data_6IAP
# 
_entry.id   6IAP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.311 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6IAP         
WWPDB D_1200013112 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6IAP 
_pdbx_database_status.recvd_initial_deposition_date   2018-11-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Roussel, A.' 1 ? 
'Amigues, B.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            177 
_citation.language                  ? 
_citation.page_first                1701 
_citation.page_last                 1713.e16 
_citation.title                     
'Multifunctional Natural Killer Cell Engagers Targeting NKp46 Trigger Protective Tumor Immunity.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2019.04.041 
_citation.pdbx_database_id_PubMed   31155232 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gauthier, L.'          1  ? 
primary 'Morel, A.'             2  ? 
primary 'Anceriz, N.'           3  ? 
primary 'Rossi, B.'             4  ? 
primary 'Blanchard-Alvarez, A.' 5  ? 
primary 'Grondin, G.'           6  ? 
primary 'Trichard, S.'          7  ? 
primary 'Cesari, C.'            8  ? 
primary 'Sapet, M.'             9  ? 
primary 'Bosco, F.'             10 ? 
primary 'Rispaud-Blanc, H.'     11 ? 
primary 'Guillot, F.'           12 ? 
primary 'Cornen, S.'            13 ? 
primary 'Roussel, A.'           14 ? 
primary 'Amigues, B.'           15 ? 
primary 'Habif, G.'             16 ? 
primary 'Caraguel, F.'          17 ? 
primary 'Arrufat, S.'           18 ? 
primary 'Remark, R.'            19 ? 
primary 'Romagne, F.'           20 ? 
primary 'Morel, Y.'             21 ? 
primary 'Narni-Mancinelli, E.'  22 ? 
primary 'Vivier, E.'            23 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.570 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6IAP 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     67.858 
_cell.length_a_esd                 ? 
_cell.length_b                     73.827 
_cell.length_b_esd                 ? 
_cell.length_c                     128.518 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6IAP 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Natural cytotoxicity triggering receptor 1' 20710.625 1   ? ? ? ? 
2 polymer man 'Fab NKp46-4 light chain'                    23056.580 1   ? ? ? ? 
3 polymer man 'Fab NKp46-4 heavy chain'                    23192.908 1   ? ? ? ? 
4 polymer man 'Fab NKp46-1 heavy chain'                    23521.297 1   ? ? ? ? 
5 polymer man 'Fab NKp46-1 light chain'                    23244.791 1   ? ? ? ? 
6 water   nat water                                        18.015    159 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Lymphocyte antigen 94 homolog,NK cell-activating receptor,Natural killer cell p46-related protein,hNKp46' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGE
LWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAH
RGTYRCFGSYNNHAWSFPSEPV
;
;TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGE
LWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAH
RGTYRCFGSYNNHAWSFPSEPV
;
A ? 
2 'polypeptide(L)' no no 
;DIQMTQSPSSLSASVGDRVTITCRASENIYSNLAWFQQKPGKAPKLLVYAATNLADGVPSRFSGSGSGTDYTLTISSLQP
EDFATYYCQHFWGTPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
;DIQMTQSPSSLSASVGDRVTITCRASENIYSNLAWFQQKPGKAPKLLVYAATNLADGVPSRFSGSGSGTDYTLTISSLQP
EDFATYYCQHFWGTPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
D ? 
3 'polypeptide(L)' no no 
;QVQLVQSGAEVKKPGASVKVSCKASGYTFTSFTMHWVRQAPGQGLEWIGYINPSSGYTEYNQKFKDRVTITADKSTSTAY
MELSSLRSEDTAVYYCVRGSSRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
;
;QVQLVQSGAEVKKPGASVKVSCKASGYTFTSFTMHWVRQAPGQGLEWIGYINPSSGYTEYNQKFKDRVTITADKSTSTAY
MELSSLRSEDTAVYYCVRGSSRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
;
E ? 
4 'polypeptide(L)' no no 
;QVQLVQSGAEVKKPGSSVKVSCKASGYTFSDYVINWVRQAPGQGLEWMGEIYPGSGTNYYNEKFKAKATITADKSTSTAY
MELSSLRSEDTAVYYCARRGRYGLYAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
;
;QVQLVQSGAEVKKPGSSVKVSCKASGYTFSDYVINWVRQAPGQGLEWMGEIYPGSGTNYYNEKFKAKATITADKSTSTAY
MELSSLRSEDTAVYYCARRGRYGLYAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
;
H ? 
5 'polypeptide(L)' no no 
;DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSRLHSGVPSRFSGSGSGTDFTFTISSLQP
EDIATYFCQQGNTRPWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
;DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSRLHSGVPSRFSGSGSGTDFTFTISSLQP
EDIATYFCQQGNTRPWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   LEU n 
1 3   PRO n 
1 4   LYS n 
1 5   PRO n 
1 6   PHE n 
1 7   ILE n 
1 8   TRP n 
1 9   ALA n 
1 10  GLU n 
1 11  PRO n 
1 12  HIS n 
1 13  PHE n 
1 14  MET n 
1 15  VAL n 
1 16  PRO n 
1 17  LYS n 
1 18  GLU n 
1 19  LYS n 
1 20  GLN n 
1 21  VAL n 
1 22  THR n 
1 23  ILE n 
1 24  CYS n 
1 25  CYS n 
1 26  GLN n 
1 27  GLY n 
1 28  ASN n 
1 29  TYR n 
1 30  GLY n 
1 31  ALA n 
1 32  VAL n 
1 33  GLU n 
1 34  TYR n 
1 35  GLN n 
1 36  LEU n 
1 37  HIS n 
1 38  PHE n 
1 39  GLU n 
1 40  GLY n 
1 41  SER n 
1 42  LEU n 
1 43  PHE n 
1 44  ALA n 
1 45  VAL n 
1 46  ASP n 
1 47  ARG n 
1 48  PRO n 
1 49  LYS n 
1 50  PRO n 
1 51  PRO n 
1 52  GLU n 
1 53  ARG n 
1 54  ILE n 
1 55  ASN n 
1 56  LYS n 
1 57  VAL n 
1 58  LYS n 
1 59  PHE n 
1 60  TYR n 
1 61  ILE n 
1 62  PRO n 
1 63  ASP n 
1 64  MET n 
1 65  ASN n 
1 66  SER n 
1 67  ARG n 
1 68  MET n 
1 69  ALA n 
1 70  GLY n 
1 71  GLN n 
1 72  TYR n 
1 73  SER n 
1 74  CYS n 
1 75  ILE n 
1 76  TYR n 
1 77  ARG n 
1 78  VAL n 
1 79  GLY n 
1 80  GLU n 
1 81  LEU n 
1 82  TRP n 
1 83  SER n 
1 84  GLU n 
1 85  PRO n 
1 86  SER n 
1 87  ASN n 
1 88  LEU n 
1 89  LEU n 
1 90  ASP n 
1 91  LEU n 
1 92  VAL n 
1 93  VAL n 
1 94  THR n 
1 95  GLU n 
1 96  MET n 
1 97  TYR n 
1 98  ASP n 
1 99  THR n 
1 100 PRO n 
1 101 THR n 
1 102 LEU n 
1 103 SER n 
1 104 VAL n 
1 105 HIS n 
1 106 PRO n 
1 107 GLY n 
1 108 PRO n 
1 109 GLU n 
1 110 VAL n 
1 111 ILE n 
1 112 SER n 
1 113 GLY n 
1 114 GLU n 
1 115 LYS n 
1 116 VAL n 
1 117 THR n 
1 118 PHE n 
1 119 TYR n 
1 120 CYS n 
1 121 ARG n 
1 122 LEU n 
1 123 ASP n 
1 124 THR n 
1 125 ALA n 
1 126 THR n 
1 127 SER n 
1 128 MET n 
1 129 PHE n 
1 130 LEU n 
1 131 LEU n 
1 132 LEU n 
1 133 LYS n 
1 134 GLU n 
1 135 GLY n 
1 136 ARG n 
1 137 SER n 
1 138 SER n 
1 139 HIS n 
1 140 VAL n 
1 141 GLN n 
1 142 ARG n 
1 143 GLY n 
1 144 TYR n 
1 145 GLY n 
1 146 LYS n 
1 147 VAL n 
1 148 GLN n 
1 149 ALA n 
1 150 GLU n 
1 151 PHE n 
1 152 PRO n 
1 153 LEU n 
1 154 GLY n 
1 155 PRO n 
1 156 VAL n 
1 157 THR n 
1 158 THR n 
1 159 ALA n 
1 160 HIS n 
1 161 ARG n 
1 162 GLY n 
1 163 THR n 
1 164 TYR n 
1 165 ARG n 
1 166 CYS n 
1 167 PHE n 
1 168 GLY n 
1 169 SER n 
1 170 TYR n 
1 171 ASN n 
1 172 ASN n 
1 173 HIS n 
1 174 ALA n 
1 175 TRP n 
1 176 SER n 
1 177 PHE n 
1 178 PRO n 
1 179 SER n 
1 180 GLU n 
1 181 PRO n 
1 182 VAL n 
2 1   ASP n 
2 2   ILE n 
2 3   GLN n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   SER n 
2 10  SER n 
2 11  LEU n 
2 12  SER n 
2 13  ALA n 
2 14  SER n 
2 15  VAL n 
2 16  GLY n 
2 17  ASP n 
2 18  ARG n 
2 19  VAL n 
2 20  THR n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  ARG n 
2 25  ALA n 
2 26  SER n 
2 27  GLU n 
2 28  ASN n 
2 29  ILE n 
2 30  TYR n 
2 31  SER n 
2 32  ASN n 
2 33  LEU n 
2 34  ALA n 
2 35  TRP n 
2 36  PHE n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  GLY n 
2 42  LYS n 
2 43  ALA n 
2 44  PRO n 
2 45  LYS n 
2 46  LEU n 
2 47  LEU n 
2 48  VAL n 
2 49  TYR n 
2 50  ALA n 
2 51  ALA n 
2 52  THR n 
2 53  ASN n 
2 54  LEU n 
2 55  ALA n 
2 56  ASP n 
2 57  GLY n 
2 58  VAL n 
2 59  PRO n 
2 60  SER n 
2 61  ARG n 
2 62  PHE n 
2 63  SER n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  ASP n 
2 71  TYR n 
2 72  THR n 
2 73  LEU n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  SER n 
2 78  LEU n 
2 79  GLN n 
2 80  PRO n 
2 81  GLU n 
2 82  ASP n 
2 83  PHE n 
2 84  ALA n 
2 85  THR n 
2 86  TYR n 
2 87  TYR n 
2 88  CYS n 
2 89  GLN n 
2 90  HIS n 
2 91  PHE n 
2 92  TRP n 
2 93  GLY n 
2 94  THR n 
2 95  PRO n 
2 96  ARG n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLY n 
2 101 GLY n 
2 102 THR n 
2 103 LYS n 
2 104 VAL n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 THR n 
2 110 VAL n 
2 111 ALA n 
2 112 ALA n 
2 113 PRO n 
2 114 SER n 
2 115 VAL n 
2 116 PHE n 
2 117 ILE n 
2 118 PHE n 
2 119 PRO n 
2 120 PRO n 
2 121 SER n 
2 122 ASP n 
2 123 GLU n 
2 124 GLN n 
2 125 LEU n 
2 126 LYS n 
2 127 SER n 
2 128 GLY n 
2 129 THR n 
2 130 ALA n 
2 131 SER n 
2 132 VAL n 
2 133 VAL n 
2 134 CYS n 
2 135 LEU n 
2 136 LEU n 
2 137 ASN n 
2 138 ASN n 
2 139 PHE n 
2 140 TYR n 
2 141 PRO n 
2 142 ARG n 
2 143 GLU n 
2 144 ALA n 
2 145 LYS n 
2 146 VAL n 
2 147 GLN n 
2 148 TRP n 
2 149 LYS n 
2 150 VAL n 
2 151 ASP n 
2 152 ASN n 
2 153 ALA n 
2 154 LEU n 
2 155 GLN n 
2 156 SER n 
2 157 GLY n 
2 158 ASN n 
2 159 SER n 
2 160 GLN n 
2 161 GLU n 
2 162 SER n 
2 163 VAL n 
2 164 THR n 
2 165 GLU n 
2 166 GLN n 
2 167 ASP n 
2 168 SER n 
2 169 LYS n 
2 170 ASP n 
2 171 SER n 
2 172 THR n 
2 173 TYR n 
2 174 SER n 
2 175 LEU n 
2 176 SER n 
2 177 SER n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LEU n 
2 182 SER n 
2 183 LYS n 
2 184 ALA n 
2 185 ASP n 
2 186 TYR n 
2 187 GLU n 
2 188 LYS n 
2 189 HIS n 
2 190 LYS n 
2 191 VAL n 
2 192 TYR n 
2 193 ALA n 
2 194 CYS n 
2 195 GLU n 
2 196 VAL n 
2 197 THR n 
2 198 HIS n 
2 199 GLN n 
2 200 GLY n 
2 201 LEU n 
2 202 SER n 
2 203 SER n 
2 204 PRO n 
2 205 VAL n 
2 206 THR n 
2 207 LYS n 
2 208 SER n 
2 209 PHE n 
2 210 ASN n 
2 211 ARG n 
3 1   GLN n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   VAL n 
3 6   GLN n 
3 7   SER n 
3 8   GLY n 
3 9   ALA n 
3 10  GLU n 
3 11  VAL n 
3 12  LYS n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  ALA n 
3 17  SER n 
3 18  VAL n 
3 19  LYS n 
3 20  VAL n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  TYR n 
3 28  THR n 
3 29  PHE n 
3 30  THR n 
3 31  SER n 
3 32  PHE n 
3 33  THR n 
3 34  MET n 
3 35  HIS n 
3 36  TRP n 
3 37  VAL n 
3 38  ARG n 
3 39  GLN n 
3 40  ALA n 
3 41  PRO n 
3 42  GLY n 
3 43  GLN n 
3 44  GLY n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  ILE n 
3 49  GLY n 
3 50  TYR n 
3 51  ILE n 
3 52  ASN n 
3 53  PRO n 
3 54  SER n 
3 55  SER n 
3 56  GLY n 
3 57  TYR n 
3 58  THR n 
3 59  GLU n 
3 60  TYR n 
3 61  ASN n 
3 62  GLN n 
3 63  LYS n 
3 64  PHE n 
3 65  LYS n 
3 66  ASP n 
3 67  ARG n 
3 68  VAL n 
3 69  THR n 
3 70  ILE n 
3 71  THR n 
3 72  ALA n 
3 73  ASP n 
3 74  LYS n 
3 75  SER n 
3 76  THR n 
3 77  SER n 
3 78  THR n 
3 79  ALA n 
3 80  TYR n 
3 81  MET n 
3 82  GLU n 
3 83  LEU n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  ARG n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  THR n 
3 92  ALA n 
3 93  VAL n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  VAL n 
3 98  ARG n 
3 99  GLY n 
3 100 SER n 
3 101 SER n 
3 102 ARG n 
3 103 GLY n 
3 104 PHE n 
3 105 ASP n 
3 106 TYR n 
3 107 TRP n 
3 108 GLY n 
3 109 GLN n 
3 110 GLY n 
3 111 THR n 
3 112 LEU n 
3 113 VAL n 
3 114 THR n 
3 115 VAL n 
3 116 SER n 
3 117 SER n 
3 118 ALA n 
3 119 SER n 
3 120 THR n 
3 121 LYS n 
3 122 GLY n 
3 123 PRO n 
3 124 SER n 
3 125 VAL n 
3 126 PHE n 
3 127 PRO n 
3 128 LEU n 
3 129 ALA n 
3 130 PRO n 
3 131 SER n 
3 132 SER n 
3 133 LYS n 
3 134 SER n 
3 135 THR n 
3 136 SER n 
3 137 GLY n 
3 138 GLY n 
3 139 THR n 
3 140 ALA n 
3 141 ALA n 
3 142 LEU n 
3 143 GLY n 
3 144 CYS n 
3 145 LEU n 
3 146 VAL n 
3 147 LYS n 
3 148 ASP n 
3 149 TYR n 
3 150 PHE n 
3 151 PRO n 
3 152 GLU n 
3 153 PRO n 
3 154 VAL n 
3 155 THR n 
3 156 VAL n 
3 157 SER n 
3 158 TRP n 
3 159 ASN n 
3 160 SER n 
3 161 GLY n 
3 162 ALA n 
3 163 LEU n 
3 164 THR n 
3 165 SER n 
3 166 GLY n 
3 167 VAL n 
3 168 HIS n 
3 169 THR n 
3 170 PHE n 
3 171 PRO n 
3 172 ALA n 
3 173 VAL n 
3 174 LEU n 
3 175 GLN n 
3 176 SER n 
3 177 SER n 
3 178 GLY n 
3 179 LEU n 
3 180 TYR n 
3 181 SER n 
3 182 LEU n 
3 183 SER n 
3 184 SER n 
3 185 VAL n 
3 186 VAL n 
3 187 THR n 
3 188 VAL n 
3 189 PRO n 
3 190 SER n 
3 191 SER n 
3 192 SER n 
3 193 LEU n 
3 194 GLY n 
3 195 THR n 
3 196 GLN n 
3 197 THR n 
3 198 TYR n 
3 199 ILE n 
3 200 CYS n 
3 201 ASN n 
3 202 VAL n 
3 203 ASN n 
3 204 HIS n 
3 205 LYS n 
3 206 PRO n 
3 207 SER n 
3 208 ASN n 
3 209 THR n 
3 210 LYS n 
3 211 VAL n 
3 212 ASP n 
3 213 LYS n 
3 214 ARG n 
3 215 VAL n 
3 216 GLU n 
3 217 PRO n 
4 1   GLN n 
4 2   VAL n 
4 3   GLN n 
4 4   LEU n 
4 5   VAL n 
4 6   GLN n 
4 7   SER n 
4 8   GLY n 
4 9   ALA n 
4 10  GLU n 
4 11  VAL n 
4 12  LYS n 
4 13  LYS n 
4 14  PRO n 
4 15  GLY n 
4 16  SER n 
4 17  SER n 
4 18  VAL n 
4 19  LYS n 
4 20  VAL n 
4 21  SER n 
4 22  CYS n 
4 23  LYS n 
4 24  ALA n 
4 25  SER n 
4 26  GLY n 
4 27  TYR n 
4 28  THR n 
4 29  PHE n 
4 30  SER n 
4 31  ASP n 
4 32  TYR n 
4 33  VAL n 
4 34  ILE n 
4 35  ASN n 
4 36  TRP n 
4 37  VAL n 
4 38  ARG n 
4 39  GLN n 
4 40  ALA n 
4 41  PRO n 
4 42  GLY n 
4 43  GLN n 
4 44  GLY n 
4 45  LEU n 
4 46  GLU n 
4 47  TRP n 
4 48  MET n 
4 49  GLY n 
4 50  GLU n 
4 51  ILE n 
4 52  TYR n 
4 53  PRO n 
4 54  GLY n 
4 55  SER n 
4 56  GLY n 
4 57  THR n 
4 58  ASN n 
4 59  TYR n 
4 60  TYR n 
4 61  ASN n 
4 62  GLU n 
4 63  LYS n 
4 64  PHE n 
4 65  LYS n 
4 66  ALA n 
4 67  LYS n 
4 68  ALA n 
4 69  THR n 
4 70  ILE n 
4 71  THR n 
4 72  ALA n 
4 73  ASP n 
4 74  LYS n 
4 75  SER n 
4 76  THR n 
4 77  SER n 
4 78  THR n 
4 79  ALA n 
4 80  TYR n 
4 81  MET n 
4 82  GLU n 
4 83  LEU n 
4 84  SER n 
4 85  SER n 
4 86  LEU n 
4 87  ARG n 
4 88  SER n 
4 89  GLU n 
4 90  ASP n 
4 91  THR n 
4 92  ALA n 
4 93  VAL n 
4 94  TYR n 
4 95  TYR n 
4 96  CYS n 
4 97  ALA n 
4 98  ARG n 
4 99  ARG n 
4 100 GLY n 
4 101 ARG n 
4 102 TYR n 
4 103 GLY n 
4 104 LEU n 
4 105 TYR n 
4 106 ALA n 
4 107 MET n 
4 108 ASP n 
4 109 TYR n 
4 110 TRP n 
4 111 GLY n 
4 112 GLN n 
4 113 GLY n 
4 114 THR n 
4 115 THR n 
4 116 VAL n 
4 117 THR n 
4 118 VAL n 
4 119 SER n 
4 120 SER n 
4 121 ALA n 
4 122 SER n 
4 123 THR n 
4 124 LYS n 
4 125 GLY n 
4 126 PRO n 
4 127 SER n 
4 128 VAL n 
4 129 PHE n 
4 130 PRO n 
4 131 LEU n 
4 132 ALA n 
4 133 PRO n 
4 134 SER n 
4 135 SER n 
4 136 LYS n 
4 137 SER n 
4 138 THR n 
4 139 SER n 
4 140 GLY n 
4 141 GLY n 
4 142 THR n 
4 143 ALA n 
4 144 ALA n 
4 145 LEU n 
4 146 GLY n 
4 147 CYS n 
4 148 LEU n 
4 149 VAL n 
4 150 LYS n 
4 151 ASP n 
4 152 TYR n 
4 153 PHE n 
4 154 PRO n 
4 155 GLU n 
4 156 PRO n 
4 157 VAL n 
4 158 THR n 
4 159 VAL n 
4 160 SER n 
4 161 TRP n 
4 162 ASN n 
4 163 SER n 
4 164 GLY n 
4 165 ALA n 
4 166 LEU n 
4 167 THR n 
4 168 SER n 
4 169 GLY n 
4 170 VAL n 
4 171 HIS n 
4 172 THR n 
4 173 PHE n 
4 174 PRO n 
4 175 ALA n 
4 176 VAL n 
4 177 LEU n 
4 178 GLN n 
4 179 SER n 
4 180 SER n 
4 181 GLY n 
4 182 LEU n 
4 183 TYR n 
4 184 SER n 
4 185 LEU n 
4 186 SER n 
4 187 SER n 
4 188 VAL n 
4 189 VAL n 
4 190 THR n 
4 191 VAL n 
4 192 PRO n 
4 193 SER n 
4 194 SER n 
4 195 SER n 
4 196 LEU n 
4 197 GLY n 
4 198 THR n 
4 199 GLN n 
4 200 THR n 
4 201 TYR n 
4 202 ILE n 
4 203 CYS n 
4 204 ASN n 
4 205 VAL n 
4 206 ASN n 
4 207 HIS n 
4 208 LYS n 
4 209 PRO n 
4 210 SER n 
4 211 ASN n 
4 212 THR n 
4 213 LYS n 
4 214 VAL n 
4 215 ASP n 
4 216 LYS n 
4 217 ARG n 
4 218 VAL n 
4 219 GLU n 
4 220 PRO n 
5 1   ASP n 
5 2   ILE n 
5 3   GLN n 
5 4   MET n 
5 5   THR n 
5 6   GLN n 
5 7   SER n 
5 8   PRO n 
5 9   SER n 
5 10  SER n 
5 11  LEU n 
5 12  SER n 
5 13  ALA n 
5 14  SER n 
5 15  VAL n 
5 16  GLY n 
5 17  ASP n 
5 18  ARG n 
5 19  VAL n 
5 20  THR n 
5 21  ILE n 
5 22  THR n 
5 23  CYS n 
5 24  ARG n 
5 25  ALA n 
5 26  SER n 
5 27  GLN n 
5 28  ASP n 
5 29  ILE n 
5 30  SER n 
5 31  ASN n 
5 32  TYR n 
5 33  LEU n 
5 34  ASN n 
5 35  TRP n 
5 36  TYR n 
5 37  GLN n 
5 38  GLN n 
5 39  LYS n 
5 40  PRO n 
5 41  GLY n 
5 42  LYS n 
5 43  ALA n 
5 44  PRO n 
5 45  LYS n 
5 46  LEU n 
5 47  LEU n 
5 48  ILE n 
5 49  TYR n 
5 50  TYR n 
5 51  THR n 
5 52  SER n 
5 53  ARG n 
5 54  LEU n 
5 55  HIS n 
5 56  SER n 
5 57  GLY n 
5 58  VAL n 
5 59  PRO n 
5 60  SER n 
5 61  ARG n 
5 62  PHE n 
5 63  SER n 
5 64  GLY n 
5 65  SER n 
5 66  GLY n 
5 67  SER n 
5 68  GLY n 
5 69  THR n 
5 70  ASP n 
5 71  PHE n 
5 72  THR n 
5 73  PHE n 
5 74  THR n 
5 75  ILE n 
5 76  SER n 
5 77  SER n 
5 78  LEU n 
5 79  GLN n 
5 80  PRO n 
5 81  GLU n 
5 82  ASP n 
5 83  ILE n 
5 84  ALA n 
5 85  THR n 
5 86  TYR n 
5 87  PHE n 
5 88  CYS n 
5 89  GLN n 
5 90  GLN n 
5 91  GLY n 
5 92  ASN n 
5 93  THR n 
5 94  ARG n 
5 95  PRO n 
5 96  TRP n 
5 97  THR n 
5 98  PHE n 
5 99  GLY n 
5 100 GLY n 
5 101 GLY n 
5 102 THR n 
5 103 LYS n 
5 104 VAL n 
5 105 GLU n 
5 106 ILE n 
5 107 LYS n 
5 108 ARG n 
5 109 THR n 
5 110 VAL n 
5 111 ALA n 
5 112 ALA n 
5 113 PRO n 
5 114 SER n 
5 115 VAL n 
5 116 PHE n 
5 117 ILE n 
5 118 PHE n 
5 119 PRO n 
5 120 PRO n 
5 121 SER n 
5 122 ASP n 
5 123 GLU n 
5 124 GLN n 
5 125 LEU n 
5 126 LYS n 
5 127 SER n 
5 128 GLY n 
5 129 THR n 
5 130 ALA n 
5 131 SER n 
5 132 VAL n 
5 133 VAL n 
5 134 CYS n 
5 135 LEU n 
5 136 LEU n 
5 137 ASN n 
5 138 ASN n 
5 139 PHE n 
5 140 TYR n 
5 141 PRO n 
5 142 ARG n 
5 143 GLU n 
5 144 ALA n 
5 145 LYS n 
5 146 VAL n 
5 147 GLN n 
5 148 TRP n 
5 149 LYS n 
5 150 VAL n 
5 151 ASP n 
5 152 ASN n 
5 153 ALA n 
5 154 LEU n 
5 155 GLN n 
5 156 SER n 
5 157 GLY n 
5 158 ASN n 
5 159 SER n 
5 160 GLN n 
5 161 GLU n 
5 162 SER n 
5 163 VAL n 
5 164 THR n 
5 165 GLU n 
5 166 GLN n 
5 167 ASP n 
5 168 SER n 
5 169 LYS n 
5 170 ASP n 
5 171 SER n 
5 172 THR n 
5 173 TYR n 
5 174 SER n 
5 175 LEU n 
5 176 SER n 
5 177 SER n 
5 178 THR n 
5 179 LEU n 
5 180 THR n 
5 181 LEU n 
5 182 SER n 
5 183 LYS n 
5 184 ALA n 
5 185 ASP n 
5 186 TYR n 
5 187 GLU n 
5 188 LYS n 
5 189 HIS n 
5 190 LYS n 
5 191 VAL n 
5 192 TYR n 
5 193 ALA n 
5 194 CYS n 
5 195 GLU n 
5 196 VAL n 
5 197 THR n 
5 198 HIS n 
5 199 GLN n 
5 200 GLY n 
5 201 LEU n 
5 202 SER n 
5 203 SER n 
5 204 PRO n 
5 205 VAL n 
5 206 THR n 
5 207 LYS n 
5 208 SER n 
5 209 PHE n 
5 210 ASN n 
5 211 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 182 Human ? 'NCR1, LY94' ? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? 'fall armyworm' 
'Spodoptera frugiperda' 7108  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 211 ?     ? ?            ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? 
'Chinese hamster' 'Cricetulus griseus'    10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 217 ?     ? ?            ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? 
'Chinese hamster' 'Cricetulus griseus'    10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 220 ?     ? ?            ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? 
'Chinese hamster' 'Cricetulus griseus'    10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 211 ?     ? ?            ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? 
'Chinese hamster' 'Cricetulus griseus'    10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NCTR1_HUMAN O76036 ? 1 
;TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGE
LWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAH
RGTYRCFGSYNNHAWSFPSEPV
;
25 
2 PDB 6IAP        6IAP   ? 2 ? 1  
3 PDB 6IAP        6IAP   ? 3 ? 1  
4 PDB 6IAP        6IAP   ? 4 ? 1  
5 PDB 6IAP        6IAP   ? 5 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6IAP A 1 ? 182 ? O76036 25 ? 206 ? 1 182 
2 2 6IAP D 1 ? 211 ? 6IAP   1  ? 211 ? 1 211 
3 3 6IAP E 1 ? 217 ? 6IAP   1  ? 217 ? 1 217 
4 4 6IAP H 1 ? 220 ? 6IAP   1  ? 220 ? 1 220 
5 5 6IAP L 1 ? 211 ? 6IAP   1  ? 211 ? 1 211 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6IAP 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.83 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.55 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M acid carboxylique, 0.1M Tris/bicine pH8.5, 50%P500MME/P20k' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-07 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97857 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97857 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            81.390 
_reflns.entry_id                         6IAP 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.89 
_reflns.d_resolution_low                 48.47 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       28415 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.89 
_reflns_shell.d_res_low                   3.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           28397 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -9.6439 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -22.2483 
_refine.aniso_B[2][2]                            14.3440 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -4.7001 
_refine.B_iso_max                                212.290 
_refine.B_iso_mean                               91.8000 
_refine.B_iso_min                                44.450 
_refine.correlation_coeff_Fo_to_Fc               0.9190 
_refine.correlation_coeff_Fo_to_Fc_free          0.8880 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6IAP 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9000 
_refine.ls_d_res_low                             48.4700 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28397 
_refine.ls_number_reflns_R_free                  1399 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.3000 
_refine.ls_percent_reflns_R_free                 4.9300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1910 
_refine.ls_R_factor_R_free                       0.2630 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1870 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1OLL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.3990 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6IAP 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.380 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.9000 
_refine_hist.d_res_low                        48.4700 
_refine_hist.number_atoms_solvent             159 
_refine_hist.number_atoms_total               8138 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       1041 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          74.92 
_refine_hist.pdbx_number_atoms_protein        7979 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? ?      ? 2695  ? t_dihedral_angle_d        2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_trig_c_planes           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 1363  ? t_gen_planes              5.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 8190  ? t_it                      20.000 HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_nbd                     ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_improper_torsion        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_pseud_angle             ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 1080  ? t_chiral_improper_torsion 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_sum_occupancies         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_distance        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_angle           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_torsion         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 8998  ? t_ideal_dist_contact      4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 0.010  ? 8190  ? t_bond_d                  2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 1.240  ? 11150 ? t_angle_deg               2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 2.990  ? ?     ? t_omega_torsion           ?      ?            
'X-RAY DIFFRACTION' ? 21.070 ? ?     ? t_other_torsion           ?      ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.9000 
_refine_ls_shell.d_res_low                        2.9200 
_refine_ls_shell.number_reflns_all                568 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.number_reflns_R_work             537 
_refine_ls_shell.percent_reflns_obs               86.4700 
_refine_ls_shell.percent_reflns_R_free            5.4600 
_refine_ls_shell.R_factor_all                     0.2510 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3792 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2443 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6IAP 
_struct.title                        'structure of human NKp46 in complex with antibody NKp46-1 and NKp46-4' 
_struct.pdbx_descriptor              
;Natural cytotoxicity triggering receptor 1, Fab NKp46-4 light chain, Fab NKp46-4 heavy chain, Fab NKp46-1 heavy chain, Fab NKp46-1 light chain
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6IAP 
_struct_keywords.text            'THERAPEUTIC ANTIBODY, Immune system' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 65  ? ALA A 69  ? ASN A 65  ALA A 69  5 ? 5 
HELX_P HELX_P2  AA2 GLN B 79  ? PHE B 83  ? GLN D 79  PHE D 83  5 ? 5 
HELX_P HELX_P3  AA3 SER B 121 ? LYS B 126 ? SER D 121 LYS D 126 1 ? 6 
HELX_P HELX_P4  AA4 LYS B 183 ? HIS B 189 ? LYS D 183 HIS D 189 1 ? 7 
HELX_P HELX_P5  AA5 THR C 28  ? PHE C 32  ? THR E 28  PHE E 32  5 ? 5 
HELX_P HELX_P6  AA6 ARG C 87  ? THR C 91  ? ARG E 87  THR E 91  5 ? 5 
HELX_P HELX_P7  AA7 SER C 160 ? ALA C 162 ? SER E 160 ALA E 162 5 ? 3 
HELX_P HELX_P8  AA8 THR D 28  ? TYR D 32  ? THR H 28  TYR H 32  5 ? 5 
HELX_P HELX_P9  AA9 ASN D 61  ? ALA D 66  ? ASN H 61  ALA H 66  1 ? 6 
HELX_P HELX_P10 AB1 ARG D 87  ? THR D 91  ? ARG H 87  THR H 91  5 ? 5 
HELX_P HELX_P11 AB2 LYS D 208 ? ASN D 211 ? LYS H 208 ASN H 211 5 ? 4 
HELX_P HELX_P12 AB3 GLN E 79  ? ILE E 83  ? GLN L 79  ILE L 83  5 ? 5 
HELX_P HELX_P13 AB4 SER E 121 ? GLY E 128 ? SER L 121 GLY L 128 1 ? 8 
HELX_P HELX_P14 AB5 LYS E 183 ? LYS E 188 ? LYS L 183 LYS L 188 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 74  SG ? ? A CYS 25  A CYS 74  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf2  disulf ? ? A CYS 120 SG ? ? ? 1_555 A CYS 166 SG ? ? A CYS 120 A CYS 166 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf3  disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 88  SG ? ? D CYS 23  D CYS 88  1_555 ? ? ? ? ? ? ? 2.075 ? 
disulf4  disulf ? ? B CYS 134 SG ? ? ? 1_555 B CYS 194 SG ? ? D CYS 134 D CYS 194 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf5  disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG ? ? E CYS 22  E CYS 96  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf6  disulf ? ? C CYS 144 SG ? ? ? 1_555 C CYS 200 SG ? ? E CYS 144 E CYS 200 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf7  disulf ? ? D CYS 22  SG ? ? ? 1_555 D CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf8  disulf ? ? D CYS 147 SG ? ? ? 1_555 D CYS 203 SG ? ? H CYS 147 H CYS 203 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf9  disulf ? ? E CYS 23  SG ? ? ? 1_555 E CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf10 disulf ? ? E CYS 134 SG ? ? ? 1_555 E CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.037 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 10  A . ? GLU 10  A PRO 11  A ? PRO 11  A 1 8.20  
2  HIS 105 A . ? HIS 105 A PRO 106 A ? PRO 106 A 1 4.01  
3  SER 7   B . ? SER 7   D PRO 8   B ? PRO 8   D 1 -1.84 
4  THR 94  B . ? THR 94  D PRO 95  B ? PRO 95  D 1 -0.82 
5  TYR 140 B . ? TYR 140 D PRO 141 B ? PRO 141 D 1 -3.44 
6  PHE 150 C . ? PHE 150 E PRO 151 C ? PRO 151 E 1 -4.88 
7  GLU 152 C . ? GLU 152 E PRO 153 C ? PRO 153 E 1 11.07 
8  PHE 153 D . ? PHE 153 H PRO 154 D ? PRO 154 H 1 -0.90 
9  GLU 155 D . ? GLU 155 H PRO 156 D ? PRO 156 H 1 7.13  
10 SER 7   E . ? SER 7   L PRO 8   E ? PRO 8   L 1 -0.84 
11 ARG 94  E . ? ARG 94  L PRO 95  E ? PRO 95  L 1 3.85  
12 TYR 140 E . ? TYR 140 L PRO 141 E ? PRO 141 L 1 -2.83 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 6 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 6 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 3 ? 
AB8 ? 4 ? 
AB9 ? 6 ? 
AC1 ? 4 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 5 ? 
AC6 ? 5 ? 
AC7 ? 4 ? 
AC8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? parallel      
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 6   ? GLU A 10  ? PHE A 6   GLU A 10  
AA1 2 VAL A 21  ? GLN A 26  ? VAL A 21  GLN A 26  
AA1 3 LYS A 56  ? ILE A 61  ? LYS A 56  ILE A 61  
AA2 1 MET A 14  ? PRO A 16  ? MET A 14  PRO A 16  
AA2 2 LEU A 89  ? THR A 94  ? LEU A 89  THR A 94  
AA2 3 GLY A 70  ? VAL A 78  ? GLY A 70  VAL A 78  
AA2 4 GLU A 33  ? PHE A 38  ? GLU A 33  PHE A 38  
AA2 5 LEU A 42  ? ASP A 46  ? LEU A 42  ASP A 46  
AA3 1 MET A 14  ? PRO A 16  ? MET A 14  PRO A 16  
AA3 2 LEU A 89  ? THR A 94  ? LEU A 89  THR A 94  
AA3 3 GLY A 70  ? VAL A 78  ? GLY A 70  VAL A 78  
AA3 4 LEU A 81  ? TRP A 82  ? LEU A 81  TRP A 82  
AA4 1 THR A 101 ? HIS A 105 ? THR A 101 HIS A 105 
AA4 2 LYS A 115 ? ARG A 121 ? LYS A 115 ARG A 121 
AA4 3 GLN A 148 ? PRO A 155 ? GLN A 148 PRO A 155 
AA5 1 VAL A 140 ? TYR A 144 ? VAL A 140 TYR A 144 
AA5 2 MET A 128 ? LYS A 133 ? MET A 128 LYS A 133 
AA5 3 TYR A 164 ? ASN A 171 ? TYR A 164 ASN A 171 
AA5 4 ALA A 174 ? TRP A 175 ? ALA A 174 TRP A 175 
AA6 1 MET B 4   ? SER B 7   ? MET D 4   SER D 7   
AA6 2 VAL B 19  ? ALA B 25  ? VAL D 19  ALA D 25  
AA6 3 ASP B 70  ? ILE B 75  ? ASP D 70  ILE D 75  
AA6 4 PHE B 62  ? GLY B 66  ? PHE D 62  GLY D 66  
AA7 1 SER B 10  ? ALA B 13  ? SER D 10  ALA D 13  
AA7 2 THR B 102 ? ILE B 106 ? THR D 102 ILE D 106 
AA7 3 THR B 85  ? HIS B 90  ? THR D 85  HIS D 90  
AA7 4 LEU B 33  ? GLN B 38  ? LEU D 33  GLN D 38  
AA7 5 LYS B 45  ? TYR B 49  ? LYS D 45  TYR D 49  
AA7 6 ASN B 53  ? LEU B 54  ? ASN D 53  LEU D 54  
AA8 1 SER B 10  ? ALA B 13  ? SER D 10  ALA D 13  
AA8 2 THR B 102 ? ILE B 106 ? THR D 102 ILE D 106 
AA8 3 THR B 85  ? HIS B 90  ? THR D 85  HIS D 90  
AA8 4 THR B 97  ? PHE B 98  ? THR D 97  PHE D 98  
AA9 1 SER B 114 ? PHE B 118 ? SER D 114 PHE D 118 
AA9 2 THR B 129 ? PHE B 139 ? THR D 129 PHE D 139 
AA9 3 TYR B 173 ? SER B 182 ? TYR D 173 SER D 182 
AA9 4 SER B 159 ? VAL B 163 ? SER D 159 VAL D 163 
AB1 1 ALA B 153 ? LEU B 154 ? ALA D 153 LEU D 154 
AB1 2 LYS B 145 ? VAL B 150 ? LYS D 145 VAL D 150 
AB1 3 VAL B 191 ? THR B 197 ? VAL D 191 THR D 197 
AB1 4 VAL B 205 ? ASN B 210 ? VAL D 205 ASN D 210 
AB2 1 GLN C 3   ? GLN C 6   ? GLN E 3   GLN E 6   
AB2 2 VAL C 18  ? SER C 25  ? VAL E 18  SER E 25  
AB2 3 THR C 78  ? LEU C 83  ? THR E 78  LEU E 83  
AB2 4 VAL C 68  ? ASP C 73  ? VAL E 68  ASP E 73  
AB3 1 GLU C 10  ? LYS C 12  ? GLU E 10  LYS E 12  
AB3 2 THR C 111 ? VAL C 115 ? THR E 111 VAL E 115 
AB3 3 ALA C 92  ? SER C 100 ? ALA E 92  SER E 100 
AB3 4 THR C 33  ? GLN C 39  ? THR E 33  GLN E 39  
AB3 5 LEU C 45  ? ILE C 51  ? LEU E 45  ILE E 51  
AB3 6 THR C 58  ? TYR C 60  ? THR E 58  TYR E 60  
AB4 1 GLU C 10  ? LYS C 12  ? GLU E 10  LYS E 12  
AB4 2 THR C 111 ? VAL C 115 ? THR E 111 VAL E 115 
AB4 3 ALA C 92  ? SER C 100 ? ALA E 92  SER E 100 
AB4 4 GLY C 103 ? TRP C 107 ? GLY E 103 TRP E 107 
AB5 1 SER C 124 ? LEU C 128 ? SER E 124 LEU E 128 
AB5 2 THR C 139 ? TYR C 149 ? THR E 139 TYR E 149 
AB5 3 TYR C 180 ? PRO C 189 ? TYR E 180 PRO E 189 
AB5 4 HIS C 168 ? THR C 169 ? HIS E 168 THR E 169 
AB6 1 THR C 135 ? SER C 136 ? THR E 135 SER E 136 
AB6 2 THR C 139 ? TYR C 149 ? THR E 139 TYR E 149 
AB6 3 TYR C 180 ? PRO C 189 ? TYR E 180 PRO E 189 
AB6 4 VAL C 173 ? LEU C 174 ? VAL E 173 LEU E 174 
AB7 1 VAL C 154 ? TRP C 158 ? VAL E 154 TRP E 158 
AB7 2 TYR C 198 ? HIS C 204 ? TYR E 198 HIS E 204 
AB7 3 THR C 209 ? VAL C 215 ? THR E 209 VAL E 215 
AB8 1 GLN D 3   ? GLN D 6   ? GLN H 3   GLN H 6   
AB8 2 VAL D 18  ? SER D 25  ? VAL H 18  SER H 25  
AB8 3 THR D 78  ? LEU D 83  ? THR H 78  LEU H 83  
AB8 4 ALA D 68  ? ALA D 72  ? ALA H 68  ALA H 72  
AB9 1 VAL D 11  ? LYS D 12  ? VAL H 11  LYS H 12  
AB9 2 THR D 114 ? VAL D 118 ? THR H 114 VAL H 118 
AB9 3 ALA D 92  ? ARG D 98  ? ALA H 92  ARG H 98  
AB9 4 ILE D 34  ? ALA D 40  ? ILE H 34  ALA H 40  
AB9 5 GLY D 44  ? TYR D 52  ? GLY H 44  TYR H 52  
AB9 6 THR D 57  ? TYR D 60  ? THR H 57  TYR H 60  
AC1 1 SER D 127 ? LEU D 131 ? SER H 127 LEU H 131 
AC1 2 ALA D 143 ? TYR D 152 ? ALA H 143 TYR H 152 
AC1 3 TYR D 183 ? VAL D 191 ? TYR H 183 VAL H 191 
AC1 4 VAL D 170 ? THR D 172 ? VAL H 170 THR H 172 
AC2 1 THR D 158 ? TRP D 161 ? THR H 158 TRP H 161 
AC2 2 ILE D 202 ? HIS D 207 ? ILE H 202 HIS H 207 
AC2 3 THR D 212 ? ARG D 217 ? THR H 212 ARG H 217 
AC3 1 MET E 4   ? SER E 7   ? MET L 4   SER L 7   
AC3 2 VAL E 19  ? ALA E 25  ? VAL L 19  ALA L 25  
AC3 3 ASP E 70  ? ILE E 75  ? ASP L 70  ILE L 75  
AC3 4 PHE E 62  ? SER E 67  ? PHE L 62  SER L 67  
AC4 1 SER E 12  ? ALA E 13  ? SER L 12  ALA L 13  
AC4 2 GLU E 105 ? ILE E 106 ? GLU L 105 ILE L 106 
AC5 1 ARG E 53  ? LEU E 54  ? ARG L 53  LEU L 54  
AC5 2 LYS E 45  ? TYR E 49  ? LYS L 45  TYR L 49  
AC5 3 LEU E 33  ? GLN E 38  ? LEU L 33  GLN L 38  
AC5 4 THR E 85  ? GLN E 90  ? THR L 85  GLN L 90  
AC5 5 THR E 97  ? PHE E 98  ? THR L 97  PHE L 98  
AC6 1 ARG E 53  ? LEU E 54  ? ARG L 53  LEU L 54  
AC6 2 LYS E 45  ? TYR E 49  ? LYS L 45  TYR L 49  
AC6 3 LEU E 33  ? GLN E 38  ? LEU L 33  GLN L 38  
AC6 4 THR E 85  ? GLN E 90  ? THR L 85  GLN L 90  
AC6 5 THR E 102 ? LYS E 103 ? THR L 102 LYS L 103 
AC7 1 SER E 114 ? PHE E 118 ? SER L 114 PHE L 118 
AC7 2 THR E 129 ? PHE E 139 ? THR L 129 PHE L 139 
AC7 3 TYR E 173 ? SER E 182 ? TYR L 173 SER L 182 
AC7 4 SER E 159 ? VAL E 163 ? SER L 159 VAL L 163 
AC8 1 ALA E 153 ? LEU E 154 ? ALA L 153 LEU L 154 
AC8 2 LYS E 145 ? VAL E 150 ? LYS L 145 VAL L 150 
AC8 3 VAL E 191 ? THR E 197 ? VAL L 191 THR L 197 
AC8 4 VAL E 205 ? ASN E 210 ? VAL L 205 ASN L 210 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 10  ? N GLU A 10  O THR A 22  ? O THR A 22  
AA1 2 3 N ILE A 23  ? N ILE A 23  O PHE A 59  ? O PHE A 59  
AA2 1 2 N VAL A 15  ? N VAL A 15  O VAL A 92  ? O VAL A 92  
AA2 2 3 O LEU A 91  ? O LEU A 91  N GLY A 70  ? N GLY A 70  
AA2 3 4 O ILE A 75  ? O ILE A 75  N GLN A 35  ? N GLN A 35  
AA2 4 5 N LEU A 36  ? N LEU A 36  O ALA A 44  ? O ALA A 44  
AA3 1 2 N VAL A 15  ? N VAL A 15  O VAL A 92  ? O VAL A 92  
AA3 2 3 O LEU A 91  ? O LEU A 91  N GLY A 70  ? N GLY A 70  
AA3 3 4 N VAL A 78  ? N VAL A 78  O LEU A 81  ? O LEU A 81  
AA4 1 2 N HIS A 105 ? N HIS A 105 O THR A 117 ? O THR A 117 
AA4 2 3 N PHE A 118 ? N PHE A 118 O PHE A 151 ? O PHE A 151 
AA5 1 2 O GLN A 141 ? O GLN A 141 N LEU A 131 ? N LEU A 131 
AA5 2 3 N LEU A 130 ? N LEU A 130 O PHE A 167 ? O PHE A 167 
AA5 3 4 N TYR A 170 ? N TYR A 170 O ALA A 174 ? O ALA A 174 
AA6 1 2 N SER B 7   ? N SER D 7   O THR B 22  ? O THR D 22  
AA6 2 3 N ILE B 21  ? N ILE D 21  O LEU B 73  ? O LEU D 73  
AA6 3 4 O THR B 74  ? O THR D 74  N SER B 63  ? N SER D 63  
AA7 1 2 N LEU B 11  ? N LEU D 11  O GLU B 105 ? O GLU D 105 
AA7 2 3 O THR B 102 ? O THR D 102 N TYR B 86  ? N TYR D 86  
AA7 3 4 O TYR B 87  ? O TYR D 87  N PHE B 36  ? N PHE D 36  
AA7 4 5 N TRP B 35  ? N TRP D 35  O LEU B 47  ? O LEU D 47  
AA7 5 6 N TYR B 49  ? N TYR D 49  O ASN B 53  ? O ASN D 53  
AA8 1 2 N LEU B 11  ? N LEU D 11  O GLU B 105 ? O GLU D 105 
AA8 2 3 O THR B 102 ? O THR D 102 N TYR B 86  ? N TYR D 86  
AA8 3 4 N HIS B 90  ? N HIS D 90  O THR B 97  ? O THR D 97  
AA9 1 2 N PHE B 116 ? N PHE D 116 O LEU B 135 ? O LEU D 135 
AA9 2 3 N PHE B 139 ? N PHE D 139 O TYR B 173 ? O TYR D 173 
AA9 3 4 O SER B 176 ? O SER D 176 N SER B 162 ? N SER D 162 
AB1 1 2 O ALA B 153 ? O ALA D 153 N VAL B 150 ? N VAL D 150 
AB1 2 3 N GLN B 147 ? N GLN D 147 O GLU B 195 ? O GLU D 195 
AB1 3 4 N VAL B 196 ? N VAL D 196 O VAL B 205 ? O VAL D 205 
AB2 1 2 N GLN C 3   ? N GLN E 3   O SER C 25  ? O SER E 25  
AB2 2 3 N VAL C 20  ? N VAL E 20  O MET C 81  ? O MET E 81  
AB2 3 4 O THR C 78  ? O THR E 78  N ASP C 73  ? N ASP E 73  
AB3 1 2 N LYS C 12  ? N LYS E 12  O THR C 114 ? O THR E 114 
AB3 2 3 O VAL C 113 ? O VAL E 113 N ALA C 92  ? N ALA E 92  
AB3 3 4 O TYR C 95  ? O TYR E 95  N VAL C 37  ? N VAL E 37  
AB3 4 5 N TRP C 36  ? N TRP E 36  O ILE C 48  ? O ILE E 48  
AB3 5 6 N TYR C 50  ? N TYR E 50  O GLU C 59  ? O GLU E 59  
AB4 1 2 N LYS C 12  ? N LYS E 12  O THR C 114 ? O THR E 114 
AB4 2 3 O VAL C 113 ? O VAL E 113 N ALA C 92  ? N ALA E 92  
AB4 3 4 N ARG C 98  ? N ARG E 98  O TYR C 106 ? O TYR E 106 
AB5 1 2 N LEU C 128 ? N LEU E 128 O GLY C 143 ? O GLY E 143 
AB5 2 3 N LEU C 142 ? N LEU E 142 O VAL C 186 ? O VAL E 186 
AB5 3 4 O VAL C 185 ? O VAL E 185 N HIS C 168 ? N HIS E 168 
AB6 1 2 N SER C 136 ? N SER E 136 O THR C 139 ? O THR E 139 
AB6 2 3 N LEU C 142 ? N LEU E 142 O VAL C 186 ? O VAL E 186 
AB6 3 4 O SER C 181 ? O SER E 181 N VAL C 173 ? N VAL E 173 
AB7 1 2 N THR C 155 ? N THR E 155 O ASN C 203 ? O ASN E 203 
AB7 2 3 N TYR C 198 ? N TYR E 198 O VAL C 215 ? O VAL E 215 
AB8 1 2 N VAL D 5   ? N VAL H 5   O LYS D 23  ? O LYS H 23  
AB8 2 3 N VAL D 18  ? N VAL H 18  O LEU D 83  ? O LEU H 83  
AB8 3 4 O TYR D 80  ? O TYR H 80  N THR D 71  ? N THR H 71  
AB9 1 2 N LYS D 12  ? N LYS H 12  O THR D 117 ? O THR H 117 
AB9 2 3 O THR D 114 ? O THR H 114 N TYR D 94  ? N TYR H 94  
AB9 3 4 O TYR D 95  ? O TYR H 95  N VAL D 37  ? N VAL H 37  
AB9 4 5 N ARG D 38  ? N ARG H 38  O GLU D 46  ? O GLU H 46  
AB9 5 6 N GLU D 50  ? N GLU H 50  O TYR D 59  ? O TYR H 59  
AC1 1 2 N LEU D 131 ? N LEU H 131 O GLY D 146 ? O GLY H 146 
AC1 2 3 N LEU D 145 ? N LEU H 145 O VAL D 189 ? O VAL H 189 
AC1 3 4 O VAL D 188 ? O VAL H 188 N HIS D 171 ? N HIS H 171 
AC2 1 2 N SER D 160 ? N SER H 160 O ASN D 204 ? O ASN H 204 
AC2 2 3 N VAL D 205 ? N VAL H 205 O VAL D 214 ? O VAL H 214 
AC3 1 2 N SER E 7   ? N SER L 7   O THR E 22  ? O THR L 22  
AC3 2 3 N ILE E 21  ? N ILE L 21  O PHE E 73  ? O PHE L 73  
AC3 3 4 O THR E 74  ? O THR L 74  N SER E 63  ? N SER L 63  
AC4 1 2 N ALA E 13  ? N ALA L 13  O GLU E 105 ? O GLU L 105 
AC5 1 2 O ARG E 53  ? O ARG L 53  N TYR E 49  ? N TYR L 49  
AC5 2 3 O LEU E 47  ? O LEU L 47  N TRP E 35  ? N TRP L 35  
AC5 3 4 N TYR E 36  ? N TYR L 36  O PHE E 87  ? O PHE L 87  
AC5 4 5 N GLN E 90  ? N GLN L 90  O THR E 97  ? O THR L 97  
AC6 1 2 O ARG E 53  ? O ARG L 53  N TYR E 49  ? N TYR L 49  
AC6 2 3 O LEU E 47  ? O LEU L 47  N TRP E 35  ? N TRP L 35  
AC6 3 4 N TYR E 36  ? N TYR L 36  O PHE E 87  ? O PHE L 87  
AC6 4 5 N TYR E 86  ? N TYR L 86  O THR E 102 ? O THR L 102 
AC7 1 2 N PHE E 116 ? N PHE L 116 O LEU E 135 ? O LEU L 135 
AC7 2 3 N PHE E 139 ? N PHE L 139 O TYR E 173 ? O TYR L 173 
AC7 3 4 O SER E 176 ? O SER L 176 N SER E 162 ? N SER L 162 
AC8 1 2 O ALA E 153 ? O ALA L 153 N VAL E 150 ? N VAL L 150 
AC8 2 3 N LYS E 149 ? N LYS L 149 O ALA E 193 ? O ALA L 193 
AC8 3 4 N VAL E 196 ? N VAL L 196 O VAL E 205 ? O VAL L 205 
# 
_atom_sites.entry_id                    6IAP 
_atom_sites.fract_transf_matrix[1][1]   0.014737 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000147 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013545 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007781 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? 13.499  13.486  -47.161 1.00 111.33 ? 1   THR A N   1 
ATOM   2    C CA  . THR A 1 1   ? 14.902  13.505  -47.581 1.00 111.08 ? 1   THR A CA  1 
ATOM   3    C C   . THR A 1 1   ? 15.790  12.825  -46.522 1.00 112.57 ? 1   THR A C   1 
ATOM   4    O O   . THR A 1 1   ? 15.926  11.594  -46.560 1.00 112.86 ? 1   THR A O   1 
ATOM   5    C CB  . THR A 1 1   ? 15.368  14.934  -47.986 1.00 123.50 ? 1   THR A CB  1 
ATOM   6    O OG1 . THR A 1 1   ? 14.959  15.894  -46.995 1.00 124.29 ? 1   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 1   ? 14.885  15.345  -49.382 1.00 122.07 ? 1   THR A CG2 1 
ATOM   8    N N   . LEU A 1 2   ? 16.392  13.620  -45.585 1.00 104.99 ? 2   LEU A N   1 
ATOM   9    C CA  . LEU A 1 2   ? 17.261  13.133  -44.501 1.00 102.20 ? 2   LEU A CA  1 
ATOM   10   C C   . LEU A 1 2   ? 16.519  13.249  -43.142 1.00 98.97  ? 2   LEU A C   1 
ATOM   11   O O   . LEU A 1 2   ? 16.450  14.342  -42.567 1.00 98.43  ? 2   LEU A O   1 
ATOM   12   C CB  . LEU A 1 2   ? 18.622  13.870  -44.515 1.00 102.12 ? 2   LEU A CB  1 
ATOM   13   C CG  . LEU A 1 2   ? 19.807  13.110  -43.908 1.00 106.76 ? 2   LEU A CG  1 
ATOM   14   C CD1 . LEU A 1 2   ? 20.138  11.859  -44.703 1.00 107.00 ? 2   LEU A CD1 1 
ATOM   15   C CD2 . LEU A 1 2   ? 21.032  13.967  -43.869 1.00 109.11 ? 2   LEU A CD2 1 
ATOM   16   N N   . PRO A 1 3   ? 15.905  12.136  -42.666 1.00 89.68  ? 3   PRO A N   1 
ATOM   17   C CA  . PRO A 1 3   ? 15.049  12.202  -41.469 1.00 87.67  ? 3   PRO A CA  1 
ATOM   18   C C   . PRO A 1 3   ? 15.664  12.825  -40.225 1.00 90.21  ? 3   PRO A C   1 
ATOM   19   O O   . PRO A 1 3   ? 16.856  12.670  -39.981 1.00 89.62  ? 3   PRO A O   1 
ATOM   20   C CB  . PRO A 1 3   ? 14.641  10.748  -41.232 1.00 88.99  ? 3   PRO A CB  1 
ATOM   21   C CG  . PRO A 1 3   ? 15.508  9.937   -42.109 1.00 93.99  ? 3   PRO A CG  1 
ATOM   22   C CD  . PRO A 1 3   ? 15.849  10.794  -43.266 1.00 90.29  ? 3   PRO A CD  1 
ATOM   23   N N   . LYS A 1 4   ? 14.835  13.562  -39.451 1.00 86.12  ? 4   LYS A N   1 
ATOM   24   C CA  . LYS A 1 4   ? 15.285  14.245  -38.235 1.00 85.89  ? 4   LYS A CA  1 
ATOM   25   C C   . LYS A 1 4   ? 15.456  13.243  -37.131 1.00 86.88  ? 4   LYS A C   1 
ATOM   26   O O   . LYS A 1 4   ? 14.520  12.487  -36.886 1.00 86.29  ? 4   LYS A O   1 
ATOM   27   C CB  . LYS A 1 4   ? 14.327  15.363  -37.788 1.00 89.82  ? 4   LYS A CB  1 
ATOM   28   C CG  . LYS A 1 4   ? 13.959  16.343  -38.900 1.00 114.08 ? 4   LYS A CG  1 
ATOM   29   C CD  . LYS A 1 4   ? 14.656  17.701  -38.803 1.00 116.66 ? 4   LYS A CD  1 
ATOM   30   C CE  . LYS A 1 4   ? 14.178  18.602  -39.918 1.00 111.93 ? 4   LYS A CE  1 
ATOM   31   N NZ  . LYS A 1 4   ? 14.608  18.097  -41.255 1.00 114.73 ? 4   LYS A NZ  1 
ATOM   32   N N   . PRO A 1 5   ? 16.624  13.216  -36.449 1.00 82.23  ? 5   PRO A N   1 
ATOM   33   C CA  . PRO A 1 5   ? 16.823  12.219  -35.386 1.00 82.15  ? 5   PRO A CA  1 
ATOM   34   C C   . PRO A 1 5   ? 15.970  12.430  -34.129 1.00 88.90  ? 5   PRO A C   1 
ATOM   35   O O   . PRO A 1 5   ? 15.314  13.475  -33.957 1.00 89.82  ? 5   PRO A O   1 
ATOM   36   C CB  . PRO A 1 5   ? 18.324  12.330  -35.075 1.00 83.38  ? 5   PRO A CB  1 
ATOM   37   C CG  . PRO A 1 5   ? 18.689  13.699  -35.472 1.00 87.48  ? 5   PRO A CG  1 
ATOM   38   C CD  . PRO A 1 5   ? 17.832  14.047  -36.641 1.00 83.24  ? 5   PRO A CD  1 
ATOM   39   N N   . PHE A 1 6   ? 15.970  11.413  -33.251 1.00 84.64  ? 6   PHE A N   1 
ATOM   40   C CA  . PHE A 1 6   ? 15.300  11.505  -31.977 1.00 84.14  ? 6   PHE A CA  1 
ATOM   41   C C   . PHE A 1 6   ? 16.310  11.260  -30.903 1.00 86.82  ? 6   PHE A C   1 
ATOM   42   O O   . PHE A 1 6   ? 17.040  10.277  -30.957 1.00 84.67  ? 6   PHE A O   1 
ATOM   43   C CB  . PHE A 1 6   ? 14.091  10.560  -31.848 1.00 86.45  ? 6   PHE A CB  1 
ATOM   44   C CG  . PHE A 1 6   ? 13.274  10.792  -30.580 1.00 88.74  ? 6   PHE A CG  1 
ATOM   45   C CD1 . PHE A 1 6   ? 12.679  12.026  -30.327 1.00 91.77  ? 6   PHE A CD1 1 
ATOM   46   C CD2 . PHE A 1 6   ? 13.084  9.769   -29.657 1.00 92.04  ? 6   PHE A CD2 1 
ATOM   47   C CE1 . PHE A 1 6   ? 11.956  12.245  -29.154 1.00 93.01  ? 6   PHE A CE1 1 
ATOM   48   C CE2 . PHE A 1 6   ? 12.352  9.986   -28.486 1.00 95.27  ? 6   PHE A CE2 1 
ATOM   49   C CZ  . PHE A 1 6   ? 11.790  11.224  -28.244 1.00 93.26  ? 6   PHE A CZ  1 
ATOM   50   N N   . ILE A 1 7   ? 16.363  12.185  -29.940 1.00 85.43  ? 7   ILE A N   1 
ATOM   51   C CA  . ILE A 1 7   ? 17.240  12.165  -28.763 1.00 85.66  ? 7   ILE A CA  1 
ATOM   52   C C   . ILE A 1 7   ? 16.396  11.912  -27.504 1.00 91.99  ? 7   ILE A C   1 
ATOM   53   O O   . ILE A 1 7   ? 15.287  12.440  -27.405 1.00 92.71  ? 7   ILE A O   1 
ATOM   54   C CB  . ILE A 1 7   ? 18.074  13.492  -28.673 1.00 87.77  ? 7   ILE A CB  1 
ATOM   55   C CG1 . ILE A 1 7   ? 19.271  13.376  -27.693 1.00 86.05  ? 7   ILE A CG1 1 
ATOM   56   C CG2 . ILE A 1 7   ? 17.186  14.690  -28.343 1.00 88.99  ? 7   ILE A CG2 1 
ATOM   57   C CD1 . ILE A 1 7   ? 20.332  14.445  -27.795 1.00 74.37  ? 7   ILE A CD1 1 
ATOM   58   N N   . TRP A 1 8   ? 16.916  11.111  -26.552 1.00 89.08  ? 8   TRP A N   1 
ATOM   59   C CA  . TRP A 1 8   ? 16.245  10.816  -25.282 1.00 88.94  ? 8   TRP A CA  1 
ATOM   60   C C   . TRP A 1 8   ? 17.234  10.363  -24.227 1.00 90.45  ? 8   TRP A C   1 
ATOM   61   O O   . TRP A 1 8   ? 18.322  9.894   -24.547 1.00 88.77  ? 8   TRP A O   1 
ATOM   62   C CB  . TRP A 1 8   ? 15.057  9.835   -25.443 1.00 88.65  ? 8   TRP A CB  1 
ATOM   63   C CG  . TRP A 1 8   ? 15.431  8.413   -25.750 1.00 90.37  ? 8   TRP A CG  1 
ATOM   64   C CD1 . TRP A 1 8   ? 15.514  7.382   -24.865 1.00 93.52  ? 8   TRP A CD1 1 
ATOM   65   C CD2 . TRP A 1 8   ? 15.782  7.871   -27.036 1.00 90.45  ? 8   TRP A CD2 1 
ATOM   66   N NE1 . TRP A 1 8   ? 15.908  6.230   -25.516 1.00 93.44  ? 8   TRP A NE1 1 
ATOM   67   C CE2 . TRP A 1 8   ? 16.064  6.499   -26.850 1.00 94.71  ? 8   TRP A CE2 1 
ATOM   68   C CE3 . TRP A 1 8   ? 15.905  8.417   -28.326 1.00 91.39  ? 8   TRP A CE3 1 
ATOM   69   C CZ2 . TRP A 1 8   ? 16.419  5.659   -27.907 1.00 93.75  ? 8   TRP A CZ2 1 
ATOM   70   C CZ3 . TRP A 1 8   ? 16.251  7.582   -29.371 1.00 93.10  ? 8   TRP A CZ3 1 
ATOM   71   C CH2 . TRP A 1 8   ? 16.533  6.227   -29.154 1.00 93.56  ? 8   TRP A CH2 1 
ATOM   72   N N   . ALA A 1 9   ? 16.861  10.522  -22.969 1.00 88.00  ? 9   ALA A N   1 
ATOM   73   C CA  . ALA A 1 9   ? 17.719  10.168  -21.857 1.00 87.98  ? 9   ALA A CA  1 
ATOM   74   C C   . ALA A 1 9   ? 17.278  8.876   -21.170 1.00 93.41  ? 9   ALA A C   1 
ATOM   75   O O   . ALA A 1 9   ? 16.108  8.729   -20.798 1.00 94.17  ? 9   ALA A O   1 
ATOM   76   C CB  . ALA A 1 9   ? 17.736  11.308  -20.855 1.00 88.40  ? 9   ALA A CB  1 
ATOM   77   N N   . GLU A 1 10  ? 18.226  7.960   -20.956 1.00 88.98  ? 10  GLU A N   1 
ATOM   78   C CA  . GLU A 1 10  ? 17.954  6.734   -20.219 1.00 87.89  ? 10  GLU A CA  1 
ATOM   79   C C   . GLU A 1 10  ? 18.760  6.678   -18.898 1.00 89.55  ? 10  GLU A C   1 
ATOM   80   O O   . GLU A 1 10  ? 19.956  6.916   -18.909 1.00 88.87  ? 10  GLU A O   1 
ATOM   81   C CB  . GLU A 1 10  ? 18.120  5.495   -21.094 1.00 89.22  ? 10  GLU A CB  1 
ATOM   82   C CG  . GLU A 1 10  ? 16.928  5.264   -22.002 1.00 99.89  ? 10  GLU A CG  1 
ATOM   83   C CD  . GLU A 1 10  ? 17.077  4.049   -22.891 1.00 125.40 ? 10  GLU A CD  1 
ATOM   84   O OE1 . GLU A 1 10  ? 17.335  4.220   -24.106 1.00 108.71 ? 10  GLU A OE1 1 
ATOM   85   O OE2 . GLU A 1 10  ? 16.943  2.919   -22.366 1.00 128.36 ? 10  GLU A OE2 1 
ATOM   86   N N   . PRO A 1 11  ? 18.116  6.485   -17.729 1.00 86.31  ? 11  PRO A N   1 
ATOM   87   C CA  . PRO A 1 11  ? 16.688  6.143   -17.519 1.00 86.01  ? 11  PRO A CA  1 
ATOM   88   C C   . PRO A 1 11  ? 15.673  7.272   -17.744 1.00 90.23  ? 11  PRO A C   1 
ATOM   89   O O   . PRO A 1 11  ? 14.571  7.018   -18.245 1.00 89.55  ? 11  PRO A O   1 
ATOM   90   C CB  . PRO A 1 11  ? 16.667  5.631   -16.072 1.00 86.99  ? 11  PRO A CB  1 
ATOM   91   C CG  . PRO A 1 11  ? 17.805  6.340   -15.406 1.00 91.57  ? 11  PRO A CG  1 
ATOM   92   C CD  . PRO A 1 11  ? 18.874  6.432   -16.461 1.00 87.83  ? 11  PRO A CD  1 
ATOM   93   N N   . HIS A 1 12  ? 16.056  8.508   -17.395 1.00 86.65  ? 12  HIS A N   1 
ATOM   94   C CA  . HIS A 1 12  ? 15.188  9.682   -17.408 1.00 85.74  ? 12  HIS A CA  1 
ATOM   95   C C   . HIS A 1 12  ? 16.021  10.956  -17.562 1.00 87.10  ? 12  HIS A C   1 
ATOM   96   O O   . HIS A 1 12  ? 17.219  10.915  -17.298 1.00 87.54  ? 12  HIS A O   1 
ATOM   97   C CB  . HIS A 1 12  ? 14.473  9.691   -16.043 1.00 86.66  ? 12  HIS A CB  1 
ATOM   98   C CG  . HIS A 1 12  ? 13.423  10.727  -15.882 1.00 90.11  ? 12  HIS A CG  1 
ATOM   99   N ND1 . HIS A 1 12  ? 12.422  10.888  -16.819 1.00 92.38  ? 12  HIS A ND1 1 
ATOM   100  C CD2 . HIS A 1 12  ? 13.222  11.593  -14.865 1.00 92.40  ? 12  HIS A CD2 1 
ATOM   101  C CE1 . HIS A 1 12  ? 11.651  11.856  -16.352 1.00 92.05  ? 12  HIS A CE1 1 
ATOM   102  N NE2 . HIS A 1 12  ? 12.096  12.314  -15.181 1.00 92.40  ? 12  HIS A NE2 1 
ATOM   103  N N   . PHE A 1 13  ? 15.406  12.095  -17.942 1.00 80.85  ? 13  PHE A N   1 
ATOM   104  C CA  . PHE A 1 13  ? 16.178  13.346  -18.074 1.00 79.26  ? 13  PHE A CA  1 
ATOM   105  C C   . PHE A 1 13  ? 16.586  13.977  -16.720 1.00 83.11  ? 13  PHE A C   1 
ATOM   106  O O   . PHE A 1 13  ? 17.455  14.859  -16.698 1.00 82.92  ? 13  PHE A O   1 
ATOM   107  C CB  . PHE A 1 13  ? 15.458  14.363  -18.962 1.00 79.99  ? 13  PHE A CB  1 
ATOM   108  C CG  . PHE A 1 13  ? 14.354  15.099  -18.259 1.00 80.35  ? 13  PHE A CG  1 
ATOM   109  C CD1 . PHE A 1 13  ? 13.097  14.526  -18.119 1.00 82.33  ? 13  PHE A CD1 1 
ATOM   110  C CD2 . PHE A 1 13  ? 14.574  16.363  -17.719 1.00 81.30  ? 13  PHE A CD2 1 
ATOM   111  C CE1 . PHE A 1 13  ? 12.073  15.219  -17.487 1.00 82.84  ? 13  PHE A CE1 1 
ATOM   112  C CE2 . PHE A 1 13  ? 13.555  17.045  -17.066 1.00 83.61  ? 13  PHE A CE2 1 
ATOM   113  C CZ  . PHE A 1 13  ? 12.308  16.478  -16.971 1.00 81.70  ? 13  PHE A CZ  1 
ATOM   114  N N   . MET A 1 14  ? 15.917  13.560  -15.610 1.00 77.94  ? 14  MET A N   1 
ATOM   115  C CA  . MET A 1 14  ? 16.220  14.024  -14.260 1.00 75.86  ? 14  MET A CA  1 
ATOM   116  C C   . MET A 1 14  ? 17.206  13.040  -13.642 1.00 79.61  ? 14  MET A C   1 
ATOM   117  O O   . MET A 1 14  ? 16.842  11.948  -13.210 1.00 78.64  ? 14  MET A O   1 
ATOM   118  C CB  . MET A 1 14  ? 14.956  14.154  -13.436 1.00 77.43  ? 14  MET A CB  1 
ATOM   119  C CG  . MET A 1 14  ? 14.146  15.340  -13.792 1.00 80.73  ? 14  MET A CG  1 
ATOM   120  S SD  . MET A 1 14  ? 12.723  15.360  -12.707 1.00 85.09  ? 14  MET A SD  1 
ATOM   121  C CE  . MET A 1 14  ? 11.424  15.147  -13.884 1.00 81.75  ? 14  MET A CE  1 
ATOM   122  N N   . VAL A 1 15  ? 18.480  13.408  -13.679 1.00 76.76  ? 15  VAL A N   1 
ATOM   123  C CA  . VAL A 1 15  ? 19.557  12.549  -13.215 1.00 76.45  ? 15  VAL A CA  1 
ATOM   124  C C   . VAL A 1 15  ? 20.171  13.101  -11.925 1.00 80.10  ? 15  VAL A C   1 
ATOM   125  O O   . VAL A 1 15  ? 20.848  14.140  -11.989 1.00 80.79  ? 15  VAL A O   1 
ATOM   126  C CB  . VAL A 1 15  ? 20.641  12.365  -14.318 1.00 79.94  ? 15  VAL A CB  1 
ATOM   127  C CG1 . VAL A 1 15  ? 21.498  11.130  -14.056 1.00 79.65  ? 15  VAL A CG1 1 
ATOM   128  C CG2 . VAL A 1 15  ? 20.025  12.321  -15.712 1.00 79.43  ? 15  VAL A CG2 1 
ATOM   129  N N   . PRO A 1 16  ? 19.988  12.410  -10.763 1.00 73.73  ? 16  PRO A N   1 
ATOM   130  C CA  . PRO A 1 16  ? 20.643  12.853  -9.521  1.00 72.28  ? 16  PRO A CA  1 
ATOM   131  C C   . PRO A 1 16  ? 22.158  12.806  -9.678  1.00 75.00  ? 16  PRO A C   1 
ATOM   132  O O   . PRO A 1 16  ? 22.654  12.005  -10.478 1.00 72.61  ? 16  PRO A O   1 
ATOM   133  C CB  . PRO A 1 16  ? 20.210  11.800  -8.498  1.00 73.74  ? 16  PRO A CB  1 
ATOM   134  C CG  . PRO A 1 16  ? 19.043  11.161  -9.056  1.00 78.80  ? 16  PRO A CG  1 
ATOM   135  C CD  . PRO A 1 16  ? 19.217  11.178  -10.535 1.00 75.30  ? 16  PRO A CD  1 
ATOM   136  N N   . LYS A 1 17  ? 22.886  13.674  -8.929  1.00 73.09  ? 17  LYS A N   1 
ATOM   137  C CA  . LYS A 1 17  ? 24.354  13.777  -8.935  1.00 73.00  ? 17  LYS A CA  1 
ATOM   138  C C   . LYS A 1 17  ? 25.037  12.400  -8.848  1.00 78.03  ? 17  LYS A C   1 
ATOM   139  O O   . LYS A 1 17  ? 24.531  11.485  -8.191  1.00 77.43  ? 17  LYS A O   1 
ATOM   140  C CB  . LYS A 1 17  ? 24.834  14.698  -7.799  1.00 74.34  ? 17  LYS A CB  1 
ATOM   141  N N   . GLU A 1 18  ? 26.181  12.273  -9.516  1.00 75.47  ? 18  GLU A N   1 
ATOM   142  C CA  . GLU A 1 18  ? 27.075  11.114  -9.629  1.00 76.67  ? 18  GLU A CA  1 
ATOM   143  C C   . GLU A 1 18  ? 26.359  9.794   -9.937  1.00 87.66  ? 18  GLU A C   1 
ATOM   144  O O   . GLU A 1 18  ? 26.814  8.720   -9.522  1.00 88.44  ? 18  GLU A O   1 
ATOM   145  C CB  . GLU A 1 18  ? 28.045  10.972  -8.432  1.00 77.46  ? 18  GLU A CB  1 
ATOM   146  C CG  . GLU A 1 18  ? 27.490  11.199  -7.040  1.00 85.45  ? 18  GLU A CG  1 
ATOM   147  C CD  . GLU A 1 18  ? 28.513  11.609  -5.999  1.00 108.39 ? 18  GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 18  ? 29.196  12.647  -6.188  1.00 82.48  ? 18  GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 18  ? 28.616  10.892  -4.976  1.00 116.80 ? 18  GLU A OE2 1 
ATOM   150  N N   . LYS A 1 19  ? 25.273  9.898   -10.693 1.00 89.01  ? 19  LYS A N   1 
ATOM   151  C CA  . LYS A 1 19  ? 24.498  8.719   -11.150 1.00 90.85  ? 19  LYS A CA  1 
ATOM   152  C C   . LYS A 1 19  ? 24.759  8.539   -12.647 1.00 98.25  ? 19  LYS A C   1 
ATOM   153  O O   . LYS A 1 19  ? 25.146  9.514   -13.292 1.00 97.17  ? 19  LYS A O   1 
ATOM   154  C CB  . LYS A 1 19  ? 23.011  8.921   -10.867 1.00 92.60  ? 19  LYS A CB  1 
ATOM   155  C CG  . LYS A 1 19  ? 22.204  7.638   -10.802 1.00 104.24 ? 19  LYS A CG  1 
ATOM   156  C CD  . LYS A 1 19  ? 20.918  7.781   -10.036 1.00 112.82 ? 19  LYS A CD  1 
ATOM   157  C CE  . LYS A 1 19  ? 19.716  7.284   -10.807 1.00 124.11 ? 19  LYS A CE  1 
ATOM   158  N NZ  . LYS A 1 19  ? 18.885  6.373   -9.987  1.00 129.02 ? 19  LYS A NZ  1 
ATOM   159  N N   . GLN A 1 20  ? 24.527  7.345   -13.188 1.00 97.12  ? 20  GLN A N   1 
ATOM   160  C CA  . GLN A 1 20  ? 24.831  7.104   -14.623 1.00 97.64  ? 20  GLN A CA  1 
ATOM   161  C C   . GLN A 1 20  ? 23.665  7.513   -15.521 1.00 97.48  ? 20  GLN A C   1 
ATOM   162  O O   . GLN A 1 20  ? 22.513  7.289   -15.148 1.00 97.98  ? 20  GLN A O   1 
ATOM   163  C CB  . GLN A 1 20  ? 25.193  5.640   -14.860 1.00 99.92  ? 20  GLN A CB  1 
ATOM   164  C CG  . GLN A 1 20  ? 26.690  5.393   -14.907 1.00 126.35 ? 20  GLN A CG  1 
ATOM   165  C CD  . GLN A 1 20  ? 27.002  4.009   -15.412 1.00 147.15 ? 20  GLN A CD  1 
ATOM   166  O OE1 . GLN A 1 20  ? 26.309  3.047   -15.097 1.00 146.06 ? 20  GLN A OE1 1 
ATOM   167  N NE2 . GLN A 1 20  ? 28.050  3.901   -16.209 1.00 133.72 ? 20  GLN A NE2 1 
ATOM   168  N N   . VAL A 1 21  ? 23.990  8.087   -16.676 1.00 90.98  ? 21  VAL A N   1 
ATOM   169  C CA  . VAL A 1 21  ? 22.959  8.508   -17.663 1.00 90.08  ? 21  VAL A CA  1 
ATOM   170  C C   . VAL A 1 21  ? 23.461  8.148   -19.056 1.00 91.66  ? 21  VAL A C   1 
ATOM   171  O O   . VAL A 1 21  ? 24.654  8.329   -19.330 1.00 91.59  ? 21  VAL A O   1 
ATOM   172  C CB  . VAL A 1 21  ? 22.661  10.011  -17.583 1.00 93.82  ? 21  VAL A CB  1 
ATOM   173  C CG1 . VAL A 1 21  ? 23.878  10.831  -17.959 1.00 93.62  ? 21  VAL A CG1 1 
ATOM   174  C CG2 . VAL A 1 21  ? 21.493  10.372  -18.477 1.00 93.40  ? 21  VAL A CG2 1 
ATOM   175  N N   . THR A 1 22  ? 22.561  7.649   -19.891 1.00 86.56  ? 22  THR A N   1 
ATOM   176  C CA  . THR A 1 22  ? 22.933  7.272   -21.268 1.00 87.44  ? 22  THR A CA  1 
ATOM   177  C C   . THR A 1 22  ? 22.028  8.051   -22.212 1.00 93.06  ? 22  THR A C   1 
ATOM   178  O O   . THR A 1 22  ? 20.806  7.934   -22.084 1.00 92.64  ? 22  THR A O   1 
ATOM   179  C CB  . THR A 1 22  ? 22.801  5.761   -21.462 1.00 90.62  ? 22  THR A CB  1 
ATOM   180  O OG1 . THR A 1 22  ? 22.459  5.523   -22.823 1.00 83.69  ? 22  THR A OG1 1 
ATOM   181  C CG2 . THR A 1 22  ? 21.738  5.162   -20.572 1.00 91.08  ? 22  THR A CG2 1 
ATOM   182  N N   . ILE A 1 23  ? 22.627  8.856   -23.082 1.00 89.10  ? 23  ILE A N   1 
ATOM   183  C CA  . ILE A 1 23  ? 21.823  9.634   -24.059 1.00 88.26  ? 23  ILE A CA  1 
ATOM   184  C C   . ILE A 1 23  ? 21.754  8.801   -25.330 1.00 94.74  ? 23  ILE A C   1 
ATOM   185  O O   . ILE A 1 23  ? 22.800  8.375   -25.819 1.00 93.20  ? 23  ILE A O   1 
ATOM   186  C CB  . ILE A 1 23  ? 22.439  11.015  -24.315 1.00 90.07  ? 23  ILE A CB  1 
ATOM   187  C CG1 . ILE A 1 23  ? 22.217  11.953  -23.129 1.00 88.51  ? 23  ILE A CG1 1 
ATOM   188  C CG2 . ILE A 1 23  ? 21.878  11.598  -25.592 1.00 90.89  ? 23  ILE A CG2 1 
ATOM   189  C CD1 . ILE A 1 23  ? 23.390  12.838  -22.825 1.00 82.11  ? 23  ILE A CD1 1 
ATOM   190  N N   . CYS A 1 24  ? 20.546  8.557   -25.810 1.00 94.84  ? 24  CYS A N   1 
ATOM   191  C CA  . CYS A 1 24  ? 20.404  7.724   -27.018 1.00 95.85  ? 24  CYS A CA  1 
ATOM   192  C C   . CYS A 1 24  ? 19.934  8.599   -28.167 1.00 96.68  ? 24  CYS A C   1 
ATOM   193  O O   . CYS A 1 24  ? 19.077  9.449   -27.942 1.00 94.33  ? 24  CYS A O   1 
ATOM   194  C CB  . CYS A 1 24  ? 19.405  6.608   -26.772 1.00 97.49  ? 24  CYS A CB  1 
ATOM   195  S SG  . CYS A 1 24  ? 19.984  5.466   -25.497 1.00 102.15 ? 24  CYS A SG  1 
ATOM   196  N N   . CYS A 1 25  ? 20.523  8.370   -29.336 1.00 93.09  ? 25  CYS A N   1 
ATOM   197  C CA  . CYS A 1 25  ? 20.206  9.059   -30.573 1.00 92.44  ? 25  CYS A CA  1 
ATOM   198  C C   . CYS A 1 25  ? 19.883  8.104   -31.715 1.00 96.10  ? 25  CYS A C   1 
ATOM   199  O O   . CYS A 1 25  ? 20.747  7.349   -32.154 1.00 95.52  ? 25  CYS A O   1 
ATOM   200  C CB  . CYS A 1 25  ? 21.304  10.039  -30.960 1.00 92.32  ? 25  CYS A CB  1 
ATOM   201  S SG  . CYS A 1 25  ? 20.955  10.933  -32.489 1.00 95.93  ? 25  CYS A SG  1 
ATOM   202  N N   . GLN A 1 26  ? 18.649  8.172   -32.212 1.00 93.25  ? 26  GLN A N   1 
ATOM   203  C CA  . GLN A 1 26  ? 18.206  7.343   -33.320 1.00 93.62  ? 26  GLN A CA  1 
ATOM   204  C C   . GLN A 1 26  ? 18.173  8.195   -34.588 1.00 99.54  ? 26  GLN A C   1 
ATOM   205  O O   . GLN A 1 26  ? 17.345  9.096   -34.714 1.00 99.91  ? 26  GLN A O   1 
ATOM   206  C CB  . GLN A 1 26  ? 16.837  6.711   -33.020 1.00 94.69  ? 26  GLN A CB  1 
ATOM   207  C CG  . GLN A 1 26  ? 16.442  5.651   -34.025 1.00 102.81 ? 26  GLN A CG  1 
ATOM   208  C CD  . GLN A 1 26  ? 14.977  5.363   -33.959 1.00 115.85 ? 26  GLN A CD  1 
ATOM   209  O OE1 . GLN A 1 26  ? 14.525  4.510   -33.195 1.00 108.30 ? 26  GLN A OE1 1 
ATOM   210  N NE2 . GLN A 1 26  ? 14.207  6.069   -34.768 1.00 111.20 ? 26  GLN A NE2 1 
ATOM   211  N N   . GLY A 1 27  ? 19.116  7.940   -35.480 1.00 96.69  ? 27  GLY A N   1 
ATOM   212  C CA  . GLY A 1 27  ? 19.207  8.644   -36.747 1.00 96.79  ? 27  GLY A CA  1 
ATOM   213  C C   . GLY A 1 27  ? 18.608  7.784   -37.832 1.00 102.61 ? 27  GLY A C   1 
ATOM   214  O O   . GLY A 1 27  ? 17.430  7.412   -37.768 1.00 103.44 ? 27  GLY A O   1 
ATOM   215  N N   . ASN A 1 28  ? 19.433  7.418   -38.804 1.00 98.88  ? 28  ASN A N   1 
ATOM   216  C CA  . ASN A 1 28  ? 19.002  6.596   -39.916 1.00 98.79  ? 28  ASN A CA  1 
ATOM   217  C C   . ASN A 1 28  ? 20.071  5.540   -40.193 1.00 104.29 ? 28  ASN A C   1 
ATOM   218  O O   . ASN A 1 28  ? 21.202  5.658   -39.699 1.00 103.84 ? 28  ASN A O   1 
ATOM   219  C CB  . ASN A 1 28  ? 18.756  7.488   -41.138 1.00 97.63  ? 28  ASN A CB  1 
ATOM   220  C CG  . ASN A 1 28  ? 17.971  6.872   -42.269 1.00 119.16 ? 28  ASN A CG  1 
ATOM   221  O OD1 . ASN A 1 28  ? 17.576  5.688   -42.254 1.00 116.97 ? 28  ASN A OD1 1 
ATOM   222  N ND2 . ASN A 1 28  ? 17.740  7.674   -43.296 1.00 106.65 ? 28  ASN A ND2 1 
ATOM   223  N N   . TYR A 1 29  ? 19.694  4.479   -40.942 1.00 101.63 ? 29  TYR A N   1 
ATOM   224  C CA  . TYR A 1 29  ? 20.624  3.415   -41.331 1.00 101.43 ? 29  TYR A CA  1 
ATOM   225  C C   . TYR A 1 29  ? 21.572  3.954   -42.393 1.00 102.08 ? 29  TYR A C   1 
ATOM   226  O O   . TYR A 1 29  ? 21.144  4.718   -43.261 1.00 102.09 ? 29  TYR A O   1 
ATOM   227  C CB  . TYR A 1 29  ? 19.891  2.191   -41.897 1.00 102.96 ? 29  TYR A CB  1 
ATOM   228  C CG  . TYR A 1 29  ? 19.103  1.395   -40.886 1.00 104.69 ? 29  TYR A CG  1 
ATOM   229  C CD1 . TYR A 1 29  ? 19.703  0.376   -40.151 1.00 106.84 ? 29  TYR A CD1 1 
ATOM   230  C CD2 . TYR A 1 29  ? 17.728  1.560   -40.768 1.00 105.34 ? 29  TYR A CD2 1 
ATOM   231  C CE1 . TYR A 1 29  ? 18.963  -0.400  -39.260 1.00 107.04 ? 29  TYR A CE1 1 
ATOM   232  C CE2 . TYR A 1 29  ? 16.974  0.761   -39.909 1.00 106.03 ? 29  TYR A CE2 1 
ATOM   233  C CZ  . TYR A 1 29  ? 17.594  -0.214  -39.158 1.00 110.77 ? 29  TYR A CZ  1 
ATOM   234  O OH  . TYR A 1 29  ? 16.869  -1.020  -38.320 1.00 109.39 ? 29  TYR A OH  1 
ATOM   235  N N   . GLY A 1 30  ? 22.832  3.531   -42.326 1.00 95.65  ? 30  GLY A N   1 
ATOM   236  C CA  . GLY A 1 30  ? 23.857  3.954   -43.266 1.00 94.29  ? 30  GLY A CA  1 
ATOM   237  C C   . GLY A 1 30  ? 24.299  5.390   -43.073 1.00 95.89  ? 30  GLY A C   1 
ATOM   238  O O   . GLY A 1 30  ? 24.603  6.071   -44.058 1.00 97.17  ? 30  GLY A O   1 
ATOM   239  N N   . ALA A 1 31  ? 24.314  5.863   -41.808 1.00 88.42  ? 31  ALA A N   1 
ATOM   240  C CA  . ALA A 1 31  ? 24.766  7.193   -41.430 1.00 86.32  ? 31  ALA A CA  1 
ATOM   241  C C   . ALA A 1 31  ? 26.180  7.022   -40.868 1.00 88.82  ? 31  ALA A C   1 
ATOM   242  O O   . ALA A 1 31  ? 26.382  6.189   -39.992 1.00 89.85  ? 31  ALA A O   1 
ATOM   243  C CB  . ALA A 1 31  ? 23.835  7.780   -40.394 1.00 86.72  ? 31  ALA A CB  1 
ATOM   244  N N   . VAL A 1 32  ? 27.154  7.764   -41.403 1.00 82.91  ? 32  VAL A N   1 
ATOM   245  C CA  . VAL A 1 32  ? 28.581  7.689   -41.082 1.00 82.65  ? 32  VAL A CA  1 
ATOM   246  C C   . VAL A 1 32  ? 28.999  8.242   -39.698 1.00 84.74  ? 32  VAL A C   1 
ATOM   247  O O   . VAL A 1 32  ? 29.854  7.645   -39.075 1.00 84.77  ? 32  VAL A O   1 
ATOM   248  C CB  . VAL A 1 32  ? 29.405  8.383   -42.191 1.00 88.47  ? 32  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 32  ? 30.814  7.820   -42.257 1.00 88.50  ? 32  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 32  ? 28.720  8.296   -43.560 1.00 88.75  ? 32  VAL A CG2 1 
ATOM   251  N N   . GLU A 1 33  ? 28.490  9.411   -39.271 1.00 80.05  ? 33  GLU A N   1 
ATOM   252  C CA  . GLU A 1 33  ? 28.827  10.106  -38.009 1.00 78.85  ? 33  GLU A CA  1 
ATOM   253  C C   . GLU A 1 33  ? 27.551  10.372  -37.227 1.00 82.44  ? 33  GLU A C   1 
ATOM   254  O O   . GLU A 1 33  ? 26.496  10.459  -37.837 1.00 83.90  ? 33  GLU A O   1 
ATOM   255  C CB  . GLU A 1 33  ? 29.452  11.478  -38.365 1.00 79.76  ? 33  GLU A CB  1 
ATOM   256  C CG  . GLU A 1 33  ? 30.178  12.214  -37.248 1.00 83.12  ? 33  GLU A CG  1 
ATOM   257  C CD  . GLU A 1 33  ? 31.529  12.758  -37.667 1.00 101.33 ? 33  GLU A CD  1 
ATOM   258  O OE1 . GLU A 1 33  ? 31.902  13.869  -37.218 1.00 90.27  ? 33  GLU A OE1 1 
ATOM   259  O OE2 . GLU A 1 33  ? 32.217  12.070  -38.459 1.00 97.63  ? 33  GLU A OE2 1 
ATOM   260  N N   . TYR A 1 34  ? 27.639  10.572  -35.907 1.00 76.96  ? 34  TYR A N   1 
ATOM   261  C CA  . TYR A 1 34  ? 26.497  10.907  -35.037 1.00 75.87  ? 34  TYR A CA  1 
ATOM   262  C C   . TYR A 1 34  ? 27.085  11.842  -34.013 1.00 79.70  ? 34  TYR A C   1 
ATOM   263  O O   . TYR A 1 34  ? 28.023  11.474  -33.313 1.00 79.99  ? 34  TYR A O   1 
ATOM   264  C CB  . TYR A 1 34  ? 25.903  9.658   -34.323 1.00 76.45  ? 34  TYR A CB  1 
ATOM   265  C CG  . TYR A 1 34  ? 24.861  8.897   -35.104 1.00 76.81  ? 34  TYR A CG  1 
ATOM   266  C CD1 . TYR A 1 34  ? 25.233  7.929   -36.032 1.00 78.70  ? 34  TYR A CD1 1 
ATOM   267  C CD2 . TYR A 1 34  ? 23.506  9.116   -34.902 1.00 77.33  ? 34  TYR A CD2 1 
ATOM   268  C CE1 . TYR A 1 34  ? 24.268  7.199   -36.742 1.00 80.43  ? 34  TYR A CE1 1 
ATOM   269  C CE2 . TYR A 1 34  ? 22.542  8.425   -35.624 1.00 78.41  ? 34  TYR A CE2 1 
ATOM   270  C CZ  . TYR A 1 34  ? 22.924  7.458   -36.534 1.00 89.08  ? 34  TYR A CZ  1 
ATOM   271  O OH  . TYR A 1 34  ? 21.977  6.741   -37.251 1.00 92.81  ? 34  TYR A OH  1 
ATOM   272  N N   . GLN A 1 35  ? 26.590  13.064  -33.951 1.00 75.88  ? 35  GLN A N   1 
ATOM   273  C CA  . GLN A 1 35  ? 27.117  14.061  -33.035 1.00 75.21  ? 35  GLN A CA  1 
ATOM   274  C C   . GLN A 1 35  ? 26.127  14.459  -31.927 1.00 78.56  ? 35  GLN A C   1 
ATOM   275  O O   . GLN A 1 35  ? 24.913  14.595  -32.152 1.00 75.65  ? 35  GLN A O   1 
ATOM   276  C CB  . GLN A 1 35  ? 27.630  15.307  -33.799 1.00 76.36  ? 35  GLN A CB  1 
ATOM   277  C CG  . GLN A 1 35  ? 28.613  14.985  -34.923 1.00 80.98  ? 35  GLN A CG  1 
ATOM   278  C CD  . GLN A 1 35  ? 29.352  16.169  -35.489 1.00 93.77  ? 35  GLN A CD  1 
ATOM   279  O OE1 . GLN A 1 35  ? 28.897  17.318  -35.469 1.00 90.87  ? 35  GLN A OE1 1 
ATOM   280  N NE2 . GLN A 1 35  ? 30.514  15.901  -36.043 1.00 80.64  ? 35  GLN A NE2 1 
ATOM   281  N N   . LEU A 1 36  ? 26.688  14.620  -30.719 1.00 76.71  ? 36  LEU A N   1 
ATOM   282  C CA  . LEU A 1 36  ? 26.021  15.097  -29.524 1.00 76.34  ? 36  LEU A CA  1 
ATOM   283  C C   . LEU A 1 36  ? 26.539  16.505  -29.315 1.00 82.18  ? 36  LEU A C   1 
ATOM   284  O O   . LEU A 1 36  ? 27.750  16.729  -29.240 1.00 83.31  ? 36  LEU A O   1 
ATOM   285  C CB  . LEU A 1 36  ? 26.337  14.223  -28.301 1.00 76.02  ? 36  LEU A CB  1 
ATOM   286  C CG  . LEU A 1 36  ? 25.550  14.533  -27.016 1.00 80.28  ? 36  LEU A CG  1 
ATOM   287  C CD1 . LEU A 1 36  ? 24.067  14.326  -27.210 1.00 80.43  ? 36  LEU A CD1 1 
ATOM   288  C CD2 . LEU A 1 36  ? 25.990  13.641  -25.888 1.00 81.59  ? 36  LEU A CD2 1 
ATOM   289  N N   . HIS A 1 37  ? 25.632  17.464  -29.310 1.00 77.82  ? 37  HIS A N   1 
ATOM   290  C CA  . HIS A 1 37  ? 26.028  18.833  -29.089 1.00 77.00  ? 37  HIS A CA  1 
ATOM   291  C C   . HIS A 1 37  ? 25.542  19.226  -27.718 1.00 82.08  ? 37  HIS A C   1 
ATOM   292  O O   . HIS A 1 37  ? 24.380  18.980  -27.363 1.00 81.89  ? 37  HIS A O   1 
ATOM   293  C CB  . HIS A 1 37  ? 25.476  19.764  -30.171 1.00 77.43  ? 37  HIS A CB  1 
ATOM   294  C CG  . HIS A 1 37  ? 26.305  19.776  -31.408 1.00 80.91  ? 37  HIS A CG  1 
ATOM   295  N ND1 . HIS A 1 37  ? 25.989  18.988  -32.490 1.00 83.06  ? 37  HIS A ND1 1 
ATOM   296  C CD2 . HIS A 1 37  ? 27.443  20.459  -31.678 1.00 82.87  ? 37  HIS A CD2 1 
ATOM   297  C CE1 . HIS A 1 37  ? 26.937  19.215  -33.382 1.00 82.40  ? 37  HIS A CE1 1 
ATOM   298  N NE2 . HIS A 1 37  ? 27.816  20.120  -32.945 1.00 82.62  ? 37  HIS A NE2 1 
ATOM   299  N N   . PHE A 1 38  ? 26.461  19.784  -26.926 1.00 77.37  ? 38  PHE A N   1 
ATOM   300  C CA  . PHE A 1 38  ? 26.174  20.296  -25.613 1.00 75.20  ? 38  PHE A CA  1 
ATOM   301  C C   . PHE A 1 38  ? 26.315  21.804  -25.626 1.00 78.95  ? 38  PHE A C   1 
ATOM   302  O O   . PHE A 1 38  ? 27.326  22.320  -26.112 1.00 77.55  ? 38  PHE A O   1 
ATOM   303  C CB  . PHE A 1 38  ? 27.090  19.677  -24.570 1.00 76.35  ? 38  PHE A CB  1 
ATOM   304  C CG  . PHE A 1 38  ? 26.646  20.040  -23.172 1.00 78.06  ? 38  PHE A CG  1 
ATOM   305  C CD1 . PHE A 1 38  ? 25.312  19.927  -22.796 1.00 81.35  ? 38  PHE A CD1 1 
ATOM   306  C CD2 . PHE A 1 38  ? 27.554  20.505  -22.239 1.00 80.52  ? 38  PHE A CD2 1 
ATOM   307  C CE1 . PHE A 1 38  ? 24.904  20.248  -21.511 1.00 82.74  ? 38  PHE A CE1 1 
ATOM   308  C CE2 . PHE A 1 38  ? 27.140  20.845  -20.955 1.00 84.08  ? 38  PHE A CE2 1 
ATOM   309  C CZ  . PHE A 1 38  ? 25.818  20.708  -20.597 1.00 82.41  ? 38  PHE A CZ  1 
ATOM   310  N N   . GLU A 1 39  ? 25.284  22.512  -25.120 1.00 76.76  ? 39  GLU A N   1 
ATOM   311  C CA  . GLU A 1 39  ? 25.198  23.974  -24.986 1.00 76.83  ? 39  GLU A CA  1 
ATOM   312  C C   . GLU A 1 39  ? 25.960  24.720  -26.075 1.00 83.86  ? 39  GLU A C   1 
ATOM   313  O O   . GLU A 1 39  ? 26.863  25.516  -25.785 1.00 83.87  ? 39  GLU A O   1 
ATOM   314  C CB  . GLU A 1 39  ? 25.651  24.405  -23.589 1.00 78.06  ? 39  GLU A CB  1 
ATOM   315  C CG  . GLU A 1 39  ? 24.732  23.908  -22.489 1.00 92.48  ? 39  GLU A CG  1 
ATOM   316  C CD  . GLU A 1 39  ? 23.519  24.774  -22.207 1.00 120.21 ? 39  GLU A CD  1 
ATOM   317  O OE1 . GLU A 1 39  ? 22.382  24.267  -22.343 1.00 106.22 ? 39  GLU A OE1 1 
ATOM   318  O OE2 . GLU A 1 39  ? 23.706  25.955  -21.834 1.00 121.07 ? 39  GLU A OE2 1 
ATOM   319  N N   . GLY A 1 40  ? 25.620  24.391  -27.324 1.00 82.20  ? 40  GLY A N   1 
ATOM   320  C CA  . GLY A 1 40  ? 26.230  24.928  -28.537 1.00 81.97  ? 40  GLY A CA  1 
ATOM   321  C C   . GLY A 1 40  ? 27.716  24.650  -28.722 1.00 86.01  ? 40  GLY A C   1 
ATOM   322  O O   . GLY A 1 40  ? 28.497  25.586  -28.918 1.00 86.11  ? 40  GLY A O   1 
ATOM   323  N N   . SER A 1 41  ? 28.131  23.366  -28.638 1.00 80.84  ? 41  SER A N   1 
ATOM   324  C CA  . SER A 1 41  ? 29.524  22.948  -28.839 1.00 79.21  ? 41  SER A CA  1 
ATOM   325  C C   . SER A 1 41  ? 29.593  21.459  -28.940 1.00 79.86  ? 41  SER A C   1 
ATOM   326  O O   . SER A 1 41  ? 28.861  20.768  -28.238 1.00 80.25  ? 41  SER A O   1 
ATOM   327  C CB  . SER A 1 41  ? 30.464  23.459  -27.746 1.00 82.68  ? 41  SER A CB  1 
ATOM   328  O OG  . SER A 1 41  ? 29.804  23.711  -26.520 1.00 96.97  ? 41  SER A OG  1 
ATOM   329  N N   . LEU A 1 42  ? 30.432  20.955  -29.852 1.00 73.32  ? 42  LEU A N   1 
ATOM   330  C CA  . LEU A 1 42  ? 30.595  19.527  -30.051 1.00 72.24  ? 42  LEU A CA  1 
ATOM   331  C C   . LEU A 1 42  ? 31.028  18.896  -28.730 1.00 78.86  ? 42  LEU A C   1 
ATOM   332  O O   . LEU A 1 42  ? 31.957  19.390  -28.101 1.00 79.96  ? 42  LEU A O   1 
ATOM   333  C CB  . LEU A 1 42  ? 31.595  19.239  -31.184 1.00 71.37  ? 42  LEU A CB  1 
ATOM   334  C CG  . LEU A 1 42  ? 31.639  17.791  -31.722 1.00 75.86  ? 42  LEU A CG  1 
ATOM   335  C CD1 . LEU A 1 42  ? 30.232  17.219  -31.996 1.00 77.12  ? 42  LEU A CD1 1 
ATOM   336  C CD2 . LEU A 1 42  ? 32.501  17.686  -32.956 1.00 75.32  ? 42  LEU A CD2 1 
ATOM   337  N N   . PHE A 1 43  ? 30.294  17.877  -28.271 1.00 75.71  ? 43  PHE A N   1 
ATOM   338  C CA  . PHE A 1 43  ? 30.541  17.172  -27.011 1.00 75.95  ? 43  PHE A CA  1 
ATOM   339  C C   . PHE A 1 43  ? 31.098  15.782  -27.263 1.00 77.06  ? 43  PHE A C   1 
ATOM   340  O O   . PHE A 1 43  ? 32.091  15.397  -26.644 1.00 78.21  ? 43  PHE A O   1 
ATOM   341  C CB  . PHE A 1 43  ? 29.225  17.057  -26.228 1.00 78.98  ? 43  PHE A CB  1 
ATOM   342  C CG  . PHE A 1 43  ? 29.326  16.608  -24.790 1.00 82.06  ? 43  PHE A CG  1 
ATOM   343  C CD1 . PHE A 1 43  ? 29.828  17.462  -23.810 1.00 86.21  ? 43  PHE A CD1 1 
ATOM   344  C CD2 . PHE A 1 43  ? 28.826  15.371  -24.396 1.00 85.49  ? 43  PHE A CD2 1 
ATOM   345  C CE1 . PHE A 1 43  ? 29.867  17.069  -22.466 1.00 87.83  ? 43  PHE A CE1 1 
ATOM   346  C CE2 . PHE A 1 43  ? 28.860  14.977  -23.052 1.00 88.88  ? 43  PHE A CE2 1 
ATOM   347  C CZ  . PHE A 1 43  ? 29.380  15.832  -22.096 1.00 87.25  ? 43  PHE A CZ  1 
ATOM   348  N N   . ALA A 1 44  ? 30.427  15.018  -28.151 1.00 69.26  ? 44  ALA A N   1 
ATOM   349  C CA  . ALA A 1 44  ? 30.773  13.664  -28.536 1.00 66.60  ? 44  ALA A CA  1 
ATOM   350  C C   . ALA A 1 44  ? 30.313  13.331  -29.955 1.00 70.90  ? 44  ALA A C   1 
ATOM   351  O O   . ALA A 1 44  ? 29.396  13.946  -30.501 1.00 69.84  ? 44  ALA A O   1 
ATOM   352  C CB  . ALA A 1 44  ? 30.199  12.677  -27.550 1.00 66.63  ? 44  ALA A CB  1 
ATOM   353  N N   . VAL A 1 45  ? 31.017  12.363  -30.557 1.00 68.94  ? 45  VAL A N   1 
ATOM   354  C CA  . VAL A 1 45  ? 30.852  11.830  -31.913 1.00 68.33  ? 45  VAL A CA  1 
ATOM   355  C C   . VAL A 1 45  ? 30.883  10.287  -31.848 1.00 80.81  ? 45  VAL A C   1 
ATOM   356  O O   . VAL A 1 45  ? 31.739  9.703   -31.154 1.00 81.43  ? 45  VAL A O   1 
ATOM   357  C CB  . VAL A 1 45  ? 31.973  12.359  -32.835 1.00 68.00  ? 45  VAL A CB  1 
ATOM   358  C CG1 . VAL A 1 45  ? 32.098  11.534  -34.108 1.00 66.27  ? 45  VAL A CG1 1 
ATOM   359  C CG2 . VAL A 1 45  ? 31.769  13.830  -33.144 1.00 67.57  ? 45  VAL A CG2 1 
ATOM   360  N N   . ASP A 1 46  ? 29.941  9.638   -32.563 1.00 80.94  ? 46  ASP A N   1 
ATOM   361  C CA  . ASP A 1 46  ? 29.911  8.196   -32.702 1.00 81.90  ? 46  ASP A CA  1 
ATOM   362  C C   . ASP A 1 46  ? 29.848  7.867   -34.158 1.00 87.10  ? 46  ASP A C   1 
ATOM   363  O O   . ASP A 1 46  ? 28.935  8.306   -34.867 1.00 86.26  ? 46  ASP A O   1 
ATOM   364  C CB  . ASP A 1 46  ? 28.768  7.525   -31.950 1.00 84.36  ? 46  ASP A CB  1 
ATOM   365  C CG  . ASP A 1 46  ? 28.978  6.029   -31.728 1.00 104.42 ? 46  ASP A CG  1 
ATOM   366  O OD1 . ASP A 1 46  ? 29.989  5.479   -32.239 1.00 108.41 ? 46  ASP A OD1 1 
ATOM   367  O OD2 . ASP A 1 46  ? 28.155  5.413   -31.020 1.00 112.03 ? 46  ASP A OD2 1 
ATOM   368  N N   . ARG A 1 47  ? 30.850  7.114   -34.609 1.00 85.00  ? 47  ARG A N   1 
ATOM   369  C CA  . ARG A 1 47  ? 30.960  6.676   -35.989 1.00 85.35  ? 47  ARG A CA  1 
ATOM   370  C C   . ARG A 1 47  ? 30.608  5.183   -36.030 1.00 91.60  ? 47  ARG A C   1 
ATOM   371  O O   . ARG A 1 47  ? 31.414  4.377   -35.580 1.00 91.51  ? 47  ARG A O   1 
ATOM   372  C CB  . ARG A 1 47  ? 32.343  7.043   -36.555 1.00 83.70  ? 47  ARG A CB  1 
ATOM   373  C CG  . ARG A 1 47  ? 32.393  8.516   -36.973 1.00 87.00  ? 47  ARG A CG  1 
ATOM   374  C CD  . ARG A 1 47  ? 33.679  8.924   -37.636 1.00 82.79  ? 47  ARG A CD  1 
ATOM   375  N NE  . ARG A 1 47  ? 34.664  9.355   -36.652 1.00 89.29  ? 47  ARG A NE  1 
ATOM   376  C CZ  . ARG A 1 47  ? 35.086  10.607  -36.508 1.00 102.49 ? 47  ARG A CZ  1 
ATOM   377  N NH1 . ARG A 1 47  ? 34.608  11.566  -37.293 1.00 73.98  ? 47  ARG A NH1 1 
ATOM   378  N NH2 . ARG A 1 47  ? 35.990  10.911  -35.585 1.00 101.14 ? 47  ARG A NH2 1 
ATOM   379  N N   . PRO A 1 48  ? 29.345  4.820   -36.388 1.00 90.37  ? 48  PRO A N   1 
ATOM   380  C CA  . PRO A 1 48  ? 28.927  3.404   -36.322 1.00 91.89  ? 48  PRO A CA  1 
ATOM   381  C C   . PRO A 1 48  ? 29.783  2.529   -37.207 1.00 100.18 ? 48  PRO A C   1 
ATOM   382  O O   . PRO A 1 48  ? 29.662  2.678   -38.423 1.00 100.72 ? 48  PRO A O   1 
ATOM   383  C CB  . PRO A 1 48  ? 27.473  3.441   -36.822 1.00 93.42  ? 48  PRO A CB  1 
ATOM   384  C CG  . PRO A 1 48  ? 27.034  4.834   -36.685 1.00 96.55  ? 48  PRO A CG  1 
ATOM   385  C CD  . PRO A 1 48  ? 28.246  5.674   -36.884 1.00 91.77  ? 48  PRO A CD  1 
ATOM   386  N N   . LYS A 1 49  ? 30.687  1.683   -36.623 1.00 99.37  ? 49  LYS A N   1 
ATOM   387  C CA  . LYS A 1 49  ? 31.628  0.892   -37.428 1.00 100.63 ? 49  LYS A CA  1 
ATOM   388  C C   . LYS A 1 49  ? 30.876  0.224   -38.583 1.00 110.70 ? 49  LYS A C   1 
ATOM   389  O O   . LYS A 1 49  ? 31.094  0.728   -39.676 1.00 113.79 ? 49  LYS A O   1 
ATOM   390  C CB  . LYS A 1 49  ? 32.540  -0.044  -36.643 1.00 102.38 ? 49  LYS A CB  1 
ATOM   391  C CG  . LYS A 1 49  ? 33.681  0.658   -35.909 1.00 118.44 ? 49  LYS A CG  1 
ATOM   392  C CD  . LYS A 1 49  ? 34.344  -0.350  -34.909 1.00 137.95 ? 49  LYS A CD  1 
ATOM   393  C CE  . LYS A 1 49  ? 34.557  0.142   -33.477 1.00 140.55 ? 49  LYS A CE  1 
ATOM   394  N NZ  . LYS A 1 49  ? 35.168  -0.902  -32.602 1.00 135.83 ? 49  LYS A NZ  1 
ATOM   395  N N   . PRO A 1 50  ? 29.872  -0.678  -38.465 1.00 107.22 ? 50  PRO A N   1 
ATOM   396  C CA  . PRO A 1 50  ? 29.114  -1.045  -39.684 1.00 106.79 ? 50  PRO A CA  1 
ATOM   397  C C   . PRO A 1 50  ? 27.964  0.002   -39.829 1.00 109.35 ? 50  PRO A C   1 
ATOM   398  O O   . PRO A 1 50  ? 27.042  0.017   -39.005 1.00 109.60 ? 50  PRO A O   1 
ATOM   399  C CB  . PRO A 1 50  ? 28.657  -2.478  -39.402 1.00 108.39 ? 50  PRO A CB  1 
ATOM   400  C CG  . PRO A 1 50  ? 28.760  -2.635  -37.888 1.00 113.05 ? 50  PRO A CG  1 
ATOM   401  C CD  . PRO A 1 50  ? 29.350  -1.386  -37.283 1.00 108.59 ? 50  PRO A CD  1 
ATOM   402  N N   . PRO A 1 51  ? 28.046  0.997   -40.744 1.00 103.51 ? 51  PRO A N   1 
ATOM   403  C CA  . PRO A 1 51  ? 27.032  2.050   -40.748 1.00 102.96 ? 51  PRO A CA  1 
ATOM   404  C C   . PRO A 1 51  ? 25.675  1.631   -41.272 1.00 107.47 ? 51  PRO A C   1 
ATOM   405  O O   . PRO A 1 51  ? 24.676  2.085   -40.721 1.00 107.94 ? 51  PRO A O   1 
ATOM   406  C CB  . PRO A 1 51  ? 27.673  3.160   -41.591 1.00 104.38 ? 51  PRO A CB  1 
ATOM   407  C CG  . PRO A 1 51  ? 29.095  2.750   -41.785 1.00 108.43 ? 51  PRO A CG  1 
ATOM   408  C CD  . PRO A 1 51  ? 29.053  1.269   -41.780 1.00 104.45 ? 51  PRO A CD  1 
ATOM   409  N N   . GLU A 1 52  ? 25.625  0.772   -42.314 1.00 103.51 ? 52  GLU A N   1 
ATOM   410  C CA  . GLU A 1 52  ? 24.365  0.308   -42.909 1.00 102.48 ? 52  GLU A CA  1 
ATOM   411  C C   . GLU A 1 52  ? 23.623  -0.608  -41.978 1.00 102.39 ? 52  GLU A C   1 
ATOM   412  O O   . GLU A 1 52  ? 22.412  -0.775  -42.115 1.00 102.38 ? 52  GLU A O   1 
ATOM   413  C CB  . GLU A 1 52  ? 24.558  -0.330  -44.300 1.00 104.14 ? 52  GLU A CB  1 
ATOM   414  C CG  . GLU A 1 52  ? 25.095  -1.755  -44.300 1.00 116.56 ? 52  GLU A CG  1 
ATOM   415  C CD  . GLU A 1 52  ? 26.599  -1.952  -44.368 1.00 146.42 ? 52  GLU A CD  1 
ATOM   416  O OE1 . GLU A 1 52  ? 27.340  -0.970  -44.617 1.00 140.63 ? 52  GLU A OE1 1 
ATOM   417  O OE2 . GLU A 1 52  ? 27.032  -3.115  -44.193 1.00 144.66 ? 52  GLU A OE2 1 
ATOM   418  N N   . ARG A 1 53  ? 24.348  -1.166  -41.008 1.00 96.15  ? 53  ARG A N   1 
ATOM   419  C CA  . ARG A 1 53  ? 23.823  -2.096  -40.017 1.00 94.52  ? 53  ARG A CA  1 
ATOM   420  C C   . ARG A 1 53  ? 23.235  -1.397  -38.770 1.00 95.44  ? 53  ARG A C   1 
ATOM   421  O O   . ARG A 1 53  ? 22.572  -2.055  -37.968 1.00 94.71  ? 53  ARG A O   1 
ATOM   422  C CB  . ARG A 1 53  ? 24.915  -3.126  -39.648 1.00 92.86  ? 53  ARG A CB  1 
ATOM   423  N N   . ILE A 1 54  ? 23.439  -0.066  -38.638 1.00 90.34  ? 54  ILE A N   1 
ATOM   424  C CA  . ILE A 1 54  ? 23.021  0.724   -37.473 1.00 89.33  ? 54  ILE A CA  1 
ATOM   425  C C   . ILE A 1 54  ? 22.161  1.953   -37.834 1.00 94.08  ? 54  ILE A C   1 
ATOM   426  O O   . ILE A 1 54  ? 22.449  2.653   -38.806 1.00 94.30  ? 54  ILE A O   1 
ATOM   427  C CB  . ILE A 1 54  ? 24.312  1.111   -36.676 1.00 91.52  ? 54  ILE A CB  1 
ATOM   428  C CG1 . ILE A 1 54  ? 24.875  -0.079  -35.891 1.00 91.36  ? 54  ILE A CG1 1 
ATOM   429  C CG2 . ILE A 1 54  ? 24.138  2.322   -35.775 1.00 91.33  ? 54  ILE A CG2 1 
ATOM   430  C CD1 . ILE A 1 54  ? 26.352  0.002   -35.668 1.00 95.39  ? 54  ILE A CD1 1 
ATOM   431  N N   . ASN A 1 55  ? 21.160  2.251   -36.976 1.00 89.78  ? 55  ASN A N   1 
ATOM   432  C CA  . ASN A 1 55  ? 20.249  3.401   -37.062 1.00 88.24  ? 55  ASN A CA  1 
ATOM   433  C C   . ASN A 1 55  ? 20.227  4.189   -35.713 1.00 89.79  ? 55  ASN A C   1 
ATOM   434  O O   . ASN A 1 55  ? 19.519  5.188   -35.622 1.00 90.46  ? 55  ASN A O   1 
ATOM   435  C CB  . ASN A 1 55  ? 18.833  2.915   -37.416 1.00 87.68  ? 55  ASN A CB  1 
ATOM   436  C CG  . ASN A 1 55  ? 18.266  1.958   -36.381 1.00 106.56 ? 55  ASN A CG  1 
ATOM   437  O OD1 . ASN A 1 55  ? 18.884  0.946   -36.016 1.00 97.53  ? 55  ASN A OD1 1 
ATOM   438  N ND2 . ASN A 1 55  ? 17.090  2.258   -35.871 1.00 99.20  ? 55  ASN A ND2 1 
ATOM   439  N N   . LYS A 1 56  ? 20.994  3.753   -34.682 1.00 83.72  ? 56  LYS A N   1 
ATOM   440  C CA  . LYS A 1 56  ? 21.026  4.401   -33.355 1.00 82.79  ? 56  LYS A CA  1 
ATOM   441  C C   . LYS A 1 56  ? 22.422  4.346   -32.677 1.00 84.28  ? 56  LYS A C   1 
ATOM   442  O O   . LYS A 1 56  ? 23.253  3.495   -32.968 1.00 81.88  ? 56  LYS A O   1 
ATOM   443  C CB  . LYS A 1 56  ? 19.906  3.831   -32.445 1.00 85.51  ? 56  LYS A CB  1 
ATOM   444  C CG  . LYS A 1 56  ? 19.863  4.316   -30.987 1.00 104.01 ? 56  LYS A CG  1 
ATOM   445  C CD  . LYS A 1 56  ? 19.627  3.120   -30.037 1.00 119.36 ? 56  LYS A CD  1 
ATOM   446  C CE  . LYS A 1 56  ? 19.720  3.464   -28.561 1.00 126.63 ? 56  LYS A CE  1 
ATOM   447  N NZ  . LYS A 1 56  ? 19.283  2.334   -27.684 1.00 127.45 ? 56  LYS A NZ  1 
ATOM   448  N N   . VAL A 1 57  ? 22.657  5.280   -31.767 1.00 81.88  ? 57  VAL A N   1 
ATOM   449  C CA  . VAL A 1 57  ? 23.924  5.456   -31.069 1.00 81.92  ? 57  VAL A CA  1 
ATOM   450  C C   . VAL A 1 57  ? 23.707  5.721   -29.579 1.00 84.32  ? 57  VAL A C   1 
ATOM   451  O O   . VAL A 1 57  ? 22.708  6.331   -29.187 1.00 84.03  ? 57  VAL A O   1 
ATOM   452  C CB  . VAL A 1 57  ? 24.723  6.590   -31.777 1.00 86.67  ? 57  VAL A CB  1 
ATOM   453  C CG1 . VAL A 1 57  ? 25.566  7.389   -30.809 1.00 86.79  ? 57  VAL A CG1 1 
ATOM   454  C CG2 . VAL A 1 57  ? 25.580  6.038   -32.906 1.00 86.57  ? 57  VAL A CG2 1 
ATOM   455  N N   . LYS A 1 58  ? 24.655  5.276   -28.754 1.00 80.22  ? 58  LYS A N   1 
ATOM   456  C CA  . LYS A 1 58  ? 24.566  5.457   -27.313 1.00 79.66  ? 58  LYS A CA  1 
ATOM   457  C C   . LYS A 1 58  ? 25.746  6.253   -26.819 1.00 84.70  ? 58  LYS A C   1 
ATOM   458  O O   . LYS A 1 58  ? 26.881  5.963   -27.202 1.00 85.99  ? 58  LYS A O   1 
ATOM   459  C CB  . LYS A 1 58  ? 24.445  4.094   -26.614 1.00 81.09  ? 58  LYS A CB  1 
ATOM   460  C CG  . LYS A 1 58  ? 23.032  3.514   -26.693 1.00 90.73  ? 58  LYS A CG  1 
ATOM   461  C CD  . LYS A 1 58  ? 22.998  2.017   -26.416 1.00 108.17 ? 58  LYS A CD  1 
ATOM   462  C CE  . LYS A 1 58  ? 23.149  1.156   -27.660 1.00 129.00 ? 58  LYS A CE  1 
ATOM   463  N NZ  . LYS A 1 58  ? 24.573  0.912   -28.039 1.00 137.06 ? 58  LYS A NZ  1 
ATOM   464  N N   . PHE A 1 59  ? 25.466  7.325   -26.066 1.00 80.60  ? 59  PHE A N   1 
ATOM   465  C CA  . PHE A 1 59  ? 26.466  8.211   -25.462 1.00 80.58  ? 59  PHE A CA  1 
ATOM   466  C C   . PHE A 1 59  ? 26.259  8.089   -23.948 1.00 89.96  ? 59  PHE A C   1 
ATOM   467  O O   . PHE A 1 59  ? 25.137  8.254   -23.476 1.00 89.20  ? 59  PHE A O   1 
ATOM   468  C CB  . PHE A 1 59  ? 26.254  9.674   -25.918 1.00 81.15  ? 59  PHE A CB  1 
ATOM   469  C CG  . PHE A 1 59  ? 26.400  9.972   -27.406 1.00 82.17  ? 59  PHE A CG  1 
ATOM   470  C CD1 . PHE A 1 59  ? 27.657  10.075  -27.995 1.00 83.94  ? 59  PHE A CD1 1 
ATOM   471  C CD2 . PHE A 1 59  ? 25.281  10.224  -28.199 1.00 82.78  ? 59  PHE A CD2 1 
ATOM   472  C CE1 . PHE A 1 59  ? 27.790  10.387  -29.346 1.00 83.27  ? 59  PHE A CE1 1 
ATOM   473  C CE2 . PHE A 1 59  ? 25.419  10.549  -29.546 1.00 83.63  ? 59  PHE A CE2 1 
ATOM   474  C CZ  . PHE A 1 59  ? 26.672  10.622  -30.108 1.00 81.63  ? 59  PHE A CZ  1 
ATOM   475  N N   . TYR A 1 60  ? 27.273  7.742   -23.174 1.00 90.44  ? 60  TYR A N   1 
ATOM   476  C CA  . TYR A 1 60  ? 26.928  7.649   -21.765 1.00 92.36  ? 60  TYR A CA  1 
ATOM   477  C C   . TYR A 1 60  ? 27.816  8.478   -20.856 1.00 93.49  ? 60  TYR A C   1 
ATOM   478  O O   . TYR A 1 60  ? 29.027  8.525   -21.060 1.00 94.26  ? 60  TYR A O   1 
ATOM   479  C CB  . TYR A 1 60  ? 26.850  6.183   -21.289 1.00 97.47  ? 60  TYR A CB  1 
ATOM   480  C CG  . TYR A 1 60  ? 28.172  5.444   -21.245 1.00 105.26 ? 60  TYR A CG  1 
ATOM   481  C CD1 . TYR A 1 60  ? 28.689  4.831   -22.387 1.00 109.42 ? 60  TYR A CD1 1 
ATOM   482  C CD2 . TYR A 1 60  ? 28.884  5.309   -20.050 1.00 106.95 ? 60  TYR A CD2 1 
ATOM   483  C CE1 . TYR A 1 60  ? 29.903  4.135   -22.351 1.00 113.51 ? 60  TYR A CE1 1 
ATOM   484  C CE2 . TYR A 1 60  ? 30.105  4.629   -20.003 1.00 108.67 ? 60  TYR A CE2 1 
ATOM   485  C CZ  . TYR A 1 60  ? 30.611  4.040   -21.158 1.00 120.84 ? 60  TYR A CZ  1 
ATOM   486  O OH  . TYR A 1 60  ? 31.810  3.357   -21.129 1.00 122.89 ? 60  TYR A OH  1 
ATOM   487  N N   . ILE A 1 61  ? 27.206  9.120   -19.845 1.00 86.83  ? 61  ILE A N   1 
ATOM   488  C CA  . ILE A 1 61  ? 27.897  9.875   -18.799 1.00 85.85  ? 61  ILE A CA  1 
ATOM   489  C C   . ILE A 1 61  ? 28.024  8.912   -17.601 1.00 89.88  ? 61  ILE A C   1 
ATOM   490  O O   . ILE A 1 61  ? 27.009  8.331   -17.188 1.00 89.76  ? 61  ILE A O   1 
ATOM   491  C CB  . ILE A 1 61  ? 27.140  11.171  -18.422 1.00 88.68  ? 61  ILE A CB  1 
ATOM   492  C CG1 . ILE A 1 61  ? 27.236  12.265  -19.520 1.00 88.16  ? 61  ILE A CG1 1 
ATOM   493  C CG2 . ILE A 1 61  ? 27.593  11.701  -17.065 1.00 89.56  ? 61  ILE A CG2 1 
ATOM   494  C CD1 . ILE A 1 61  ? 26.154  12.247  -20.588 1.00 82.80  ? 61  ILE A CD1 1 
ATOM   495  N N   . PRO A 1 62  ? 29.239  8.690   -17.044 1.00 86.12  ? 62  PRO A N   1 
ATOM   496  C CA  . PRO A 1 62  ? 29.366  7.720   -15.943 1.00 86.17  ? 62  PRO A CA  1 
ATOM   497  C C   . PRO A 1 62  ? 28.995  8.277   -14.552 1.00 91.81  ? 62  PRO A C   1 
ATOM   498  O O   . PRO A 1 62  ? 28.409  7.551   -13.729 1.00 91.62  ? 62  PRO A O   1 
ATOM   499  C CB  . PRO A 1 62  ? 30.821  7.242   -16.054 1.00 87.37  ? 62  PRO A CB  1 
ATOM   500  C CG  . PRO A 1 62  ? 31.540  8.296   -16.831 1.00 91.34  ? 62  PRO A CG  1 
ATOM   501  C CD  . PRO A 1 62  ? 30.547  9.278   -17.391 1.00 87.28  ? 62  PRO A CD  1 
ATOM   502  N N   . ASP A 1 63  ? 29.338  9.563   -14.288 1.00 87.64  ? 63  ASP A N   1 
ATOM   503  C CA  . ASP A 1 63  ? 29.029  10.274  -13.046 1.00 86.71  ? 63  ASP A CA  1 
ATOM   504  C C   . ASP A 1 63  ? 28.431  11.577  -13.504 1.00 87.43  ? 63  ASP A C   1 
ATOM   505  O O   . ASP A 1 63  ? 29.067  12.297  -14.274 1.00 87.52  ? 63  ASP A O   1 
ATOM   506  C CB  . ASP A 1 63  ? 30.298  10.520  -12.219 1.00 89.38  ? 63  ASP A CB  1 
ATOM   507  C CG  . ASP A 1 63  ? 30.953  9.246   -11.725 1.00 112.03 ? 63  ASP A CG  1 
ATOM   508  O OD1 . ASP A 1 63  ? 30.510  8.722   -10.664 1.00 117.58 ? 63  ASP A OD1 1 
ATOM   509  O OD2 . ASP A 1 63  ? 31.916  8.761   -12.399 1.00 114.57 ? 63  ASP A OD2 1 
ATOM   510  N N   . MET A 1 64  ? 27.179  11.838  -13.117 1.00 80.85  ? 64  MET A N   1 
ATOM   511  C CA  . MET A 1 64  ? 26.469  13.031  -13.543 1.00 79.04  ? 64  MET A CA  1 
ATOM   512  C C   . MET A 1 64  ? 26.760  14.182  -12.606 1.00 82.97  ? 64  MET A C   1 
ATOM   513  O O   . MET A 1 64  ? 26.612  14.065  -11.395 1.00 82.35  ? 64  MET A O   1 
ATOM   514  C CB  . MET A 1 64  ? 24.964  12.744  -13.701 1.00 80.81  ? 64  MET A CB  1 
ATOM   515  C CG  . MET A 1 64  ? 24.092  13.970  -13.886 1.00 83.65  ? 64  MET A CG  1 
ATOM   516  S SD  . MET A 1 64  ? 24.426  14.806  -15.430 1.00 87.12  ? 64  MET A SD  1 
ATOM   517  C CE  . MET A 1 64  ? 22.910  15.557  -15.702 1.00 83.91  ? 64  MET A CE  1 
ATOM   518  N N   . ASN A 1 65  ? 27.177  15.301  -13.178 1.00 80.30  ? 65  ASN A N   1 
ATOM   519  C CA  . ASN A 1 65  ? 27.504  16.516  -12.445 1.00 80.12  ? 65  ASN A CA  1 
ATOM   520  C C   . ASN A 1 65  ? 26.789  17.722  -13.077 1.00 83.82  ? 65  ASN A C   1 
ATOM   521  O O   . ASN A 1 65  ? 26.151  17.583  -14.121 1.00 83.25  ? 65  ASN A O   1 
ATOM   522  C CB  . ASN A 1 65  ? 29.038  16.717  -12.443 1.00 81.98  ? 65  ASN A CB  1 
ATOM   523  C CG  . ASN A 1 65  ? 29.679  16.706  -13.817 1.00 90.56  ? 65  ASN A CG  1 
ATOM   524  O OD1 . ASN A 1 65  ? 29.135  17.238  -14.784 1.00 91.26  ? 65  ASN A OD1 1 
ATOM   525  N ND2 . ASN A 1 65  ? 30.846  16.088  -13.940 1.00 70.96  ? 65  ASN A ND2 1 
ATOM   526  N N   . SER A 1 66  ? 26.935  18.901  -12.463 1.00 80.54  ? 66  SER A N   1 
ATOM   527  C CA  . SER A 1 66  ? 26.401  20.180  -12.935 1.00 79.88  ? 66  SER A CA  1 
ATOM   528  C C   . SER A 1 66  ? 27.073  20.587  -14.236 1.00 84.77  ? 66  SER A C   1 
ATOM   529  O O   . SER A 1 66  ? 26.430  21.163  -15.115 1.00 84.30  ? 66  SER A O   1 
ATOM   530  C CB  . SER A 1 66  ? 26.655  21.259  -11.888 1.00 81.25  ? 66  SER A CB  1 
ATOM   531  O OG  . SER A 1 66  ? 28.040  21.466  -11.653 1.00 82.62  ? 66  SER A OG  1 
ATOM   532  N N   . ARG A 1 67  ? 28.375  20.281  -14.349 1.00 82.72  ? 67  ARG A N   1 
ATOM   533  C CA  . ARG A 1 67  ? 29.224  20.580  -15.498 1.00 83.76  ? 67  ARG A CA  1 
ATOM   534  C C   . ARG A 1 67  ? 28.650  19.980  -16.796 1.00 88.24  ? 67  ARG A C   1 
ATOM   535  O O   . ARG A 1 67  ? 28.973  20.476  -17.868 1.00 89.08  ? 67  ARG A O   1 
ATOM   536  C CB  . ARG A 1 67  ? 30.658  20.057  -15.235 1.00 87.00  ? 67  ARG A CB  1 
ATOM   537  C CG  . ARG A 1 67  ? 31.818  20.739  -15.986 1.00 100.51 ? 67  ARG A CG  1 
ATOM   538  C CD  . ARG A 1 67  ? 33.089  19.882  -15.977 1.00 119.36 ? 67  ARG A CD  1 
ATOM   539  N NE  . ARG A 1 67  ? 33.488  19.444  -14.623 1.00 136.14 ? 67  ARG A NE  1 
ATOM   540  C CZ  . ARG A 1 67  ? 34.334  18.443  -14.354 1.00 151.31 ? 67  ARG A CZ  1 
ATOM   541  N NH1 . ARG A 1 67  ? 34.897  17.753  -15.342 1.00 142.90 ? 67  ARG A NH1 1 
ATOM   542  N NH2 . ARG A 1 67  ? 34.621  18.128  -13.099 1.00 132.45 ? 67  ARG A NH2 1 
ATOM   543  N N   . MET A 1 68  ? 27.798  18.940  -16.705 1.00 84.46  ? 68  MET A N   1 
ATOM   544  C CA  . MET A 1 68  ? 27.198  18.280  -17.876 1.00 83.88  ? 68  MET A CA  1 
ATOM   545  C C   . MET A 1 68  ? 25.665  18.349  -17.892 1.00 86.42  ? 68  MET A C   1 
ATOM   546  O O   . MET A 1 68  ? 25.008  17.584  -18.604 1.00 85.59  ? 68  MET A O   1 
ATOM   547  C CB  . MET A 1 68  ? 27.704  16.849  -18.010 1.00 86.08  ? 68  MET A CB  1 
ATOM   548  C CG  . MET A 1 68  ? 29.167  16.797  -18.236 1.00 90.03  ? 68  MET A CG  1 
ATOM   549  S SD  . MET A 1 68  ? 29.643  15.115  -18.543 1.00 95.51  ? 68  MET A SD  1 
ATOM   550  C CE  . MET A 1 68  ? 29.889  14.528  -16.893 1.00 93.07  ? 68  MET A CE  1 
ATOM   551  N N   . ALA A 1 69  ? 25.109  19.288  -17.116 1.00 81.68  ? 69  ALA A N   1 
ATOM   552  C CA  . ALA A 1 69  ? 23.675  19.528  -17.045 1.00 80.64  ? 69  ALA A CA  1 
ATOM   553  C C   . ALA A 1 69  ? 23.389  20.663  -18.017 1.00 83.96  ? 69  ALA A C   1 
ATOM   554  O O   . ALA A 1 69  ? 24.147  21.632  -18.067 1.00 83.50  ? 69  ALA A O   1 
ATOM   555  C CB  . ALA A 1 69  ? 23.274  19.918  -15.629 1.00 81.19  ? 69  ALA A CB  1 
ATOM   556  N N   . GLY A 1 70  ? 22.346  20.504  -18.821 1.00 80.76  ? 70  GLY A N   1 
ATOM   557  C CA  . GLY A 1 70  ? 21.970  21.489  -19.824 1.00 80.64  ? 70  GLY A CA  1 
ATOM   558  C C   . GLY A 1 70  ? 21.278  20.924  -21.047 1.00 84.71  ? 70  GLY A C   1 
ATOM   559  O O   . GLY A 1 70  ? 20.709  19.826  -20.999 1.00 83.93  ? 70  GLY A O   1 
ATOM   560  N N   . GLN A 1 71  ? 21.372  21.670  -22.172 1.00 81.36  ? 71  GLN A N   1 
ATOM   561  C CA  . GLN A 1 71  ? 20.714  21.337  -23.431 1.00 80.74  ? 71  GLN A CA  1 
ATOM   562  C C   . GLN A 1 71  ? 21.583  20.558  -24.424 1.00 82.35  ? 71  GLN A C   1 
ATOM   563  O O   . GLN A 1 71  ? 22.703  20.941  -24.754 1.00 81.18  ? 71  GLN A O   1 
ATOM   564  C CB  . GLN A 1 71  ? 20.104  22.578  -24.068 1.00 82.19  ? 71  GLN A CB  1 
ATOM   565  C CG  . GLN A 1 71  ? 18.878  23.016  -23.298 1.00 103.97 ? 71  GLN A CG  1 
ATOM   566  C CD  . GLN A 1 71  ? 18.380  24.365  -23.712 1.00 123.94 ? 71  GLN A CD  1 
ATOM   567  O OE1 . GLN A 1 71  ? 17.561  24.488  -24.630 1.00 120.86 ? 71  GLN A OE1 1 
ATOM   568  N NE2 . GLN A 1 71  ? 18.855  25.402  -23.029 1.00 109.43 ? 71  GLN A NE2 1 
ATOM   569  N N   . TYR A 1 72  ? 21.006  19.447  -24.897 1.00 78.85  ? 72  TYR A N   1 
ATOM   570  C CA  . TYR A 1 72  ? 21.583  18.476  -25.813 1.00 78.81  ? 72  TYR A CA  1 
ATOM   571  C C   . TYR A 1 72  ? 20.762  18.353  -27.084 1.00 83.34  ? 72  TYR A C   1 
ATOM   572  O O   . TYR A 1 72  ? 19.531  18.278  -27.029 1.00 83.37  ? 72  TYR A O   1 
ATOM   573  C CB  . TYR A 1 72  ? 21.687  17.087  -25.135 1.00 79.53  ? 72  TYR A CB  1 
ATOM   574  C CG  . TYR A 1 72  ? 22.750  16.986  -24.063 1.00 80.55  ? 72  TYR A CG  1 
ATOM   575  C CD1 . TYR A 1 72  ? 24.050  16.604  -24.380 1.00 82.53  ? 72  TYR A CD1 1 
ATOM   576  C CD2 . TYR A 1 72  ? 22.455  17.242  -22.733 1.00 81.28  ? 72  TYR A CD2 1 
ATOM   577  C CE1 . TYR A 1 72  ? 25.027  16.481  -23.388 1.00 83.37  ? 72  TYR A CE1 1 
ATOM   578  C CE2 . TYR A 1 72  ? 23.419  17.131  -21.740 1.00 82.32  ? 72  TYR A CE2 1 
ATOM   579  C CZ  . TYR A 1 72  ? 24.707  16.750  -22.072 1.00 91.55  ? 72  TYR A CZ  1 
ATOM   580  O OH  . TYR A 1 72  ? 25.670  16.687  -21.094 1.00 95.61  ? 72  TYR A OH  1 
ATOM   581  N N   . SER A 1 73  ? 21.448  18.306  -28.228 1.00 79.48  ? 73  SER A N   1 
ATOM   582  C CA  . SER A 1 73  ? 20.810  18.076  -29.519 1.00 79.11  ? 73  SER A CA  1 
ATOM   583  C C   . SER A 1 73  ? 21.645  17.070  -30.276 1.00 84.44  ? 73  SER A C   1 
ATOM   584  O O   . SER A 1 73  ? 22.838  16.921  -29.985 1.00 81.88  ? 73  SER A O   1 
ATOM   585  C CB  . SER A 1 73  ? 20.592  19.372  -30.295 1.00 81.30  ? 73  SER A CB  1 
ATOM   586  O OG  . SER A 1 73  ? 21.778  20.121  -30.480 1.00 88.81  ? 73  SER A OG  1 
ATOM   587  N N   . CYS A 1 74  ? 21.002  16.316  -31.177 1.00 85.12  ? 74  CYS A N   1 
ATOM   588  C CA  . CYS A 1 74  ? 21.646  15.276  -31.963 1.00 87.37  ? 74  CYS A CA  1 
ATOM   589  C C   . CYS A 1 74  ? 21.628  15.536  -33.472 1.00 89.93  ? 74  CYS A C   1 
ATOM   590  O O   . CYS A 1 74  ? 20.611  15.984  -34.008 1.00 91.49  ? 74  CYS A O   1 
ATOM   591  C CB  . CYS A 1 74  ? 21.081  13.907  -31.634 1.00 90.13  ? 74  CYS A CB  1 
ATOM   592  S SG  . CYS A 1 74  ? 22.116  12.572  -32.260 1.00 95.97  ? 74  CYS A SG  1 
ATOM   593  N N   . ILE A 1 75  ? 22.748  15.239  -34.165 1.00 82.75  ? 75  ILE A N   1 
ATOM   594  C CA  . ILE A 1 75  ? 22.914  15.482  -35.611 1.00 80.89  ? 75  ILE A CA  1 
ATOM   595  C C   . ILE A 1 75  ? 23.671  14.317  -36.200 1.00 83.21  ? 75  ILE A C   1 
ATOM   596  O O   . ILE A 1 75  ? 24.580  13.836  -35.546 1.00 82.43  ? 75  ILE A O   1 
ATOM   597  C CB  . ILE A 1 75  ? 23.635  16.864  -35.804 1.00 83.29  ? 75  ILE A CB  1 
ATOM   598  C CG1 . ILE A 1 75  ? 22.639  17.974  -35.952 1.00 85.35  ? 75  ILE A CG1 1 
ATOM   599  C CG2 . ILE A 1 75  ? 24.636  16.947  -36.901 1.00 80.11  ? 75  ILE A CG2 1 
ATOM   600  C CD1 . ILE A 1 75  ? 22.856  19.078  -34.898 1.00 107.38 ? 75  ILE A CD1 1 
ATOM   601  N N   . TYR A 1 76  ? 23.302  13.840  -37.408 1.00 79.49  ? 76  TYR A N   1 
ATOM   602  C CA  . TYR A 1 76  ? 24.036  12.731  -38.042 1.00 78.26  ? 76  TYR A CA  1 
ATOM   603  C C   . TYR A 1 76  ? 24.468  13.029  -39.511 1.00 78.45  ? 76  TYR A C   1 
ATOM   604  O O   . TYR A 1 76  ? 23.866  13.871  -40.186 1.00 77.93  ? 76  TYR A O   1 
ATOM   605  C CB  . TYR A 1 76  ? 23.279  11.398  -37.913 1.00 79.27  ? 76  TYR A CB  1 
ATOM   606  C CG  . TYR A 1 76  ? 22.016  11.287  -38.731 1.00 80.40  ? 76  TYR A CG  1 
ATOM   607  C CD1 . TYR A 1 76  ? 22.037  10.724  -40.004 1.00 81.55  ? 76  TYR A CD1 1 
ATOM   608  C CD2 . TYR A 1 76  ? 20.782  11.657  -38.201 1.00 81.23  ? 76  TYR A CD2 1 
ATOM   609  C CE1 . TYR A 1 76  ? 20.867  10.572  -40.746 1.00 81.22  ? 76  TYR A CE1 1 
ATOM   610  C CE2 . TYR A 1 76  ? 19.605  11.523  -38.940 1.00 81.71  ? 76  TYR A CE2 1 
ATOM   611  C CZ  . TYR A 1 76  ? 19.655  10.987  -40.218 1.00 84.66  ? 76  TYR A CZ  1 
ATOM   612  O OH  . TYR A 1 76  ? 18.517  10.856  -40.971 1.00 80.38  ? 76  TYR A OH  1 
ATOM   613  N N   . ARG A 1 77  ? 25.547  12.369  -39.977 1.00 72.17  ? 77  ARG A N   1 
ATOM   614  C CA  . ARG A 1 77  ? 26.079  12.602  -41.328 1.00 70.66  ? 77  ARG A CA  1 
ATOM   615  C C   . ARG A 1 77  ? 25.872  11.447  -42.329 1.00 73.81  ? 77  ARG A C   1 
ATOM   616  O O   . ARG A 1 77  ? 26.092  10.266  -41.993 1.00 73.38  ? 77  ARG A O   1 
ATOM   617  C CB  . ARG A 1 77  ? 27.571  12.991  -41.289 1.00 66.02  ? 77  ARG A CB  1 
ATOM   618  C CG  . ARG A 1 77  ? 28.050  13.557  -42.599 1.00 64.73  ? 77  ARG A CG  1 
ATOM   619  C CD  . ARG A 1 77  ? 29.485  13.961  -42.618 1.00 67.37  ? 77  ARG A CD  1 
ATOM   620  N NE  . ARG A 1 77  ? 30.408  12.830  -42.669 1.00 73.99  ? 77  ARG A NE  1 
ATOM   621  C CZ  . ARG A 1 77  ? 31.372  12.657  -41.776 1.00 94.51  ? 77  ARG A CZ  1 
ATOM   622  N NH1 . ARG A 1 77  ? 31.513  13.503  -40.767 1.00 93.12  ? 77  ARG A NH1 1 
ATOM   623  N NH2 . ARG A 1 77  ? 32.194  11.626  -41.879 1.00 74.77  ? 77  ARG A NH2 1 
ATOM   624  N N   . VAL A 1 78  ? 25.469  11.815  -43.579 1.00 67.66  ? 78  VAL A N   1 
ATOM   625  C CA  . VAL A 1 78  ? 25.330  10.897  -44.712 1.00 65.94  ? 78  VAL A CA  1 
ATOM   626  C C   . VAL A 1 78  ? 26.054  11.567  -45.845 1.00 68.61  ? 78  VAL A C   1 
ATOM   627  O O   . VAL A 1 78  ? 25.587  12.573  -46.361 1.00 69.17  ? 78  VAL A O   1 
ATOM   628  C CB  . VAL A 1 78  ? 23.874  10.467  -45.028 1.00 68.26  ? 78  VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 78  ? 23.728  9.955   -46.449 1.00 67.28  ? 78  VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 78  ? 23.417  9.400   -44.050 1.00 68.23  ? 78  VAL A CG2 1 
ATOM   631  N N   . GLY A 1 79  ? 27.240  11.062  -46.139 1.00 64.25  ? 79  GLY A N   1 
ATOM   632  C CA  . GLY A 1 79  ? 28.132  11.616  -47.145 1.00 64.37  ? 79  GLY A CA  1 
ATOM   633  C C   . GLY A 1 79  ? 28.779  12.834  -46.538 1.00 69.52  ? 79  GLY A C   1 
ATOM   634  O O   . GLY A 1 79  ? 29.617  12.700  -45.645 1.00 71.09  ? 79  GLY A O   1 
ATOM   635  N N   . GLU A 1 80  ? 28.350  14.021  -46.957 1.00 64.65  ? 80  GLU A N   1 
ATOM   636  C CA  . GLU A 1 80  ? 28.849  15.240  -46.361 1.00 64.71  ? 80  GLU A CA  1 
ATOM   637  C C   . GLU A 1 80  ? 27.692  16.109  -45.921 1.00 72.37  ? 80  GLU A C   1 
ATOM   638  O O   . GLU A 1 80  ? 27.889  17.237  -45.461 1.00 74.50  ? 80  GLU A O   1 
ATOM   639  C CB  . GLU A 1 80  ? 29.824  15.971  -47.283 1.00 65.99  ? 80  GLU A CB  1 
ATOM   640  C CG  . GLU A 1 80  ? 31.208  15.340  -47.344 1.00 76.77  ? 80  GLU A CG  1 
ATOM   641  C CD  . GLU A 1 80  ? 32.101  15.287  -46.110 1.00 88.52  ? 80  GLU A CD  1 
ATOM   642  O OE1 . GLU A 1 80  ? 31.743  15.847  -45.040 1.00 44.45  ? 80  GLU A OE1 1 
ATOM   643  O OE2 . GLU A 1 80  ? 33.192  14.682  -46.237 1.00 78.89  ? 80  GLU A OE2 1 
ATOM   644  N N   . LEU A 1 81  ? 26.486  15.536  -46.003 1.00 67.50  ? 81  LEU A N   1 
ATOM   645  C CA  . LEU A 1 81  ? 25.212  16.122  -45.613 1.00 65.83  ? 81  LEU A CA  1 
ATOM   646  C C   . LEU A 1 81  ? 24.998  15.887  -44.132 1.00 69.46  ? 81  LEU A C   1 
ATOM   647  O O   . LEU A 1 81  ? 25.411  14.849  -43.620 1.00 69.84  ? 81  LEU A O   1 
ATOM   648  C CB  . LEU A 1 81  ? 24.119  15.378  -46.392 1.00 65.10  ? 81  LEU A CB  1 
ATOM   649  C CG  . LEU A 1 81  ? 23.074  16.192  -47.102 1.00 68.07  ? 81  LEU A CG  1 
ATOM   650  C CD1 . LEU A 1 81  ? 23.682  17.103  -48.125 1.00 67.58  ? 81  LEU A CD1 1 
ATOM   651  C CD2 . LEU A 1 81  ? 22.124  15.294  -47.789 1.00 69.37  ? 81  LEU A CD2 1 
ATOM   652  N N   . TRP A 1 82  ? 24.312  16.822  -43.448 1.00 65.84  ? 82  TRP A N   1 
ATOM   653  C CA  . TRP A 1 82  ? 23.979  16.698  -42.013 1.00 64.83  ? 82  TRP A CA  1 
ATOM   654  C C   . TRP A 1 82  ? 22.490  16.776  -41.796 1.00 67.67  ? 82  TRP A C   1 
ATOM   655  O O   . TRP A 1 82  ? 21.845  17.658  -42.324 1.00 64.61  ? 82  TRP A O   1 
ATOM   656  C CB  . TRP A 1 82  ? 24.679  17.771  -41.154 1.00 63.26  ? 82  TRP A CB  1 
ATOM   657  C CG  . TRP A 1 82  ? 26.145  17.539  -40.962 1.00 64.15  ? 82  TRP A CG  1 
ATOM   658  C CD1 . TRP A 1 82  ? 27.164  18.088  -41.688 1.00 67.36  ? 82  TRP A CD1 1 
ATOM   659  C CD2 . TRP A 1 82  ? 26.752  16.610  -40.056 1.00 64.07  ? 82  TRP A CD2 1 
ATOM   660  N NE1 . TRP A 1 82  ? 28.371  17.583  -41.270 1.00 66.62  ? 82  TRP A NE1 1 
ATOM   661  C CE2 . TRP A 1 82  ? 28.147  16.663  -40.275 1.00 67.93  ? 82  TRP A CE2 1 
ATOM   662  C CE3 . TRP A 1 82  ? 26.250  15.719  -39.088 1.00 65.15  ? 82  TRP A CE3 1 
ATOM   663  C CZ2 . TRP A 1 82  ? 29.048  15.906  -39.521 1.00 67.17  ? 82  TRP A CZ2 1 
ATOM   664  C CZ3 . TRP A 1 82  ? 27.142  14.992  -38.323 1.00 66.59  ? 82  TRP A CZ3 1 
ATOM   665  C CH2 . TRP A 1 82  ? 28.522  15.079  -38.550 1.00 67.39  ? 82  TRP A CH2 1 
ATOM   666  N N   . SER A 1 83  ? 21.933  15.861  -41.012 1.00 68.48  ? 83  SER A N   1 
ATOM   667  C CA  . SER A 1 83  ? 20.508  15.904  -40.700 1.00 69.77  ? 83  SER A CA  1 
ATOM   668  C C   . SER A 1 83  ? 20.217  17.170  -39.860 1.00 78.67  ? 83  SER A C   1 
ATOM   669  O O   . SER A 1 83  ? 21.093  17.612  -39.104 1.00 79.45  ? 83  SER A O   1 
ATOM   670  C CB  . SER A 1 83  ? 20.110  14.663  -39.916 1.00 72.02  ? 83  SER A CB  1 
ATOM   671  O OG  . SER A 1 83  ? 20.651  14.683  -38.602 1.00 79.04  ? 83  SER A OG  1 
ATOM   672  N N   . GLU A 1 84  ? 19.005  17.753  -39.986 1.00 76.72  ? 84  GLU A N   1 
ATOM   673  C CA  . GLU A 1 84  ? 18.670  18.910  -39.174 1.00 77.60  ? 84  GLU A CA  1 
ATOM   674  C C   . GLU A 1 84  ? 18.571  18.451  -37.708 1.00 82.97  ? 84  GLU A C   1 
ATOM   675  O O   . GLU A 1 84  ? 18.263  17.271  -37.474 1.00 84.06  ? 84  GLU A O   1 
ATOM   676  C CB  . GLU A 1 84  ? 17.424  19.641  -39.693 1.00 79.74  ? 84  GLU A CB  1 
ATOM   677  C CG  . GLU A 1 84  ? 17.761  20.830  -40.603 1.00 100.34 ? 84  GLU A CG  1 
ATOM   678  C CD  . GLU A 1 84  ? 16.658  21.522  -41.403 1.00 129.44 ? 84  GLU A CD  1 
ATOM   679  O OE1 . GLU A 1 84  ? 15.548  21.753  -40.860 1.00 106.96 ? 84  GLU A OE1 1 
ATOM   680  O OE2 . GLU A 1 84  ? 16.929  21.864  -42.579 1.00 126.26 ? 84  GLU A OE2 1 
ATOM   681  N N   . PRO A 1 85  ? 18.959  19.291  -36.711 1.00 77.97  ? 85  PRO A N   1 
ATOM   682  C CA  . PRO A 1 85  ? 18.987  18.816  -35.317 1.00 77.11  ? 85  PRO A CA  1 
ATOM   683  C C   . PRO A 1 85  ? 17.737  18.122  -34.803 1.00 83.85  ? 85  PRO A C   1 
ATOM   684  O O   . PRO A 1 85  ? 16.608  18.423  -35.210 1.00 84.69  ? 85  PRO A O   1 
ATOM   685  C CB  . PRO A 1 85  ? 19.284  20.084  -34.512 1.00 77.93  ? 85  PRO A CB  1 
ATOM   686  C CG  . PRO A 1 85  ? 19.113  21.193  -35.441 1.00 81.92  ? 85  PRO A CG  1 
ATOM   687  C CD  . PRO A 1 85  ? 19.438  20.681  -36.787 1.00 78.24  ? 85  PRO A CD  1 
ATOM   688  N N   . SER A 1 86  ? 17.966  17.180  -33.878 1.00 81.29  ? 86  SER A N   1 
ATOM   689  C CA  . SER A 1 86  ? 16.964  16.401  -33.154 1.00 80.61  ? 86  SER A CA  1 
ATOM   690  C C   . SER A 1 86  ? 16.232  17.344  -32.223 1.00 85.30  ? 86  SER A C   1 
ATOM   691  O O   . SER A 1 86  ? 16.598  18.524  -32.134 1.00 84.35  ? 86  SER A O   1 
ATOM   692  C CB  . SER A 1 86  ? 17.666  15.366  -32.288 1.00 82.35  ? 86  SER A CB  1 
ATOM   693  O OG  . SER A 1 86  ? 18.319  16.021  -31.215 1.00 86.01  ? 86  SER A OG  1 
ATOM   694  N N   . ASN A 1 87  ? 15.266  16.818  -31.451 1.00 83.33  ? 87  ASN A N   1 
ATOM   695  C CA  . ASN A 1 87  ? 14.579  17.652  -30.466 1.00 84.02  ? 87  ASN A CA  1 
ATOM   696  C C   . ASN A 1 87  ? 15.596  18.011  -29.336 1.00 87.26  ? 87  ASN A C   1 
ATOM   697  O O   . ASN A 1 87  ? 16.695  17.436  -29.276 1.00 87.11  ? 87  ASN A O   1 
ATOM   698  C CB  . ASN A 1 87  ? 13.318  16.947  -29.927 1.00 90.68  ? 87  ASN A CB  1 
ATOM   699  C CG  . ASN A 1 87  ? 13.572  15.682  -29.116 1.00 116.52 ? 87  ASN A CG  1 
ATOM   700  O OD1 . ASN A 1 87  ? 14.121  14.686  -29.619 1.00 101.18 ? 87  ASN A OD1 1 
ATOM   701  N ND2 . ASN A 1 87  ? 13.162  15.705  -27.835 1.00 108.59 ? 87  ASN A ND2 1 
ATOM   702  N N   . LEU A 1 88  ? 15.273  19.002  -28.500 1.00 81.67  ? 88  LEU A N   1 
ATOM   703  C CA  . LEU A 1 88  ? 16.197  19.369  -27.439 1.00 79.51  ? 88  LEU A CA  1 
ATOM   704  C C   . LEU A 1 88  ? 16.005  18.471  -26.258 1.00 75.48  ? 88  LEU A C   1 
ATOM   705  O O   . LEU A 1 88  ? 14.876  18.142  -25.886 1.00 73.21  ? 88  LEU A O   1 
ATOM   706  C CB  . LEU A 1 88  ? 16.014  20.825  -26.987 1.00 80.20  ? 88  LEU A CB  1 
ATOM   707  C CG  . LEU A 1 88  ? 16.193  21.958  -28.000 1.00 84.44  ? 88  LEU A CG  1 
ATOM   708  C CD1 . LEU A 1 88  ? 15.980  23.272  -27.310 1.00 84.79  ? 88  LEU A CD1 1 
ATOM   709  C CD2 . LEU A 1 88  ? 17.576  21.954  -28.597 1.00 86.32  ? 88  LEU A CD2 1 
ATOM   710  N N   . LEU A 1 89  ? 17.125  18.062  -25.683 1.00 68.75  ? 89  LEU A N   1 
ATOM   711  C CA  . LEU A 1 89  ? 17.157  17.255  -24.485 1.00 66.96  ? 89  LEU A CA  1 
ATOM   712  C C   . LEU A 1 89  ? 17.641  18.158  -23.388 1.00 74.78  ? 89  LEU A C   1 
ATOM   713  O O   . LEU A 1 89  ? 18.698  18.765  -23.510 1.00 75.04  ? 89  LEU A O   1 
ATOM   714  C CB  . LEU A 1 89  ? 18.062  16.029  -24.638 1.00 65.52  ? 89  LEU A CB  1 
ATOM   715  C CG  . LEU A 1 89  ? 18.438  15.248  -23.390 1.00 68.46  ? 89  LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 89  ? 17.220  14.758  -22.625 1.00 68.44  ? 89  LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 89  ? 19.284  14.077  -23.754 1.00 70.02  ? 89  LEU A CD2 1 
ATOM   718  N N   . ASP A 1 90  ? 16.842  18.289  -22.335 1.00 74.03  ? 90  ASP A N   1 
ATOM   719  C CA  . ASP A 1 90  ? 17.216  19.109  -21.199 1.00 74.42  ? 90  ASP A CA  1 
ATOM   720  C C   . ASP A 1 90  ? 17.664  18.161  -20.113 1.00 78.80  ? 90  ASP A C   1 
ATOM   721  O O   . ASP A 1 90  ? 16.820  17.569  -19.451 1.00 79.15  ? 90  ASP A O   1 
ATOM   722  C CB  . ASP A 1 90  ? 16.048  20.009  -20.756 1.00 76.00  ? 90  ASP A CB  1 
ATOM   723  C CG  . ASP A 1 90  ? 15.521  20.886  -21.877 1.00 85.88  ? 90  ASP A CG  1 
ATOM   724  O OD1 . ASP A 1 90  ? 16.164  21.914  -22.177 1.00 83.78  ? 90  ASP A OD1 1 
ATOM   725  O OD2 . ASP A 1 90  ? 14.470  20.534  -22.463 1.00 95.59  ? 90  ASP A OD2 1 
ATOM   726  N N   . LEU A 1 91  ? 18.973  17.950  -20.003 1.00 75.77  ? 91  LEU A N   1 
ATOM   727  C CA  . LEU A 1 91  ? 19.495  17.028  -18.969 1.00 76.48  ? 91  LEU A CA  1 
ATOM   728  C C   . LEU A 1 91  ? 19.631  17.801  -17.667 1.00 82.37  ? 91  LEU A C   1 
ATOM   729  O O   . LEU A 1 91  ? 20.485  18.678  -17.604 1.00 82.58  ? 91  LEU A O   1 
ATOM   730  C CB  . LEU A 1 91  ? 20.843  16.464  -19.409 1.00 76.27  ? 91  LEU A CB  1 
ATOM   731  C CG  . LEU A 1 91  ? 21.147  15.078  -18.856 1.00 78.75  ? 91  LEU A CG  1 
ATOM   732  C CD1 . LEU A 1 91  ? 19.902  14.221  -18.889 1.00 78.73  ? 91  LEU A CD1 1 
ATOM   733  C CD2 . LEU A 1 91  ? 22.251  14.419  -19.648 1.00 78.86  ? 91  LEU A CD2 1 
ATOM   734  N N   . VAL A 1 92  ? 18.810  17.457  -16.680 1.00 79.21  ? 92  VAL A N   1 
ATOM   735  C CA  . VAL A 1 92  ? 18.799  18.176  -15.379 1.00 79.46  ? 92  VAL A CA  1 
ATOM   736  C C   . VAL A 1 92  ? 19.500  17.325  -14.331 1.00 84.15  ? 92  VAL A C   1 
ATOM   737  O O   . VAL A 1 92  ? 19.195  16.146  -14.252 1.00 85.40  ? 92  VAL A O   1 
ATOM   738  C CB  . VAL A 1 92  ? 17.356  18.448  -14.938 1.00 83.33  ? 92  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 92  ? 17.296  18.876  -13.487 1.00 82.72  ? 92  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 92  ? 16.690  19.472  -15.832 1.00 83.14  ? 92  VAL A CG2 1 
ATOM   741  N N   . VAL A 1 93  ? 20.402  17.924  -13.563 1.00 79.98  ? 93  VAL A N   1 
ATOM   742  C CA  . VAL A 1 93  ? 21.077  17.171  -12.477 1.00 80.43  ? 93  VAL A CA  1 
ATOM   743  C C   . VAL A 1 93  ? 20.328  17.506  -11.192 1.00 84.54  ? 93  VAL A C   1 
ATOM   744  O O   . VAL A 1 93  ? 20.258  18.682  -10.847 1.00 84.64  ? 93  VAL A O   1 
ATOM   745  C CB  . VAL A 1 93  ? 22.569  17.521  -12.377 1.00 85.19  ? 93  VAL A CB  1 
ATOM   746  C CG1 . VAL A 1 93  ? 22.782  18.895  -11.785 1.00 85.35  ? 93  VAL A CG1 1 
ATOM   747  C CG2 . VAL A 1 93  ? 23.330  16.487  -11.574 1.00 85.17  ? 93  VAL A CG2 1 
ATOM   748  N N   . THR A 1 94  ? 19.749  16.499  -10.546 1.00 80.49  ? 94  THR A N   1 
ATOM   749  C CA  . THR A 1 94  ? 18.985  16.720  -9.296  1.00 79.12  ? 94  THR A CA  1 
ATOM   750  C C   . THR A 1 94  ? 19.871  16.406  -8.092  1.00 82.57  ? 94  THR A C   1 
ATOM   751  O O   . THR A 1 94  ? 21.042  16.088  -8.297  1.00 82.56  ? 94  THR A O   1 
ATOM   752  C CB  . THR A 1 94  ? 17.730  15.847  -9.298  1.00 77.87  ? 94  THR A CB  1 
ATOM   753  O OG1 . THR A 1 94  ? 18.136  14.531  -9.655  1.00 75.20  ? 94  THR A OG1 1 
ATOM   754  C CG2 . THR A 1 94  ? 16.708  16.312  -10.305 1.00 70.75  ? 94  THR A CG2 1 
ATOM   755  N N   . GLU A 1 95  ? 19.317  16.549  -6.891  1.00 78.81  ? 95  GLU A N   1 
ATOM   756  C CA  . GLU A 1 95  ? 19.997  16.222  -5.626  1.00 78.64  ? 95  GLU A CA  1 
ATOM   757  C C   . GLU A 1 95  ? 21.261  17.008  -5.421  1.00 82.20  ? 95  GLU A C   1 
ATOM   758  O O   . GLU A 1 95  ? 22.253  16.470  -4.910  1.00 81.29  ? 95  GLU A O   1 
ATOM   759  C CB  . GLU A 1 95  ? 20.293  14.715  -5.507  1.00 79.71  ? 95  GLU A CB  1 
ATOM   760  C CG  . GLU A 1 95  ? 19.068  13.836  -5.438  1.00 88.00  ? 95  GLU A CG  1 
ATOM   761  C CD  . GLU A 1 95  ? 19.431  12.388  -5.226  1.00 102.08 ? 95  GLU A CD  1 
ATOM   762  O OE1 . GLU A 1 95  ? 20.618  12.119  -4.922  1.00 86.03  ? 95  GLU A OE1 1 
ATOM   763  O OE2 . GLU A 1 95  ? 18.541  11.521  -5.398  1.00 93.33  ? 95  GLU A OE2 1 
ATOM   764  N N   . MET A 1 96  ? 21.240  18.272  -5.823  1.00 79.74  ? 96  MET A N   1 
ATOM   765  C CA  . MET A 1 96  ? 22.441  19.087  -5.749  1.00 79.77  ? 96  MET A CA  1 
ATOM   766  C C   . MET A 1 96  ? 22.860  19.462  -4.329  1.00 85.72  ? 96  MET A C   1 
ATOM   767  O O   . MET A 1 96  ? 23.867  18.898  -3.838  1.00 87.51  ? 96  MET A O   1 
ATOM   768  C CB  . MET A 1 96  ? 22.367  20.316  -6.650  1.00 81.21  ? 96  MET A CB  1 
ATOM   769  C CG  . MET A 1 96  ? 22.649  19.976  -8.072  1.00 83.25  ? 96  MET A CG  1 
ATOM   770  S SD  . MET A 1 96  ? 24.296  19.289  -8.255  1.00 86.32  ? 96  MET A SD  1 
ATOM   771  C CE  . MET A 1 96  ? 25.240  20.807  -8.489  1.00 82.84  ? 96  MET A CE  1 
ATOM   772  N N   . TYR A 1 97  ? 22.131  20.370  -3.657  1.00 78.19  ? 97  TYR A N   1 
ATOM   773  C CA  . TYR A 1 97  ? 22.674  20.731  -2.362  1.00 76.86  ? 97  TYR A CA  1 
ATOM   774  C C   . TYR A 1 97  ? 21.815  20.532  -1.119  1.00 78.55  ? 97  TYR A C   1 
ATOM   775  O O   . TYR A 1 97  ? 22.307  20.068  -0.073  1.00 76.31  ? 97  TYR A O   1 
ATOM   776  C CB  . TYR A 1 97  ? 23.079  22.192  -2.408  1.00 78.03  ? 97  TYR A CB  1 
ATOM   777  C CG  . TYR A 1 97  ? 24.172  22.493  -3.384  1.00 80.65  ? 97  TYR A CG  1 
ATOM   778  C CD1 . TYR A 1 97  ? 25.493  22.176  -3.095  1.00 83.93  ? 97  TYR A CD1 1 
ATOM   779  C CD2 . TYR A 1 97  ? 23.904  23.167  -4.572  1.00 81.30  ? 97  TYR A CD2 1 
ATOM   780  C CE1 . TYR A 1 97  ? 26.522  22.500  -3.975  1.00 86.91  ? 97  TYR A CE1 1 
ATOM   781  C CE2 . TYR A 1 97  ? 24.920  23.500  -5.459  1.00 82.33  ? 97  TYR A CE2 1 
ATOM   782  C CZ  . TYR A 1 97  ? 26.227  23.154  -5.162  1.00 91.39  ? 97  TYR A CZ  1 
ATOM   783  O OH  . TYR A 1 97  ? 27.226  23.501  -6.023  1.00 87.24  ? 97  TYR A OH  1 
ATOM   784  N N   . ASP A 1 98  ? 20.580  21.020  -1.206  1.00 74.71  ? 98  ASP A N   1 
ATOM   785  C CA  . ASP A 1 98  ? 19.668  21.155  -0.110  1.00 74.68  ? 98  ASP A CA  1 
ATOM   786  C C   . ASP A 1 98  ? 18.336  20.536  -0.440  1.00 81.01  ? 98  ASP A C   1 
ATOM   787  O O   . ASP A 1 98  ? 18.033  20.263  -1.593  1.00 80.29  ? 98  ASP A O   1 
ATOM   788  C CB  . ASP A 1 98  ? 19.473  22.673  0.146   1.00 76.50  ? 98  ASP A CB  1 
ATOM   789  C CG  . ASP A 1 98  ? 20.735  23.549  0.210   1.00 85.14  ? 98  ASP A CG  1 
ATOM   790  O OD1 . ASP A 1 98  ? 21.697  23.145  0.866   1.00 86.84  ? 98  ASP A OD1 1 
ATOM   791  O OD2 . ASP A 1 98  ? 20.733  24.657  -0.380  1.00 86.08  ? 98  ASP A OD2 1 
ATOM   792  N N   . THR A 1 99  ? 17.520  20.354  0.577   1.00 80.71  ? 99  THR A N   1 
ATOM   793  C CA  . THR A 1 99  ? 16.173  19.853  0.423   1.00 82.11  ? 99  THR A CA  1 
ATOM   794  C C   . THR A 1 99  ? 15.202  21.013  0.721   1.00 90.93  ? 99  THR A C   1 
ATOM   795  O O   . THR A 1 99  ? 15.282  21.633  1.799   1.00 89.72  ? 99  THR A O   1 
ATOM   796  C CB  . THR A 1 99  ? 15.944  18.616  1.298   1.00 87.68  ? 99  THR A CB  1 
ATOM   797  O OG1 . THR A 1 99  ? 16.845  17.602  0.877   1.00 89.52  ? 99  THR A OG1 1 
ATOM   798  C CG2 . THR A 1 99  ? 14.532  18.083  1.193   1.00 86.17  ? 99  THR A CG2 1 
ATOM   799  N N   . PRO A 1 100 ? 14.291  21.330  -0.236  1.00 91.39  ? 100 PRO A N   1 
ATOM   800  C CA  . PRO A 1 100 ? 13.307  22.391  0.023   1.00 92.29  ? 100 PRO A CA  1 
ATOM   801  C C   . PRO A 1 100 ? 12.135  21.859  0.864   1.00 99.34  ? 100 PRO A C   1 
ATOM   802  O O   . PRO A 1 100 ? 11.970  20.638  1.000   1.00 98.61  ? 100 PRO A O   1 
ATOM   803  C CB  . PRO A 1 100 ? 12.864  22.826  -1.392  1.00 93.67  ? 100 PRO A CB  1 
ATOM   804  C CG  . PRO A 1 100 ? 13.500  21.846  -2.361  1.00 97.71  ? 100 PRO A CG  1 
ATOM   805  C CD  . PRO A 1 100 ? 14.074  20.717  -1.564  1.00 93.11  ? 100 PRO A CD  1 
ATOM   806  N N   . THR A 1 101 ? 11.341  22.770  1.453   1.00 98.65  ? 101 THR A N   1 
ATOM   807  C CA  . THR A 1 101 ? 10.149  22.400  2.227   1.00 99.93  ? 101 THR A CA  1 
ATOM   808  C C   . THR A 1 101 ? 8.907   22.589  1.357   1.00 105.29 ? 101 THR A C   1 
ATOM   809  O O   . THR A 1 101 ? 8.805   23.590  0.634   1.00 104.53 ? 101 THR A O   1 
ATOM   810  C CB  . THR A 1 101 ? 10.075  23.112  3.582   1.00 111.08 ? 101 THR A CB  1 
ATOM   811  O OG1 . THR A 1 101 ? 10.372  24.505  3.430   1.00 111.85 ? 101 THR A OG1 1 
ATOM   812  C CG2 . THR A 1 101 ? 10.987  22.480  4.615   1.00 110.11 ? 101 THR A CG2 1 
ATOM   813  N N   . LEU A 1 102 ? 7.997   21.598  1.381   1.00 102.57 ? 102 LEU A N   1 
ATOM   814  C CA  . LEU A 1 102 ? 6.800   21.639  0.550   1.00 102.71 ? 102 LEU A CA  1 
ATOM   815  C C   . LEU A 1 102 ? 5.513   21.616  1.374   1.00 108.18 ? 102 LEU A C   1 
ATOM   816  O O   . LEU A 1 102 ? 5.043   20.564  1.813   1.00 106.98 ? 102 LEU A O   1 
ATOM   817  C CB  . LEU A 1 102 ? 6.830   20.533  -0.546  1.00 102.40 ? 102 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 102 ? 5.599   20.339  -1.472  1.00 106.07 ? 102 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 102 ? 5.315   21.562  -2.330  1.00 105.57 ? 102 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 102 ? 5.744   19.095  -2.328  1.00 106.99 ? 102 LEU A CD2 1 
ATOM   821  N N   . SER A 1 103 ? 4.945   22.799  1.569   1.00 107.28 ? 103 SER A N   1 
ATOM   822  C CA  . SER A 1 103 ? 3.664   22.945  2.243   1.00 108.53 ? 103 SER A CA  1 
ATOM   823  C C   . SER A 1 103 ? 2.535   23.043  1.190   1.00 118.04 ? 103 SER A C   1 
ATOM   824  O O   . SER A 1 103 ? 2.802   23.267  0.004   1.00 119.19 ? 103 SER A O   1 
ATOM   825  C CB  . SER A 1 103 ? 3.671   24.141  3.193   1.00 109.67 ? 103 SER A CB  1 
ATOM   826  O OG  . SER A 1 103 ? 4.251   25.293  2.608   1.00 111.35 ? 103 SER A OG  1 
ATOM   827  N N   . VAL A 1 104 ? 1.292   22.816  1.609   1.00 117.12 ? 104 VAL A N   1 
ATOM   828  C CA  . VAL A 1 104 ? 0.135   22.872  0.727   1.00 118.26 ? 104 VAL A CA  1 
ATOM   829  C C   . VAL A 1 104 ? -0.942  23.752  1.368   1.00 127.25 ? 104 VAL A C   1 
ATOM   830  O O   . VAL A 1 104 ? -1.086  23.760  2.593   1.00 127.17 ? 104 VAL A O   1 
ATOM   831  C CB  . VAL A 1 104 ? -0.347  21.453  0.300   1.00 121.81 ? 104 VAL A CB  1 
ATOM   832  C CG1 . VAL A 1 104 ? -0.671  20.569  1.501   1.00 121.21 ? 104 VAL A CG1 1 
ATOM   833  C CG2 . VAL A 1 104 ? -1.513  21.508  -0.688  1.00 121.61 ? 104 VAL A CG2 1 
ATOM   834  N N   . HIS A 1 105 ? -1.644  24.540  0.547   1.00 127.42 ? 105 HIS A N   1 
ATOM   835  C CA  . HIS A 1 105 ? -2.701  25.458  0.984   1.00 128.70 ? 105 HIS A CA  1 
ATOM   836  C C   . HIS A 1 105 ? -3.980  25.119  0.203   1.00 132.99 ? 105 HIS A C   1 
ATOM   837  O O   . HIS A 1 105 ? -3.941  25.086  -1.030  1.00 133.02 ? 105 HIS A O   1 
ATOM   838  C CB  . HIS A 1 105 ? -2.244  26.925  0.765   1.00 130.23 ? 105 HIS A CB  1 
ATOM   839  C CG  . HIS A 1 105 ? -3.203  28.009  1.182   1.00 133.81 ? 105 HIS A CG  1 
ATOM   840  N ND1 . HIS A 1 105 ? -3.695  28.933  0.263   1.00 135.73 ? 105 HIS A ND1 1 
ATOM   841  C CD2 . HIS A 1 105 ? -3.650  28.348  2.415   1.00 135.91 ? 105 HIS A CD2 1 
ATOM   842  C CE1 . HIS A 1 105 ? -4.454  29.766  0.956   1.00 135.35 ? 105 HIS A CE1 1 
ATOM   843  N NE2 . HIS A 1 105 ? -4.461  29.456  2.254   1.00 135.28 ? 105 HIS A NE2 1 
ATOM   844  N N   . PRO A 1 106 ? -5.099  24.793  0.879   1.00 129.27 ? 106 PRO A N   1 
ATOM   845  C CA  . PRO A 1 106 ? -5.300  24.790  2.334   1.00 129.23 ? 106 PRO A CA  1 
ATOM   846  C C   . PRO A 1 106 ? -4.876  23.504  3.071   1.00 133.86 ? 106 PRO A C   1 
ATOM   847  O O   . PRO A 1 106 ? -4.390  23.607  4.197   1.00 133.44 ? 106 PRO A O   1 
ATOM   848  C CB  . PRO A 1 106 ? -6.793  25.089  2.471   1.00 131.06 ? 106 PRO A CB  1 
ATOM   849  C CG  . PRO A 1 106 ? -7.423  24.560  1.195   1.00 135.57 ? 106 PRO A CG  1 
ATOM   850  C CD  . PRO A 1 106 ? -6.344  24.475  0.151   1.00 130.93 ? 106 PRO A CD  1 
ATOM   851  N N   . GLY A 1 107 ? -5.042  22.328  2.457   1.00 130.86 ? 107 GLY A N   1 
ATOM   852  C CA  . GLY A 1 107 ? -4.692  21.055  3.092   1.00 130.70 ? 107 GLY A CA  1 
ATOM   853  C C   . GLY A 1 107 ? -4.165  19.956  2.184   1.00 134.40 ? 107 GLY A C   1 
ATOM   854  O O   . GLY A 1 107 ? -4.222  20.095  0.958   1.00 133.70 ? 107 GLY A O   1 
ATOM   855  N N   . PRO A 1 108 ? -3.665  18.829  2.768   1.00 131.07 ? 108 PRO A N   1 
ATOM   856  C CA  . PRO A 1 108 ? -3.077  17.742  1.943   1.00 130.96 ? 108 PRO A CA  1 
ATOM   857  C C   . PRO A 1 108 ? -4.031  17.010  0.984   1.00 134.90 ? 108 PRO A C   1 
ATOM   858  O O   . PRO A 1 108 ? -3.580  16.476  -0.039  1.00 135.04 ? 108 PRO A O   1 
ATOM   859  C CB  . PRO A 1 108 ? -2.472  16.786  2.981   1.00 132.60 ? 108 PRO A CB  1 
ATOM   860  C CG  . PRO A 1 108 ? -2.335  17.604  4.230   1.00 137.10 ? 108 PRO A CG  1 
ATOM   861  C CD  . PRO A 1 108 ? -3.506  18.539  4.206   1.00 132.63 ? 108 PRO A CD  1 
ATOM   862  N N   . GLU A 1 109 ? -5.329  16.967  1.325   1.00 130.30 ? 109 GLU A N   1 
ATOM   863  C CA  . GLU A 1 109 ? -6.403  16.384  0.522   1.00 129.57 ? 109 GLU A CA  1 
ATOM   864  C C   . GLU A 1 109 ? -7.680  17.140  0.836   1.00 133.95 ? 109 GLU A C   1 
ATOM   865  O O   . GLU A 1 109 ? -8.009  17.359  2.011   1.00 132.74 ? 109 GLU A O   1 
ATOM   866  C CB  . GLU A 1 109 ? -6.541  14.875  0.738   1.00 130.62 ? 109 GLU A CB  1 
ATOM   867  C CG  . GLU A 1 109 ? -5.707  14.064  -0.238  1.00 136.81 ? 109 GLU A CG  1 
ATOM   868  C CD  . GLU A 1 109 ? -5.680  12.566  -0.003  1.00 149.39 ? 109 GLU A CD  1 
ATOM   869  O OE1 . GLU A 1 109 ? -5.425  12.143  1.150   1.00 129.73 ? 109 GLU A OE1 1 
ATOM   870  O OE2 . GLU A 1 109 ? -5.893  11.811  -0.980  1.00 140.94 ? 109 GLU A OE2 1 
ATOM   871  N N   . VAL A 1 110 ? -8.358  17.606  -0.219  1.00 131.57 ? 110 VAL A N   1 
ATOM   872  C CA  . VAL A 1 110 ? -9.539  18.449  -0.081  1.00 132.01 ? 110 VAL A CA  1 
ATOM   873  C C   . VAL A 1 110 ? -10.705 18.033  -1.016  1.00 135.09 ? 110 VAL A C   1 
ATOM   874  O O   . VAL A 1 110 ? -10.522 17.184  -1.902  1.00 134.97 ? 110 VAL A O   1 
ATOM   875  C CB  . VAL A 1 110 ? -9.086  19.933  -0.284  1.00 136.78 ? 110 VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 110 ? -8.903  20.285  -1.760  1.00 136.42 ? 110 VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 110 ? -10.020 20.919  0.418   1.00 136.81 ? 110 VAL A CG2 1 
ATOM   878  N N   . ILE A 1 111 ? -11.902 18.643  -0.798  1.00 129.98 ? 111 ILE A N   1 
ATOM   879  C CA  . ILE A 1 111 ? -13.103 18.473  -1.616  1.00 128.80 ? 111 ILE A CA  1 
ATOM   880  C C   . ILE A 1 111 ? -12.871 19.187  -2.951  1.00 130.92 ? 111 ILE A C   1 
ATOM   881  O O   . ILE A 1 111 ? -12.258 20.263  -2.971  1.00 130.12 ? 111 ILE A O   1 
ATOM   882  C CB  . ILE A 1 111 ? -14.343 19.046  -0.893  1.00 131.52 ? 111 ILE A CB  1 
ATOM   883  N N   . SER A 1 112 ? -13.347 18.588  -4.059  1.00 126.47 ? 112 SER A N   1 
ATOM   884  C CA  . SER A 1 112 ? -13.201 19.150  -5.409  1.00 125.94 ? 112 SER A CA  1 
ATOM   885  C C   . SER A 1 112 ? -13.772 20.580  -5.548  1.00 129.57 ? 112 SER A C   1 
ATOM   886  O O   . SER A 1 112 ? -14.733 20.950  -4.852  1.00 129.28 ? 112 SER A O   1 
ATOM   887  C CB  . SER A 1 112 ? -13.816 18.221  -6.454  1.00 128.38 ? 112 SER A CB  1 
ATOM   888  O OG  . SER A 1 112 ? -13.656 18.752  -7.760  1.00 134.03 ? 112 SER A OG  1 
ATOM   889  N N   . GLY A 1 113 ? -13.148 21.363  -6.432  1.00 124.80 ? 113 GLY A N   1 
ATOM   890  C CA  . GLY A 1 113 ? -13.538 22.742  -6.707  1.00 123.61 ? 113 GLY A CA  1 
ATOM   891  C C   . GLY A 1 113 ? -12.936 23.767  -5.770  1.00 125.18 ? 113 GLY A C   1 
ATOM   892  O O   . GLY A 1 113 ? -13.164 24.965  -5.948  1.00 124.51 ? 113 GLY A O   1 
ATOM   893  N N   . GLU A 1 114 ? -12.174 23.306  -4.756  1.00 120.71 ? 114 GLU A N   1 
ATOM   894  C CA  . GLU A 1 114 ? -11.494 24.169  -3.787  1.00 119.92 ? 114 GLU A CA  1 
ATOM   895  C C   . GLU A 1 114 ? -10.229 24.723  -4.424  1.00 121.35 ? 114 GLU A C   1 
ATOM   896  O O   . GLU A 1 114 ? -9.566  24.030  -5.181  1.00 120.47 ? 114 GLU A O   1 
ATOM   897  C CB  . GLU A 1 114 ? -11.151 23.395  -2.500  1.00 121.44 ? 114 GLU A CB  1 
ATOM   898  C CG  . GLU A 1 114 ? -10.797 24.287  -1.317  1.00 131.31 ? 114 GLU A CG  1 
ATOM   899  C CD  . GLU A 1 114 ? -11.659 24.109  -0.080  1.00 149.11 ? 114 GLU A CD  1 
ATOM   900  O OE1 . GLU A 1 114 ? -11.081 24.031  1.027   1.00 138.91 ? 114 GLU A OE1 1 
ATOM   901  O OE2 . GLU A 1 114 ? -12.904 24.053  -0.206  1.00 142.60 ? 114 GLU A OE2 1 
ATOM   902  N N   . LYS A 1 115 ? -9.900  25.969  -4.128  1.00 117.16 ? 115 LYS A N   1 
ATOM   903  C CA  . LYS A 1 115 ? -8.702  26.605  -4.666  1.00 116.71 ? 115 LYS A CA  1 
ATOM   904  C C   . LYS A 1 115 ? -7.460  26.105  -3.877  1.00 121.48 ? 115 LYS A C   1 
ATOM   905  O O   . LYS A 1 115 ? -7.339  26.352  -2.665  1.00 122.04 ? 115 LYS A O   1 
ATOM   906  C CB  . LYS A 1 115 ? -8.821  28.149  -4.660  1.00 118.42 ? 115 LYS A CB  1 
ATOM   907  C CG  . LYS A 1 115 ? -10.255 28.695  -4.690  1.00 126.45 ? 115 LYS A CG  1 
ATOM   908  C CD  . LYS A 1 115 ? -10.702 29.355  -3.351  1.00 129.09 ? 115 LYS A CD  1 
ATOM   909  C CE  . LYS A 1 115 ? -10.992 28.425  -2.181  1.00 127.95 ? 115 LYS A CE  1 
ATOM   910  N NZ  . LYS A 1 115 ? -12.162 27.542  -2.435  1.00 130.39 ? 115 LYS A NZ  1 
ATOM   911  N N   . VAL A 1 116 ? -6.579  25.341  -4.565  1.00 116.45 ? 116 VAL A N   1 
ATOM   912  C CA  . VAL A 1 116 ? -5.354  24.778  -3.990  1.00 115.10 ? 116 VAL A CA  1 
ATOM   913  C C   . VAL A 1 116 ? -4.146  25.517  -4.527  1.00 116.47 ? 116 VAL A C   1 
ATOM   914  O O   . VAL A 1 116 ? -4.062  25.753  -5.730  1.00 116.23 ? 116 VAL A O   1 
ATOM   915  C CB  . VAL A 1 116 ? -5.265  23.235  -4.190  1.00 119.06 ? 116 VAL A CB  1 
ATOM   916  C CG1 . VAL A 1 116 ? -3.820  22.726  -4.205  1.00 118.92 ? 116 VAL A CG1 1 
ATOM   917  C CG2 . VAL A 1 116 ? -6.075  22.510  -3.123  1.00 118.80 ? 116 VAL A CG2 1 
ATOM   918  N N   . THR A 1 117 ? -3.247  25.940  -3.631  1.00 110.97 ? 117 THR A N   1 
ATOM   919  C CA  . THR A 1 117 ? -2.012  26.618  -4.018  1.00 109.76 ? 117 THR A CA  1 
ATOM   920  C C   . THR A 1 117 ? -0.870  25.978  -3.230  1.00 109.82 ? 117 THR A C   1 
ATOM   921  O O   . THR A 1 117 ? -0.808  26.102  -2.010  1.00 108.72 ? 117 THR A O   1 
ATOM   922  C CB  . THR A 1 117 ? -2.085  28.186  -3.926  1.00 120.56 ? 117 THR A CB  1 
ATOM   923  O OG1 . THR A 1 117 ? -2.044  28.602  -2.564  1.00 125.75 ? 117 THR A OG1 1 
ATOM   924  C CG2 . THR A 1 117 ? -3.316  28.797  -4.614  1.00 116.88 ? 117 THR A CG2 1 
ATOM   925  N N   . PHE A 1 118 ? -0.004  25.242  -3.927  1.00 104.83 ? 118 PHE A N   1 
ATOM   926  C CA  . PHE A 1 118 ? 1.167   24.581  -3.343  1.00 103.69 ? 118 PHE A CA  1 
ATOM   927  C C   . PHE A 1 118 ? 2.238   25.610  -3.052  1.00 105.89 ? 118 PHE A C   1 
ATOM   928  O O   . PHE A 1 118 ? 2.463   26.507  -3.866  1.00 105.20 ? 118 PHE A O   1 
ATOM   929  C CB  . PHE A 1 118 ? 1.750   23.547  -4.318  1.00 105.02 ? 118 PHE A CB  1 
ATOM   930  C CG  . PHE A 1 118 ? 1.184   22.159  -4.217  1.00 105.66 ? 118 PHE A CG  1 
ATOM   931  C CD1 . PHE A 1 118 ? 1.551   21.315  -3.174  1.00 108.11 ? 118 PHE A CD1 1 
ATOM   932  C CD2 . PHE A 1 118 ? 0.329   21.669  -5.197  1.00 106.83 ? 118 PHE A CD2 1 
ATOM   933  C CE1 . PHE A 1 118 ? 1.046   20.014  -3.094  1.00 108.44 ? 118 PHE A CE1 1 
ATOM   934  C CE2 . PHE A 1 118 ? -0.177  20.371  -5.117  1.00 109.39 ? 118 PHE A CE2 1 
ATOM   935  C CZ  . PHE A 1 118 ? 0.189   19.548  -4.068  1.00 107.30 ? 118 PHE A CZ  1 
ATOM   936  N N   . TYR A 1 119 ? 2.915   25.475  -1.913  1.00 101.30 ? 119 TYR A N   1 
ATOM   937  C CA  . TYR A 1 119 ? 4.001   26.389  -1.569  1.00 100.95 ? 119 TYR A CA  1 
ATOM   938  C C   . TYR A 1 119 ? 5.310   25.637  -1.421  1.00 104.67 ? 119 TYR A C   1 
ATOM   939  O O   . TYR A 1 119 ? 5.323   24.498  -0.945  1.00 104.00 ? 119 TYR A O   1 
ATOM   940  C CB  . TYR A 1 119 ? 3.684   27.214  -0.316  1.00 101.93 ? 119 TYR A CB  1 
ATOM   941  C CG  . TYR A 1 119 ? 2.647   28.299  -0.521  1.00 103.82 ? 119 TYR A CG  1 
ATOM   942  C CD1 . TYR A 1 119 ? 1.284   28.016  -0.433  1.00 105.72 ? 119 TYR A CD1 1 
ATOM   943  C CD2 . TYR A 1 119 ? 3.025   29.625  -0.711  1.00 104.86 ? 119 TYR A CD2 1 
ATOM   944  C CE1 . TYR A 1 119 ? 0.323   29.020  -0.568  1.00 105.76 ? 119 TYR A CE1 1 
ATOM   945  C CE2 . TYR A 1 119 ? 2.072   30.635  -0.872  1.00 106.16 ? 119 TYR A CE2 1 
ATOM   946  C CZ  . TYR A 1 119 ? 0.720   30.327  -0.797  1.00 112.76 ? 119 TYR A CZ  1 
ATOM   947  O OH  . TYR A 1 119 ? -0.226  31.315  -0.957  1.00 111.94 ? 119 TYR A OH  1 
ATOM   948  N N   . CYS A 1 120 ? 6.409   26.258  -1.873  1.00 101.27 ? 120 CYS A N   1 
ATOM   949  C CA  . CYS A 1 120 ? 7.732   25.652  -1.800  1.00 101.01 ? 120 CYS A CA  1 
ATOM   950  C C   . CYS A 1 120 ? 8.812   26.645  -1.399  1.00 105.59 ? 120 CYS A C   1 
ATOM   951  O O   . CYS A 1 120 ? 9.038   27.635  -2.096  1.00 105.43 ? 120 CYS A O   1 
ATOM   952  C CB  . CYS A 1 120 ? 8.081   24.935  -3.092  1.00 101.24 ? 120 CYS A CB  1 
ATOM   953  S SG  . CYS A 1 120 ? 9.499   23.828  -2.938  1.00 105.33 ? 120 CYS A SG  1 
ATOM   954  N N   . ARG A 1 121 ? 9.471   26.381  -0.261  1.00 101.96 ? 121 ARG A N   1 
ATOM   955  C CA  . ARG A 1 121 ? 10.502  27.250  0.302   1.00 101.25 ? 121 ARG A CA  1 
ATOM   956  C C   . ARG A 1 121 ? 11.849  26.571  0.269   1.00 102.74 ? 121 ARG A C   1 
ATOM   957  O O   . ARG A 1 121 ? 11.924  25.354  0.382   1.00 102.64 ? 121 ARG A O   1 
ATOM   958  C CB  . ARG A 1 121 ? 10.145  27.619  1.756   1.00 103.31 ? 121 ARG A CB  1 
ATOM   959  C CG  . ARG A 1 121 ? 10.713  28.963  2.230   1.00 119.81 ? 121 ARG A CG  1 
ATOM   960  C CD  . ARG A 1 121 ? 10.826  29.075  3.745   1.00 136.23 ? 121 ARG A CD  1 
ATOM   961  N NE  . ARG A 1 121 ? 9.545   28.852  4.428   1.00 153.04 ? 121 ARG A NE  1 
ATOM   962  C CZ  . ARG A 1 121 ? 9.420   28.624  5.734   1.00 174.84 ? 121 ARG A CZ  1 
ATOM   963  N NH1 . ARG A 1 121 ? 8.220   28.424  6.264   1.00 165.76 ? 121 ARG A NH1 1 
ATOM   964  N NH2 . ARG A 1 121 ? 10.491  28.589  6.518   1.00 164.66 ? 121 ARG A NH2 1 
ATOM   965  N N   . LEU A 1 122 ? 12.912  27.380  0.123   1.00 97.08  ? 122 LEU A N   1 
ATOM   966  C CA  . LEU A 1 122 ? 14.342  27.052  0.138   1.00 95.21  ? 122 LEU A CA  1 
ATOM   967  C C   . LEU A 1 122 ? 15.128  28.316  -0.142  1.00 99.84  ? 122 LEU A C   1 
ATOM   968  O O   . LEU A 1 122 ? 15.233  28.742  -1.291  1.00 99.06  ? 122 LEU A O   1 
ATOM   969  C CB  . LEU A 1 122 ? 14.757  25.903  -0.829  1.00 94.25  ? 122 LEU A CB  1 
ATOM   970  C CG  . LEU A 1 122 ? 16.267  25.616  -1.018  1.00 97.00  ? 122 LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 122 ? 16.912  25.167  0.231   1.00 97.32  ? 122 LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 122 ? 16.504  24.593  -2.063  1.00 96.05  ? 122 LEU A CD2 1 
ATOM   973  N N   . ASP A 1 123 ? 15.687  28.916  0.915   1.00 98.27  ? 123 ASP A N   1 
ATOM   974  C CA  . ASP A 1 123 ? 16.575  30.078  0.815   1.00 99.08  ? 123 ASP A CA  1 
ATOM   975  C C   . ASP A 1 123 ? 17.888  29.475  0.343   1.00 103.80 ? 123 ASP A C   1 
ATOM   976  O O   . ASP A 1 123 ? 18.007  28.250  0.331   1.00 105.31 ? 123 ASP A O   1 
ATOM   977  C CB  . ASP A 1 123 ? 16.764  30.736  2.192   1.00 101.67 ? 123 ASP A CB  1 
ATOM   978  C CG  . ASP A 1 123 ? 16.836  29.747  3.345   1.00 120.19 ? 123 ASP A CG  1 
ATOM   979  O OD1 . ASP A 1 123 ? 15.766  29.182  3.718   1.00 122.07 ? 123 ASP A OD1 1 
ATOM   980  O OD2 . ASP A 1 123 ? 17.952  29.540  3.881   1.00 127.68 ? 123 ASP A OD2 1 
ATOM   981  N N   . THR A 1 124 ? 18.870  30.288  -0.048  1.00 98.13  ? 124 THR A N   1 
ATOM   982  C CA  . THR A 1 124 ? 20.154  29.756  -0.540  1.00 96.81  ? 124 THR A CA  1 
ATOM   983  C C   . THR A 1 124 ? 19.922  28.936  -1.836  1.00 100.24 ? 124 THR A C   1 
ATOM   984  O O   . THR A 1 124 ? 20.544  27.902  -2.053  1.00 100.53 ? 124 THR A O   1 
ATOM   985  C CB  . THR A 1 124 ? 20.999  29.001  0.562   1.00 96.14  ? 124 THR A CB  1 
ATOM   986  O OG1 . THR A 1 124 ? 20.555  27.650  0.718   1.00 87.28  ? 124 THR A OG1 1 
ATOM   987  C CG2 . THR A 1 124 ? 21.042  29.725  1.919   1.00 97.89  ? 124 THR A CG2 1 
ATOM   988  N N   . ALA A 1 125 ? 19.002  29.409  -2.680  1.00 95.10  ? 125 ALA A N   1 
ATOM   989  C CA  . ALA A 1 125 ? 18.626  28.816  -3.963  1.00 93.37  ? 125 ALA A CA  1 
ATOM   990  C C   . ALA A 1 125 ? 18.314  29.973  -4.893  1.00 95.20  ? 125 ALA A C   1 
ATOM   991  O O   . ALA A 1 125 ? 18.425  31.131  -4.466  1.00 95.84  ? 125 ALA A O   1 
ATOM   992  C CB  . ALA A 1 125 ? 17.379  27.970  -3.781  1.00 93.77  ? 125 ALA A CB  1 
ATOM   993  N N   . THR A 1 126 ? 17.892  29.682  -6.141  1.00 88.48  ? 126 THR A N   1 
ATOM   994  C CA  . THR A 1 126 ? 17.480  30.734  -7.067  1.00 87.02  ? 126 THR A CA  1 
ATOM   995  C C   . THR A 1 126 ? 16.007  31.056  -6.831  1.00 91.75  ? 126 THR A C   1 
ATOM   996  O O   . THR A 1 126 ? 15.375  30.462  -5.944  1.00 91.09  ? 126 THR A O   1 
ATOM   997  C CB  . THR A 1 126 ? 17.793  30.413  -8.548  1.00 85.23  ? 126 THR A CB  1 
ATOM   998  O OG1 . THR A 1 126 ? 17.147  29.204  -8.956  1.00 81.02  ? 126 THR A OG1 1 
ATOM   999  C CG2 . THR A 1 126 ? 19.277  30.381  -8.844  1.00 78.74  ? 126 THR A CG2 1 
ATOM   1000 N N   . SER A 1 127 ? 15.472  32.014  -7.619  1.00 90.24  ? 127 SER A N   1 
ATOM   1001 C CA  . SER A 1 127 ? 14.075  32.467  -7.590  1.00 90.80  ? 127 SER A CA  1 
ATOM   1002 C C   . SER A 1 127 ? 13.142  31.455  -8.289  1.00 96.11  ? 127 SER A C   1 
ATOM   1003 O O   . SER A 1 127 ? 11.920  31.508  -8.105  1.00 95.05  ? 127 SER A O   1 
ATOM   1004 C CB  . SER A 1 127 ? 13.955  33.831  -8.252  1.00 94.23  ? 127 SER A CB  1 
ATOM   1005 O OG  . SER A 1 127 ? 14.855  34.770  -7.690  1.00 106.05 ? 127 SER A OG  1 
ATOM   1006 N N   . MET A 1 128 ? 13.738  30.518  -9.068  1.00 94.09  ? 128 MET A N   1 
ATOM   1007 C CA  . MET A 1 128 ? 13.034  29.469  -9.803  1.00 94.13  ? 128 MET A CA  1 
ATOM   1008 C C   . MET A 1 128 ? 12.925  28.146  -9.017  1.00 95.73  ? 128 MET A C   1 
ATOM   1009 O O   . MET A 1 128 ? 13.914  27.645  -8.469  1.00 95.24  ? 128 MET A O   1 
ATOM   1010 C CB  . MET A 1 128 ? 13.664  29.253  -11.181 1.00 97.05  ? 128 MET A CB  1 
ATOM   1011 C CG  . MET A 1 128 ? 12.753  28.514  -12.134 1.00 101.38 ? 128 MET A CG  1 
ATOM   1012 S SD  . MET A 1 128 ? 13.641  27.891  -13.571 1.00 106.48 ? 128 MET A SD  1 
ATOM   1013 C CE  . MET A 1 128 ? 14.349  26.433  -12.882 1.00 103.36 ? 128 MET A CE  1 
ATOM   1014 N N   . PHE A 1 129 ? 11.699  27.603  -8.974  1.00 89.37  ? 129 PHE A N   1 
ATOM   1015 C CA  . PHE A 1 129 ? 11.326  26.377  -8.282  1.00 87.57  ? 129 PHE A CA  1 
ATOM   1016 C C   . PHE A 1 129 ? 10.525  25.491  -9.232  1.00 90.23  ? 129 PHE A C   1 
ATOM   1017 O O   . PHE A 1 129 ? 9.934   25.984  -10.191 1.00 90.22  ? 129 PHE A O   1 
ATOM   1018 C CB  . PHE A 1 129 ? 10.491  26.718  -7.025  1.00 88.58  ? 129 PHE A CB  1 
ATOM   1019 C CG  . PHE A 1 129 ? 11.259  27.341  -5.876  1.00 89.21  ? 129 PHE A CG  1 
ATOM   1020 C CD1 . PHE A 1 129 ? 11.742  28.647  -5.961  1.00 91.30  ? 129 PHE A CD1 1 
ATOM   1021 C CD2 . PHE A 1 129 ? 11.465  26.639  -4.695  1.00 90.67  ? 129 PHE A CD2 1 
ATOM   1022 C CE1 . PHE A 1 129 ? 12.468  29.216  -4.908  1.00 91.80  ? 129 PHE A CE1 1 
ATOM   1023 C CE2 . PHE A 1 129 ? 12.166  27.223  -3.627  1.00 93.14  ? 129 PHE A CE2 1 
ATOM   1024 C CZ  . PHE A 1 129 ? 12.669  28.503  -3.746  1.00 90.89  ? 129 PHE A CZ  1 
ATOM   1025 N N   . LEU A 1 130 ? 10.517  24.180  -8.982  1.00 85.71  ? 130 LEU A N   1 
ATOM   1026 C CA  . LEU A 1 130 ? 9.780   23.241  -9.821  1.00 85.36  ? 130 LEU A CA  1 
ATOM   1027 C C   . LEU A 1 130 ? 8.850   22.327  -9.032  1.00 89.33  ? 130 LEU A C   1 
ATOM   1028 O O   . LEU A 1 130 ? 9.219   21.840  -7.961  1.00 87.82  ? 130 LEU A O   1 
ATOM   1029 C CB  . LEU A 1 130 ? 10.736  22.429  -10.677 1.00 85.40  ? 130 LEU A CB  1 
ATOM   1030 C CG  . LEU A 1 130 ? 11.548  23.287  -11.622 1.00 90.40  ? 130 LEU A CG  1 
ATOM   1031 C CD1 . LEU A 1 130 ? 13.004  23.292  -11.249 1.00 89.85  ? 130 LEU A CD1 1 
ATOM   1032 C CD2 . LEU A 1 130 ? 11.228  22.994  -13.059 1.00 94.19  ? 130 LEU A CD2 1 
ATOM   1033 N N   . LEU A 1 131 ? 7.620   22.146  -9.554  1.00 86.43  ? 131 LEU A N   1 
ATOM   1034 C CA  . LEU A 1 131 ? 6.587   21.289  -8.996  1.00 86.55  ? 131 LEU A CA  1 
ATOM   1035 C C   . LEU A 1 131 ? 6.418   20.116  -9.934  1.00 94.18  ? 131 LEU A C   1 
ATOM   1036 O O   . LEU A 1 131 ? 6.233   20.304  -11.141 1.00 92.58  ? 131 LEU A O   1 
ATOM   1037 C CB  . LEU A 1 131 ? 5.262   22.033  -8.826  1.00 86.05  ? 131 LEU A CB  1 
ATOM   1038 C CG  . LEU A 1 131 ? 4.288   21.361  -7.869  1.00 90.26  ? 131 LEU A CG  1 
ATOM   1039 C CD1 . LEU A 1 131 ? 4.404   21.946  -6.486  1.00 90.03  ? 131 LEU A CD1 1 
ATOM   1040 C CD2 . LEU A 1 131 ? 2.859   21.412  -8.402  1.00 92.62  ? 131 LEU A CD2 1 
ATOM   1041 N N   . LEU A 1 132 ? 6.483   18.902  -9.377  1.00 95.11  ? 132 LEU A N   1 
ATOM   1042 C CA  . LEU A 1 132 ? 6.404   17.676  -10.154 1.00 97.04  ? 132 LEU A CA  1 
ATOM   1043 C C   . LEU A 1 132 ? 5.313   16.702  -9.660  1.00 109.69 ? 132 LEU A C   1 
ATOM   1044 O O   . LEU A 1 132 ? 5.216   16.439  -8.461  1.00 110.28 ? 132 LEU A O   1 
ATOM   1045 C CB  . LEU A 1 132 ? 7.792   17.028  -10.125 1.00 96.14  ? 132 LEU A CB  1 
ATOM   1046 C CG  . LEU A 1 132 ? 7.935   15.701  -10.800 1.00 99.35  ? 132 LEU A CG  1 
ATOM   1047 C CD1 . LEU A 1 132 ? 9.093   15.708  -11.657 1.00 99.03  ? 132 LEU A CD1 1 
ATOM   1048 C CD2 . LEU A 1 132 ? 8.070   14.594  -9.781  1.00 101.56 ? 132 LEU A CD2 1 
ATOM   1049 N N   . LYS A 1 133 ? 4.531   16.135  -10.595 1.00 111.66 ? 133 LYS A N   1 
ATOM   1050 C CA  . LYS A 1 133 ? 3.498   15.145  -10.286 1.00 113.95 ? 133 LYS A CA  1 
ATOM   1051 C C   . LYS A 1 133 ? 4.018   13.736  -10.659 1.00 124.05 ? 133 LYS A C   1 
ATOM   1052 O O   . LYS A 1 133 ? 4.036   13.355  -11.841 1.00 123.62 ? 133 LYS A O   1 
ATOM   1053 C CB  . LYS A 1 133 ? 2.164   15.498  -10.979 1.00 116.23 ? 133 LYS A CB  1 
ATOM   1054 C CG  . LYS A 1 133 ? 0.966   14.653  -10.540 1.00 131.61 ? 133 LYS A CG  1 
ATOM   1055 C CD  . LYS A 1 133 ? 0.527   13.708  -11.660 1.00 141.65 ? 133 LYS A CD  1 
ATOM   1056 C CE  . LYS A 1 133 ? -0.810  13.051  -11.422 1.00 149.74 ? 133 LYS A CE  1 
ATOM   1057 N NZ  . LYS A 1 133 ? -1.939  13.998  -11.609 1.00 154.85 ? 133 LYS A NZ  1 
ATOM   1058 N N   . GLU A 1 134 ? 4.469   12.987  -9.630  1.00 125.42 ? 134 GLU A N   1 
ATOM   1059 C CA  . GLU A 1 134 ? 5.022   11.632  -9.758  1.00 127.87 ? 134 GLU A CA  1 
ATOM   1060 C C   . GLU A 1 134 ? 4.116   10.674  -10.524 1.00 136.83 ? 134 GLU A C   1 
ATOM   1061 O O   . GLU A 1 134 ? 2.897   10.692  -10.338 1.00 136.90 ? 134 GLU A O   1 
ATOM   1062 C CB  . GLU A 1 134 ? 5.349   11.035  -8.379  1.00 129.54 ? 134 GLU A CB  1 
ATOM   1063 C CG  . GLU A 1 134 ? 6.523   11.700  -7.679  1.00 141.82 ? 134 GLU A CG  1 
ATOM   1064 C CD  . GLU A 1 134 ? 7.027   10.994  -6.434  1.00 157.98 ? 134 GLU A CD  1 
ATOM   1065 O OE1 . GLU A 1 134 ? 8.240   10.687  -6.382  1.00 160.13 ? 134 GLU A OE1 1 
ATOM   1066 O OE2 . GLU A 1 134 ? 6.223   10.760  -5.503  1.00 141.03 ? 134 GLU A OE2 1 
ATOM   1067 N N   . GLY A 1 135 ? 4.736   9.858   -11.375 1.00 136.72 ? 135 GLY A N   1 
ATOM   1068 C CA  . GLY A 1 135 ? 4.066   8.836   -12.175 1.00 138.18 ? 135 GLY A CA  1 
ATOM   1069 C C   . GLY A 1 135 ? 3.185   9.363   -13.287 1.00 145.04 ? 135 GLY A C   1 
ATOM   1070 O O   . GLY A 1 135 ? 3.573   10.315  -13.974 1.00 143.80 ? 135 GLY A O   1 
ATOM   1071 N N   . ARG A 1 136 ? 1.990   8.712   -13.468 1.00 144.31 ? 136 ARG A N   1 
ATOM   1072 C CA  . ARG A 1 136 ? 0.938   9.012   -14.463 1.00 145.00 ? 136 ARG A CA  1 
ATOM   1073 C C   . ARG A 1 136 ? 0.896   10.504  -14.820 1.00 150.46 ? 136 ARG A C   1 
ATOM   1074 O O   . ARG A 1 136 ? 0.523   11.332  -13.977 1.00 150.38 ? 136 ARG A O   1 
ATOM   1075 C CB  . ARG A 1 136 ? -0.440  8.501   -13.995 1.00 145.26 ? 136 ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 136 ? -0.639  6.999   -14.171 1.00 155.29 ? 136 ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 136 ? -1.900  6.500   -13.482 1.00 162.80 ? 136 ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 136 ? -1.677  6.195   -12.072 1.00 165.77 ? 136 ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 136 ? -2.091  6.950   -11.060 1.00 171.33 ? 136 ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 136 ? -2.780  8.067   -11.291 1.00 153.79 ? 136 ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 136 ? -1.830  6.594   -9.805  1.00 153.12 ? 136 ARG A NH2 1 
ATOM   1082 N N   . SER A 1 137 ? 1.353   10.833  -16.058 1.00 146.83 ? 137 SER A N   1 
ATOM   1083 C CA  . SER A 1 137 ? 1.515   12.181  -16.623 1.00 146.20 ? 137 SER A CA  1 
ATOM   1084 C C   . SER A 1 137 ? 2.553   13.019  -15.796 1.00 147.57 ? 137 SER A C   1 
ATOM   1085 O O   . SER A 1 137 ? 2.216   14.046  -15.195 1.00 146.83 ? 137 SER A O   1 
ATOM   1086 C CB  . SER A 1 137 ? 0.171   12.892  -16.847 1.00 150.25 ? 137 SER A CB  1 
ATOM   1087 O OG  . SER A 1 137 ? -0.644  13.041  -15.693 1.00 158.29 ? 137 SER A OG  1 
ATOM   1088 N N   . SER A 1 138 ? 3.831   12.541  -15.783 1.00 142.09 ? 138 SER A N   1 
ATOM   1089 C CA  . SER A 1 138 ? 4.981   13.150  -15.090 1.00 140.31 ? 138 SER A CA  1 
ATOM   1090 C C   . SER A 1 138 ? 5.440   14.464  -15.756 1.00 140.26 ? 138 SER A C   1 
ATOM   1091 O O   . SER A 1 138 ? 6.514   14.527  -16.383 1.00 140.49 ? 138 SER A O   1 
ATOM   1092 C CB  . SER A 1 138 ? 6.136   12.150  -14.944 1.00 143.30 ? 138 SER A CB  1 
ATOM   1093 O OG  . SER A 1 138 ? 6.802   11.854  -16.163 1.00 148.31 ? 138 SER A OG  1 
ATOM   1094 N N   . HIS A 1 139 ? 4.595   15.510  -15.625 1.00 132.12 ? 139 HIS A N   1 
ATOM   1095 C CA  . HIS A 1 139 ? 4.858   16.844  -16.176 1.00 129.44 ? 139 HIS A CA  1 
ATOM   1096 C C   . HIS A 1 139 ? 5.469   17.745  -15.111 1.00 125.27 ? 139 HIS A C   1 
ATOM   1097 O O   . HIS A 1 139 ? 5.236   17.527  -13.915 1.00 124.75 ? 139 HIS A O   1 
ATOM   1098 C CB  . HIS A 1 139 ? 3.577   17.485  -16.757 1.00 130.70 ? 139 HIS A CB  1 
ATOM   1099 C CG  . HIS A 1 139 ? 3.134   16.899  -18.066 1.00 134.08 ? 139 HIS A CG  1 
ATOM   1100 N ND1 . HIS A 1 139 ? 3.594   17.398  -19.271 1.00 135.94 ? 139 HIS A ND1 1 
ATOM   1101 C CD2 . HIS A 1 139 ? 2.273   15.882  -18.316 1.00 135.61 ? 139 HIS A CD2 1 
ATOM   1102 C CE1 . HIS A 1 139 ? 3.008   16.669  -20.209 1.00 134.97 ? 139 HIS A CE1 1 
ATOM   1103 N NE2 . HIS A 1 139 ? 2.208   15.742  -19.683 1.00 135.89 ? 139 HIS A NE2 1 
ATOM   1104 N N   . VAL A 1 140 ? 6.257   18.744  -15.541 1.00 114.99 ? 140 VAL A N   1 
ATOM   1105 C CA  . VAL A 1 140 ? 6.897   19.683  -14.621 1.00 111.42 ? 140 VAL A CA  1 
ATOM   1106 C C   . VAL A 1 140 ? 6.246   21.042  -14.733 1.00 108.22 ? 140 VAL A C   1 
ATOM   1107 O O   . VAL A 1 140 ? 5.923   21.465  -15.841 1.00 107.96 ? 140 VAL A O   1 
ATOM   1108 C CB  . VAL A 1 140 ? 8.444   19.737  -14.722 1.00 114.86 ? 140 VAL A CB  1 
ATOM   1109 C CG1 . VAL A 1 140 ? 9.063   18.387  -14.364 1.00 114.44 ? 140 VAL A CG1 1 
ATOM   1110 C CG2 . VAL A 1 140 ? 8.904   20.189  -16.103 1.00 114.83 ? 140 VAL A CG2 1 
ATOM   1111 N N   . GLN A 1 141 ? 5.990   21.691  -13.583 1.00 99.20  ? 141 GLN A N   1 
ATOM   1112 C CA  . GLN A 1 141 ? 5.379   23.018  -13.488 1.00 96.30  ? 141 GLN A CA  1 
ATOM   1113 C C   . GLN A 1 141 ? 6.421   23.926  -12.826 1.00 95.45  ? 141 GLN A C   1 
ATOM   1114 O O   . GLN A 1 141 ? 6.930   23.608  -11.759 1.00 94.47  ? 141 GLN A O   1 
ATOM   1115 C CB  . GLN A 1 141 ? 4.037   22.986  -12.701 1.00 97.65  ? 141 GLN A CB  1 
ATOM   1116 C CG  . GLN A 1 141 ? 2.960   21.968  -13.206 1.00 110.67 ? 141 GLN A CG  1 
ATOM   1117 C CD  . GLN A 1 141 ? 2.547   20.823  -12.246 1.00 112.00 ? 141 GLN A CD  1 
ATOM   1118 O OE1 . GLN A 1 141 ? 3.349   19.947  -11.852 1.00 94.05  ? 141 GLN A OE1 1 
ATOM   1119 N NE2 . GLN A 1 141 ? 1.256   20.773  -11.895 1.00 98.73  ? 141 GLN A NE2 1 
ATOM   1120 N N   . ARG A 1 142 ? 6.797   25.009  -13.510 1.00 89.92  ? 142 ARG A N   1 
ATOM   1121 C CA  . ARG A 1 142 ? 7.803   25.987  -13.094 1.00 87.86  ? 142 ARG A CA  1 
ATOM   1122 C C   . ARG A 1 142 ? 7.181   27.129  -12.272 1.00 91.21  ? 142 ARG A C   1 
ATOM   1123 O O   . ARG A 1 142 ? 6.123   27.653  -12.632 1.00 90.80  ? 142 ARG A O   1 
ATOM   1124 C CB  . ARG A 1 142 ? 8.455   26.546  -14.347 1.00 83.37  ? 142 ARG A CB  1 
ATOM   1125 C CG  . ARG A 1 142 ? 9.856   27.043  -14.136 1.00 88.20  ? 142 ARG A CG  1 
ATOM   1126 C CD  . ARG A 1 142 ? 10.461  27.494  -15.454 1.00 92.77  ? 142 ARG A CD  1 
ATOM   1127 N NE  . ARG A 1 142 ? 10.896  26.374  -16.289 1.00 101.08 ? 142 ARG A NE  1 
ATOM   1128 C CZ  . ARG A 1 142 ? 11.636  26.500  -17.381 1.00 117.34 ? 142 ARG A CZ  1 
ATOM   1129 N NH1 . ARG A 1 142 ? 12.028  27.697  -17.792 1.00 81.94  ? 142 ARG A NH1 1 
ATOM   1130 N NH2 . ARG A 1 142 ? 11.985  25.428  -18.076 1.00 127.42 ? 142 ARG A NH2 1 
ATOM   1131 N N   . GLY A 1 143 ? 7.850   27.511  -11.192 1.00 87.76  ? 143 GLY A N   1 
ATOM   1132 C CA  . GLY A 1 143 ? 7.391   28.567  -10.293 1.00 87.72  ? 143 GLY A CA  1 
ATOM   1133 C C   . GLY A 1 143 ? 8.455   29.581  -9.927  1.00 92.06  ? 143 GLY A C   1 
ATOM   1134 O O   . GLY A 1 143 ? 9.639   29.246  -9.805  1.00 91.40  ? 143 GLY A O   1 
ATOM   1135 N N   . TYR A 1 144 ? 8.029   30.836  -9.749  1.00 88.75  ? 144 TYR A N   1 
ATOM   1136 C CA  . TYR A 1 144 ? 8.921   31.951  -9.436  1.00 88.54  ? 144 TYR A CA  1 
ATOM   1137 C C   . TYR A 1 144 ? 8.603   32.546  -8.082  1.00 93.98  ? 144 TYR A C   1 
ATOM   1138 O O   . TYR A 1 144 ? 7.434   32.599  -7.682  1.00 94.75  ? 144 TYR A O   1 
ATOM   1139 C CB  . TYR A 1 144 ? 8.917   32.999  -10.573 1.00 89.15  ? 144 TYR A CB  1 
ATOM   1140 C CG  . TYR A 1 144 ? 9.454   32.434  -11.874 1.00 90.70  ? 144 TYR A CG  1 
ATOM   1141 C CD1 . TYR A 1 144 ? 10.824  32.401  -12.127 1.00 92.73  ? 144 TYR A CD1 1 
ATOM   1142 C CD2 . TYR A 1 144 ? 8.604   31.855  -12.814 1.00 91.18  ? 144 TYR A CD2 1 
ATOM   1143 C CE1 . TYR A 1 144 ? 11.333  31.808  -13.277 1.00 93.74  ? 144 TYR A CE1 1 
ATOM   1144 C CE2 . TYR A 1 144 ? 9.102   31.258  -13.970 1.00 92.11  ? 144 TYR A CE2 1 
ATOM   1145 C CZ  . TYR A 1 144 ? 10.468  31.252  -14.205 1.00 103.14 ? 144 TYR A CZ  1 
ATOM   1146 O OH  . TYR A 1 144 ? 10.983  30.737  -15.374 1.00 109.15 ? 144 TYR A OH  1 
ATOM   1147 N N   . GLY A 1 145 ? 9.649   32.913  -7.355  1.00 89.92  ? 145 GLY A N   1 
ATOM   1148 C CA  . GLY A 1 145 ? 9.514   33.472  -6.019  1.00 89.47  ? 145 GLY A CA  1 
ATOM   1149 C C   . GLY A 1 145 ? 10.818  33.510  -5.265  1.00 92.77  ? 145 GLY A C   1 
ATOM   1150 O O   . GLY A 1 145 ? 11.580  32.542  -5.278  1.00 92.12  ? 145 GLY A O   1 
ATOM   1151 N N   . LYS A 1 146 ? 11.087  34.633  -4.619  1.00 90.17  ? 146 LYS A N   1 
ATOM   1152 C CA  . LYS A 1 146 ? 12.299  34.809  -3.831  1.00 90.67  ? 146 LYS A CA  1 
ATOM   1153 C C   . LYS A 1 146 ? 12.102  34.053  -2.501  1.00 96.62  ? 146 LYS A C   1 
ATOM   1154 O O   . LYS A 1 146 ? 11.176  34.374  -1.750  1.00 97.47  ? 146 LYS A O   1 
ATOM   1155 C CB  . LYS A 1 146 ? 12.565  36.315  -3.586  1.00 92.50  ? 146 LYS A CB  1 
ATOM   1156 C CG  . LYS A 1 146 ? 13.045  37.116  -4.790  1.00 92.90  ? 146 LYS A CG  1 
ATOM   1157 C CD  . LYS A 1 146 ? 13.276  38.573  -4.388  1.00 99.01  ? 146 LYS A CD  1 
ATOM   1158 C CE  . LYS A 1 146 ? 14.114  39.362  -5.373  1.00 104.46 ? 146 LYS A CE  1 
ATOM   1159 N NZ  . LYS A 1 146 ? 14.043  40.838  -5.128  1.00 107.28 ? 146 LYS A NZ  1 
ATOM   1160 N N   . VAL A 1 147 ? 12.915  33.006  -2.250  1.00 93.30  ? 147 VAL A N   1 
ATOM   1161 C CA  . VAL A 1 147 ? 12.897  32.179  -1.028  1.00 93.16  ? 147 VAL A CA  1 
ATOM   1162 C C   . VAL A 1 147 ? 11.672  31.220  -0.965  1.00 97.35  ? 147 VAL A C   1 
ATOM   1163 O O   . VAL A 1 147 ? 11.850  30.046  -0.654  1.00 97.19  ? 147 VAL A O   1 
ATOM   1164 C CB  . VAL A 1 147 ? 13.078  33.022  0.265   1.00 96.90  ? 147 VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 147 ? 12.559  32.301  1.502   1.00 97.06  ? 147 VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 147 ? 14.539  33.401  0.447   1.00 96.65  ? 147 VAL A CG2 1 
ATOM   1167 N N   . GLN A 1 148 ? 10.464  31.703  -1.242  1.00 94.55  ? 148 GLN A N   1 
ATOM   1168 C CA  . GLN A 1 148 ? 9.265   30.868  -1.237  1.00 94.98  ? 148 GLN A CA  1 
ATOM   1169 C C   . GLN A 1 148 ? 8.507   31.089  -2.527  1.00 101.67 ? 148 GLN A C   1 
ATOM   1170 O O   . GLN A 1 148 ? 8.214   32.236  -2.910  1.00 102.16 ? 148 GLN A O   1 
ATOM   1171 C CB  . GLN A 1 148 ? 8.377   31.191  -0.040  1.00 96.14  ? 148 GLN A CB  1 
ATOM   1172 C CG  . GLN A 1 148 ? 7.522   30.031  0.422   1.00 110.27 ? 148 GLN A CG  1 
ATOM   1173 C CD  . GLN A 1 148 ? 6.822   30.381  1.717   1.00 131.16 ? 148 GLN A CD  1 
ATOM   1174 O OE1 . GLN A 1 148 ? 7.433   30.440  2.802   1.00 122.06 ? 148 GLN A OE1 1 
ATOM   1175 N NE2 . GLN A 1 148 ? 5.520   30.633  1.629   1.00 126.84 ? 148 GLN A NE2 1 
ATOM   1176 N N   . ALA A 1 149 ? 8.209   29.992  -3.213  1.00 98.89  ? 149 ALA A N   1 
ATOM   1177 C CA  . ALA A 1 149 ? 7.486   30.054  -4.467  1.00 99.32  ? 149 ALA A CA  1 
ATOM   1178 C C   . ALA A 1 149 ? 6.068   29.515  -4.322  1.00 104.89 ? 149 ALA A C   1 
ATOM   1179 O O   . ALA A 1 149 ? 5.824   28.549  -3.588  1.00 103.13 ? 149 ALA A O   1 
ATOM   1180 C CB  . ALA A 1 149 ? 8.238   29.307  -5.545  1.00 100.04 ? 149 ALA A CB  1 
ATOM   1181 N N   . GLU A 1 150 ? 5.134   30.177  -5.030  1.00 103.83 ? 150 GLU A N   1 
ATOM   1182 C CA  . GLU A 1 150 ? 3.704   29.875  -5.061  1.00 104.03 ? 150 GLU A CA  1 
ATOM   1183 C C   . GLU A 1 150 ? 3.333   29.131  -6.360  1.00 107.03 ? 150 GLU A C   1 
ATOM   1184 O O   . GLU A 1 150 ? 3.558   29.636  -7.468  1.00 106.14 ? 150 GLU A O   1 
ATOM   1185 C CB  . GLU A 1 150 ? 2.903   31.182  -4.923  1.00 105.51 ? 150 GLU A CB  1 
ATOM   1186 C CG  . GLU A 1 150 ? 1.438   31.003  -4.580  1.00 114.75 ? 150 GLU A CG  1 
ATOM   1187 C CD  . GLU A 1 150 ? 0.749   32.328  -4.322  1.00 130.26 ? 150 GLU A CD  1 
ATOM   1188 O OE1 . GLU A 1 150 ? -0.100  32.727  -5.152  1.00 126.47 ? 150 GLU A OE1 1 
ATOM   1189 O OE2 . GLU A 1 150 ? 1.073   32.977  -3.300  1.00 113.00 ? 150 GLU A OE2 1 
ATOM   1190 N N   . PHE A 1 151 ? 2.762   27.924  -6.194  1.00 102.61 ? 151 PHE A N   1 
ATOM   1191 C CA  . PHE A 1 151 ? 2.298   27.035  -7.258  1.00 101.00 ? 151 PHE A CA  1 
ATOM   1192 C C   . PHE A 1 151 ? 0.760   26.892  -7.187  1.00 101.46 ? 151 PHE A C   1 
ATOM   1193 O O   . PHE A 1 151 ? 0.264   25.904  -6.637  1.00 99.02  ? 151 PHE A O   1 
ATOM   1194 C CB  . PHE A 1 151 ? 2.988   25.660  -7.163  1.00 102.31 ? 151 PHE A CB  1 
ATOM   1195 C CG  . PHE A 1 151 ? 4.452   25.686  -7.500  1.00 103.25 ? 151 PHE A CG  1 
ATOM   1196 C CD1 . PHE A 1 151 ? 4.880   25.507  -8.805  1.00 105.92 ? 151 PHE A CD1 1 
ATOM   1197 C CD2 . PHE A 1 151 ? 5.404   25.901  -6.515  1.00 105.56 ? 151 PHE A CD2 1 
ATOM   1198 C CE1 . PHE A 1 151 ? 6.241   25.519  -9.118  1.00 106.80 ? 151 PHE A CE1 1 
ATOM   1199 C CE2 . PHE A 1 151 ? 6.764   25.936  -6.832  1.00 108.38 ? 151 PHE A CE2 1 
ATOM   1200 C CZ  . PHE A 1 151 ? 7.173   25.746  -8.132  1.00 106.15 ? 151 PHE A CZ  1 
ATOM   1201 N N   . PRO A 1 152 ? -0.004  27.878  -7.727  1.00 97.24  ? 152 PRO A N   1 
ATOM   1202 C CA  . PRO A 1 152 ? -1.470  27.778  -7.691  1.00 96.92  ? 152 PRO A CA  1 
ATOM   1203 C C   . PRO A 1 152 ? -2.009  26.762  -8.688  1.00 102.54 ? 152 PRO A C   1 
ATOM   1204 O O   . PRO A 1 152 ? -1.518  26.651  -9.801  1.00 102.67 ? 152 PRO A O   1 
ATOM   1205 C CB  . PRO A 1 152 ? -1.936  29.201  -8.027  1.00 98.27  ? 152 PRO A CB  1 
ATOM   1206 C CG  . PRO A 1 152 ? -0.688  30.047  -8.039  1.00 102.84 ? 152 PRO A CG  1 
ATOM   1207 C CD  . PRO A 1 152 ? 0.410   29.120  -8.401  1.00 98.41  ? 152 PRO A CD  1 
ATOM   1208 N N   . LEU A 1 153 ? -3.011  26.009  -8.270  1.00 100.68 ? 153 LEU A N   1 
ATOM   1209 C CA  . LEU A 1 153 ? -3.657  24.973  -9.067  1.00 101.40 ? 153 LEU A CA  1 
ATOM   1210 C C   . LEU A 1 153 ? -5.084  25.399  -9.333  1.00 107.34 ? 153 LEU A C   1 
ATOM   1211 O O   . LEU A 1 153 ? -5.679  24.961  -10.320 1.00 105.81 ? 153 LEU A O   1 
ATOM   1212 C CB  . LEU A 1 153 ? -3.662  23.660  -8.265  1.00 101.71 ? 153 LEU A CB  1 
ATOM   1213 C CG  . LEU A 1 153 ? -2.480  22.698  -8.436  1.00 107.23 ? 153 LEU A CG  1 
ATOM   1214 C CD1 . LEU A 1 153 ? -1.134  23.359  -8.147  1.00 107.75 ? 153 LEU A CD1 1 
ATOM   1215 C CD2 . LEU A 1 153 ? -2.639  21.495  -7.538  1.00 109.75 ? 153 LEU A CD2 1 
ATOM   1216 N N   . GLY A 1 154 ? -5.616  26.237  -8.431  1.00 107.04 ? 154 GLY A N   1 
ATOM   1217 C CA  . GLY A 1 154 ? -6.980  26.756  -8.473  1.00 108.04 ? 154 GLY A CA  1 
ATOM   1218 C C   . GLY A 1 154 ? -8.014  25.702  -8.116  1.00 114.72 ? 154 GLY A C   1 
ATOM   1219 O O   . GLY A 1 154 ? -7.699  24.761  -7.374  1.00 114.02 ? 154 GLY A O   1 
ATOM   1220 N N   . PRO A 1 155 ? -9.266  25.814  -8.639  1.00 113.32 ? 155 PRO A N   1 
ATOM   1221 C CA  . PRO A 1 155 ? -10.284 24.793  -8.323  1.00 113.55 ? 155 PRO A CA  1 
ATOM   1222 C C   . PRO A 1 155 ? -9.854  23.379  -8.739  1.00 118.23 ? 155 PRO A C   1 
ATOM   1223 O O   . PRO A 1 155 ? -9.712  23.076  -9.924  1.00 116.74 ? 155 PRO A O   1 
ATOM   1224 C CB  . PRO A 1 155 ? -11.550 25.312  -9.029  1.00 115.08 ? 155 PRO A CB  1 
ATOM   1225 C CG  . PRO A 1 155 ? -11.300 26.782  -9.235  1.00 119.12 ? 155 PRO A CG  1 
ATOM   1226 C CD  . PRO A 1 155 ? -9.824  26.864  -9.518  1.00 114.75 ? 155 PRO A CD  1 
ATOM   1227 N N   . VAL A 1 156 ? -9.548  22.555  -7.726  1.00 117.60 ? 156 VAL A N   1 
ATOM   1228 C CA  . VAL A 1 156 ? -9.087  21.159  -7.846  1.00 119.10 ? 156 VAL A CA  1 
ATOM   1229 C C   . VAL A 1 156 ? -10.068 20.274  -8.615  1.00 125.75 ? 156 VAL A C   1 
ATOM   1230 O O   . VAL A 1 156 ? -11.287 20.457  -8.522  1.00 126.17 ? 156 VAL A O   1 
ATOM   1231 C CB  . VAL A 1 156 ? -8.758  20.462  -6.477  1.00 123.22 ? 156 VAL A CB  1 
ATOM   1232 C CG1 . VAL A 1 156 ? -7.434  19.718  -6.528  1.00 122.90 ? 156 VAL A CG1 1 
ATOM   1233 C CG2 . VAL A 1 156 ? -8.792  21.410  -5.293  1.00 123.07 ? 156 VAL A CG2 1 
ATOM   1234 N N   . THR A 1 157 ? -9.526  19.280  -9.325  1.00 123.03 ? 157 THR A N   1 
ATOM   1235 C CA  . THR A 1 157 ? -10.297 18.263  -10.025 1.00 123.51 ? 157 THR A CA  1 
ATOM   1236 C C   . THR A 1 157 ? -9.718  16.885  -9.684  1.00 129.55 ? 157 THR A C   1 
ATOM   1237 O O   . THR A 1 157 ? -8.773  16.806  -8.889  1.00 129.29 ? 157 THR A O   1 
ATOM   1238 C CB  . THR A 1 157 ? -10.453 18.572  -11.513 1.00 131.37 ? 157 THR A CB  1 
ATOM   1239 O OG1 . THR A 1 157 ? -9.208  19.025  -12.041 1.00 129.49 ? 157 THR A OG1 1 
ATOM   1240 C CG2 . THR A 1 157 ? -11.566 19.586  -11.783 1.00 130.87 ? 157 THR A CG2 1 
ATOM   1241 N N   . THR A 1 158 ? -10.300 15.801  -10.240 1.00 126.93 ? 158 THR A N   1 
ATOM   1242 C CA  . THR A 1 158 ? -9.868  14.426  -9.956  1.00 126.80 ? 158 THR A CA  1 
ATOM   1243 C C   . THR A 1 158 ? -8.480  14.106  -10.565 1.00 130.26 ? 158 THR A C   1 
ATOM   1244 O O   . THR A 1 158 ? -7.792  13.210  -10.070 1.00 129.71 ? 158 THR A O   1 
ATOM   1245 C CB  . THR A 1 158 ? -10.951 13.409  -10.345 1.00 135.30 ? 158 THR A CB  1 
ATOM   1246 O OG1 . THR A 1 158 ? -10.855 13.103  -11.736 1.00 137.18 ? 158 THR A OG1 1 
ATOM   1247 C CG2 . THR A 1 158 ? -12.367 13.873  -9.973  1.00 132.77 ? 158 THR A CG2 1 
ATOM   1248 N N   . ALA A 1 159 ? -8.079  14.836  -11.628 1.00 126.52 ? 159 ALA A N   1 
ATOM   1249 C CA  . ALA A 1 159 ? -6.771  14.690  -12.269 1.00 126.33 ? 159 ALA A CA  1 
ATOM   1250 C C   . ALA A 1 159 ? -5.705  15.280  -11.338 1.00 130.26 ? 159 ALA A C   1 
ATOM   1251 O O   . ALA A 1 159 ? -4.603  14.742  -11.240 1.00 129.54 ? 159 ALA A O   1 
ATOM   1252 C CB  . ALA A 1 159 ? -6.758  15.411  -13.609 1.00 127.06 ? 159 ALA A CB  1 
ATOM   1253 N N   . HIS A 1 160 ? -6.079  16.349  -10.600 1.00 127.15 ? 160 HIS A N   1 
ATOM   1254 C CA  . HIS A 1 160 ? -5.255  17.054  -9.616  1.00 127.35 ? 160 HIS A CA  1 
ATOM   1255 C C   . HIS A 1 160 ? -4.866  16.168  -8.433  1.00 130.93 ? 160 HIS A C   1 
ATOM   1256 O O   . HIS A 1 160 ? -4.261  16.656  -7.468  1.00 130.64 ? 160 HIS A O   1 
ATOM   1257 C CB  . HIS A 1 160 ? -5.987  18.296  -9.116  1.00 127.84 ? 160 HIS A CB  1 
ATOM   1258 C CG  . HIS A 1 160 ? -5.994  19.431  -10.080 1.00 131.90 ? 160 HIS A CG  1 
ATOM   1259 N ND1 . HIS A 1 160 ? -6.518  19.294  -11.351 1.00 133.54 ? 160 HIS A ND1 1 
ATOM   1260 C CD2 . HIS A 1 160 ? -5.566  20.703  -9.915  1.00 133.66 ? 160 HIS A CD2 1 
ATOM   1261 C CE1 . HIS A 1 160 ? -6.376  20.478  -11.924 1.00 133.58 ? 160 HIS A CE1 1 
ATOM   1262 N NE2 . HIS A 1 160 ? -5.808  21.358  -11.097 1.00 133.53 ? 160 HIS A NE2 1 
ATOM   1263 N N   . ARG A 1 161 ? -5.224  14.865  -8.509  1.00 126.93 ? 161 ARG A N   1 
ATOM   1264 C CA  . ARG A 1 161 ? -4.880  13.836  -7.534  1.00 125.90 ? 161 ARG A CA  1 
ATOM   1265 C C   . ARG A 1 161 ? -3.451  13.402  -7.828  1.00 128.65 ? 161 ARG A C   1 
ATOM   1266 O O   . ARG A 1 161 ? -2.953  13.589  -8.942  1.00 128.00 ? 161 ARG A O   1 
ATOM   1267 C CB  . ARG A 1 161 ? -5.819  12.620  -7.658  1.00 124.51 ? 161 ARG A CB  1 
ATOM   1268 C CG  . ARG A 1 161 ? -7.019  12.654  -6.736  1.00 130.62 ? 161 ARG A CG  1 
ATOM   1269 C CD  . ARG A 1 161 ? -7.784  11.354  -6.793  1.00 137.48 ? 161 ARG A CD  1 
ATOM   1270 N NE  . ARG A 1 161 ? -8.973  11.400  -5.937  1.00 144.49 ? 161 ARG A NE  1 
ATOM   1271 C CZ  . ARG A 1 161 ? -10.224 11.363  -6.385  1.00 158.89 ? 161 ARG A CZ  1 
ATOM   1272 N NH1 . ARG A 1 161 ? -10.469 11.261  -7.685  1.00 149.08 ? 161 ARG A NH1 1 
ATOM   1273 N NH2 . ARG A 1 161 ? -11.241 11.418  -5.536  1.00 145.82 ? 161 ARG A NH2 1 
ATOM   1274 N N   . GLY A 1 162 ? -2.812  12.820  -6.830  1.00 124.51 ? 162 GLY A N   1 
ATOM   1275 C CA  . GLY A 1 162 ? -1.455  12.328  -6.967  1.00 123.79 ? 162 GLY A CA  1 
ATOM   1276 C C   . GLY A 1 162 ? -0.536  12.821  -5.880  1.00 126.25 ? 162 GLY A C   1 
ATOM   1277 O O   . GLY A 1 162 ? -0.917  13.666  -5.055  1.00 126.08 ? 162 GLY A O   1 
ATOM   1278 N N   . THR A 1 163 ? 0.676   12.250  -5.873  1.00 120.78 ? 163 THR A N   1 
ATOM   1279 C CA  . THR A 1 163 ? 1.746   12.577  -4.947  1.00 119.33 ? 163 THR A CA  1 
ATOM   1280 C C   . THR A 1 163 ? 2.682   13.588  -5.656  1.00 120.61 ? 163 THR A C   1 
ATOM   1281 O O   . THR A 1 163 ? 3.222   13.326  -6.739  1.00 120.48 ? 163 THR A O   1 
ATOM   1282 C CB  . THR A 1 163 ? 2.364   11.297  -4.361  1.00 126.48 ? 163 THR A CB  1 
ATOM   1283 O OG1 . THR A 1 163 ? 3.391   11.651  -3.440  1.00 128.17 ? 163 THR A OG1 1 
ATOM   1284 C CG2 . THR A 1 163 ? 2.869   10.305  -5.427  1.00 123.32 ? 163 THR A CG2 1 
ATOM   1285 N N   . TYR A 1 164 ? 2.771   14.785  -5.079  1.00 114.22 ? 164 TYR A N   1 
ATOM   1286 C CA  . TYR A 1 164 ? 3.528   15.898  -5.634  1.00 112.36 ? 164 TYR A CA  1 
ATOM   1287 C C   . TYR A 1 164 ? 4.861   16.082  -4.919  1.00 113.06 ? 164 TYR A C   1 
ATOM   1288 O O   . TYR A 1 164 ? 4.990   15.739  -3.732  1.00 113.68 ? 164 TYR A O   1 
ATOM   1289 C CB  . TYR A 1 164 ? 2.691   17.187  -5.574  1.00 113.48 ? 164 TYR A CB  1 
ATOM   1290 C CG  . TYR A 1 164 ? 1.484   17.201  -6.491  1.00 115.77 ? 164 TYR A CG  1 
ATOM   1291 C CD1 . TYR A 1 164 ? 0.422   16.321  -6.298  1.00 117.78 ? 164 TYR A CD1 1 
ATOM   1292 C CD2 . TYR A 1 164 ? 1.364   18.151  -7.499  1.00 117.04 ? 164 TYR A CD2 1 
ATOM   1293 C CE1 . TYR A 1 164 ? -0.695  16.338  -7.129  1.00 118.79 ? 164 TYR A CE1 1 
ATOM   1294 C CE2 . TYR A 1 164 ? 0.240   18.194  -8.323  1.00 118.23 ? 164 TYR A CE2 1 
ATOM   1295 C CZ  . TYR A 1 164 ? -0.787  17.284  -8.135  1.00 126.07 ? 164 TYR A CZ  1 
ATOM   1296 O OH  . TYR A 1 164 ? -1.889  17.321  -8.958  1.00 128.06 ? 164 TYR A OH  1 
ATOM   1297 N N   . ARG A 1 165 ? 5.859   16.618  -5.655  1.00 104.97 ? 165 ARG A N   1 
ATOM   1298 C CA  . ARG A 1 165 ? 7.214   16.867  -5.162  1.00 101.91 ? 165 ARG A CA  1 
ATOM   1299 C C   . ARG A 1 165 ? 7.737   18.211  -5.619  1.00 101.78 ? 165 ARG A C   1 
ATOM   1300 O O   . ARG A 1 165 ? 7.387   18.689  -6.700  1.00 99.64  ? 165 ARG A O   1 
ATOM   1301 C CB  . ARG A 1 165 ? 8.172   15.739  -5.589  1.00 98.07  ? 165 ARG A CB  1 
ATOM   1302 C CG  . ARG A 1 165 ? 8.538   14.812  -4.448  1.00 102.33 ? 165 ARG A CG  1 
ATOM   1303 C CD  . ARG A 1 165 ? 9.513   13.729  -4.878  1.00 103.88 ? 165 ARG A CD  1 
ATOM   1304 N NE  . ARG A 1 165 ? 10.095  12.992  -3.750  1.00 95.77  ? 165 ARG A NE  1 
ATOM   1305 C CZ  . ARG A 1 165 ? 9.551   11.914  -3.196  1.00 114.02 ? 165 ARG A CZ  1 
ATOM   1306 N NH1 . ARG A 1 165 ? 8.397   11.437  -3.656  1.00 96.20  ? 165 ARG A NH1 1 
ATOM   1307 N NH2 . ARG A 1 165 ? 10.147  11.308  -2.181  1.00 111.31 ? 165 ARG A NH2 1 
ATOM   1308 N N   . CYS A 1 166 ? 8.578   18.824  -4.792  1.00 97.76  ? 166 CYS A N   1 
ATOM   1309 C CA  . CYS A 1 166 ? 9.180   20.090  -5.137  1.00 97.89  ? 166 CYS A CA  1 
ATOM   1310 C C   . CYS A 1 166 ? 10.685  20.056  -5.170  1.00 97.27  ? 166 CYS A C   1 
ATOM   1311 O O   . CYS A 1 166 ? 11.329  19.506  -4.276  1.00 96.95  ? 166 CYS A O   1 
ATOM   1312 C CB  . CYS A 1 166 ? 8.688   21.234  -4.264  1.00 100.10 ? 166 CYS A CB  1 
ATOM   1313 S SG  . CYS A 1 166 ? 9.435   22.830  -4.697  1.00 105.34 ? 166 CYS A SG  1 
ATOM   1314 N N   . PHE A 1 167 ? 11.237  20.762  -6.171  1.00 89.38  ? 167 PHE A N   1 
ATOM   1315 C CA  . PHE A 1 167 ? 12.646  20.987  -6.391  1.00 86.07  ? 167 PHE A CA  1 
ATOM   1316 C C   . PHE A 1 167 ? 12.897  22.482  -6.386  1.00 87.90  ? 167 PHE A C   1 
ATOM   1317 O O   . PHE A 1 167 ? 12.085  23.266  -6.889  1.00 87.36  ? 167 PHE A O   1 
ATOM   1318 C CB  . PHE A 1 167 ? 13.041  20.454  -7.763  1.00 86.86  ? 167 PHE A CB  1 
ATOM   1319 C CG  . PHE A 1 167 ? 13.022  18.960  -7.876  1.00 87.54  ? 167 PHE A CG  1 
ATOM   1320 C CD1 . PHE A 1 167 ? 14.122  18.206  -7.494  1.00 90.00  ? 167 PHE A CD1 1 
ATOM   1321 C CD2 . PHE A 1 167 ? 11.918  18.303  -8.399  1.00 89.05  ? 167 PHE A CD2 1 
ATOM   1322 C CE1 . PHE A 1 167 ? 14.114  16.825  -7.621  1.00 90.54  ? 167 PHE A CE1 1 
ATOM   1323 C CE2 . PHE A 1 167 ? 11.908  16.916  -8.523  1.00 91.37  ? 167 PHE A CE2 1 
ATOM   1324 C CZ  . PHE A 1 167 ? 13.005  16.188  -8.135  1.00 89.43  ? 167 PHE A CZ  1 
ATOM   1325 N N   . GLY A 1 168 ? 14.019  22.857  -5.805  1.00 82.61  ? 168 GLY A N   1 
ATOM   1326 C CA  . GLY A 1 168 ? 14.539  24.212  -5.858  1.00 81.56  ? 168 GLY A CA  1 
ATOM   1327 C C   . GLY A 1 168 ? 15.592  24.126  -6.948  1.00 84.12  ? 168 GLY A C   1 
ATOM   1328 O O   . GLY A 1 168 ? 15.912  23.008  -7.374  1.00 84.04  ? 168 GLY A O   1 
ATOM   1329 N N   . SER A 1 169 ? 16.128  25.262  -7.434  1.00 78.53  ? 169 SER A N   1 
ATOM   1330 C CA  . SER A 1 169 ? 17.144  25.220  -8.493  1.00 77.36  ? 169 SER A CA  1 
ATOM   1331 C C   . SER A 1 169 ? 18.319  26.143  -8.209  1.00 83.92  ? 169 SER A C   1 
ATOM   1332 O O   . SER A 1 169 ? 18.173  27.148  -7.502  1.00 83.46  ? 169 SER A O   1 
ATOM   1333 C CB  . SER A 1 169 ? 16.534  25.525  -9.858  1.00 77.40  ? 169 SER A CB  1 
ATOM   1334 O OG  . SER A 1 169 ? 16.289  26.906  -10.072 1.00 76.35  ? 169 SER A OG  1 
ATOM   1335 N N   . TYR A 1 170 ? 19.494  25.783  -8.747  1.00 81.51  ? 170 TYR A N   1 
ATOM   1336 C CA  . TYR A 1 170 ? 20.737  26.545  -8.618  1.00 81.05  ? 170 TYR A CA  1 
ATOM   1337 C C   . TYR A 1 170 ? 21.116  27.133  -9.962  1.00 84.80  ? 170 TYR A C   1 
ATOM   1338 O O   . TYR A 1 170 ? 22.051  27.911  -10.058 1.00 84.22  ? 170 TYR A O   1 
ATOM   1339 C CB  . TYR A 1 170 ? 21.841  25.682  -7.986  1.00 81.83  ? 170 TYR A CB  1 
ATOM   1340 C CG  . TYR A 1 170 ? 21.443  25.205  -6.612  1.00 82.83  ? 170 TYR A CG  1 
ATOM   1341 C CD1 . TYR A 1 170 ? 21.462  26.075  -5.522  1.00 83.69  ? 170 TYR A CD1 1 
ATOM   1342 C CD2 . TYR A 1 170 ? 20.931  23.930  -6.417  1.00 84.57  ? 170 TYR A CD2 1 
ATOM   1343 C CE1 . TYR A 1 170 ? 21.030  25.666  -4.264  1.00 82.85  ? 170 TYR A CE1 1 
ATOM   1344 C CE2 . TYR A 1 170 ? 20.487  23.510  -5.159  1.00 85.71  ? 170 TYR A CE2 1 
ATOM   1345 C CZ  . TYR A 1 170 ? 20.542  24.382  -4.089  1.00 87.63  ? 170 TYR A CZ  1 
ATOM   1346 O OH  . TYR A 1 170 ? 20.120  23.977  -2.862  1.00 83.50  ? 170 TYR A OH  1 
ATOM   1347 N N   . ASN A 1 171 ? 20.318  26.771  -10.976 1.00 82.84  ? 171 ASN A N   1 
ATOM   1348 C CA  . ASN A 1 171 ? 20.233  27.160  -12.387 1.00 84.05  ? 171 ASN A CA  1 
ATOM   1349 C C   . ASN A 1 171 ? 19.164  26.270  -13.041 1.00 91.54  ? 171 ASN A C   1 
ATOM   1350 O O   . ASN A 1 171 ? 18.798  25.238  -12.471 1.00 92.66  ? 171 ASN A O   1 
ATOM   1351 C CB  . ASN A 1 171 ? 21.575  27.119  -13.138 1.00 82.94  ? 171 ASN A CB  1 
ATOM   1352 C CG  . ASN A 1 171 ? 22.210  25.768  -13.246 1.00 98.59  ? 171 ASN A CG  1 
ATOM   1353 O OD1 . ASN A 1 171 ? 21.653  24.837  -13.831 1.00 88.37  ? 171 ASN A OD1 1 
ATOM   1354 N ND2 . ASN A 1 171 ? 23.413  25.650  -12.711 1.00 93.90  ? 171 ASN A ND2 1 
ATOM   1355 N N   . ASN A 1 172 ? 18.683  26.642  -14.235 1.00 88.52  ? 172 ASN A N   1 
ATOM   1356 C CA  . ASN A 1 172 ? 17.609  25.933  -14.946 1.00 88.10  ? 172 ASN A CA  1 
ATOM   1357 C C   . ASN A 1 172 ? 17.795  24.412  -15.096 1.00 89.01  ? 172 ASN A C   1 
ATOM   1358 O O   . ASN A 1 172 ? 16.811  23.706  -15.320 1.00 88.63  ? 172 ASN A O   1 
ATOM   1359 C CB  . ASN A 1 172 ? 17.379  26.576  -16.327 1.00 91.72  ? 172 ASN A CB  1 
ATOM   1360 C CG  . ASN A 1 172 ? 16.736  27.947  -16.305 1.00 120.22 ? 172 ASN A CG  1 
ATOM   1361 O OD1 . ASN A 1 172 ? 16.482  28.544  -15.247 1.00 124.68 ? 172 ASN A OD1 1 
ATOM   1362 N ND2 . ASN A 1 172 ? 16.456  28.487  -17.483 1.00 105.95 ? 172 ASN A ND2 1 
ATOM   1363 N N   . HIS A 1 173 ? 19.045  23.925  -14.963 1.00 83.70  ? 173 HIS A N   1 
ATOM   1364 C CA  . HIS A 1 173 ? 19.431  22.526  -15.170 1.00 82.89  ? 173 HIS A CA  1 
ATOM   1365 C C   . HIS A 1 173 ? 20.084  21.854  -13.965 1.00 82.64  ? 173 HIS A C   1 
ATOM   1366 O O   . HIS A 1 173 ? 20.397  20.666  -14.035 1.00 82.38  ? 173 HIS A O   1 
ATOM   1367 C CB  . HIS A 1 173 ? 20.328  22.420  -16.412 1.00 84.27  ? 173 HIS A CB  1 
ATOM   1368 C CG  . HIS A 1 173 ? 19.603  22.806  -17.661 1.00 87.92  ? 173 HIS A CG  1 
ATOM   1369 N ND1 . HIS A 1 173 ? 19.044  21.849  -18.493 1.00 89.97  ? 173 HIS A ND1 1 
ATOM   1370 C CD2 . HIS A 1 173 ? 19.293  24.033  -18.137 1.00 89.43  ? 173 HIS A CD2 1 
ATOM   1371 C CE1 . HIS A 1 173 ? 18.441  22.523  -19.456 1.00 89.24  ? 173 HIS A CE1 1 
ATOM   1372 N NE2 . HIS A 1 173 ? 18.553  23.839  -19.275 1.00 89.53  ? 173 HIS A NE2 1 
ATOM   1373 N N   . ALA A 1 174 ? 20.273  22.588  -12.860 1.00 75.90  ? 174 ALA A N   1 
ATOM   1374 C CA  . ALA A 1 174 ? 20.834  22.020  -11.649 1.00 74.25  ? 174 ALA A CA  1 
ATOM   1375 C C   . ALA A 1 174 ? 19.846  22.275  -10.539 1.00 78.41  ? 174 ALA A C   1 
ATOM   1376 O O   . ALA A 1 174 ? 19.786  23.366  -9.959  1.00 77.98  ? 174 ALA A O   1 
ATOM   1377 C CB  . ALA A 1 174 ? 22.195  22.617  -11.340 1.00 74.64  ? 174 ALA A CB  1 
ATOM   1378 N N   . TRP A 1 175 ? 19.002  21.273  -10.298 1.00 74.53  ? 175 TRP A N   1 
ATOM   1379 C CA  . TRP A 1 175 ? 17.966  21.350  -9.270  1.00 72.97  ? 175 TRP A CA  1 
ATOM   1380 C C   . TRP A 1 175 ? 18.437  20.709  -8.017  1.00 79.20  ? 175 TRP A C   1 
ATOM   1381 O O   . TRP A 1 175 ? 19.290  19.813  -8.067  1.00 80.02  ? 175 TRP A O   1 
ATOM   1382 C CB  . TRP A 1 175 ? 16.666  20.662  -9.713  1.00 70.44  ? 175 TRP A CB  1 
ATOM   1383 C CG  . TRP A 1 175 ? 16.128  21.104  -11.043 1.00 69.74  ? 175 TRP A CG  1 
ATOM   1384 C CD1 . TRP A 1 175 ? 16.552  22.149  -11.815 1.00 72.14  ? 175 TRP A CD1 1 
ATOM   1385 C CD2 . TRP A 1 175 ? 15.030  20.519  -11.729 1.00 69.33  ? 175 TRP A CD2 1 
ATOM   1386 N NE1 . TRP A 1 175 ? 15.798  22.230  -12.949 1.00 70.62  ? 175 TRP A NE1 1 
ATOM   1387 C CE2 . TRP A 1 175 ? 14.864  21.229  -12.935 1.00 72.01  ? 175 TRP A CE2 1 
ATOM   1388 C CE3 . TRP A 1 175 ? 14.184  19.430  -11.458 1.00 70.42  ? 175 TRP A CE3 1 
ATOM   1389 C CZ2 . TRP A 1 175 ? 13.885  20.894  -13.868 1.00 71.06  ? 175 TRP A CZ2 1 
ATOM   1390 C CZ3 . TRP A 1 175 ? 13.221  19.095  -12.391 1.00 71.52  ? 175 TRP A CZ3 1 
ATOM   1391 C CH2 . TRP A 1 175 ? 13.075  19.829  -13.578 1.00 72.10  ? 175 TRP A CH2 1 
ATOM   1392 N N   . SER A 1 176 ? 17.837  21.116  -6.897  1.00 76.53  ? 176 SER A N   1 
ATOM   1393 C CA  . SER A 1 176 ? 18.135  20.600  -5.573  1.00 77.61  ? 176 SER A CA  1 
ATOM   1394 C C   . SER A 1 176 ? 17.583  19.155  -5.390  1.00 82.96  ? 176 SER A C   1 
ATOM   1395 O O   . SER A 1 176 ? 17.070  18.535  -6.322  1.00 82.00  ? 176 SER A O   1 
ATOM   1396 C CB  . SER A 1 176 ? 17.543  21.544  -4.524  1.00 81.66  ? 176 SER A CB  1 
ATOM   1397 O OG  . SER A 1 176 ? 16.129  21.455  -4.425  1.00 90.28  ? 176 SER A OG  1 
ATOM   1398 N N   . PHE A 1 177 ? 17.684  18.639  -4.181  1.00 81.39  ? 177 PHE A N   1 
ATOM   1399 C CA  . PHE A 1 177 ? 17.121  17.351  -3.828  1.00 82.30  ? 177 PHE A CA  1 
ATOM   1400 C C   . PHE A 1 177 ? 15.582  17.451  -3.882  1.00 88.69  ? 177 PHE A C   1 
ATOM   1401 O O   . PHE A 1 177 ? 15.046  18.555  -3.716  1.00 88.32  ? 177 PHE A O   1 
ATOM   1402 C CB  . PHE A 1 177 ? 17.525  17.025  -2.395  1.00 84.18  ? 177 PHE A CB  1 
ATOM   1403 C CG  . PHE A 1 177 ? 18.794  16.244  -2.238  1.00 85.77  ? 177 PHE A CG  1 
ATOM   1404 C CD1 . PHE A 1 177 ? 20.014  16.892  -2.121  1.00 89.57  ? 177 PHE A CD1 1 
ATOM   1405 C CD2 . PHE A 1 177 ? 18.764  14.863  -2.113  1.00 88.41  ? 177 PHE A CD2 1 
ATOM   1406 C CE1 . PHE A 1 177 ? 21.192  16.167  -1.932  1.00 91.20  ? 177 PHE A CE1 1 
ATOM   1407 C CE2 . PHE A 1 177 ? 19.935  14.138  -1.908  1.00 92.07  ? 177 PHE A CE2 1 
ATOM   1408 C CZ  . PHE A 1 177 ? 21.143  14.795  -1.820  1.00 90.84  ? 177 PHE A CZ  1 
ATOM   1409 N N   . PRO A 1 178 ? 14.847  16.332  -4.068  1.00 86.80  ? 178 PRO A N   1 
ATOM   1410 C CA  . PRO A 1 178 ? 13.383  16.423  -4.047  1.00 87.44  ? 178 PRO A CA  1 
ATOM   1411 C C   . PRO A 1 178 ? 12.886  16.669  -2.625  1.00 96.39  ? 178 PRO A C   1 
ATOM   1412 O O   . PRO A 1 178 ? 13.521  16.216  -1.668  1.00 96.94  ? 178 PRO A O   1 
ATOM   1413 C CB  . PRO A 1 178 ? 12.955  15.062  -4.561  1.00 88.67  ? 178 PRO A CB  1 
ATOM   1414 C CG  . PRO A 1 178 ? 14.048  14.137  -4.114  1.00 92.57  ? 178 PRO A CG  1 
ATOM   1415 C CD  . PRO A 1 178 ? 15.294  14.934  -4.257  1.00 88.24  ? 178 PRO A CD  1 
ATOM   1416 N N   . SER A 1 179 ? 11.792  17.428  -2.483  1.00 96.15  ? 179 SER A N   1 
ATOM   1417 C CA  . SER A 1 179 ? 11.191  17.747  -1.181  1.00 97.48  ? 179 SER A CA  1 
ATOM   1418 C C   . SER A 1 179 ? 10.327  16.582  -0.750  1.00 104.35 ? 179 SER A C   1 
ATOM   1419 O O   . SER A 1 179 ? 9.879   15.810  -1.598  1.00 104.22 ? 179 SER A O   1 
ATOM   1420 C CB  . SER A 1 179 ? 10.328  19.000  -1.281  1.00 102.05 ? 179 SER A CB  1 
ATOM   1421 O OG  . SER A 1 179 ? 9.129   18.755  -2.000  1.00 112.15 ? 179 SER A OG  1 
ATOM   1422 N N   . GLU A 1 180 ? 10.043  16.472  0.547   1.00 103.40 ? 180 GLU A N   1 
ATOM   1423 C CA  . GLU A 1 180 ? 9.204   15.389  1.042   1.00 104.60 ? 180 GLU A CA  1 
ATOM   1424 C C   . GLU A 1 180 ? 7.808   15.379  0.337   1.00 110.27 ? 180 GLU A C   1 
ATOM   1425 O O   . GLU A 1 180 ? 7.222   16.441  0.117   1.00 111.25 ? 180 GLU A O   1 
ATOM   1426 C CB  . GLU A 1 180 ? 9.132   15.417  2.578   1.00 106.59 ? 180 GLU A CB  1 
ATOM   1427 C CG  . GLU A 1 180 ? 10.389  14.849  3.256   1.00 120.99 ? 180 GLU A CG  1 
ATOM   1428 C CD  . GLU A 1 180 ? 11.602  15.751  3.473   1.00 143.64 ? 180 GLU A CD  1 
ATOM   1429 O OE1 . GLU A 1 180 ? 11.732  16.784  2.773   1.00 144.59 ? 180 GLU A OE1 1 
ATOM   1430 O OE2 . GLU A 1 180 ? 12.432  15.414  4.351   1.00 129.58 ? 180 GLU A OE2 1 
ATOM   1431 N N   . PRO A 1 181 ? 7.344   14.198  -0.133  1.00 106.82 ? 181 PRO A N   1 
ATOM   1432 C CA  . PRO A 1 181 ? 6.066   14.125  -0.884  1.00 106.64 ? 181 PRO A CA  1 
ATOM   1433 C C   . PRO A 1 181 ? 4.759   14.583  -0.195  1.00 109.17 ? 181 PRO A C   1 
ATOM   1434 O O   . PRO A 1 181 ? 4.655   14.561  1.036   1.00 107.93 ? 181 PRO A O   1 
ATOM   1435 C CB  . PRO A 1 181 ? 5.958   12.635  -1.223  1.00 108.45 ? 181 PRO A CB  1 
ATOM   1436 C CG  . PRO A 1 181 ? 6.820   11.939  -0.198  1.00 112.62 ? 181 PRO A CG  1 
ATOM   1437 C CD  . PRO A 1 181 ? 7.963   12.863  0.004   1.00 108.23 ? 181 PRO A CD  1 
ATOM   1438 N N   . VAL A 1 182 ? 3.741   14.960  -1.029  1.00 104.73 ? 182 VAL A N   1 
ATOM   1439 C CA  . VAL A 1 182 ? 2.385   15.392  -0.637  1.00 100.13 ? 182 VAL A CA  1 
ATOM   1440 C C   . VAL A 1 182 ? 1.308   14.608  -1.453  1.00 151.70 ? 182 VAL A C   1 
ATOM   1441 O O   . VAL A 1 182 ? 0.332   14.064  -0.902  1.00 113.34 ? 182 VAL A O   1 
ATOM   1442 C CB  . VAL A 1 182 ? 2.211   16.937  -0.731  1.00 102.65 ? 182 VAL A CB  1 
ATOM   1443 C CG1 . VAL A 1 182 ? 0.776   17.371  -0.435  1.00 101.86 ? 182 VAL A CG1 1 
ATOM   1444 C CG2 . VAL A 1 182 ? 3.173   17.656  0.203   1.00 102.39 ? 182 VAL A CG2 1 
ATOM   1445 N N   . ASP B 2 1   ? 43.837  10.407  -37.094 1.00 94.29  ? 1   ASP D N   1 
ATOM   1446 C CA  . ASP B 2 1   ? 44.072  11.042  -38.389 1.00 94.52  ? 1   ASP D CA  1 
ATOM   1447 C C   . ASP B 2 1   ? 44.352  9.968   -39.486 1.00 98.16  ? 1   ASP D C   1 
ATOM   1448 O O   . ASP B 2 1   ? 45.431  9.364   -39.485 1.00 98.80  ? 1   ASP D O   1 
ATOM   1449 C CB  . ASP B 2 1   ? 45.222  12.048  -38.264 1.00 96.92  ? 1   ASP D CB  1 
ATOM   1450 C CG  . ASP B 2 1   ? 45.595  12.719  -39.565 1.00 112.20 ? 1   ASP D CG  1 
ATOM   1451 O OD1 . ASP B 2 1   ? 46.399  12.126  -40.337 1.00 113.01 ? 1   ASP D OD1 1 
ATOM   1452 O OD2 . ASP B 2 1   ? 45.099  13.835  -39.812 1.00 119.76 ? 1   ASP D OD2 1 
ATOM   1453 N N   . ILE B 2 2   ? 43.377  9.726   -40.410 1.00 91.97  ? 2   ILE D N   1 
ATOM   1454 C CA  . ILE B 2 2   ? 43.488  8.695   -41.448 1.00 89.90  ? 2   ILE D CA  1 
ATOM   1455 C C   . ILE B 2 2   ? 44.438  9.113   -42.539 1.00 93.65  ? 2   ILE D C   1 
ATOM   1456 O O   . ILE B 2 2   ? 44.304  10.200  -43.082 1.00 93.55  ? 2   ILE D O   1 
ATOM   1457 C CB  . ILE B 2 2   ? 42.110  8.227   -41.997 1.00 91.88  ? 2   ILE D CB  1 
ATOM   1458 C CG1 . ILE B 2 2   ? 41.285  7.543   -40.889 1.00 91.81  ? 2   ILE D CG1 1 
ATOM   1459 C CG2 . ILE B 2 2   ? 42.277  7.293   -43.198 1.00 91.48  ? 2   ILE D CG2 1 
ATOM   1460 C CD1 . ILE B 2 2   ? 39.813  7.380   -41.139 1.00 97.88  ? 2   ILE D CD1 1 
ATOM   1461 N N   . GLN B 2 3   ? 45.402  8.236   -42.869 1.00 90.18  ? 3   GLN D N   1 
ATOM   1462 C CA  . GLN B 2 3   ? 46.385  8.511   -43.920 1.00 89.06  ? 3   GLN D CA  1 
ATOM   1463 C C   . GLN B 2 3   ? 46.048  7.728   -45.162 1.00 88.47  ? 3   GLN D C   1 
ATOM   1464 O O   . GLN B 2 3   ? 45.912  6.505   -45.098 1.00 87.34  ? 3   GLN D O   1 
ATOM   1465 C CB  . GLN B 2 3   ? 47.834  8.265   -43.442 1.00 90.84  ? 3   GLN D CB  1 
ATOM   1466 C CG  . GLN B 2 3   ? 48.233  9.125   -42.225 1.00 121.05 ? 3   GLN D CG  1 
ATOM   1467 C CD  . GLN B 2 3   ? 49.598  8.818   -41.658 1.00 154.19 ? 3   GLN D CD  1 
ATOM   1468 O OE1 . GLN B 2 3   ? 50.106  7.688   -41.732 1.00 153.87 ? 3   GLN D OE1 1 
ATOM   1469 N NE2 . GLN B 2 3   ? 50.216  9.827   -41.054 1.00 149.30 ? 3   GLN D NE2 1 
ATOM   1470 N N   . MET B 2 4   ? 45.856  8.446   -46.283 1.00 83.90  ? 4   MET D N   1 
ATOM   1471 C CA  . MET B 2 4   ? 45.532  7.851   -47.580 1.00 83.33  ? 4   MET D CA  1 
ATOM   1472 C C   . MET B 2 4   ? 46.816  7.678   -48.377 1.00 86.84  ? 4   MET D C   1 
ATOM   1473 O O   . MET B 2 4   ? 47.546  8.658   -48.605 1.00 85.86  ? 4   MET D O   1 
ATOM   1474 C CB  . MET B 2 4   ? 44.540  8.723   -48.383 1.00 85.10  ? 4   MET D CB  1 
ATOM   1475 C CG  . MET B 2 4   ? 43.226  9.011   -47.691 1.00 88.21  ? 4   MET D CG  1 
ATOM   1476 S SD  . MET B 2 4   ? 42.405  7.568   -47.026 1.00 91.67  ? 4   MET D SD  1 
ATOM   1477 C CE  . MET B 2 4   ? 41.981  6.762   -48.456 1.00 87.74  ? 4   MET D CE  1 
ATOM   1478 N N   . THR B 2 5   ? 47.114  6.433   -48.769 1.00 83.41  ? 5   THR D N   1 
ATOM   1479 C CA  . THR B 2 5   ? 48.322  6.197   -49.550 1.00 83.62  ? 5   THR D CA  1 
ATOM   1480 C C   . THR B 2 5   ? 47.912  5.715   -50.919 1.00 86.61  ? 5   THR D C   1 
ATOM   1481 O O   . THR B 2 5   ? 47.394  4.606   -51.078 1.00 85.24  ? 5   THR D O   1 
ATOM   1482 C CB  . THR B 2 5   ? 49.356  5.337   -48.824 1.00 92.49  ? 5   THR D CB  1 
ATOM   1483 O OG1 . THR B 2 5   ? 48.784  4.061   -48.574 1.00 99.46  ? 5   THR D OG1 1 
ATOM   1484 C CG2 . THR B 2 5   ? 49.841  5.976   -47.513 1.00 87.00  ? 5   THR D CG2 1 
ATOM   1485 N N   . GLN B 2 6   ? 48.064  6.614   -51.902 1.00 83.57  ? 6   GLN D N   1 
ATOM   1486 C CA  . GLN B 2 6   ? 47.712  6.393   -53.293 1.00 83.55  ? 6   GLN D CA  1 
ATOM   1487 C C   . GLN B 2 6   ? 48.947  5.964   -54.079 1.00 88.28  ? 6   GLN D C   1 
ATOM   1488 O O   . GLN B 2 6   ? 49.983  6.610   -53.961 1.00 88.87  ? 6   GLN D O   1 
ATOM   1489 C CB  . GLN B 2 6   ? 47.147  7.683   -53.851 1.00 84.79  ? 6   GLN D CB  1 
ATOM   1490 C CG  . GLN B 2 6   ? 46.150  7.454   -54.944 1.00 86.45  ? 6   GLN D CG  1 
ATOM   1491 C CD  . GLN B 2 6   ? 45.712  8.760   -55.525 1.00 90.88  ? 6   GLN D CD  1 
ATOM   1492 O OE1 . GLN B 2 6   ? 45.506  9.763   -54.828 1.00 72.84  ? 6   GLN D OE1 1 
ATOM   1493 N NE2 . GLN B 2 6   ? 45.552  8.762   -56.820 1.00 93.16  ? 6   GLN D NE2 1 
ATOM   1494 N N   . SER B 2 7   ? 48.846  4.875   -54.864 1.00 84.92  ? 7   SER D N   1 
ATOM   1495 C CA  . SER B 2 7   ? 49.953  4.279   -55.614 1.00 84.77  ? 7   SER D CA  1 
ATOM   1496 C C   . SER B 2 7   ? 49.568  3.896   -57.043 1.00 87.78  ? 7   SER D C   1 
ATOM   1497 O O   . SER B 2 7   ? 48.503  3.310   -57.246 1.00 87.27  ? 7   SER D O   1 
ATOM   1498 C CB  . SER B 2 7   ? 50.487  3.054   -54.871 1.00 89.40  ? 7   SER D CB  1 
ATOM   1499 O OG  . SER B 2 7   ? 51.514  2.370   -55.571 1.00 100.89 ? 7   SER D OG  1 
ATOM   1500 N N   . PRO B 2 8   ? 50.431  4.159   -58.049 1.00 83.79  ? 8   PRO D N   1 
ATOM   1501 C CA  . PRO B 2 8   ? 51.747  4.827   -57.988 1.00 84.06  ? 8   PRO D CA  1 
ATOM   1502 C C   . PRO B 2 8   ? 51.665  6.349   -57.969 1.00 91.26  ? 8   PRO D C   1 
ATOM   1503 O O   . PRO B 2 8   ? 50.588  6.903   -58.195 1.00 91.04  ? 8   PRO D O   1 
ATOM   1504 C CB  . PRO B 2 8   ? 52.436  4.313   -59.253 1.00 85.36  ? 8   PRO D CB  1 
ATOM   1505 C CG  . PRO B 2 8   ? 51.318  4.117   -60.230 1.00 88.83  ? 8   PRO D CG  1 
ATOM   1506 C CD  . PRO B 2 8   ? 50.097  3.751   -59.427 1.00 84.53  ? 8   PRO D CD  1 
ATOM   1507 N N   . SER B 2 9   ? 52.800  7.036   -57.718 1.00 90.06  ? 9   SER D N   1 
ATOM   1508 C CA  . SER B 2 9   ? 52.848  8.508   -57.719 1.00 90.13  ? 9   SER D CA  1 
ATOM   1509 C C   . SER B 2 9   ? 52.521  9.057   -59.091 1.00 92.16  ? 9   SER D C   1 
ATOM   1510 O O   . SER B 2 9   ? 51.891  10.103  -59.198 1.00 90.76  ? 9   SER D O   1 
ATOM   1511 C CB  . SER B 2 9   ? 54.226  8.997   -57.302 1.00 96.00  ? 9   SER D CB  1 
ATOM   1512 O OG  . SER B 2 9   ? 54.290  9.049   -55.887 1.00 113.97 ? 9   SER D OG  1 
ATOM   1513 N N   . SER B 2 10  ? 52.976  8.347   -60.143 1.00 88.81  ? 10  SER D N   1 
ATOM   1514 C CA  . SER B 2 10  ? 52.750  8.664   -61.559 1.00 87.66  ? 10  SER D CA  1 
ATOM   1515 C C   . SER B 2 10  ? 52.681  7.384   -62.360 1.00 87.99  ? 10  SER D C   1 
ATOM   1516 O O   . SER B 2 10  ? 53.081  6.352   -61.851 1.00 85.48  ? 10  SER D O   1 
ATOM   1517 C CB  . SER B 2 10  ? 53.866  9.559   -62.104 1.00 89.91  ? 10  SER D CB  1 
ATOM   1518 O OG  . SER B 2 10  ? 55.144  8.947   -62.033 1.00 92.94  ? 10  SER D OG  1 
ATOM   1519 N N   . LEU B 2 11  ? 52.164  7.449   -63.586 1.00 85.93  ? 11  LEU D N   1 
ATOM   1520 C CA  . LEU B 2 11  ? 52.142  6.326   -64.520 1.00 87.50  ? 11  LEU D CA  1 
ATOM   1521 C C   . LEU B 2 11  ? 51.998  6.786   -65.955 1.00 93.20  ? 11  LEU D C   1 
ATOM   1522 O O   . LEU B 2 11  ? 51.307  7.773   -66.212 1.00 94.10  ? 11  LEU D O   1 
ATOM   1523 C CB  . LEU B 2 11  ? 51.128  5.220   -64.174 1.00 88.09  ? 11  LEU D CB  1 
ATOM   1524 C CG  . LEU B 2 11  ? 49.649  5.564   -64.105 1.00 93.97  ? 11  LEU D CG  1 
ATOM   1525 C CD1 . LEU B 2 11  ? 49.000  5.450   -65.469 1.00 95.60  ? 11  LEU D CD1 1 
ATOM   1526 C CD2 . LEU B 2 11  ? 48.928  4.591   -63.173 1.00 94.83  ? 11  LEU D CD2 1 
ATOM   1527 N N   . SER B 2 12  ? 52.669  6.086   -66.886 1.00 89.09  ? 12  SER D N   1 
ATOM   1528 C CA  . SER B 2 12  ? 52.606  6.426   -68.298 1.00 88.51  ? 12  SER D CA  1 
ATOM   1529 C C   . SER B 2 12  ? 52.013  5.315   -69.112 1.00 91.63  ? 12  SER D C   1 
ATOM   1530 O O   . SER B 2 12  ? 52.497  4.180   -69.072 1.00 91.37  ? 12  SER D O   1 
ATOM   1531 C CB  . SER B 2 12  ? 53.968  6.851   -68.833 1.00 91.80  ? 12  SER D CB  1 
ATOM   1532 O OG  . SER B 2 12  ? 54.109  8.261   -68.753 1.00 105.37 ? 12  SER D OG  1 
ATOM   1533 N N   . ALA B 2 13  ? 50.911  5.623   -69.807 1.00 87.61  ? 13  ALA D N   1 
ATOM   1534 C CA  . ALA B 2 13  ? 50.216  4.658   -70.626 1.00 87.05  ? 13  ALA D CA  1 
ATOM   1535 C C   . ALA B 2 13  ? 49.811  5.246   -71.950 1.00 87.23  ? 13  ALA D C   1 
ATOM   1536 O O   . ALA B 2 13  ? 49.527  6.442   -72.038 1.00 85.29  ? 13  ALA D O   1 
ATOM   1537 C CB  . ALA B 2 13  ? 48.985  4.137   -69.897 1.00 88.25  ? 13  ALA D CB  1 
ATOM   1538 N N   . SER B 2 14  ? 49.777  4.377   -72.977 1.00 82.52  ? 14  SER D N   1 
ATOM   1539 C CA  . SER B 2 14  ? 49.365  4.678   -74.342 1.00 81.67  ? 14  SER D CA  1 
ATOM   1540 C C   . SER B 2 14  ? 47.829  4.797   -74.386 1.00 84.53  ? 14  SER D C   1 
ATOM   1541 O O   . SER B 2 14  ? 47.151  4.340   -73.464 1.00 85.58  ? 14  SER D O   1 
ATOM   1542 C CB  . SER B 2 14  ? 49.816  3.560   -75.274 1.00 85.17  ? 14  SER D CB  1 
ATOM   1543 O OG  . SER B 2 14  ? 51.213  3.341   -75.188 1.00 96.25  ? 14  SER D OG  1 
ATOM   1544 N N   . VAL B 2 15  ? 47.270  5.419   -75.433 1.00 78.61  ? 15  VAL D N   1 
ATOM   1545 C CA  . VAL B 2 15  ? 45.819  5.509   -75.548 1.00 77.13  ? 15  VAL D CA  1 
ATOM   1546 C C   . VAL B 2 15  ? 45.243  4.118   -75.808 1.00 84.40  ? 15  VAL D C   1 
ATOM   1547 O O   . VAL B 2 15  ? 45.844  3.305   -76.523 1.00 85.78  ? 15  VAL D O   1 
ATOM   1548 C CB  . VAL B 2 15  ? 45.293  6.588   -76.517 1.00 79.47  ? 15  VAL D CB  1 
ATOM   1549 C CG1 . VAL B 2 15  ? 45.730  7.973   -76.086 1.00 78.80  ? 15  VAL D CG1 1 
ATOM   1550 C CG2 . VAL B 2 15  ? 45.724  6.327   -77.932 1.00 79.90  ? 15  VAL D CG2 1 
ATOM   1551 N N   . GLY B 2 16  ? 44.132  3.842   -75.153 1.00 81.20  ? 16  GLY D N   1 
ATOM   1552 C CA  . GLY B 2 16  ? 43.438  2.560   -75.189 1.00 81.02  ? 16  GLY D CA  1 
ATOM   1553 C C   . GLY B 2 16  ? 44.019  1.558   -74.212 1.00 84.01  ? 16  GLY D C   1 
ATOM   1554 O O   . GLY B 2 16  ? 43.941  0.365   -74.459 1.00 87.23  ? 16  GLY D O   1 
ATOM   1555 N N   . ASP B 2 17  ? 44.640  2.020   -73.124 1.00 75.98  ? 17  ASP D N   1 
ATOM   1556 C CA  . ASP B 2 17  ? 45.266  1.159   -72.124 1.00 74.51  ? 17  ASP D CA  1 
ATOM   1557 C C   . ASP B 2 17  ? 44.452  1.042   -70.835 1.00 78.82  ? 17  ASP D C   1 
ATOM   1558 O O   . ASP B 2 17  ? 43.798  2.007   -70.407 1.00 78.59  ? 17  ASP D O   1 
ATOM   1559 C CB  . ASP B 2 17  ? 46.678  1.674   -71.781 1.00 75.80  ? 17  ASP D CB  1 
ATOM   1560 C CG  . ASP B 2 17  ? 47.800  1.340   -72.751 1.00 95.96  ? 17  ASP D CG  1 
ATOM   1561 O OD1 . ASP B 2 17  ? 47.543  1.313   -73.993 1.00 98.33  ? 17  ASP D OD1 1 
ATOM   1562 O OD2 . ASP B 2 17  ? 48.945  1.140   -72.282 1.00 104.75 ? 17  ASP D OD2 1 
ATOM   1563 N N   . ARG B 2 18  ? 44.539  -0.127  -70.184 1.00 74.26  ? 18  ARG D N   1 
ATOM   1564 C CA  . ARG B 2 18  ? 43.883  -0.327  -68.887 1.00 72.79  ? 18  ARG D CA  1 
ATOM   1565 C C   . ARG B 2 18  ? 44.826  0.260   -67.856 1.00 76.03  ? 18  ARG D C   1 
ATOM   1566 O O   . ARG B 2 18  ? 46.031  -0.034  -67.878 1.00 77.34  ? 18  ARG D O   1 
ATOM   1567 C CB  . ARG B 2 18  ? 43.627  -1.817  -68.612 1.00 70.49  ? 18  ARG D CB  1 
ATOM   1568 C CG  . ARG B 2 18  ? 42.807  -2.097  -67.393 1.00 70.93  ? 18  ARG D CG  1 
ATOM   1569 C CD  . ARG B 2 18  ? 41.966  -3.341  -67.559 1.00 79.23  ? 18  ARG D CD  1 
ATOM   1570 N NE  . ARG B 2 18  ? 41.044  -3.533  -66.444 1.00 94.37  ? 18  ARG D NE  1 
ATOM   1571 C CZ  . ARG B 2 18  ? 41.401  -3.993  -65.250 1.00 123.11 ? 18  ARG D CZ  1 
ATOM   1572 N NH1 . ARG B 2 18  ? 42.664  -4.305  -64.994 1.00 111.96 ? 18  ARG D NH1 1 
ATOM   1573 N NH2 . ARG B 2 18  ? 40.494  -4.131  -64.291 1.00 123.71 ? 18  ARG D NH2 1 
ATOM   1574 N N   . VAL B 2 19  ? 44.295  1.136   -67.000 1.00 70.09  ? 19  VAL D N   1 
ATOM   1575 C CA  . VAL B 2 19  ? 45.040  1.811   -65.943 1.00 68.39  ? 19  VAL D CA  1 
ATOM   1576 C C   . VAL B 2 19  ? 44.396  1.460   -64.593 1.00 72.46  ? 19  VAL D C   1 
ATOM   1577 O O   . VAL B 2 19  ? 43.181  1.478   -64.466 1.00 71.24  ? 19  VAL D O   1 
ATOM   1578 C CB  . VAL B 2 19  ? 45.107  3.348   -66.223 1.00 70.79  ? 19  VAL D CB  1 
ATOM   1579 C CG1 . VAL B 2 19  ? 45.545  4.139   -65.002 1.00 69.90  ? 19  VAL D CG1 1 
ATOM   1580 C CG2 . VAL B 2 19  ? 46.031  3.656   -67.401 1.00 70.51  ? 19  VAL D CG2 1 
ATOM   1581 N N   . THR B 2 20  ? 45.207  1.124   -63.597 1.00 70.48  ? 20  THR D N   1 
ATOM   1582 C CA  . THR B 2 20  ? 44.716  0.830   -62.256 1.00 71.05  ? 20  THR D CA  1 
ATOM   1583 C C   . THR B 2 20  ? 45.482  1.634   -61.196 1.00 77.96  ? 20  THR D C   1 
ATOM   1584 O O   . THR B 2 20  ? 46.683  1.431   -61.013 1.00 79.54  ? 20  THR D O   1 
ATOM   1585 C CB  . THR B 2 20  ? 44.762  -0.680  -61.979 1.00 83.06  ? 20  THR D CB  1 
ATOM   1586 O OG1 . THR B 2 20  ? 44.138  -1.374  -63.066 1.00 87.02  ? 20  THR D OG1 1 
ATOM   1587 C CG2 . THR B 2 20  ? 44.105  -1.054  -60.632 1.00 84.33  ? 20  THR D CG2 1 
ATOM   1588 N N   . ILE B 2 21  ? 44.785  2.514   -60.484 1.00 75.44  ? 21  ILE D N   1 
ATOM   1589 C CA  . ILE B 2 21  ? 45.348  3.312   -59.390 1.00 75.91  ? 21  ILE D CA  1 
ATOM   1590 C C   . ILE B 2 21  ? 44.893  2.652   -58.079 1.00 80.64  ? 21  ILE D C   1 
ATOM   1591 O O   . ILE B 2 21  ? 43.738  2.240   -57.963 1.00 79.49  ? 21  ILE D O   1 
ATOM   1592 C CB  . ILE B 2 21  ? 44.904  4.805   -59.471 1.00 79.27  ? 21  ILE D CB  1 
ATOM   1593 C CG1 . ILE B 2 21  ? 45.397  5.466   -60.763 1.00 79.34  ? 21  ILE D CG1 1 
ATOM   1594 C CG2 . ILE B 2 21  ? 45.371  5.604   -58.255 1.00 80.73  ? 21  ILE D CG2 1 
ATOM   1595 C CD1 . ILE B 2 21  ? 44.610  6.698   -61.171 1.00 81.84  ? 21  ILE D CD1 1 
ATOM   1596 N N   . THR B 2 22  ? 45.823  2.515   -57.123 1.00 78.32  ? 22  THR D N   1 
ATOM   1597 C CA  . THR B 2 22  ? 45.563  1.948   -55.812 1.00 78.64  ? 22  THR D CA  1 
ATOM   1598 C C   . THR B 2 22  ? 45.482  3.044   -54.789 1.00 85.86  ? 22  THR D C   1 
ATOM   1599 O O   . THR B 2 22  ? 46.158  4.066   -54.926 1.00 87.41  ? 22  THR D O   1 
ATOM   1600 C CB  . THR B 2 22  ? 46.597  0.876   -55.503 1.00 84.34  ? 22  THR D CB  1 
ATOM   1601 O OG1 . THR B 2 22  ? 46.059  -0.357  -55.944 1.00 82.19  ? 22  THR D OG1 1 
ATOM   1602 C CG2 . THR B 2 22  ? 47.020  0.818   -54.023 1.00 84.03  ? 22  THR D CG2 1 
ATOM   1603 N N   . CYS B 2 23  ? 44.645  2.837   -53.761 1.00 82.11  ? 23  CYS D N   1 
ATOM   1604 C CA  . CYS B 2 23  ? 44.437  3.735   -52.636 1.00 81.11  ? 23  CYS D CA  1 
ATOM   1605 C C   . CYS B 2 23  ? 44.216  2.869   -51.386 1.00 83.24  ? 23  CYS D C   1 
ATOM   1606 O O   . CYS B 2 23  ? 43.357  1.982   -51.383 1.00 83.24  ? 23  CYS D O   1 
ATOM   1607 C CB  . CYS B 2 23  ? 43.264  4.675   -52.911 1.00 81.12  ? 23  CYS D CB  1 
ATOM   1608 S SG  . CYS B 2 23  ? 42.996  5.941   -51.630 1.00 84.53  ? 23  CYS D SG  1 
ATOM   1609 N N   . ARG B 2 24  ? 45.040  3.085   -50.359 1.00 77.85  ? 24  ARG D N   1 
ATOM   1610 C CA  . ARG B 2 24  ? 45.007  2.330   -49.110 1.00 76.52  ? 24  ARG D CA  1 
ATOM   1611 C C   . ARG B 2 24  ? 44.851  3.306   -47.915 1.00 80.43  ? 24  ARG D C   1 
ATOM   1612 O O   . ARG B 2 24  ? 45.619  4.273   -47.784 1.00 79.64  ? 24  ARG D O   1 
ATOM   1613 C CB  . ARG B 2 24  ? 46.284  1.506   -49.017 1.00 74.15  ? 24  ARG D CB  1 
ATOM   1614 C CG  . ARG B 2 24  ? 46.257  0.249   -48.157 1.00 91.70  ? 24  ARG D CG  1 
ATOM   1615 C CD  . ARG B 2 24  ? 47.523  -0.605  -48.383 1.00 114.84 ? 24  ARG D CD  1 
ATOM   1616 N NE  . ARG B 2 24  ? 48.773  0.072   -47.964 1.00 131.84 ? 24  ARG D NE  1 
ATOM   1617 C CZ  . ARG B 2 24  ? 49.662  0.648   -48.782 1.00 137.27 ? 24  ARG D CZ  1 
ATOM   1618 N NH1 . ARG B 2 24  ? 49.475  0.647   -50.101 1.00 116.58 ? 24  ARG D NH1 1 
ATOM   1619 N NH2 . ARG B 2 24  ? 50.745  1.235   -48.282 1.00 115.42 ? 24  ARG D NH2 1 
ATOM   1620 N N   . ALA B 2 25  ? 43.802  3.084   -47.092 1.00 76.67  ? 25  ALA D N   1 
ATOM   1621 C CA  . ALA B 2 25  ? 43.486  3.901   -45.921 1.00 77.02  ? 25  ALA D CA  1 
ATOM   1622 C C   . ALA B 2 25  ? 44.091  3.271   -44.672 1.00 83.40  ? 25  ALA D C   1 
ATOM   1623 O O   . ALA B 2 25  ? 44.184  2.037   -44.611 1.00 84.17  ? 25  ALA D O   1 
ATOM   1624 C CB  . ALA B 2 25  ? 41.979  4.027   -45.776 1.00 77.49  ? 25  ALA D CB  1 
ATOM   1625 N N   . SER B 2 26  ? 44.514  4.093   -43.684 1.00 80.56  ? 26  SER D N   1 
ATOM   1626 C CA  . SER B 2 26  ? 45.111  3.568   -42.448 1.00 81.71  ? 26  SER D CA  1 
ATOM   1627 C C   . SER B 2 26  ? 44.083  2.793   -41.595 1.00 89.44  ? 26  SER D C   1 
ATOM   1628 O O   . SER B 2 26  ? 44.417  1.835   -40.891 1.00 89.23  ? 26  SER D O   1 
ATOM   1629 C CB  . SER B 2 26  ? 45.741  4.686   -41.623 1.00 84.00  ? 26  SER D CB  1 
ATOM   1630 O OG  . SER B 2 26  ? 44.754  5.537   -41.088 1.00 92.28  ? 26  SER D OG  1 
ATOM   1631 N N   . GLU B 2 27  ? 42.835  3.217   -41.680 1.00 87.45  ? 27  GLU D N   1 
ATOM   1632 C CA  . GLU B 2 27  ? 41.725  2.675   -40.909 1.00 87.25  ? 27  GLU D CA  1 
ATOM   1633 C C   . GLU B 2 27  ? 40.655  2.233   -41.893 1.00 88.47  ? 27  GLU D C   1 
ATOM   1634 O O   . GLU B 2 27  ? 40.661  2.659   -43.055 1.00 87.45  ? 27  GLU D O   1 
ATOM   1635 C CB  . GLU B 2 27  ? 41.180  3.813   -39.996 1.00 88.56  ? 27  GLU D CB  1 
ATOM   1636 C CG  . GLU B 2 27  ? 40.361  3.439   -38.769 1.00 98.58  ? 27  GLU D CG  1 
ATOM   1637 C CD  . GLU B 2 27  ? 40.014  4.631   -37.896 1.00 125.44 ? 27  GLU D CD  1 
ATOM   1638 O OE1 . GLU B 2 27  ? 40.903  5.484   -37.660 1.00 103.92 ? 27  GLU D OE1 1 
ATOM   1639 O OE2 . GLU B 2 27  ? 38.850  4.706   -37.437 1.00 132.80 ? 27  GLU D OE2 1 
ATOM   1640 N N   . ASN B 2 28  ? 39.736  1.383   -41.422 1.00 83.53  ? 28  ASN D N   1 
ATOM   1641 C CA  . ASN B 2 28  ? 38.596  0.940   -42.198 1.00 82.82  ? 28  ASN D CA  1 
ATOM   1642 C C   . ASN B 2 28  ? 37.645  2.120   -42.254 1.00 84.83  ? 28  ASN D C   1 
ATOM   1643 O O   . ASN B 2 28  ? 37.263  2.700   -41.236 1.00 82.61  ? 28  ASN D O   1 
ATOM   1644 C CB  . ASN B 2 28  ? 37.919  -0.307  -41.576 1.00 86.00  ? 28  ASN D CB  1 
ATOM   1645 C CG  . ASN B 2 28  ? 36.711  -0.860  -42.324 1.00 109.78 ? 28  ASN D CG  1 
ATOM   1646 O OD1 . ASN B 2 28  ? 35.961  -0.147  -42.989 1.00 102.19 ? 28  ASN D OD1 1 
ATOM   1647 N ND2 . ASN B 2 28  ? 36.471  -2.159  -42.200 1.00 103.48 ? 28  ASN D ND2 1 
ATOM   1648 N N   . ILE B 2 29  ? 37.396  2.534   -43.484 1.00 82.91  ? 29  ILE D N   1 
ATOM   1649 C CA  . ILE B 2 29  ? 36.460  3.558   -43.937 1.00 82.06  ? 29  ILE D CA  1 
ATOM   1650 C C   . ILE B 2 29  ? 35.383  2.637   -44.524 1.00 87.22  ? 29  ILE D C   1 
ATOM   1651 O O   . ILE B 2 29  ? 35.704  1.600   -45.101 1.00 90.09  ? 29  ILE D O   1 
ATOM   1652 C CB  . ILE B 2 29  ? 37.148  4.600   -44.896 1.00 83.97  ? 29  ILE D CB  1 
ATOM   1653 C CG1 . ILE B 2 29  ? 37.551  4.019   -46.254 1.00 84.16  ? 29  ILE D CG1 1 
ATOM   1654 C CG2 . ILE B 2 29  ? 38.386  5.235   -44.214 1.00 83.24  ? 29  ILE D CG2 1 
ATOM   1655 C CD1 . ILE B 2 29  ? 38.074  5.039   -47.290 1.00 86.63  ? 29  ILE D CD1 1 
ATOM   1656 N N   . TYR B 2 30  ? 34.149  2.859   -44.215 1.00 81.51  ? 30  TYR D N   1 
ATOM   1657 C CA  . TYR B 2 30  ? 33.178  1.862   -44.624 1.00 80.19  ? 30  TYR D CA  1 
ATOM   1658 C C   . TYR B 2 30  ? 32.516  2.252   -45.925 1.00 85.05  ? 30  TYR D C   1 
ATOM   1659 O O   . TYR B 2 30  ? 31.295  2.467   -45.984 1.00 85.66  ? 30  TYR D O   1 
ATOM   1660 C CB  . TYR B 2 30  ? 32.214  1.587   -43.465 1.00 80.24  ? 30  TYR D CB  1 
ATOM   1661 C CG  . TYR B 2 30  ? 32.916  0.941   -42.289 1.00 80.79  ? 30  TYR D CG  1 
ATOM   1662 C CD1 . TYR B 2 30  ? 33.787  1.670   -41.481 1.00 82.30  ? 30  TYR D CD1 1 
ATOM   1663 C CD2 . TYR B 2 30  ? 32.748  -0.410  -42.011 1.00 82.13  ? 30  TYR D CD2 1 
ATOM   1664 C CE1 . TYR B 2 30  ? 34.482  1.065   -40.433 1.00 83.84  ? 30  TYR D CE1 1 
ATOM   1665 C CE2 . TYR B 2 30  ? 33.399  -1.018  -40.932 1.00 83.64  ? 30  TYR D CE2 1 
ATOM   1666 C CZ  . TYR B 2 30  ? 34.264  -0.277  -40.142 1.00 92.21  ? 30  TYR D CZ  1 
ATOM   1667 O OH  . TYR B 2 30  ? 34.904  -0.889  -39.082 1.00 91.51  ? 30  TYR D OH  1 
ATOM   1668 N N   . SER B 2 31  ? 33.380  2.372   -46.969 1.00 80.75  ? 31  SER D N   1 
ATOM   1669 C CA  . SER B 2 31  ? 33.145  2.742   -48.361 1.00 80.40  ? 31  SER D CA  1 
ATOM   1670 C C   . SER B 2 31  ? 33.059  4.244   -48.559 1.00 79.47  ? 31  SER D C   1 
ATOM   1671 O O   . SER B 2 31  ? 32.772  4.693   -49.671 1.00 79.11  ? 31  SER D O   1 
ATOM   1672 C CB  . SER B 2 31  ? 31.924  2.042   -48.956 1.00 89.41  ? 31  SER D CB  1 
ATOM   1673 O OG  . SER B 2 31  ? 30.733  2.759   -48.651 1.00 110.70 ? 31  SER D OG  1 
ATOM   1674 N N   . ASN B 2 32  ? 33.327  5.022   -47.499 1.00 73.11  ? 32  ASN D N   1 
ATOM   1675 C CA  . ASN B 2 32  ? 33.309  6.494   -47.554 1.00 71.75  ? 32  ASN D CA  1 
ATOM   1676 C C   . ASN B 2 32  ? 34.561  7.041   -48.289 1.00 72.26  ? 32  ASN D C   1 
ATOM   1677 O O   . ASN B 2 32  ? 35.421  7.699   -47.692 1.00 70.42  ? 32  ASN D O   1 
ATOM   1678 C CB  . ASN B 2 32  ? 33.175  7.077   -46.145 1.00 72.49  ? 32  ASN D CB  1 
ATOM   1679 C CG  . ASN B 2 32  ? 31.874  6.679   -45.519 1.00 93.59  ? 32  ASN D CG  1 
ATOM   1680 O OD1 . ASN B 2 32  ? 30.859  7.364   -45.693 1.00 88.57  ? 32  ASN D OD1 1 
ATOM   1681 N ND2 . ASN B 2 32  ? 31.855  5.534   -44.837 1.00 80.58  ? 32  ASN D ND2 1 
ATOM   1682 N N   . LEU B 2 33  ? 34.655  6.731   -49.585 1.00 67.98  ? 33  LEU D N   1 
ATOM   1683 C CA  . LEU B 2 33  ? 35.775  7.079   -50.439 1.00 67.63  ? 33  LEU D CA  1 
ATOM   1684 C C   . LEU B 2 33  ? 35.286  7.711   -51.724 1.00 70.88  ? 33  LEU D C   1 
ATOM   1685 O O   . LEU B 2 33  ? 34.357  7.192   -52.353 1.00 71.49  ? 33  LEU D O   1 
ATOM   1686 C CB  . LEU B 2 33  ? 36.677  5.835   -50.756 1.00 67.67  ? 33  LEU D CB  1 
ATOM   1687 C CG  . LEU B 2 33  ? 37.979  6.153   -51.504 1.00 73.64  ? 33  LEU D CG  1 
ATOM   1688 C CD1 . LEU B 2 33  ? 39.149  6.211   -50.585 1.00 74.50  ? 33  LEU D CD1 1 
ATOM   1689 C CD2 . LEU B 2 33  ? 38.246  5.216   -52.617 1.00 78.09  ? 33  LEU D CD2 1 
ATOM   1690 N N   . ALA B 2 34  ? 35.958  8.803   -52.137 1.00 64.67  ? 34  ALA D N   1 
ATOM   1691 C CA  . ALA B 2 34  ? 35.698  9.484   -53.380 1.00 62.55  ? 34  ALA D CA  1 
ATOM   1692 C C   . ALA B 2 34  ? 36.980  9.558   -54.232 1.00 65.82  ? 34  ALA D C   1 
ATOM   1693 O O   . ALA B 2 34  ? 38.073  9.450   -53.689 1.00 64.69  ? 34  ALA D O   1 
ATOM   1694 C CB  . ALA B 2 34  ? 35.156  10.856  -53.089 1.00 63.00  ? 34  ALA D CB  1 
ATOM   1695 N N   . TRP B 2 35  ? 36.838  9.704   -55.560 1.00 62.80  ? 35  TRP D N   1 
ATOM   1696 C CA  . TRP B 2 35  ? 37.924  9.826   -56.539 1.00 61.92  ? 35  TRP D CA  1 
ATOM   1697 C C   . TRP B 2 35  ? 37.726  11.083  -57.357 1.00 64.41  ? 35  TRP D C   1 
ATOM   1698 O O   . TRP B 2 35  ? 36.613  11.349  -57.797 1.00 64.61  ? 35  TRP D O   1 
ATOM   1699 C CB  . TRP B 2 35  ? 37.957  8.627   -57.480 1.00 61.12  ? 35  TRP D CB  1 
ATOM   1700 C CG  . TRP B 2 35  ? 38.442  7.346   -56.866 1.00 62.72  ? 35  TRP D CG  1 
ATOM   1701 C CD1 . TRP B 2 35  ? 37.677  6.333   -56.365 1.00 65.87  ? 35  TRP D CD1 1 
ATOM   1702 C CD2 . TRP B 2 35  ? 39.806  6.922   -56.733 1.00 62.07  ? 35  TRP D CD2 1 
ATOM   1703 N NE1 . TRP B 2 35  ? 38.478  5.302   -55.939 1.00 65.24  ? 35  TRP D NE1 1 
ATOM   1704 C CE2 . TRP B 2 35  ? 39.792  5.649   -56.128 1.00 66.33  ? 35  TRP D CE2 1 
ATOM   1705 C CE3 . TRP B 2 35  ? 41.040  7.505   -57.049 1.00 62.97  ? 35  TRP D CE3 1 
ATOM   1706 C CZ2 . TRP B 2 35  ? 40.963  4.932   -55.863 1.00 65.60  ? 35  TRP D CZ2 1 
ATOM   1707 C CZ3 . TRP B 2 35  ? 42.199  6.797   -56.787 1.00 64.71  ? 35  TRP D CZ3 1 
ATOM   1708 C CH2 . TRP B 2 35  ? 42.155  5.525   -56.195 1.00 65.63  ? 35  TRP D CH2 1 
ATOM   1709 N N   . PHE B 2 36  ? 38.797  11.849  -57.578 1.00 59.50  ? 36  PHE D N   1 
ATOM   1710 C CA  . PHE B 2 36  ? 38.755  13.100  -58.329 1.00 58.26  ? 36  PHE D CA  1 
ATOM   1711 C C   . PHE B 2 36  ? 39.740  13.089  -59.471 1.00 63.59  ? 36  PHE D C   1 
ATOM   1712 O O   . PHE B 2 36  ? 40.824  12.526  -59.354 1.00 63.26  ? 36  PHE D O   1 
ATOM   1713 C CB  . PHE B 2 36  ? 39.026  14.320  -57.419 1.00 59.22  ? 36  PHE D CB  1 
ATOM   1714 C CG  . PHE B 2 36  ? 38.096  14.403  -56.228 1.00 60.28  ? 36  PHE D CG  1 
ATOM   1715 C CD1 . PHE B 2 36  ? 38.403  13.751  -55.040 1.00 61.66  ? 36  PHE D CD1 1 
ATOM   1716 C CD2 . PHE B 2 36  ? 36.900  15.104  -56.309 1.00 62.07  ? 36  PHE D CD2 1 
ATOM   1717 C CE1 . PHE B 2 36  ? 37.523  13.770  -53.973 1.00 61.97  ? 36  PHE D CE1 1 
ATOM   1718 C CE2 . PHE B 2 36  ? 36.031  15.149  -55.232 1.00 64.73  ? 36  PHE D CE2 1 
ATOM   1719 C CZ  . PHE B 2 36  ? 36.340  14.461  -54.076 1.00 62.67  ? 36  PHE D CZ  1 
ATOM   1720 N N   . GLN B 2 37  ? 39.361  13.727  -60.571 1.00 61.25  ? 37  GLN D N   1 
ATOM   1721 C CA  . GLN B 2 37  ? 40.214  13.929  -61.726 1.00 61.52  ? 37  GLN D CA  1 
ATOM   1722 C C   . GLN B 2 37  ? 40.544  15.422  -61.749 1.00 63.33  ? 37  GLN D C   1 
ATOM   1723 O O   . GLN B 2 37  ? 39.630  16.257  -61.720 1.00 61.38  ? 37  GLN D O   1 
ATOM   1724 C CB  . GLN B 2 37  ? 39.488  13.514  -63.014 1.00 63.08  ? 37  GLN D CB  1 
ATOM   1725 C CG  . GLN B 2 37  ? 40.327  13.663  -64.269 1.00 68.77  ? 37  GLN D CG  1 
ATOM   1726 C CD  . GLN B 2 37  ? 39.477  13.709  -65.503 1.00 91.97  ? 37  GLN D CD  1 
ATOM   1727 O OE1 . GLN B 2 37  ? 38.698  14.657  -65.721 1.00 95.47  ? 37  GLN D OE1 1 
ATOM   1728 N NE2 . GLN B 2 37  ? 39.634  12.709  -66.353 1.00 76.89  ? 37  GLN D NE2 1 
ATOM   1729 N N   . GLN B 2 38  ? 41.836  15.758  -61.760 1.00 61.22  ? 38  GLN D N   1 
ATOM   1730 C CA  . GLN B 2 38  ? 42.234  17.167  -61.801 1.00 62.04  ? 38  GLN D CA  1 
ATOM   1731 C C   . GLN B 2 38  ? 43.090  17.416  -63.042 1.00 71.37  ? 38  GLN D C   1 
ATOM   1732 O O   . GLN B 2 38  ? 44.178  16.848  -63.175 1.00 71.63  ? 38  GLN D O   1 
ATOM   1733 C CB  . GLN B 2 38  ? 42.935  17.618  -60.513 1.00 61.67  ? 38  GLN D CB  1 
ATOM   1734 C CG  . GLN B 2 38  ? 43.058  19.122  -60.454 1.00 60.02  ? 38  GLN D CG  1 
ATOM   1735 C CD  . GLN B 2 38  ? 43.953  19.606  -59.346 1.00 77.08  ? 38  GLN D CD  1 
ATOM   1736 O OE1 . GLN B 2 38  ? 44.842  18.884  -58.860 1.00 68.34  ? 38  GLN D OE1 1 
ATOM   1737 N NE2 . GLN B 2 38  ? 43.736  20.855  -58.934 1.00 69.54  ? 38  GLN D NE2 1 
ATOM   1738 N N   . LYS B 2 39  ? 42.592  18.227  -63.967 1.00 70.30  ? 39  LYS D N   1 
ATOM   1739 C CA  . LYS B 2 39  ? 43.381  18.477  -65.178 1.00 70.73  ? 39  LYS D CA  1 
ATOM   1740 C C   . LYS B 2 39  ? 44.314  19.691  -64.935 1.00 75.64  ? 39  LYS D C   1 
ATOM   1741 O O   . LYS B 2 39  ? 44.068  20.460  -64.014 1.00 71.33  ? 39  LYS D O   1 
ATOM   1742 C CB  . LYS B 2 39  ? 42.492  18.610  -66.444 1.00 72.70  ? 39  LYS D CB  1 
ATOM   1743 C CG  . LYS B 2 39  ? 41.433  17.510  -66.570 1.00 77.22  ? 39  LYS D CG  1 
ATOM   1744 C CD  . LYS B 2 39  ? 41.601  16.588  -67.736 1.00 79.96  ? 39  LYS D CD  1 
ATOM   1745 C CE  . LYS B 2 39  ? 40.284  16.662  -68.467 1.00 95.19  ? 39  LYS D CE  1 
ATOM   1746 N NZ  . LYS B 2 39  ? 40.433  16.568  -69.948 1.00 107.13 ? 39  LYS D NZ  1 
ATOM   1747 N N   . PRO B 2 40  ? 45.423  19.847  -65.691 1.00 79.19  ? 40  PRO D N   1 
ATOM   1748 C CA  . PRO B 2 40  ? 46.327  20.991  -65.429 1.00 79.95  ? 40  PRO D CA  1 
ATOM   1749 C C   . PRO B 2 40  ? 45.612  22.325  -65.456 1.00 87.38  ? 40  PRO D C   1 
ATOM   1750 O O   . PRO B 2 40  ? 44.908  22.617  -66.427 1.00 88.45  ? 40  PRO D O   1 
ATOM   1751 C CB  . PRO B 2 40  ? 47.379  20.920  -66.545 1.00 81.20  ? 40  PRO D CB  1 
ATOM   1752 C CG  . PRO B 2 40  ? 47.291  19.522  -67.105 1.00 87.22  ? 40  PRO D CG  1 
ATOM   1753 C CD  . PRO B 2 40  ? 45.906  19.000  -66.815 1.00 82.92  ? 40  PRO D CD  1 
ATOM   1754 N N   . GLY B 2 41  ? 45.774  23.088  -64.379 1.00 84.50  ? 41  GLY D N   1 
ATOM   1755 C CA  . GLY B 2 41  ? 45.181  24.409  -64.206 1.00 84.53  ? 41  GLY D CA  1 
ATOM   1756 C C   . GLY B 2 41  ? 43.855  24.397  -63.468 1.00 89.18  ? 41  GLY D C   1 
ATOM   1757 O O   . GLY B 2 41  ? 43.691  25.078  -62.449 1.00 89.36  ? 41  GLY D O   1 
ATOM   1758 N N   . LYS B 2 42  ? 42.906  23.590  -63.975 1.00 83.57  ? 42  LYS D N   1 
ATOM   1759 C CA  . LYS B 2 42  ? 41.542  23.467  -63.461 1.00 81.36  ? 42  LYS D CA  1 
ATOM   1760 C C   . LYS B 2 42  ? 41.425  22.921  -62.015 1.00 82.45  ? 42  LYS D C   1 
ATOM   1761 O O   . LYS B 2 42  ? 42.405  22.449  -61.432 1.00 82.77  ? 42  LYS D O   1 
ATOM   1762 C CB  . LYS B 2 42  ? 40.722  22.599  -64.437 1.00 83.97  ? 42  LYS D CB  1 
ATOM   1763 C CG  . LYS B 2 42  ? 40.316  23.303  -65.735 1.00 93.64  ? 42  LYS D CG  1 
ATOM   1764 C CD  . LYS B 2 42  ? 39.947  22.293  -66.842 1.00 108.59 ? 42  LYS D CD  1 
ATOM   1765 C CE  . LYS B 2 42  ? 38.548  21.682  -66.709 1.00 128.27 ? 42  LYS D CE  1 
ATOM   1766 N NZ  . LYS B 2 42  ? 38.489  20.490  -65.797 1.00 129.03 ? 42  LYS D NZ  1 
ATOM   1767 N N   . ALA B 2 43  ? 40.204  22.989  -61.445 1.00 76.77  ? 43  ALA D N   1 
ATOM   1768 C CA  . ALA B 2 43  ? 39.869  22.491  -60.109 1.00 75.08  ? 43  ALA D CA  1 
ATOM   1769 C C   . ALA B 2 43  ? 39.499  21.023  -60.198 1.00 76.59  ? 43  ALA D C   1 
ATOM   1770 O O   . ALA B 2 43  ? 38.996  20.595  -61.240 1.00 76.50  ? 43  ALA D O   1 
ATOM   1771 C CB  . ALA B 2 43  ? 38.694  23.271  -59.540 1.00 75.53  ? 43  ALA D CB  1 
ATOM   1772 N N   . PRO B 2 44  ? 39.669  20.235  -59.115 1.00 70.55  ? 44  PRO D N   1 
ATOM   1773 C CA  . PRO B 2 44  ? 39.258  18.825  -59.176 1.00 69.07  ? 44  PRO D CA  1 
ATOM   1774 C C   . PRO B 2 44  ? 37.778  18.659  -59.520 1.00 72.58  ? 44  PRO D C   1 
ATOM   1775 O O   . PRO B 2 44  ? 36.946  19.495  -59.125 1.00 71.59  ? 44  PRO D O   1 
ATOM   1776 C CB  . PRO B 2 44  ? 39.535  18.314  -57.758 1.00 70.10  ? 44  PRO D CB  1 
ATOM   1777 C CG  . PRO B 2 44  ? 40.505  19.224  -57.188 1.00 74.65  ? 44  PRO D CG  1 
ATOM   1778 C CD  . PRO B 2 44  ? 40.265  20.563  -57.803 1.00 71.16  ? 44  PRO D CD  1 
ATOM   1779 N N   . LYS B 2 45  ? 37.460  17.582  -60.271 1.00 68.86  ? 45  LYS D N   1 
ATOM   1780 C CA  . LYS B 2 45  ? 36.105  17.194  -60.672 1.00 68.25  ? 45  LYS D CA  1 
ATOM   1781 C C   . LYS B 2 45  ? 35.833  15.829  -60.012 1.00 71.17  ? 45  LYS D C   1 
ATOM   1782 O O   . LYS B 2 45  ? 36.706  14.954  -60.052 1.00 71.48  ? 45  LYS D O   1 
ATOM   1783 C CB  . LYS B 2 45  ? 36.020  17.076  -62.213 1.00 71.84  ? 45  LYS D CB  1 
ATOM   1784 C CG  . LYS B 2 45  ? 34.747  16.403  -62.752 1.00 99.46  ? 45  LYS D CG  1 
ATOM   1785 C CD  . LYS B 2 45  ? 34.896  15.867  -64.199 1.00 106.99 ? 45  LYS D CD  1 
ATOM   1786 C CE  . LYS B 2 45  ? 33.831  14.862  -64.621 1.00 98.41  ? 45  LYS D CE  1 
ATOM   1787 N NZ  . LYS B 2 45  ? 34.038  14.353  -66.012 1.00 88.36  ? 45  LYS D NZ  1 
ATOM   1788 N N   . LEU B 2 46  ? 34.638  15.647  -59.391 1.00 64.95  ? 46  LEU D N   1 
ATOM   1789 C CA  . LEU B 2 46  ? 34.277  14.373  -58.754 1.00 61.71  ? 46  LEU D CA  1 
ATOM   1790 C C   . LEU B 2 46  ? 34.047  13.327  -59.834 1.00 69.79  ? 46  LEU D C   1 
ATOM   1791 O O   . LEU B 2 46  ? 33.297  13.543  -60.789 1.00 70.93  ? 46  LEU D O   1 
ATOM   1792 C CB  . LEU B 2 46  ? 33.033  14.529  -57.872 1.00 60.17  ? 46  LEU D CB  1 
ATOM   1793 C CG  . LEU B 2 46  ? 32.445  13.265  -57.222 1.00 62.78  ? 46  LEU D CG  1 
ATOM   1794 C CD1 . LEU B 2 46  ? 33.242  12.849  -55.995 1.00 62.43  ? 46  LEU D CD1 1 
ATOM   1795 C CD2 . LEU B 2 46  ? 30.986  13.465  -56.816 1.00 61.65  ? 46  LEU D CD2 1 
ATOM   1796 N N   . LEU B 2 47  ? 34.731  12.198  -59.691 1.00 68.08  ? 47  LEU D N   1 
ATOM   1797 C CA  . LEU B 2 47  ? 34.633  11.058  -60.604 1.00 67.38  ? 47  LEU D CA  1 
ATOM   1798 C C   . LEU B 2 47  ? 33.799  9.954   -59.993 1.00 73.51  ? 47  LEU D C   1 
ATOM   1799 O O   . LEU B 2 47  ? 32.783  9.561   -60.566 1.00 73.68  ? 47  LEU D O   1 
ATOM   1800 C CB  . LEU B 2 47  ? 36.032  10.532  -60.926 1.00 66.38  ? 47  LEU D CB  1 
ATOM   1801 C CG  . LEU B 2 47  ? 36.413  10.444  -62.368 1.00 71.16  ? 47  LEU D CG  1 
ATOM   1802 C CD1 . LEU B 2 47  ? 36.201  11.757  -63.068 1.00 73.39  ? 47  LEU D CD1 1 
ATOM   1803 C CD2 . LEU B 2 47  ? 37.842  10.135  -62.477 1.00 73.61  ? 47  LEU D CD2 1 
ATOM   1804 N N   . VAL B 2 48  ? 34.240  9.442   -58.832 1.00 71.23  ? 48  VAL D N   1 
ATOM   1805 C CA  . VAL B 2 48  ? 33.608  8.322   -58.147 1.00 71.89  ? 48  VAL D CA  1 
ATOM   1806 C C   . VAL B 2 48  ? 33.302  8.715   -56.714 1.00 75.88  ? 48  VAL D C   1 
ATOM   1807 O O   . VAL B 2 48  ? 34.182  9.220   -56.037 1.00 76.47  ? 48  VAL D O   1 
ATOM   1808 C CB  . VAL B 2 48  ? 34.503  7.018   -58.220 1.00 75.63  ? 48  VAL D CB  1 
ATOM   1809 C CG1 . VAL B 2 48  ? 33.872  5.852   -57.466 1.00 75.48  ? 48  VAL D CG1 1 
ATOM   1810 C CG2 . VAL B 2 48  ? 34.760  6.584   -59.667 1.00 74.95  ? 48  VAL D CG2 1 
ATOM   1811 N N   . TYR B 2 49  ? 32.080  8.465   -56.252 1.00 72.20  ? 49  TYR D N   1 
ATOM   1812 C CA  . TYR B 2 49  ? 31.667  8.708   -54.868 1.00 73.00  ? 49  TYR D CA  1 
ATOM   1813 C C   . TYR B 2 49  ? 31.255  7.362   -54.237 1.00 80.25  ? 49  TYR D C   1 
ATOM   1814 O O   . TYR B 2 49  ? 30.959  6.404   -54.971 1.00 81.31  ? 49  TYR D O   1 
ATOM   1815 C CB  . TYR B 2 49  ? 30.562  9.784   -54.770 1.00 74.18  ? 49  TYR D CB  1 
ATOM   1816 C CG  . TYR B 2 49  ? 29.207  9.372   -55.309 1.00 78.35  ? 49  TYR D CG  1 
ATOM   1817 C CD1 . TYR B 2 49  ? 28.914  9.471   -56.666 1.00 80.27  ? 49  TYR D CD1 1 
ATOM   1818 C CD2 . TYR B 2 49  ? 28.208  8.900   -54.461 1.00 81.10  ? 49  TYR D CD2 1 
ATOM   1819 C CE1 . TYR B 2 49  ? 27.677  9.078   -57.174 1.00 81.55  ? 49  TYR D CE1 1 
ATOM   1820 C CE2 . TYR B 2 49  ? 26.961  8.510   -54.956 1.00 83.21  ? 49  TYR D CE2 1 
ATOM   1821 C CZ  . TYR B 2 49  ? 26.702  8.603   -56.316 1.00 93.29  ? 49  TYR D CZ  1 
ATOM   1822 O OH  . TYR B 2 49  ? 25.490  8.220   -56.833 1.00 100.31 ? 49  TYR D OH  1 
ATOM   1823 N N   . ALA B 2 50  ? 31.271  7.272   -52.890 1.00 76.82  ? 50  ALA D N   1 
ATOM   1824 C CA  . ALA B 2 50  ? 30.941  6.052   -52.135 1.00 77.12  ? 50  ALA D CA  1 
ATOM   1825 C C   . ALA B 2 50  ? 31.578  4.790   -52.728 1.00 82.95  ? 50  ALA D C   1 
ATOM   1826 O O   . ALA B 2 50  ? 30.871  3.838   -53.065 1.00 84.16  ? 50  ALA D O   1 
ATOM   1827 C CB  . ALA B 2 50  ? 29.434  5.880   -52.007 1.00 77.89  ? 50  ALA D CB  1 
ATOM   1828 N N   . ALA B 2 51  ? 32.923  4.831   -52.909 1.00 78.51  ? 51  ALA D N   1 
ATOM   1829 C CA  . ALA B 2 51  ? 33.829  3.789   -53.420 1.00 77.26  ? 51  ALA D CA  1 
ATOM   1830 C C   . ALA B 2 51  ? 33.635  3.374   -54.879 1.00 82.14  ? 51  ALA D C   1 
ATOM   1831 O O   . ALA B 2 51  ? 34.614  3.334   -55.638 1.00 82.18  ? 51  ALA D O   1 
ATOM   1832 C CB  . ALA B 2 51  ? 33.791  2.549   -52.533 1.00 77.32  ? 51  ALA D CB  1 
ATOM   1833 N N   . THR B 2 52  ? 32.403  3.016   -55.250 1.00 78.11  ? 52  THR D N   1 
ATOM   1834 C CA  . THR B 2 52  ? 32.057  2.418   -56.531 1.00 77.17  ? 52  THR D CA  1 
ATOM   1835 C C   . THR B 2 52  ? 31.115  3.223   -57.417 1.00 80.49  ? 52  THR D C   1 
ATOM   1836 O O   . THR B 2 52  ? 31.011  2.914   -58.593 1.00 80.46  ? 52  THR D O   1 
ATOM   1837 C CB  . THR B 2 52  ? 31.428  1.026   -56.241 1.00 84.68  ? 52  THR D CB  1 
ATOM   1838 O OG1 . THR B 2 52  ? 30.160  1.234   -55.616 1.00 84.32  ? 52  THR D OG1 1 
ATOM   1839 C CG2 . THR B 2 52  ? 32.285  0.141   -55.316 1.00 82.41  ? 52  THR D CG2 1 
ATOM   1840 N N   . ASN B 2 53  ? 30.401  4.202   -56.870 1.00 77.66  ? 53  ASN D N   1 
ATOM   1841 C CA  . ASN B 2 53  ? 29.422  4.969   -57.639 1.00 77.68  ? 53  ASN D CA  1 
ATOM   1842 C C   . ASN B 2 53  ? 30.016  6.061   -58.585 1.00 79.95  ? 53  ASN D C   1 
ATOM   1843 O O   . ASN B 2 53  ? 30.751  6.928   -58.123 1.00 79.84  ? 53  ASN D O   1 
ATOM   1844 C CB  . ASN B 2 53  ? 28.405  5.584   -56.671 1.00 79.20  ? 53  ASN D CB  1 
ATOM   1845 C CG  . ASN B 2 53  ? 27.363  4.609   -56.259 1.00 104.79 ? 53  ASN D CG  1 
ATOM   1846 O OD1 . ASN B 2 53  ? 27.375  4.129   -55.126 1.00 108.94 ? 53  ASN D OD1 1 
ATOM   1847 N ND2 . ASN B 2 53  ? 26.469  4.282   -57.187 1.00 94.26  ? 53  ASN D ND2 1 
ATOM   1848 N N   . LEU B 2 54  ? 29.679  6.039   -59.901 1.00 73.63  ? 54  LEU D N   1 
ATOM   1849 C CA  . LEU B 2 54  ? 30.170  7.086   -60.844 1.00 72.01  ? 54  LEU D CA  1 
ATOM   1850 C C   . LEU B 2 54  ? 29.359  8.390   -60.710 1.00 77.17  ? 54  LEU D C   1 
ATOM   1851 O O   . LEU B 2 54  ? 28.138  8.328   -60.595 1.00 76.52  ? 54  LEU D O   1 
ATOM   1852 C CB  . LEU B 2 54  ? 30.093  6.623   -62.331 1.00 70.50  ? 54  LEU D CB  1 
ATOM   1853 C CG  . LEU B 2 54  ? 31.123  5.630   -62.871 1.00 71.63  ? 54  LEU D CG  1 
ATOM   1854 C CD1 . LEU B 2 54  ? 30.999  5.478   -64.337 1.00 69.52  ? 54  LEU D CD1 1 
ATOM   1855 C CD2 . LEU B 2 54  ? 32.497  6.065   -62.582 1.00 73.69  ? 54  LEU D CD2 1 
ATOM   1856 N N   . ALA B 2 55  ? 30.017  9.557   -60.798 1.00 75.75  ? 55  ALA D N   1 
ATOM   1857 C CA  . ALA B 2 55  ? 29.345  10.864  -60.734 1.00 76.76  ? 55  ALA D CA  1 
ATOM   1858 C C   . ALA B 2 55  ? 28.701  11.190  -62.070 1.00 85.71  ? 55  ALA D C   1 
ATOM   1859 O O   . ALA B 2 55  ? 29.269  10.855  -63.108 1.00 84.02  ? 55  ALA D O   1 
ATOM   1860 C CB  . ALA B 2 55  ? 30.334  11.957  -60.351 1.00 77.22  ? 55  ALA D CB  1 
ATOM   1861 N N   . ASP B 2 56  ? 27.494  11.799  -62.057 1.00 88.06  ? 56  ASP D N   1 
ATOM   1862 C CA  . ASP B 2 56  ? 26.775  12.179  -63.285 1.00 90.44  ? 56  ASP D CA  1 
ATOM   1863 C C   . ASP B 2 56  ? 27.659  12.973  -64.265 1.00 94.91  ? 56  ASP D C   1 
ATOM   1864 O O   . ASP B 2 56  ? 28.166  14.038  -63.914 1.00 95.83  ? 56  ASP D O   1 
ATOM   1865 C CB  . ASP B 2 56  ? 25.471  12.943  -62.967 1.00 94.07  ? 56  ASP D CB  1 
ATOM   1866 C CG  . ASP B 2 56  ? 25.600  14.212  -62.105 1.00 114.90 ? 56  ASP D CG  1 
ATOM   1867 O OD1 . ASP B 2 56  ? 26.618  14.343  -61.366 1.00 117.23 ? 56  ASP D OD1 1 
ATOM   1868 O OD2 . ASP B 2 56  ? 24.673  15.065  -62.153 1.00 122.13 ? 56  ASP D OD2 1 
ATOM   1869 N N   . GLY B 2 57  ? 27.874  12.398  -65.450 1.00 90.04  ? 57  GLY D N   1 
ATOM   1870 C CA  . GLY B 2 57  ? 28.710  12.958  -66.508 1.00 89.11  ? 57  GLY D CA  1 
ATOM   1871 C C   . GLY B 2 57  ? 29.942  12.125  -66.797 1.00 92.26  ? 57  GLY D C   1 
ATOM   1872 O O   . GLY B 2 57  ? 30.399  12.067  -67.940 1.00 92.49  ? 57  GLY D O   1 
ATOM   1873 N N   . VAL B 2 58  ? 30.476  11.448  -65.752 1.00 86.82  ? 58  VAL D N   1 
ATOM   1874 C CA  . VAL B 2 58  ? 31.657  10.570  -65.780 1.00 85.14  ? 58  VAL D CA  1 
ATOM   1875 C C   . VAL B 2 58  ? 31.410  9.361   -66.712 1.00 89.70  ? 58  VAL D C   1 
ATOM   1876 O O   . VAL B 2 58  ? 30.416  8.662   -66.527 1.00 89.86  ? 58  VAL D O   1 
ATOM   1877 C CB  . VAL B 2 58  ? 32.073  10.169  -64.344 1.00 86.96  ? 58  VAL D CB  1 
ATOM   1878 C CG1 . VAL B 2 58  ? 33.196  9.155   -64.340 1.00 85.91  ? 58  VAL D CG1 1 
ATOM   1879 C CG2 . VAL B 2 58  ? 32.455  11.391  -63.509 1.00 86.53  ? 58  VAL D CG2 1 
ATOM   1880 N N   . PRO B 2 59  ? 32.277  9.116   -67.737 1.00 86.34  ? 59  PRO D N   1 
ATOM   1881 C CA  . PRO B 2 59  ? 32.026  7.995   -68.672 1.00 85.73  ? 59  PRO D CA  1 
ATOM   1882 C C   . PRO B 2 59  ? 32.213  6.601   -68.132 1.00 88.91  ? 59  PRO D C   1 
ATOM   1883 O O   . PRO B 2 59  ? 33.029  6.381   -67.244 1.00 89.51  ? 59  PRO D O   1 
ATOM   1884 C CB  . PRO B 2 59  ? 33.011  8.234   -69.821 1.00 87.83  ? 59  PRO D CB  1 
ATOM   1885 C CG  . PRO B 2 59  ? 33.666  9.536   -69.539 1.00 92.82  ? 59  PRO D CG  1 
ATOM   1886 C CD  . PRO B 2 59  ? 33.490  9.872   -68.108 1.00 88.32  ? 59  PRO D CD  1 
ATOM   1887 N N   . SER B 2 60  ? 31.485  5.652   -68.741 1.00 84.94  ? 60  SER D N   1 
ATOM   1888 C CA  . SER B 2 60  ? 31.424  4.201   -68.461 1.00 84.16  ? 60  SER D CA  1 
ATOM   1889 C C   . SER B 2 60  ? 32.770  3.548   -68.139 1.00 86.02  ? 60  SER D C   1 
ATOM   1890 O O   . SER B 2 60  ? 32.824  2.673   -67.267 1.00 86.49  ? 60  SER D O   1 
ATOM   1891 C CB  . SER B 2 60  ? 30.815  3.455   -69.652 1.00 88.27  ? 60  SER D CB  1 
ATOM   1892 O OG  . SER B 2 60  ? 29.546  3.951   -70.044 1.00 98.15  ? 60  SER D OG  1 
ATOM   1893 N N   . ARG B 2 61  ? 33.848  3.972   -68.868 1.00 79.89  ? 61  ARG D N   1 
ATOM   1894 C CA  . ARG B 2 61  ? 35.240  3.489   -68.762 1.00 77.83  ? 61  ARG D CA  1 
ATOM   1895 C C   . ARG B 2 61  ? 35.908  3.701   -67.367 1.00 77.79  ? 61  ARG D C   1 
ATOM   1896 O O   . ARG B 2 61  ? 36.957  3.096   -67.107 1.00 77.46  ? 61  ARG D O   1 
ATOM   1897 C CB  . ARG B 2 61  ? 36.119  4.079   -69.878 1.00 76.05  ? 61  ARG D CB  1 
ATOM   1898 C CG  . ARG B 2 61  ? 36.330  5.589   -69.807 1.00 85.04  ? 61  ARG D CG  1 
ATOM   1899 C CD  . ARG B 2 61  ? 37.004  6.099   -71.064 1.00 87.79  ? 61  ARG D CD  1 
ATOM   1900 N NE  . ARG B 2 61  ? 37.219  7.547   -71.054 1.00 82.44  ? 61  ARG D NE  1 
ATOM   1901 C CZ  . ARG B 2 61  ? 36.425  8.441   -71.643 1.00 92.69  ? 61  ARG D CZ  1 
ATOM   1902 N NH1 . ARG B 2 61  ? 35.327  8.050   -72.274 1.00 73.95  ? 61  ARG D NH1 1 
ATOM   1903 N NH2 . ARG B 2 61  ? 36.728  9.728   -71.612 1.00 88.14  ? 61  ARG D NH2 1 
ATOM   1904 N N   . PHE B 2 62  ? 35.309  4.547   -66.489 1.00 69.81  ? 62  PHE D N   1 
ATOM   1905 C CA  . PHE B 2 62  ? 35.796  4.774   -65.139 1.00 68.10  ? 62  PHE D CA  1 
ATOM   1906 C C   . PHE B 2 62  ? 35.038  3.828   -64.206 1.00 76.60  ? 62  PHE D C   1 
ATOM   1907 O O   . PHE B 2 62  ? 33.820  3.657   -64.372 1.00 77.64  ? 62  PHE D O   1 
ATOM   1908 C CB  . PHE B 2 62  ? 35.605  6.237   -64.731 1.00 68.45  ? 62  PHE D CB  1 
ATOM   1909 C CG  . PHE B 2 62  ? 36.460  7.194   -65.516 1.00 69.19  ? 62  PHE D CG  1 
ATOM   1910 C CD1 . PHE B 2 62  ? 36.024  7.699   -66.734 1.00 72.06  ? 62  PHE D CD1 1 
ATOM   1911 C CD2 . PHE B 2 62  ? 37.729  7.544   -65.073 1.00 70.76  ? 62  PHE D CD2 1 
ATOM   1912 C CE1 . PHE B 2 62  ? 36.828  8.551   -67.486 1.00 72.98  ? 62  PHE D CE1 1 
ATOM   1913 C CE2 . PHE B 2 62  ? 38.533  8.405   -65.826 1.00 73.61  ? 62  PHE D CE2 1 
ATOM   1914 C CZ  . PHE B 2 62  ? 38.072  8.908   -67.023 1.00 72.00  ? 62  PHE D CZ  1 
ATOM   1915 N N   . SER B 2 63  ? 35.770  3.157   -63.268 1.00 73.65  ? 63  SER D N   1 
ATOM   1916 C CA  . SER B 2 63  ? 35.216  2.187   -62.319 1.00 73.35  ? 63  SER D CA  1 
ATOM   1917 C C   . SER B 2 63  ? 35.785  2.297   -60.890 1.00 79.75  ? 63  SER D C   1 
ATOM   1918 O O   . SER B 2 63  ? 37.003  2.274   -60.708 1.00 79.39  ? 63  SER D O   1 
ATOM   1919 C CB  . SER B 2 63  ? 35.393  0.770   -62.861 1.00 75.43  ? 63  SER D CB  1 
ATOM   1920 O OG  . SER B 2 63  ? 36.204  -0.055  -62.036 1.00 83.32  ? 63  SER D OG  1 
ATOM   1921 N N   . GLY B 2 64  ? 34.900  2.356   -59.897 1.00 78.60  ? 64  GLY D N   1 
ATOM   1922 C CA  . GLY B 2 64  ? 35.314  2.401   -58.498 1.00 80.38  ? 64  GLY D CA  1 
ATOM   1923 C C   . GLY B 2 64  ? 35.152  1.053   -57.825 1.00 89.42  ? 64  GLY D C   1 
ATOM   1924 O O   . GLY B 2 64  ? 34.205  0.328   -58.149 1.00 90.88  ? 64  GLY D O   1 
ATOM   1925 N N   . SER B 2 65  ? 36.078  0.673   -56.908 1.00 87.52  ? 65  SER D N   1 
ATOM   1926 C CA  . SER B 2 65  ? 36.012  -0.647  -56.233 1.00 88.21  ? 65  SER D CA  1 
ATOM   1927 C C   . SER B 2 65  ? 36.682  -0.660  -54.847 1.00 93.66  ? 65  SER D C   1 
ATOM   1928 O O   . SER B 2 65  ? 37.503  0.226   -54.574 1.00 93.93  ? 65  SER D O   1 
ATOM   1929 C CB  . SER B 2 65  ? 36.610  -1.740  -57.116 1.00 90.96  ? 65  SER D CB  1 
ATOM   1930 O OG  . SER B 2 65  ? 38.006  -1.554  -57.268 1.00 99.09  ? 65  SER D OG  1 
ATOM   1931 N N   . GLY B 2 66  ? 36.318  -1.638  -53.999 1.00 89.65  ? 66  GLY D N   1 
ATOM   1932 C CA  . GLY B 2 66  ? 36.878  -1.766  -52.653 1.00 90.66  ? 66  GLY D CA  1 
ATOM   1933 C C   . GLY B 2 66  ? 35.883  -1.797  -51.501 1.00 97.84  ? 66  GLY D C   1 
ATOM   1934 O O   . GLY B 2 66  ? 34.720  -1.414  -51.670 1.00 96.42  ? 66  GLY D O   1 
ATOM   1935 N N   . SER B 2 67  ? 36.339  -2.212  -50.298 1.00 98.49  ? 67  SER D N   1 
ATOM   1936 C CA  . SER B 2 67  ? 35.394  -2.373  -49.185 1.00 101.70 ? 67  SER D CA  1 
ATOM   1937 C C   . SER B 2 67  ? 35.788  -1.763  -47.804 1.00 110.70 ? 67  SER D C   1 
ATOM   1938 O O   . SER B 2 67  ? 34.918  -1.588  -46.923 1.00 111.29 ? 67  SER D O   1 
ATOM   1939 C CB  . SER B 2 67  ? 35.066  -3.859  -48.987 1.00 107.50 ? 67  SER D CB  1 
ATOM   1940 O OG  . SER B 2 67  ? 34.699  -4.538  -50.181 1.00 119.53 ? 67  SER D OG  1 
ATOM   1941 N N   . GLY B 2 68  ? 37.069  -1.477  -47.616 1.00 108.23 ? 68  GLY D N   1 
ATOM   1942 C CA  . GLY B 2 68  ? 37.585  -0.953  -46.355 1.00 107.95 ? 68  GLY D CA  1 
ATOM   1943 C C   . GLY B 2 68  ? 39.080  -1.083  -46.407 1.00 110.89 ? 68  GLY D C   1 
ATOM   1944 O O   . GLY B 2 68  ? 39.583  -2.178  -46.675 1.00 112.76 ? 68  GLY D O   1 
ATOM   1945 N N   . THR B 2 69  ? 39.781  0.039   -46.223 1.00 102.84 ? 69  THR D N   1 
ATOM   1946 C CA  . THR B 2 69  ? 41.239  0.218   -46.340 1.00 100.68 ? 69  THR D CA  1 
ATOM   1947 C C   . THR B 2 69  ? 41.716  0.083   -47.794 1.00 100.25 ? 69  THR D C   1 
ATOM   1948 O O   . THR B 2 69  ? 42.342  1.032   -48.268 1.00 100.59 ? 69  THR D O   1 
ATOM   1949 C CB  . THR B 2 69  ? 42.109  -0.599  -45.370 1.00 105.72 ? 69  THR D CB  1 
ATOM   1950 O OG1 . THR B 2 69  ? 42.047  -1.977  -45.674 1.00 110.05 ? 69  THR D OG1 1 
ATOM   1951 C CG2 . THR B 2 69  ? 41.753  -0.378  -43.941 1.00 103.62 ? 69  THR D CG2 1 
ATOM   1952 N N   . ASP B 2 70  ? 41.396  -1.031  -48.515 1.00 92.50  ? 70  ASP D N   1 
ATOM   1953 C CA  . ASP B 2 70  ? 41.841  -1.255  -49.909 1.00 90.87  ? 70  ASP D CA  1 
ATOM   1954 C C   . ASP B 2 70  ? 40.816  -0.846  -50.977 1.00 91.26  ? 70  ASP D C   1 
ATOM   1955 O O   . ASP B 2 70  ? 39.715  -1.391  -51.004 1.00 93.27  ? 70  ASP D O   1 
ATOM   1956 C CB  . ASP B 2 70  ? 42.290  -2.718  -50.121 1.00 92.72  ? 70  ASP D CB  1 
ATOM   1957 C CG  . ASP B 2 70  ? 43.506  -3.140  -49.310 1.00 106.29 ? 70  ASP D CG  1 
ATOM   1958 O OD1 . ASP B 2 70  ? 44.199  -2.242  -48.754 1.00 107.38 ? 70  ASP D OD1 1 
ATOM   1959 O OD2 . ASP B 2 70  ? 43.777  -4.374  -49.236 1.00 111.67 ? 70  ASP D OD2 1 
ATOM   1960 N N   . TYR B 2 71  ? 41.169  0.124   -51.839 1.00 82.49  ? 71  TYR D N   1 
ATOM   1961 C CA  . TYR B 2 71  ? 40.325  0.643   -52.926 1.00 80.34  ? 71  TYR D CA  1 
ATOM   1962 C C   . TYR B 2 71  ? 41.156  0.888   -54.189 1.00 81.70  ? 71  TYR D C   1 
ATOM   1963 O O   . TYR B 2 71  ? 42.308  1.289   -54.072 1.00 80.16  ? 71  TYR D O   1 
ATOM   1964 C CB  . TYR B 2 71  ? 39.644  1.966   -52.514 1.00 80.78  ? 71  TYR D CB  1 
ATOM   1965 C CG  . TYR B 2 71  ? 38.734  1.835   -51.310 1.00 81.60  ? 71  TYR D CG  1 
ATOM   1966 C CD1 . TYR B 2 71  ? 39.246  1.897   -50.015 1.00 83.70  ? 71  TYR D CD1 1 
ATOM   1967 C CD2 . TYR B 2 71  ? 37.362  1.684   -51.460 1.00 81.69  ? 71  TYR D CD2 1 
ATOM   1968 C CE1 . TYR B 2 71  ? 38.433  1.705   -48.904 1.00 84.74  ? 71  TYR D CE1 1 
ATOM   1969 C CE2 . TYR B 2 71  ? 36.532  1.515   -50.355 1.00 83.12  ? 71  TYR D CE2 1 
ATOM   1970 C CZ  . TYR B 2 71  ? 37.074  1.517   -49.073 1.00 89.41  ? 71  TYR D CZ  1 
ATOM   1971 O OH  . TYR B 2 71  ? 36.285  1.361   -47.955 1.00 81.63  ? 71  TYR D OH  1 
ATOM   1972 N N   . THR B 2 72  ? 40.592  0.614   -55.390 1.00 77.78  ? 72  THR D N   1 
ATOM   1973 C CA  . THR B 2 72  ? 41.257  0.864   -56.673 1.00 77.70  ? 72  THR D CA  1 
ATOM   1974 C C   . THR B 2 72  ? 40.329  1.586   -57.660 1.00 81.09  ? 72  THR D C   1 
ATOM   1975 O O   . THR B 2 72  ? 39.156  1.206   -57.769 1.00 81.49  ? 72  THR D O   1 
ATOM   1976 C CB  . THR B 2 72  ? 41.843  -0.421  -57.355 1.00 86.11  ? 72  THR D CB  1 
ATOM   1977 O OG1 . THR B 2 72  ? 40.903  -0.967  -58.279 1.00 87.77  ? 72  THR D OG1 1 
ATOM   1978 C CG2 . THR B 2 72  ? 42.346  -1.477  -56.377 1.00 81.12  ? 72  THR D CG2 1 
ATOM   1979 N N   . LEU B 2 73  ? 40.856  2.612   -58.383 1.00 75.19  ? 73  LEU D N   1 
ATOM   1980 C CA  . LEU B 2 73  ? 40.147  3.268   -59.490 1.00 73.43  ? 73  LEU D CA  1 
ATOM   1981 C C   . LEU B 2 73  ? 40.798  2.724   -60.714 1.00 77.61  ? 73  LEU D C   1 
ATOM   1982 O O   . LEU B 2 73  ? 42.022  2.727   -60.775 1.00 77.26  ? 73  LEU D O   1 
ATOM   1983 C CB  . LEU B 2 73  ? 40.300  4.794   -59.516 1.00 72.67  ? 73  LEU D CB  1 
ATOM   1984 C CG  . LEU B 2 73  ? 39.877  5.488   -60.829 1.00 74.94  ? 73  LEU D CG  1 
ATOM   1985 C CD1 . LEU B 2 73  ? 38.381  5.813   -60.848 1.00 74.12  ? 73  LEU D CD1 1 
ATOM   1986 C CD2 . LEU B 2 73  ? 40.746  6.699   -61.125 1.00 72.92  ? 73  LEU D CD2 1 
ATOM   1987 N N   . THR B 2 74  ? 40.003  2.247   -61.684 1.00 75.08  ? 74  THR D N   1 
ATOM   1988 C CA  . THR B 2 74  ? 40.549  1.733   -62.939 1.00 75.23  ? 74  THR D CA  1 
ATOM   1989 C C   . THR B 2 74  ? 39.900  2.382   -64.162 1.00 80.36  ? 74  THR D C   1 
ATOM   1990 O O   . THR B 2 74  ? 38.691  2.619   -64.173 1.00 79.85  ? 74  THR D O   1 
ATOM   1991 C CB  . THR B 2 74  ? 40.501  0.191   -63.054 1.00 83.55  ? 74  THR D CB  1 
ATOM   1992 O OG1 . THR B 2 74  ? 39.419  -0.163  -63.896 1.00 85.88  ? 74  THR D OG1 1 
ATOM   1993 C CG2 . THR B 2 74  ? 40.406  -0.547  -61.704 1.00 82.17  ? 74  THR D CG2 1 
ATOM   1994 N N   . ILE B 2 75  ? 40.707  2.628   -65.206 1.00 77.99  ? 75  ILE D N   1 
ATOM   1995 C CA  . ILE B 2 75  ? 40.241  3.121   -66.505 1.00 77.55  ? 75  ILE D CA  1 
ATOM   1996 C C   . ILE B 2 75  ? 40.453  1.956   -67.495 1.00 82.17  ? 75  ILE D C   1 
ATOM   1997 O O   . ILE B 2 75  ? 41.590  1.510   -67.669 1.00 82.10  ? 75  ILE D O   1 
ATOM   1998 C CB  . ILE B 2 75  ? 40.861  4.476   -66.987 1.00 79.97  ? 75  ILE D CB  1 
ATOM   1999 C CG1 . ILE B 2 75  ? 41.029  5.505   -65.823 1.00 79.28  ? 75  ILE D CG1 1 
ATOM   2000 C CG2 . ILE B 2 75  ? 39.992  5.078   -68.113 1.00 81.08  ? 75  ILE D CG2 1 
ATOM   2001 C CD1 . ILE B 2 75  ? 41.900  6.809   -66.137 1.00 74.94  ? 75  ILE D CD1 1 
ATOM   2002 N N   . SER B 2 76  ? 39.356  1.426   -68.078 1.00 78.51  ? 76  SER D N   1 
ATOM   2003 C CA  . SER B 2 76  ? 39.397  0.288   -68.997 1.00 78.73  ? 76  SER D CA  1 
ATOM   2004 C C   . SER B 2 76  ? 40.255  0.531   -70.274 1.00 87.04  ? 76  SER D C   1 
ATOM   2005 O O   . SER B 2 76  ? 41.056  -0.334  -70.645 1.00 86.31  ? 76  SER D O   1 
ATOM   2006 C CB  . SER B 2 76  ? 37.988  -0.160  -69.346 1.00 80.99  ? 76  SER D CB  1 
ATOM   2007 O OG  . SER B 2 76  ? 37.327  0.752   -70.202 1.00 88.12  ? 76  SER D OG  1 
ATOM   2008 N N   . SER B 2 77  ? 40.088  1.702   -70.933 1.00 86.84  ? 77  SER D N   1 
ATOM   2009 C CA  . SER B 2 77  ? 40.892  2.097   -72.103 1.00 87.15  ? 77  SER D CA  1 
ATOM   2010 C C   . SER B 2 77  ? 41.023  3.583   -72.037 1.00 89.52  ? 77  SER D C   1 
ATOM   2011 O O   . SER B 2 77  ? 40.042  4.330   -72.150 1.00 89.08  ? 77  SER D O   1 
ATOM   2012 C CB  . SER B 2 77  ? 40.315  1.618   -73.435 1.00 91.99  ? 77  SER D CB  1 
ATOM   2013 O OG  . SER B 2 77  ? 39.214  2.412   -73.846 1.00 107.27 ? 77  SER D OG  1 
ATOM   2014 N N   . LEU B 2 78  ? 42.241  3.982   -71.723 1.00 84.85  ? 78  LEU D N   1 
ATOM   2015 C CA  . LEU B 2 78  ? 42.683  5.350   -71.563 1.00 84.08  ? 78  LEU D CA  1 
ATOM   2016 C C   . LEU B 2 78  ? 42.440  6.176   -72.838 1.00 87.51  ? 78  LEU D C   1 
ATOM   2017 O O   . LEU B 2 78  ? 42.846  5.774   -73.909 1.00 86.24  ? 78  LEU D O   1 
ATOM   2018 C CB  . LEU B 2 78  ? 44.166  5.315   -71.170 1.00 84.18  ? 78  LEU D CB  1 
ATOM   2019 C CG  . LEU B 2 78  ? 44.683  6.441   -70.334 1.00 90.41  ? 78  LEU D CG  1 
ATOM   2020 C CD1 . LEU B 2 78  ? 44.028  6.448   -68.969 1.00 90.65  ? 78  LEU D CD1 1 
ATOM   2021 C CD2 . LEU B 2 78  ? 46.156  6.299   -70.141 1.00 96.59  ? 78  LEU D CD2 1 
ATOM   2022 N N   . GLN B 2 79  ? 41.701  7.286   -72.745 1.00 84.34  ? 79  GLN D N   1 
ATOM   2023 C CA  . GLN B 2 79  ? 41.402  8.160   -73.902 1.00 82.87  ? 79  GLN D CA  1 
ATOM   2024 C C   . GLN B 2 79  ? 42.285  9.389   -73.818 1.00 83.45  ? 79  GLN D C   1 
ATOM   2025 O O   . GLN B 2 79  ? 42.812  9.626   -72.738 1.00 82.67  ? 79  GLN D O   1 
ATOM   2026 C CB  . GLN B 2 79  ? 39.925  8.607   -73.858 1.00 84.49  ? 79  GLN D CB  1 
ATOM   2027 C CG  . GLN B 2 79  ? 38.912  7.474   -73.994 1.00 104.63 ? 79  GLN D CG  1 
ATOM   2028 C CD  . GLN B 2 79  ? 38.925  6.830   -75.347 1.00 119.01 ? 79  GLN D CD  1 
ATOM   2029 O OE1 . GLN B 2 79  ? 38.442  7.393   -76.331 1.00 109.20 ? 79  GLN D OE1 1 
ATOM   2030 N NE2 . GLN B 2 79  ? 39.480  5.633   -75.417 1.00 115.64 ? 79  GLN D NE2 1 
ATOM   2031 N N   . PRO B 2 80  ? 42.416  10.242  -74.868 1.00 79.33  ? 80  PRO D N   1 
ATOM   2032 C CA  . PRO B 2 80  ? 43.258  11.446  -74.729 1.00 78.72  ? 80  PRO D CA  1 
ATOM   2033 C C   . PRO B 2 80  ? 42.854  12.385  -73.592 1.00 81.85  ? 80  PRO D C   1 
ATOM   2034 O O   . PRO B 2 80  ? 43.721  12.871  -72.869 1.00 82.14  ? 80  PRO D O   1 
ATOM   2035 C CB  . PRO B 2 80  ? 43.150  12.104  -76.100 1.00 80.42  ? 80  PRO D CB  1 
ATOM   2036 C CG  . PRO B 2 80  ? 42.815  10.981  -77.030 1.00 84.54  ? 80  PRO D CG  1 
ATOM   2037 C CD  . PRO B 2 80  ? 41.876  10.144  -76.241 1.00 80.57  ? 80  PRO D CD  1 
ATOM   2038 N N   . GLU B 2 81  ? 41.539  12.582  -73.389 1.00 77.63  ? 81  GLU D N   1 
ATOM   2039 C CA  . GLU B 2 81  ? 40.960  13.440  -72.332 1.00 75.89  ? 81  GLU D CA  1 
ATOM   2040 C C   . GLU B 2 81  ? 41.277  12.993  -70.903 1.00 77.65  ? 81  GLU D C   1 
ATOM   2041 O O   . GLU B 2 81  ? 41.339  13.837  -70.019 1.00 79.37  ? 81  GLU D O   1 
ATOM   2042 C CB  . GLU B 2 81  ? 39.435  13.612  -72.502 1.00 76.88  ? 81  GLU D CB  1 
ATOM   2043 C CG  . GLU B 2 81  ? 38.662  12.325  -72.768 1.00 90.41  ? 81  GLU D CG  1 
ATOM   2044 C CD  . GLU B 2 81  ? 38.090  12.228  -74.173 1.00 126.88 ? 81  GLU D CD  1 
ATOM   2045 O OE1 . GLU B 2 81  ? 38.687  11.519  -75.018 1.00 127.28 ? 81  GLU D OE1 1 
ATOM   2046 O OE2 . GLU B 2 81  ? 37.048  12.872  -74.435 1.00 125.06 ? 81  GLU D OE2 1 
ATOM   2047 N N   . ASP B 2 82  ? 41.512  11.693  -70.683 1.00 70.63  ? 82  ASP D N   1 
ATOM   2048 C CA  . ASP B 2 82  ? 41.758  11.107  -69.360 1.00 68.49  ? 82  ASP D CA  1 
ATOM   2049 C C   . ASP B 2 82  ? 43.148  11.394  -68.777 1.00 71.48  ? 82  ASP D C   1 
ATOM   2050 O O   . ASP B 2 82  ? 43.436  10.992  -67.647 1.00 69.56  ? 82  ASP D O   1 
ATOM   2051 C CB  . ASP B 2 82  ? 41.478  9.594   -69.359 1.00 69.73  ? 82  ASP D CB  1 
ATOM   2052 C CG  . ASP B 2 82  ? 40.176  9.144   -69.993 1.00 80.62  ? 82  ASP D CG  1 
ATOM   2053 O OD1 . ASP B 2 82  ? 39.247  9.964   -70.082 1.00 81.79  ? 82  ASP D OD1 1 
ATOM   2054 O OD2 . ASP B 2 82  ? 40.085  7.955   -70.385 1.00 87.90  ? 82  ASP D OD2 1 
ATOM   2055 N N   . PHE B 2 83  ? 44.028  12.063  -69.523 1.00 70.73  ? 83  PHE D N   1 
ATOM   2056 C CA  . PHE B 2 83  ? 45.345  12.342  -68.957 1.00 71.13  ? 83  PHE D CA  1 
ATOM   2057 C C   . PHE B 2 83  ? 45.206  13.499  -67.949 1.00 77.25  ? 83  PHE D C   1 
ATOM   2058 O O   . PHE B 2 83  ? 44.841  14.613  -68.319 1.00 78.58  ? 83  PHE D O   1 
ATOM   2059 C CB  . PHE B 2 83  ? 46.417  12.507  -70.047 1.00 72.22  ? 83  PHE D CB  1 
ATOM   2060 C CG  . PHE B 2 83  ? 46.587  11.233  -70.867 1.00 72.76  ? 83  PHE D CG  1 
ATOM   2061 C CD1 . PHE B 2 83  ? 47.404  10.193  -70.420 1.00 75.53  ? 83  PHE D CD1 1 
ATOM   2062 C CD2 . PHE B 2 83  ? 45.907  11.059  -72.063 1.00 73.92  ? 83  PHE D CD2 1 
ATOM   2063 C CE1 . PHE B 2 83  ? 47.548  9.015   -71.170 1.00 75.93  ? 83  PHE D CE1 1 
ATOM   2064 C CE2 . PHE B 2 83  ? 46.051  9.872   -72.812 1.00 76.51  ? 83  PHE D CE2 1 
ATOM   2065 C CZ  . PHE B 2 83  ? 46.874  8.864   -72.362 1.00 74.14  ? 83  PHE D CZ  1 
ATOM   2066 N N   . ALA B 2 84  ? 45.327  13.165  -66.652 1.00 73.61  ? 84  ALA D N   1 
ATOM   2067 C CA  . ALA B 2 84  ? 45.180  14.092  -65.535 1.00 73.53  ? 84  ALA D CA  1 
ATOM   2068 C C   . ALA B 2 84  ? 45.804  13.513  -64.275 1.00 79.33  ? 84  ALA D C   1 
ATOM   2069 O O   . ALA B 2 84  ? 46.409  12.446  -64.329 1.00 80.89  ? 84  ALA D O   1 
ATOM   2070 C CB  . ALA B 2 84  ? 43.706  14.379  -65.299 1.00 74.54  ? 84  ALA D CB  1 
ATOM   2071 N N   . THR B 2 85  ? 45.649  14.222  -63.141 1.00 76.09  ? 85  THR D N   1 
ATOM   2072 C CA  . THR B 2 85  ? 46.112  13.842  -61.800 1.00 74.50  ? 85  THR D CA  1 
ATOM   2073 C C   . THR B 2 85  ? 44.882  13.330  -61.045 1.00 71.28  ? 85  THR D C   1 
ATOM   2074 O O   . THR B 2 85  ? 43.893  14.044  -60.915 1.00 68.66  ? 85  THR D O   1 
ATOM   2075 C CB  . THR B 2 85  ? 46.809  15.054  -61.114 1.00 87.19  ? 85  THR D CB  1 
ATOM   2076 O OG1 . THR B 2 85  ? 47.628  15.766  -62.061 1.00 88.77  ? 85  THR D OG1 1 
ATOM   2077 C CG2 . THR B 2 85  ? 47.642  14.655  -59.911 1.00 86.50  ? 85  THR D CG2 1 
ATOM   2078 N N   . TYR B 2 86  ? 44.929  12.088  -60.604 1.00 66.45  ? 86  TYR D N   1 
ATOM   2079 C CA  . TYR B 2 86  ? 43.804  11.488  -59.875 1.00 67.10  ? 86  TYR D CA  1 
ATOM   2080 C C   . TYR B 2 86  ? 44.044  11.422  -58.383 1.00 73.67  ? 86  TYR D C   1 
ATOM   2081 O O   . TYR B 2 86  ? 45.181  11.214  -57.976 1.00 73.79  ? 86  TYR D O   1 
ATOM   2082 C CB  . TYR B 2 86  ? 43.446  10.118  -60.436 1.00 68.14  ? 86  TYR D CB  1 
ATOM   2083 C CG  . TYR B 2 86  ? 42.966  10.206  -61.862 1.00 70.48  ? 86  TYR D CG  1 
ATOM   2084 C CD1 . TYR B 2 86  ? 43.872  10.337  -62.924 1.00 71.70  ? 86  TYR D CD1 1 
ATOM   2085 C CD2 . TYR B 2 86  ? 41.608  10.235  -62.155 1.00 71.19  ? 86  TYR D CD2 1 
ATOM   2086 C CE1 . TYR B 2 86  ? 43.429  10.475  -64.236 1.00 68.99  ? 86  TYR D CE1 1 
ATOM   2087 C CE2 . TYR B 2 86  ? 41.159  10.317  -63.468 1.00 71.79  ? 86  TYR D CE2 1 
ATOM   2088 C CZ  . TYR B 2 86  ? 42.070  10.447  -64.499 1.00 72.10  ? 86  TYR D CZ  1 
ATOM   2089 O OH  . TYR B 2 86  ? 41.582  10.539  -65.760 1.00 68.86  ? 86  TYR D OH  1 
ATOM   2090 N N   . TYR B 2 87  ? 42.992  11.655  -57.563 1.00 71.05  ? 87  TYR D N   1 
ATOM   2091 C CA  . TYR B 2 87  ? 43.090  11.666  -56.107 1.00 70.50  ? 87  TYR D CA  1 
ATOM   2092 C C   . TYR B 2 87  ? 41.957  10.915  -55.527 1.00 75.18  ? 87  TYR D C   1 
ATOM   2093 O O   . TYR B 2 87  ? 40.847  11.038  -56.018 1.00 73.21  ? 87  TYR D O   1 
ATOM   2094 C CB  . TYR B 2 87  ? 42.980  13.098  -55.549 1.00 71.94  ? 87  TYR D CB  1 
ATOM   2095 C CG  . TYR B 2 87  ? 44.067  14.076  -55.941 1.00 75.58  ? 87  TYR D CG  1 
ATOM   2096 C CD1 . TYR B 2 87  ? 45.183  14.277  -55.127 1.00 78.21  ? 87  TYR D CD1 1 
ATOM   2097 C CD2 . TYR B 2 87  ? 43.931  14.881  -57.064 1.00 76.27  ? 87  TYR D CD2 1 
ATOM   2098 C CE1 . TYR B 2 87  ? 46.161  15.215  -55.455 1.00 78.23  ? 87  TYR D CE1 1 
ATOM   2099 C CE2 . TYR B 2 87  ? 44.893  15.829  -57.391 1.00 77.37  ? 87  TYR D CE2 1 
ATOM   2100 C CZ  . TYR B 2 87  ? 46.007  15.989  -56.589 1.00 82.75  ? 87  TYR D CZ  1 
ATOM   2101 O OH  . TYR B 2 87  ? 46.947  16.913  -56.956 1.00 82.96  ? 87  TYR D OH  1 
ATOM   2102 N N   . CYS B 2 88  ? 42.210  10.158  -54.456 1.00 74.93  ? 88  CYS D N   1 
ATOM   2103 C CA  . CYS B 2 88  ? 41.178  9.495   -53.659 1.00 75.18  ? 88  CYS D CA  1 
ATOM   2104 C C   . CYS B 2 88  ? 41.009  10.317  -52.382 1.00 76.28  ? 88  CYS D C   1 
ATOM   2105 O O   . CYS B 2 88  ? 41.918  11.053  -52.002 1.00 76.06  ? 88  CYS D O   1 
ATOM   2106 C CB  . CYS B 2 88  ? 41.538  8.048   -53.355 1.00 77.06  ? 88  CYS D CB  1 
ATOM   2107 S SG  . CYS B 2 88  ? 43.099  7.839   -52.461 1.00 83.02  ? 88  CYS D SG  1 
ATOM   2108 N N   . GLN B 2 89  ? 39.844  10.264  -51.751 1.00 71.22  ? 89  GLN D N   1 
ATOM   2109 C CA  . GLN B 2 89  ? 39.604  11.013  -50.507 1.00 69.97  ? 89  GLN D CA  1 
ATOM   2110 C C   . GLN B 2 89  ? 38.701  10.209  -49.639 1.00 71.00  ? 89  GLN D C   1 
ATOM   2111 O O   . GLN B 2 89  ? 37.843  9.511   -50.163 1.00 69.34  ? 89  GLN D O   1 
ATOM   2112 C CB  . GLN B 2 89  ? 38.983  12.393  -50.822 1.00 71.54  ? 89  GLN D CB  1 
ATOM   2113 C CG  . GLN B 2 89  ? 38.509  13.258  -49.651 1.00 81.79  ? 89  GLN D CG  1 
ATOM   2114 C CD  . GLN B 2 89  ? 37.038  13.622  -49.730 1.00 92.79  ? 89  GLN D CD  1 
ATOM   2115 O OE1 . GLN B 2 89  ? 36.499  14.033  -50.756 1.00 78.95  ? 89  GLN D OE1 1 
ATOM   2116 N NE2 . GLN B 2 89  ? 36.341  13.485  -48.627 1.00 91.10  ? 89  GLN D NE2 1 
ATOM   2117 N N   . HIS B 2 90  ? 38.880  10.291  -48.316 1.00 68.62  ? 90  HIS D N   1 
ATOM   2118 C CA  . HIS B 2 90  ? 37.995  9.603   -47.355 1.00 67.77  ? 90  HIS D CA  1 
ATOM   2119 C C   . HIS B 2 90  ? 37.052  10.626  -46.694 1.00 73.83  ? 90  HIS D C   1 
ATOM   2120 O O   . HIS B 2 90  ? 37.399  11.811  -46.563 1.00 72.07  ? 90  HIS D O   1 
ATOM   2121 C CB  . HIS B 2 90  ? 38.786  8.777   -46.294 1.00 67.56  ? 90  HIS D CB  1 
ATOM   2122 C CG  . HIS B 2 90  ? 39.220  9.557   -45.075 1.00 70.20  ? 90  HIS D CG  1 
ATOM   2123 N ND1 . HIS B 2 90  ? 40.047  10.665  -45.147 1.00 71.97  ? 90  HIS D ND1 1 
ATOM   2124 C CD2 . HIS B 2 90  ? 38.723  9.483   -43.814 1.00 70.74  ? 90  HIS D CD2 1 
ATOM   2125 C CE1 . HIS B 2 90  ? 40.117  11.136  -43.909 1.00 69.80  ? 90  HIS D CE1 1 
ATOM   2126 N NE2 . HIS B 2 90  ? 39.351  10.457  -43.074 1.00 70.40  ? 90  HIS D NE2 1 
ATOM   2127 N N   . PHE B 2 91  ? 35.877  10.179  -46.301 1.00 73.23  ? 91  PHE D N   1 
ATOM   2128 C CA  . PHE B 2 91  ? 34.928  11.005  -45.578 1.00 73.85  ? 91  PHE D CA  1 
ATOM   2129 C C   . PHE B 2 91  ? 34.272  10.193  -44.479 1.00 81.06  ? 91  PHE D C   1 
ATOM   2130 O O   . PHE B 2 91  ? 33.118  10.416  -44.165 1.00 83.20  ? 91  PHE D O   1 
ATOM   2131 C CB  . PHE B 2 91  ? 33.935  11.719  -46.495 1.00 75.52  ? 91  PHE D CB  1 
ATOM   2132 C CG  . PHE B 2 91  ? 33.266  10.881  -47.554 1.00 76.94  ? 91  PHE D CG  1 
ATOM   2133 C CD1 . PHE B 2 91  ? 33.858  10.701  -48.796 1.00 80.44  ? 91  PHE D CD1 1 
ATOM   2134 C CD2 . PHE B 2 91  ? 31.999  10.360  -47.350 1.00 78.46  ? 91  PHE D CD2 1 
ATOM   2135 C CE1 . PHE B 2 91  ? 33.223  9.948   -49.790 1.00 81.44  ? 91  PHE D CE1 1 
ATOM   2136 C CE2 . PHE B 2 91  ? 31.357  9.629   -48.350 1.00 81.22  ? 91  PHE D CE2 1 
ATOM   2137 C CZ  . PHE B 2 91  ? 31.975  9.423   -49.560 1.00 79.45  ? 91  PHE D CZ  1 
ATOM   2138 N N   . TRP B 2 92  ? 35.023  9.247   -43.899 1.00 77.27  ? 92  TRP D N   1 
ATOM   2139 C CA  . TRP B 2 92  ? 34.619  8.453   -42.761 1.00 78.02  ? 92  TRP D CA  1 
ATOM   2140 C C   . TRP B 2 92  ? 34.825  9.287   -41.464 1.00 83.58  ? 92  TRP D C   1 
ATOM   2141 O O   . TRP B 2 92  ? 33.870  9.465   -40.696 1.00 86.13  ? 92  TRP D O   1 
ATOM   2142 C CB  . TRP B 2 92  ? 35.381  7.106   -42.727 1.00 77.29  ? 92  TRP D CB  1 
ATOM   2143 C CG  . TRP B 2 92  ? 35.297  6.364   -41.418 1.00 78.90  ? 92  TRP D CG  1 
ATOM   2144 C CD1 . TRP B 2 92  ? 36.250  6.342   -40.436 1.00 81.97  ? 92  TRP D CD1 1 
ATOM   2145 C CD2 . TRP B 2 92  ? 34.146  5.705   -40.874 1.00 78.69  ? 92  TRP D CD2 1 
ATOM   2146 N NE1 . TRP B 2 92  ? 35.781  5.662   -39.332 1.00 81.61  ? 92  TRP D NE1 1 
ATOM   2147 C CE2 . TRP B 2 92  ? 34.503  5.232   -39.585 1.00 83.16  ? 92  TRP D CE2 1 
ATOM   2148 C CE3 . TRP B 2 92  ? 32.875  5.391   -41.379 1.00 80.07  ? 92  TRP D CE3 1 
ATOM   2149 C CZ2 . TRP B 2 92  ? 33.625  4.477   -38.792 1.00 82.69  ? 92  TRP D CZ2 1 
ATOM   2150 C CZ3 . TRP B 2 92  ? 31.994  4.666   -40.583 1.00 81.99  ? 92  TRP D CZ3 1 
ATOM   2151 C CH2 . TRP B 2 92  ? 32.371  4.212   -39.308 1.00 82.65  ? 92  TRP D CH2 1 
ATOM   2152 N N   . GLY B 2 93  ? 36.040  9.789   -41.235 1.00 77.54  ? 93  GLY D N   1 
ATOM   2153 C CA  . GLY B 2 93  ? 36.354  10.551  -40.031 1.00 77.26  ? 93  GLY D CA  1 
ATOM   2154 C C   . GLY B 2 93  ? 37.087  11.846  -40.285 1.00 82.89  ? 93  GLY D C   1 
ATOM   2155 O O   . GLY B 2 93  ? 37.808  11.974  -41.270 1.00 83.77  ? 93  GLY D O   1 
ATOM   2156 N N   . THR B 2 94  ? 36.920  12.806  -39.383 1.00 78.93  ? 94  THR D N   1 
ATOM   2157 C CA  . THR B 2 94  ? 37.529  14.135  -39.435 1.00 77.02  ? 94  THR D CA  1 
ATOM   2158 C C   . THR B 2 94  ? 39.001  14.049  -38.995 1.00 79.50  ? 94  THR D C   1 
ATOM   2159 O O   . THR B 2 94  ? 39.294  13.361  -38.012 1.00 79.54  ? 94  THR D O   1 
ATOM   2160 C CB  . THR B 2 94  ? 36.751  15.017  -38.474 1.00 78.30  ? 94  THR D CB  1 
ATOM   2161 O OG1 . THR B 2 94  ? 35.344  14.709  -38.534 1.00 78.23  ? 94  THR D OG1 1 
ATOM   2162 C CG2 . THR B 2 94  ? 37.025  16.482  -38.646 1.00 75.52  ? 94  THR D CG2 1 
ATOM   2163 N N   . PRO B 2 95  ? 39.950  14.725  -39.673 1.00 75.25  ? 95  PRO D N   1 
ATOM   2164 C CA  . PRO B 2 95  ? 39.785  15.582  -40.864 1.00 74.84  ? 95  PRO D CA  1 
ATOM   2165 C C   . PRO B 2 95  ? 39.703  14.763  -42.147 1.00 78.78  ? 95  PRO D C   1 
ATOM   2166 O O   . PRO B 2 95  ? 40.248  13.662  -42.182 1.00 79.93  ? 95  PRO D O   1 
ATOM   2167 C CB  . PRO B 2 95  ? 41.046  16.455  -40.831 1.00 76.14  ? 95  PRO D CB  1 
ATOM   2168 C CG  . PRO B 2 95  ? 42.088  15.598  -40.166 1.00 80.44  ? 95  PRO D CG  1 
ATOM   2169 C CD  . PRO B 2 95  ? 41.360  14.669  -39.232 1.00 76.32  ? 95  PRO D CD  1 
ATOM   2170 N N   . ARG B 2 96  ? 39.046  15.293  -43.200 1.00 72.34  ? 96  ARG D N   1 
ATOM   2171 C CA  . ARG B 2 96  ? 38.997  14.619  -44.504 1.00 69.58  ? 96  ARG D CA  1 
ATOM   2172 C C   . ARG B 2 96  ? 40.412  14.629  -45.039 1.00 72.86  ? 96  ARG D C   1 
ATOM   2173 O O   . ARG B 2 96  ? 41.132  15.637  -44.941 1.00 72.11  ? 96  ARG D O   1 
ATOM   2174 C CB  . ARG B 2 96  ? 38.030  15.292  -45.511 1.00 64.36  ? 96  ARG D CB  1 
ATOM   2175 C CG  . ARG B 2 96  ? 36.636  15.629  -44.970 1.00 65.69  ? 96  ARG D CG  1 
ATOM   2176 C CD  . ARG B 2 96  ? 35.837  14.465  -44.351 1.00 55.43  ? 96  ARG D CD  1 
ATOM   2177 N NE  . ARG B 2 96  ? 34.630  14.987  -43.718 1.00 57.73  ? 96  ARG D NE  1 
ATOM   2178 C CZ  . ARG B 2 96  ? 34.320  14.837  -42.432 1.00 75.23  ? 96  ARG D CZ  1 
ATOM   2179 N NH1 . ARG B 2 96  ? 35.082  14.094  -41.638 1.00 66.02  ? 96  ARG D NH1 1 
ATOM   2180 N NH2 . ARG B 2 96  ? 33.223  15.402  -41.938 1.00 52.15  ? 96  ARG D NH2 1 
ATOM   2181 N N   . THR B 2 97  ? 40.842  13.479  -45.516 1.00 69.41  ? 97  THR D N   1 
ATOM   2182 C CA  . THR B 2 97  ? 42.187  13.314  -46.011 1.00 69.04  ? 97  THR D CA  1 
ATOM   2183 C C   . THR B 2 97  ? 42.121  12.881  -47.435 1.00 75.65  ? 97  THR D C   1 
ATOM   2184 O O   . THR B 2 97  ? 41.224  12.108  -47.810 1.00 76.51  ? 97  THR D O   1 
ATOM   2185 C CB  . THR B 2 97  ? 42.915  12.326  -45.118 1.00 73.79  ? 97  THR D CB  1 
ATOM   2186 O OG1 . THR B 2 97  ? 43.154  12.912  -43.856 1.00 76.10  ? 97  THR D OG1 1 
ATOM   2187 C CG2 . THR B 2 97  ? 44.216  11.838  -45.683 1.00 73.00  ? 97  THR D CG2 1 
ATOM   2188 N N   . PHE B 2 98  ? 43.064  13.404  -48.242 1.00 72.51  ? 98  PHE D N   1 
ATOM   2189 C CA  . PHE B 2 98  ? 43.207  13.057  -49.653 1.00 72.09  ? 98  PHE D CA  1 
ATOM   2190 C C   . PHE B 2 98  ? 44.461  12.171  -49.859 1.00 74.89  ? 98  PHE D C   1 
ATOM   2191 O O   . PHE B 2 98  ? 45.391  12.232  -49.057 1.00 75.64  ? 98  PHE D O   1 
ATOM   2192 C CB  . PHE B 2 98  ? 43.336  14.349  -50.473 1.00 73.56  ? 98  PHE D CB  1 
ATOM   2193 C CG  . PHE B 2 98  ? 42.108  15.233  -50.516 1.00 74.89  ? 98  PHE D CG  1 
ATOM   2194 C CD1 . PHE B 2 98  ? 41.853  16.149  -49.503 1.00 76.79  ? 98  PHE D CD1 1 
ATOM   2195 C CD2 . PHE B 2 98  ? 41.236  15.189  -51.599 1.00 77.00  ? 98  PHE D CD2 1 
ATOM   2196 C CE1 . PHE B 2 98  ? 40.734  16.983  -49.557 1.00 76.35  ? 98  PHE D CE1 1 
ATOM   2197 C CE2 . PHE B 2 98  ? 40.129  16.046  -51.667 1.00 78.57  ? 98  PHE D CE2 1 
ATOM   2198 C CZ  . PHE B 2 98  ? 39.887  16.931  -50.642 1.00 75.46  ? 98  PHE D CZ  1 
ATOM   2199 N N   . GLY B 2 99  ? 44.481  11.390  -50.930 1.00 69.26  ? 99  GLY D N   1 
ATOM   2200 C CA  . GLY B 2 99  ? 45.649  10.621  -51.338 1.00 68.52  ? 99  GLY D CA  1 
ATOM   2201 C C   . GLY B 2 99  ? 46.635  11.565  -52.008 1.00 72.66  ? 99  GLY D C   1 
ATOM   2202 O O   . GLY B 2 99  ? 46.251  12.648  -52.475 1.00 71.03  ? 99  GLY D O   1 
ATOM   2203 N N   . GLY B 2 100 ? 47.902  11.159  -52.047 1.00 70.83  ? 100 GLY D N   1 
ATOM   2204 C CA  . GLY B 2 100 ? 49.007  11.937  -52.607 1.00 70.93  ? 100 GLY D CA  1 
ATOM   2205 C C   . GLY B 2 100 ? 48.891  12.376  -54.056 1.00 76.72  ? 100 GLY D C   1 
ATOM   2206 O O   . GLY B 2 100 ? 49.572  13.320  -54.477 1.00 77.45  ? 100 GLY D O   1 
ATOM   2207 N N   . GLY B 2 101 ? 48.032  11.703  -54.810 1.00 73.18  ? 101 GLY D N   1 
ATOM   2208 C CA  . GLY B 2 101 ? 47.802  11.999  -56.217 1.00 72.49  ? 101 GLY D CA  1 
ATOM   2209 C C   . GLY B 2 101 ? 48.557  11.067  -57.149 1.00 76.41  ? 101 GLY D C   1 
ATOM   2210 O O   . GLY B 2 101 ? 49.652  10.620  -56.801 1.00 76.76  ? 101 GLY D O   1 
ATOM   2211 N N   . THR B 2 102 ? 47.968  10.803  -58.369 1.00 71.11  ? 102 THR D N   1 
ATOM   2212 C CA  . THR B 2 102 ? 48.510  9.975   -59.460 1.00 69.89  ? 102 THR D CA  1 
ATOM   2213 C C   . THR B 2 102 ? 48.504  10.698  -60.831 1.00 70.91  ? 102 THR D C   1 
ATOM   2214 O O   . THR B 2 102 ? 47.452  10.802  -61.464 1.00 70.20  ? 102 THR D O   1 
ATOM   2215 C CB  . THR B 2 102 ? 47.801  8.606   -59.557 1.00 73.22  ? 102 THR D CB  1 
ATOM   2216 O OG1 . THR B 2 102 ? 47.743  8.006   -58.268 1.00 73.40  ? 102 THR D OG1 1 
ATOM   2217 C CG2 . THR B 2 102 ? 48.496  7.669   -60.541 1.00 66.63  ? 102 THR D CG2 1 
ATOM   2218 N N   . LYS B 2 103 ? 49.692  11.076  -61.324 1.00 65.37  ? 103 LYS D N   1 
ATOM   2219 C CA  . LYS B 2 103 ? 49.811  11.728  -62.617 1.00 64.86  ? 103 LYS D CA  1 
ATOM   2220 C C   . LYS B 2 103 ? 49.822  10.727  -63.736 1.00 67.96  ? 103 LYS D C   1 
ATOM   2221 O O   . LYS B 2 103 ? 50.827  10.057  -63.977 1.00 68.42  ? 103 LYS D O   1 
ATOM   2222 C CB  . LYS B 2 103 ? 51.024  12.676  -62.695 1.00 67.98  ? 103 LYS D CB  1 
ATOM   2223 C CG  . LYS B 2 103 ? 50.897  13.711  -63.824 1.00 89.69  ? 103 LYS D CG  1 
ATOM   2224 C CD  . LYS B 2 103 ? 51.351  15.108  -63.428 1.00 104.46 ? 103 LYS D CD  1 
ATOM   2225 C CE  . LYS B 2 103 ? 52.743  15.457  -63.910 1.00 116.55 ? 103 LYS D CE  1 
ATOM   2226 N NZ  . LYS B 2 103 ? 52.724  16.062  -65.264 1.00 125.26 ? 103 LYS D NZ  1 
ATOM   2227 N N   . VAL B 2 104 ? 48.696  10.639  -64.428 1.00 63.47  ? 104 VAL D N   1 
ATOM   2228 C CA  . VAL B 2 104 ? 48.516  9.760   -65.576 1.00 62.92  ? 104 VAL D CA  1 
ATOM   2229 C C   . VAL B 2 104 ? 49.004  10.560  -66.777 1.00 66.82  ? 104 VAL D C   1 
ATOM   2230 O O   . VAL B 2 104 ? 48.472  11.634  -67.079 1.00 66.10  ? 104 VAL D O   1 
ATOM   2231 C CB  . VAL B 2 104 ? 47.060  9.235   -65.703 1.00 65.84  ? 104 VAL D CB  1 
ATOM   2232 C CG1 . VAL B 2 104 ? 46.854  8.462   -66.998 1.00 65.48  ? 104 VAL D CG1 1 
ATOM   2233 C CG2 . VAL B 2 104 ? 46.702  8.367   -64.506 1.00 65.43  ? 104 VAL D CG2 1 
ATOM   2234 N N   . GLU B 2 105 ? 50.088  10.064  -67.385 1.00 63.85  ? 105 GLU D N   1 
ATOM   2235 C CA  . GLU B 2 105 ? 50.783  10.680  -68.497 1.00 64.27  ? 105 GLU D CA  1 
ATOM   2236 C C   . GLU B 2 105 ? 50.745  9.805   -69.729 1.00 68.06  ? 105 GLU D C   1 
ATOM   2237 O O   . GLU B 2 105 ? 50.418  8.638   -69.588 1.00 69.65  ? 105 GLU D O   1 
ATOM   2238 C CB  . GLU B 2 105 ? 52.211  11.063  -68.064 1.00 66.18  ? 105 GLU D CB  1 
ATOM   2239 C CG  . GLU B 2 105 ? 52.217  12.488  -67.511 1.00 85.26  ? 105 GLU D CG  1 
ATOM   2240 C CD  . GLU B 2 105 ? 53.351  12.941  -66.603 1.00 119.50 ? 105 GLU D CD  1 
ATOM   2241 O OE1 . GLU B 2 105 ? 53.882  14.055  -66.838 1.00 95.95  ? 105 GLU D OE1 1 
ATOM   2242 O OE2 . GLU B 2 105 ? 53.696  12.200  -65.651 1.00 122.60 ? 105 GLU D OE2 1 
ATOM   2243 N N   . ILE B 2 106 ? 50.995  10.364  -70.938 1.00 63.39  ? 106 ILE D N   1 
ATOM   2244 C CA  . ILE B 2 106 ? 51.003  9.597   -72.196 1.00 63.35  ? 106 ILE D CA  1 
ATOM   2245 C C   . ILE B 2 106 ? 52.358  8.867   -72.413 1.00 68.61  ? 106 ILE D C   1 
ATOM   2246 O O   . ILE B 2 106 ? 53.422  9.475   -72.302 1.00 68.23  ? 106 ILE D O   1 
ATOM   2247 C CB  . ILE B 2 106 ? 50.609  10.459  -73.439 1.00 65.59  ? 106 ILE D CB  1 
ATOM   2248 C CG1 . ILE B 2 106 ? 49.386  11.340  -73.168 1.00 66.23  ? 106 ILE D CG1 1 
ATOM   2249 C CG2 . ILE B 2 106 ? 50.431  9.608   -74.700 1.00 64.02  ? 106 ILE D CG2 1 
ATOM   2250 C CD1 . ILE B 2 106 ? 48.649  11.970  -74.430 1.00 76.93  ? 106 ILE D CD1 1 
ATOM   2251 N N   . LYS B 2 107 ? 52.315  7.585   -72.745 1.00 66.23  ? 107 LYS D N   1 
ATOM   2252 C CA  . LYS B 2 107 ? 53.554  6.851   -73.039 1.00 66.74  ? 107 LYS D CA  1 
ATOM   2253 C C   . LYS B 2 107 ? 53.932  7.044   -74.494 1.00 72.23  ? 107 LYS D C   1 
ATOM   2254 O O   . LYS B 2 107 ? 53.105  6.907   -75.413 1.00 71.62  ? 107 LYS D O   1 
ATOM   2255 C CB  . LYS B 2 107 ? 53.454  5.339   -72.722 1.00 68.26  ? 107 LYS D CB  1 
ATOM   2256 C CG  . LYS B 2 107 ? 54.820  4.696   -72.539 1.00 80.62  ? 107 LYS D CG  1 
ATOM   2257 C CD  . LYS B 2 107 ? 54.796  3.187   -72.634 1.00 94.34  ? 107 LYS D CD  1 
ATOM   2258 C CE  . LYS B 2 107 ? 55.927  2.601   -71.823 1.00 106.60 ? 107 LYS D CE  1 
ATOM   2259 N NZ  . LYS B 2 107 ? 56.249  1.220   -72.253 1.00 114.11 ? 107 LYS D NZ  1 
ATOM   2260 N N   . ARG B 2 108 ? 55.210  7.305   -74.699 1.00 69.87  ? 108 ARG D N   1 
ATOM   2261 C CA  . ARG B 2 108 ? 55.758  7.495   -76.025 1.00 69.76  ? 108 ARG D CA  1 
ATOM   2262 C C   . ARG B 2 108 ? 57.111  6.820   -76.140 1.00 72.01  ? 108 ARG D C   1 
ATOM   2263 O O   . ARG B 2 108 ? 57.537  6.133   -75.220 1.00 70.98  ? 108 ARG D O   1 
ATOM   2264 C CB  . ARG B 2 108 ? 55.832  8.989   -76.364 1.00 72.85  ? 108 ARG D CB  1 
ATOM   2265 C CG  . ARG B 2 108 ? 55.447  9.202   -77.824 1.00 98.32  ? 108 ARG D CG  1 
ATOM   2266 C CD  . ARG B 2 108 ? 55.842  10.561  -78.341 1.00 112.81 ? 108 ARG D CD  1 
ATOM   2267 N NE  . ARG B 2 108 ? 57.110  10.973  -77.746 1.00 108.78 ? 108 ARG D NE  1 
ATOM   2268 C CZ  . ARG B 2 108 ? 58.282  10.802  -78.321 1.00 117.00 ? 108 ARG D CZ  1 
ATOM   2269 N NH1 . ARG B 2 108 ? 58.371  10.296  -79.546 1.00 86.35  ? 108 ARG D NH1 1 
ATOM   2270 N NH2 . ARG B 2 108 ? 59.386  11.151  -77.682 1.00 116.53 ? 108 ARG D NH2 1 
ATOM   2271 N N   . THR B 2 109 ? 57.757  6.956   -77.286 1.00 69.43  ? 109 THR D N   1 
ATOM   2272 C CA  . THR B 2 109 ? 59.067  6.365   -77.500 1.00 69.96  ? 109 THR D CA  1 
ATOM   2273 C C   . THR B 2 109 ? 60.115  7.285   -76.923 1.00 75.75  ? 109 THR D C   1 
ATOM   2274 O O   . THR B 2 109 ? 59.951  8.505   -76.951 1.00 76.24  ? 109 THR D O   1 
ATOM   2275 C CB  . THR B 2 109 ? 59.338  6.153   -78.983 1.00 74.70  ? 109 THR D CB  1 
ATOM   2276 O OG1 . THR B 2 109 ? 59.208  7.422   -79.640 1.00 78.64  ? 109 THR D OG1 1 
ATOM   2277 C CG2 . THR B 2 109 ? 58.456  5.057   -79.593 1.00 65.98  ? 109 THR D CG2 1 
ATOM   2278 N N   . VAL B 2 110 ? 61.221  6.702   -76.471 1.00 72.41  ? 110 VAL D N   1 
ATOM   2279 C CA  . VAL B 2 110 ? 62.304  7.480   -75.899 1.00 71.85  ? 110 VAL D CA  1 
ATOM   2280 C C   . VAL B 2 110 ? 62.880  8.392   -76.959 1.00 74.82  ? 110 VAL D C   1 
ATOM   2281 O O   . VAL B 2 110 ? 63.278  7.930   -78.035 1.00 76.20  ? 110 VAL D O   1 
ATOM   2282 C CB  . VAL B 2 110 ? 63.394  6.608   -75.243 1.00 76.11  ? 110 VAL D CB  1 
ATOM   2283 C CG1 . VAL B 2 110 ? 64.463  7.469   -74.575 1.00 75.51  ? 110 VAL D CG1 1 
ATOM   2284 C CG2 . VAL B 2 110 ? 62.785  5.644   -74.236 1.00 76.41  ? 110 VAL D CG2 1 
ATOM   2285 N N   . ALA B 2 111 ? 62.888  9.690   -76.666 1.00 67.03  ? 111 ALA D N   1 
ATOM   2286 C CA  . ALA B 2 111 ? 63.458  10.666  -77.564 1.00 64.79  ? 111 ALA D CA  1 
ATOM   2287 C C   . ALA B 2 111 ? 64.428  11.504  -76.780 1.00 70.87  ? 111 ALA D C   1 
ATOM   2288 O O   . ALA B 2 111 ? 64.089  12.029  -75.723 1.00 71.87  ? 111 ALA D O   1 
ATOM   2289 C CB  . ALA B 2 111 ? 62.380  11.524  -78.164 1.00 64.56  ? 111 ALA D CB  1 
ATOM   2290 N N   . ALA B 2 112 ? 65.661  11.583  -77.267 1.00 68.07  ? 112 ALA D N   1 
ATOM   2291 C CA  . ALA B 2 112 ? 66.720  12.364  -76.642 1.00 67.48  ? 112 ALA D CA  1 
ATOM   2292 C C   . ALA B 2 112 ? 66.410  13.868  -76.768 1.00 72.84  ? 112 ALA D C   1 
ATOM   2293 O O   . ALA B 2 112 ? 65.763  14.301  -77.745 1.00 72.49  ? 112 ALA D O   1 
ATOM   2294 C CB  . ALA B 2 112 ? 68.049  12.047  -77.309 1.00 67.75  ? 112 ALA D CB  1 
ATOM   2295 N N   . PRO B 2 113 ? 66.826  14.699  -75.786 1.00 69.13  ? 113 PRO D N   1 
ATOM   2296 C CA  . PRO B 2 113 ? 66.572  16.128  -75.928 1.00 67.58  ? 113 PRO D CA  1 
ATOM   2297 C C   . PRO B 2 113 ? 67.556  16.799  -76.886 1.00 70.16  ? 113 PRO D C   1 
ATOM   2298 O O   . PRO B 2 113 ? 68.686  16.351  -77.064 1.00 67.74  ? 113 PRO D O   1 
ATOM   2299 C CB  . PRO B 2 113 ? 66.719  16.650  -74.498 1.00 68.99  ? 113 PRO D CB  1 
ATOM   2300 C CG  . PRO B 2 113 ? 67.686  15.756  -73.864 1.00 74.12  ? 113 PRO D CG  1 
ATOM   2301 C CD  . PRO B 2 113 ? 67.579  14.410  -74.544 1.00 70.58  ? 113 PRO D CD  1 
ATOM   2302 N N   . SER B 2 114 ? 67.086  17.873  -77.529 1.00 68.65  ? 114 SER D N   1 
ATOM   2303 C CA  . SER B 2 114 ? 67.871  18.756  -78.377 1.00 68.44  ? 114 SER D CA  1 
ATOM   2304 C C   . SER B 2 114 ? 68.332  19.791  -77.353 1.00 71.52  ? 114 SER D C   1 
ATOM   2305 O O   . SER B 2 114 ? 67.493  20.425  -76.700 1.00 68.54  ? 114 SER D O   1 
ATOM   2306 C CB  . SER B 2 114 ? 66.987  19.411  -79.439 1.00 72.08  ? 114 SER D CB  1 
ATOM   2307 O OG  . SER B 2 114 ? 66.144  18.476  -80.099 1.00 76.85  ? 114 SER D OG  1 
ATOM   2308 N N   . VAL B 2 115 ? 69.649  19.865  -77.117 1.00 69.90  ? 115 VAL D N   1 
ATOM   2309 C CA  . VAL B 2 115 ? 70.203  20.796  -76.131 1.00 70.36  ? 115 VAL D CA  1 
ATOM   2310 C C   . VAL B 2 115 ? 70.594  22.096  -76.818 1.00 77.33  ? 115 VAL D C   1 
ATOM   2311 O O   . VAL B 2 115 ? 71.153  22.064  -77.913 1.00 77.51  ? 115 VAL D O   1 
ATOM   2312 C CB  . VAL B 2 115 ? 71.371  20.186  -75.323 1.00 74.26  ? 115 VAL D CB  1 
ATOM   2313 C CG1 . VAL B 2 115 ? 71.728  21.058  -74.120 1.00 74.00  ? 115 VAL D CG1 1 
ATOM   2314 C CG2 . VAL B 2 115 ? 71.046  18.764  -74.876 1.00 73.98  ? 115 VAL D CG2 1 
ATOM   2315 N N   . PHE B 2 116 ? 70.249  23.233  -76.200 1.00 76.35  ? 116 PHE D N   1 
ATOM   2316 C CA  . PHE B 2 116 ? 70.544  24.585  -76.688 1.00 76.91  ? 116 PHE D CA  1 
ATOM   2317 C C   . PHE B 2 116 ? 70.966  25.464  -75.523 1.00 85.12  ? 116 PHE D C   1 
ATOM   2318 O O   . PHE B 2 116 ? 70.372  25.391  -74.447 1.00 85.56  ? 116 PHE D O   1 
ATOM   2319 C CB  . PHE B 2 116 ? 69.321  25.222  -77.359 1.00 78.05  ? 116 PHE D CB  1 
ATOM   2320 C CG  . PHE B 2 116 ? 68.669  24.428  -78.452 1.00 79.15  ? 116 PHE D CG  1 
ATOM   2321 C CD1 . PHE B 2 116 ? 69.313  24.235  -79.668 1.00 82.57  ? 116 PHE D CD1 1 
ATOM   2322 C CD2 . PHE B 2 116 ? 67.390  23.921  -78.288 1.00 81.81  ? 116 PHE D CD2 1 
ATOM   2323 C CE1 . PHE B 2 116 ? 68.693  23.543  -80.699 1.00 84.38  ? 116 PHE D CE1 1 
ATOM   2324 C CE2 . PHE B 2 116 ? 66.759  23.240  -79.321 1.00 85.93  ? 116 PHE D CE2 1 
ATOM   2325 C CZ  . PHE B 2 116 ? 67.418  23.054  -80.523 1.00 84.82  ? 116 PHE D CZ  1 
ATOM   2326 N N   . ILE B 2 117 ? 71.988  26.293  -75.726 1.00 84.22  ? 117 ILE D N   1 
ATOM   2327 C CA  . ILE B 2 117 ? 72.461  27.169  -74.667 1.00 85.33  ? 117 ILE D CA  1 
ATOM   2328 C C   . ILE B 2 117 ? 72.280  28.632  -75.094 1.00 90.65  ? 117 ILE D C   1 
ATOM   2329 O O   . ILE B 2 117 ? 72.423  28.958  -76.279 1.00 89.95  ? 117 ILE D O   1 
ATOM   2330 C CB  . ILE B 2 117 ? 73.893  26.781  -74.179 1.00 89.08  ? 117 ILE D CB  1 
ATOM   2331 C CG1 . ILE B 2 117 ? 74.230  27.426  -72.830 1.00 90.82  ? 117 ILE D CG1 1 
ATOM   2332 C CG2 . ILE B 2 117 ? 74.982  27.030  -75.218 1.00 89.25  ? 117 ILE D CG2 1 
ATOM   2333 C CD1 . ILE B 2 117 ? 75.179  26.594  -71.973 1.00 103.13 ? 117 ILE D CD1 1 
ATOM   2334 N N   . PHE B 2 118 ? 71.853  29.483  -74.140 1.00 87.83  ? 118 PHE D N   1 
ATOM   2335 C CA  . PHE B 2 118 ? 71.610  30.902  -74.376 1.00 87.19  ? 118 PHE D CA  1 
ATOM   2336 C C   . PHE B 2 118 ? 72.430  31.715  -73.397 1.00 93.07  ? 118 PHE D C   1 
ATOM   2337 O O   . PHE B 2 118 ? 72.214  31.619  -72.187 1.00 92.95  ? 118 PHE D O   1 
ATOM   2338 C CB  . PHE B 2 118 ? 70.121  31.257  -74.234 1.00 87.96  ? 118 PHE D CB  1 
ATOM   2339 C CG  . PHE B 2 118 ? 69.196  30.565  -75.199 1.00 88.14  ? 118 PHE D CG  1 
ATOM   2340 C CD1 . PHE B 2 118 ? 68.913  31.131  -76.438 1.00 90.29  ? 118 PHE D CD1 1 
ATOM   2341 C CD2 . PHE B 2 118 ? 68.567  29.365  -74.855 1.00 87.54  ? 118 PHE D CD2 1 
ATOM   2342 C CE1 . PHE B 2 118 ? 68.029  30.499  -77.322 1.00 89.45  ? 118 PHE D CE1 1 
ATOM   2343 C CE2 . PHE B 2 118 ? 67.669  28.750  -75.734 1.00 89.35  ? 118 PHE D CE2 1 
ATOM   2344 C CZ  . PHE B 2 118 ? 67.426  29.308  -76.966 1.00 87.08  ? 118 PHE D CZ  1 
ATOM   2345 N N   . PRO B 2 119 ? 73.371  32.536  -73.895 1.00 90.50  ? 119 PRO D N   1 
ATOM   2346 C CA  . PRO B 2 119 ? 74.183  33.358  -72.988 1.00 90.61  ? 119 PRO D CA  1 
ATOM   2347 C C   . PRO B 2 119 ? 73.374  34.532  -72.433 1.00 95.66  ? 119 PRO D C   1 
ATOM   2348 O O   . PRO B 2 119 ? 72.329  34.852  -73.008 1.00 95.52  ? 119 PRO D O   1 
ATOM   2349 C CB  . PRO B 2 119 ? 75.320  33.852  -73.901 1.00 92.25  ? 119 PRO D CB  1 
ATOM   2350 C CG  . PRO B 2 119 ? 75.238  33.022  -75.147 1.00 96.56  ? 119 PRO D CG  1 
ATOM   2351 C CD  . PRO B 2 119 ? 73.772  32.760  -75.296 1.00 91.97  ? 119 PRO D CD  1 
ATOM   2352 N N   . PRO B 2 120 ? 73.820  35.200  -71.346 1.00 93.09  ? 120 PRO D N   1 
ATOM   2353 C CA  . PRO B 2 120 ? 73.067  36.358  -70.829 1.00 93.45  ? 120 PRO D CA  1 
ATOM   2354 C C   . PRO B 2 120 ? 72.918  37.456  -71.867 1.00 100.94 ? 120 PRO D C   1 
ATOM   2355 O O   . PRO B 2 120 ? 73.889  37.821  -72.528 1.00 101.92 ? 120 PRO D O   1 
ATOM   2356 C CB  . PRO B 2 120 ? 73.922  36.844  -69.660 1.00 94.59  ? 120 PRO D CB  1 
ATOM   2357 C CG  . PRO B 2 120 ? 74.710  35.660  -69.267 1.00 98.74  ? 120 PRO D CG  1 
ATOM   2358 C CD  . PRO B 2 120 ? 75.022  34.954  -70.536 1.00 94.32  ? 120 PRO D CD  1 
ATOM   2359 N N   . SER B 2 121 ? 71.686  37.944  -72.029 1.00 99.39  ? 121 SER D N   1 
ATOM   2360 C CA  . SER B 2 121 ? 71.315  39.018  -72.949 1.00 99.97  ? 121 SER D CA  1 
ATOM   2361 C C   . SER B 2 121 ? 72.043  40.325  -72.572 1.00 102.04 ? 121 SER D C   1 
ATOM   2362 O O   . SER B 2 121 ? 72.329  40.545  -71.400 1.00 101.40 ? 121 SER D O   1 
ATOM   2363 C CB  . SER B 2 121 ? 69.799  39.204  -72.915 1.00 106.27 ? 121 SER D CB  1 
ATOM   2364 O OG  . SER B 2 121 ? 69.382  40.387  -73.566 1.00 121.58 ? 121 SER D OG  1 
ATOM   2365 N N   . ASP B 2 122 ? 72.344  41.183  -73.555 1.00 98.15  ? 122 ASP D N   1 
ATOM   2366 C CA  . ASP B 2 122 ? 73.017  42.448  -73.282 1.00 97.64  ? 122 ASP D CA  1 
ATOM   2367 C C   . ASP B 2 122 ? 72.162  43.379  -72.450 1.00 98.73  ? 122 ASP D C   1 
ATOM   2368 O O   . ASP B 2 122 ? 72.704  44.155  -71.679 1.00 99.69  ? 122 ASP D O   1 
ATOM   2369 C CB  . ASP B 2 122 ? 73.471  43.119  -74.576 1.00 100.77 ? 122 ASP D CB  1 
ATOM   2370 C CG  . ASP B 2 122 ? 74.718  42.489  -75.167 1.00 122.32 ? 122 ASP D CG  1 
ATOM   2371 O OD1 . ASP B 2 122 ? 75.822  42.715  -74.607 1.00 123.81 ? 122 ASP D OD1 1 
ATOM   2372 O OD2 . ASP B 2 122 ? 74.596  41.781  -76.200 1.00 132.48 ? 122 ASP D OD2 1 
ATOM   2373 N N   . GLU B 2 123 ? 70.831  43.274  -72.578 1.00 93.18  ? 123 GLU D N   1 
ATOM   2374 C CA  . GLU B 2 123 ? 69.832  44.056  -71.833 1.00 92.29  ? 123 GLU D CA  1 
ATOM   2375 C C   . GLU B 2 123 ? 69.907  43.681  -70.353 1.00 94.66  ? 123 GLU D C   1 
ATOM   2376 O O   . GLU B 2 123 ? 69.948  44.569  -69.502 1.00 93.37  ? 123 GLU D O   1 
ATOM   2377 C CB  . GLU B 2 123 ? 68.401  43.804  -72.372 1.00 93.71  ? 123 GLU D CB  1 
ATOM   2378 C CG  . GLU B 2 123 ? 68.095  44.402  -73.738 1.00 106.08 ? 123 GLU D CG  1 
ATOM   2379 C CD  . GLU B 2 123 ? 68.922  43.920  -74.920 1.00 134.36 ? 123 GLU D CD  1 
ATOM   2380 O OE1 . GLU B 2 123 ? 69.417  44.791  -75.674 1.00 144.32 ? 123 GLU D OE1 1 
ATOM   2381 O OE2 . GLU B 2 123 ? 69.101  42.688  -75.080 1.00 116.06 ? 123 GLU D OE2 1 
ATOM   2382 N N   . GLN B 2 124 ? 69.945  42.352  -70.053 1.00 90.55  ? 124 GLN D N   1 
ATOM   2383 C CA  . GLN B 2 124 ? 70.051  41.848  -68.686 1.00 89.00  ? 124 GLN D CA  1 
ATOM   2384 C C   . GLN B 2 124 ? 71.384  42.253  -68.090 1.00 91.45  ? 124 GLN D C   1 
ATOM   2385 O O   . GLN B 2 124 ? 71.427  42.700  -66.954 1.00 90.83  ? 124 GLN D O   1 
ATOM   2386 C CB  . GLN B 2 124 ? 69.864  40.333  -68.629 1.00 89.51  ? 124 GLN D CB  1 
ATOM   2387 C CG  . GLN B 2 124 ? 69.581  39.857  -67.204 1.00 101.31 ? 124 GLN D CG  1 
ATOM   2388 C CD  . GLN B 2 124 ? 69.722  38.367  -66.993 1.00 122.53 ? 124 GLN D CD  1 
ATOM   2389 O OE1 . GLN B 2 124 ? 70.188  37.613  -67.865 1.00 120.03 ? 124 GLN D OE1 1 
ATOM   2390 N NE2 . GLN B 2 124 ? 69.312  37.912  -65.807 1.00 104.53 ? 124 GLN D NE2 1 
ATOM   2391 N N   . LEU B 2 125 ? 72.471  42.125  -68.868 1.00 87.14  ? 125 LEU D N   1 
ATOM   2392 C CA  . LEU B 2 125 ? 73.801  42.492  -68.416 1.00 86.85  ? 125 LEU D CA  1 
ATOM   2393 C C   . LEU B 2 125 ? 73.815  43.956  -68.028 1.00 93.61  ? 125 LEU D C   1 
ATOM   2394 O O   . LEU B 2 125 ? 74.493  44.325  -67.058 1.00 94.26  ? 125 LEU D O   1 
ATOM   2395 C CB  . LEU B 2 125 ? 74.833  42.213  -69.492 1.00 86.66  ? 125 LEU D CB  1 
ATOM   2396 C CG  . LEU B 2 125 ? 75.203  40.762  -69.681 1.00 91.91  ? 125 LEU D CG  1 
ATOM   2397 C CD1 . LEU B 2 125 ? 75.829  40.545  -71.052 1.00 91.71  ? 125 LEU D CD1 1 
ATOM   2398 C CD2 . LEU B 2 125 ? 76.079  40.246  -68.523 1.00 96.39  ? 125 LEU D CD2 1 
ATOM   2399 N N   . LYS B 2 126 ? 72.986  44.768  -68.743 1.00 90.46  ? 126 LYS D N   1 
ATOM   2400 C CA  . LYS B 2 126 ? 72.797  46.197  -68.518 1.00 89.95  ? 126 LYS D CA  1 
ATOM   2401 C C   . LYS B 2 126 ? 72.079  46.437  -67.191 1.00 94.36  ? 126 LYS D C   1 
ATOM   2402 O O   . LYS B 2 126 ? 72.193  47.521  -66.640 1.00 95.81  ? 126 LYS D O   1 
ATOM   2403 C CB  . LYS B 2 126 ? 72.055  46.863  -69.698 1.00 92.13  ? 126 LYS D CB  1 
ATOM   2404 C CG  . LYS B 2 126 ? 72.948  47.254  -70.891 1.00 110.64 ? 126 LYS D CG  1 
ATOM   2405 C CD  . LYS B 2 126 ? 73.761  48.564  -70.665 1.00 126.11 ? 126 LYS D CD  1 
ATOM   2406 C CE  . LYS B 2 126 ? 73.018  49.851  -70.976 1.00 131.39 ? 126 LYS D CE  1 
ATOM   2407 N NZ  . LYS B 2 126 ? 72.995  50.156  -72.432 1.00 133.11 ? 126 LYS D NZ  1 
ATOM   2408 N N   . SER B 2 127 ? 71.397  45.421  -66.649 1.00 89.40  ? 127 SER D N   1 
ATOM   2409 C CA  . SER B 2 127 ? 70.707  45.505  -65.372 1.00 88.39  ? 127 SER D CA  1 
ATOM   2410 C C   . SER B 2 127 ? 71.474  44.819  -64.192 1.00 93.08  ? 127 SER D C   1 
ATOM   2411 O O   . SER B 2 127 ? 70.884  44.588  -63.135 1.00 93.46  ? 127 SER D O   1 
ATOM   2412 C CB  . SER B 2 127 ? 69.287  44.975  -65.518 1.00 90.32  ? 127 SER D CB  1 
ATOM   2413 O OG  . SER B 2 127 ? 69.272  43.575  -65.717 1.00 94.27  ? 127 SER D OG  1 
ATOM   2414 N N   . GLY B 2 128 ? 72.765  44.510  -64.391 1.00 89.16  ? 128 GLY D N   1 
ATOM   2415 C CA  . GLY B 2 128 ? 73.694  43.965  -63.387 1.00 88.86  ? 128 GLY D CA  1 
ATOM   2416 C C   . GLY B 2 128 ? 73.541  42.518  -62.966 1.00 93.27  ? 128 GLY D C   1 
ATOM   2417 O O   . GLY B 2 128 ? 74.261  42.019  -62.087 1.00 93.01  ? 128 GLY D O   1 
ATOM   2418 N N   . THR B 2 129 ? 72.526  41.882  -63.541 1.00 89.47  ? 129 THR D N   1 
ATOM   2419 C CA  . THR B 2 129 ? 72.234  40.488  -63.314 1.00 89.30  ? 129 THR D CA  1 
ATOM   2420 C C   . THR B 2 129 ? 72.590  39.723  -64.584 1.00 92.91  ? 129 THR D C   1 
ATOM   2421 O O   . THR B 2 129 ? 72.701  40.332  -65.649 1.00 91.86  ? 129 THR D O   1 
ATOM   2422 C CB  . THR B 2 129 ? 70.811  40.287  -62.750 1.00 97.33  ? 129 THR D CB  1 
ATOM   2423 O OG1 . THR B 2 129 ? 70.641  38.901  -62.471 1.00 98.02  ? 129 THR D OG1 1 
ATOM   2424 C CG2 . THR B 2 129 ? 69.702  40.790  -63.682 1.00 95.66  ? 129 THR D CG2 1 
ATOM   2425 N N   . ALA B 2 130 ? 72.821  38.402  -64.462 1.00 89.77  ? 130 ALA D N   1 
ATOM   2426 C CA  . ALA B 2 130 ? 73.168  37.541  -65.589 1.00 89.17  ? 130 ALA D CA  1 
ATOM   2427 C C   . ALA B 2 130 ? 72.612  36.136  -65.408 1.00 91.62  ? 130 ALA D C   1 
ATOM   2428 O O   . ALA B 2 130 ? 72.857  35.485  -64.386 1.00 91.95  ? 130 ALA D O   1 
ATOM   2429 C CB  . ALA B 2 130 ? 74.681  37.492  -65.774 1.00 90.16  ? 130 ALA D CB  1 
ATOM   2430 N N   . SER B 2 131 ? 71.867  35.661  -66.408 1.00 86.31  ? 131 SER D N   1 
ATOM   2431 C CA  . SER B 2 131 ? 71.313  34.312  -66.378 1.00 84.72  ? 131 SER D CA  1 
ATOM   2432 C C   . SER B 2 131 ? 71.558  33.582  -67.693 1.00 84.18  ? 131 SER D C   1 
ATOM   2433 O O   . SER B 2 131 ? 71.192  34.066  -68.773 1.00 81.38  ? 131 SER D O   1 
ATOM   2434 C CB  . SER B 2 131 ? 69.845  34.286  -65.939 1.00 87.75  ? 131 SER D CB  1 
ATOM   2435 O OG  . SER B 2 131 ? 68.976  35.238  -66.523 1.00 99.21  ? 131 SER D OG  1 
ATOM   2436 N N   . VAL B 2 132 ? 72.230  32.429  -67.587 1.00 80.14  ? 132 VAL D N   1 
ATOM   2437 C CA  . VAL B 2 132 ? 72.524  31.550  -68.715 1.00 79.72  ? 132 VAL D CA  1 
ATOM   2438 C C   . VAL B 2 132 ? 71.422  30.484  -68.752 1.00 82.99  ? 132 VAL D C   1 
ATOM   2439 O O   . VAL B 2 132 ? 71.085  29.928  -67.702 1.00 83.89  ? 132 VAL D O   1 
ATOM   2440 C CB  . VAL B 2 132 ? 73.935  30.931  -68.606 1.00 83.78  ? 132 VAL D CB  1 
ATOM   2441 C CG1 . VAL B 2 132 ? 74.327  30.263  -69.909 1.00 83.41  ? 132 VAL D CG1 1 
ATOM   2442 C CG2 . VAL B 2 132 ? 74.972  31.986  -68.214 1.00 83.96  ? 132 VAL D CG2 1 
ATOM   2443 N N   . VAL B 2 133 ? 70.819  30.246  -69.934 1.00 77.39  ? 133 VAL D N   1 
ATOM   2444 C CA  . VAL B 2 133 ? 69.718  29.296  -70.068 1.00 77.07  ? 133 VAL D CA  1 
ATOM   2445 C C   . VAL B 2 133 ? 70.122  28.061  -70.872 1.00 86.99  ? 133 VAL D C   1 
ATOM   2446 O O   . VAL B 2 133 ? 70.627  28.178  -71.994 1.00 87.98  ? 133 VAL D O   1 
ATOM   2447 C CB  . VAL B 2 133 ? 68.421  29.959  -70.603 1.00 78.95  ? 133 VAL D CB  1 
ATOM   2448 C CG1 . VAL B 2 133 ? 67.338  28.919  -70.897 1.00 78.15  ? 133 VAL D CG1 1 
ATOM   2449 C CG2 . VAL B 2 133 ? 67.893  31.002  -69.623 1.00 78.32  ? 133 VAL D CG2 1 
ATOM   2450 N N   . CYS B 2 134 ? 69.866  26.876  -70.292 1.00 85.75  ? 134 CYS D N   1 
ATOM   2451 C CA  . CYS B 2 134 ? 70.122  25.584  -70.911 1.00 86.89  ? 134 CYS D CA  1 
ATOM   2452 C C   . CYS B 2 134 ? 68.772  24.963  -71.211 1.00 88.91  ? 134 CYS D C   1 
ATOM   2453 O O   . CYS B 2 134 ? 68.049  24.567  -70.293 1.00 90.48  ? 134 CYS D O   1 
ATOM   2454 C CB  . CYS B 2 134 ? 70.957  24.693  -69.996 1.00 88.62  ? 134 CYS D CB  1 
ATOM   2455 S SG  . CYS B 2 134 ? 71.395  23.081  -70.700 1.00 93.78  ? 134 CYS D SG  1 
ATOM   2456 N N   . LEU B 2 135 ? 68.417  24.894  -72.494 1.00 81.21  ? 135 LEU D N   1 
ATOM   2457 C CA  . LEU B 2 135 ? 67.159  24.327  -72.933 1.00 78.43  ? 135 LEU D CA  1 
ATOM   2458 C C   . LEU B 2 135 ? 67.353  22.929  -73.535 1.00 81.36  ? 135 LEU D C   1 
ATOM   2459 O O   . LEU B 2 135 ? 68.132  22.756  -74.473 1.00 80.97  ? 135 LEU D O   1 
ATOM   2460 C CB  . LEU B 2 135 ? 66.515  25.285  -73.939 1.00 77.56  ? 135 LEU D CB  1 
ATOM   2461 C CG  . LEU B 2 135 ? 65.357  24.753  -74.720 1.00 81.73  ? 135 LEU D CG  1 
ATOM   2462 C CD1 . LEU B 2 135 ? 64.118  24.678  -73.852 1.00 82.18  ? 135 LEU D CD1 1 
ATOM   2463 C CD2 . LEU B 2 135 ? 65.125  25.565  -75.965 1.00 81.28  ? 135 LEU D CD2 1 
ATOM   2464 N N   . LEU B 2 136 ? 66.629  21.940  -72.981 1.00 77.11  ? 136 LEU D N   1 
ATOM   2465 C CA  . LEU B 2 136 ? 66.571  20.542  -73.425 1.00 76.78  ? 136 LEU D CA  1 
ATOM   2466 C C   . LEU B 2 136 ? 65.202  20.480  -74.037 1.00 80.04  ? 136 LEU D C   1 
ATOM   2467 O O   . LEU B 2 136 ? 64.203  20.682  -73.342 1.00 79.81  ? 136 LEU D O   1 
ATOM   2468 C CB  . LEU B 2 136 ? 66.645  19.593  -72.224 1.00 77.08  ? 136 LEU D CB  1 
ATOM   2469 C CG  . LEU B 2 136 ? 68.006  19.371  -71.568 1.00 81.83  ? 136 LEU D CG  1 
ATOM   2470 C CD1 . LEU B 2 136 ? 68.548  20.649  -70.919 1.00 82.55  ? 136 LEU D CD1 1 
ATOM   2471 C CD2 . LEU B 2 136 ? 67.899  18.287  -70.522 1.00 83.39  ? 136 LEU D CD2 1 
ATOM   2472 N N   . ASN B 2 137 ? 65.137  20.315  -75.343 1.00 76.78  ? 137 ASN D N   1 
ATOM   2473 C CA  . ASN B 2 137 ? 63.855  20.448  -76.007 1.00 76.93  ? 137 ASN D CA  1 
ATOM   2474 C C   . ASN B 2 137 ? 63.350  19.147  -76.679 1.00 78.74  ? 137 ASN D C   1 
ATOM   2475 O O   . ASN B 2 137 ? 64.103  18.448  -77.353 1.00 80.58  ? 137 ASN D O   1 
ATOM   2476 C CB  . ASN B 2 137 ? 63.933  21.651  -76.977 1.00 77.79  ? 137 ASN D CB  1 
ATOM   2477 C CG  . ASN B 2 137 ? 62.675  21.973  -77.733 1.00 97.59  ? 137 ASN D CG  1 
ATOM   2478 O OD1 . ASN B 2 137 ? 61.625  22.315  -77.164 1.00 84.92  ? 137 ASN D OD1 1 
ATOM   2479 N ND2 . ASN B 2 137 ? 62.760  21.891  -79.029 1.00 94.38  ? 137 ASN D ND2 1 
ATOM   2480 N N   . ASN B 2 138 ? 62.053  18.855  -76.452 1.00 71.20  ? 138 ASN D N   1 
ATOM   2481 C CA  . ASN B 2 138 ? 61.237  17.756  -76.949 1.00 69.92  ? 138 ASN D CA  1 
ATOM   2482 C C   . ASN B 2 138 ? 61.866  16.389  -76.682 1.00 73.01  ? 138 ASN D C   1 
ATOM   2483 O O   . ASN B 2 138 ? 62.445  15.754  -77.575 1.00 72.61  ? 138 ASN D O   1 
ATOM   2484 C CB  . ASN B 2 138 ? 60.864  17.960  -78.422 1.00 66.87  ? 138 ASN D CB  1 
ATOM   2485 C CG  . ASN B 2 138 ? 59.900  19.070  -78.700 1.00 113.16 ? 138 ASN D CG  1 
ATOM   2486 O OD1 . ASN B 2 138 ? 58.959  19.356  -77.934 1.00 120.98 ? 138 ASN D OD1 1 
ATOM   2487 N ND2 . ASN B 2 138 ? 60.121  19.715  -79.828 1.00 107.56 ? 138 ASN D ND2 1 
ATOM   2488 N N   . PHE B 2 139 ? 61.747  15.945  -75.435 1.00 67.94  ? 139 PHE D N   1 
ATOM   2489 C CA  . PHE B 2 139 ? 62.298  14.670  -74.991 1.00 66.69  ? 139 PHE D CA  1 
ATOM   2490 C C   . PHE B 2 139 ? 61.303  13.858  -74.201 1.00 67.83  ? 139 PHE D C   1 
ATOM   2491 O O   . PHE B 2 139 ? 60.310  14.387  -73.694 1.00 66.57  ? 139 PHE D O   1 
ATOM   2492 C CB  . PHE B 2 139 ? 63.581  14.884  -74.146 1.00 68.90  ? 139 PHE D CB  1 
ATOM   2493 C CG  . PHE B 2 139 ? 63.390  15.638  -72.848 1.00 70.30  ? 139 PHE D CG  1 
ATOM   2494 C CD1 . PHE B 2 139 ? 63.058  14.968  -71.678 1.00 71.28  ? 139 PHE D CD1 1 
ATOM   2495 C CD2 . PHE B 2 139 ? 63.558  17.010  -72.796 1.00 72.98  ? 139 PHE D CD2 1 
ATOM   2496 C CE1 . PHE B 2 139 ? 62.870  15.652  -70.494 1.00 71.54  ? 139 PHE D CE1 1 
ATOM   2497 C CE2 . PHE B 2 139 ? 63.365  17.693  -71.605 1.00 75.72  ? 139 PHE D CE2 1 
ATOM   2498 C CZ  . PHE B 2 139 ? 63.020  17.005  -70.463 1.00 72.73  ? 139 PHE D CZ  1 
ATOM   2499 N N   . TYR B 2 140 ? 61.628  12.585  -74.020 1.00 64.12  ? 140 TYR D N   1 
ATOM   2500 C CA  . TYR B 2 140 ? 60.838  11.628  -73.271 1.00 63.67  ? 140 TYR D CA  1 
ATOM   2501 C C   . TYR B 2 140 ? 61.717  10.432  -72.897 1.00 66.78  ? 140 TYR D C   1 
ATOM   2502 O O   . TYR B 2 140 ? 62.433  9.936   -73.770 1.00 65.37  ? 140 TYR D O   1 
ATOM   2503 C CB  . TYR B 2 140 ? 59.623  11.168  -74.092 1.00 65.46  ? 140 TYR D CB  1 
ATOM   2504 C CG  . TYR B 2 140 ? 58.727  10.244  -73.309 1.00 67.59  ? 140 TYR D CG  1 
ATOM   2505 C CD1 . TYR B 2 140 ? 57.747  10.751  -72.458 1.00 70.07  ? 140 TYR D CD1 1 
ATOM   2506 C CD2 . TYR B 2 140 ? 58.901  8.865   -73.357 1.00 67.16  ? 140 TYR D CD2 1 
ATOM   2507 C CE1 . TYR B 2 140 ? 56.943  9.904   -71.706 1.00 72.28  ? 140 TYR D CE1 1 
ATOM   2508 C CE2 . TYR B 2 140 ? 58.117  8.013   -72.596 1.00 67.80  ? 140 TYR D CE2 1 
ATOM   2509 C CZ  . TYR B 2 140 ? 57.129  8.534   -71.787 1.00 78.58  ? 140 TYR D CZ  1 
ATOM   2510 O OH  . TYR B 2 140 ? 56.335  7.677   -71.081 1.00 84.23  ? 140 TYR D OH  1 
ATOM   2511 N N   . PRO B 2 141 ? 61.636  9.892   -71.652 1.00 64.98  ? 141 PRO D N   1 
ATOM   2512 C CA  . PRO B 2 141 ? 60.823  10.347  -70.497 1.00 64.94  ? 141 PRO D CA  1 
ATOM   2513 C C   . PRO B 2 141 ? 61.328  11.658  -69.890 1.00 69.44  ? 141 PRO D C   1 
ATOM   2514 O O   . PRO B 2 141 ? 62.423  12.125  -70.245 1.00 68.51  ? 141 PRO D O   1 
ATOM   2515 C CB  . PRO B 2 141 ? 60.944  9.176   -69.512 1.00 66.38  ? 141 PRO D CB  1 
ATOM   2516 C CG  . PRO B 2 141 ? 62.319  8.619   -69.795 1.00 70.42  ? 141 PRO D CG  1 
ATOM   2517 C CD  . PRO B 2 141 ? 62.457  8.711   -71.292 1.00 66.08  ? 141 PRO D CD  1 
ATOM   2518 N N   . ARG B 2 142 ? 60.519  12.234  -68.969 1.00 66.39  ? 142 ARG D N   1 
ATOM   2519 C CA  . ARG B 2 142 ? 60.743  13.499  -68.266 1.00 66.82  ? 142 ARG D CA  1 
ATOM   2520 C C   . ARG B 2 142 ? 62.089  13.535  -67.524 1.00 75.56  ? 142 ARG D C   1 
ATOM   2521 O O   . ARG B 2 142 ? 62.764  14.578  -67.505 1.00 76.84  ? 142 ARG D O   1 
ATOM   2522 C CB  . ARG B 2 142 ? 59.581  13.736  -67.309 1.00 65.15  ? 142 ARG D CB  1 
ATOM   2523 C CG  . ARG B 2 142 ? 59.567  15.032  -66.533 1.00 76.17  ? 142 ARG D CG  1 
ATOM   2524 C CD  . ARG B 2 142 ? 58.670  14.838  -65.324 1.00 95.21  ? 142 ARG D CD  1 
ATOM   2525 N NE  . ARG B 2 142 ? 58.377  16.067  -64.615 1.00 110.13 ? 142 ARG D NE  1 
ATOM   2526 C CZ  . ARG B 2 142 ? 57.149  16.420  -64.278 1.00 134.17 ? 142 ARG D CZ  1 
ATOM   2527 N NH1 . ARG B 2 142 ? 56.118  15.633  -64.561 1.00 119.71 ? 142 ARG D NH1 1 
ATOM   2528 N NH2 . ARG B 2 142 ? 56.935  17.563  -63.637 1.00 132.98 ? 142 ARG D NH2 1 
ATOM   2529 N N   . GLU B 2 143 ? 62.486  12.391  -66.939 1.00 72.06  ? 143 GLU D N   1 
ATOM   2530 C CA  . GLU B 2 143 ? 63.720  12.240  -66.187 1.00 71.85  ? 143 GLU D CA  1 
ATOM   2531 C C   . GLU B 2 143 ? 64.926  12.602  -67.038 1.00 78.98  ? 143 GLU D C   1 
ATOM   2532 O O   . GLU B 2 143 ? 65.155  12.008  -68.100 1.00 78.55  ? 143 GLU D O   1 
ATOM   2533 C CB  . GLU B 2 143 ? 63.841  10.829  -65.613 1.00 73.25  ? 143 GLU D CB  1 
ATOM   2534 C CG  . GLU B 2 143 ? 62.819  10.517  -64.524 1.00 88.18  ? 143 GLU D CG  1 
ATOM   2535 C CD  . GLU B 2 143 ? 61.388  10.256  -64.961 1.00 117.23 ? 143 GLU D CD  1 
ATOM   2536 O OE1 . GLU B 2 143 ? 61.170  9.509   -65.943 1.00 112.09 ? 143 GLU D OE1 1 
ATOM   2537 O OE2 . GLU B 2 143 ? 60.476  10.820  -64.317 1.00 119.05 ? 143 GLU D OE2 1 
ATOM   2538 N N   . ALA B 2 144 ? 65.691  13.604  -66.541 1.00 78.19  ? 144 ALA D N   1 
ATOM   2539 C CA  . ALA B 2 144 ? 66.916  14.175  -67.113 1.00 78.67  ? 144 ALA D CA  1 
ATOM   2540 C C   . ALA B 2 144 ? 67.763  14.870  -66.036 1.00 85.65  ? 144 ALA D C   1 
ATOM   2541 O O   . ALA B 2 144 ? 67.224  15.560  -65.169 1.00 86.39  ? 144 ALA D O   1 
ATOM   2542 C CB  . ALA B 2 144 ? 66.556  15.185  -68.193 1.00 79.42  ? 144 ALA D CB  1 
ATOM   2543 N N   . LYS B 2 145 ? 69.092  14.724  -66.119 1.00 84.26  ? 145 LYS D N   1 
ATOM   2544 C CA  . LYS B 2 145 ? 70.027  15.373  -65.195 1.00 84.83  ? 145 LYS D CA  1 
ATOM   2545 C C   . LYS B 2 145 ? 70.889  16.336  -65.987 1.00 89.82  ? 145 LYS D C   1 
ATOM   2546 O O   . LYS B 2 145 ? 71.611  15.920  -66.895 1.00 90.42  ? 145 LYS D O   1 
ATOM   2547 C CB  . LYS B 2 145 ? 70.901  14.352  -64.433 1.00 88.31  ? 145 LYS D CB  1 
ATOM   2548 C CG  . LYS B 2 145 ? 70.142  13.496  -63.394 1.00 114.48 ? 145 LYS D CG  1 
ATOM   2549 C CD  . LYS B 2 145 ? 70.988  12.316  -62.845 1.00 123.09 ? 145 LYS D CD  1 
ATOM   2550 C CE  . LYS B 2 145 ? 70.442  11.725  -61.558 1.00 132.16 ? 145 LYS D CE  1 
ATOM   2551 N NZ  . LYS B 2 145 ? 71.331  10.669  -60.980 1.00 141.25 ? 145 LYS D NZ  1 
ATOM   2552 N N   . VAL B 2 146 ? 70.757  17.633  -65.687 1.00 85.82  ? 146 VAL D N   1 
ATOM   2553 C CA  . VAL B 2 146 ? 71.530  18.703  -66.301 1.00 85.11  ? 146 VAL D CA  1 
ATOM   2554 C C   . VAL B 2 146 ? 72.443  19.316  -65.246 1.00 91.23  ? 146 VAL D C   1 
ATOM   2555 O O   . VAL B 2 146 ? 71.963  19.786  -64.221 1.00 91.10  ? 146 VAL D O   1 
ATOM   2556 C CB  . VAL B 2 146 ? 70.689  19.745  -67.115 1.00 87.88  ? 146 VAL D CB  1 
ATOM   2557 C CG1 . VAL B 2 146 ? 69.478  20.237  -66.344 1.00 87.69  ? 146 VAL D CG1 1 
ATOM   2558 C CG2 . VAL B 2 146 ? 71.545  20.921  -67.609 1.00 87.33  ? 146 VAL D CG2 1 
ATOM   2559 N N   . GLN B 2 147 ? 73.758  19.275  -65.486 1.00 89.63  ? 147 GLN D N   1 
ATOM   2560 C CA  . GLN B 2 147 ? 74.751  19.870  -64.591 1.00 89.98  ? 147 GLN D CA  1 
ATOM   2561 C C   . GLN B 2 147 ? 75.348  21.098  -65.235 1.00 93.63  ? 147 GLN D C   1 
ATOM   2562 O O   . GLN B 2 147 ? 75.413  21.161  -66.464 1.00 93.00  ? 147 GLN D O   1 
ATOM   2563 C CB  . GLN B 2 147 ? 75.837  18.861  -64.194 1.00 91.72  ? 147 GLN D CB  1 
ATOM   2564 C CG  . GLN B 2 147 ? 75.356  17.910  -63.094 1.00 119.57 ? 147 GLN D CG  1 
ATOM   2565 C CD  . GLN B 2 147 ? 76.348  16.885  -62.619 1.00 138.15 ? 147 GLN D CD  1 
ATOM   2566 O OE1 . GLN B 2 147 ? 77.231  16.417  -63.356 1.00 130.71 ? 147 GLN D OE1 1 
ATOM   2567 N NE2 . GLN B 2 147 ? 76.204  16.501  -61.345 1.00 128.89 ? 147 GLN D NE2 1 
ATOM   2568 N N   . TRP B 2 148 ? 75.742  22.053  -64.398 1.00 89.97  ? 148 TRP D N   1 
ATOM   2569 C CA  . TRP B 2 148 ? 76.331  23.322  -64.881 1.00 89.93  ? 148 TRP D CA  1 
ATOM   2570 C C   . TRP B 2 148 ? 77.786  23.379  -64.431 1.00 95.99  ? 148 TRP D C   1 
ATOM   2571 O O   . TRP B 2 148 ? 78.037  23.157  -63.249 1.00 96.69  ? 148 TRP D O   1 
ATOM   2572 C CB  . TRP B 2 148 ? 75.537  24.495  -64.315 1.00 88.31  ? 148 TRP D CB  1 
ATOM   2573 C CG  . TRP B 2 148 ? 74.345  24.896  -65.123 1.00 88.68  ? 148 TRP D CG  1 
ATOM   2574 C CD1 . TRP B 2 148 ? 73.037  24.753  -64.777 1.00 91.55  ? 148 TRP D CD1 1 
ATOM   2575 C CD2 . TRP B 2 148 ? 74.345  25.552  -66.398 1.00 88.08  ? 148 TRP D CD2 1 
ATOM   2576 N NE1 . TRP B 2 148 ? 72.227  25.259  -65.753 1.00 90.63  ? 148 TRP D NE1 1 
ATOM   2577 C CE2 . TRP B 2 148 ? 73.002  25.759  -66.758 1.00 92.05  ? 148 TRP D CE2 1 
ATOM   2578 C CE3 . TRP B 2 148 ? 75.343  25.976  -67.271 1.00 88.90  ? 148 TRP D CE3 1 
ATOM   2579 C CZ2 . TRP B 2 148 ? 72.634  26.367  -67.951 1.00 91.44  ? 148 TRP D CZ2 1 
ATOM   2580 C CZ3 . TRP B 2 148 ? 74.981  26.582  -68.450 1.00 90.14  ? 148 TRP D CZ3 1 
ATOM   2581 C CH2 . TRP B 2 148 ? 73.645  26.774  -68.784 1.00 91.01  ? 148 TRP D CH2 1 
ATOM   2582 N N   . LYS B 2 149 ? 78.694  23.674  -65.356 1.00 94.11  ? 149 LYS D N   1 
ATOM   2583 C CA  . LYS B 2 149 ? 80.137  23.750  -65.023 1.00 95.57  ? 149 LYS D CA  1 
ATOM   2584 C C   . LYS B 2 149 ? 80.698  25.074  -65.533 1.00 101.82 ? 149 LYS D C   1 
ATOM   2585 O O   . LYS B 2 149 ? 80.600  25.323  -66.734 1.00 101.63 ? 149 LYS D O   1 
ATOM   2586 C CB  . LYS B 2 149 ? 80.901  22.608  -65.693 1.00 98.67  ? 149 LYS D CB  1 
ATOM   2587 C CG  . LYS B 2 149 ? 80.835  21.271  -64.974 1.00 117.62 ? 149 LYS D CG  1 
ATOM   2588 C CD  . LYS B 2 149 ? 82.063  20.429  -65.198 1.00 128.03 ? 149 LYS D CD  1 
ATOM   2589 C CE  . LYS B 2 149 ? 81.825  19.273  -66.143 1.00 135.32 ? 149 LYS D CE  1 
ATOM   2590 N NZ  . LYS B 2 149 ? 82.793  19.271  -67.264 1.00 134.35 ? 149 LYS D NZ  1 
ATOM   2591 N N   . VAL B 2 150 ? 81.258  25.892  -64.647 1.00 99.18  ? 150 VAL D N   1 
ATOM   2592 C CA  . VAL B 2 150 ? 81.848  27.172  -65.125 1.00 99.46  ? 150 VAL D CA  1 
ATOM   2593 C C   . VAL B 2 150 ? 83.357  26.974  -65.224 1.00 104.63 ? 150 VAL D C   1 
ATOM   2594 O O   . VAL B 2 150 ? 83.976  26.651  -64.210 1.00 103.92 ? 150 VAL D O   1 
ATOM   2595 C CB  . VAL B 2 150 ? 81.480  28.361  -64.225 1.00 103.39 ? 150 VAL D CB  1 
ATOM   2596 C CG1 . VAL B 2 150 ? 82.349  28.417  -62.985 1.00 103.27 ? 150 VAL D CG1 1 
ATOM   2597 C CG2 . VAL B 2 150 ? 81.560  29.669  -64.989 1.00 103.29 ? 150 VAL D CG2 1 
ATOM   2598 N N   . ASP B 2 151 ? 83.895  27.056  -66.441 1.00 102.52 ? 151 ASP D N   1 
ATOM   2599 C CA  . ASP B 2 151 ? 85.347  26.872  -66.687 1.00 103.54 ? 151 ASP D CA  1 
ATOM   2600 C C   . ASP B 2 151 ? 85.810  25.548  -66.072 1.00 106.99 ? 151 ASP D C   1 
ATOM   2601 O O   . ASP B 2 151 ? 86.801  25.573  -65.331 1.00 106.90 ? 151 ASP D O   1 
ATOM   2602 C CB  . ASP B 2 151 ? 86.144  28.075  -66.178 1.00 106.18 ? 151 ASP D CB  1 
ATOM   2603 C CG  . ASP B 2 151 ? 85.881  29.343  -66.972 1.00 120.53 ? 151 ASP D CG  1 
ATOM   2604 O OD1 . ASP B 2 151 ? 85.268  29.243  -68.056 1.00 122.23 ? 151 ASP D OD1 1 
ATOM   2605 O OD2 . ASP B 2 151 ? 86.285  30.423  -66.501 1.00 123.44 ? 151 ASP D OD2 1 
ATOM   2606 N N   . ASN B 2 152 ? 85.063  24.462  -66.312 1.00 102.79 ? 152 ASN D N   1 
ATOM   2607 C CA  . ASN B 2 152 ? 85.314  23.076  -65.821 1.00 102.98 ? 152 ASN D CA  1 
ATOM   2608 C C   . ASN B 2 152 ? 85.051  22.905  -64.317 1.00 106.53 ? 152 ASN D C   1 
ATOM   2609 O O   . ASN B 2 152 ? 85.315  21.812  -63.809 1.00 106.28 ? 152 ASN D O   1 
ATOM   2610 C CB  . ASN B 2 152 ? 86.659  22.507  -66.271 1.00 106.46 ? 152 ASN D CB  1 
ATOM   2611 C CG  . ASN B 2 152 ? 86.639  20.998  -66.363 1.00 146.35 ? 152 ASN D CG  1 
ATOM   2612 O OD1 . ASN B 2 152 ? 85.724  20.359  -65.858 1.00 144.19 ? 152 ASN D OD1 1 
ATOM   2613 N ND2 . ASN B 2 152 ? 87.638  20.417  -67.007 1.00 141.26 ? 152 ASN D ND2 1 
ATOM   2614 N N   . ALA B 2 153 ? 84.517  23.914  -63.632 1.00 101.79 ? 153 ALA D N   1 
ATOM   2615 C CA  . ALA B 2 153 ? 84.245  23.777  -62.190 1.00 100.87 ? 153 ALA D CA  1 
ATOM   2616 C C   . ALA B 2 153 ? 82.766  23.462  -62.040 1.00 107.28 ? 153 ALA D C   1 
ATOM   2617 O O   . ALA B 2 153 ? 81.965  24.296  -62.440 1.00 107.83 ? 153 ALA D O   1 
ATOM   2618 C CB  . ALA B 2 153 ? 84.591  25.056  -61.486 1.00 101.13 ? 153 ALA D CB  1 
ATOM   2619 N N   . LEU B 2 154 ? 82.435  22.300  -61.486 1.00 104.32 ? 154 LEU D N   1 
ATOM   2620 C CA  . LEU B 2 154 ? 81.013  21.917  -61.315 1.00 103.81 ? 154 LEU D CA  1 
ATOM   2621 C C   . LEU B 2 154 ? 80.331  22.906  -60.372 1.00 107.39 ? 154 LEU D C   1 
ATOM   2622 O O   . LEU B 2 154 ? 80.956  23.305  -59.389 1.00 106.21 ? 154 LEU D O   1 
ATOM   2623 C CB  . LEU B 2 154 ? 80.953  20.499  -60.752 1.00 103.92 ? 154 LEU D CB  1 
ATOM   2624 C CG  . LEU B 2 154 ? 80.312  19.483  -61.688 1.00 108.83 ? 154 LEU D CG  1 
ATOM   2625 C CD1 . LEU B 2 154 ? 81.058  18.163  -61.653 1.00 108.96 ? 154 LEU D CD1 1 
ATOM   2626 C CD2 . LEU B 2 154 ? 78.849  19.290  -61.338 1.00 110.54 ? 154 LEU D CD2 1 
ATOM   2627 N N   . GLN B 2 155 ? 79.075  23.245  -60.654 1.00 105.11 ? 155 GLN D N   1 
ATOM   2628 C CA  . GLN B 2 155 ? 78.329  24.209  -59.808 1.00 105.92 ? 155 GLN D CA  1 
ATOM   2629 C C   . GLN B 2 155 ? 77.195  23.509  -59.056 1.00 112.74 ? 155 GLN D C   1 
ATOM   2630 O O   . GLN B 2 155 ? 76.780  22.433  -59.492 1.00 112.74 ? 155 GLN D O   1 
ATOM   2631 C CB  . GLN B 2 155 ? 77.757  25.305  -60.699 1.00 107.02 ? 155 GLN D CB  1 
ATOM   2632 C CG  . GLN B 2 155 ? 78.826  26.065  -61.459 1.00 113.56 ? 155 GLN D CG  1 
ATOM   2633 C CD  . GLN B 2 155 ? 79.653  26.902  -60.519 1.00 127.84 ? 155 GLN D CD  1 
ATOM   2634 O OE1 . GLN B 2 155 ? 79.129  27.687  -59.737 1.00 121.48 ? 155 GLN D OE1 1 
ATOM   2635 N NE2 . GLN B 2 155 ? 80.959  26.732  -60.581 1.00 120.18 ? 155 GLN D NE2 1 
ATOM   2636 N N   . SER B 2 156 ? 76.738  24.111  -57.955 1.00 110.44 ? 156 SER D N   1 
ATOM   2637 C CA  . SER B 2 156 ? 75.615  23.577  -57.177 1.00 110.85 ? 156 SER D CA  1 
ATOM   2638 C C   . SER B 2 156 ? 74.800  24.679  -56.477 1.00 114.27 ? 156 SER D C   1 
ATOM   2639 O O   . SER B 2 156 ? 75.358  25.651  -55.940 1.00 111.83 ? 156 SER D O   1 
ATOM   2640 C CB  . SER B 2 156 ? 76.028  22.465  -56.211 1.00 113.96 ? 156 SER D CB  1 
ATOM   2641 O OG  . SER B 2 156 ? 74.944  21.562  -56.040 1.00 118.23 ? 156 SER D OG  1 
ATOM   2642 N N   . GLY B 2 157 ? 73.475  24.517  -56.563 1.00 111.72 ? 157 GLY D N   1 
ATOM   2643 C CA  . GLY B 2 157 ? 72.485  25.427  -56.002 1.00 111.36 ? 157 GLY D CA  1 
ATOM   2644 C C   . GLY B 2 157 ? 72.210  26.685  -56.810 1.00 112.70 ? 157 GLY D C   1 
ATOM   2645 O O   . GLY B 2 157 ? 71.056  27.128  -56.883 1.00 112.91 ? 157 GLY D O   1 
ATOM   2646 N N   . ASN B 2 158 ? 73.260  27.277  -57.419 1.00 105.95 ? 158 ASN D N   1 
ATOM   2647 C CA  . ASN B 2 158 ? 73.166  28.522  -58.199 1.00 104.46 ? 158 ASN D CA  1 
ATOM   2648 C C   . ASN B 2 158 ? 72.252  28.431  -59.439 1.00 105.09 ? 158 ASN D C   1 
ATOM   2649 O O   . ASN B 2 158 ? 72.027  29.448  -60.109 1.00 104.89 ? 158 ASN D O   1 
ATOM   2650 C CB  . ASN B 2 158 ? 74.559  29.039  -58.579 1.00 103.42 ? 158 ASN D CB  1 
ATOM   2651 C CG  . ASN B 2 158 ? 75.380  28.082  -59.409 1.00 113.13 ? 158 ASN D CG  1 
ATOM   2652 O OD1 . ASN B 2 158 ? 75.112  26.864  -59.481 1.00 105.39 ? 158 ASN D OD1 1 
ATOM   2653 N ND2 . ASN B 2 158 ? 76.409  28.624  -60.046 1.00 96.53  ? 158 ASN D ND2 1 
ATOM   2654 N N   . SER B 2 159 ? 71.726  27.219  -59.734 1.00 98.47  ? 159 SER D N   1 
ATOM   2655 C CA  . SER B 2 159 ? 70.798  26.990  -60.837 1.00 96.90  ? 159 SER D CA  1 
ATOM   2656 C C   . SER B 2 159 ? 69.484  26.354  -60.399 1.00 96.34  ? 159 SER D C   1 
ATOM   2657 O O   . SER B 2 159 ? 69.441  25.602  -59.420 1.00 95.14  ? 159 SER D O   1 
ATOM   2658 C CB  . SER B 2 159 ? 71.445  26.195  -61.968 1.00 100.26 ? 159 SER D CB  1 
ATOM   2659 O OG  . SER B 2 159 ? 71.893  24.929  -61.521 1.00 105.83 ? 159 SER D OG  1 
ATOM   2660 N N   . GLN B 2 160 ? 68.407  26.689  -61.139 1.00 90.59  ? 160 GLN D N   1 
ATOM   2661 C CA  . GLN B 2 160 ? 67.039  26.222  -60.940 1.00 89.54  ? 160 GLN D CA  1 
ATOM   2662 C C   . GLN B 2 160 ? 66.463  25.616  -62.231 1.00 90.00  ? 160 GLN D C   1 
ATOM   2663 O O   . GLN B 2 160 ? 66.557  26.236  -63.293 1.00 89.53  ? 160 GLN D O   1 
ATOM   2664 C CB  . GLN B 2 160 ? 66.134  27.377  -60.428 1.00 91.22  ? 160 GLN D CB  1 
ATOM   2665 C CG  . GLN B 2 160 ? 66.627  28.106  -59.167 1.00 113.65 ? 160 GLN D CG  1 
ATOM   2666 C CD  . GLN B 2 160 ? 65.735  28.021  -57.932 1.00 136.95 ? 160 GLN D CD  1 
ATOM   2667 O OE1 . GLN B 2 160 ? 64.530  27.793  -58.005 1.00 133.32 ? 160 GLN D OE1 1 
ATOM   2668 N NE2 . GLN B 2 160 ? 66.326  28.208  -56.750 1.00 129.40 ? 160 GLN D NE2 1 
ATOM   2669 N N   . GLU B 2 161 ? 65.866  24.410  -62.133 1.00 84.10  ? 161 GLU D N   1 
ATOM   2670 C CA  . GLU B 2 161 ? 65.263  23.707  -63.276 1.00 82.46  ? 161 GLU D CA  1 
ATOM   2671 C C   . GLU B 2 161 ? 63.770  23.977  -63.325 1.00 80.80  ? 161 GLU D C   1 
ATOM   2672 O O   . GLU B 2 161 ? 63.181  24.317  -62.307 1.00 79.19  ? 161 GLU D O   1 
ATOM   2673 C CB  . GLU B 2 161 ? 65.487  22.184  -63.175 1.00 84.37  ? 161 GLU D CB  1 
ATOM   2674 C CG  . GLU B 2 161 ? 66.802  21.665  -63.749 1.00 101.09 ? 161 GLU D CG  1 
ATOM   2675 C CD  . GLU B 2 161 ? 67.066  20.169  -63.593 1.00 142.21 ? 161 GLU D CD  1 
ATOM   2676 O OE1 . GLU B 2 161 ? 66.103  19.369  -63.660 1.00 145.52 ? 161 GLU D OE1 1 
ATOM   2677 O OE2 . GLU B 2 161 ? 68.248  19.794  -63.410 1.00 142.84 ? 161 GLU D OE2 1 
ATOM   2678 N N   . SER B 2 162 ? 63.161  23.805  -64.504 1.00 75.53  ? 162 SER D N   1 
ATOM   2679 C CA  . SER B 2 162 ? 61.725  23.926  -64.746 1.00 74.35  ? 162 SER D CA  1 
ATOM   2680 C C   . SER B 2 162 ? 61.346  23.094  -65.958 1.00 78.80  ? 162 SER D C   1 
ATOM   2681 O O   . SER B 2 162 ? 61.949  23.245  -67.026 1.00 79.91  ? 162 SER D O   1 
ATOM   2682 C CB  . SER B 2 162 ? 61.314  25.367  -64.965 1.00 76.52  ? 162 SER D CB  1 
ATOM   2683 O OG  . SER B 2 162 ? 59.975  25.492  -64.517 1.00 82.41  ? 162 SER D OG  1 
ATOM   2684 N N   . VAL B 2 163 ? 60.376  22.197  -65.797 1.00 73.52  ? 163 VAL D N   1 
ATOM   2685 C CA  . VAL B 2 163 ? 59.956  21.307  -66.869 1.00 73.22  ? 163 VAL D CA  1 
ATOM   2686 C C   . VAL B 2 163 ? 58.498  21.611  -67.261 1.00 77.96  ? 163 VAL D C   1 
ATOM   2687 O O   . VAL B 2 163 ? 57.682  21.948  -66.394 1.00 77.54  ? 163 VAL D O   1 
ATOM   2688 C CB  . VAL B 2 163 ? 60.248  19.815  -66.514 1.00 77.12  ? 163 VAL D CB  1 
ATOM   2689 C CG1 . VAL B 2 163 ? 59.360  19.315  -65.384 1.00 77.49  ? 163 VAL D CG1 1 
ATOM   2690 C CG2 . VAL B 2 163 ? 60.141  18.904  -67.721 1.00 77.10  ? 163 VAL D CG2 1 
ATOM   2691 N N   . THR B 2 164 ? 58.202  21.546  -68.582 1.00 74.51  ? 164 THR D N   1 
ATOM   2692 C CA  . THR B 2 164 ? 56.865  21.777  -69.157 1.00 72.96  ? 164 THR D CA  1 
ATOM   2693 C C   . THR B 2 164 ? 55.976  20.563  -68.970 1.00 75.43  ? 164 THR D C   1 
ATOM   2694 O O   . THR B 2 164 ? 56.470  19.435  -68.857 1.00 74.40  ? 164 THR D O   1 
ATOM   2695 C CB  . THR B 2 164 ? 56.939  21.978  -70.667 1.00 69.83  ? 164 THR D CB  1 
ATOM   2696 O OG1 . THR B 2 164 ? 57.730  20.935  -71.226 1.00 72.17  ? 164 THR D OG1 1 
ATOM   2697 C CG2 . THR B 2 164 ? 57.458  23.311  -71.051 1.00 64.54  ? 164 THR D CG2 1 
ATOM   2698 N N   . GLU B 2 165 ? 54.654  20.787  -69.009 1.00 71.85  ? 165 GLU D N   1 
ATOM   2699 C CA  . GLU B 2 165 ? 53.690  19.696  -68.953 1.00 71.65  ? 165 GLU D CA  1 
ATOM   2700 C C   . GLU B 2 165 ? 53.752  19.045  -70.323 1.00 77.71  ? 165 GLU D C   1 
ATOM   2701 O O   . GLU B 2 165 ? 54.052  19.725  -71.311 1.00 78.08  ? 165 GLU D O   1 
ATOM   2702 C CB  . GLU B 2 165 ? 52.273  20.190  -68.640 1.00 72.62  ? 165 GLU D CB  1 
ATOM   2703 C CG  . GLU B 2 165 ? 52.141  20.729  -67.227 1.00 87.42  ? 165 GLU D CG  1 
ATOM   2704 C CD  . GLU B 2 165 ? 51.427  19.909  -66.168 1.00 121.20 ? 165 GLU D CD  1 
ATOM   2705 O OE1 . GLU B 2 165 ? 51.425  18.659  -66.262 1.00 120.97 ? 165 GLU D OE1 1 
ATOM   2706 O OE2 . GLU B 2 165 ? 50.913  20.530  -65.208 1.00 121.22 ? 165 GLU D OE2 1 
ATOM   2707 N N   . GLN B 2 166 ? 53.554  17.718  -70.369 1.00 74.78  ? 166 GLN D N   1 
ATOM   2708 C CA  . GLN B 2 166 ? 53.618  16.917  -71.597 1.00 73.87  ? 166 GLN D CA  1 
ATOM   2709 C C   . GLN B 2 166 ? 52.825  17.552  -72.752 1.00 80.16  ? 166 GLN D C   1 
ATOM   2710 O O   . GLN B 2 166 ? 51.654  17.917  -72.603 1.00 79.99  ? 166 GLN D O   1 
ATOM   2711 C CB  . GLN B 2 166 ? 53.182  15.478  -71.321 1.00 73.89  ? 166 GLN D CB  1 
ATOM   2712 C CG  . GLN B 2 166 ? 53.609  14.510  -72.379 1.00 69.18  ? 166 GLN D CG  1 
ATOM   2713 C CD  . GLN B 2 166 ? 53.358  13.078  -71.984 1.00 86.21  ? 166 GLN D CD  1 
ATOM   2714 O OE1 . GLN B 2 166 ? 52.372  12.741  -71.334 1.00 77.75  ? 166 GLN D OE1 1 
ATOM   2715 N NE2 . GLN B 2 166 ? 54.252  12.194  -72.380 1.00 84.64  ? 166 GLN D NE2 1 
ATOM   2716 N N   . ASP B 2 167 ? 53.500  17.736  -73.876 1.00 78.57  ? 167 ASP D N   1 
ATOM   2717 C CA  . ASP B 2 167 ? 52.933  18.321  -75.075 1.00 80.11  ? 167 ASP D CA  1 
ATOM   2718 C C   . ASP B 2 167 ? 51.787  17.481  -75.601 1.00 85.45  ? 167 ASP D C   1 
ATOM   2719 O O   . ASP B 2 167 ? 51.911  16.268  -75.741 1.00 86.36  ? 167 ASP D O   1 
ATOM   2720 C CB  . ASP B 2 167 ? 54.027  18.435  -76.153 1.00 83.57  ? 167 ASP D CB  1 
ATOM   2721 C CG  . ASP B 2 167 ? 53.704  19.310  -77.354 1.00 102.88 ? 167 ASP D CG  1 
ATOM   2722 O OD1 . ASP B 2 167 ? 52.513  19.547  -77.615 1.00 105.64 ? 167 ASP D OD1 1 
ATOM   2723 O OD2 . ASP B 2 167 ? 54.648  19.761  -78.025 1.00 110.65 ? 167 ASP D OD2 1 
ATOM   2724 N N   . SER B 2 168 ? 50.704  18.139  -75.961 1.00 83.00  ? 168 SER D N   1 
ATOM   2725 C CA  . SER B 2 168 ? 49.541  17.505  -76.561 1.00 83.35  ? 168 SER D CA  1 
ATOM   2726 C C   . SER B 2 168 ? 49.893  17.011  -77.967 1.00 87.28  ? 168 SER D C   1 
ATOM   2727 O O   . SER B 2 168 ? 49.429  15.937  -78.342 1.00 88.15  ? 168 SER D O   1 
ATOM   2728 C CB  . SER B 2 168 ? 48.384  18.503  -76.651 1.00 88.27  ? 168 SER D CB  1 
ATOM   2729 O OG  . SER B 2 168 ? 48.701  19.652  -77.425 1.00 96.54  ? 168 SER D OG  1 
ATOM   2730 N N   . LYS B 2 169 ? 50.727  17.784  -78.725 1.00 82.39  ? 169 LYS D N   1 
ATOM   2731 C CA  . LYS B 2 169 ? 51.141  17.529  -80.119 1.00 81.91  ? 169 LYS D CA  1 
ATOM   2732 C C   . LYS B 2 169 ? 51.946  16.214  -80.340 1.00 86.49  ? 169 LYS D C   1 
ATOM   2733 O O   . LYS B 2 169 ? 51.538  15.388  -81.158 1.00 84.93  ? 169 LYS D O   1 
ATOM   2734 C CB  . LYS B 2 169 ? 51.898  18.739  -80.718 1.00 82.90  ? 169 LYS D CB  1 
ATOM   2735 C CG  . LYS B 2 169 ? 51.014  20.001  -80.828 1.00 103.36 ? 169 LYS D CG  1 
ATOM   2736 C CD  . LYS B 2 169 ? 51.811  21.357  -80.901 1.00 111.06 ? 169 LYS D CD  1 
ATOM   2737 C CE  . LYS B 2 169 ? 51.000  22.607  -80.581 1.00 100.14 ? 169 LYS D CE  1 
ATOM   2738 N NZ  . LYS B 2 169 ? 51.236  23.102  -79.189 1.00 93.86  ? 169 LYS D NZ  1 
ATOM   2739 N N   . ASP B 2 170 ? 53.074  16.036  -79.625 1.00 84.08  ? 170 ASP D N   1 
ATOM   2740 C CA  . ASP B 2 170 ? 54.007  14.910  -79.781 1.00 83.43  ? 170 ASP D CA  1 
ATOM   2741 C C   . ASP B 2 170 ? 54.353  14.182  -78.477 1.00 83.99  ? 170 ASP D C   1 
ATOM   2742 O O   . ASP B 2 170 ? 55.359  13.472  -78.447 1.00 85.42  ? 170 ASP D O   1 
ATOM   2743 C CB  . ASP B 2 170 ? 55.305  15.394  -80.477 1.00 86.05  ? 170 ASP D CB  1 
ATOM   2744 C CG  . ASP B 2 170 ? 56.104  16.452  -79.711 1.00 105.98 ? 170 ASP D CG  1 
ATOM   2745 O OD1 . ASP B 2 170 ? 55.562  17.016  -78.726 1.00 109.01 ? 170 ASP D OD1 1 
ATOM   2746 O OD2 . ASP B 2 170 ? 57.268  16.720  -80.101 1.00 112.82 ? 170 ASP D OD2 1 
ATOM   2747 N N   . SER B 2 171 ? 53.548  14.367  -77.410 1.00 75.58  ? 171 SER D N   1 
ATOM   2748 C CA  . SER B 2 171 ? 53.701  13.720  -76.096 1.00 73.42  ? 171 SER D CA  1 
ATOM   2749 C C   . SER B 2 171 ? 55.125  13.831  -75.467 1.00 72.08  ? 171 SER D C   1 
ATOM   2750 O O   . SER B 2 171 ? 55.584  12.902  -74.790 1.00 71.32  ? 171 SER D O   1 
ATOM   2751 C CB  . SER B 2 171 ? 53.247  12.264  -76.158 1.00 76.89  ? 171 SER D CB  1 
ATOM   2752 O OG  . SER B 2 171 ? 52.000  12.164  -76.819 1.00 87.91  ? 171 SER D OG  1 
ATOM   2753 N N   . THR B 2 172 ? 55.797  14.977  -75.657 1.00 64.82  ? 172 THR D N   1 
ATOM   2754 C CA  . THR B 2 172 ? 57.131  15.172  -75.089 1.00 64.23  ? 172 THR D CA  1 
ATOM   2755 C C   . THR B 2 172 ? 57.177  16.236  -73.974 1.00 70.01  ? 172 THR D C   1 
ATOM   2756 O O   . THR B 2 172 ? 56.214  16.992  -73.746 1.00 69.46  ? 172 THR D O   1 
ATOM   2757 C CB  . THR B 2 172 ? 58.172  15.464  -76.183 1.00 72.64  ? 172 THR D CB  1 
ATOM   2758 O OG1 . THR B 2 172 ? 57.737  16.544  -76.984 1.00 75.76  ? 172 THR D OG1 1 
ATOM   2759 C CG2 . THR B 2 172 ? 58.432  14.294  -77.063 1.00 76.10  ? 172 THR D CG2 1 
ATOM   2760 N N   . TYR B 2 173 ? 58.322  16.294  -73.290 1.00 66.58  ? 173 TYR D N   1 
ATOM   2761 C CA  . TYR B 2 173 ? 58.598  17.282  -72.277 1.00 66.59  ? 173 TYR D CA  1 
ATOM   2762 C C   . TYR B 2 173 ? 59.758  18.155  -72.779 1.00 71.27  ? 173 TYR D C   1 
ATOM   2763 O O   . TYR B 2 173 ? 60.558  17.707  -73.610 1.00 71.18  ? 173 TYR D O   1 
ATOM   2764 C CB  . TYR B 2 173 ? 59.022  16.589  -70.989 1.00 68.25  ? 173 TYR D CB  1 
ATOM   2765 C CG  . TYR B 2 173 ? 58.007  15.614  -70.434 1.00 70.30  ? 173 TYR D CG  1 
ATOM   2766 C CD1 . TYR B 2 173 ? 56.999  16.039  -69.563 1.00 71.86  ? 173 TYR D CD1 1 
ATOM   2767 C CD2 . TYR B 2 173 ? 58.103  14.254  -70.711 1.00 71.06  ? 173 TYR D CD2 1 
ATOM   2768 C CE1 . TYR B 2 173 ? 56.080  15.138  -69.031 1.00 72.22  ? 173 TYR D CE1 1 
ATOM   2769 C CE2 . TYR B 2 173 ? 57.184  13.348  -70.194 1.00 72.09  ? 173 TYR D CE2 1 
ATOM   2770 C CZ  . TYR B 2 173 ? 56.176  13.799  -69.352 1.00 80.80  ? 173 TYR D CZ  1 
ATOM   2771 O OH  . TYR B 2 173 ? 55.278  12.889  -68.848 1.00 84.38  ? 173 TYR D OH  1 
ATOM   2772 N N   . SER B 2 174 ? 59.826  19.398  -72.302 1.00 67.53  ? 174 SER D N   1 
ATOM   2773 C CA  . SER B 2 174 ? 60.921  20.319  -72.563 1.00 68.08  ? 174 SER D CA  1 
ATOM   2774 C C   . SER B 2 174 ? 61.366  20.864  -71.198 1.00 75.53  ? 174 SER D C   1 
ATOM   2775 O O   . SER B 2 174 ? 60.543  21.018  -70.281 1.00 75.68  ? 174 SER D O   1 
ATOM   2776 C CB  . SER B 2 174 ? 60.500  21.424  -73.518 1.00 71.82  ? 174 SER D CB  1 
ATOM   2777 O OG  . SER B 2 174 ? 60.301  20.910  -74.825 1.00 82.74  ? 174 SER D OG  1 
ATOM   2778 N N   . LEU B 2 175 ? 62.664  21.081  -71.029 1.00 72.82  ? 175 LEU D N   1 
ATOM   2779 C CA  . LEU B 2 175 ? 63.181  21.487  -69.735 1.00 73.26  ? 175 LEU D CA  1 
ATOM   2780 C C   . LEU B 2 175 ? 64.150  22.633  -69.875 1.00 77.28  ? 175 LEU D C   1 
ATOM   2781 O O   . LEU B 2 175 ? 64.982  22.646  -70.793 1.00 78.07  ? 175 LEU D O   1 
ATOM   2782 C CB  . LEU B 2 175 ? 63.835  20.252  -69.075 1.00 73.72  ? 175 LEU D CB  1 
ATOM   2783 C CG  . LEU B 2 175 ? 64.544  20.403  -67.723 1.00 80.04  ? 175 LEU D CG  1 
ATOM   2784 C CD1 . LEU B 2 175 ? 64.091  19.344  -66.762 1.00 80.62  ? 175 LEU D CD1 1 
ATOM   2785 C CD2 . LEU B 2 175 ? 66.063  20.298  -67.890 1.00 83.54  ? 175 LEU D CD2 1 
ATOM   2786 N N   . SER B 2 176 ? 64.037  23.603  -68.956 1.00 71.90  ? 176 SER D N   1 
ATOM   2787 C CA  . SER B 2 176 ? 64.920  24.760  -68.912 1.00 69.78  ? 176 SER D CA  1 
ATOM   2788 C C   . SER B 2 176 ? 65.731  24.693  -67.630 1.00 76.57  ? 176 SER D C   1 
ATOM   2789 O O   . SER B 2 176 ? 65.196  24.370  -66.555 1.00 76.51  ? 176 SER D O   1 
ATOM   2790 C CB  . SER B 2 176 ? 64.120  26.052  -68.949 1.00 68.21  ? 176 SER D CB  1 
ATOM   2791 O OG  . SER B 2 176 ? 63.715  26.430  -67.640 1.00 77.69  ? 176 SER D OG  1 
ATOM   2792 N N   . SER B 2 177 ? 67.018  25.014  -67.740 1.00 74.63  ? 177 SER D N   1 
ATOM   2793 C CA  . SER B 2 177 ? 67.890  25.100  -66.584 1.00 75.17  ? 177 SER D CA  1 
ATOM   2794 C C   . SER B 2 177 ? 68.539  26.477  -66.627 1.00 82.85  ? 177 SER D C   1 
ATOM   2795 O O   . SER B 2 177 ? 69.263  26.791  -67.586 1.00 83.42  ? 177 SER D O   1 
ATOM   2796 C CB  . SER B 2 177 ? 68.927  23.991  -66.591 1.00 76.50  ? 177 SER D CB  1 
ATOM   2797 O OG  . SER B 2 177 ? 69.417  23.821  -65.274 1.00 83.62  ? 177 SER D OG  1 
ATOM   2798 N N   . THR B 2 178 ? 68.215  27.331  -65.638 1.00 80.40  ? 178 THR D N   1 
ATOM   2799 C CA  . THR B 2 178 ? 68.741  28.686  -65.595 1.00 80.72  ? 178 THR D CA  1 
ATOM   2800 C C   . THR B 2 178 ? 69.794  28.832  -64.514 1.00 88.86  ? 178 THR D C   1 
ATOM   2801 O O   . THR B 2 178 ? 69.498  28.686  -63.338 1.00 88.73  ? 178 THR D O   1 
ATOM   2802 C CB  . THR B 2 178 ? 67.609  29.702  -65.497 1.00 83.96  ? 178 THR D CB  1 
ATOM   2803 O OG1 . THR B 2 178 ? 66.757  29.596  -66.628 1.00 81.32  ? 178 THR D OG1 1 
ATOM   2804 C CG2 . THR B 2 178 ? 68.105  31.084  -65.451 1.00 87.30  ? 178 THR D CG2 1 
ATOM   2805 N N   . LEU B 2 179 ? 71.017  29.147  -64.926 1.00 89.00  ? 179 LEU D N   1 
ATOM   2806 C CA  . LEU B 2 179 ? 72.162  29.411  -64.062 1.00 90.45  ? 179 LEU D CA  1 
ATOM   2807 C C   . LEU B 2 179 ? 72.157  30.920  -63.791 1.00 95.32  ? 179 LEU D C   1 
ATOM   2808 O O   . LEU B 2 179 ? 72.339  31.712  -64.717 1.00 95.21  ? 179 LEU D O   1 
ATOM   2809 C CB  . LEU B 2 179 ? 73.447  28.975  -64.799 1.00 91.11  ? 179 LEU D CB  1 
ATOM   2810 C CG  . LEU B 2 179 ? 74.807  29.336  -64.215 1.00 96.79  ? 179 LEU D CG  1 
ATOM   2811 C CD1 . LEU B 2 179 ? 75.172  28.453  -63.052 1.00 98.30  ? 179 LEU D CD1 1 
ATOM   2812 C CD2 . LEU B 2 179 ? 75.857  29.161  -65.250 1.00 98.46  ? 179 LEU D CD2 1 
ATOM   2813 N N   . THR B 2 180 ? 71.909  31.315  -62.544 1.00 93.19  ? 180 THR D N   1 
ATOM   2814 C CA  . THR B 2 180 ? 71.850  32.727  -62.180 1.00 94.18  ? 180 THR D CA  1 
ATOM   2815 C C   . THR B 2 180 ? 73.123  33.166  -61.427 1.00 100.20 ? 180 THR D C   1 
ATOM   2816 O O   . THR B 2 180 ? 73.442  32.677  -60.338 1.00 99.91  ? 180 THR D O   1 
ATOM   2817 C CB  . THR B 2 180 ? 70.521  33.083  -61.467 1.00 103.15 ? 180 THR D CB  1 
ATOM   2818 O OG1 . THR B 2 180 ? 70.667  34.265  -60.678 1.00 106.73 ? 180 THR D OG1 1 
ATOM   2819 C CG2 . THR B 2 180 ? 69.935  31.921  -60.645 1.00 99.13  ? 180 THR D CG2 1 
ATOM   2820 N N   . LEU B 2 181 ? 73.818  34.120  -62.039 1.00 97.57  ? 181 LEU D N   1 
ATOM   2821 C CA  . LEU B 2 181 ? 75.027  34.739  -61.512 1.00 97.41  ? 181 LEU D CA  1 
ATOM   2822 C C   . LEU B 2 181 ? 74.897  36.258  -61.588 1.00 97.77  ? 181 LEU D C   1 
ATOM   2823 O O   . LEU B 2 181 ? 74.067  36.783  -62.329 1.00 97.00  ? 181 LEU D O   1 
ATOM   2824 C CB  . LEU B 2 181 ? 76.244  34.351  -62.366 1.00 97.68  ? 181 LEU D CB  1 
ATOM   2825 C CG  . LEU B 2 181 ? 76.771  32.978  -62.287 1.00 102.14 ? 181 LEU D CG  1 
ATOM   2826 C CD1 . LEU B 2 181 ? 76.280  32.237  -63.521 1.00 102.39 ? 181 LEU D CD1 1 
ATOM   2827 C CD2 . LEU B 2 181 ? 78.267  33.000  -62.229 1.00 105.10 ? 181 LEU D CD2 1 
ATOM   2828 N N   . SER B 2 182 ? 75.753  36.962  -60.857 1.00 91.87  ? 182 SER D N   1 
ATOM   2829 C CA  . SER B 2 182 ? 75.778  38.411  -60.937 1.00 91.12  ? 182 SER D CA  1 
ATOM   2830 C C   . SER B 2 182 ? 76.656  38.782  -62.133 1.00 96.71  ? 182 SER D C   1 
ATOM   2831 O O   . SER B 2 182 ? 77.495  37.974  -62.540 1.00 95.91  ? 182 SER D O   1 
ATOM   2832 C CB  . SER B 2 182 ? 76.397  38.976  -59.673 1.00 92.74  ? 182 SER D CB  1 
ATOM   2833 O OG  . SER B 2 182 ? 77.748  38.561  -59.562 1.00 97.33  ? 182 SER D OG  1 
ATOM   2834 N N   . LYS B 2 183 ? 76.492  40.015  -62.666 1.00 94.76  ? 183 LYS D N   1 
ATOM   2835 C CA  . LYS B 2 183 ? 77.286  40.568  -63.769 1.00 94.59  ? 183 LYS D CA  1 
ATOM   2836 C C   . LYS B 2 183 ? 78.775  40.360  -63.436 1.00 101.10 ? 183 LYS D C   1 
ATOM   2837 O O   . LYS B 2 183 ? 79.513  39.809  -64.248 1.00 100.76 ? 183 LYS D O   1 
ATOM   2838 C CB  . LYS B 2 183 ? 76.964  42.070  -63.951 1.00 96.27  ? 183 LYS D CB  1 
ATOM   2839 C CG  . LYS B 2 183 ? 77.328  42.656  -65.315 1.00 108.67 ? 183 LYS D CG  1 
ATOM   2840 C CD  . LYS B 2 183 ? 77.414  44.191  -65.265 1.00 113.40 ? 183 LYS D CD  1 
ATOM   2841 C CE  . LYS B 2 183 ? 78.069  44.804  -66.478 1.00 122.47 ? 183 LYS D CE  1 
ATOM   2842 N NZ  . LYS B 2 183 ? 77.173  44.823  -67.664 1.00 133.25 ? 183 LYS D NZ  1 
ATOM   2843 N N   . ALA B 2 184 ? 79.168  40.711  -62.196 1.00 100.25 ? 184 ALA D N   1 
ATOM   2844 C CA  . ALA B 2 184 ? 80.509  40.581  -61.617 1.00 100.98 ? 184 ALA D CA  1 
ATOM   2845 C C   . ALA B 2 184 ? 81.052  39.128  -61.651 1.00 105.77 ? 184 ALA D C   1 
ATOM   2846 O O   . ALA B 2 184 ? 82.211  38.904  -62.020 1.00 104.51 ? 184 ALA D O   1 
ATOM   2847 C CB  . ALA B 2 184 ? 80.482  41.102  -60.182 1.00 101.73 ? 184 ALA D CB  1 
ATOM   2848 N N   . ASP B 2 185 ? 80.206  38.157  -61.260 1.00 103.73 ? 185 ASP D N   1 
ATOM   2849 C CA  . ASP B 2 185 ? 80.540  36.727  -61.225 1.00 103.85 ? 185 ASP D CA  1 
ATOM   2850 C C   . ASP B 2 185 ? 80.667  36.179  -62.634 1.00 106.46 ? 185 ASP D C   1 
ATOM   2851 O O   . ASP B 2 185 ? 81.473  35.284  -62.885 1.00 106.09 ? 185 ASP D O   1 
ATOM   2852 C CB  . ASP B 2 185 ? 79.423  35.938  -60.505 1.00 106.21 ? 185 ASP D CB  1 
ATOM   2853 C CG  . ASP B 2 185 ? 79.377  36.043  -58.993 1.00 119.77 ? 185 ASP D CG  1 
ATOM   2854 O OD1 . ASP B 2 185 ? 80.419  36.418  -58.386 1.00 121.86 ? 185 ASP D OD1 1 
ATOM   2855 O OD2 . ASP B 2 185 ? 78.302  35.741  -58.411 1.00 121.56 ? 185 ASP D OD2 1 
ATOM   2856 N N   . TYR B 2 186 ? 79.816  36.686  -63.538 1.00 101.18 ? 186 TYR D N   1 
ATOM   2857 C CA  . TYR B 2 186 ? 79.785  36.253  -64.922 1.00 99.49  ? 186 TYR D CA  1 
ATOM   2858 C C   . TYR B 2 186 ? 81.003  36.770  -65.669 1.00 103.28 ? 186 TYR D C   1 
ATOM   2859 O O   . TYR B 2 186 ? 81.735  35.976  -66.263 1.00 103.06 ? 186 TYR D O   1 
ATOM   2860 C CB  . TYR B 2 186 ? 78.437  36.618  -65.582 1.00 99.17  ? 186 TYR D CB  1 
ATOM   2861 C CG  . TYR B 2 186 ? 78.365  36.303  -67.051 1.00 98.89  ? 186 TYR D CG  1 
ATOM   2862 C CD1 . TYR B 2 186 ? 78.338  34.987  -67.504 1.00 99.90  ? 186 TYR D CD1 1 
ATOM   2863 C CD2 . TYR B 2 186 ? 78.323  37.322  -67.996 1.00 99.44  ? 186 TYR D CD2 1 
ATOM   2864 C CE1 . TYR B 2 186 ? 78.309  34.693  -68.867 1.00 99.56  ? 186 TYR D CE1 1 
ATOM   2865 C CE2 . TYR B 2 186 ? 78.269  37.043  -69.359 1.00 99.97  ? 186 TYR D CE2 1 
ATOM   2866 C CZ  . TYR B 2 186 ? 78.277  35.722  -69.788 1.00 106.19 ? 186 TYR D CZ  1 
ATOM   2867 O OH  . TYR B 2 186 ? 78.231  35.451  -71.125 1.00 108.96 ? 186 TYR D OH  1 
ATOM   2868 N N   . GLU B 2 187 ? 81.271  38.078  -65.572 1.00 99.73  ? 187 GLU D N   1 
ATOM   2869 C CA  . GLU B 2 187 ? 82.403  38.711  -66.254 1.00 99.97  ? 187 GLU D CA  1 
ATOM   2870 C C   . GLU B 2 187 ? 83.773  38.217  -65.784 1.00 105.90 ? 187 GLU D C   1 
ATOM   2871 O O   . GLU B 2 187 ? 84.769  38.423  -66.481 1.00 105.41 ? 187 GLU D O   1 
ATOM   2872 C CB  . GLU B 2 187 ? 82.307  40.232  -66.155 1.00 100.99 ? 187 GLU D CB  1 
ATOM   2873 C CG  . GLU B 2 187 ? 81.204  40.804  -67.015 1.00 107.73 ? 187 GLU D CG  1 
ATOM   2874 C CD  . GLU B 2 187 ? 80.913  42.275  -66.778 1.00 127.52 ? 187 GLU D CD  1 
ATOM   2875 O OE1 . GLU B 2 187 ? 80.620  42.975  -67.774 1.00 140.93 ? 187 GLU D OE1 1 
ATOM   2876 O OE2 . GLU B 2 187 ? 80.984  42.732  -65.611 1.00 105.57 ? 187 GLU D OE2 1 
ATOM   2877 N N   . LYS B 2 188 ? 83.809  37.538  -64.625 1.00 103.96 ? 188 LYS D N   1 
ATOM   2878 C CA  . LYS B 2 188 ? 85.018  36.992  -64.023 1.00 104.33 ? 188 LYS D CA  1 
ATOM   2879 C C   . LYS B 2 188 ? 85.557  35.729  -64.763 1.00 109.30 ? 188 LYS D C   1 
ATOM   2880 O O   . LYS B 2 188 ? 86.777  35.554  -64.813 1.00 108.30 ? 188 LYS D O   1 
ATOM   2881 C CB  . LYS B 2 188 ? 84.751  36.728  -62.530 1.00 107.19 ? 188 LYS D CB  1 
ATOM   2882 C CG  . LYS B 2 188 ? 85.982  36.566  -61.661 1.00 128.80 ? 188 LYS D CG  1 
ATOM   2883 C CD  . LYS B 2 188 ? 85.583  36.311  -60.204 1.00 144.46 ? 188 LYS D CD  1 
ATOM   2884 C CE  . LYS B 2 188 ? 86.689  35.550  -59.487 1.00 160.82 ? 188 LYS D CE  1 
ATOM   2885 N NZ  . LYS B 2 188 ? 86.195  34.429  -58.631 1.00 172.62 ? 188 LYS D NZ  1 
ATOM   2886 N N   . HIS B 2 189 ? 84.652  34.887  -65.366 1.00 107.84 ? 189 HIS D N   1 
ATOM   2887 C CA  . HIS B 2 189 ? 84.974  33.617  -66.067 1.00 108.80 ? 189 HIS D CA  1 
ATOM   2888 C C   . HIS B 2 189 ? 84.596  33.572  -67.556 1.00 109.73 ? 189 HIS D C   1 
ATOM   2889 O O   . HIS B 2 189 ? 83.757  34.359  -67.982 1.00 108.47 ? 189 HIS D O   1 
ATOM   2890 C CB  . HIS B 2 189 ? 84.343  32.433  -65.335 1.00 110.98 ? 189 HIS D CB  1 
ATOM   2891 C CG  . HIS B 2 189 ? 84.601  32.478  -63.868 1.00 115.32 ? 189 HIS D CG  1 
ATOM   2892 N ND1 . HIS B 2 189 ? 85.829  32.096  -63.335 1.00 117.68 ? 189 HIS D ND1 1 
ATOM   2893 C CD2 . HIS B 2 189 ? 83.815  32.949  -62.873 1.00 117.33 ? 189 HIS D CD2 1 
ATOM   2894 C CE1 . HIS B 2 189 ? 85.733  32.313  -62.031 1.00 117.04 ? 189 HIS D CE1 1 
ATOM   2895 N NE2 . HIS B 2 189 ? 84.541  32.828  -61.706 1.00 117.41 ? 189 HIS D NE2 1 
ATOM   2896 N N   . LYS B 2 190 ? 85.163  32.614  -68.339 1.00 105.51 ? 190 LYS D N   1 
ATOM   2897 C CA  . LYS B 2 190 ? 84.918  32.581  -69.789 1.00 105.50 ? 190 LYS D CA  1 
ATOM   2898 C C   . LYS B 2 190 ? 84.078  31.428  -70.320 1.00 109.69 ? 190 LYS D C   1 
ATOM   2899 O O   . LYS B 2 190 ? 83.209  31.697  -71.155 1.00 108.98 ? 190 LYS D O   1 
ATOM   2900 C CB  . LYS B 2 190 ? 86.237  32.639  -70.590 1.00 108.16 ? 190 LYS D CB  1 
ATOM   2901 C CG  . LYS B 2 190 ? 86.076  33.050  -72.066 1.00 120.51 ? 190 LYS D CG  1 
ATOM   2902 C CD  . LYS B 2 190 ? 87.359  32.873  -72.887 1.00 132.13 ? 190 LYS D CD  1 
ATOM   2903 C CE  . LYS B 2 190 ? 87.614  31.447  -73.338 1.00 139.92 ? 190 LYS D CE  1 
ATOM   2904 N NZ  . LYS B 2 190 ? 88.796  31.350  -74.236 1.00 145.82 ? 190 LYS D NZ  1 
ATOM   2905 N N   . VAL B 2 191 ? 84.377  30.155  -69.958 1.00 106.83 ? 191 VAL D N   1 
ATOM   2906 C CA  . VAL B 2 191 ? 83.607  29.042  -70.544 1.00 106.29 ? 191 VAL D CA  1 
ATOM   2907 C C   . VAL B 2 191 ? 82.428  28.629  -69.622 1.00 109.67 ? 191 VAL D C   1 
ATOM   2908 O O   . VAL B 2 191 ? 82.621  28.484  -68.425 1.00 109.34 ? 191 VAL D O   1 
ATOM   2909 C CB  . VAL B 2 191 ? 84.509  27.865  -71.014 1.00 109.53 ? 191 VAL D CB  1 
ATOM   2910 C CG1 . VAL B 2 191 ? 85.801  27.737  -70.200 1.00 108.53 ? 191 VAL D CG1 1 
ATOM   2911 C CG2 . VAL B 2 191 ? 83.779  26.528  -71.112 1.00 109.56 ? 191 VAL D CG2 1 
ATOM   2912 N N   . TYR B 2 192 ? 81.215  28.555  -70.191 1.00 105.90 ? 192 TYR D N   1 
ATOM   2913 C CA  . TYR B 2 192 ? 79.965  28.249  -69.493 1.00 105.96 ? 192 TYR D CA  1 
ATOM   2914 C C   . TYR B 2 192 ? 79.290  27.096  -70.218 1.00 106.84 ? 192 TYR D C   1 
ATOM   2915 O O   . TYR B 2 192 ? 78.911  27.246  -71.381 1.00 107.26 ? 192 TYR D O   1 
ATOM   2916 C CB  . TYR B 2 192 ? 79.066  29.502  -69.489 1.00 108.29 ? 192 TYR D CB  1 
ATOM   2917 C CG  . TYR B 2 192 ? 79.569  30.584  -68.563 1.00 111.15 ? 192 TYR D CG  1 
ATOM   2918 C CD1 . TYR B 2 192 ? 80.560  31.471  -68.971 1.00 112.93 ? 192 TYR D CD1 1 
ATOM   2919 C CD2 . TYR B 2 192 ? 79.060  30.719  -67.276 1.00 112.50 ? 192 TYR D CD2 1 
ATOM   2920 C CE1 . TYR B 2 192 ? 81.065  32.439  -68.106 1.00 113.94 ? 192 TYR D CE1 1 
ATOM   2921 C CE2 . TYR B 2 192 ? 79.531  31.707  -66.417 1.00 113.43 ? 192 TYR D CE2 1 
ATOM   2922 C CZ  . TYR B 2 192 ? 80.565  32.536  -66.822 1.00 120.13 ? 192 TYR D CZ  1 
ATOM   2923 O OH  . TYR B 2 192 ? 81.066  33.487  -65.976 1.00 120.30 ? 192 TYR D OH  1 
ATOM   2924 N N   . ALA B 2 193 ? 79.158  25.937  -69.548 1.00 99.69  ? 193 ALA D N   1 
ATOM   2925 C CA  . ALA B 2 193 ? 78.561  24.736  -70.152 1.00 97.21  ? 193 ALA D CA  1 
ATOM   2926 C C   . ALA B 2 193 ? 77.514  24.004  -69.310 1.00 97.59  ? 193 ALA D C   1 
ATOM   2927 O O   . ALA B 2 193 ? 77.601  23.974  -68.084 1.00 95.48  ? 193 ALA D O   1 
ATOM   2928 C CB  . ALA B 2 193 ? 79.649  23.758  -70.546 1.00 97.42  ? 193 ALA D CB  1 
ATOM   2929 N N   . CYS B 2 194 ? 76.531  23.390  -69.985 1.00 93.06  ? 194 CYS D N   1 
ATOM   2930 C CA  . CYS B 2 194 ? 75.548  22.554  -69.317 1.00 92.30  ? 194 CYS D CA  1 
ATOM   2931 C C   . CYS B 2 194 ? 75.648  21.160  -69.902 1.00 96.25  ? 194 CYS D C   1 
ATOM   2932 O O   . CYS B 2 194 ? 75.639  20.987  -71.120 1.00 95.71  ? 194 CYS D O   1 
ATOM   2933 C CB  . CYS B 2 194 ? 74.130  23.118  -69.368 1.00 91.95  ? 194 CYS D CB  1 
ATOM   2934 S SG  . CYS B 2 194 ? 73.407  23.211  -71.027 1.00 95.26  ? 194 CYS D SG  1 
ATOM   2935 N N   . GLU B 2 195 ? 75.869  20.188  -69.026 1.00 92.70  ? 195 GLU D N   1 
ATOM   2936 C CA  . GLU B 2 195 ? 76.058  18.787  -69.355 1.00 92.32  ? 195 GLU D CA  1 
ATOM   2937 C C   . GLU B 2 195 ? 74.774  18.020  -69.091 1.00 94.40  ? 195 GLU D C   1 
ATOM   2938 O O   . GLU B 2 195 ? 74.300  17.950  -67.953 1.00 94.17  ? 195 GLU D O   1 
ATOM   2939 C CB  . GLU B 2 195 ? 77.192  18.246  -68.506 1.00 94.12  ? 195 GLU D CB  1 
ATOM   2940 C CG  . GLU B 2 195 ? 77.896  17.045  -69.086 1.00 108.86 ? 195 GLU D CG  1 
ATOM   2941 C CD  . GLU B 2 195 ? 79.145  16.745  -68.286 1.00 141.86 ? 195 GLU D CD  1 
ATOM   2942 O OE1 . GLU B 2 195 ? 79.010  16.419  -67.084 1.00 131.28 ? 195 GLU D OE1 1 
ATOM   2943 O OE2 . GLU B 2 195 ? 80.259  16.873  -68.843 1.00 147.81 ? 195 GLU D OE2 1 
ATOM   2944 N N   . VAL B 2 196 ? 74.224  17.432  -70.149 1.00 89.12  ? 196 VAL D N   1 
ATOM   2945 C CA  . VAL B 2 196 ? 72.951  16.721  -70.130 1.00 87.99  ? 196 VAL D CA  1 
ATOM   2946 C C   . VAL B 2 196 ? 73.086  15.200  -70.171 1.00 89.73  ? 196 VAL D C   1 
ATOM   2947 O O   . VAL B 2 196 ? 73.758  14.662  -71.040 1.00 88.02  ? 196 VAL D O   1 
ATOM   2948 C CB  . VAL B 2 196 ? 72.062  17.257  -71.279 1.00 91.88  ? 196 VAL D CB  1 
ATOM   2949 C CG1 . VAL B 2 196 ? 70.818  16.390  -71.503 1.00 91.64  ? 196 VAL D CG1 1 
ATOM   2950 C CG2 . VAL B 2 196 ? 71.680  18.710  -71.033 1.00 91.50  ? 196 VAL D CG2 1 
ATOM   2951 N N   . THR B 2 197 ? 72.367  14.530  -69.262 1.00 86.49  ? 197 THR D N   1 
ATOM   2952 C CA  . THR B 2 197 ? 72.245  13.076  -69.155 1.00 85.98  ? 197 THR D CA  1 
ATOM   2953 C C   . THR B 2 197 ? 70.766  12.694  -69.261 1.00 86.53  ? 197 THR D C   1 
ATOM   2954 O O   . THR B 2 197 ? 69.915  13.230  -68.549 1.00 83.97  ? 197 THR D O   1 
ATOM   2955 C CB  . THR B 2 197 ? 72.929  12.508  -67.905 1.00 99.92  ? 197 THR D CB  1 
ATOM   2956 O OG1 . THR B 2 197 ? 72.787  13.379  -66.786 1.00 103.15 ? 197 THR D OG1 1 
ATOM   2957 C CG2 . THR B 2 197 ? 74.369  12.148  -68.127 1.00 100.04 ? 197 THR D CG2 1 
ATOM   2958 N N   . HIS B 2 198 ? 70.470  11.795  -70.198 1.00 83.48  ? 198 HIS D N   1 
ATOM   2959 C CA  . HIS B 2 198 ? 69.119  11.310  -70.494 1.00 82.36  ? 198 HIS D CA  1 
ATOM   2960 C C   . HIS B 2 198 ? 69.208  9.912   -71.071 1.00 83.09  ? 198 HIS D C   1 
ATOM   2961 O O   . HIS B 2 198 ? 70.215  9.557   -71.692 1.00 81.68  ? 198 HIS D O   1 
ATOM   2962 C CB  . HIS B 2 198 ? 68.426  12.268  -71.478 1.00 83.06  ? 198 HIS D CB  1 
ATOM   2963 C CG  . HIS B 2 198 ? 67.006  11.913  -71.796 1.00 86.19  ? 198 HIS D CG  1 
ATOM   2964 N ND1 . HIS B 2 198 ? 66.682  11.167  -72.917 1.00 88.13  ? 198 HIS D ND1 1 
ATOM   2965 C CD2 . HIS B 2 198 ? 65.869  12.217  -71.131 1.00 87.98  ? 198 HIS D CD2 1 
ATOM   2966 C CE1 . HIS B 2 198 ? 65.364  11.045  -72.898 1.00 87.35  ? 198 HIS D CE1 1 
ATOM   2967 N NE2 . HIS B 2 198 ? 64.829  11.667  -71.848 1.00 87.79  ? 198 HIS D NE2 1 
ATOM   2968 N N   . GLN B 2 199 ? 68.156  9.121   -70.844 1.00 79.65  ? 199 GLN D N   1 
ATOM   2969 C CA  . GLN B 2 199 ? 67.984  7.742   -71.313 1.00 79.40  ? 199 GLN D CA  1 
ATOM   2970 C C   . GLN B 2 199 ? 68.296  7.613   -72.817 1.00 85.24  ? 199 GLN D C   1 
ATOM   2971 O O   . GLN B 2 199 ? 69.073  6.736   -73.199 1.00 85.62  ? 199 GLN D O   1 
ATOM   2972 C CB  . GLN B 2 199 ? 66.551  7.295   -71.027 1.00 80.17  ? 199 GLN D CB  1 
ATOM   2973 C CG  . GLN B 2 199 ? 66.365  5.817   -71.064 1.00 106.70 ? 199 GLN D CG  1 
ATOM   2974 C CD  . GLN B 2 199 ? 64.963  5.443   -70.669 1.00 134.13 ? 199 GLN D CD  1 
ATOM   2975 O OE1 . GLN B 2 199 ? 64.377  6.004   -69.731 1.00 126.41 ? 199 GLN D OE1 1 
ATOM   2976 N NE2 . GLN B 2 199 ? 64.398  4.464   -71.373 1.00 132.58 ? 199 GLN D NE2 1 
ATOM   2977 N N   . GLY B 2 200 ? 67.743  8.523   -73.627 1.00 81.66  ? 200 GLY D N   1 
ATOM   2978 C CA  . GLY B 2 200 ? 67.933  8.554   -75.075 1.00 80.80  ? 200 GLY D CA  1 
ATOM   2979 C C   . GLY B 2 200 ? 69.303  8.985   -75.564 1.00 82.87  ? 200 GLY D C   1 
ATOM   2980 O O   . GLY B 2 200 ? 69.549  9.043   -76.775 1.00 79.74  ? 200 GLY D O   1 
ATOM   2981 N N   . LEU B 2 201 ? 70.200  9.298   -74.626 1.00 81.58  ? 201 LEU D N   1 
ATOM   2982 C CA  . LEU B 2 201 ? 71.556  9.717   -74.931 1.00 82.27  ? 201 LEU D CA  1 
ATOM   2983 C C   . LEU B 2 201 ? 72.521  8.649   -74.519 1.00 93.14  ? 201 LEU D C   1 
ATOM   2984 O O   . LEU B 2 201 ? 72.556  8.265   -73.340 1.00 93.94  ? 201 LEU D O   1 
ATOM   2985 C CB  . LEU B 2 201 ? 71.911  11.035  -74.235 1.00 81.32  ? 201 LEU D CB  1 
ATOM   2986 C CG  . LEU B 2 201 ? 71.222  12.249  -74.763 1.00 83.50  ? 201 LEU D CG  1 
ATOM   2987 C CD1 . LEU B 2 201 ? 71.406  13.388  -73.835 1.00 83.42  ? 201 LEU D CD1 1 
ATOM   2988 C CD2 . LEU B 2 201 ? 71.696  12.581  -76.137 1.00 81.73  ? 201 LEU D CD2 1 
ATOM   2989 N N   . SER B 2 202 ? 73.309  8.176   -75.499 1.00 93.32  ? 202 SER D N   1 
ATOM   2990 C CA  . SER B 2 202 ? 74.324  7.150   -75.322 1.00 95.38  ? 202 SER D CA  1 
ATOM   2991 C C   . SER B 2 202 ? 75.468  7.702   -74.462 1.00 101.79 ? 202 SER D C   1 
ATOM   2992 O O   . SER B 2 202 ? 75.989  6.999   -73.597 1.00 101.70 ? 202 SER D O   1 
ATOM   2993 C CB  . SER B 2 202 ? 74.824  6.676   -76.685 1.00 101.31 ? 202 SER D CB  1 
ATOM   2994 O OG  . SER B 2 202 ? 75.170  7.785   -77.500 1.00 114.13 ? 202 SER D OG  1 
ATOM   2995 N N   . SER B 2 203 ? 75.820  8.974   -74.676 1.00 99.57  ? 203 SER D N   1 
ATOM   2996 C CA  . SER B 2 203 ? 76.879  9.675   -73.948 1.00 99.72  ? 203 SER D CA  1 
ATOM   2997 C C   . SER B 2 203 ? 76.304  11.029  -73.477 1.00 102.28 ? 203 SER D C   1 
ATOM   2998 O O   . SER B 2 203 ? 75.374  11.512  -74.121 1.00 101.87 ? 203 SER D O   1 
ATOM   2999 C CB  . SER B 2 203 ? 78.109  9.848   -74.854 1.00 104.65 ? 203 SER D CB  1 
ATOM   3000 O OG  . SER B 2 203 ? 78.702  11.140  -74.861 1.00 113.65 ? 203 SER D OG  1 
ATOM   3001 N N   . PRO B 2 204 ? 76.777  11.659  -72.375 1.00 97.80  ? 204 PRO D N   1 
ATOM   3002 C CA  . PRO B 2 204 ? 76.218  12.961  -71.995 1.00 97.28  ? 204 PRO D CA  1 
ATOM   3003 C C   . PRO B 2 204 ? 76.657  14.070  -72.944 1.00 102.73 ? 204 PRO D C   1 
ATOM   3004 O O   . PRO B 2 204 ? 77.826  14.123  -73.346 1.00 104.67 ? 204 PRO D O   1 
ATOM   3005 C CB  . PRO B 2 204 ? 76.770  13.202  -70.588 1.00 98.78  ? 204 PRO D CB  1 
ATOM   3006 C CG  . PRO B 2 204 ? 77.463  11.942  -70.196 1.00 103.42 ? 204 PRO D CG  1 
ATOM   3007 C CD  . PRO B 2 204 ? 77.857  11.270  -71.454 1.00 99.37  ? 204 PRO D CD  1 
ATOM   3008 N N   . VAL B 2 205 ? 75.708  14.935  -73.316 1.00 97.43  ? 205 VAL D N   1 
ATOM   3009 C CA  . VAL B 2 205 ? 75.910  16.062  -74.226 1.00 96.97  ? 205 VAL D CA  1 
ATOM   3010 C C   . VAL B 2 205 ? 76.398  17.272  -73.431 1.00 102.11 ? 205 VAL D C   1 
ATOM   3011 O O   . VAL B 2 205 ? 75.819  17.585  -72.392 1.00 103.19 ? 205 VAL D O   1 
ATOM   3012 C CB  . VAL B 2 205 ? 74.592  16.352  -74.995 1.00 100.61 ? 205 VAL D CB  1 
ATOM   3013 C CG1 . VAL B 2 205 ? 74.684  17.631  -75.822 1.00 100.60 ? 205 VAL D CG1 1 
ATOM   3014 C CG2 . VAL B 2 205 ? 74.205  15.180  -75.883 1.00 100.32 ? 205 VAL D CG2 1 
ATOM   3015 N N   . THR B 2 206 ? 77.450  17.961  -73.915 1.00 97.52  ? 206 THR D N   1 
ATOM   3016 C CA  . THR B 2 206 ? 77.966  19.143  -73.222 1.00 96.35  ? 206 THR D CA  1 
ATOM   3017 C C   . THR B 2 206 ? 77.878  20.386  -74.114 1.00 97.17  ? 206 THR D C   1 
ATOM   3018 O O   . THR B 2 206 ? 78.780  20.643  -74.906 1.00 95.95  ? 206 THR D O   1 
ATOM   3019 C CB  . THR B 2 206 ? 79.372  18.889  -72.635 1.00 105.27 ? 206 THR D CB  1 
ATOM   3020 O OG1 . THR B 2 206 ? 79.422  17.592  -72.016 1.00 107.14 ? 206 THR D OG1 1 
ATOM   3021 C CG2 . THR B 2 206 ? 79.784  19.959  -71.633 1.00 101.45 ? 206 THR D CG2 1 
ATOM   3022 N N   . LYS B 2 207 ? 76.781  21.147  -73.981 1.00 92.58  ? 207 LYS D N   1 
ATOM   3023 C CA  . LYS B 2 207 ? 76.562  22.382  -74.735 1.00 91.35  ? 207 LYS D CA  1 
ATOM   3024 C C   . LYS B 2 207 ? 77.245  23.548  -73.986 1.00 94.17  ? 207 LYS D C   1 
ATOM   3025 O O   . LYS B 2 207 ? 76.916  23.797  -72.830 1.00 94.53  ? 207 LYS D O   1 
ATOM   3026 C CB  . LYS B 2 207 ? 75.048  22.617  -74.923 1.00 92.96  ? 207 LYS D CB  1 
ATOM   3027 C CG  . LYS B 2 207 ? 74.663  23.300  -76.230 1.00 97.37  ? 207 LYS D CG  1 
ATOM   3028 C CD  . LYS B 2 207 ? 74.499  22.323  -77.388 1.00 100.83 ? 207 LYS D CD  1 
ATOM   3029 C CE  . LYS B 2 207 ? 74.245  23.041  -78.693 1.00 112.48 ? 207 LYS D CE  1 
ATOM   3030 N NZ  . LYS B 2 207 ? 75.489  23.619  -79.285 1.00 118.52 ? 207 LYS D NZ  1 
ATOM   3031 N N   . SER B 2 208 ? 78.223  24.219  -74.619 1.00 90.36  ? 208 SER D N   1 
ATOM   3032 C CA  . SER B 2 208 ? 78.985  25.326  -74.015 1.00 90.36  ? 208 SER D CA  1 
ATOM   3033 C C   . SER B 2 208 ? 79.165  26.552  -74.919 1.00 93.13  ? 208 SER D C   1 
ATOM   3034 O O   . SER B 2 208 ? 78.859  26.509  -76.111 1.00 92.99  ? 208 SER D O   1 
ATOM   3035 C CB  . SER B 2 208 ? 80.366  24.849  -73.565 1.00 95.66  ? 208 SER D CB  1 
ATOM   3036 O OG  . SER B 2 208 ? 81.201  24.506  -74.660 1.00 107.65 ? 208 SER D OG  1 
ATOM   3037 N N   . PHE B 2 209 ? 79.703  27.636  -74.339 1.00 89.28  ? 209 PHE D N   1 
ATOM   3038 C CA  . PHE B 2 209 ? 80.005  28.888  -75.023 1.00 89.14  ? 209 PHE D CA  1 
ATOM   3039 C C   . PHE B 2 209 ? 81.059  29.658  -74.265 1.00 94.66  ? 209 PHE D C   1 
ATOM   3040 O O   . PHE B 2 209 ? 81.293  29.393  -73.087 1.00 92.85  ? 209 PHE D O   1 
ATOM   3041 C CB  . PHE B 2 209 ? 78.747  29.766  -75.218 1.00 90.84  ? 209 PHE D CB  1 
ATOM   3042 C CG  . PHE B 2 209 ? 78.200  30.430  -73.977 1.00 92.68  ? 209 PHE D CG  1 
ATOM   3043 C CD1 . PHE B 2 209 ? 77.365  29.743  -73.113 1.00 96.32  ? 209 PHE D CD1 1 
ATOM   3044 C CD2 . PHE B 2 209 ? 78.517  31.746  -73.679 1.00 95.11  ? 209 PHE D CD2 1 
ATOM   3045 C CE1 . PHE B 2 209 ? 76.852  30.368  -71.984 1.00 97.44  ? 209 PHE D CE1 1 
ATOM   3046 C CE2 . PHE B 2 209 ? 78.038  32.353  -72.525 1.00 97.74  ? 209 PHE D CE2 1 
ATOM   3047 C CZ  . PHE B 2 209 ? 77.188  31.676  -71.704 1.00 96.12  ? 209 PHE D CZ  1 
ATOM   3048 N N   . ASN B 2 210 ? 81.668  30.645  -74.935 1.00 94.88  ? 210 ASN D N   1 
ATOM   3049 C CA  . ASN B 2 210 ? 82.684  31.528  -74.365 1.00 96.08  ? 210 ASN D CA  1 
ATOM   3050 C C   . ASN B 2 210 ? 82.159  32.973  -74.350 1.00 101.34 ? 210 ASN D C   1 
ATOM   3051 O O   . ASN B 2 210 ? 81.521  33.415  -75.323 1.00 101.73 ? 210 ASN D O   1 
ATOM   3052 C CB  . ASN B 2 210 ? 84.027  31.424  -75.142 1.00 97.80  ? 210 ASN D CB  1 
ATOM   3053 C CG  . ASN B 2 210 ? 84.673  30.043  -75.156 1.00 124.15 ? 210 ASN D CG  1 
ATOM   3054 O OD1 . ASN B 2 210 ? 84.120  29.045  -74.677 1.00 123.89 ? 210 ASN D OD1 1 
ATOM   3055 N ND2 . ASN B 2 210 ? 85.848  29.936  -75.760 1.00 111.24 ? 210 ASN D ND2 1 
ATOM   3056 N N   . ARG B 2 211 ? 82.428  33.700  -73.238 1.00 96.92  ? 211 ARG D N   1 
ATOM   3057 C CA  . ARG B 2 211 ? 82.073  35.108  -73.043 1.00 92.73  ? 211 ARG D CA  1 
ATOM   3058 C C   . ARG B 2 211 ? 82.995  35.973  -73.921 1.00 108.03 ? 211 ARG D C   1 
ATOM   3059 O O   . ARG B 2 211 ? 82.785  36.098  -75.128 1.00 64.36  ? 211 ARG D O   1 
ATOM   3060 C CB  . ARG B 2 211 ? 82.230  35.488  -71.557 1.00 90.88  ? 211 ARG D CB  1 
ATOM   3061 C CG  . ARG B 2 211 ? 81.849  36.947  -71.223 1.00 93.80  ? 211 ARG D CG  1 
ATOM   3062 C CD  . ARG B 2 211 ? 82.251  37.416  -69.822 1.00 88.65  ? 211 ARG D CD  1 
ATOM   3063 N NE  . ARG B 2 211 ? 83.483  36.788  -69.335 1.00 105.64 ? 211 ARG D NE  1 
ATOM   3064 C CZ  . ARG B 2 211 ? 84.718  37.171  -69.662 1.00 125.25 ? 211 ARG D CZ  1 
ATOM   3065 N NH1 . ARG B 2 211 ? 84.908  38.195  -70.475 1.00 116.31 ? 211 ARG D NH1 1 
ATOM   3066 N NH2 . ARG B 2 211 ? 85.768  36.534  -69.160 1.00 108.87 ? 211 ARG D NH2 1 
ATOM   3067 N N   . GLN C 3 1   ? 22.555  23.597  -62.946 1.00 88.86  ? 1   GLN E N   1 
ATOM   3068 C CA  . GLN C 3 1   ? 23.504  24.695  -63.252 1.00 88.62  ? 1   GLN E CA  1 
ATOM   3069 C C   . GLN C 3 1   ? 24.160  25.311  -61.972 1.00 90.39  ? 1   GLN E C   1 
ATOM   3070 O O   . GLN C 3 1   ? 24.281  26.538  -61.834 1.00 91.30  ? 1   GLN E O   1 
ATOM   3071 C CB  . GLN C 3 1   ? 22.841  25.779  -64.139 1.00 90.14  ? 1   GLN E CB  1 
ATOM   3072 C CG  . GLN C 3 1   ? 23.816  26.646  -64.943 1.00 107.71 ? 1   GLN E CG  1 
ATOM   3073 C CD  . GLN C 3 1   ? 23.166  27.936  -65.386 1.00 142.41 ? 1   GLN E CD  1 
ATOM   3074 O OE1 . GLN C 3 1   ? 22.637  28.707  -64.571 1.00 144.54 ? 1   GLN E OE1 1 
ATOM   3075 N NE2 . GLN C 3 1   ? 23.192  28.208  -66.690 1.00 135.23 ? 1   GLN E NE2 1 
ATOM   3076 N N   . VAL C 3 2   ? 24.571  24.423  -61.041 1.00 82.67  ? 2   VAL E N   1 
ATOM   3077 C CA  . VAL C 3 2   ? 25.240  24.729  -59.779 1.00 79.26  ? 2   VAL E CA  1 
ATOM   3078 C C   . VAL C 3 2   ? 26.543  25.421  -60.120 1.00 80.41  ? 2   VAL E C   1 
ATOM   3079 O O   . VAL C 3 2   ? 27.274  24.961  -60.991 1.00 79.61  ? 2   VAL E O   1 
ATOM   3080 C CB  . VAL C 3 2   ? 25.484  23.425  -58.980 1.00 81.47  ? 2   VAL E CB  1 
ATOM   3081 C CG1 . VAL C 3 2   ? 26.479  23.633  -57.845 1.00 80.90  ? 2   VAL E CG1 1 
ATOM   3082 C CG2 . VAL C 3 2   ? 24.176  22.852  -58.456 1.00 81.18  ? 2   VAL E CG2 1 
ATOM   3083 N N   . GLN C 3 3   ? 26.818  26.535  -59.460 1.00 75.60  ? 3   GLN E N   1 
ATOM   3084 C CA  . GLN C 3 3   ? 28.046  27.266  -59.679 1.00 74.20  ? 3   GLN E CA  1 
ATOM   3085 C C   . GLN C 3 3   ? 28.609  27.757  -58.387 1.00 73.23  ? 3   GLN E C   1 
ATOM   3086 O O   . GLN C 3 3   ? 27.875  28.200  -57.513 1.00 71.74  ? 3   GLN E O   1 
ATOM   3087 C CB  . GLN C 3 3   ? 27.815  28.433  -60.648 1.00 76.41  ? 3   GLN E CB  1 
ATOM   3088 C CG  . GLN C 3 3   ? 28.096  28.070  -62.109 1.00 101.47 ? 3   GLN E CG  1 
ATOM   3089 C CD  . GLN C 3 3   ? 27.456  28.991  -63.117 1.00 134.01 ? 3   GLN E CD  1 
ATOM   3090 O OE1 . GLN C 3 3   ? 26.682  29.900  -62.786 1.00 137.51 ? 3   GLN E OE1 1 
ATOM   3091 N NE2 . GLN C 3 3   ? 27.762  28.764  -64.383 1.00 125.09 ? 3   GLN E NE2 1 
ATOM   3092 N N   . LEU C 3 4   ? 29.922  27.657  -58.262 1.00 69.01  ? 4   LEU E N   1 
ATOM   3093 C CA  . LEU C 3 4   ? 30.674  28.173  -57.118 1.00 68.63  ? 4   LEU E CA  1 
ATOM   3094 C C   . LEU C 3 4   ? 31.734  29.177  -57.613 1.00 74.06  ? 4   LEU E C   1 
ATOM   3095 O O   . LEU C 3 4   ? 32.662  28.836  -58.384 1.00 74.72  ? 4   LEU E O   1 
ATOM   3096 C CB  . LEU C 3 4   ? 31.301  27.060  -56.265 1.00 67.43  ? 4   LEU E CB  1 
ATOM   3097 C CG  . LEU C 3 4   ? 30.394  26.072  -55.569 1.00 68.08  ? 4   LEU E CG  1 
ATOM   3098 C CD1 . LEU C 3 4   ? 31.222  25.050  -54.919 1.00 65.68  ? 4   LEU E CD1 1 
ATOM   3099 C CD2 . LEU C 3 4   ? 29.538  26.757  -54.531 1.00 71.57  ? 4   LEU E CD2 1 
ATOM   3100 N N   . VAL C 3 5   ? 31.507  30.438  -57.263 1.00 69.34  ? 5   VAL E N   1 
ATOM   3101 C CA  . VAL C 3 5   ? 32.353  31.521  -57.714 1.00 69.41  ? 5   VAL E CA  1 
ATOM   3102 C C   . VAL C 3 5   ? 33.005  32.238  -56.530 1.00 74.72  ? 5   VAL E C   1 
ATOM   3103 O O   . VAL C 3 5   ? 32.358  32.963  -55.747 1.00 75.05  ? 5   VAL E O   1 
ATOM   3104 C CB  . VAL C 3 5   ? 31.627  32.483  -58.694 1.00 73.20  ? 5   VAL E CB  1 
ATOM   3105 C CG1 . VAL C 3 5   ? 32.578  33.549  -59.222 1.00 73.18  ? 5   VAL E CG1 1 
ATOM   3106 C CG2 . VAL C 3 5   ? 31.014  31.718  -59.856 1.00 72.81  ? 5   VAL E CG2 1 
ATOM   3107 N N   . GLN C 3 6   ? 34.318  32.046  -56.445 1.00 70.61  ? 6   GLN E N   1 
ATOM   3108 C CA  . GLN C 3 6   ? 35.191  32.582  -55.417 1.00 70.03  ? 6   GLN E CA  1 
ATOM   3109 C C   . GLN C 3 6   ? 35.726  33.988  -55.702 1.00 76.42  ? 6   GLN E C   1 
ATOM   3110 O O   . GLN C 3 6   ? 35.781  34.455  -56.866 1.00 77.34  ? 6   GLN E O   1 
ATOM   3111 C CB  . GLN C 3 6   ? 36.348  31.625  -55.206 1.00 70.48  ? 6   GLN E CB  1 
ATOM   3112 C CG  . GLN C 3 6   ? 35.903  30.185  -55.095 1.00 68.95  ? 6   GLN E CG  1 
ATOM   3113 C CD  . GLN C 3 6   ? 37.019  29.322  -54.619 1.00 79.17  ? 6   GLN E CD  1 
ATOM   3114 O OE1 . GLN C 3 6   ? 37.171  28.168  -55.046 1.00 76.52  ? 6   GLN E OE1 1 
ATOM   3115 N NE2 . GLN C 3 6   ? 37.827  29.867  -53.724 1.00 64.28  ? 6   GLN E NE2 1 
ATOM   3116 N N   . SER C 3 7   ? 36.156  34.655  -54.609 1.00 71.43  ? 7   SER E N   1 
ATOM   3117 C CA  . SER C 3 7   ? 36.755  35.973  -54.661 1.00 69.98  ? 7   SER E CA  1 
ATOM   3118 C C   . SER C 3 7   ? 38.094  35.849  -55.372 1.00 75.17  ? 7   SER E C   1 
ATOM   3119 O O   . SER C 3 7   ? 38.652  34.767  -55.410 1.00 77.00  ? 7   SER E O   1 
ATOM   3120 C CB  . SER C 3 7   ? 36.904  36.548  -53.256 1.00 71.93  ? 7   SER E CB  1 
ATOM   3121 O OG  . SER C 3 7   ? 37.568  35.733  -52.306 1.00 76.45  ? 7   SER E OG  1 
ATOM   3122 N N   . GLY C 3 8   ? 38.559  36.926  -55.985 1.00 71.52  ? 8   GLY E N   1 
ATOM   3123 C CA  . GLY C 3 8   ? 39.810  36.974  -56.737 1.00 70.60  ? 8   GLY E CA  1 
ATOM   3124 C C   . GLY C 3 8   ? 41.088  36.760  -55.946 1.00 74.78  ? 8   GLY E C   1 
ATOM   3125 O O   . GLY C 3 8   ? 41.080  36.722  -54.713 1.00 73.23  ? 8   GLY E O   1 
ATOM   3126 N N   . ALA C 3 9   ? 42.211  36.641  -56.684 1.00 73.84  ? 9   ALA E N   1 
ATOM   3127 C CA  . ALA C 3 9   ? 43.551  36.363  -56.173 1.00 73.89  ? 9   ALA E CA  1 
ATOM   3128 C C   . ALA C 3 9   ? 44.071  37.461  -55.285 1.00 78.06  ? 9   ALA E C   1 
ATOM   3129 O O   . ALA C 3 9   ? 44.210  38.598  -55.716 1.00 77.55  ? 9   ALA E O   1 
ATOM   3130 C CB  . ALA C 3 9   ? 44.505  36.099  -57.319 1.00 74.63  ? 9   ALA E CB  1 
ATOM   3131 N N   . GLU C 3 10  ? 44.317  37.107  -54.025 1.00 75.36  ? 10  GLU E N   1 
ATOM   3132 C CA  . GLU C 3 10  ? 44.789  37.971  -52.957 1.00 75.02  ? 10  GLU E CA  1 
ATOM   3133 C C   . GLU C 3 10  ? 46.256  37.777  -52.753 1.00 78.19  ? 10  GLU E C   1 
ATOM   3134 O O   . GLU C 3 10  ? 46.767  36.666  -52.839 1.00 76.56  ? 10  GLU E O   1 
ATOM   3135 C CB  . GLU C 3 10  ? 44.031  37.655  -51.643 1.00 76.83  ? 10  GLU E CB  1 
ATOM   3136 C CG  . GLU C 3 10  ? 42.849  38.587  -51.362 1.00 92.83  ? 10  GLU E CG  1 
ATOM   3137 C CD  . GLU C 3 10  ? 41.506  37.948  -51.034 1.00 129.00 ? 10  GLU E CD  1 
ATOM   3138 O OE1 . GLU C 3 10  ? 41.431  36.699  -50.932 1.00 121.47 ? 10  GLU E OE1 1 
ATOM   3139 O OE2 . GLU C 3 10  ? 40.520  38.708  -50.880 1.00 130.28 ? 10  GLU E OE2 1 
ATOM   3140 N N   . VAL C 3 11  ? 46.940  38.858  -52.499 1.00 78.54  ? 11  VAL E N   1 
ATOM   3141 C CA  . VAL C 3 11  ? 48.374  38.846  -52.210 1.00 80.44  ? 11  VAL E CA  1 
ATOM   3142 C C   . VAL C 3 11  ? 48.493  39.252  -50.747 1.00 86.30  ? 11  VAL E C   1 
ATOM   3143 O O   . VAL C 3 11  ? 47.970  40.306  -50.365 1.00 85.43  ? 11  VAL E O   1 
ATOM   3144 C CB  . VAL C 3 11  ? 49.145  39.824  -53.122 1.00 85.10  ? 11  VAL E CB  1 
ATOM   3145 C CG1 . VAL C 3 11  ? 50.636  39.887  -52.759 1.00 84.64  ? 11  VAL E CG1 1 
ATOM   3146 C CG2 . VAL C 3 11  ? 48.934  39.474  -54.593 1.00 85.42  ? 11  VAL E CG2 1 
ATOM   3147 N N   . LYS C 3 12  ? 49.152  38.418  -49.925 1.00 83.37  ? 12  LYS E N   1 
ATOM   3148 C CA  . LYS C 3 12  ? 49.285  38.734  -48.512 1.00 83.17  ? 12  LYS E CA  1 
ATOM   3149 C C   . LYS C 3 12  ? 50.724  38.659  -48.006 1.00 86.54  ? 12  LYS E C   1 
ATOM   3150 O O   . LYS C 3 12  ? 51.539  37.881  -48.514 1.00 84.17  ? 12  LYS E O   1 
ATOM   3151 C CB  . LYS C 3 12  ? 48.330  37.885  -47.648 1.00 85.56  ? 12  LYS E CB  1 
ATOM   3152 C CG  . LYS C 3 12  ? 46.853  38.294  -47.729 1.00 94.85  ? 12  LYS E CG  1 
ATOM   3153 C CD  . LYS C 3 12  ? 46.499  39.549  -46.906 1.00 102.62 ? 12  LYS E CD  1 
ATOM   3154 C CE  . LYS C 3 12  ? 45.161  40.121  -47.318 1.00 111.48 ? 12  LYS E CE  1 
ATOM   3155 N NZ  . LYS C 3 12  ? 45.238  40.922  -48.570 1.00 122.99 ? 12  LYS E NZ  1 
ATOM   3156 N N   . LYS C 3 13  ? 51.030  39.535  -47.031 1.00 84.71  ? 13  LYS E N   1 
ATOM   3157 C CA  . LYS C 3 13  ? 52.322  39.609  -46.361 1.00 85.02  ? 13  LYS E CA  1 
ATOM   3158 C C   . LYS C 3 13  ? 52.287  38.585  -45.211 1.00 91.46  ? 13  LYS E C   1 
ATOM   3159 O O   . LYS C 3 13  ? 51.184  38.171  -44.818 1.00 91.47  ? 13  LYS E O   1 
ATOM   3160 C CB  . LYS C 3 13  ? 52.599  41.038  -45.866 1.00 86.38  ? 13  LYS E CB  1 
ATOM   3161 C CG  . LYS C 3 13  ? 52.738  42.063  -46.992 1.00 96.13  ? 13  LYS E CG  1 
ATOM   3162 C CD  . LYS C 3 13  ? 54.185  42.217  -47.502 1.00 108.97 ? 13  LYS E CD  1 
ATOM   3163 C CE  . LYS C 3 13  ? 54.333  43.274  -48.581 1.00 124.99 ? 13  LYS E CE  1 
ATOM   3164 N NZ  . LYS C 3 13  ? 53.593  42.928  -49.832 1.00 140.94 ? 13  LYS E NZ  1 
ATOM   3165 N N   . PRO C 3 14  ? 53.442  38.084  -44.706 1.00 88.09  ? 14  PRO E N   1 
ATOM   3166 C CA  . PRO C 3 14  ? 53.376  37.061  -43.648 1.00 87.83  ? 14  PRO E CA  1 
ATOM   3167 C C   . PRO C 3 14  ? 52.935  37.590  -42.285 1.00 92.58  ? 14  PRO E C   1 
ATOM   3168 O O   . PRO C 3 14  ? 53.524  38.532  -41.755 1.00 93.67  ? 14  PRO E O   1 
ATOM   3169 C CB  . PRO C 3 14  ? 54.778  36.462  -43.640 1.00 89.49  ? 14  PRO E CB  1 
ATOM   3170 C CG  . PRO C 3 14  ? 55.649  37.541  -44.146 1.00 93.93  ? 14  PRO E CG  1 
ATOM   3171 C CD  . PRO C 3 14  ? 54.839  38.397  -45.068 1.00 89.36  ? 14  PRO E CD  1 
ATOM   3172 N N   . GLY C 3 15  ? 51.891  36.985  -41.740 1.00 88.62  ? 15  GLY E N   1 
ATOM   3173 C CA  . GLY C 3 15  ? 51.317  37.388  -40.463 1.00 88.37  ? 15  GLY E CA  1 
ATOM   3174 C C   . GLY C 3 15  ? 49.969  38.059  -40.626 1.00 91.53  ? 15  GLY E C   1 
ATOM   3175 O O   . GLY C 3 15  ? 49.251  38.279  -39.646 1.00 91.56  ? 15  GLY E O   1 
ATOM   3176 N N   . ALA C 3 16  ? 49.609  38.362  -41.873 1.00 87.20  ? 16  ALA E N   1 
ATOM   3177 C CA  . ALA C 3 16  ? 48.344  38.984  -42.228 1.00 87.01  ? 16  ALA E CA  1 
ATOM   3178 C C   . ALA C 3 16  ? 47.159  37.991  -42.171 1.00 91.97  ? 16  ALA E C   1 
ATOM   3179 O O   . ALA C 3 16  ? 47.320  36.796  -41.882 1.00 92.53  ? 16  ALA E O   1 
ATOM   3180 C CB  . ALA C 3 16  ? 48.450  39.599  -43.616 1.00 87.81  ? 16  ALA E CB  1 
ATOM   3181 N N   . SER C 3 17  ? 45.961  38.518  -42.432 1.00 87.08  ? 17  SER E N   1 
ATOM   3182 C CA  . SER C 3 17  ? 44.714  37.775  -42.463 1.00 85.60  ? 17  SER E CA  1 
ATOM   3183 C C   . SER C 3 17  ? 44.196  37.877  -43.866 1.00 85.23  ? 17  SER E C   1 
ATOM   3184 O O   . SER C 3 17  ? 44.277  38.945  -44.464 1.00 86.16  ? 17  SER E O   1 
ATOM   3185 C CB  . SER C 3 17  ? 43.700  38.408  -41.506 1.00 89.91  ? 17  SER E CB  1 
ATOM   3186 O OG  . SER C 3 17  ? 42.443  37.746  -41.505 1.00 98.59  ? 17  SER E OG  1 
ATOM   3187 N N   . VAL C 3 18  ? 43.639  36.787  -44.380 1.00 77.95  ? 18  VAL E N   1 
ATOM   3188 C CA  . VAL C 3 18  ? 43.029  36.724  -45.705 1.00 76.34  ? 18  VAL E CA  1 
ATOM   3189 C C   . VAL C 3 18  ? 41.594  36.177  -45.563 1.00 80.44  ? 18  VAL E C   1 
ATOM   3190 O O   . VAL C 3 18  ? 41.399  35.142  -44.915 1.00 81.38  ? 18  VAL E O   1 
ATOM   3191 C CB  . VAL C 3 18  ? 43.915  35.908  -46.694 1.00 79.07  ? 18  VAL E CB  1 
ATOM   3192 C CG1 . VAL C 3 18  ? 44.034  34.436  -46.300 1.00 78.52  ? 18  VAL E CG1 1 
ATOM   3193 C CG2 . VAL C 3 18  ? 43.442  36.047  -48.126 1.00 78.76  ? 18  VAL E CG2 1 
ATOM   3194 N N   . LYS C 3 19  ? 40.593  36.902  -46.094 1.00 74.79  ? 19  LYS E N   1 
ATOM   3195 C CA  . LYS C 3 19  ? 39.211  36.418  -46.080 1.00 73.35  ? 19  LYS E CA  1 
ATOM   3196 C C   . LYS C 3 19  ? 38.772  36.217  -47.524 1.00 78.04  ? 19  LYS E C   1 
ATOM   3197 O O   . LYS C 3 19  ? 38.715  37.194  -48.289 1.00 78.47  ? 19  LYS E O   1 
ATOM   3198 C CB  . LYS C 3 19  ? 38.232  37.313  -45.289 1.00 73.74  ? 19  LYS E CB  1 
ATOM   3199 C CG  . LYS C 3 19  ? 36.894  36.623  -45.004 1.00 70.91  ? 19  LYS E CG  1 
ATOM   3200 C CD  . LYS C 3 19  ? 35.842  37.561  -44.485 1.00 83.24  ? 19  LYS E CD  1 
ATOM   3201 C CE  . LYS C 3 19  ? 35.316  37.154  -43.115 1.00 95.91  ? 19  LYS E CE  1 
ATOM   3202 N NZ  . LYS C 3 19  ? 34.008  37.800  -42.767 1.00 91.49  ? 19  LYS E NZ  1 
ATOM   3203 N N   . VAL C 3 20  ? 38.505  34.936  -47.889 1.00 73.80  ? 20  VAL E N   1 
ATOM   3204 C CA  . VAL C 3 20  ? 38.091  34.470  -49.222 1.00 73.50  ? 20  VAL E CA  1 
ATOM   3205 C C   . VAL C 3 20  ? 36.605  34.143  -49.259 1.00 77.24  ? 20  VAL E C   1 
ATOM   3206 O O   . VAL C 3 20  ? 36.141  33.288  -48.507 1.00 75.29  ? 20  VAL E O   1 
ATOM   3207 C CB  . VAL C 3 20  ? 38.940  33.263  -49.691 1.00 77.20  ? 20  VAL E CB  1 
ATOM   3208 C CG1 . VAL C 3 20  ? 38.411  32.677  -51.000 1.00 76.44  ? 20  VAL E CG1 1 
ATOM   3209 C CG2 . VAL C 3 20  ? 40.408  33.650  -49.825 1.00 77.43  ? 20  VAL E CG2 1 
ATOM   3210 N N   . SER C 3 21  ? 35.874  34.793  -50.177 1.00 75.69  ? 21  SER E N   1 
ATOM   3211 C CA  . SER C 3 21  ? 34.431  34.599  -50.341 1.00 75.64  ? 21  SER E CA  1 
ATOM   3212 C C   . SER C 3 21  ? 34.155  33.511  -51.344 1.00 80.50  ? 21  SER E C   1 
ATOM   3213 O O   . SER C 3 21  ? 34.996  33.219  -52.202 1.00 80.44  ? 21  SER E O   1 
ATOM   3214 C CB  . SER C 3 21  ? 33.753  35.891  -50.804 1.00 78.08  ? 21  SER E CB  1 
ATOM   3215 O OG  . SER C 3 21  ? 33.585  35.928  -52.214 1.00 84.04  ? 21  SER E OG  1 
ATOM   3216 N N   . CYS C 3 22  ? 32.931  32.985  -51.290 1.00 76.87  ? 22  CYS E N   1 
ATOM   3217 C CA  . CYS C 3 22  ? 32.428  31.961  -52.182 1.00 76.64  ? 22  CYS E CA  1 
ATOM   3218 C C   . CYS C 3 22  ? 30.895  32.091  -52.338 1.00 76.54  ? 22  CYS E C   1 
ATOM   3219 O O   . CYS C 3 22  ? 30.118  31.841  -51.394 1.00 72.84  ? 22  CYS E O   1 
ATOM   3220 C CB  . CYS C 3 22  ? 32.845  30.588  -51.673 1.00 78.18  ? 22  CYS E CB  1 
ATOM   3221 S SG  . CYS C 3 22  ? 32.149  29.222  -52.610 1.00 83.31  ? 22  CYS E SG  1 
ATOM   3222 N N   . LYS C 3 23  ? 30.472  32.535  -53.534 1.00 72.43  ? 23  LYS E N   1 
ATOM   3223 C CA  . LYS C 3 23  ? 29.056  32.713  -53.834 1.00 70.88  ? 23  LYS E CA  1 
ATOM   3224 C C   . LYS C 3 23  ? 28.462  31.464  -54.467 1.00 71.93  ? 23  LYS E C   1 
ATOM   3225 O O   . LYS C 3 23  ? 28.907  31.037  -55.529 1.00 72.56  ? 23  LYS E O   1 
ATOM   3226 C CB  . LYS C 3 23  ? 28.806  33.999  -54.663 1.00 71.86  ? 23  LYS E CB  1 
ATOM   3227 C CG  . LYS C 3 23  ? 27.448  34.094  -55.386 1.00 71.13  ? 23  LYS E CG  1 
ATOM   3228 C CD  . LYS C 3 23  ? 26.251  34.377  -54.496 1.00 75.20  ? 23  LYS E CD  1 
ATOM   3229 C CE  . LYS C 3 23  ? 24.995  34.372  -55.334 1.00 96.81  ? 23  LYS E CE  1 
ATOM   3230 N NZ  . LYS C 3 23  ? 23.795  34.794  -54.560 1.00 111.03 ? 23  LYS E NZ  1 
ATOM   3231 N N   . ALA C 3 24  ? 27.456  30.895  -53.800 1.00 67.01  ? 24  ALA E N   1 
ATOM   3232 C CA  . ALA C 3 24  ? 26.718  29.698  -54.226 1.00 67.12  ? 24  ALA E CA  1 
ATOM   3233 C C   . ALA C 3 24  ? 25.459  30.074  -55.006 1.00 70.86  ? 24  ALA E C   1 
ATOM   3234 O O   . ALA C 3 24  ? 24.669  30.915  -54.557 1.00 71.44  ? 24  ALA E O   1 
ATOM   3235 C CB  . ALA C 3 24  ? 26.337  28.862  -53.017 1.00 67.67  ? 24  ALA E CB  1 
ATOM   3236 N N   . SER C 3 25  ? 25.276  29.450  -56.173 1.00 66.29  ? 25  SER E N   1 
ATOM   3237 C CA  . SER C 3 25  ? 24.141  29.709  -57.052 1.00 66.77  ? 25  SER E CA  1 
ATOM   3238 C C   . SER C 3 25  ? 23.758  28.468  -57.878 1.00 72.90  ? 25  SER E C   1 
ATOM   3239 O O   . SER C 3 25  ? 24.608  27.631  -58.192 1.00 72.64  ? 25  SER E O   1 
ATOM   3240 C CB  . SER C 3 25  ? 24.410  30.925  -57.939 1.00 70.58  ? 25  SER E CB  1 
ATOM   3241 O OG  . SER C 3 25  ? 25.729  30.932  -58.465 1.00 81.41  ? 25  SER E OG  1 
ATOM   3242 N N   . GLY C 3 26  ? 22.478  28.344  -58.193 1.00 70.29  ? 26  GLY E N   1 
ATOM   3243 C CA  . GLY C 3 26  ? 22.002  27.195  -58.948 1.00 71.23  ? 26  GLY E CA  1 
ATOM   3244 C C   . GLY C 3 26  ? 21.473  26.085  -58.057 1.00 76.69  ? 26  GLY E C   1 
ATOM   3245 O O   . GLY C 3 26  ? 20.809  25.146  -58.540 1.00 77.07  ? 26  GLY E O   1 
ATOM   3246 N N   . TYR C 3 27  ? 21.749  26.210  -56.730 1.00 71.75  ? 27  TYR E N   1 
ATOM   3247 C CA  . TYR C 3 27  ? 21.272  25.292  -55.703 1.00 70.42  ? 27  TYR E CA  1 
ATOM   3248 C C   . TYR C 3 27  ? 20.942  26.020  -54.390 1.00 74.04  ? 27  TYR E C   1 
ATOM   3249 O O   . TYR C 3 27  ? 21.337  27.187  -54.191 1.00 72.35  ? 27  TYR E O   1 
ATOM   3250 C CB  . TYR C 3 27  ? 22.262  24.165  -55.480 1.00 70.42  ? 27  TYR E CB  1 
ATOM   3251 C CG  . TYR C 3 27  ? 23.500  24.610  -54.746 1.00 72.06  ? 27  TYR E CG  1 
ATOM   3252 C CD1 . TYR C 3 27  ? 24.533  25.266  -55.410 1.00 73.63  ? 27  TYR E CD1 1 
ATOM   3253 C CD2 . TYR C 3 27  ? 23.642  24.376  -53.376 1.00 73.10  ? 27  TYR E CD2 1 
ATOM   3254 C CE1 . TYR C 3 27  ? 25.689  25.658  -54.742 1.00 73.82  ? 27  TYR E CE1 1 
ATOM   3255 C CE2 . TYR C 3 27  ? 24.794  24.765  -52.692 1.00 74.15  ? 27  TYR E CE2 1 
ATOM   3256 C CZ  . TYR C 3 27  ? 25.817  25.403  -53.385 1.00 80.57  ? 27  TYR E CZ  1 
ATOM   3257 O OH  . TYR C 3 27  ? 26.959  25.783  -52.732 1.00 79.13  ? 27  TYR E OH  1 
ATOM   3258 N N   . THR C 3 28  ? 20.227  25.287  -53.491 1.00 70.30  ? 28  THR E N   1 
ATOM   3259 C CA  . THR C 3 28  ? 19.736  25.722  -52.181 1.00 69.01  ? 28  THR E CA  1 
ATOM   3260 C C   . THR C 3 28  ? 20.875  25.663  -51.161 1.00 72.11  ? 28  THR E C   1 
ATOM   3261 O O   . THR C 3 28  ? 21.214  24.600  -50.629 1.00 70.58  ? 28  THR E O   1 
ATOM   3262 C CB  . THR C 3 28  ? 18.463  24.940  -51.815 1.00 73.54  ? 28  THR E CB  1 
ATOM   3263 O OG1 . THR C 3 28  ? 17.466  25.195  -52.807 1.00 70.61  ? 28  THR E OG1 1 
ATOM   3264 C CG2 . THR C 3 28  ? 17.925  25.289  -50.429 1.00 71.55  ? 28  THR E CG2 1 
ATOM   3265 N N   . PHE C 3 29  ? 21.477  26.836  -50.923 1.00 69.17  ? 29  PHE E N   1 
ATOM   3266 C CA  . PHE C 3 29  ? 22.627  27.041  -50.045 1.00 68.40  ? 29  PHE E CA  1 
ATOM   3267 C C   . PHE C 3 29  ? 22.588  26.230  -48.732 1.00 73.59  ? 29  PHE E C   1 
ATOM   3268 O O   . PHE C 3 29  ? 23.506  25.447  -48.485 1.00 73.14  ? 29  PHE E O   1 
ATOM   3269 C CB  . PHE C 3 29  ? 22.812  28.533  -49.774 1.00 69.31  ? 29  PHE E CB  1 
ATOM   3270 C CG  . PHE C 3 29  ? 24.102  28.928  -49.105 1.00 70.29  ? 29  PHE E CG  1 
ATOM   3271 C CD1 . PHE C 3 29  ? 25.326  28.642  -49.698 1.00 73.46  ? 29  PHE E CD1 1 
ATOM   3272 C CD2 . PHE C 3 29  ? 24.092  29.680  -47.937 1.00 72.45  ? 29  PHE E CD2 1 
ATOM   3273 C CE1 . PHE C 3 29  ? 26.520  29.067  -49.116 1.00 74.70  ? 29  PHE E CE1 1 
ATOM   3274 C CE2 . PHE C 3 29  ? 25.281  30.087  -47.340 1.00 75.82  ? 29  PHE E CE2 1 
ATOM   3275 C CZ  . PHE C 3 29  ? 26.490  29.777  -47.932 1.00 74.51  ? 29  PHE E CZ  1 
ATOM   3276 N N   . THR C 3 30  ? 21.531  26.406  -47.922 1.00 71.38  ? 30  THR E N   1 
ATOM   3277 C CA  . THR C 3 30  ? 21.357  25.775  -46.608 1.00 71.79  ? 30  THR E CA  1 
ATOM   3278 C C   . THR C 3 30  ? 21.345  24.254  -46.632 1.00 76.10  ? 30  THR E C   1 
ATOM   3279 O O   . THR C 3 30  ? 21.901  23.621  -45.718 1.00 74.39  ? 30  THR E O   1 
ATOM   3280 C CB  . THR C 3 30  ? 20.114  26.312  -45.931 1.00 83.08  ? 30  THR E CB  1 
ATOM   3281 O OG1 . THR C 3 30  ? 19.031  26.274  -46.859 1.00 87.38  ? 30  THR E OG1 1 
ATOM   3282 C CG2 . THR C 3 30  ? 20.310  27.708  -45.412 1.00 81.93  ? 30  THR E CG2 1 
ATOM   3283 N N   . SER C 3 31  ? 20.729  23.682  -47.694 1.00 73.98  ? 31  SER E N   1 
ATOM   3284 C CA  . SER C 3 31  ? 20.573  22.239  -47.954 1.00 73.88  ? 31  SER E CA  1 
ATOM   3285 C C   . SER C 3 31  ? 21.889  21.445  -48.063 1.00 75.06  ? 31  SER E C   1 
ATOM   3286 O O   . SER C 3 31  ? 21.847  20.216  -48.061 1.00 76.87  ? 31  SER E O   1 
ATOM   3287 C CB  . SER C 3 31  ? 19.746  22.006  -49.222 1.00 78.50  ? 31  SER E CB  1 
ATOM   3288 O OG  . SER C 3 31  ? 18.348  22.085  -49.004 1.00 88.95  ? 31  SER E OG  1 
ATOM   3289 N N   . PHE C 3 32  ? 23.035  22.122  -48.183 1.00 67.32  ? 32  PHE E N   1 
ATOM   3290 C CA  . PHE C 3 32  ? 24.328  21.469  -48.326 1.00 66.32  ? 32  PHE E CA  1 
ATOM   3291 C C   . PHE C 3 32  ? 25.368  22.087  -47.432 1.00 72.98  ? 32  PHE E C   1 
ATOM   3292 O O   . PHE C 3 32  ? 25.166  23.169  -46.852 1.00 74.10  ? 32  PHE E O   1 
ATOM   3293 C CB  . PHE C 3 32  ? 24.821  21.569  -49.768 1.00 67.83  ? 32  PHE E CB  1 
ATOM   3294 C CG  . PHE C 3 32  ? 23.854  21.056  -50.794 1.00 68.98  ? 32  PHE E CG  1 
ATOM   3295 C CD1 . PHE C 3 32  ? 22.839  21.874  -51.288 1.00 70.36  ? 32  PHE E CD1 1 
ATOM   3296 C CD2 . PHE C 3 32  ? 23.965  19.758  -51.286 1.00 70.36  ? 32  PHE E CD2 1 
ATOM   3297 C CE1 . PHE C 3 32  ? 21.939  21.399  -52.236 1.00 70.55  ? 32  PHE E CE1 1 
ATOM   3298 C CE2 . PHE C 3 32  ? 23.080  19.292  -52.251 1.00 72.53  ? 32  PHE E CE2 1 
ATOM   3299 C CZ  . PHE C 3 32  ? 22.084  20.126  -52.737 1.00 70.00  ? 32  PHE E CZ  1 
ATOM   3300 N N   . THR C 3 33  ? 26.525  21.425  -47.387 1.00 69.99  ? 33  THR E N   1 
ATOM   3301 C CA  . THR C 3 33  ? 27.677  21.804  -46.581 1.00 69.92  ? 33  THR E CA  1 
ATOM   3302 C C   . THR C 3 33  ? 28.659  22.601  -47.418 1.00 70.88  ? 33  THR E C   1 
ATOM   3303 O O   . THR C 3 33  ? 28.671  22.427  -48.628 1.00 70.55  ? 33  THR E O   1 
ATOM   3304 C CB  . THR C 3 33  ? 28.290  20.527  -45.993 1.00 79.03  ? 33  THR E CB  1 
ATOM   3305 O OG1 . THR C 3 33  ? 27.220  19.735  -45.508 1.00 77.65  ? 33  THR E OG1 1 
ATOM   3306 C CG2 . THR C 3 33  ? 29.189  20.802  -44.841 1.00 81.43  ? 33  THR E CG2 1 
ATOM   3307 N N   . MET C 3 34  ? 29.459  23.475  -46.785 1.00 65.96  ? 34  MET E N   1 
ATOM   3308 C CA  . MET C 3 34  ? 30.499  24.216  -47.476 1.00 66.45  ? 34  MET E CA  1 
ATOM   3309 C C   . MET C 3 34  ? 31.844  23.911  -46.864 1.00 67.12  ? 34  MET E C   1 
ATOM   3310 O O   . MET C 3 34  ? 32.114  24.282  -45.733 1.00 65.66  ? 34  MET E O   1 
ATOM   3311 C CB  . MET C 3 34  ? 30.215  25.729  -47.536 1.00 70.05  ? 34  MET E CB  1 
ATOM   3312 C CG  . MET C 3 34  ? 30.896  26.447  -48.718 1.00 75.53  ? 34  MET E CG  1 
ATOM   3313 S SD  . MET C 3 34  ? 30.341  26.045  -50.421 1.00 81.79  ? 34  MET E SD  1 
ATOM   3314 C CE  . MET C 3 34  ? 28.534  25.846  -50.138 1.00 78.51  ? 34  MET E CE  1 
ATOM   3315 N N   . HIS C 3 35  ? 32.664  23.194  -47.605 1.00 63.53  ? 35  HIS E N   1 
ATOM   3316 C CA  . HIS C 3 35  ? 34.008  22.834  -47.195 1.00 63.36  ? 35  HIS E CA  1 
ATOM   3317 C C   . HIS C 3 35  ? 35.056  23.721  -47.893 1.00 70.15  ? 35  HIS E C   1 
ATOM   3318 O O   . HIS C 3 35  ? 34.791  24.329  -48.938 1.00 69.92  ? 35  HIS E O   1 
ATOM   3319 C CB  . HIS C 3 35  ? 34.272  21.356  -47.482 1.00 63.46  ? 35  HIS E CB  1 
ATOM   3320 C CG  . HIS C 3 35  ? 33.420  20.400  -46.691 1.00 66.75  ? 35  HIS E CG  1 
ATOM   3321 N ND1 . HIS C 3 35  ? 33.987  19.462  -45.831 1.00 67.96  ? 35  HIS E ND1 1 
ATOM   3322 C CD2 . HIS C 3 35  ? 32.075  20.239  -46.680 1.00 68.34  ? 35  HIS E CD2 1 
ATOM   3323 C CE1 . HIS C 3 35  ? 32.977  18.777  -45.336 1.00 67.45  ? 35  HIS E CE1 1 
ATOM   3324 N NE2 . HIS C 3 35  ? 31.809  19.202  -45.818 1.00 68.06  ? 35  HIS E NE2 1 
ATOM   3325 N N   . TRP C 3 36  ? 36.226  23.844  -47.270 1.00 67.45  ? 36  TRP E N   1 
ATOM   3326 C CA  . TRP C 3 36  ? 37.337  24.604  -47.822 1.00 67.24  ? 36  TRP E CA  1 
ATOM   3327 C C   . TRP C 3 36  ? 38.508  23.674  -47.865 1.00 70.87  ? 36  TRP E C   1 
ATOM   3328 O O   . TRP C 3 36  ? 38.826  23.042  -46.845 1.00 69.98  ? 36  TRP E O   1 
ATOM   3329 C CB  . TRP C 3 36  ? 37.647  25.822  -46.977 1.00 66.23  ? 36  TRP E CB  1 
ATOM   3330 C CG  . TRP C 3 36  ? 36.659  26.913  -47.202 1.00 67.58  ? 36  TRP E CG  1 
ATOM   3331 C CD1 . TRP C 3 36  ? 35.462  27.086  -46.571 1.00 70.24  ? 36  TRP E CD1 1 
ATOM   3332 C CD2 . TRP C 3 36  ? 36.743  27.940  -48.193 1.00 67.52  ? 36  TRP E CD2 1 
ATOM   3333 N NE1 . TRP C 3 36  ? 34.822  28.197  -47.071 1.00 69.53  ? 36  TRP E NE1 1 
ATOM   3334 C CE2 . TRP C 3 36  ? 35.582  28.732  -48.077 1.00 70.95  ? 36  TRP E CE2 1 
ATOM   3335 C CE3 . TRP C 3 36  ? 37.683  28.256  -49.184 1.00 68.42  ? 36  TRP E CE3 1 
ATOM   3336 C CZ2 . TRP C 3 36  ? 35.334  29.812  -48.917 1.00 70.14  ? 36  TRP E CZ2 1 
ATOM   3337 C CZ3 . TRP C 3 36  ? 37.414  29.302  -50.038 1.00 69.86  ? 36  TRP E CZ3 1 
ATOM   3338 C CH2 . TRP C 3 36  ? 36.250  30.062  -49.903 1.00 70.39  ? 36  TRP E CH2 1 
ATOM   3339 N N   . VAL C 3 37  ? 39.072  23.501  -49.074 1.00 66.12  ? 37  VAL E N   1 
ATOM   3340 C CA  . VAL C 3 37  ? 40.204  22.621  -49.332 1.00 65.96  ? 37  VAL E CA  1 
ATOM   3341 C C   . VAL C 3 37  ? 41.212  23.480  -50.043 1.00 68.64  ? 37  VAL E C   1 
ATOM   3342 O O   . VAL C 3 37  ? 40.788  24.324  -50.829 1.00 68.50  ? 37  VAL E O   1 
ATOM   3343 C CB  . VAL C 3 37  ? 39.764  21.388  -50.184 1.00 70.15  ? 37  VAL E CB  1 
ATOM   3344 C CG1 . VAL C 3 37  ? 40.953  20.522  -50.615 1.00 69.52  ? 37  VAL E CG1 1 
ATOM   3345 C CG2 . VAL C 3 37  ? 38.729  20.545  -49.442 1.00 69.93  ? 37  VAL E CG2 1 
ATOM   3346 N N   . ARG C 3 38  ? 42.522  23.317  -49.745 1.00 64.91  ? 38  ARG E N   1 
ATOM   3347 C CA  . ARG C 3 38  ? 43.580  24.097  -50.399 1.00 65.55  ? 38  ARG E CA  1 
ATOM   3348 C C   . ARG C 3 38  ? 44.570  23.205  -51.093 1.00 73.25  ? 38  ARG E C   1 
ATOM   3349 O O   . ARG C 3 38  ? 44.659  22.015  -50.776 1.00 74.34  ? 38  ARG E O   1 
ATOM   3350 C CB  . ARG C 3 38  ? 44.320  25.006  -49.418 1.00 64.38  ? 38  ARG E CB  1 
ATOM   3351 C CG  . ARG C 3 38  ? 45.269  24.279  -48.460 1.00 65.42  ? 38  ARG E CG  1 
ATOM   3352 C CD  . ARG C 3 38  ? 46.264  25.250  -47.867 1.00 68.44  ? 38  ARG E CD  1 
ATOM   3353 N NE  . ARG C 3 38  ? 47.145  24.652  -46.862 1.00 65.60  ? 38  ARG E NE  1 
ATOM   3354 C CZ  . ARG C 3 38  ? 47.650  25.324  -45.830 1.00 84.48  ? 38  ARG E CZ  1 
ATOM   3355 N NH1 . ARG C 3 38  ? 48.468  24.726  -44.975 1.00 77.70  ? 38  ARG E NH1 1 
ATOM   3356 N NH2 . ARG C 3 38  ? 47.346  26.605  -45.647 1.00 70.32  ? 38  ARG E NH2 1 
ATOM   3357 N N   . GLN C 3 39  ? 45.371  23.770  -52.002 1.00 71.53  ? 39  GLN E N   1 
ATOM   3358 C CA  . GLN C 3 39  ? 46.403  22.972  -52.677 1.00 71.71  ? 39  GLN E CA  1 
ATOM   3359 C C   . GLN C 3 39  ? 47.687  23.800  -52.868 1.00 79.39  ? 39  GLN E C   1 
ATOM   3360 O O   . GLN C 3 39  ? 47.679  24.830  -53.551 1.00 79.09  ? 39  GLN E O   1 
ATOM   3361 C CB  . GLN C 3 39  ? 45.849  22.408  -53.974 1.00 71.99  ? 39  GLN E CB  1 
ATOM   3362 C CG  . GLN C 3 39  ? 46.818  21.590  -54.753 1.00 68.49  ? 39  GLN E CG  1 
ATOM   3363 C CD  . GLN C 3 39  ? 46.221  21.239  -56.072 1.00 78.57  ? 39  GLN E CD  1 
ATOM   3364 O OE1 . GLN C 3 39  ? 45.687  22.085  -56.790 1.00 86.49  ? 39  GLN E OE1 1 
ATOM   3365 N NE2 . GLN C 3 39  ? 46.306  19.993  -56.430 1.00 53.33  ? 39  GLN E NE2 1 
ATOM   3366 N N   . ALA C 3 40  ? 48.759  23.383  -52.196 1.00 78.82  ? 40  ALA E N   1 
ATOM   3367 C CA  . ALA C 3 40  ? 50.031  24.097  -52.223 1.00 80.63  ? 40  ALA E CA  1 
ATOM   3368 C C   . ALA C 3 40  ? 50.727  24.012  -53.600 1.00 86.18  ? 40  ALA E C   1 
ATOM   3369 O O   . ALA C 3 40  ? 50.455  23.056  -54.325 1.00 85.71  ? 40  ALA E O   1 
ATOM   3370 C CB  . ALA C 3 40  ? 50.935  23.549  -51.136 1.00 81.98  ? 40  ALA E CB  1 
ATOM   3371 N N   . PRO C 3 41  ? 51.605  24.972  -54.013 1.00 84.44  ? 41  PRO E N   1 
ATOM   3372 C CA  . PRO C 3 41  ? 52.232  24.839  -55.338 1.00 85.23  ? 41  PRO E CA  1 
ATOM   3373 C C   . PRO C 3 41  ? 52.963  23.513  -55.423 1.00 91.28  ? 41  PRO E C   1 
ATOM   3374 O O   . PRO C 3 41  ? 53.627  23.111  -54.457 1.00 90.74  ? 41  PRO E O   1 
ATOM   3375 C CB  . PRO C 3 41  ? 53.178  26.043  -55.434 1.00 86.80  ? 41  PRO E CB  1 
ATOM   3376 C CG  . PRO C 3 41  ? 52.683  27.004  -54.416 1.00 90.80  ? 41  PRO E CG  1 
ATOM   3377 C CD  . PRO C 3 41  ? 52.084  26.185  -53.317 1.00 85.96  ? 41  PRO E CD  1 
ATOM   3378 N N   . GLY C 3 42  ? 52.702  22.797  -56.517 1.00 88.84  ? 42  GLY E N   1 
ATOM   3379 C CA  . GLY C 3 42  ? 53.265  21.480  -56.783 1.00 88.57  ? 42  GLY E CA  1 
ATOM   3380 C C   . GLY C 3 42  ? 53.024  20.483  -55.666 1.00 91.60  ? 42  GLY E C   1 
ATOM   3381 O O   . GLY C 3 42  ? 53.955  19.775  -55.262 1.00 90.90  ? 42  GLY E O   1 
ATOM   3382 N N   . GLN C 3 43  ? 51.768  20.451  -55.141 1.00 86.90  ? 43  GLN E N   1 
ATOM   3383 C CA  . GLN C 3 43  ? 51.357  19.558  -54.053 1.00 85.67  ? 43  GLN E CA  1 
ATOM   3384 C C   . GLN C 3 43  ? 49.927  19.030  -54.188 1.00 85.02  ? 43  GLN E C   1 
ATOM   3385 O O   . GLN C 3 43  ? 49.202  19.413  -55.106 1.00 83.97  ? 43  GLN E O   1 
ATOM   3386 C CB  . GLN C 3 43  ? 51.578  20.226  -52.693 1.00 87.23  ? 43  GLN E CB  1 
ATOM   3387 C CG  . GLN C 3 43  ? 52.969  19.953  -52.134 1.00 113.49 ? 43  GLN E CG  1 
ATOM   3388 C CD  . GLN C 3 43  ? 53.291  20.819  -50.953 1.00 141.22 ? 43  GLN E CD  1 
ATOM   3389 O OE1 . GLN C 3 43  ? 52.609  20.779  -49.927 1.00 140.05 ? 43  GLN E OE1 1 
ATOM   3390 N NE2 . GLN C 3 43  ? 54.342  21.619  -51.067 1.00 134.00 ? 43  GLN E NE2 1 
ATOM   3391 N N   . GLY C 3 44  ? 49.568  18.115  -53.293 1.00 78.84  ? 44  GLY E N   1 
ATOM   3392 C CA  . GLY C 3 44  ? 48.252  17.494  -53.241 1.00 77.60  ? 44  GLY E CA  1 
ATOM   3393 C C   . GLY C 3 44  ? 47.287  18.379  -52.488 1.00 79.39  ? 44  GLY E C   1 
ATOM   3394 O O   . GLY C 3 44  ? 47.669  19.469  -52.043 1.00 81.92  ? 44  GLY E O   1 
ATOM   3395 N N   . LEU C 3 45  ? 46.038  17.924  -52.321 1.00 70.28  ? 45  LEU E N   1 
ATOM   3396 C CA  . LEU C 3 45  ? 45.021  18.709  -51.635 1.00 67.65  ? 45  LEU E CA  1 
ATOM   3397 C C   . LEU C 3 45  ? 45.037  18.451  -50.132 1.00 70.67  ? 45  LEU E C   1 
ATOM   3398 O O   . LEU C 3 45  ? 45.405  17.363  -49.696 1.00 69.98  ? 45  LEU E O   1 
ATOM   3399 C CB  . LEU C 3 45  ? 43.638  18.458  -52.232 1.00 67.06  ? 45  LEU E CB  1 
ATOM   3400 C CG  . LEU C 3 45  ? 43.515  18.513  -53.756 1.00 70.64  ? 45  LEU E CG  1 
ATOM   3401 C CD1 . LEU C 3 45  ? 42.619  17.401  -54.268 1.00 70.72  ? 45  LEU E CD1 1 
ATOM   3402 C CD2 . LEU C 3 45  ? 43.019  19.842  -54.228 1.00 70.46  ? 45  LEU E CD2 1 
ATOM   3403 N N   . GLU C 3 46  ? 44.615  19.454  -49.347 1.00 66.81  ? 46  GLU E N   1 
ATOM   3404 C CA  . GLU C 3 46  ? 44.592  19.482  -47.885 1.00 66.24  ? 46  GLU E CA  1 
ATOM   3405 C C   . GLU C 3 46  ? 43.282  20.132  -47.400 1.00 69.27  ? 46  GLU E C   1 
ATOM   3406 O O   . GLU C 3 46  ? 43.000  21.273  -47.774 1.00 69.40  ? 46  GLU E O   1 
ATOM   3407 C CB  . GLU C 3 46  ? 45.826  20.298  -47.443 1.00 68.01  ? 46  GLU E CB  1 
ATOM   3408 C CG  . GLU C 3 46  ? 45.996  20.554  -45.953 1.00 86.45  ? 46  GLU E CG  1 
ATOM   3409 C CD  . GLU C 3 46  ? 47.401  20.989  -45.568 1.00 115.64 ? 46  GLU E CD  1 
ATOM   3410 O OE1 . GLU C 3 46  ? 48.002  21.804  -46.306 1.00 96.99  ? 46  GLU E OE1 1 
ATOM   3411 O OE2 . GLU C 3 46  ? 47.904  20.502  -44.530 1.00 121.22 ? 46  GLU E OE2 1 
ATOM   3412 N N   . TRP C 3 47  ? 42.488  19.414  -46.589 1.00 65.23  ? 47  TRP E N   1 
ATOM   3413 C CA  . TRP C 3 47  ? 41.200  19.897  -46.067 1.00 65.30  ? 47  TRP E CA  1 
ATOM   3414 C C   . TRP C 3 47  ? 41.380  20.894  -44.929 1.00 70.55  ? 47  TRP E C   1 
ATOM   3415 O O   . TRP C 3 47  ? 42.038  20.607  -43.920 1.00 70.95  ? 47  TRP E O   1 
ATOM   3416 C CB  . TRP C 3 47  ? 40.362  18.708  -45.583 1.00 64.88  ? 47  TRP E CB  1 
ATOM   3417 C CG  . TRP C 3 47  ? 38.967  19.013  -45.121 1.00 66.80  ? 47  TRP E CG  1 
ATOM   3418 C CD1 . TRP C 3 47  ? 37.870  19.191  -45.911 1.00 69.99  ? 47  TRP E CD1 1 
ATOM   3419 C CD2 . TRP C 3 47  ? 38.482  18.999  -43.761 1.00 67.02  ? 47  TRP E CD2 1 
ATOM   3420 N NE1 . TRP C 3 47  ? 36.745  19.375  -45.128 1.00 70.14  ? 47  TRP E NE1 1 
ATOM   3421 C CE2 . TRP C 3 47  ? 37.091  19.263  -43.808 1.00 71.14  ? 47  TRP E CE2 1 
ATOM   3422 C CE3 . TRP C 3 47  ? 39.091  18.812  -42.504 1.00 68.15  ? 47  TRP E CE3 1 
ATOM   3423 C CZ2 . TRP C 3 47  ? 36.299  19.326  -42.657 1.00 70.35  ? 47  TRP E CZ2 1 
ATOM   3424 C CZ3 . TRP C 3 47  ? 38.308  18.921  -41.354 1.00 69.07  ? 47  TRP E CZ3 1 
ATOM   3425 C CH2 . TRP C 3 47  ? 36.934  19.180  -41.436 1.00 69.60  ? 47  TRP E CH2 1 
ATOM   3426 N N   . ILE C 3 48  ? 40.697  22.026  -45.056 1.00 66.75  ? 48  ILE E N   1 
ATOM   3427 C CA  . ILE C 3 48  ? 40.763  23.113  -44.043 1.00 65.24  ? 48  ILE E CA  1 
ATOM   3428 C C   . ILE C 3 48  ? 39.612  22.956  -43.049 1.00 70.99  ? 48  ILE E C   1 
ATOM   3429 O O   . ILE C 3 48  ? 39.877  22.897  -41.856 1.00 71.09  ? 48  ILE E O   1 
ATOM   3430 C CB  . ILE C 3 48  ? 40.708  24.474  -44.749 1.00 67.06  ? 48  ILE E CB  1 
ATOM   3431 C CG1 . ILE C 3 48  ? 41.940  24.704  -45.621 1.00 67.58  ? 48  ILE E CG1 1 
ATOM   3432 C CG2 . ILE C 3 48  ? 40.517  25.586  -43.742 1.00 66.65  ? 48  ILE E CG2 1 
ATOM   3433 C CD1 . ILE C 3 48  ? 41.693  25.635  -46.772 1.00 74.70  ? 48  ILE E CD1 1 
ATOM   3434 N N   . GLY C 3 49  ? 38.376  22.910  -43.535 1.00 66.06  ? 49  GLY E N   1 
ATOM   3435 C CA  . GLY C 3 49  ? 37.214  22.780  -42.640 1.00 63.93  ? 49  GLY E CA  1 
ATOM   3436 C C   . GLY C 3 49  ? 35.918  22.902  -43.405 1.00 66.57  ? 49  GLY E C   1 
ATOM   3437 O O   . GLY C 3 49  ? 35.977  22.975  -44.625 1.00 66.51  ? 49  GLY E O   1 
ATOM   3438 N N   . TYR C 3 50  ? 34.789  22.931  -42.703 1.00 62.50  ? 50  TYR E N   1 
ATOM   3439 C CA  . TYR C 3 50  ? 33.475  23.028  -43.383 1.00 62.27  ? 50  TYR E CA  1 
ATOM   3440 C C   . TYR C 3 50  ? 32.491  23.801  -42.510 1.00 68.20  ? 50  TYR E C   1 
ATOM   3441 O O   . TYR C 3 50  ? 32.736  23.914  -41.318 1.00 67.60  ? 50  TYR E O   1 
ATOM   3442 C CB  . TYR C 3 50  ? 32.935  21.631  -43.674 1.00 62.40  ? 50  TYR E CB  1 
ATOM   3443 C CG  . TYR C 3 50  ? 32.326  20.928  -42.492 1.00 61.11  ? 50  TYR E CG  1 
ATOM   3444 C CD1 . TYR C 3 50  ? 31.110  21.319  -41.977 1.00 62.93  ? 50  TYR E CD1 1 
ATOM   3445 C CD2 . TYR C 3 50  ? 32.953  19.854  -41.903 1.00 60.88  ? 50  TYR E CD2 1 
ATOM   3446 C CE1 . TYR C 3 50  ? 30.536  20.676  -40.899 1.00 63.89  ? 50  TYR E CE1 1 
ATOM   3447 C CE2 . TYR C 3 50  ? 32.396  19.198  -40.824 1.00 61.47  ? 50  TYR E CE2 1 
ATOM   3448 C CZ  . TYR C 3 50  ? 31.183  19.610  -40.318 1.00 65.64  ? 50  TYR E CZ  1 
ATOM   3449 O OH  . TYR C 3 50  ? 30.620  18.983  -39.253 1.00 58.96  ? 50  TYR E OH  1 
ATOM   3450 N N   . ILE C 3 51  ? 31.429  24.335  -43.115 1.00 64.96  ? 51  ILE E N   1 
ATOM   3451 C CA  . ILE C 3 51  ? 30.355  25.040  -42.360 1.00 64.51  ? 51  ILE E CA  1 
ATOM   3452 C C   . ILE C 3 51  ? 29.014  24.471  -42.797 1.00 67.36  ? 51  ILE E C   1 
ATOM   3453 O O   . ILE C 3 51  ? 28.893  24.122  -43.958 1.00 66.82  ? 51  ILE E O   1 
ATOM   3454 C CB  . ILE C 3 51  ? 30.367  26.550  -42.662 1.00 68.81  ? 51  ILE E CB  1 
ATOM   3455 C CG1 . ILE C 3 51  ? 31.774  27.091  -42.924 1.00 72.04  ? 51  ILE E CG1 1 
ATOM   3456 C CG2 . ILE C 3 51  ? 29.636  27.326  -41.583 1.00 65.63  ? 51  ILE E CG2 1 
ATOM   3457 C CD1 . ILE C 3 51  ? 32.074  28.434  -42.294 1.00 93.57  ? 51  ILE E CD1 1 
ATOM   3458 N N   . ASN C 3 52  ? 28.068  24.354  -41.873 1.00 63.02  ? 52  ASN E N   1 
ATOM   3459 C CA  . ASN C 3 52  ? 26.695  23.963  -42.267 1.00 62.87  ? 52  ASN E CA  1 
ATOM   3460 C C   . ASN C 3 52  ? 25.891  25.254  -42.202 1.00 70.46  ? 52  ASN E C   1 
ATOM   3461 O O   . ASN C 3 52  ? 25.598  25.703  -41.100 1.00 72.96  ? 52  ASN E O   1 
ATOM   3462 C CB  . ASN C 3 52  ? 26.089  22.861  -41.402 1.00 63.31  ? 52  ASN E CB  1 
ATOM   3463 C CG  . ASN C 3 52  ? 24.841  22.270  -42.018 1.00 83.59  ? 52  ASN E CG  1 
ATOM   3464 O OD1 . ASN C 3 52  ? 24.523  22.539  -43.165 1.00 74.03  ? 52  ASN E OD1 1 
ATOM   3465 N ND2 . ASN C 3 52  ? 24.115  21.470  -41.264 1.00 75.26  ? 52  ASN E ND2 1 
ATOM   3466 N N   . PRO C 3 53  ? 25.590  25.897  -43.341 1.00 65.71  ? 53  PRO E N   1 
ATOM   3467 C CA  . PRO C 3 53  ? 24.885  27.158  -43.342 1.00 64.47  ? 53  PRO E CA  1 
ATOM   3468 C C   . PRO C 3 53  ? 23.586  27.076  -42.550 1.00 68.30  ? 53  PRO E C   1 
ATOM   3469 O O   . PRO C 3 53  ? 23.315  27.958  -41.810 1.00 69.33  ? 53  PRO E O   1 
ATOM   3470 C CB  . PRO C 3 53  ? 24.561  27.361  -44.815 1.00 66.47  ? 53  PRO E CB  1 
ATOM   3471 C CG  . PRO C 3 53  ? 25.692  26.675  -45.506 1.00 71.59  ? 53  PRO E CG  1 
ATOM   3472 C CD  . PRO C 3 53  ? 25.916  25.436  -44.676 1.00 67.49  ? 53  PRO E CD  1 
ATOM   3473 N N   . SER C 3 54  ? 22.830  26.005  -42.722 1.00 65.67  ? 54  SER E N   1 
ATOM   3474 C CA  . SER C 3 54  ? 21.571  25.921  -41.968 1.00 66.02  ? 54  SER E CA  1 
ATOM   3475 C C   . SER C 3 54  ? 21.759  26.010  -40.415 1.00 68.45  ? 54  SER E C   1 
ATOM   3476 O O   . SER C 3 54  ? 21.017  26.767  -39.773 1.00 67.19  ? 54  SER E O   1 
ATOM   3477 C CB  . SER C 3 54  ? 20.770  24.691  -42.375 1.00 70.17  ? 54  SER E CB  1 
ATOM   3478 O OG  . SER C 3 54  ? 21.447  23.499  -42.024 1.00 86.34  ? 54  SER E OG  1 
ATOM   3479 N N   . SER C 3 55  ? 22.777  25.305  -39.834 1.00 63.33  ? 55  SER E N   1 
ATOM   3480 C CA  . SER C 3 55  ? 23.020  25.325  -38.381 1.00 62.42  ? 55  SER E CA  1 
ATOM   3481 C C   . SER C 3 55  ? 24.030  26.355  -37.905 1.00 67.02  ? 55  SER E C   1 
ATOM   3482 O O   . SER C 3 55  ? 24.003  26.787  -36.743 1.00 68.62  ? 55  SER E O   1 
ATOM   3483 C CB  . SER C 3 55  ? 23.422  23.950  -37.875 1.00 64.32  ? 55  SER E CB  1 
ATOM   3484 O OG  . SER C 3 55  ? 24.514  23.437  -38.611 1.00 78.93  ? 55  SER E OG  1 
ATOM   3485 N N   . GLY C 3 56  ? 24.918  26.741  -38.788 1.00 61.63  ? 56  GLY E N   1 
ATOM   3486 C CA  . GLY C 3 56  ? 25.994  27.637  -38.423 1.00 61.53  ? 56  GLY E CA  1 
ATOM   3487 C C   . GLY C 3 56  ? 27.136  26.803  -37.878 1.00 66.76  ? 56  GLY E C   1 
ATOM   3488 O O   . GLY C 3 56  ? 28.239  27.322  -37.684 1.00 67.27  ? 56  GLY E O   1 
ATOM   3489 N N   . TYR C 3 57  ? 26.895  25.480  -37.690 1.00 62.72  ? 57  TYR E N   1 
ATOM   3490 C CA  . TYR C 3 57  ? 27.865  24.514  -37.178 1.00 62.58  ? 57  TYR E CA  1 
ATOM   3491 C C   . TYR C 3 57  ? 29.055  24.327  -38.092 1.00 66.41  ? 57  TYR E C   1 
ATOM   3492 O O   . TYR C 3 57  ? 28.894  24.104  -39.291 1.00 66.58  ? 57  TYR E O   1 
ATOM   3493 C CB  . TYR C 3 57  ? 27.203  23.152  -36.893 1.00 64.53  ? 57  TYR E CB  1 
ATOM   3494 C CG  . TYR C 3 57  ? 26.296  23.125  -35.673 1.00 66.81  ? 57  TYR E CG  1 
ATOM   3495 C CD1 . TYR C 3 57  ? 25.917  24.298  -35.038 1.00 69.14  ? 57  TYR E CD1 1 
ATOM   3496 C CD2 . TYR C 3 57  ? 25.795  21.925  -35.175 1.00 67.57  ? 57  TYR E CD2 1 
ATOM   3497 C CE1 . TYR C 3 57  ? 25.086  24.282  -33.921 1.00 73.07  ? 57  TYR E CE1 1 
ATOM   3498 C CE2 . TYR C 3 57  ? 24.936  21.897  -34.073 1.00 69.38  ? 57  TYR E CE2 1 
ATOM   3499 C CZ  . TYR C 3 57  ? 24.590  23.082  -33.436 1.00 77.44  ? 57  TYR E CZ  1 
ATOM   3500 O OH  . TYR C 3 57  ? 23.788  23.121  -32.301 1.00 72.94  ? 57  TYR E OH  1 
ATOM   3501 N N   . THR C 3 58  ? 30.260  24.409  -37.519 1.00 63.80  ? 58  THR E N   1 
ATOM   3502 C CA  . THR C 3 58  ? 31.525  24.208  -38.239 1.00 63.92  ? 58  THR E CA  1 
ATOM   3503 C C   . THR C 3 58  ? 32.417  23.177  -37.536 1.00 68.29  ? 58  THR E C   1 
ATOM   3504 O O   . THR C 3 58  ? 32.353  23.009  -36.313 1.00 69.02  ? 58  THR E O   1 
ATOM   3505 C CB  . THR C 3 58  ? 32.349  25.525  -38.314 1.00 68.69  ? 58  THR E CB  1 
ATOM   3506 O OG1 . THR C 3 58  ? 32.931  25.793  -37.033 1.00 72.55  ? 58  THR E OG1 1 
ATOM   3507 C CG2 . THR C 3 58  ? 31.560  26.717  -38.846 1.00 57.71  ? 58  THR E CG2 1 
ATOM   3508 N N   . GLU C 3 59  ? 33.295  22.550  -38.321 1.00 63.47  ? 59  GLU E N   1 
ATOM   3509 C CA  . GLU C 3 59  ? 34.369  21.653  -37.892 1.00 61.35  ? 59  GLU E CA  1 
ATOM   3510 C C   . GLU C 3 59  ? 35.628  22.049  -38.691 1.00 66.68  ? 59  GLU E C   1 
ATOM   3511 O O   . GLU C 3 59  ? 35.524  22.364  -39.888 1.00 65.89  ? 59  GLU E O   1 
ATOM   3512 C CB  . GLU C 3 59  ? 34.031  20.221  -38.174 1.00 61.44  ? 59  GLU E CB  1 
ATOM   3513 C CG  . GLU C 3 59  ? 33.010  19.635  -37.252 1.00 67.21  ? 59  GLU E CG  1 
ATOM   3514 C CD  . GLU C 3 59  ? 33.270  18.157  -37.045 1.00 85.28  ? 59  GLU E CD  1 
ATOM   3515 O OE1 . GLU C 3 59  ? 32.724  17.336  -37.823 1.00 75.64  ? 59  GLU E OE1 1 
ATOM   3516 O OE2 . GLU C 3 59  ? 34.050  17.825  -36.120 1.00 71.99  ? 59  GLU E OE2 1 
ATOM   3517 N N   . TYR C 3 60  ? 36.790  22.094  -38.013 1.00 63.92  ? 60  TYR E N   1 
ATOM   3518 C CA  . TYR C 3 60  ? 38.057  22.454  -38.642 1.00 64.44  ? 60  TYR E CA  1 
ATOM   3519 C C   . TYR C 3 60  ? 39.105  21.324  -38.530 1.00 70.92  ? 60  TYR E C   1 
ATOM   3520 O O   . TYR C 3 60  ? 38.929  20.367  -37.781 1.00 72.14  ? 60  TYR E O   1 
ATOM   3521 C CB  . TYR C 3 60  ? 38.614  23.763  -38.041 1.00 65.66  ? 60  TYR E CB  1 
ATOM   3522 C CG  . TYR C 3 60  ? 37.662  24.942  -38.055 1.00 68.26  ? 60  TYR E CG  1 
ATOM   3523 C CD1 . TYR C 3 60  ? 37.219  25.497  -39.249 1.00 70.28  ? 60  TYR E CD1 1 
ATOM   3524 C CD2 . TYR C 3 60  ? 37.240  25.533  -36.870 1.00 70.22  ? 60  TYR E CD2 1 
ATOM   3525 C CE1 . TYR C 3 60  ? 36.338  26.577  -39.263 1.00 70.83  ? 60  TYR E CE1 1 
ATOM   3526 C CE2 . TYR C 3 60  ? 36.350  26.609  -36.871 1.00 71.97  ? 60  TYR E CE2 1 
ATOM   3527 C CZ  . TYR C 3 60  ? 35.903  27.130  -38.072 1.00 80.37  ? 60  TYR E CZ  1 
ATOM   3528 O OH  . TYR C 3 60  ? 35.030  28.192  -38.072 1.00 81.95  ? 60  TYR E OH  1 
ATOM   3529 N N   . ASN C 3 61  ? 40.185  21.425  -39.294 1.00 67.13  ? 61  ASN E N   1 
ATOM   3530 C CA  . ASN C 3 61  ? 41.290  20.498  -39.188 1.00 66.56  ? 61  ASN E CA  1 
ATOM   3531 C C   . ASN C 3 61  ? 42.119  21.141  -38.084 1.00 72.76  ? 61  ASN E C   1 
ATOM   3532 O O   . ASN C 3 61  ? 42.322  22.366  -38.107 1.00 72.12  ? 61  ASN E O   1 
ATOM   3533 C CB  . ASN C 3 61  ? 42.035  20.444  -40.520 1.00 67.10  ? 61  ASN E CB  1 
ATOM   3534 C CG  . ASN C 3 61  ? 43.451  19.897  -40.531 1.00 90.79  ? 61  ASN E CG  1 
ATOM   3535 O OD1 . ASN C 3 61  ? 44.123  19.712  -39.501 1.00 83.81  ? 61  ASN E OD1 1 
ATOM   3536 N ND2 . ASN C 3 61  ? 43.950  19.654  -41.736 1.00 79.73  ? 61  ASN E ND2 1 
ATOM   3537 N N   . GLN C 3 62  ? 42.526  20.337  -37.078 1.00 71.39  ? 62  GLN E N   1 
ATOM   3538 C CA  . GLN C 3 62  ? 43.315  20.769  -35.916 1.00 71.89  ? 62  GLN E CA  1 
ATOM   3539 C C   . GLN C 3 62  ? 44.506  21.632  -36.315 1.00 77.06  ? 62  GLN E C   1 
ATOM   3540 O O   . GLN C 3 62  ? 44.832  22.573  -35.577 1.00 76.21  ? 62  GLN E O   1 
ATOM   3541 C CB  . GLN C 3 62  ? 43.767  19.565  -35.078 1.00 74.04  ? 62  GLN E CB  1 
ATOM   3542 C CG  . GLN C 3 62  ? 42.659  18.958  -34.195 1.00 113.92 ? 62  GLN E CG  1 
ATOM   3543 C CD  . GLN C 3 62  ? 42.791  17.456  -33.959 1.00 146.55 ? 62  GLN E CD  1 
ATOM   3544 O OE1 . GLN C 3 62  ? 43.435  16.723  -34.727 1.00 145.00 ? 62  GLN E OE1 1 
ATOM   3545 N NE2 . GLN C 3 62  ? 42.163  16.954  -32.893 1.00 138.00 ? 62  GLN E NE2 1 
ATOM   3546 N N   . LYS C 3 63  ? 45.111  21.347  -37.525 1.00 74.90  ? 63  LYS E N   1 
ATOM   3547 C CA  . LYS C 3 63  ? 46.227  22.077  -38.149 1.00 74.98  ? 63  LYS E CA  1 
ATOM   3548 C C   . LYS C 3 63  ? 45.947  23.583  -38.194 1.00 82.33  ? 63  LYS E C   1 
ATOM   3549 O O   . LYS C 3 63  ? 46.876  24.401  -38.151 1.00 82.18  ? 63  LYS E O   1 
ATOM   3550 C CB  . LYS C 3 63  ? 46.512  21.553  -39.575 1.00 76.37  ? 63  LYS E CB  1 
ATOM   3551 C CG  . LYS C 3 63  ? 47.812  22.104  -40.215 1.00 82.41  ? 63  LYS E CG  1 
ATOM   3552 C CD  . LYS C 3 63  ? 48.303  21.290  -41.398 1.00 82.96  ? 63  LYS E CD  1 
ATOM   3553 C CE  . LYS C 3 63  ? 49.793  21.446  -41.605 1.00 86.07  ? 63  LYS E CE  1 
ATOM   3554 N NZ  . LYS C 3 63  ? 50.238  21.011  -42.964 1.00 86.83  ? 63  LYS E NZ  1 
ATOM   3555 N N   . PHE C 3 64  ? 44.655  23.930  -38.265 1.00 81.60  ? 64  PHE E N   1 
ATOM   3556 C CA  . PHE C 3 64  ? 44.159  25.296  -38.316 1.00 82.04  ? 64  PHE E CA  1 
ATOM   3557 C C   . PHE C 3 64  ? 43.391  25.567  -37.036 1.00 90.30  ? 64  PHE E C   1 
ATOM   3558 O O   . PHE C 3 64  ? 44.066  25.820  -36.044 1.00 91.57  ? 64  PHE E O   1 
ATOM   3559 C CB  . PHE C 3 64  ? 43.389  25.508  -39.618 1.00 82.87  ? 64  PHE E CB  1 
ATOM   3560 C CG  . PHE C 3 64  ? 44.166  24.950  -40.793 1.00 83.00  ? 64  PHE E CG  1 
ATOM   3561 C CD1 . PHE C 3 64  ? 45.254  25.639  -41.318 1.00 85.48  ? 64  PHE E CD1 1 
ATOM   3562 C CD2 . PHE C 3 64  ? 43.873  23.700  -41.308 1.00 84.93  ? 64  PHE E CD2 1 
ATOM   3563 C CE1 . PHE C 3 64  ? 45.996  25.114  -42.371 1.00 86.17  ? 64  PHE E CE1 1 
ATOM   3564 C CE2 . PHE C 3 64  ? 44.621  23.170  -42.360 1.00 88.19  ? 64  PHE E CE2 1 
ATOM   3565 C CZ  . PHE C 3 64  ? 45.678  23.884  -42.885 1.00 86.04  ? 64  PHE E CZ  1 
ATOM   3566 N N   . LYS C 3 65  ? 42.049  25.371  -36.997 1.00 88.69  ? 65  LYS E N   1 
ATOM   3567 C CA  . LYS C 3 65  ? 41.147  25.544  -35.820 1.00 88.90  ? 65  LYS E CA  1 
ATOM   3568 C C   . LYS C 3 65  ? 41.269  26.946  -35.163 1.00 92.27  ? 65  LYS E C   1 
ATOM   3569 O O   . LYS C 3 65  ? 40.314  27.741  -35.159 1.00 92.38  ? 65  LYS E O   1 
ATOM   3570 C CB  . LYS C 3 65  ? 41.323  24.399  -34.777 1.00 90.91  ? 65  LYS E CB  1 
ATOM   3571 C CG  . LYS C 3 65  ? 40.125  24.245  -33.817 1.00 103.97 ? 65  LYS E CG  1 
ATOM   3572 C CD  . LYS C 3 65  ? 39.980  22.845  -33.169 1.00 112.17 ? 65  LYS E CD  1 
ATOM   3573 C CE  . LYS C 3 65  ? 39.268  21.794  -34.017 1.00 118.37 ? 65  LYS E CE  1 
ATOM   3574 N NZ  . LYS C 3 65  ? 37.820  22.097  -34.261 1.00 121.15 ? 65  LYS E NZ  1 
ATOM   3575 N N   . ASP C 3 66  ? 42.468  27.189  -34.605 1.00 86.37  ? 66  ASP E N   1 
ATOM   3576 C CA  . ASP C 3 66  ? 43.029  28.349  -33.964 1.00 84.89  ? 66  ASP E CA  1 
ATOM   3577 C C   . ASP C 3 66  ? 43.182  29.537  -34.968 1.00 85.47  ? 66  ASP E C   1 
ATOM   3578 O O   . ASP C 3 66  ? 42.716  30.635  -34.674 1.00 84.57  ? 66  ASP E O   1 
ATOM   3579 C CB  . ASP C 3 66  ? 44.357  27.890  -33.319 1.00 87.26  ? 66  ASP E CB  1 
ATOM   3580 C CG  . ASP C 3 66  ? 45.564  28.790  -33.492 1.00 108.94 ? 66  ASP E CG  1 
ATOM   3581 O OD1 . ASP C 3 66  ? 45.534  29.937  -32.968 1.00 110.81 ? 66  ASP E OD1 1 
ATOM   3582 O OD2 . ASP C 3 66  ? 46.552  28.345  -34.132 1.00 117.89 ? 66  ASP E OD2 1 
ATOM   3583 N N   . ARG C 3 67  ? 43.783  29.304  -36.156 1.00 80.64  ? 67  ARG E N   1 
ATOM   3584 C CA  . ARG C 3 67  ? 44.040  30.315  -37.204 1.00 78.73  ? 67  ARG E CA  1 
ATOM   3585 C C   . ARG C 3 67  ? 42.841  30.611  -38.104 1.00 81.53  ? 67  ARG E C   1 
ATOM   3586 O O   . ARG C 3 67  ? 42.582  31.773  -38.453 1.00 81.31  ? 67  ARG E O   1 
ATOM   3587 C CB  . ARG C 3 67  ? 45.188  29.852  -38.088 1.00 77.53  ? 67  ARG E CB  1 
ATOM   3588 C CG  . ARG C 3 67  ? 46.535  29.986  -37.434 1.00 93.43  ? 67  ARG E CG  1 
ATOM   3589 C CD  . ARG C 3 67  ? 47.601  29.908  -38.486 1.00 115.59 ? 67  ARG E CD  1 
ATOM   3590 N NE  . ARG C 3 67  ? 47.960  28.522  -38.760 1.00 135.39 ? 67  ARG E NE  1 
ATOM   3591 C CZ  . ARG C 3 67  ? 48.550  28.113  -39.876 1.00 155.01 ? 67  ARG E CZ  1 
ATOM   3592 N NH1 . ARG C 3 67  ? 48.823  28.978  -40.847 1.00 139.40 ? 67  ARG E NH1 1 
ATOM   3593 N NH2 . ARG C 3 67  ? 48.850  26.831  -40.041 1.00 148.87 ? 67  ARG E NH2 1 
ATOM   3594 N N   . VAL C 3 68  ? 42.110  29.550  -38.479 1.00 77.06  ? 68  VAL E N   1 
ATOM   3595 C CA  . VAL C 3 68  ? 40.960  29.626  -39.370 1.00 75.94  ? 68  VAL E CA  1 
ATOM   3596 C C   . VAL C 3 68  ? 39.585  29.867  -38.652 1.00 79.63  ? 68  VAL E C   1 
ATOM   3597 O O   . VAL C 3 68  ? 39.407  29.620  -37.437 1.00 77.85  ? 68  VAL E O   1 
ATOM   3598 C CB  . VAL C 3 68  ? 40.949  28.370  -40.266 1.00 78.62  ? 68  VAL E CB  1 
ATOM   3599 C CG1 . VAL C 3 68  ? 40.360  27.170  -39.540 1.00 78.12  ? 68  VAL E CG1 1 
ATOM   3600 C CG2 . VAL C 3 68  ? 40.245  28.632  -41.595 1.00 78.28  ? 68  VAL E CG2 1 
ATOM   3601 N N   . THR C 3 69  ? 38.632  30.380  -39.466 1.00 75.93  ? 69  THR E N   1 
ATOM   3602 C CA  . THR C 3 69  ? 37.239  30.674  -39.147 1.00 75.36  ? 69  THR E CA  1 
ATOM   3603 C C   . THR C 3 69  ? 36.470  30.705  -40.446 1.00 76.25  ? 69  THR E C   1 
ATOM   3604 O O   . THR C 3 69  ? 36.643  31.593  -41.283 1.00 76.28  ? 69  THR E O   1 
ATOM   3605 C CB  . THR C 3 69  ? 37.092  31.967  -38.344 1.00 91.11  ? 69  THR E CB  1 
ATOM   3606 O OG1 . THR C 3 69  ? 38.226  32.798  -38.616 1.00 98.31  ? 69  THR E OG1 1 
ATOM   3607 C CG2 . THR C 3 69  ? 36.974  31.705  -36.846 1.00 91.75  ? 69  THR E CG2 1 
ATOM   3608 N N   . ILE C 3 70  ? 35.672  29.676  -40.632 1.00 70.47  ? 70  ILE E N   1 
ATOM   3609 C CA  . ILE C 3 70  ? 34.861  29.513  -41.819 1.00 69.16  ? 70  ILE E CA  1 
ATOM   3610 C C   . ILE C 3 70  ? 33.451  30.025  -41.484 1.00 72.37  ? 70  ILE E C   1 
ATOM   3611 O O   . ILE C 3 70  ? 32.929  29.756  -40.404 1.00 70.73  ? 70  ILE E O   1 
ATOM   3612 C CB  . ILE C 3 70  ? 34.944  28.065  -42.394 1.00 71.98  ? 70  ILE E CB  1 
ATOM   3613 C CG1 . ILE C 3 70  ? 36.412  27.544  -42.548 1.00 72.44  ? 70  ILE E CG1 1 
ATOM   3614 C CG2 . ILE C 3 70  ? 34.276  28.022  -43.725 1.00 72.71  ? 70  ILE E CG2 1 
ATOM   3615 C CD1 . ILE C 3 70  ? 36.390  26.199  -43.206 1.00 72.37  ? 70  ILE E CD1 1 
ATOM   3616 N N   . THR C 3 71  ? 32.890  30.867  -42.335 1.00 69.52  ? 71  THR E N   1 
ATOM   3617 C CA  . THR C 3 71  ? 31.613  31.485  -41.988 1.00 69.73  ? 71  THR E CA  1 
ATOM   3618 C C   . THR C 3 71  ? 30.594  31.524  -43.132 1.00 76.63  ? 71  THR E C   1 
ATOM   3619 O O   . THR C 3 71  ? 30.977  31.471  -44.295 1.00 75.88  ? 71  THR E O   1 
ATOM   3620 C CB  . THR C 3 71  ? 31.872  32.852  -41.405 1.00 70.80  ? 71  THR E CB  1 
ATOM   3621 O OG1 . THR C 3 71  ? 30.627  33.539  -41.292 1.00 70.49  ? 71  THR E OG1 1 
ATOM   3622 C CG2 . THR C 3 71  ? 32.919  33.632  -42.195 1.00 66.15  ? 71  THR E CG2 1 
ATOM   3623 N N   . ALA C 3 72  ? 29.283  31.599  -42.802 1.00 74.66  ? 72  ALA E N   1 
ATOM   3624 C CA  . ALA C 3 72  ? 28.290  31.560  -43.866 1.00 74.90  ? 72  ALA E CA  1 
ATOM   3625 C C   . ALA C 3 72  ? 27.272  32.625  -43.771 1.00 79.14  ? 72  ALA E C   1 
ATOM   3626 O O   . ALA C 3 72  ? 26.658  32.786  -42.714 1.00 81.18  ? 72  ALA E O   1 
ATOM   3627 C CB  . ALA C 3 72  ? 27.612  30.209  -43.892 1.00 76.06  ? 72  ALA E CB  1 
ATOM   3628 N N   . ASP C 3 73  ? 27.059  33.335  -44.887 1.00 73.39  ? 73  ASP E N   1 
ATOM   3629 C CA  . ASP C 3 73  ? 26.064  34.389  -44.966 1.00 72.37  ? 73  ASP E CA  1 
ATOM   3630 C C   . ASP C 3 73  ? 24.856  33.881  -45.704 1.00 73.78  ? 73  ASP E C   1 
ATOM   3631 O O   . ASP C 3 73  ? 24.859  33.881  -46.937 1.00 72.96  ? 73  ASP E O   1 
ATOM   3632 C CB  . ASP C 3 73  ? 26.628  35.636  -45.656 1.00 74.24  ? 73  ASP E CB  1 
ATOM   3633 C CG  . ASP C 3 73  ? 25.756  36.875  -45.504 1.00 84.84  ? 73  ASP E CG  1 
ATOM   3634 O OD1 . ASP C 3 73  ? 24.516  36.719  -45.362 1.00 83.26  ? 73  ASP E OD1 1 
ATOM   3635 O OD2 . ASP C 3 73  ? 26.314  38.006  -45.536 1.00 93.53  ? 73  ASP E OD2 1 
ATOM   3636 N N   . LYS C 3 74  ? 23.798  33.506  -44.950 1.00 68.76  ? 74  LYS E N   1 
ATOM   3637 C CA  . LYS C 3 74  ? 22.554  32.975  -45.507 1.00 67.63  ? 74  LYS E CA  1 
ATOM   3638 C C   . LYS C 3 74  ? 21.891  33.935  -46.497 1.00 72.64  ? 74  LYS E C   1 
ATOM   3639 O O   . LYS C 3 74  ? 21.643  33.568  -47.644 1.00 72.61  ? 74  LYS E O   1 
ATOM   3640 C CB  . LYS C 3 74  ? 21.591  32.574  -44.394 1.00 68.36  ? 74  LYS E CB  1 
ATOM   3641 C CG  . LYS C 3 74  ? 21.794  31.164  -43.868 1.00 75.74  ? 74  LYS E CG  1 
ATOM   3642 C CD  . LYS C 3 74  ? 20.532  30.746  -43.122 1.00 87.07  ? 74  LYS E CD  1 
ATOM   3643 C CE  . LYS C 3 74  ? 20.772  29.908  -41.904 1.00 91.80  ? 74  LYS E CE  1 
ATOM   3644 N NZ  . LYS C 3 74  ? 19.622  30.004  -40.981 1.00 106.58 ? 74  LYS E NZ  1 
ATOM   3645 N N   . SER C 3 75  ? 21.661  35.170  -46.071 1.00 69.59  ? 75  SER E N   1 
ATOM   3646 C CA  . SER C 3 75  ? 21.049  36.192  -46.884 1.00 69.58  ? 75  SER E CA  1 
ATOM   3647 C C   . SER C 3 75  ? 21.776  36.409  -48.229 1.00 75.01  ? 75  SER E C   1 
ATOM   3648 O O   . SER C 3 75  ? 21.099  36.443  -49.262 1.00 75.31  ? 75  SER E O   1 
ATOM   3649 C CB  . SER C 3 75  ? 20.938  37.483  -46.087 1.00 74.30  ? 75  SER E CB  1 
ATOM   3650 O OG  . SER C 3 75  ? 22.171  37.864  -45.503 1.00 83.89  ? 75  SER E OG  1 
ATOM   3651 N N   . THR C 3 76  ? 23.136  36.502  -48.236 1.00 71.12  ? 76  THR E N   1 
ATOM   3652 C CA  . THR C 3 76  ? 23.890  36.703  -49.495 1.00 70.13  ? 76  THR E CA  1 
ATOM   3653 C C   . THR C 3 76  ? 24.211  35.381  -50.181 1.00 72.85  ? 76  THR E C   1 
ATOM   3654 O O   . THR C 3 76  ? 24.752  35.392  -51.294 1.00 73.54  ? 76  THR E O   1 
ATOM   3655 C CB  . THR C 3 76  ? 25.159  37.611  -49.361 1.00 79.26  ? 76  THR E CB  1 
ATOM   3656 O OG1 . THR C 3 76  ? 26.275  36.903  -48.824 1.00 74.46  ? 76  THR E OG1 1 
ATOM   3657 C CG2 . THR C 3 76  ? 24.920  38.894  -48.571 1.00 84.13  ? 76  THR E CG2 1 
ATOM   3658 N N   . SER C 3 77  ? 23.873  34.241  -49.535 1.00 67.96  ? 77  SER E N   1 
ATOM   3659 C CA  . SER C 3 77  ? 24.099  32.869  -50.053 1.00 67.04  ? 77  SER E CA  1 
ATOM   3660 C C   . SER C 3 77  ? 25.602  32.646  -50.419 1.00 68.79  ? 77  SER E C   1 
ATOM   3661 O O   . SER C 3 77  ? 25.935  32.084  -51.449 1.00 67.11  ? 77  SER E O   1 
ATOM   3662 C CB  . SER C 3 77  ? 23.132  32.590  -51.205 1.00 70.20  ? 77  SER E CB  1 
ATOM   3663 O OG  . SER C 3 77  ? 23.388  31.392  -51.909 1.00 83.12  ? 77  SER E OG  1 
ATOM   3664 N N   . THR C 3 78  ? 26.490  33.116  -49.541 1.00 66.28  ? 78  THR E N   1 
ATOM   3665 C CA  . THR C 3 78  ? 27.938  33.117  -49.701 1.00 67.39  ? 78  THR E CA  1 
ATOM   3666 C C   . THR C 3 78  ? 28.604  32.540  -48.461 1.00 73.78  ? 78  THR E C   1 
ATOM   3667 O O   . THR C 3 78  ? 28.200  32.863  -47.339 1.00 73.71  ? 78  THR E O   1 
ATOM   3668 C CB  . THR C 3 78  ? 28.390  34.598  -49.905 1.00 78.73  ? 78  THR E CB  1 
ATOM   3669 O OG1 . THR C 3 78  ? 27.860  35.103  -51.126 1.00 83.34  ? 78  THR E OG1 1 
ATOM   3670 C CG2 . THR C 3 78  ? 29.882  34.797  -49.911 1.00 75.61  ? 78  THR E CG2 1 
ATOM   3671 N N   . ALA C 3 79  ? 29.659  31.734  -48.664 1.00 70.30  ? 79  ALA E N   1 
ATOM   3672 C CA  . ALA C 3 79  ? 30.491  31.187  -47.589 1.00 69.93  ? 79  ALA E CA  1 
ATOM   3673 C C   . ALA C 3 79  ? 31.844  31.920  -47.589 1.00 74.53  ? 79  ALA E C   1 
ATOM   3674 O O   . ALA C 3 79  ? 32.260  32.436  -48.627 1.00 75.99  ? 79  ALA E O   1 
ATOM   3675 C CB  . ALA C 3 79  ? 30.722  29.714  -47.809 1.00 70.52  ? 79  ALA E CB  1 
ATOM   3676 N N   . TYR C 3 80  ? 32.542  31.948  -46.446 1.00 69.21  ? 80  TYR E N   1 
ATOM   3677 C CA  . TYR C 3 80  ? 33.820  32.639  -46.318 1.00 67.90  ? 80  TYR E CA  1 
ATOM   3678 C C   . TYR C 3 80  ? 34.855  31.852  -45.563 1.00 71.59  ? 80  TYR E C   1 
ATOM   3679 O O   . TYR C 3 80  ? 34.517  31.042  -44.716 1.00 71.57  ? 80  TYR E O   1 
ATOM   3680 C CB  . TYR C 3 80  ? 33.640  33.974  -45.590 1.00 68.01  ? 80  TYR E CB  1 
ATOM   3681 C CG  . TYR C 3 80  ? 32.746  34.976  -46.269 1.00 68.54  ? 80  TYR E CG  1 
ATOM   3682 C CD1 . TYR C 3 80  ? 31.363  34.903  -46.144 1.00 71.03  ? 80  TYR E CD1 1 
ATOM   3683 C CD2 . TYR C 3 80  ? 33.280  36.072  -46.930 1.00 68.84  ? 80  TYR E CD2 1 
ATOM   3684 C CE1 . TYR C 3 80  ? 30.529  35.859  -46.716 1.00 72.33  ? 80  TYR E CE1 1 
ATOM   3685 C CE2 . TYR C 3 80  ? 32.458  37.031  -47.514 1.00 70.11  ? 80  TYR E CE2 1 
ATOM   3686 C CZ  . TYR C 3 80  ? 31.081  36.930  -47.393 1.00 78.75  ? 80  TYR E CZ  1 
ATOM   3687 O OH  . TYR C 3 80  ? 30.254  37.884  -47.944 1.00 81.11  ? 80  TYR E OH  1 
ATOM   3688 N N   . MET C 3 81  ? 36.121  32.142  -45.817 1.00 68.63  ? 81  MET E N   1 
ATOM   3689 C CA  . MET C 3 81  ? 37.214  31.545  -45.073 1.00 69.04  ? 81  MET E CA  1 
ATOM   3690 C C   . MET C 3 81  ? 38.232  32.622  -44.723 1.00 72.79  ? 81  MET E C   1 
ATOM   3691 O O   . MET C 3 81  ? 38.681  33.354  -45.606 1.00 71.27  ? 81  MET E O   1 
ATOM   3692 C CB  . MET C 3 81  ? 37.852  30.370  -45.805 1.00 71.88  ? 81  MET E CB  1 
ATOM   3693 C CG  . MET C 3 81  ? 38.809  29.628  -44.915 1.00 76.95  ? 81  MET E CG  1 
ATOM   3694 S SD  . MET C 3 81  ? 40.448  29.271  -45.578 1.00 82.87  ? 81  MET E SD  1 
ATOM   3695 C CE  . MET C 3 81  ? 40.789  30.748  -46.634 1.00 79.62  ? 81  MET E CE  1 
ATOM   3696 N N   . GLU C 3 82  ? 38.560  32.732  -43.421 1.00 70.91  ? 82  GLU E N   1 
ATOM   3697 C CA  . GLU C 3 82  ? 39.490  33.712  -42.876 1.00 71.63  ? 82  GLU E CA  1 
ATOM   3698 C C   . GLU C 3 82  ? 40.642  32.996  -42.227 1.00 79.29  ? 82  GLU E C   1 
ATOM   3699 O O   . GLU C 3 82  ? 40.436  32.307  -41.212 1.00 80.80  ? 82  GLU E O   1 
ATOM   3700 C CB  . GLU C 3 82  ? 38.785  34.601  -41.857 1.00 73.13  ? 82  GLU E CB  1 
ATOM   3701 C CG  . GLU C 3 82  ? 39.624  35.783  -41.413 1.00 87.59  ? 82  GLU E CG  1 
ATOM   3702 C CD  . GLU C 3 82  ? 38.856  37.090  -41.330 1.00 104.92 ? 82  GLU E CD  1 
ATOM   3703 O OE1 . GLU C 3 82  ? 37.747  37.108  -40.744 1.00 83.70  ? 82  GLU E OE1 1 
ATOM   3704 O OE2 . GLU C 3 82  ? 39.372  38.100  -41.860 1.00 97.07  ? 82  GLU E OE2 1 
ATOM   3705 N N   . LEU C 3 83  ? 41.852  33.139  -42.824 1.00 75.27  ? 83  LEU E N   1 
ATOM   3706 C CA  . LEU C 3 83  ? 43.082  32.518  -42.337 1.00 74.52  ? 83  LEU E CA  1 
ATOM   3707 C C   . LEU C 3 83  ? 44.000  33.606  -41.837 1.00 82.45  ? 83  LEU E C   1 
ATOM   3708 O O   . LEU C 3 83  ? 44.523  34.403  -42.624 1.00 84.30  ? 83  LEU E O   1 
ATOM   3709 C CB  . LEU C 3 83  ? 43.753  31.725  -43.456 1.00 73.91  ? 83  LEU E CB  1 
ATOM   3710 C CG  . LEU C 3 83  ? 44.698  30.580  -43.089 1.00 76.49  ? 83  LEU E CG  1 
ATOM   3711 C CD1 . LEU C 3 83  ? 43.938  29.406  -42.445 1.00 75.01  ? 83  LEU E CD1 1 
ATOM   3712 C CD2 . LEU C 3 83  ? 45.357  30.062  -44.332 1.00 76.66  ? 83  LEU E CD2 1 
ATOM   3713 N N   . SER C 3 84  ? 44.153  33.678  -40.521 1.00 80.07  ? 84  SER E N   1 
ATOM   3714 C CA  . SER C 3 84  ? 44.997  34.682  -39.893 1.00 81.03  ? 84  SER E CA  1 
ATOM   3715 C C   . SER C 3 84  ? 46.413  34.138  -39.606 1.00 85.97  ? 84  SER E C   1 
ATOM   3716 O O   . SER C 3 84  ? 46.650  32.920  -39.666 1.00 82.35  ? 84  SER E O   1 
ATOM   3717 C CB  . SER C 3 84  ? 44.329  35.257  -38.642 1.00 85.52  ? 84  SER E CB  1 
ATOM   3718 O OG  . SER C 3 84  ? 44.227  34.324  -37.575 1.00 95.85  ? 84  SER E OG  1 
ATOM   3719 N N   . SER C 3 85  ? 47.354  35.080  -39.315 1.00 86.10  ? 85  SER E N   1 
ATOM   3720 C CA  . SER C 3 85  ? 48.767  34.832  -39.014 1.00 86.08  ? 85  SER E CA  1 
ATOM   3721 C C   . SER C 3 85  ? 49.307  33.935  -40.098 1.00 88.71  ? 85  SER E C   1 
ATOM   3722 O O   . SER C 3 85  ? 49.488  32.736  -39.883 1.00 89.49  ? 85  SER E O   1 
ATOM   3723 C CB  . SER C 3 85  ? 48.921  34.238  -37.609 1.00 89.75  ? 85  SER E CB  1 
ATOM   3724 O OG  . SER C 3 85  ? 48.695  35.228  -36.616 1.00 96.47  ? 85  SER E OG  1 
ATOM   3725 N N   . LEU C 3 86  ? 49.406  34.482  -41.307 1.00 84.34  ? 86  LEU E N   1 
ATOM   3726 C CA  . LEU C 3 86  ? 49.818  33.685  -42.475 1.00 84.05  ? 86  LEU E CA  1 
ATOM   3727 C C   . LEU C 3 86  ? 51.333  33.407  -42.548 1.00 89.14  ? 86  LEU E C   1 
ATOM   3728 O O   . LEU C 3 86  ? 52.126  34.347  -42.482 1.00 88.40  ? 86  LEU E O   1 
ATOM   3729 C CB  . LEU C 3 86  ? 49.315  34.309  -43.797 1.00 83.30  ? 86  LEU E CB  1 
ATOM   3730 C CG  . LEU C 3 86  ? 47.808  34.427  -43.990 1.00 86.81  ? 86  LEU E CG  1 
ATOM   3731 C CD1 . LEU C 3 86  ? 47.479  35.560  -44.898 1.00 87.05  ? 86  LEU E CD1 1 
ATOM   3732 C CD2 . LEU C 3 86  ? 47.242  33.186  -44.565 1.00 88.09  ? 86  LEU E CD2 1 
ATOM   3733 N N   . ARG C 3 87  ? 51.732  32.116  -42.649 1.00 86.54  ? 87  ARG E N   1 
ATOM   3734 C CA  . ARG C 3 87  ? 53.139  31.742  -42.815 1.00 86.66  ? 87  ARG E CA  1 
ATOM   3735 C C   . ARG C 3 87  ? 53.354  31.579  -44.325 1.00 87.96  ? 87  ARG E C   1 
ATOM   3736 O O   . ARG C 3 87  ? 52.365  31.594  -45.060 1.00 86.68  ? 87  ARG E O   1 
ATOM   3737 C CB  . ARG C 3 87  ? 53.488  30.480  -42.006 0.00 91.83  ? 87  ARG E CB  1 
ATOM   3738 C CG  . ARG C 3 87  ? 53.645  30.759  -40.511 0.00 104.14 ? 87  ARG E CG  1 
ATOM   3739 C CD  . ARG C 3 87  ? 54.098  29.558  -39.703 0.00 117.47 ? 87  ARG E CD  1 
ATOM   3740 N NE  . ARG C 3 87  ? 54.160  29.865  -38.272 0.00 128.02 ? 87  ARG E NE  1 
ATOM   3741 C CZ  . ARG C 3 87  ? 54.526  28.996  -37.328 0.00 144.67 ? 87  ARG E CZ  1 
ATOM   3742 N NH1 . ARG C 3 87  ? 54.860  27.750  -37.649 0.00 133.10 ? 87  ARG E NH1 1 
ATOM   3743 N NH2 . ARG C 3 87  ? 54.549  29.371  -36.051 0.00 132.95 ? 87  ARG E NH2 1 
ATOM   3744 N N   . SER C 3 88  ? 54.612  31.504  -44.807 1.00 84.18  ? 88  SER E N   1 
ATOM   3745 C CA  . SER C 3 88  ? 54.901  31.344  -46.258 1.00 84.05  ? 88  SER E CA  1 
ATOM   3746 C C   . SER C 3 88  ? 54.100  30.171  -46.852 1.00 87.05  ? 88  SER E C   1 
ATOM   3747 O O   . SER C 3 88  ? 53.401  30.362  -47.845 1.00 85.64  ? 88  SER E O   1 
ATOM   3748 C CB  . SER C 3 88  ? 56.395  31.139  -46.519 1.00 87.43  ? 88  SER E CB  1 
ATOM   3749 O OG  . SER C 3 88  ? 57.177  31.964  -45.671 1.00 97.66  ? 88  SER E OG  1 
ATOM   3750 N N   . GLU C 3 89  ? 54.148  28.993  -46.165 1.00 83.23  ? 89  GLU E N   1 
ATOM   3751 C CA  . GLU C 3 89  ? 53.480  27.711  -46.434 1.00 82.73  ? 89  GLU E CA  1 
ATOM   3752 C C   . GLU C 3 89  ? 51.950  27.776  -46.626 1.00 86.01  ? 89  GLU E C   1 
ATOM   3753 O O   . GLU C 3 89  ? 51.329  26.785  -46.986 1.00 87.33  ? 89  GLU E O   1 
ATOM   3754 C CB  . GLU C 3 89  ? 53.821  26.694  -45.328 1.00 84.54  ? 89  GLU E CB  1 
ATOM   3755 C CG  . GLU C 3 89  ? 53.856  27.255  -43.911 1.00 101.68 ? 89  GLU E CG  1 
ATOM   3756 C CD  . GLU C 3 89  ? 55.245  27.483  -43.327 1.00 139.46 ? 89  GLU E CD  1 
ATOM   3757 O OE1 . GLU C 3 89  ? 56.107  28.076  -44.018 1.00 137.26 ? 89  GLU E OE1 1 
ATOM   3758 O OE2 . GLU C 3 89  ? 55.470  27.073  -42.165 1.00 142.69 ? 89  GLU E OE2 1 
ATOM   3759 N N   . ASP C 3 90  ? 51.347  28.920  -46.393 1.00 81.48  ? 90  ASP E N   1 
ATOM   3760 C CA  . ASP C 3 90  ? 49.926  29.098  -46.595 1.00 80.31  ? 90  ASP E CA  1 
ATOM   3761 C C   . ASP C 3 90  ? 49.668  29.495  -48.040 1.00 83.50  ? 90  ASP E C   1 
ATOM   3762 O O   . ASP C 3 90  ? 48.500  29.605  -48.407 1.00 84.92  ? 90  ASP E O   1 
ATOM   3763 C CB  . ASP C 3 90  ? 49.356  30.143  -45.607 1.00 81.59  ? 90  ASP E CB  1 
ATOM   3764 C CG  . ASP C 3 90  ? 49.181  29.628  -44.178 1.00 91.89  ? 90  ASP E CG  1 
ATOM   3765 O OD1 . ASP C 3 90  ? 49.005  28.388  -44.004 1.00 91.95  ? 90  ASP E OD1 1 
ATOM   3766 O OD2 . ASP C 3 90  ? 49.193  30.467  -43.227 1.00 96.69  ? 90  ASP E OD2 1 
ATOM   3767 N N   . THR C 3 91  ? 50.737  29.740  -48.868 1.00 76.88  ? 91  THR E N   1 
ATOM   3768 C CA  . THR C 3 91  ? 50.539  30.123  -50.278 1.00 74.56  ? 91  THR E CA  1 
ATOM   3769 C C   . THR C 3 91  ? 49.954  28.934  -50.994 1.00 74.85  ? 91  THR E C   1 
ATOM   3770 O O   . THR C 3 91  ? 50.564  27.862  -51.033 1.00 73.48  ? 91  THR E O   1 
ATOM   3771 C CB  . THR C 3 91  ? 51.794  30.628  -51.008 1.00 79.47  ? 91  THR E CB  1 
ATOM   3772 O OG1 . THR C 3 91  ? 52.709  29.562  -51.173 1.00 92.87  ? 91  THR E OG1 1 
ATOM   3773 C CG2 . THR C 3 91  ? 52.485  31.656  -50.300 1.00 74.31  ? 91  THR E CG2 1 
ATOM   3774 N N   . ALA C 3 92  ? 48.761  29.109  -51.523 1.00 70.52  ? 92  ALA E N   1 
ATOM   3775 C CA  . ALA C 3 92  ? 48.094  28.035  -52.224 1.00 71.18  ? 92  ALA E CA  1 
ATOM   3776 C C   . ALA C 3 92  ? 46.879  28.584  -52.960 1.00 74.53  ? 92  ALA E C   1 
ATOM   3777 O O   . ALA C 3 92  ? 46.629  29.787  -52.945 1.00 74.14  ? 92  ALA E O   1 
ATOM   3778 C CB  . ALA C 3 92  ? 47.659  26.962  -51.219 1.00 72.29  ? 92  ALA E CB  1 
ATOM   3779 N N   . VAL C 3 93  ? 46.174  27.682  -53.655 1.00 70.26  ? 93  VAL E N   1 
ATOM   3780 C CA  . VAL C 3 93  ? 44.901  27.904  -54.315 1.00 68.56  ? 93  VAL E CA  1 
ATOM   3781 C C   . VAL C 3 93  ? 43.901  27.311  -53.311 1.00 73.95  ? 93  VAL E C   1 
ATOM   3782 O O   . VAL C 3 93  ? 44.060  26.171  -52.820 1.00 74.64  ? 93  VAL E O   1 
ATOM   3783 C CB  . VAL C 3 93  ? 44.813  27.258  -55.711 1.00 70.41  ? 93  VAL E CB  1 
ATOM   3784 C CG1 . VAL C 3 93  ? 43.568  27.732  -56.448 1.00 69.44  ? 93  VAL E CG1 1 
ATOM   3785 C CG2 . VAL C 3 93  ? 46.064  27.564  -56.523 1.00 70.17  ? 93  VAL E CG2 1 
ATOM   3786 N N   . TYR C 3 94  ? 42.948  28.140  -52.921 1.00 68.68  ? 94  TYR E N   1 
ATOM   3787 C CA  . TYR C 3 94  ? 41.941  27.805  -51.936 1.00 67.28  ? 94  TYR E CA  1 
ATOM   3788 C C   . TYR C 3 94  ? 40.654  27.589  -52.685 1.00 69.64  ? 94  TYR E C   1 
ATOM   3789 O O   . TYR C 3 94  ? 40.247  28.461  -53.441 1.00 69.38  ? 94  TYR E O   1 
ATOM   3790 C CB  . TYR C 3 94  ? 41.855  28.970  -50.917 1.00 68.23  ? 94  TYR E CB  1 
ATOM   3791 C CG  . TYR C 3 94  ? 43.022  28.959  -49.945 1.00 69.60  ? 94  TYR E CG  1 
ATOM   3792 C CD1 . TYR C 3 94  ? 44.273  29.454  -50.317 1.00 70.44  ? 94  TYR E CD1 1 
ATOM   3793 C CD2 . TYR C 3 94  ? 42.909  28.363  -48.698 1.00 70.70  ? 94  TYR E CD2 1 
ATOM   3794 C CE1 . TYR C 3 94  ? 45.367  29.373  -49.457 1.00 68.52  ? 94  TYR E CE1 1 
ATOM   3795 C CE2 . TYR C 3 94  ? 44.000  28.256  -47.843 1.00 71.35  ? 94  TYR E CE2 1 
ATOM   3796 C CZ  . TYR C 3 94  ? 45.226  28.762  -48.227 1.00 74.05  ? 94  TYR E CZ  1 
ATOM   3797 O OH  . TYR C 3 94  ? 46.276  28.641  -47.365 1.00 72.81  ? 94  TYR E OH  1 
ATOM   3798 N N   . TYR C 3 95  ? 40.071  26.397  -52.577 1.00 66.46  ? 95  TYR E N   1 
ATOM   3799 C CA  . TYR C 3 95  ? 38.813  26.070  -53.257 1.00 66.55  ? 95  TYR E CA  1 
ATOM   3800 C C   . TYR C 3 95  ? 37.724  25.973  -52.224 1.00 74.32  ? 95  TYR E C   1 
ATOM   3801 O O   . TYR C 3 95  ? 37.958  25.363  -51.172 1.00 75.31  ? 95  TYR E O   1 
ATOM   3802 C CB  . TYR C 3 95  ? 38.857  24.686  -53.990 1.00 66.15  ? 95  TYR E CB  1 
ATOM   3803 C CG  . TYR C 3 95  ? 40.034  24.454  -54.912 1.00 65.64  ? 95  TYR E CG  1 
ATOM   3804 C CD1 . TYR C 3 95  ? 39.977  24.817  -56.253 1.00 67.28  ? 95  TYR E CD1 1 
ATOM   3805 C CD2 . TYR C 3 95  ? 41.201  23.853  -54.447 1.00 65.38  ? 95  TYR E CD2 1 
ATOM   3806 C CE1 . TYR C 3 95  ? 41.083  24.671  -57.087 1.00 67.84  ? 95  TYR E CE1 1 
ATOM   3807 C CE2 . TYR C 3 95  ? 42.308  23.684  -55.273 1.00 65.61  ? 95  TYR E CE2 1 
ATOM   3808 C CZ  . TYR C 3 95  ? 42.245  24.091  -56.595 1.00 77.00  ? 95  TYR E CZ  1 
ATOM   3809 O OH  . TYR C 3 95  ? 43.346  23.915  -57.412 1.00 83.20  ? 95  TYR E OH  1 
ATOM   3810 N N   . CYS C 3 96  ? 36.522  26.503  -52.526 1.00 73.54  ? 96  CYS E N   1 
ATOM   3811 C CA  . CYS C 3 96  ? 35.359  26.240  -51.685 1.00 75.55  ? 96  CYS E CA  1 
ATOM   3812 C C   . CYS C 3 96  ? 34.712  25.085  -52.389 1.00 74.19  ? 96  CYS E C   1 
ATOM   3813 O O   . CYS C 3 96  ? 34.691  25.050  -53.626 1.00 72.25  ? 96  CYS E O   1 
ATOM   3814 C CB  . CYS C 3 96  ? 34.407  27.427  -51.535 1.00 78.55  ? 96  CYS E CB  1 
ATOM   3815 S SG  . CYS C 3 96  ? 33.777  28.097  -53.099 1.00 83.95  ? 96  CYS E SG  1 
ATOM   3816 N N   . VAL C 3 97  ? 34.290  24.084  -51.626 1.00 68.28  ? 97  VAL E N   1 
ATOM   3817 C CA  . VAL C 3 97  ? 33.692  22.902  -52.223 1.00 66.57  ? 97  VAL E CA  1 
ATOM   3818 C C   . VAL C 3 97  ? 32.364  22.514  -51.524 1.00 65.79  ? 97  VAL E C   1 
ATOM   3819 O O   . VAL C 3 97  ? 32.279  22.571  -50.307 1.00 63.93  ? 97  VAL E O   1 
ATOM   3820 C CB  . VAL C 3 97  ? 34.715  21.757  -52.318 1.00 70.72  ? 97  VAL E CB  1 
ATOM   3821 C CG1 . VAL C 3 97  ? 35.335  21.420  -50.969 1.00 70.54  ? 97  VAL E CG1 1 
ATOM   3822 C CG2 . VAL C 3 97  ? 34.094  20.531  -52.935 1.00 70.99  ? 97  VAL E CG2 1 
ATOM   3823 N N   . ARG C 3 98  ? 31.329  22.179  -52.316 1.00 61.57  ? 98  ARG E N   1 
ATOM   3824 C CA  . ARG C 3 98  ? 30.002  21.790  -51.826 1.00 62.32  ? 98  ARG E CA  1 
ATOM   3825 C C   . ARG C 3 98  ? 29.985  20.357  -51.256 1.00 67.12  ? 98  ARG E C   1 
ATOM   3826 O O   . ARG C 3 98  ? 30.516  19.417  -51.866 1.00 68.11  ? 98  ARG E O   1 
ATOM   3827 C CB  . ARG C 3 98  ? 28.949  21.934  -52.945 1.00 61.67  ? 98  ARG E CB  1 
ATOM   3828 C CG  . ARG C 3 98  ? 27.525  21.555  -52.539 1.00 64.11  ? 98  ARG E CG  1 
ATOM   3829 C CD  . ARG C 3 98  ? 26.574  21.739  -53.706 1.00 80.05  ? 98  ARG E CD  1 
ATOM   3830 N NE  . ARG C 3 98  ? 26.158  20.471  -54.315 1.00 89.74  ? 98  ARG E NE  1 
ATOM   3831 C CZ  . ARG C 3 98  ? 25.004  20.301  -54.959 1.00 101.20 ? 98  ARG E CZ  1 
ATOM   3832 N NH1 . ARG C 3 98  ? 24.697  19.122  -55.477 1.00 99.57  ? 98  ARG E NH1 1 
ATOM   3833 N NH2 . ARG C 3 98  ? 24.139  21.300  -55.067 1.00 74.45  ? 98  ARG E NH2 1 
ATOM   3834 N N   . GLY C 3 99  ? 29.333  20.198  -50.116 1.00 61.61  ? 99  GLY E N   1 
ATOM   3835 C CA  . GLY C 3 99  ? 29.214  18.895  -49.486 1.00 60.95  ? 99  GLY E CA  1 
ATOM   3836 C C   . GLY C 3 99  ? 27.836  18.306  -49.673 1.00 64.17  ? 99  GLY E C   1 
ATOM   3837 O O   . GLY C 3 99  ? 26.901  18.683  -48.977 1.00 65.32  ? 99  GLY E O   1 
ATOM   3838 N N   . SER C 3 100 ? 27.671  17.415  -50.610 1.00 59.50  ? 100 SER E N   1 
ATOM   3839 C CA  . SER C 3 100 ? 26.364  16.810  -50.732 1.00 60.31  ? 100 SER E CA  1 
ATOM   3840 C C   . SER C 3 100 ? 26.412  15.344  -50.172 1.00 69.07  ? 100 SER E C   1 
ATOM   3841 O O   . SER C 3 100 ? 27.452  14.883  -49.666 1.00 69.58  ? 100 SER E O   1 
ATOM   3842 C CB  . SER C 3 100 ? 25.919  16.824  -52.177 1.00 63.05  ? 100 SER E CB  1 
ATOM   3843 O OG  . SER C 3 100 ? 26.293  15.580  -52.735 1.00 70.97  ? 100 SER E OG  1 
ATOM   3844 N N   . SER C 3 101 ? 25.295  14.611  -50.283 1.00 66.69  ? 101 SER E N   1 
ATOM   3845 C CA  . SER C 3 101 ? 25.248  13.219  -49.853 1.00 67.19  ? 101 SER E CA  1 
ATOM   3846 C C   . SER C 3 101 ? 26.224  12.401  -50.718 1.00 72.28  ? 101 SER E C   1 
ATOM   3847 O O   . SER C 3 101 ? 26.678  11.350  -50.270 1.00 75.62  ? 101 SER E O   1 
ATOM   3848 C CB  . SER C 3 101 ? 23.845  12.665  -50.016 1.00 70.61  ? 101 SER E CB  1 
ATOM   3849 O OG  . SER C 3 101 ? 23.518  12.760  -51.394 1.00 83.10  ? 101 SER E OG  1 
ATOM   3850 N N   . ARG C 3 102 ? 26.532  12.873  -51.948 1.00 65.06  ? 102 ARG E N   1 
ATOM   3851 C CA  . ARG C 3 102 ? 27.457  12.207  -52.870 1.00 63.59  ? 102 ARG E CA  1 
ATOM   3852 C C   . ARG C 3 102 ? 28.892  12.744  -52.678 1.00 72.03  ? 102 ARG E C   1 
ATOM   3853 O O   . ARG C 3 102 ? 29.691  12.699  -53.607 1.00 73.15  ? 102 ARG E O   1 
ATOM   3854 C CB  . ARG C 3 102 ? 26.976  12.343  -54.341 1.00 56.68  ? 102 ARG E CB  1 
ATOM   3855 N N   . GLY C 3 103 ? 29.210  13.247  -51.486 1.00 70.11  ? 103 GLY E N   1 
ATOM   3856 C CA  . GLY C 3 103 ? 30.528  13.811  -51.193 1.00 69.86  ? 103 GLY E CA  1 
ATOM   3857 C C   . GLY C 3 103 ? 30.683  15.197  -51.775 1.00 73.61  ? 103 GLY E C   1 
ATOM   3858 O O   . GLY C 3 103 ? 29.710  15.953  -51.829 1.00 74.34  ? 103 GLY E O   1 
ATOM   3859 N N   . PHE C 3 104 ? 31.893  15.544  -52.225 1.00 69.26  ? 104 PHE E N   1 
ATOM   3860 C CA  . PHE C 3 104 ? 32.166  16.851  -52.821 1.00 68.64  ? 104 PHE E CA  1 
ATOM   3861 C C   . PHE C 3 104 ? 31.705  16.869  -54.274 1.00 74.19  ? 104 PHE E C   1 
ATOM   3862 O O   . PHE C 3 104 ? 32.464  16.519  -55.180 1.00 75.13  ? 104 PHE E O   1 
ATOM   3863 C CB  . PHE C 3 104 ? 33.657  17.202  -52.749 1.00 70.03  ? 104 PHE E CB  1 
ATOM   3864 C CG  . PHE C 3 104 ? 34.273  17.198  -51.379 1.00 70.87  ? 104 PHE E CG  1 
ATOM   3865 C CD1 . PHE C 3 104 ? 33.485  17.378  -50.238 1.00 73.09  ? 104 PHE E CD1 1 
ATOM   3866 C CD2 . PHE C 3 104 ? 35.645  17.037  -51.223 1.00 72.39  ? 104 PHE E CD2 1 
ATOM   3867 C CE1 . PHE C 3 104 ? 34.058  17.378  -48.961 1.00 73.85  ? 104 PHE E CE1 1 
ATOM   3868 C CE2 . PHE C 3 104 ? 36.219  17.035  -49.948 1.00 75.71  ? 104 PHE E CE2 1 
ATOM   3869 C CZ  . PHE C 3 104 ? 35.422  17.216  -48.822 1.00 73.79  ? 104 PHE E CZ  1 
ATOM   3870 N N   . ASP C 3 105 ? 30.454  17.276  -54.476 1.00 69.34  ? 105 ASP E N   1 
ATOM   3871 C CA  . ASP C 3 105 ? 29.776  17.399  -55.747 1.00 68.44  ? 105 ASP E CA  1 
ATOM   3872 C C   . ASP C 3 105 ? 30.439  18.430  -56.664 1.00 73.56  ? 105 ASP E C   1 
ATOM   3873 O O   . ASP C 3 105 ? 30.749  18.128  -57.835 1.00 75.96  ? 105 ASP E O   1 
ATOM   3874 C CB  . ASP C 3 105 ? 28.348  17.862  -55.456 1.00 70.34  ? 105 ASP E CB  1 
ATOM   3875 C CG  . ASP C 3 105 ? 27.353  16.754  -55.457 1.00 89.93  ? 105 ASP E CG  1 
ATOM   3876 O OD1 . ASP C 3 105 ? 27.660  15.692  -54.909 1.00 94.39  ? 105 ASP E OD1 1 
ATOM   3877 O OD2 . ASP C 3 105 ? 26.265  16.939  -56.018 1.00 99.09  ? 105 ASP E OD2 1 
ATOM   3878 N N   . TYR C 3 106 ? 30.608  19.660  -56.150 1.00 66.37  ? 106 TYR E N   1 
ATOM   3879 C CA  . TYR C 3 106 ? 31.074  20.780  -56.939 1.00 66.04  ? 106 TYR E CA  1 
ATOM   3880 C C   . TYR C 3 106 ? 32.070  21.648  -56.211 1.00 70.86  ? 106 TYR E C   1 
ATOM   3881 O O   . TYR C 3 106 ? 31.897  21.921  -55.018 1.00 72.65  ? 106 TYR E O   1 
ATOM   3882 C CB  . TYR C 3 106 ? 29.874  21.649  -57.335 1.00 66.95  ? 106 TYR E CB  1 
ATOM   3883 C CG  . TYR C 3 106 ? 28.832  20.928  -58.153 1.00 68.07  ? 106 TYR E CG  1 
ATOM   3884 C CD1 . TYR C 3 106 ? 28.917  20.895  -59.543 1.00 70.05  ? 106 TYR E CD1 1 
ATOM   3885 C CD2 . TYR C 3 106 ? 27.718  20.338  -57.549 1.00 68.30  ? 106 TYR E CD2 1 
ATOM   3886 C CE1 . TYR C 3 106 ? 27.957  20.243  -60.316 1.00 71.99  ? 106 TYR E CE1 1 
ATOM   3887 C CE2 . TYR C 3 106 ? 26.748  19.684  -58.304 1.00 69.89  ? 106 TYR E CE2 1 
ATOM   3888 C CZ  . TYR C 3 106 ? 26.877  19.630  -59.693 1.00 83.38  ? 106 TYR E CZ  1 
ATOM   3889 O OH  . TYR C 3 106 ? 25.947  18.993  -60.495 1.00 87.93  ? 106 TYR E OH  1 
ATOM   3890 N N   . TRP C 3 107 ? 33.050  22.171  -56.964 1.00 63.55  ? 107 TRP E N   1 
ATOM   3891 C CA  . TRP C 3 107 ? 34.129  23.013  -56.473 1.00 61.63  ? 107 TRP E CA  1 
ATOM   3892 C C   . TRP C 3 107 ? 34.183  24.335  -57.261 1.00 65.29  ? 107 TRP E C   1 
ATOM   3893 O O   . TRP C 3 107 ? 33.961  24.347  -58.473 1.00 62.73  ? 107 TRP E O   1 
ATOM   3894 C CB  . TRP C 3 107 ? 35.474  22.300  -56.706 1.00 59.51  ? 107 TRP E CB  1 
ATOM   3895 C CG  . TRP C 3 107 ? 35.681  20.934  -56.118 1.00 59.02  ? 107 TRP E CG  1 
ATOM   3896 C CD1 . TRP C 3 107 ? 34.956  19.815  -56.375 1.00 62.07  ? 107 TRP E CD1 1 
ATOM   3897 C CD2 . TRP C 3 107 ? 36.833  20.503  -55.381 1.00 58.18  ? 107 TRP E CD2 1 
ATOM   3898 N NE1 . TRP C 3 107 ? 35.499  18.739  -55.715 1.00 62.58  ? 107 TRP E NE1 1 
ATOM   3899 C CE2 . TRP C 3 107 ? 36.675  19.131  -55.123 1.00 64.15  ? 107 TRP E CE2 1 
ATOM   3900 C CE3 . TRP C 3 107 ? 37.961  21.161  -54.857 1.00 59.05  ? 107 TRP E CE3 1 
ATOM   3901 C CZ2 . TRP C 3 107 ? 37.589  18.412  -54.328 1.00 64.11  ? 107 TRP E CZ2 1 
ATOM   3902 C CZ3 . TRP C 3 107 ? 38.863  20.458  -54.078 1.00 60.30  ? 107 TRP E CZ3 1 
ATOM   3903 C CH2 . TRP C 3 107 ? 38.691  19.099  -53.840 1.00 61.77  ? 107 TRP E CH2 1 
ATOM   3904 N N   . GLY C 3 108 ? 34.542  25.420  -56.565 1.00 63.69  ? 108 GLY E N   1 
ATOM   3905 C CA  . GLY C 3 108 ? 34.723  26.754  -57.135 1.00 62.43  ? 108 GLY E CA  1 
ATOM   3906 C C   . GLY C 3 108 ? 36.016  26.812  -57.913 1.00 66.33  ? 108 GLY E C   1 
ATOM   3907 O O   . GLY C 3 108 ? 36.899  25.981  -57.687 1.00 65.47  ? 108 GLY E O   1 
ATOM   3908 N N   . GLN C 3 109 ? 36.147  27.799  -58.834 1.00 64.16  ? 109 GLN E N   1 
ATOM   3909 C CA  . GLN C 3 109 ? 37.327  28.003  -59.706 1.00 63.92  ? 109 GLN E CA  1 
ATOM   3910 C C   . GLN C 3 109 ? 38.680  27.999  -58.955 1.00 69.66  ? 109 GLN E C   1 
ATOM   3911 O O   . GLN C 3 109 ? 39.694  27.640  -59.566 1.00 72.72  ? 109 GLN E O   1 
ATOM   3912 C CB  . GLN C 3 109 ? 37.186  29.269  -60.585 1.00 64.91  ? 109 GLN E CB  1 
ATOM   3913 C CG  . GLN C 3 109 ? 37.512  30.601  -59.897 1.00 74.40  ? 109 GLN E CG  1 
ATOM   3914 C CD  . GLN C 3 109 ? 36.376  31.215  -59.087 1.00 79.72  ? 109 GLN E CD  1 
ATOM   3915 O OE1 . GLN C 3 109 ? 35.610  30.526  -58.402 1.00 73.33  ? 109 GLN E OE1 1 
ATOM   3916 N NE2 . GLN C 3 109 ? 36.262  32.553  -59.134 1.00 59.66  ? 109 GLN E NE2 1 
ATOM   3917 N N   . GLY C 3 110 ? 38.666  28.327  -57.656 1.00 62.62  ? 110 GLY E N   1 
ATOM   3918 C CA  . GLY C 3 110 ? 39.856  28.378  -56.826 1.00 61.66  ? 110 GLY E CA  1 
ATOM   3919 C C   . GLY C 3 110 ? 40.271  29.809  -56.650 1.00 66.52  ? 110 GLY E C   1 
ATOM   3920 O O   . GLY C 3 110 ? 39.874  30.650  -57.449 1.00 67.86  ? 110 GLY E O   1 
ATOM   3921 N N   . THR C 3 111 ? 41.014  30.113  -55.585 1.00 63.38  ? 111 THR E N   1 
ATOM   3922 C CA  . THR C 3 111 ? 41.476  31.468  -55.270 1.00 63.37  ? 111 THR E CA  1 
ATOM   3923 C C   . THR C 3 111 ? 42.951  31.392  -54.945 1.00 71.36  ? 111 THR E C   1 
ATOM   3924 O O   . THR C 3 111 ? 43.317  30.668  -54.023 1.00 72.34  ? 111 THR E O   1 
ATOM   3925 C CB  . THR C 3 111 ? 40.680  32.034  -54.078 1.00 66.84  ? 111 THR E CB  1 
ATOM   3926 O OG1 . THR C 3 111 ? 39.318  32.147  -54.459 1.00 69.99  ? 111 THR E OG1 1 
ATOM   3927 C CG2 . THR C 3 111 ? 41.204  33.402  -53.577 1.00 62.00  ? 111 THR E CG2 1 
ATOM   3928 N N   . LEU C 3 112 ? 43.795  32.142  -55.668 1.00 70.31  ? 112 LEU E N   1 
ATOM   3929 C CA  . LEU C 3 112 ? 45.219  32.134  -55.373 1.00 72.11  ? 112 LEU E CA  1 
ATOM   3930 C C   . LEU C 3 112 ? 45.570  33.082  -54.236 1.00 77.49  ? 112 LEU E C   1 
ATOM   3931 O O   . LEU C 3 112 ? 45.483  34.317  -54.395 1.00 77.79  ? 112 LEU E O   1 
ATOM   3932 C CB  . LEU C 3 112 ? 46.051  32.484  -56.619 1.00 73.53  ? 112 LEU E CB  1 
ATOM   3933 C CG  . LEU C 3 112 ? 47.590  32.561  -56.430 1.00 80.52  ? 112 LEU E CG  1 
ATOM   3934 C CD1 . LEU C 3 112 ? 48.227  31.157  -56.397 1.00 81.06  ? 112 LEU E CD1 1 
ATOM   3935 C CD2 . LEU C 3 112 ? 48.242  33.456  -57.500 1.00 85.22  ? 112 LEU E CD2 1 
ATOM   3936 N N   . VAL C 3 113 ? 46.024  32.507  -53.111 1.00 73.64  ? 113 VAL E N   1 
ATOM   3937 C CA  . VAL C 3 113 ? 46.528  33.291  -51.990 1.00 74.08  ? 113 VAL E CA  1 
ATOM   3938 C C   . VAL C 3 113 ? 48.061  33.124  -51.981 1.00 82.14  ? 113 VAL E C   1 
ATOM   3939 O O   . VAL C 3 113 ? 48.567  32.004  -51.817 1.00 82.82  ? 113 VAL E O   1 
ATOM   3940 C CB  . VAL C 3 113 ? 45.869  32.986  -50.633 1.00 76.69  ? 113 VAL E CB  1 
ATOM   3941 C CG1 . VAL C 3 113 ? 46.375  33.953  -49.565 1.00 76.01  ? 113 VAL E CG1 1 
ATOM   3942 C CG2 . VAL C 3 113 ? 44.350  33.057  -50.743 1.00 76.39  ? 113 VAL E CG2 1 
ATOM   3943 N N   . THR C 3 114 ? 48.778  34.217  -52.290 1.00 79.20  ? 114 THR E N   1 
ATOM   3944 C CA  . THR C 3 114 ? 50.242  34.251  -52.355 1.00 79.53  ? 114 THR E CA  1 
ATOM   3945 C C   . THR C 3 114 ? 50.711  34.993  -51.094 1.00 85.64  ? 114 THR E C   1 
ATOM   3946 O O   . THR C 3 114 ? 50.312  36.148  -50.867 1.00 86.24  ? 114 THR E O   1 
ATOM   3947 C CB  . THR C 3 114 ? 50.758  34.830  -53.720 1.00 81.92  ? 114 THR E CB  1 
ATOM   3948 O OG1 . THR C 3 114 ? 49.687  35.395  -54.482 1.00 83.50  ? 114 THR E OG1 1 
ATOM   3949 C CG2 . THR C 3 114 ? 51.386  33.789  -54.581 1.00 77.40  ? 114 THR E CG2 1 
ATOM   3950 N N   . VAL C 3 115 ? 51.477  34.302  -50.234 1.00 81.32  ? 115 VAL E N   1 
ATOM   3951 C CA  . VAL C 3 115 ? 51.966  34.829  -48.958 1.00 80.79  ? 115 VAL E CA  1 
ATOM   3952 C C   . VAL C 3 115 ? 53.480  34.968  -48.958 1.00 87.03  ? 115 VAL E C   1 
ATOM   3953 O O   . VAL C 3 115 ? 54.206  33.977  -48.935 1.00 86.69  ? 115 VAL E O   1 
ATOM   3954 C CB  . VAL C 3 115 ? 51.450  34.034  -47.723 1.00 83.43  ? 115 VAL E CB  1 
ATOM   3955 C CG1 . VAL C 3 115 ? 52.002  34.614  -46.424 1.00 83.04  ? 115 VAL E CG1 1 
ATOM   3956 C CG2 . VAL C 3 115 ? 49.927  33.973  -47.688 1.00 82.80  ? 115 VAL E CG2 1 
ATOM   3957 N N   . SER C 3 116 ? 53.950  36.211  -48.953 1.00 86.37  ? 116 SER E N   1 
ATOM   3958 C CA  . SER C 3 116 ? 55.371  36.530  -48.902 1.00 87.39  ? 116 SER E CA  1 
ATOM   3959 C C   . SER C 3 116 ? 55.588  37.957  -48.414 1.00 94.47  ? 116 SER E C   1 
ATOM   3960 O O   . SER C 3 116 ? 54.654  38.769  -48.374 1.00 92.79  ? 116 SER E O   1 
ATOM   3961 C CB  . SER C 3 116 ? 56.007  36.384  -50.279 1.00 90.52  ? 116 SER E CB  1 
ATOM   3962 O OG  . SER C 3 116 ? 56.071  37.653  -50.905 1.00 95.51  ? 116 SER E OG  1 
ATOM   3963 N N   . SER C 3 117 ? 56.863  38.253  -48.122 1.00 93.87  ? 117 SER E N   1 
ATOM   3964 C CA  . SER C 3 117 ? 57.404  39.535  -47.695 1.00 94.89  ? 117 SER E CA  1 
ATOM   3965 C C   . SER C 3 117 ? 57.535  40.470  -48.910 1.00 100.31 ? 117 SER E C   1 
ATOM   3966 O O   . SER C 3 117 ? 57.573  41.691  -48.731 1.00 99.59  ? 117 SER E O   1 
ATOM   3967 C CB  . SER C 3 117 ? 58.776  39.311  -47.072 1.00 99.40  ? 117 SER E CB  1 
ATOM   3968 O OG  . SER C 3 117 ? 59.481  38.351  -47.849 1.00 112.64 ? 117 SER E OG  1 
ATOM   3969 N N   . ALA C 3 118 ? 57.601  39.891  -50.145 1.00 97.61  ? 118 ALA E N   1 
ATOM   3970 C CA  . ALA C 3 118 ? 57.733  40.625  -51.417 1.00 97.77  ? 118 ALA E CA  1 
ATOM   3971 C C   . ALA C 3 118 ? 56.524  41.496  -51.746 1.00 102.82 ? 118 ALA E C   1 
ATOM   3972 O O   . ALA C 3 118 ? 55.452  41.308  -51.158 1.00 102.78 ? 118 ALA E O   1 
ATOM   3973 C CB  . ALA C 3 118 ? 57.998  39.655  -52.561 1.00 98.68  ? 118 ALA E CB  1 
ATOM   3974 N N   . SER C 3 119 ? 56.699  42.443  -52.692 1.00 99.65  ? 119 SER E N   1 
ATOM   3975 C CA  . SER C 3 119 ? 55.641  43.353  -53.130 1.00 99.41  ? 119 SER E CA  1 
ATOM   3976 C C   . SER C 3 119 ? 55.452  43.268  -54.621 1.00 101.68 ? 119 SER E C   1 
ATOM   3977 O O   . SER C 3 119 ? 56.432  43.068  -55.336 1.00 100.24 ? 119 SER E O   1 
ATOM   3978 C CB  . SER C 3 119 ? 55.950  44.781  -52.718 1.00 104.23 ? 119 SER E CB  1 
ATOM   3979 O OG  . SER C 3 119 ? 55.814  44.912  -51.313 1.00 117.72 ? 119 SER E OG  1 
ATOM   3980 N N   . THR C 3 120 ? 54.184  43.411  -55.088 1.00 98.61  ? 120 THR E N   1 
ATOM   3981 C CA  . THR C 3 120 ? 53.800  43.317  -56.506 1.00 98.48  ? 120 THR E CA  1 
ATOM   3982 C C   . THR C 3 120 ? 54.705  44.151  -57.388 1.00 102.86 ? 120 THR E C   1 
ATOM   3983 O O   . THR C 3 120 ? 54.936  45.319  -57.089 1.00 103.79 ? 120 THR E O   1 
ATOM   3984 C CB  . THR C 3 120 ? 52.300  43.590  -56.793 1.00 108.63 ? 120 THR E CB  1 
ATOM   3985 O OG1 . THR C 3 120 ? 52.017  44.983  -56.782 1.00 114.11 ? 120 THR E OG1 1 
ATOM   3986 C CG2 . THR C 3 120 ? 51.355  42.833  -55.870 1.00 110.42 ? 120 THR E CG2 1 
ATOM   3987 N N   . LYS C 3 121 ? 55.291  43.517  -58.414 1.00 99.96  ? 121 LYS E N   1 
ATOM   3988 C CA  . LYS C 3 121 ? 56.194  44.170  -59.350 1.00 100.77 ? 121 LYS E CA  1 
ATOM   3989 C C   . LYS C 3 121 ? 56.184  43.514  -60.731 1.00 106.71 ? 121 LYS E C   1 
ATOM   3990 O O   . LYS C 3 121 ? 55.857  42.337  -60.884 1.00 105.50 ? 121 LYS E O   1 
ATOM   3991 C CB  . LYS C 3 121 ? 57.619  44.316  -58.786 1.00 103.36 ? 121 LYS E CB  1 
ATOM   3992 C CG  . LYS C 3 121 ? 58.464  43.054  -58.733 1.00 114.94 ? 121 LYS E CG  1 
ATOM   3993 C CD  . LYS C 3 121 ? 59.708  43.307  -57.893 1.00 126.85 ? 121 LYS E CD  1 
ATOM   3994 C CE  . LYS C 3 121 ? 60.798  44.156  -58.521 1.00 133.42 ? 121 LYS E CE  1 
ATOM   3995 N NZ  . LYS C 3 121 ? 61.599  44.863  -57.482 1.00 134.19 ? 121 LYS E NZ  1 
ATOM   3996 N N   . GLY C 3 122 ? 56.506  44.323  -61.729 1.00 105.07 ? 122 GLY E N   1 
ATOM   3997 C CA  . GLY C 3 122 ? 56.541  43.886  -63.111 1.00 104.97 ? 122 GLY E CA  1 
ATOM   3998 C C   . GLY C 3 122 ? 57.799  43.113  -63.411 1.00 108.51 ? 122 GLY E C   1 
ATOM   3999 O O   . GLY C 3 122 ? 58.789  43.230  -62.682 1.00 108.09 ? 122 GLY E O   1 
ATOM   4000 N N   . PRO C 3 123 ? 57.790  42.326  -64.496 1.00 105.17 ? 123 PRO E N   1 
ATOM   4001 C CA  . PRO C 3 123 ? 59.000  41.589  -64.864 1.00 105.17 ? 123 PRO E CA  1 
ATOM   4002 C C   . PRO C 3 123 ? 59.858  42.377  -65.828 1.00 110.41 ? 123 PRO E C   1 
ATOM   4003 O O   . PRO C 3 123 ? 59.373  43.292  -66.507 1.00 109.67 ? 123 PRO E O   1 
ATOM   4004 C CB  . PRO C 3 123 ? 58.456  40.366  -65.586 1.00 106.77 ? 123 PRO E CB  1 
ATOM   4005 C CG  . PRO C 3 123 ? 57.004  40.693  -65.926 1.00 111.28 ? 123 PRO E CG  1 
ATOM   4006 C CD  . PRO C 3 123 ? 56.695  42.069  -65.448 1.00 106.71 ? 123 PRO E CD  1 
ATOM   4007 N N   . SER C 3 124 ? 61.126  42.000  -65.916 1.00 107.36 ? 124 SER E N   1 
ATOM   4008 C CA  . SER C 3 124 ? 62.016  42.586  -66.906 1.00 106.90 ? 124 SER E CA  1 
ATOM   4009 C C   . SER C 3 124 ? 62.183  41.489  -67.978 1.00 108.30 ? 124 SER E C   1 
ATOM   4010 O O   . SER C 3 124 ? 62.520  40.335  -67.653 1.00 108.23 ? 124 SER E O   1 
ATOM   4011 C CB  . SER C 3 124 ? 63.329  43.091  -66.300 1.00 110.63 ? 124 SER E CB  1 
ATOM   4012 O OG  . SER C 3 124 ? 63.640  42.579  -65.013 1.00 120.35 ? 124 SER E OG  1 
ATOM   4013 N N   . VAL C 3 125 ? 61.795  41.825  -69.227 1.00 101.49 ? 125 VAL E N   1 
ATOM   4014 C CA  . VAL C 3 125 ? 61.788  40.922  -70.382 1.00 99.55  ? 125 VAL E CA  1 
ATOM   4015 C C   . VAL C 3 125 ? 63.079  41.040  -71.199 1.00 103.23 ? 125 VAL E C   1 
ATOM   4016 O O   . VAL C 3 125 ? 63.358  42.104  -71.771 1.00 103.45 ? 125 VAL E O   1 
ATOM   4017 C CB  . VAL C 3 125 ? 60.530  41.156  -71.247 1.00 102.23 ? 125 VAL E CB  1 
ATOM   4018 C CG1 . VAL C 3 125 ? 60.498  40.219  -72.441 1.00 101.61 ? 125 VAL E CG1 1 
ATOM   4019 C CG2 . VAL C 3 125 ? 59.257  41.020  -70.418 1.00 102.08 ? 125 VAL E CG2 1 
ATOM   4020 N N   . PHE C 3 126 ? 63.852  39.936  -71.267 1.00 98.30  ? 126 PHE E N   1 
ATOM   4021 C CA  . PHE C 3 126 ? 65.122  39.883  -71.992 1.00 97.18  ? 126 PHE E CA  1 
ATOM   4022 C C   . PHE C 3 126 ? 65.079  38.891  -73.131 1.00 101.37 ? 126 PHE E C   1 
ATOM   4023 O O   . PHE C 3 126 ? 64.562  37.796  -72.932 1.00 100.51 ? 126 PHE E O   1 
ATOM   4024 C CB  . PHE C 3 126 ? 66.271  39.537  -71.047 1.00 98.30  ? 126 PHE E CB  1 
ATOM   4025 C CG  . PHE C 3 126 ? 66.301  40.389  -69.808 1.00 99.07  ? 126 PHE E CG  1 
ATOM   4026 C CD1 . PHE C 3 126 ? 66.570  41.756  -69.889 1.00 101.53 ? 126 PHE E CD1 1 
ATOM   4027 C CD2 . PHE C 3 126 ? 66.059  39.833  -68.560 1.00 100.24 ? 126 PHE E CD2 1 
ATOM   4028 C CE1 . PHE C 3 126 ? 66.591  42.550  -68.743 1.00 101.72 ? 126 PHE E CE1 1 
ATOM   4029 C CE2 . PHE C 3 126 ? 66.099  40.625  -67.411 1.00 103.24 ? 126 PHE E CE2 1 
ATOM   4030 C CZ  . PHE C 3 126 ? 66.382  41.974  -67.509 1.00 101.03 ? 126 PHE E CZ  1 
ATOM   4031 N N   . PRO C 3 127 ? 65.607  39.230  -74.328 1.00 98.75  ? 127 PRO E N   1 
ATOM   4032 C CA  . PRO C 3 127 ? 65.548  38.283  -75.437 1.00 98.89  ? 127 PRO E CA  1 
ATOM   4033 C C   . PRO C 3 127 ? 66.646  37.257  -75.326 1.00 105.23 ? 127 PRO E C   1 
ATOM   4034 O O   . PRO C 3 127 ? 67.787  37.616  -75.025 1.00 105.75 ? 127 PRO E O   1 
ATOM   4035 C CB  . PRO C 3 127 ? 65.751  39.156  -76.681 1.00 100.68 ? 127 PRO E CB  1 
ATOM   4036 C CG  . PRO C 3 127 ? 65.914  40.555  -76.206 1.00 105.35 ? 127 PRO E CG  1 
ATOM   4037 C CD  . PRO C 3 127 ? 66.244  40.486  -74.751 1.00 100.97 ? 127 PRO E CD  1 
ATOM   4038 N N   . LEU C 3 128 ? 66.280  35.983  -75.552 1.00 102.36 ? 128 LEU E N   1 
ATOM   4039 C CA  . LEU C 3 128 ? 67.153  34.820  -75.578 1.00 102.72 ? 128 LEU E CA  1 
ATOM   4040 C C   . LEU C 3 128 ? 67.430  34.563  -77.066 1.00 107.50 ? 128 LEU E C   1 
ATOM   4041 O O   . LEU C 3 128 ? 66.934  33.600  -77.661 1.00 107.04 ? 128 LEU E O   1 
ATOM   4042 C CB  . LEU C 3 128 ? 66.474  33.611  -74.915 1.00 103.04 ? 128 LEU E CB  1 
ATOM   4043 C CG  . LEU C 3 128 ? 66.206  33.702  -73.423 1.00 108.69 ? 128 LEU E CG  1 
ATOM   4044 C CD1 . LEU C 3 128 ? 65.118  32.753  -73.030 1.00 109.38 ? 128 LEU E CD1 1 
ATOM   4045 C CD2 . LEU C 3 128 ? 67.461  33.408  -72.609 1.00 112.43 ? 128 LEU E CD2 1 
ATOM   4046 N N   . ALA C 3 129 ? 68.198  35.486  -77.671 1.00 103.85 ? 129 ALA E N   1 
ATOM   4047 C CA  . ALA C 3 129 ? 68.561  35.492  -79.079 1.00 103.10 ? 129 ALA E CA  1 
ATOM   4048 C C   . ALA C 3 129 ? 69.066  34.137  -79.615 1.00 105.29 ? 129 ALA E C   1 
ATOM   4049 O O   . ALA C 3 129 ? 69.739  33.392  -78.891 1.00 102.61 ? 129 ALA E O   1 
ATOM   4050 C CB  . ALA C 3 129 ? 69.571  36.594  -79.349 1.00 103.91 ? 129 ALA E CB  1 
ATOM   4051 N N   . PRO C 3 130 ? 68.714  33.818  -80.887 1.00 104.08 ? 130 PRO E N   1 
ATOM   4052 C CA  . PRO C 3 130 ? 69.155  32.546  -81.486 1.00 104.66 ? 130 PRO E CA  1 
ATOM   4053 C C   . PRO C 3 130 ? 70.576  32.587  -82.052 1.00 108.18 ? 130 PRO E C   1 
ATOM   4054 O O   . PRO C 3 130 ? 70.842  33.342  -82.977 1.00 106.89 ? 130 PRO E O   1 
ATOM   4055 C CB  . PRO C 3 130 ? 68.115  32.298  -82.594 1.00 106.62 ? 130 PRO E CB  1 
ATOM   4056 C CG  . PRO C 3 130 ? 67.284  33.563  -82.691 1.00 110.56 ? 130 PRO E CG  1 
ATOM   4057 C CD  . PRO C 3 130 ? 67.921  34.605  -81.853 1.00 105.95 ? 130 PRO E CD  1 
ATOM   4058 N N   . SER C 3 131 ? 71.471  31.749  -81.511 1.00 106.49 ? 131 SER E N   1 
ATOM   4059 C CA  . SER C 3 131 ? 72.883  31.625  -81.900 1.00 107.57 ? 131 SER E CA  1 
ATOM   4060 C C   . SER C 3 131 ? 73.157  30.300  -82.667 1.00 112.01 ? 131 SER E C   1 
ATOM   4061 O O   . SER C 3 131 ? 72.315  29.395  -82.627 1.00 110.29 ? 131 SER E O   1 
ATOM   4062 C CB  . SER C 3 131 ? 73.760  31.657  -80.647 1.00 111.70 ? 131 SER E CB  1 
ATOM   4063 O OG  . SER C 3 131 ? 73.582  30.496  -79.843 1.00 116.78 ? 131 SER E OG  1 
ATOM   4064 N N   . SER C 3 132 ? 74.363  30.151  -83.283 1.00 109.02 ? 132 SER E N   1 
ATOM   4065 C CA  . SER C 3 132 ? 74.722  28.891  -83.938 1.00 109.92 ? 132 SER E CA  1 
ATOM   4066 C C   . SER C 3 132 ? 74.761  27.718  -82.898 1.00 117.56 ? 132 SER E C   1 
ATOM   4067 O O   . SER C 3 132 ? 74.916  26.545  -83.285 1.00 118.39 ? 132 SER E O   1 
ATOM   4068 C CB  . SER C 3 132 ? 76.040  29.017  -84.694 1.00 112.86 ? 132 SER E CB  1 
ATOM   4069 O OG  . SER C 3 132 ? 77.161  28.854  -83.842 1.00 121.19 ? 132 SER E OG  1 
ATOM   4070 N N   . LYS C 3 133 ? 74.591  28.059  -81.582 1.00 114.02 ? 133 LYS E N   1 
ATOM   4071 C CA  . LYS C 3 133 ? 74.532  27.120  -80.459 1.00 113.94 ? 133 LYS E CA  1 
ATOM   4072 C C   . LYS C 3 133 ? 73.140  27.129  -79.780 1.00 119.15 ? 133 LYS E C   1 
ATOM   4073 O O   . LYS C 3 133 ? 72.973  26.740  -78.615 1.00 119.53 ? 133 LYS E O   1 
ATOM   4074 C CB  . LYS C 3 133 ? 75.693  27.279  -79.451 1.00 115.93 ? 133 LYS E CB  1 
ATOM   4075 C CG  . LYS C 3 133 ? 76.182  28.679  -79.113 1.00 124.93 ? 133 LYS E CG  1 
ATOM   4076 C CD  . LYS C 3 133 ? 77.568  28.597  -78.450 1.00 140.08 ? 133 LYS E CD  1 
ATOM   4077 C CE  . LYS C 3 133 ? 78.714  28.280  -79.406 1.00 160.23 ? 133 LYS E CE  1 
ATOM   4078 N NZ  . LYS C 3 133 ? 79.851  27.590  -78.730 1.00 170.69 ? 133 LYS E NZ  1 
ATOM   4079 N N   . SER C 3 134 ? 72.137  27.523  -80.579 1.00 114.82 ? 134 SER E N   1 
ATOM   4080 C CA  . SER C 3 134 ? 70.703  27.576  -80.294 1.00 113.19 ? 134 SER E CA  1 
ATOM   4081 C C   . SER C 3 134 ? 69.961  27.076  -81.589 1.00 116.51 ? 134 SER E C   1 
ATOM   4082 O O   . SER C 3 134 ? 68.728  27.102  -81.666 1.00 115.54 ? 134 SER E O   1 
ATOM   4083 C CB  . SER C 3 134 ? 70.317  28.999  -79.905 1.00 114.23 ? 134 SER E CB  1 
ATOM   4084 O OG  . SER C 3 134 ? 68.949  29.271  -80.129 1.00 117.24 ? 134 SER E OG  1 
ATOM   4085 N N   . THR C 3 135 ? 70.758  26.551  -82.576 1.00 112.07 ? 135 THR E N   1 
ATOM   4086 C CA  . THR C 3 135 ? 70.326  26.033  -83.878 1.00 110.55 ? 135 THR E CA  1 
ATOM   4087 C C   . THR C 3 135 ? 70.821  24.612  -84.126 1.00 117.09 ? 135 THR E C   1 
ATOM   4088 O O   . THR C 3 135 ? 72.032  24.385  -84.283 1.00 116.61 ? 135 THR E O   1 
ATOM   4089 C CB  . THR C 3 135 ? 70.865  26.911  -85.012 1.00 99.20  ? 135 THR E CB  1 
ATOM   4090 O OG1 . THR C 3 135 ? 70.912  28.270  -84.591 1.00 94.57  ? 135 THR E OG1 1 
ATOM   4091 C CG2 . THR C 3 135 ? 70.085  26.753  -86.308 1.00 88.91  ? 135 THR E CG2 1 
ATOM   4092 N N   . SER C 3 136 ? 69.865  23.676  -84.241 1.00 115.43 ? 136 SER E N   1 
ATOM   4093 C CA  . SER C 3 136 ? 70.095  22.268  -84.569 1.00 115.95 ? 136 SER E CA  1 
ATOM   4094 C C   . SER C 3 136 ? 69.238  21.898  -85.781 1.00 120.27 ? 136 SER E C   1 
ATOM   4095 O O   . SER C 3 136 ? 68.054  22.239  -85.847 1.00 118.92 ? 136 SER E O   1 
ATOM   4096 C CB  . SER C 3 136 ? 69.823  21.352  -83.377 1.00 119.65 ? 136 SER E CB  1 
ATOM   4097 O OG  . SER C 3 136 ? 71.020  20.777  -82.870 1.00 125.82 ? 136 SER E OG  1 
ATOM   4098 N N   . GLY C 3 137 ? 69.870  21.255  -86.748 1.00 118.45 ? 137 GLY E N   1 
ATOM   4099 C CA  . GLY C 3 137 ? 69.231  20.944  -88.017 1.00 118.66 ? 137 GLY E CA  1 
ATOM   4100 C C   . GLY C 3 137 ? 68.916  22.247  -88.724 1.00 121.72 ? 137 GLY E C   1 
ATOM   4101 O O   . GLY C 3 137 ? 69.728  23.184  -88.698 1.00 121.15 ? 137 GLY E O   1 
ATOM   4102 N N   . GLY C 3 138 ? 67.710  22.331  -89.269 1.00 116.93 ? 138 GLY E N   1 
ATOM   4103 C CA  . GLY C 3 138 ? 67.236  23.531  -89.948 1.00 115.68 ? 138 GLY E CA  1 
ATOM   4104 C C   . GLY C 3 138 ? 66.379  24.415  -89.072 1.00 115.97 ? 138 GLY E C   1 
ATOM   4105 O O   . GLY C 3 138 ? 65.840  25.409  -89.557 1.00 114.98 ? 138 GLY E O   1 
ATOM   4106 N N   . THR C 3 139 ? 66.275  24.056  -87.759 1.00 110.02 ? 139 THR E N   1 
ATOM   4107 C CA  . THR C 3 139 ? 65.479  24.733  -86.720 1.00 108.18 ? 139 THR E CA  1 
ATOM   4108 C C   . THR C 3 139 ? 66.361  25.488  -85.690 1.00 108.82 ? 139 THR E C   1 
ATOM   4109 O O   . THR C 3 139 ? 67.457  25.034  -85.361 1.00 109.42 ? 139 THR E O   1 
ATOM   4110 C CB  . THR C 3 139 ? 64.570  23.707  -86.009 1.00 107.99 ? 139 THR E CB  1 
ATOM   4111 O OG1 . THR C 3 139 ? 64.067  22.763  -86.959 1.00 107.67 ? 139 THR E OG1 1 
ATOM   4112 C CG2 . THR C 3 139 ? 63.412  24.354  -85.293 1.00 103.18 ? 139 THR E CG2 1 
ATOM   4113 N N   . ALA C 3 140 ? 65.850  26.610  -85.166 1.00 100.89 ? 140 ALA E N   1 
ATOM   4114 C CA  . ALA C 3 140 ? 66.545  27.398  -84.159 1.00 99.14  ? 140 ALA E CA  1 
ATOM   4115 C C   . ALA C 3 140 ? 65.591  27.810  -83.087 1.00 102.42 ? 140 ALA E C   1 
ATOM   4116 O O   . ALA C 3 140 ? 64.442  28.173  -83.369 1.00 102.64 ? 140 ALA E O   1 
ATOM   4117 C CB  . ALA C 3 140 ? 67.155  28.635  -84.784 1.00 99.67  ? 140 ALA E CB  1 
ATOM   4118 N N   . ALA C 3 141 ? 66.067  27.781  -81.844 1.00 97.85  ? 141 ALA E N   1 
ATOM   4119 C CA  . ALA C 3 141 ? 65.265  28.197  -80.700 1.00 96.88  ? 141 ALA E CA  1 
ATOM   4120 C C   . ALA C 3 141 ? 65.553  29.644  -80.386 1.00 100.89 ? 141 ALA E C   1 
ATOM   4121 O O   . ALA C 3 141 ? 66.586  30.191  -80.764 1.00 100.76 ? 141 ALA E O   1 
ATOM   4122 C CB  . ALA C 3 141 ? 65.559  27.331  -79.486 1.00 97.37  ? 141 ALA E CB  1 
ATOM   4123 N N   . LEU C 3 142 ? 64.612  30.269  -79.725 1.00 96.47  ? 142 LEU E N   1 
ATOM   4124 C CA  . LEU C 3 142 ? 64.680  31.648  -79.293 1.00 95.46  ? 142 LEU E CA  1 
ATOM   4125 C C   . LEU C 3 142 ? 63.584  31.794  -78.255 1.00 98.65  ? 142 LEU E C   1 
ATOM   4126 O O   . LEU C 3 142 ? 62.712  30.928  -78.159 1.00 96.45  ? 142 LEU E O   1 
ATOM   4127 C CB  . LEU C 3 142 ? 64.505  32.646  -80.465 1.00 95.33  ? 142 LEU E CB  1 
ATOM   4128 C CG  . LEU C 3 142 ? 63.233  32.533  -81.311 1.00 99.98  ? 142 LEU E CG  1 
ATOM   4129 C CD1 . LEU C 3 142 ? 62.275  33.635  -80.994 1.00 99.82  ? 142 LEU E CD1 1 
ATOM   4130 C CD2 . LEU C 3 142 ? 63.556  32.614  -82.766 1.00 103.12 ? 142 LEU E CD2 1 
ATOM   4131 N N   . GLY C 3 143 ? 63.643  32.865  -77.481 1.00 95.55  ? 143 GLY E N   1 
ATOM   4132 C CA  . GLY C 3 143 ? 62.660  33.081  -76.445 1.00 95.04  ? 143 GLY E CA  1 
ATOM   4133 C C   . GLY C 3 143 ? 62.916  34.304  -75.626 1.00 99.47  ? 143 GLY E C   1 
ATOM   4134 O O   . GLY C 3 143 ? 63.772  35.106  -75.965 1.00 98.65  ? 143 GLY E O   1 
ATOM   4135 N N   . CYS C 3 144 ? 62.161  34.451  -74.556 1.00 99.02  ? 144 CYS E N   1 
ATOM   4136 C CA  . CYS C 3 144 ? 62.270  35.582  -73.647 1.00 100.30 ? 144 CYS E CA  1 
ATOM   4137 C C   . CYS C 3 144 ? 62.484  35.128  -72.235 1.00 102.37 ? 144 CYS E C   1 
ATOM   4138 O O   . CYS C 3 144 ? 62.003  34.064  -71.840 1.00 102.87 ? 144 CYS E O   1 
ATOM   4139 C CB  . CYS C 3 144 ? 61.043  36.479  -73.752 1.00 101.97 ? 144 CYS E CB  1 
ATOM   4140 S SG  . CYS C 3 144 ? 60.955  37.432  -75.286 1.00 107.14 ? 144 CYS E SG  1 
ATOM   4141 N N   . LEU C 3 145 ? 63.181  35.941  -71.460 1.00 96.32  ? 145 LEU E N   1 
ATOM   4142 C CA  . LEU C 3 145 ? 63.359  35.634  -70.063 1.00 95.05  ? 145 LEU E CA  1 
ATOM   4143 C C   . LEU C 3 145 ? 62.491  36.623  -69.232 1.00 97.31  ? 145 LEU E C   1 
ATOM   4144 O O   . LEU C 3 145 ? 62.833  37.809  -69.059 1.00 97.18  ? 145 LEU E O   1 
ATOM   4145 C CB  . LEU C 3 145 ? 64.841  35.628  -69.673 1.00 94.64  ? 145 LEU E CB  1 
ATOM   4146 C CG  . LEU C 3 145 ? 65.122  35.292  -68.223 1.00 99.51  ? 145 LEU E CG  1 
ATOM   4147 C CD1 . LEU C 3 145 ? 65.585  33.890  -68.082 1.00 100.40 ? 145 LEU E CD1 1 
ATOM   4148 C CD2 . LEU C 3 145 ? 66.146  36.224  -67.650 1.00 102.79 ? 145 LEU E CD2 1 
ATOM   4149 N N   . VAL C 3 146 ? 61.319  36.137  -68.786 1.00 90.17  ? 146 VAL E N   1 
ATOM   4150 C CA  . VAL C 3 146 ? 60.429  36.939  -67.961 1.00 87.48  ? 146 VAL E CA  1 
ATOM   4151 C C   . VAL C 3 146 ? 61.062  36.793  -66.583 1.00 88.22  ? 146 VAL E C   1 
ATOM   4152 O O   . VAL C 3 146 ? 61.079  35.681  -66.043 1.00 86.54  ? 146 VAL E O   1 
ATOM   4153 C CB  . VAL C 3 146 ? 58.978  36.412  -68.023 1.00 90.54  ? 146 VAL E CB  1 
ATOM   4154 C CG1 . VAL C 3 146 ? 58.047  37.244  -67.137 1.00 90.41  ? 146 VAL E CG1 1 
ATOM   4155 C CG2 . VAL C 3 146 ? 58.470  36.373  -69.459 1.00 89.74  ? 146 VAL E CG2 1 
ATOM   4156 N N   . LYS C 3 147 ? 61.699  37.879  -66.082 1.00 84.05  ? 147 LYS E N   1 
ATOM   4157 C CA  . LYS C 3 147 ? 62.427  37.845  -64.804 1.00 83.29  ? 147 LYS E CA  1 
ATOM   4158 C C   . LYS C 3 147 ? 62.053  38.928  -63.755 1.00 86.98  ? 147 LYS E C   1 
ATOM   4159 O O   . LYS C 3 147 ? 61.822  40.100  -64.097 1.00 84.42  ? 147 LYS E O   1 
ATOM   4160 C CB  . LYS C 3 147 ? 63.936  37.895  -65.070 1.00 84.30  ? 147 LYS E CB  1 
ATOM   4161 C CG  . LYS C 3 147 ? 64.788  37.414  -63.912 1.00 81.29  ? 147 LYS E CG  1 
ATOM   4162 C CD  . LYS C 3 147 ? 66.237  37.623  -64.226 1.00 84.29  ? 147 LYS E CD  1 
ATOM   4163 C CE  . LYS C 3 147 ? 67.136  37.203  -63.106 1.00 82.26  ? 147 LYS E CE  1 
ATOM   4164 N NZ  . LYS C 3 147 ? 67.199  38.242  -62.057 1.00 75.66  ? 147 LYS E NZ  1 
ATOM   4165 N N   . ASP C 3 148 ? 62.067  38.493  -62.460 1.00 84.60  ? 148 ASP E N   1 
ATOM   4166 C CA  . ASP C 3 148 ? 61.881  39.258  -61.223 1.00 85.03  ? 148 ASP E CA  1 
ATOM   4167 C C   . ASP C 3 148 ? 60.532  39.948  -61.079 1.00 91.62  ? 148 ASP E C   1 
ATOM   4168 O O   . ASP C 3 148 ? 60.462  41.141  -60.755 1.00 92.62  ? 148 ASP E O   1 
ATOM   4169 C CB  . ASP C 3 148 ? 63.030  40.264  -61.013 1.00 86.89  ? 148 ASP E CB  1 
ATOM   4170 C CG  . ASP C 3 148 ? 64.396  39.639  -60.792 1.00 102.35 ? 148 ASP E CG  1 
ATOM   4171 O OD1 . ASP C 3 148 ? 64.453  38.439  -60.380 1.00 102.63 ? 148 ASP E OD1 1 
ATOM   4172 O OD2 . ASP C 3 148 ? 65.411  40.342  -61.022 1.00 110.81 ? 148 ASP E OD2 1 
ATOM   4173 N N   . TYR C 3 149 ? 59.465  39.182  -61.243 1.00 88.86  ? 149 TYR E N   1 
ATOM   4174 C CA  . TYR C 3 149 ? 58.119  39.702  -61.059 1.00 88.80  ? 149 TYR E CA  1 
ATOM   4175 C C   . TYR C 3 149 ? 57.487  39.076  -59.869 1.00 92.89  ? 149 TYR E C   1 
ATOM   4176 O O   . TYR C 3 149 ? 57.924  38.020  -59.401 1.00 92.20  ? 149 TYR E O   1 
ATOM   4177 C CB  . TYR C 3 149 ? 57.221  39.522  -62.282 1.00 90.33  ? 149 TYR E CB  1 
ATOM   4178 C CG  . TYR C 3 149 ? 56.893  38.086  -62.617 1.00 92.92  ? 149 TYR E CG  1 
ATOM   4179 C CD1 . TYR C 3 149 ? 57.729  37.330  -63.446 1.00 94.65  ? 149 TYR E CD1 1 
ATOM   4180 C CD2 . TYR C 3 149 ? 55.697  37.508  -62.188 1.00 93.59  ? 149 TYR E CD2 1 
ATOM   4181 C CE1 . TYR C 3 149 ? 57.396  36.017  -63.795 1.00 95.09  ? 149 TYR E CE1 1 
ATOM   4182 C CE2 . TYR C 3 149 ? 55.361  36.204  -62.521 1.00 94.19  ? 149 TYR E CE2 1 
ATOM   4183 C CZ  . TYR C 3 149 ? 56.213  35.457  -63.318 1.00 100.52 ? 149 TYR E CZ  1 
ATOM   4184 O OH  . TYR C 3 149 ? 55.883  34.158  -63.622 1.00 96.64  ? 149 TYR E OH  1 
ATOM   4185 N N   . PHE C 3 150 ? 56.390  39.704  -59.434 1.00 90.96  ? 150 PHE E N   1 
ATOM   4186 C CA  . PHE C 3 150 ? 55.613  39.265  -58.286 1.00 91.40  ? 150 PHE E CA  1 
ATOM   4187 C C   . PHE C 3 150 ? 54.194  39.815  -58.262 1.00 96.06  ? 150 PHE E C   1 
ATOM   4188 O O   . PHE C 3 150 ? 54.009  41.020  -58.361 1.00 96.92  ? 150 PHE E O   1 
ATOM   4189 C CB  . PHE C 3 150 ? 56.324  39.602  -56.961 1.00 93.86  ? 150 PHE E CB  1 
ATOM   4190 C CG  . PHE C 3 150 ? 55.641  39.053  -55.732 1.00 96.90  ? 150 PHE E CG  1 
ATOM   4191 C CD1 . PHE C 3 150 ? 54.638  39.785  -55.081 1.00 101.87 ? 150 PHE E CD1 1 
ATOM   4192 C CD2 . PHE C 3 150 ? 56.005  37.814  -55.214 1.00 99.81  ? 150 PHE E CD2 1 
ATOM   4193 C CE1 . PHE C 3 150 ? 53.986  39.274  -53.948 1.00 102.39 ? 150 PHE E CE1 1 
ATOM   4194 C CE2 . PHE C 3 150 ? 55.376  37.305  -54.073 1.00 104.20 ? 150 PHE E CE2 1 
ATOM   4195 C CZ  . PHE C 3 150 ? 54.356  38.040  -53.450 1.00 102.29 ? 150 PHE E CZ  1 
ATOM   4196 N N   . PRO C 3 151 ? 53.177  39.008  -58.009 1.00 92.03  ? 151 PRO E N   1 
ATOM   4197 C CA  . PRO C 3 151 ? 53.197  37.564  -57.827 1.00 90.90  ? 151 PRO E CA  1 
ATOM   4198 C C   . PRO C 3 151 ? 52.891  36.870  -59.166 1.00 91.75  ? 151 PRO E C   1 
ATOM   4199 O O   . PRO C 3 151 ? 52.924  37.519  -60.208 1.00 90.45  ? 151 PRO E O   1 
ATOM   4200 C CB  . PRO C 3 151 ? 52.083  37.390  -56.763 1.00 92.45  ? 151 PRO E CB  1 
ATOM   4201 C CG  . PRO C 3 151 ? 51.086  38.499  -57.006 1.00 96.66  ? 151 PRO E CG  1 
ATOM   4202 C CD  . PRO C 3 151 ? 51.767  39.522  -57.885 1.00 92.82  ? 151 PRO E CD  1 
ATOM   4203 N N   . GLU C 3 152 ? 52.575  35.579  -59.123 1.00 86.55  ? 152 GLU E N   1 
ATOM   4204 C CA  . GLU C 3 152 ? 52.132  34.997  -60.352 1.00 85.68  ? 152 GLU E CA  1 
ATOM   4205 C C   . GLU C 3 152 ? 50.648  35.438  -60.571 1.00 90.23  ? 152 GLU E C   1 
ATOM   4206 O O   . GLU C 3 152 ? 50.013  36.004  -59.651 1.00 88.84  ? 152 GLU E O   1 
ATOM   4207 C CB  . GLU C 3 152 ? 52.289  33.487  -60.325 1.00 86.57  ? 152 GLU E CB  1 
ATOM   4208 C CG  . GLU C 3 152 ? 53.207  33.033  -61.443 1.00 95.47  ? 152 GLU E CG  1 
ATOM   4209 C CD  . GLU C 3 152 ? 53.448  31.545  -61.499 1.00 135.66 ? 152 GLU E CD  1 
ATOM   4210 O OE1 . GLU C 3 152 ? 53.699  30.961  -60.421 1.00 143.59 ? 152 GLU E OE1 1 
ATOM   4211 O OE2 . GLU C 3 152 ? 53.389  30.960  -62.607 1.00 138.07 ? 152 GLU E OE2 1 
ATOM   4212 N N   . PRO C 3 153 ? 50.112  35.413  -61.814 1.00 86.92  ? 153 PRO E N   1 
ATOM   4213 C CA  . PRO C 3 153 ? 50.645  34.822  -63.019 1.00 86.73  ? 153 PRO E CA  1 
ATOM   4214 C C   . PRO C 3 153 ? 51.178  35.802  -64.061 1.00 91.91  ? 153 PRO E C   1 
ATOM   4215 O O   . PRO C 3 153 ? 50.914  37.019  -64.037 1.00 90.85  ? 153 PRO E O   1 
ATOM   4216 C CB  . PRO C 3 153 ? 49.407  34.082  -63.567 1.00 88.25  ? 153 PRO E CB  1 
ATOM   4217 C CG  . PRO C 3 153 ? 48.240  34.942  -63.171 1.00 91.82  ? 153 PRO E CG  1 
ATOM   4218 C CD  . PRO C 3 153 ? 48.689  35.798  -62.010 1.00 87.91  ? 153 PRO E CD  1 
ATOM   4219 N N   . VAL C 3 154 ? 51.914  35.248  -65.007 1.00 90.12  ? 154 VAL E N   1 
ATOM   4220 C CA  . VAL C 3 154 ? 52.411  35.991  -66.133 1.00 89.91  ? 154 VAL E CA  1 
ATOM   4221 C C   . VAL C 3 154 ? 51.939  35.291  -67.411 1.00 93.37  ? 154 VAL E C   1 
ATOM   4222 O O   . VAL C 3 154 ? 51.837  34.056  -67.443 1.00 91.68  ? 154 VAL E O   1 
ATOM   4223 C CB  . VAL C 3 154 ? 53.918  36.272  -66.041 1.00 93.77  ? 154 VAL E CB  1 
ATOM   4224 C CG1 . VAL C 3 154 ? 54.722  35.398  -67.014 1.00 93.70  ? 154 VAL E CG1 1 
ATOM   4225 C CG2 . VAL C 3 154 ? 54.177  37.755  -66.268 1.00 93.30  ? 154 VAL E CG2 1 
ATOM   4226 N N   . THR C 3 155 ? 51.503  36.093  -68.394 1.00 90.96  ? 155 THR E N   1 
ATOM   4227 C CA  . THR C 3 155 ? 50.986  35.600  -69.665 1.00 90.86  ? 155 THR E CA  1 
ATOM   4228 C C   . THR C 3 155 ? 51.975  35.919  -70.750 1.00 96.76  ? 155 THR E C   1 
ATOM   4229 O O   . THR C 3 155 ? 52.352  37.082  -70.922 1.00 97.46  ? 155 THR E O   1 
ATOM   4230 C CB  . THR C 3 155 ? 49.575  36.151  -69.948 1.00 92.50  ? 155 THR E CB  1 
ATOM   4231 O OG1 . THR C 3 155 ? 48.673  35.491  -69.060 1.00 97.84  ? 155 THR E OG1 1 
ATOM   4232 C CG2 . THR C 3 155 ? 49.113  35.943  -71.409 1.00 82.97  ? 155 THR E CG2 1 
ATOM   4233 N N   . VAL C 3 156 ? 52.406  34.879  -71.481 1.00 92.26  ? 156 VAL E N   1 
ATOM   4234 C CA  . VAL C 3 156 ? 53.319  35.051  -72.605 1.00 91.44  ? 156 VAL E CA  1 
ATOM   4235 C C   . VAL C 3 156 ? 52.639  34.574  -73.894 1.00 96.54  ? 156 VAL E C   1 
ATOM   4236 O O   . VAL C 3 156 ? 52.057  33.491  -73.927 1.00 95.98  ? 156 VAL E O   1 
ATOM   4237 C CB  . VAL C 3 156 ? 54.717  34.405  -72.387 1.00 93.94  ? 156 VAL E CB  1 
ATOM   4238 C CG1 . VAL C 3 156 ? 55.652  34.717  -73.556 1.00 93.22  ? 156 VAL E CG1 1 
ATOM   4239 C CG2 . VAL C 3 156 ? 55.337  34.845  -71.051 1.00 93.23  ? 156 VAL E CG2 1 
ATOM   4240 N N   . SER C 3 157 ? 52.677  35.416  -74.930 1.00 94.55  ? 157 SER E N   1 
ATOM   4241 C CA  . SER C 3 157 ? 52.176  35.112  -76.267 1.00 94.83  ? 157 SER E CA  1 
ATOM   4242 C C   . SER C 3 157 ? 53.311  35.417  -77.267 1.00 99.27  ? 157 SER E C   1 
ATOM   4243 O O   . SER C 3 157 ? 54.297  36.064  -76.890 1.00 98.26  ? 157 SER E O   1 
ATOM   4244 C CB  . SER C 3 157 ? 50.903  35.898  -76.568 1.00 97.66  ? 157 SER E CB  1 
ATOM   4245 O OG  . SER C 3 157 ? 51.179  37.170  -77.126 1.00 106.77 ? 157 SER E OG  1 
ATOM   4246 N N   . TRP C 3 158 ? 53.218  34.888  -78.495 1.00 95.99  ? 158 TRP E N   1 
ATOM   4247 C CA  . TRP C 3 158 ? 54.254  35.134  -79.498 1.00 95.97  ? 158 TRP E CA  1 
ATOM   4248 C C   . TRP C 3 158 ? 53.646  35.679  -80.754 1.00 102.12 ? 158 TRP E C   1 
ATOM   4249 O O   . TRP C 3 158 ? 52.736  35.053  -81.310 1.00 102.69 ? 158 TRP E O   1 
ATOM   4250 C CB  . TRP C 3 158 ? 55.083  33.876  -79.773 1.00 93.37  ? 158 TRP E CB  1 
ATOM   4251 C CG  . TRP C 3 158 ? 56.132  33.635  -78.726 1.00 94.04  ? 158 TRP E CG  1 
ATOM   4252 C CD1 . TRP C 3 158 ? 55.980  32.940  -77.562 1.00 96.69  ? 158 TRP E CD1 1 
ATOM   4253 C CD2 . TRP C 3 158 ? 57.479  34.134  -78.724 1.00 93.02  ? 158 TRP E CD2 1 
ATOM   4254 N NE1 . TRP C 3 158 ? 57.157  32.949  -76.847 1.00 96.01  ? 158 TRP E NE1 1 
ATOM   4255 C CE2 . TRP C 3 158 ? 58.095  33.676  -77.538 1.00 96.64  ? 158 TRP E CE2 1 
ATOM   4256 C CE3 . TRP C 3 158 ? 58.216  34.943  -79.595 1.00 94.02  ? 158 TRP E CE3 1 
ATOM   4257 C CZ2 . TRP C 3 158 ? 59.419  33.976  -77.218 1.00 95.20  ? 158 TRP E CZ2 1 
ATOM   4258 C CZ3 . TRP C 3 158 ? 59.523  35.255  -79.263 1.00 94.81  ? 158 TRP E CZ3 1 
ATOM   4259 C CH2 . TRP C 3 158 ? 60.118  34.751  -78.100 1.00 95.39  ? 158 TRP E CH2 1 
ATOM   4260 N N   . ASN C 3 159 ? 54.138  36.851  -81.205 1.00 99.54  ? 159 ASN E N   1 
ATOM   4261 C CA  . ASN C 3 159 ? 53.636  37.545  -82.393 1.00 100.14 ? 159 ASN E CA  1 
ATOM   4262 C C   . ASN C 3 159 ? 52.098  37.709  -82.291 1.00 106.05 ? 159 ASN E C   1 
ATOM   4263 O O   . ASN C 3 159 ? 51.363  37.264  -83.185 1.00 106.24 ? 159 ASN E O   1 
ATOM   4264 C CB  . ASN C 3 159 ? 54.076  36.814  -83.693 1.00 98.70  ? 159 ASN E CB  1 
ATOM   4265 C CG  . ASN C 3 159 ? 55.568  36.845  -83.960 1.00 116.13 ? 159 ASN E CG  1 
ATOM   4266 O OD1 . ASN C 3 159 ? 56.377  37.207  -83.101 1.00 106.59 ? 159 ASN E OD1 1 
ATOM   4267 N ND2 . ASN C 3 159 ? 55.960  36.461  -85.166 1.00 108.62 ? 159 ASN E ND2 1 
ATOM   4268 N N   . SER C 3 160 ? 51.615  38.276  -81.139 1.00 102.33 ? 160 SER E N   1 
ATOM   4269 C CA  . SER C 3 160 ? 50.194  38.503  -80.818 1.00 101.61 ? 160 SER E CA  1 
ATOM   4270 C C   . SER C 3 160 ? 49.367  37.212  -80.874 1.00 105.74 ? 160 SER E C   1 
ATOM   4271 O O   . SER C 3 160 ? 48.169  37.254  -81.157 1.00 104.92 ? 160 SER E O   1 
ATOM   4272 C CB  . SER C 3 160 ? 49.593  39.594  -81.714 1.00 104.86 ? 160 SER E CB  1 
ATOM   4273 O OG  . SER C 3 160 ? 50.493  40.661  -81.981 1.00 108.59 ? 160 SER E OG  1 
ATOM   4274 N N   . GLY C 3 161 ? 50.037  36.086  -80.628 1.00 103.62 ? 161 GLY E N   1 
ATOM   4275 C CA  . GLY C 3 161 ? 49.444  34.751  -80.643 1.00 103.41 ? 161 GLY E CA  1 
ATOM   4276 C C   . GLY C 3 161 ? 49.415  34.084  -82.003 1.00 106.96 ? 161 GLY E C   1 
ATOM   4277 O O   . GLY C 3 161 ? 48.739  33.062  -82.164 1.00 107.67 ? 161 GLY E O   1 
ATOM   4278 N N   . ALA C 3 162 ? 50.138  34.649  -83.000 1.00 102.15 ? 162 ALA E N   1 
ATOM   4279 C CA  . ALA C 3 162 ? 50.187  34.073  -84.352 1.00 101.62 ? 162 ALA E CA  1 
ATOM   4280 C C   . ALA C 3 162 ? 50.989  32.787  -84.322 1.00 105.25 ? 162 ALA E C   1 
ATOM   4281 O O   . ALA C 3 162 ? 50.553  31.775  -84.883 1.00 104.46 ? 162 ALA E O   1 
ATOM   4282 C CB  . ALA C 3 162 ? 50.811  35.052  -85.335 1.00 102.31 ? 162 ALA E CB  1 
ATOM   4283 N N   . LEU C 3 163 ? 52.155  32.837  -83.644 1.00 101.46 ? 163 LEU E N   1 
ATOM   4284 C CA  . LEU C 3 163 ? 53.079  31.730  -83.453 1.00 100.87 ? 163 LEU E CA  1 
ATOM   4285 C C   . LEU C 3 163 ? 52.578  30.908  -82.243 1.00 104.92 ? 163 LEU E C   1 
ATOM   4286 O O   . LEU C 3 163 ? 52.442  31.465  -81.148 1.00 104.66 ? 163 LEU E O   1 
ATOM   4287 C CB  . LEU C 3 163 ? 54.481  32.326  -83.230 1.00 100.69 ? 163 LEU E CB  1 
ATOM   4288 C CG  . LEU C 3 163 ? 55.702  31.401  -83.116 1.00 105.25 ? 163 LEU E CG  1 
ATOM   4289 C CD1 . LEU C 3 163 ? 55.552  30.090  -83.902 1.00 105.34 ? 163 LEU E CD1 1 
ATOM   4290 C CD2 . LEU C 3 163 ? 56.961  32.143  -83.497 1.00 106.90 ? 163 LEU E CD2 1 
ATOM   4291 N N   . THR C 3 164 ? 52.235  29.607  -82.472 1.00 100.78 ? 164 THR E N   1 
ATOM   4292 C CA  . THR C 3 164 ? 51.674  28.693  -81.462 1.00 100.08 ? 164 THR E CA  1 
ATOM   4293 C C   . THR C 3 164 ? 52.402  27.346  -81.450 1.00 103.13 ? 164 THR E C   1 
ATOM   4294 O O   . THR C 3 164 ? 52.708  26.813  -80.382 1.00 101.39 ? 164 THR E O   1 
ATOM   4295 C CB  . THR C 3 164 ? 50.150  28.574  -81.645 1.00 105.68 ? 164 THR E CB  1 
ATOM   4296 O OG1 . THR C 3 164 ? 49.592  29.880  -81.527 1.00 102.58 ? 164 THR E OG1 1 
ATOM   4297 C CG2 . THR C 3 164 ? 49.494  27.678  -80.602 1.00 105.34 ? 164 THR E CG2 1 
ATOM   4298 N N   . SER C 3 165 ? 52.683  26.801  -82.628 1.00 100.97 ? 165 SER E N   1 
ATOM   4299 C CA  . SER C 3 165 ? 53.402  25.542  -82.697 1.00 101.40 ? 165 SER E CA  1 
ATOM   4300 C C   . SER C 3 165 ? 54.907  25.780  -82.426 1.00 105.02 ? 165 SER E C   1 
ATOM   4301 O O   . SER C 3 165 ? 55.563  26.534  -83.155 1.00 105.05 ? 165 SER E O   1 
ATOM   4302 C CB  . SER C 3 165 ? 53.142  24.834  -84.030 1.00 105.51 ? 165 SER E CB  1 
ATOM   4303 O OG  . SER C 3 165 ? 54.247  24.829  -84.923 1.00 114.22 ? 165 SER E OG  1 
ATOM   4304 N N   . GLY C 3 166 ? 55.418  25.149  -81.367 1.00 99.48  ? 166 GLY E N   1 
ATOM   4305 C CA  . GLY C 3 166 ? 56.820  25.251  -80.975 1.00 97.79  ? 166 GLY E CA  1 
ATOM   4306 C C   . GLY C 3 166 ? 57.006  26.015  -79.688 1.00 98.10  ? 166 GLY E C   1 
ATOM   4307 O O   . GLY C 3 166 ? 58.062  25.910  -79.059 1.00 96.81  ? 166 GLY E O   1 
ATOM   4308 N N   . VAL C 3 167 ? 55.978  26.810  -79.306 1.00 93.21  ? 167 VAL E N   1 
ATOM   4309 C CA  . VAL C 3 167 ? 55.943  27.628  -78.079 1.00 91.74  ? 167 VAL E CA  1 
ATOM   4310 C C   . VAL C 3 167 ? 56.001  26.708  -76.862 1.00 95.22  ? 167 VAL E C   1 
ATOM   4311 O O   . VAL C 3 167 ? 55.423  25.606  -76.882 1.00 95.96  ? 167 VAL E O   1 
ATOM   4312 C CB  . VAL C 3 167 ? 54.748  28.626  -78.015 1.00 94.39  ? 167 VAL E CB  1 
ATOM   4313 C CG1 . VAL C 3 167 ? 54.905  29.588  -76.842 1.00 93.60  ? 167 VAL E CG1 1 
ATOM   4314 C CG2 . VAL C 3 167 ? 54.602  29.406  -79.315 1.00 93.92  ? 167 VAL E CG2 1 
ATOM   4315 N N   . HIS C 3 168 ? 56.767  27.138  -75.863 1.00 89.49  ? 168 HIS E N   1 
ATOM   4316 C CA  . HIS C 3 168 ? 57.007  26.416  -74.628 1.00 88.04  ? 168 HIS E CA  1 
ATOM   4317 C C   . HIS C 3 168 ? 57.255  27.427  -73.526 1.00 90.83  ? 168 HIS E C   1 
ATOM   4318 O O   . HIS C 3 168 ? 58.416  27.756  -73.266 1.00 91.27  ? 168 HIS E O   1 
ATOM   4319 C CB  . HIS C 3 168 ? 58.223  25.477  -74.766 1.00 88.16  ? 168 HIS E CB  1 
ATOM   4320 C CG  . HIS C 3 168 ? 58.002  24.222  -75.529 1.00 90.92  ? 168 HIS E CG  1 
ATOM   4321 N ND1 . HIS C 3 168 ? 58.835  23.853  -76.549 1.00 92.81  ? 168 HIS E ND1 1 
ATOM   4322 C CD2 . HIS C 3 168 ? 57.048  23.273  -75.373 1.00 92.80  ? 168 HIS E CD2 1 
ATOM   4323 C CE1 . HIS C 3 168 ? 58.379  22.707  -76.988 1.00 92.55  ? 168 HIS E CE1 1 
ATOM   4324 N NE2 . HIS C 3 168 ? 57.299  22.317  -76.307 1.00 93.25  ? 168 HIS E NE2 1 
ATOM   4325 N N   . THR C 3 169 ? 56.169  27.982  -72.938 1.00 85.82  ? 169 THR E N   1 
ATOM   4326 C CA  . THR C 3 169 ? 56.287  28.914  -71.801 1.00 84.75  ? 169 THR E CA  1 
ATOM   4327 C C   . THR C 3 169 ? 56.350  27.992  -70.541 1.00 86.24  ? 169 THR E C   1 
ATOM   4328 O O   . THR C 3 169 ? 55.409  27.235  -70.256 1.00 84.93  ? 169 THR E O   1 
ATOM   4329 C CB  . THR C 3 169 ? 55.225  30.082  -71.781 1.00 89.08  ? 169 THR E CB  1 
ATOM   4330 O OG1 . THR C 3 169 ? 54.110  29.745  -70.957 1.00 94.51  ? 169 THR E OG1 1 
ATOM   4331 C CG2 . THR C 3 169 ? 54.732  30.504  -73.167 1.00 83.13  ? 169 THR E CG2 1 
ATOM   4332 N N   . PHE C 3 170 ? 57.494  28.024  -69.854 1.00 81.20  ? 170 PHE E N   1 
ATOM   4333 C CA  . PHE C 3 170 ? 57.761  27.142  -68.708 1.00 80.43  ? 170 PHE E CA  1 
ATOM   4334 C C   . PHE C 3 170 ? 57.040  27.583  -67.460 1.00 85.11  ? 170 PHE E C   1 
ATOM   4335 O O   . PHE C 3 170 ? 56.687  28.749  -67.370 1.00 84.23  ? 170 PHE E O   1 
ATOM   4336 C CB  . PHE C 3 170 ? 59.259  27.053  -68.443 1.00 81.75  ? 170 PHE E CB  1 
ATOM   4337 C CG  . PHE C 3 170 ? 59.985  26.259  -69.489 1.00 82.93  ? 170 PHE E CG  1 
ATOM   4338 C CD1 . PHE C 3 170 ? 60.433  26.868  -70.648 1.00 85.70  ? 170 PHE E CD1 1 
ATOM   4339 C CD2 . PHE C 3 170 ? 60.250  24.914  -69.302 1.00 85.29  ? 170 PHE E CD2 1 
ATOM   4340 C CE1 . PHE C 3 170 ? 61.106  26.145  -71.615 1.00 85.89  ? 170 PHE E CE1 1 
ATOM   4341 C CE2 . PHE C 3 170 ? 60.935  24.185  -70.271 1.00 88.44  ? 170 PHE E CE2 1 
ATOM   4342 C CZ  . PHE C 3 170 ? 61.345  24.804  -71.424 1.00 86.03  ? 170 PHE E CZ  1 
ATOM   4343 N N   . PRO C 3 171 ? 56.802  26.709  -66.451 1.00 82.69  ? 171 PRO E N   1 
ATOM   4344 C CA  . PRO C 3 171 ? 56.143  27.203  -65.221 1.00 82.24  ? 171 PRO E CA  1 
ATOM   4345 C C   . PRO C 3 171 ? 57.049  28.194  -64.468 1.00 88.07  ? 171 PRO E C   1 
ATOM   4346 O O   . PRO C 3 171 ? 58.279  28.172  -64.693 1.00 88.17  ? 171 PRO E O   1 
ATOM   4347 C CB  . PRO C 3 171 ? 55.887  25.923  -64.426 1.00 82.99  ? 171 PRO E CB  1 
ATOM   4348 C CG  . PRO C 3 171 ? 56.895  24.973  -64.905 1.00 87.48  ? 171 PRO E CG  1 
ATOM   4349 C CD  . PRO C 3 171 ? 57.168  25.284  -66.339 1.00 83.74  ? 171 PRO E CD  1 
ATOM   4350 N N   . ALA C 3 172 ? 56.463  29.081  -63.622 1.00 83.57  ? 172 ALA E N   1 
ATOM   4351 C CA  . ALA C 3 172 ? 57.318  29.997  -62.891 1.00 83.17  ? 172 ALA E CA  1 
ATOM   4352 C C   . ALA C 3 172 ? 58.092  29.278  -61.841 1.00 86.19  ? 172 ALA E C   1 
ATOM   4353 O O   . ALA C 3 172 ? 57.595  28.356  -61.206 1.00 85.86  ? 172 ALA E O   1 
ATOM   4354 C CB  . ALA C 3 172 ? 56.537  31.127  -62.263 1.00 84.48  ? 172 ALA E CB  1 
ATOM   4355 N N   . VAL C 3 173 ? 59.327  29.686  -61.699 1.00 83.79  ? 173 VAL E N   1 
ATOM   4356 C CA  . VAL C 3 173 ? 60.249  29.158  -60.724 1.00 84.50  ? 173 VAL E CA  1 
ATOM   4357 C C   . VAL C 3 173 ? 60.591  30.314  -59.765 1.00 91.30  ? 173 VAL E C   1 
ATOM   4358 O O   . VAL C 3 173 ? 60.886  31.416  -60.227 1.00 92.08  ? 173 VAL E O   1 
ATOM   4359 C CB  . VAL C 3 173 ? 61.447  28.398  -61.388 1.00 88.80  ? 173 VAL E CB  1 
ATOM   4360 C CG1 . VAL C 3 173 ? 62.106  29.184  -62.524 1.00 88.80  ? 173 VAL E CG1 1 
ATOM   4361 C CG2 . VAL C 3 173 ? 62.474  27.956  -60.362 1.00 88.49  ? 173 VAL E CG2 1 
ATOM   4362 N N   . LEU C 3 174 ? 60.431  30.089  -58.440 1.00 89.70  ? 174 LEU E N   1 
ATOM   4363 C CA  . LEU C 3 174 ? 60.634  31.088  -57.375 1.00 89.95  ? 174 LEU E CA  1 
ATOM   4364 C C   . LEU C 3 174 ? 62.090  31.220  -56.928 1.00 95.52  ? 174 LEU E C   1 
ATOM   4365 O O   . LEU C 3 174 ? 62.591  30.387  -56.167 1.00 95.32  ? 174 LEU E O   1 
ATOM   4366 C CB  . LEU C 3 174 ? 59.698  30.806  -56.167 1.00 89.85  ? 174 LEU E CB  1 
ATOM   4367 C CG  . LEU C 3 174 ? 59.568  31.930  -55.123 1.00 94.38  ? 174 LEU E CG  1 
ATOM   4368 C CD1 . LEU C 3 174 ? 58.685  33.085  -55.622 1.00 94.38  ? 174 LEU E CD1 1 
ATOM   4369 C CD2 . LEU C 3 174 ? 59.050  31.401  -53.829 1.00 95.52  ? 174 LEU E CD2 1 
ATOM   4370 N N   . GLN C 3 175 ? 62.746  32.298  -57.381 1.00 94.33  ? 175 GLN E N   1 
ATOM   4371 C CA  . GLN C 3 175 ? 64.150  32.618  -57.089 1.00 95.56  ? 175 GLN E CA  1 
ATOM   4372 C C   . GLN C 3 175 ? 64.302  33.030  -55.631 1.00 103.57 ? 175 GLN E C   1 
ATOM   4373 O O   . GLN C 3 175 ? 63.319  33.470  -55.035 1.00 102.67 ? 175 GLN E O   1 
ATOM   4374 C CB  . GLN C 3 175 ? 64.675  33.725  -58.026 1.00 96.26  ? 175 GLN E CB  1 
ATOM   4375 C CG  . GLN C 3 175 ? 64.383  33.475  -59.495 1.00 86.26  ? 175 GLN E CG  1 
ATOM   4376 C CD  . GLN C 3 175 ? 64.371  34.739  -60.306 1.00 103.75 ? 175 GLN E CD  1 
ATOM   4377 O OE1 . GLN C 3 175 ? 65.295  35.008  -61.081 1.00 99.50  ? 175 GLN E OE1 1 
ATOM   4378 N NE2 . GLN C 3 175 ? 63.311  35.531  -60.180 1.00 96.74  ? 175 GLN E NE2 1 
ATOM   4379 N N   . SER C 3 176 ? 65.532  32.882  -55.062 1.00 104.09 ? 176 SER E N   1 
ATOM   4380 C CA  . SER C 3 176 ? 65.913  33.217  -53.665 1.00 105.80 ? 176 SER E CA  1 
ATOM   4381 C C   . SER C 3 176 ? 65.548  34.641  -53.267 1.00 110.07 ? 176 SER E C   1 
ATOM   4382 O O   . SER C 3 176 ? 65.333  34.922  -52.083 1.00 108.73 ? 176 SER E O   1 
ATOM   4383 C CB  . SER C 3 176 ? 67.410  33.006  -53.442 1.00 111.65 ? 176 SER E CB  1 
ATOM   4384 O OG  . SER C 3 176 ? 68.188  33.531  -54.507 1.00 123.66 ? 176 SER E OG  1 
ATOM   4385 N N   . SER C 3 177 ? 65.471  35.529  -54.283 1.00 107.46 ? 177 SER E N   1 
ATOM   4386 C CA  . SER C 3 177 ? 65.097  36.937  -54.184 1.00 107.55 ? 177 SER E CA  1 
ATOM   4387 C C   . SER C 3 177 ? 63.626  37.082  -53.824 1.00 111.34 ? 177 SER E C   1 
ATOM   4388 O O   . SER C 3 177 ? 63.189  38.172  -53.453 1.00 113.45 ? 177 SER E O   1 
ATOM   4389 C CB  . SER C 3 177 ? 65.411  37.666  -55.490 1.00 111.74 ? 177 SER E CB  1 
ATOM   4390 O OG  . SER C 3 177 ? 64.727  37.115  -56.601 1.00 123.83 ? 177 SER E OG  1 
ATOM   4391 N N   . GLY C 3 178 ? 62.903  35.967  -53.880 1.00 105.53 ? 178 GLY E N   1 
ATOM   4392 C CA  . GLY C 3 178 ? 61.480  35.880  -53.576 1.00 104.44 ? 178 GLY E CA  1 
ATOM   4393 C C   . GLY C 3 178 ? 60.657  36.334  -54.757 1.00 104.74 ? 178 GLY E C   1 
ATOM   4394 O O   . GLY C 3 178 ? 59.527  36.803  -54.604 1.00 105.69 ? 178 GLY E O   1 
ATOM   4395 N N   . LEU C 3 179 ? 61.240  36.232  -55.933 1.00 96.92  ? 179 LEU E N   1 
ATOM   4396 C CA  . LEU C 3 179 ? 60.604  36.670  -57.155 1.00 94.49  ? 179 LEU E CA  1 
ATOM   4397 C C   . LEU C 3 179 ? 60.543  35.511  -58.096 1.00 93.45  ? 179 LEU E C   1 
ATOM   4398 O O   . LEU C 3 179 ? 61.311  34.555  -57.962 1.00 91.85  ? 179 LEU E O   1 
ATOM   4399 C CB  . LEU C 3 179 ? 61.381  37.853  -57.781 1.00 94.12  ? 179 LEU E CB  1 
ATOM   4400 C CG  . LEU C 3 179 ? 61.451  39.142  -56.952 1.00 97.62  ? 179 LEU E CG  1 
ATOM   4401 C CD1 . LEU C 3 179 ? 62.722  39.865  -57.190 1.00 96.59  ? 179 LEU E CD1 1 
ATOM   4402 C CD2 . LEU C 3 179 ? 60.274  40.044  -57.227 1.00 100.08 ? 179 LEU E CD2 1 
ATOM   4403 N N   . TYR C 3 180 ? 59.604  35.585  -59.031 1.00 87.79  ? 180 TYR E N   1 
ATOM   4404 C CA  . TYR C 3 180 ? 59.410  34.536  -60.006 1.00 87.07  ? 180 TYR E CA  1 
ATOM   4405 C C   . TYR C 3 180 ? 60.171  34.851  -61.270 1.00 89.67  ? 180 TYR E C   1 
ATOM   4406 O O   . TYR C 3 180 ? 60.569  35.991  -61.519 1.00 90.70  ? 180 TYR E O   1 
ATOM   4407 C CB  . TYR C 3 180 ? 57.919  34.356  -60.329 1.00 88.79  ? 180 TYR E CB  1 
ATOM   4408 C CG  . TYR C 3 180 ? 57.031  34.008  -59.147 1.00 91.62  ? 180 TYR E CG  1 
ATOM   4409 C CD1 . TYR C 3 180 ? 56.761  32.682  -58.818 1.00 92.66  ? 180 TYR E CD1 1 
ATOM   4410 C CD2 . TYR C 3 180 ? 56.386  35.005  -58.415 1.00 92.40  ? 180 TYR E CD2 1 
ATOM   4411 C CE1 . TYR C 3 180 ? 55.907  32.358  -57.767 1.00 91.35  ? 180 TYR E CE1 1 
ATOM   4412 C CE2 . TYR C 3 180 ? 55.524  34.689  -57.370 1.00 93.11  ? 180 TYR E CE2 1 
ATOM   4413 C CZ  . TYR C 3 180 ? 55.289  33.364  -57.048 1.00 97.87  ? 180 TYR E CZ  1 
ATOM   4414 O OH  . TYR C 3 180 ? 54.431  33.049  -56.021 1.00 98.79  ? 180 TYR E OH  1 
ATOM   4415 N N   . SER C 3 181 ? 60.377  33.825  -62.070 1.00 83.20  ? 181 SER E N   1 
ATOM   4416 C CA  . SER C 3 181 ? 60.990  33.922  -63.363 1.00 81.97  ? 181 SER E CA  1 
ATOM   4417 C C   . SER C 3 181 ? 60.582  32.697  -64.151 1.00 85.40  ? 181 SER E C   1 
ATOM   4418 O O   . SER C 3 181 ? 60.355  31.632  -63.573 1.00 84.94  ? 181 SER E O   1 
ATOM   4419 C CB  . SER C 3 181 ? 62.502  34.000  -63.242 1.00 86.22  ? 181 SER E CB  1 
ATOM   4420 O OG  . SER C 3 181 ? 63.094  34.180  -64.518 1.00 99.20  ? 181 SER E OG  1 
ATOM   4421 N N   . LEU C 3 182 ? 60.452  32.859  -65.471 1.00 80.78  ? 182 LEU E N   1 
ATOM   4422 C CA  . LEU C 3 182 ? 60.141  31.804  -66.433 1.00 79.09  ? 182 LEU E CA  1 
ATOM   4423 C C   . LEU C 3 182 ? 60.644  32.211  -67.812 1.00 84.31  ? 182 LEU E C   1 
ATOM   4424 O O   . LEU C 3 182 ? 60.850  33.406  -68.106 1.00 84.41  ? 182 LEU E O   1 
ATOM   4425 C CB  . LEU C 3 182 ? 58.639  31.438  -66.470 1.00 78.37  ? 182 LEU E CB  1 
ATOM   4426 C CG  . LEU C 3 182 ? 57.596  32.543  -66.705 1.00 81.68  ? 182 LEU E CG  1 
ATOM   4427 C CD1 . LEU C 3 182 ? 57.466  32.884  -68.179 1.00 81.95  ? 182 LEU E CD1 1 
ATOM   4428 C CD2 . LEU C 3 182 ? 56.242  32.078  -66.254 1.00 81.50  ? 182 LEU E CD2 1 
ATOM   4429 N N   . SER C 3 183 ? 60.865  31.218  -68.654 1.00 80.85  ? 183 SER E N   1 
ATOM   4430 C CA  . SER C 3 183 ? 61.297  31.488  -70.013 1.00 80.36  ? 183 SER E CA  1 
ATOM   4431 C C   . SER C 3 183 ? 60.268  30.947  -70.981 1.00 82.04  ? 183 SER E C   1 
ATOM   4432 O O   . SER C 3 183 ? 59.554  29.987  -70.669 1.00 81.72  ? 183 SER E O   1 
ATOM   4433 C CB  . SER C 3 183 ? 62.693  30.933  -70.276 1.00 84.03  ? 183 SER E CB  1 
ATOM   4434 O OG  . SER C 3 183 ? 63.620  31.492  -69.357 1.00 92.99  ? 183 SER E OG  1 
ATOM   4435 N N   . SER C 3 184 ? 60.104  31.634  -72.097 1.00 76.13  ? 184 SER E N   1 
ATOM   4436 C CA  . SER C 3 184 ? 59.154  31.215  -73.099 1.00 74.86  ? 184 SER E CA  1 
ATOM   4437 C C   . SER C 3 184 ? 59.987  31.116  -74.311 1.00 76.98  ? 184 SER E C   1 
ATOM   4438 O O   . SER C 3 184 ? 60.529  32.125  -74.751 1.00 73.53  ? 184 SER E O   1 
ATOM   4439 C CB  . SER C 3 184 ? 58.042  32.241  -73.266 1.00 77.23  ? 184 SER E CB  1 
ATOM   4440 O OG  . SER C 3 184 ? 57.169  31.898  -74.329 1.00 80.48  ? 184 SER E OG  1 
ATOM   4441 N N   . VAL C 3 185 ? 60.207  29.870  -74.763 1.00 75.33  ? 185 VAL E N   1 
ATOM   4442 C CA  . VAL C 3 185 ? 61.039  29.540  -75.918 1.00 74.93  ? 185 VAL E CA  1 
ATOM   4443 C C   . VAL C 3 185 ? 60.189  29.016  -77.045 1.00 83.61  ? 185 VAL E C   1 
ATOM   4444 O O   . VAL C 3 185 ? 59.111  28.475  -76.811 1.00 82.69  ? 185 VAL E O   1 
ATOM   4445 C CB  . VAL C 3 185 ? 62.219  28.589  -75.589 1.00 76.60  ? 185 VAL E CB  1 
ATOM   4446 C CG1 . VAL C 3 185 ? 63.210  29.241  -74.637 1.00 75.87  ? 185 VAL E CG1 1 
ATOM   4447 C CG2 . VAL C 3 185 ? 61.741  27.241  -75.057 1.00 75.94  ? 185 VAL E CG2 1 
ATOM   4448 N N   . VAL C 3 186 ? 60.676  29.176  -78.270 1.00 84.83  ? 186 VAL E N   1 
ATOM   4449 C CA  . VAL C 3 186 ? 60.009  28.710  -79.478 1.00 86.77  ? 186 VAL E CA  1 
ATOM   4450 C C   . VAL C 3 186 ? 61.063  28.172  -80.495 1.00 95.75  ? 186 VAL E C   1 
ATOM   4451 O O   . VAL C 3 186 ? 62.168  28.703  -80.622 1.00 96.01  ? 186 VAL E O   1 
ATOM   4452 C CB  . VAL C 3 186 ? 59.026  29.784  -80.047 1.00 90.31  ? 186 VAL E CB  1 
ATOM   4453 C CG1 . VAL C 3 186 ? 59.765  30.961  -80.683 1.00 90.01  ? 186 VAL E CG1 1 
ATOM   4454 C CG2 . VAL C 3 186 ? 58.002  29.180  -81.008 1.00 90.00  ? 186 VAL E CG2 1 
ATOM   4455 N N   . THR C 3 187 ? 60.732  27.066  -81.137 1.00 95.53  ? 187 THR E N   1 
ATOM   4456 C CA  . THR C 3 187 ? 61.564  26.429  -82.150 1.00 96.68  ? 187 THR E CA  1 
ATOM   4457 C C   . THR C 3 187 ? 60.924  26.755  -83.500 1.00 105.17 ? 187 THR E C   1 
ATOM   4458 O O   . THR C 3 187 ? 59.745  26.455  -83.713 1.00 104.89 ? 187 THR E O   1 
ATOM   4459 C CB  . THR C 3 187 ? 61.746  24.916  -81.850 1.00 99.81  ? 187 THR E CB  1 
ATOM   4460 O OG1 . THR C 3 187 ? 60.609  24.403  -81.131 1.00 103.04 ? 187 THR E OG1 1 
ATOM   4461 C CG2 . THR C 3 187 ? 63.018  24.632  -81.059 1.00 92.40  ? 187 THR E CG2 1 
ATOM   4462 N N   . VAL C 3 188 ? 61.662  27.461  -84.366 1.00 105.42 ? 188 VAL E N   1 
ATOM   4463 C CA  . VAL C 3 188 ? 61.188  27.893  -85.686 1.00 107.36 ? 188 VAL E CA  1 
ATOM   4464 C C   . VAL C 3 188 ? 62.339  27.678  -86.695 1.00 115.36 ? 188 VAL E C   1 
ATOM   4465 O O   . VAL C 3 188 ? 63.493  27.747  -86.261 1.00 115.49 ? 188 VAL E O   1 
ATOM   4466 C CB  . VAL C 3 188 ? 60.734  29.386  -85.626 1.00 112.20 ? 188 VAL E CB  1 
ATOM   4467 C CG1 . VAL C 3 188 ? 60.252  29.890  -86.977 1.00 112.32 ? 188 VAL E CG1 1 
ATOM   4468 C CG2 . VAL C 3 188 ? 59.641  29.604  -84.580 1.00 112.22 ? 188 VAL E CG2 1 
ATOM   4469 N N   . PRO C 3 189 ? 62.088  27.428  -88.017 1.00 114.69 ? 189 PRO E N   1 
ATOM   4470 C CA  . PRO C 3 189 ? 63.212  27.251  -88.962 1.00 115.49 ? 189 PRO E CA  1 
ATOM   4471 C C   . PRO C 3 189 ? 64.177  28.434  -89.056 1.00 120.14 ? 189 PRO E C   1 
ATOM   4472 O O   . PRO C 3 189 ? 63.755  29.581  -89.221 1.00 119.12 ? 189 PRO E O   1 
ATOM   4473 C CB  . PRO C 3 189 ? 62.518  26.998  -90.311 1.00 117.56 ? 189 PRO E CB  1 
ATOM   4474 C CG  . PRO C 3 189 ? 61.148  27.565  -90.144 1.00 121.99 ? 189 PRO E CG  1 
ATOM   4475 C CD  . PRO C 3 189 ? 60.796  27.265  -88.716 1.00 116.94 ? 189 PRO E CD  1 
ATOM   4476 N N   . SER C 3 190 ? 65.486  28.122  -88.972 1.00 118.39 ? 190 SER E N   1 
ATOM   4477 C CA  . SER C 3 190 ? 66.632  29.042  -89.023 1.00 118.99 ? 190 SER E CA  1 
ATOM   4478 C C   . SER C 3 190 ? 66.783  29.812  -90.356 1.00 125.01 ? 190 SER E C   1 
ATOM   4479 O O   . SER C 3 190 ? 67.593  30.735  -90.439 1.00 124.60 ? 190 SER E O   1 
ATOM   4480 C CB  . SER C 3 190 ? 67.922  28.305  -88.673 1.00 122.80 ? 190 SER E CB  1 
ATOM   4481 O OG  . SER C 3 190 ? 67.991  27.006  -89.243 1.00 131.69 ? 190 SER E OG  1 
ATOM   4482 N N   . SER C 3 191 ? 66.019  29.424  -91.393 1.00 123.09 ? 191 SER E N   1 
ATOM   4483 C CA  . SER C 3 191 ? 65.988  30.089  -92.696 1.00 123.07 ? 191 SER E CA  1 
ATOM   4484 C C   . SER C 3 191 ? 65.300  31.461  -92.523 1.00 128.09 ? 191 SER E C   1 
ATOM   4485 O O   . SER C 3 191 ? 65.830  32.481  -92.971 1.00 127.59 ? 191 SER E O   1 
ATOM   4486 C CB  . SER C 3 191 ? 65.223  29.228  -93.697 1.00 126.18 ? 191 SER E CB  1 
ATOM   4487 O OG  . SER C 3 191 ? 64.155  28.537  -93.068 1.00 134.78 ? 191 SER E OG  1 
ATOM   4488 N N   . SER C 3 192 ? 64.161  31.479  -91.789 1.00 125.41 ? 192 SER E N   1 
ATOM   4489 C CA  . SER C 3 192 ? 63.347  32.659  -91.492 1.00 125.61 ? 192 SER E CA  1 
ATOM   4490 C C   . SER C 3 192 ? 63.957  33.600  -90.447 1.00 130.92 ? 192 SER E C   1 
ATOM   4491 O O   . SER C 3 192 ? 63.360  34.634  -90.174 1.00 130.12 ? 192 SER E O   1 
ATOM   4492 C CB  . SER C 3 192 ? 61.953  32.230  -91.040 1.00 129.23 ? 192 SER E CB  1 
ATOM   4493 O OG  . SER C 3 192 ? 61.987  31.604  -89.766 1.00 137.58 ? 192 SER E OG  1 
ATOM   4494 N N   . LEU C 3 193 ? 65.122  33.245  -89.854 1.00 129.39 ? 193 LEU E N   1 
ATOM   4495 C CA  . LEU C 3 193 ? 65.831  34.024  -88.822 1.00 130.20 ? 193 LEU E CA  1 
ATOM   4496 C C   . LEU C 3 193 ? 65.770  35.543  -89.020 1.00 135.80 ? 193 LEU E C   1 
ATOM   4497 O O   . LEU C 3 193 ? 65.502  36.274  -88.059 1.00 135.85 ? 193 LEU E O   1 
ATOM   4498 C CB  . LEU C 3 193 ? 67.309  33.597  -88.720 1.00 130.38 ? 193 LEU E CB  1 
ATOM   4499 C CG  . LEU C 3 193 ? 67.695  32.498  -87.727 1.00 134.81 ? 193 LEU E CG  1 
ATOM   4500 C CD1 . LEU C 3 193 ? 69.188  32.218  -87.796 1.00 135.14 ? 193 LEU E CD1 1 
ATOM   4501 C CD2 . LEU C 3 193 ? 67.320  32.860  -86.312 1.00 136.23 ? 193 LEU E CD2 1 
ATOM   4502 N N   . GLY C 3 194 ? 66.035  35.985  -90.253 1.00 132.68 ? 194 GLY E N   1 
ATOM   4503 C CA  . GLY C 3 194 ? 66.008  37.389  -90.651 1.00 132.91 ? 194 GLY E CA  1 
ATOM   4504 C C   . GLY C 3 194 ? 64.883  37.722  -91.613 1.00 137.47 ? 194 GLY E C   1 
ATOM   4505 O O   . GLY C 3 194 ? 64.687  38.891  -91.965 1.00 137.44 ? 194 GLY E O   1 
ATOM   4506 N N   . THR C 3 195 ? 64.149  36.692  -92.060 1.00 133.83 ? 195 THR E N   1 
ATOM   4507 C CA  . THR C 3 195 ? 63.015  36.853  -92.966 1.00 133.40 ? 195 THR E CA  1 
ATOM   4508 C C   . THR C 3 195 ? 61.789  37.229  -92.120 1.00 134.33 ? 195 THR E C   1 
ATOM   4509 O O   . THR C 3 195 ? 61.064  38.156  -92.481 1.00 133.84 ? 195 THR E O   1 
ATOM   4510 C CB  . THR C 3 195 ? 62.841  35.608  -93.860 1.00 148.12 ? 195 THR E CB  1 
ATOM   4511 O OG1 . THR C 3 195 ? 64.128  35.127  -94.271 1.00 148.83 ? 195 THR E OG1 1 
ATOM   4512 C CG2 . THR C 3 195 ? 61.992  35.890  -95.099 1.00 148.46 ? 195 THR E CG2 1 
ATOM   4513 N N   . GLN C 3 196 ? 61.604  36.551  -90.965 1.00 128.35 ? 196 GLN E N   1 
ATOM   4514 C CA  . GLN C 3 196 ? 60.528  36.828  -90.012 1.00 126.75 ? 196 GLN E CA  1 
ATOM   4515 C C   . GLN C 3 196 ? 61.053  37.394  -88.687 1.00 127.78 ? 196 GLN E C   1 
ATOM   4516 O O   . GLN C 3 196 ? 62.041  36.904  -88.131 1.00 126.91 ? 196 GLN E O   1 
ATOM   4517 C CB  . GLN C 3 196 ? 59.630  35.589  -89.777 1.00 127.82 ? 196 GLN E CB  1 
ATOM   4518 C CG  . GLN C 3 196 ? 58.387  35.816  -88.883 1.00 131.40 ? 196 GLN E CG  1 
ATOM   4519 C CD  . GLN C 3 196 ? 57.264  36.636  -89.493 1.00 138.33 ? 196 GLN E CD  1 
ATOM   4520 O OE1 . GLN C 3 196 ? 57.440  37.786  -89.925 1.00 134.50 ? 196 GLN E OE1 1 
ATOM   4521 N NE2 . GLN C 3 196 ? 56.066  36.072  -89.505 1.00 119.88 ? 196 GLN E NE2 1 
ATOM   4522 N N   . THR C 3 197 ? 60.363  38.436  -88.201 1.00 122.39 ? 197 THR E N   1 
ATOM   4523 C CA  . THR C 3 197 ? 60.599  39.114  -86.926 1.00 120.91 ? 197 THR E CA  1 
ATOM   4524 C C   . THR C 3 197 ? 59.855  38.339  -85.839 1.00 120.84 ? 197 THR E C   1 
ATOM   4525 O O   . THR C 3 197 ? 58.736  37.875  -86.092 1.00 120.68 ? 197 THR E O   1 
ATOM   4526 C CB  . THR C 3 197 ? 60.058  40.568  -86.985 1.00 129.40 ? 197 THR E CB  1 
ATOM   4527 O OG1 . THR C 3 197 ? 58.705  40.558  -87.448 1.00 126.18 ? 197 THR E OG1 1 
ATOM   4528 C CG2 . THR C 3 197 ? 60.895  41.472  -87.879 1.00 129.34 ? 197 THR E CG2 1 
ATOM   4529 N N   . TYR C 3 198 ? 60.454  38.198  -84.634 1.00 113.97 ? 198 TYR E N   1 
ATOM   4530 C CA  . TYR C 3 198 ? 59.787  37.492  -83.534 1.00 111.97 ? 198 TYR E CA  1 
ATOM   4531 C C   . TYR C 3 198 ? 59.661  38.351  -82.289 1.00 112.19 ? 198 TYR E C   1 
ATOM   4532 O O   . TYR C 3 198 ? 60.662  38.799  -81.739 1.00 111.74 ? 198 TYR E O   1 
ATOM   4533 C CB  . TYR C 3 198 ? 60.441  36.133  -83.244 1.00 112.86 ? 198 TYR E CB  1 
ATOM   4534 C CG  . TYR C 3 198 ? 60.395  35.195  -84.433 1.00 114.36 ? 198 TYR E CG  1 
ATOM   4535 C CD1 . TYR C 3 198 ? 59.181  34.771  -84.968 1.00 116.30 ? 198 TYR E CD1 1 
ATOM   4536 C CD2 . TYR C 3 198 ? 61.565  34.751  -85.041 1.00 115.05 ? 198 TYR E CD2 1 
ATOM   4537 C CE1 . TYR C 3 198 ? 59.134  33.922  -86.072 1.00 117.57 ? 198 TYR E CE1 1 
ATOM   4538 C CE2 . TYR C 3 198 ? 61.529  33.902  -86.146 1.00 116.19 ? 198 TYR E CE2 1 
ATOM   4539 C CZ  . TYR C 3 198 ? 60.310  33.492  -86.662 1.00 123.25 ? 198 TYR E CZ  1 
ATOM   4540 O OH  . TYR C 3 198 ? 60.270  32.670  -87.764 1.00 122.26 ? 198 TYR E OH  1 
ATOM   4541 N N   . ILE C 3 199 ? 58.416  38.613  -81.883 1.00 106.16 ? 199 ILE E N   1 
ATOM   4542 C CA  . ILE C 3 199 ? 58.080  39.435  -80.718 1.00 104.83 ? 199 ILE E CA  1 
ATOM   4543 C C   . ILE C 3 199 ? 57.320  38.605  -79.665 1.00 108.13 ? 199 ILE E C   1 
ATOM   4544 O O   . ILE C 3 199 ? 56.189  38.158  -79.914 1.00 106.83 ? 199 ILE E O   1 
ATOM   4545 C CB  . ILE C 3 199 ? 57.249  40.724  -81.082 1.00 107.15 ? 199 ILE E CB  1 
ATOM   4546 C CG1 . ILE C 3 199 ? 57.675  41.389  -82.417 1.00 106.82 ? 199 ILE E CG1 1 
ATOM   4547 C CG2 . ILE C 3 199 ? 57.277  41.732  -79.940 1.00 107.25 ? 199 ILE E CG2 1 
ATOM   4548 C CD1 . ILE C 3 199 ? 56.493  42.003  -83.215 1.00 106.04 ? 199 ILE E CD1 1 
ATOM   4549 N N   . CYS C 3 200 ? 57.921  38.446  -78.471 1.00 104.53 ? 200 CYS E N   1 
ATOM   4550 C CA  . CYS C 3 200 ? 57.210  37.802  -77.376 1.00 103.69 ? 200 CYS E CA  1 
ATOM   4551 C C   . CYS C 3 200 ? 56.439  38.904  -76.679 1.00 106.52 ? 200 CYS E C   1 
ATOM   4552 O O   . CYS C 3 200 ? 56.962  39.994  -76.414 1.00 104.07 ? 200 CYS E O   1 
ATOM   4553 C CB  . CYS C 3 200 ? 58.132  37.051  -76.419 1.00 103.96 ? 200 CYS E CB  1 
ATOM   4554 S SG  . CYS C 3 200 ? 59.039  38.101  -75.260 1.00 107.40 ? 200 CYS E SG  1 
ATOM   4555 N N   . ASN C 3 201 ? 55.165  38.644  -76.466 1.00 104.45 ? 201 ASN E N   1 
ATOM   4556 C CA  . ASN C 3 201 ? 54.269  39.598  -75.844 1.00 104.02 ? 201 ASN E CA  1 
ATOM   4557 C C   . ASN C 3 201 ? 53.981  39.077  -74.439 1.00 106.26 ? 201 ASN E C   1 
ATOM   4558 O O   . ASN C 3 201 ? 53.386  38.005  -74.278 1.00 104.70 ? 201 ASN E O   1 
ATOM   4559 C CB  . ASN C 3 201 ? 53.005  39.781  -76.698 1.00 105.37 ? 201 ASN E CB  1 
ATOM   4560 C CG  . ASN C 3 201 ? 53.211  40.107  -78.177 1.00 139.75 ? 201 ASN E CG  1 
ATOM   4561 O OD1 . ASN C 3 201 ? 52.300  39.952  -78.986 1.00 136.44 ? 201 ASN E OD1 1 
ATOM   4562 N ND2 . ASN C 3 201 ? 54.381  40.592  -78.578 1.00 135.38 ? 201 ASN E ND2 1 
ATOM   4563 N N   . VAL C 3 202 ? 54.530  39.783  -73.433 1.00 102.61 ? 202 VAL E N   1 
ATOM   4564 C CA  . VAL C 3 202 ? 54.414  39.405  -72.031 1.00 102.41 ? 202 VAL E CA  1 
ATOM   4565 C C   . VAL C 3 202 ? 53.509  40.373  -71.352 1.00 106.90 ? 202 VAL E C   1 
ATOM   4566 O O   . VAL C 3 202 ? 53.682  41.583  -71.475 1.00 107.99 ? 202 VAL E O   1 
ATOM   4567 C CB  . VAL C 3 202 ? 55.775  39.281  -71.291 1.00 106.19 ? 202 VAL E CB  1 
ATOM   4568 C CG1 . VAL C 3 202 ? 55.590  38.731  -69.871 1.00 105.40 ? 202 VAL E CG1 1 
ATOM   4569 C CG2 . VAL C 3 202 ? 56.761  38.418  -72.082 1.00 106.18 ? 202 VAL E CG2 1 
ATOM   4570 N N   . ASN C 3 203 ? 52.547  39.834  -70.624 1.00 102.39 ? 203 ASN E N   1 
ATOM   4571 C CA  . ASN C 3 203 ? 51.585  40.584  -69.857 1.00 101.41 ? 203 ASN E CA  1 
ATOM   4572 C C   . ASN C 3 203 ? 51.598  40.096  -68.402 1.00 104.25 ? 203 ASN E C   1 
ATOM   4573 O O   . ASN C 3 203 ? 51.660  38.880  -68.139 1.00 103.81 ? 203 ASN E O   1 
ATOM   4574 C CB  . ASN C 3 203 ? 50.203  40.458  -70.508 1.00 99.73  ? 203 ASN E CB  1 
ATOM   4575 C CG  . ASN C 3 203 ? 49.028  40.611  -69.573 1.00 115.04 ? 203 ASN E CG  1 
ATOM   4576 O OD1 . ASN C 3 203 ? 48.831  41.656  -68.927 1.00 107.33 ? 203 ASN E OD1 1 
ATOM   4577 N ND2 . ASN C 3 203 ? 48.223  39.558  -69.490 1.00 104.38 ? 203 ASN E ND2 1 
ATOM   4578 N N   . HIS C 3 204 ? 51.580  41.066  -67.465 1.00 99.28  ? 204 HIS E N   1 
ATOM   4579 C CA  . HIS C 3 204 ? 51.515  40.835  -66.021 1.00 98.93  ? 204 HIS E CA  1 
ATOM   4580 C C   . HIS C 3 204 ? 50.364  41.675  -65.514 1.00 104.30 ? 204 HIS E C   1 
ATOM   4581 O O   . HIS C 3 204 ? 50.448  42.907  -65.533 1.00 105.06 ? 204 HIS E O   1 
ATOM   4582 C CB  . HIS C 3 204 ? 52.836  41.206  -65.326 1.00 98.81  ? 204 HIS E CB  1 
ATOM   4583 C CG  . HIS C 3 204 ? 52.902  40.808  -63.883 1.00 101.95 ? 204 HIS E CG  1 
ATOM   4584 N ND1 . HIS C 3 204 ? 52.954  41.751  -62.880 1.00 103.74 ? 204 HIS E ND1 1 
ATOM   4585 C CD2 . HIS C 3 204 ? 52.954  39.577  -63.324 1.00 102.85 ? 204 HIS E CD2 1 
ATOM   4586 C CE1 . HIS C 3 204 ? 53.040  41.070  -61.747 1.00 102.64 ? 204 HIS E CE1 1 
ATOM   4587 N NE2 . HIS C 3 204 ? 53.040  39.758  -61.964 1.00 102.57 ? 204 HIS E NE2 1 
ATOM   4588 N N   . LYS C 3 205 ? 49.247  41.033  -65.155 1.00 100.88 ? 205 LYS E N   1 
ATOM   4589 C CA  . LYS C 3 205 ? 48.094  41.801  -64.700 1.00 100.95 ? 205 LYS E CA  1 
ATOM   4590 C C   . LYS C 3 205 ? 48.364  42.510  -63.324 1.00 106.48 ? 205 LYS E C   1 
ATOM   4591 O O   . LYS C 3 205 ? 48.177  43.737  -63.258 1.00 105.11 ? 205 LYS E O   1 
ATOM   4592 C CB  . LYS C 3 205 ? 46.795  40.962  -64.719 1.00 102.66 ? 205 LYS E CB  1 
ATOM   4593 C CG  . LYS C 3 205 ? 45.517  41.726  -64.281 1.00 123.77 ? 205 LYS E CG  1 
ATOM   4594 C CD  . LYS C 3 205 ? 45.097  42.868  -65.229 1.00 136.99 ? 205 LYS E CD  1 
ATOM   4595 C CE  . LYS C 3 205 ? 44.073  43.799  -64.629 1.00 147.13 ? 205 LYS E CE  1 
ATOM   4596 N NZ  . LYS C 3 205 ? 43.901  45.012  -65.471 1.00 158.30 ? 205 LYS E NZ  1 
ATOM   4597 N N   . PRO C 3 206 ? 48.858  41.805  -62.259 1.00 104.31 ? 206 PRO E N   1 
ATOM   4598 C CA  . PRO C 3 206 ? 49.080  42.483  -60.969 1.00 104.45 ? 206 PRO E CA  1 
ATOM   4599 C C   . PRO C 3 206 ? 49.773  43.823  -61.053 1.00 109.84 ? 206 PRO E C   1 
ATOM   4600 O O   . PRO C 3 206 ? 49.215  44.794  -60.580 1.00 109.60 ? 206 PRO E O   1 
ATOM   4601 C CB  . PRO C 3 206 ? 49.897  41.474  -60.172 1.00 105.85 ? 206 PRO E CB  1 
ATOM   4602 C CG  . PRO C 3 206 ? 49.458  40.178  -60.687 1.00 110.46 ? 206 PRO E CG  1 
ATOM   4603 C CD  . PRO C 3 206 ? 49.143  40.358  -62.141 1.00 106.07 ? 206 PRO E CD  1 
ATOM   4604 N N   . SER C 3 207 ? 50.950  43.885  -61.674 1.00 107.88 ? 207 SER E N   1 
ATOM   4605 C CA  . SER C 3 207 ? 51.691  45.130  -61.797 1.00 108.49 ? 207 SER E CA  1 
ATOM   4606 C C   . SER C 3 207 ? 51.145  46.016  -62.903 1.00 116.70 ? 207 SER E C   1 
ATOM   4607 O O   . SER C 3 207 ? 51.503  47.192  -62.952 1.00 117.30 ? 207 SER E O   1 
ATOM   4608 C CB  . SER C 3 207 ? 53.160  44.846  -62.063 1.00 110.47 ? 207 SER E CB  1 
ATOM   4609 O OG  . SER C 3 207 ? 53.372  44.521  -63.426 1.00 113.70 ? 207 SER E OG  1 
ATOM   4610 N N   . ASN C 3 208 ? 50.306  45.454  -63.801 1.00 115.42 ? 208 ASN E N   1 
ATOM   4611 C CA  . ASN C 3 208 ? 49.722  46.146  -64.955 1.00 115.90 ? 208 ASN E CA  1 
ATOM   4612 C C   . ASN C 3 208 ? 50.840  46.548  -65.939 1.00 118.84 ? 208 ASN E C   1 
ATOM   4613 O O   . ASN C 3 208 ? 51.113  47.735  -66.180 1.00 119.20 ? 208 ASN E O   1 
ATOM   4614 C CB  . ASN C 3 208 ? 48.802  47.320  -64.532 1.00 119.44 ? 208 ASN E CB  1 
ATOM   4615 C CG  . ASN C 3 208 ? 47.593  47.490  -65.412 1.00 155.80 ? 208 ASN E CG  1 
ATOM   4616 O OD1 . ASN C 3 208 ? 46.676  46.656  -65.426 1.00 156.52 ? 208 ASN E OD1 1 
ATOM   4617 N ND2 . ASN C 3 208 ? 47.563  48.584  -66.159 1.00 148.35 ? 208 ASN E ND2 1 
ATOM   4618 N N   . THR C 3 209 ? 51.531  45.526  -66.445 1.00 113.59 ? 209 THR E N   1 
ATOM   4619 C CA  . THR C 3 209 ? 52.608  45.682  -67.413 1.00 112.88 ? 209 THR E CA  1 
ATOM   4620 C C   . THR C 3 209 ? 52.310  44.824  -68.671 1.00 115.13 ? 209 THR E C   1 
ATOM   4621 O O   . THR C 3 209 ? 51.659  43.777  -68.596 1.00 114.36 ? 209 THR E O   1 
ATOM   4622 C CB  . THR C 3 209 ? 53.995  45.468  -66.770 1.00 122.13 ? 209 THR E CB  1 
ATOM   4623 O OG1 . THR C 3 209 ? 54.001  44.271  -66.011 1.00 125.06 ? 209 THR E OG1 1 
ATOM   4624 C CG2 . THR C 3 209 ? 54.402  46.607  -65.859 1.00 121.61 ? 209 THR E CG2 1 
ATOM   4625 N N   . LYS C 3 210 ? 52.730  45.336  -69.831 1.00 110.55 ? 210 LYS E N   1 
ATOM   4626 C CA  . LYS C 3 210 ? 52.554  44.758  -71.154 1.00 109.48 ? 210 LYS E CA  1 
ATOM   4627 C C   . LYS C 3 210 ? 53.832  45.131  -71.901 1.00 112.76 ? 210 LYS E C   1 
ATOM   4628 O O   . LYS C 3 210 ? 54.016  46.295  -72.295 1.00 113.24 ? 210 LYS E O   1 
ATOM   4629 C CB  . LYS C 3 210 ? 51.307  45.375  -71.830 1.00 111.83 ? 210 LYS E CB  1 
ATOM   4630 C CG  . LYS C 3 210 ? 50.925  44.783  -73.189 1.00 127.80 ? 210 LYS E CG  1 
ATOM   4631 C CD  . LYS C 3 210 ? 50.137  45.785  -74.051 1.00 137.29 ? 210 LYS E CD  1 
ATOM   4632 C CE  . LYS C 3 210 ? 50.949  46.327  -75.209 1.00 145.61 ? 210 LYS E CE  1 
ATOM   4633 N NZ  . LYS C 3 210 ? 50.307  47.499  -75.872 1.00 153.01 ? 210 LYS E NZ  1 
ATOM   4634 N N   . VAL C 3 211 ? 54.749  44.159  -72.011 1.00 107.44 ? 211 VAL E N   1 
ATOM   4635 C CA  . VAL C 3 211 ? 56.051  44.325  -72.668 1.00 106.29 ? 211 VAL E CA  1 
ATOM   4636 C C   . VAL C 3 211 ? 56.091  43.486  -73.938 1.00 110.11 ? 211 VAL E C   1 
ATOM   4637 O O   . VAL C 3 211 ? 55.771  42.292  -73.886 1.00 109.64 ? 211 VAL E O   1 
ATOM   4638 C CB  . VAL C 3 211 ? 57.248  43.973  -71.736 1.00 109.16 ? 211 VAL E CB  1 
ATOM   4639 C CG1 . VAL C 3 211 ? 58.531  44.624  -72.234 1.00 108.89 ? 211 VAL E CG1 1 
ATOM   4640 C CG2 . VAL C 3 211 ? 56.975  44.350  -70.276 1.00 108.57 ? 211 VAL E CG2 1 
ATOM   4641 N N   . ASP C 3 212 ? 56.499  44.109  -75.068 1.00 107.00 ? 212 ASP E N   1 
ATOM   4642 C CA  . ASP C 3 212 ? 56.626  43.462  -76.381 1.00 107.30 ? 212 ASP E CA  1 
ATOM   4643 C C   . ASP C 3 212 ? 58.092  43.455  -76.867 1.00 112.94 ? 212 ASP E C   1 
ATOM   4644 O O   . ASP C 3 212 ? 58.432  44.206  -77.787 1.00 114.16 ? 212 ASP E O   1 
ATOM   4645 C CB  . ASP C 3 212 ? 55.725  44.149  -77.433 1.00 109.02 ? 212 ASP E CB  1 
ATOM   4646 C CG  . ASP C 3 212 ? 54.240  44.099  -77.178 1.00 124.29 ? 212 ASP E CG  1 
ATOM   4647 O OD1 . ASP C 3 212 ? 53.776  43.116  -76.561 1.00 126.96 ? 212 ASP E OD1 1 
ATOM   4648 O OD2 . ASP C 3 212 ? 53.533  45.035  -77.614 1.00 131.39 ? 212 ASP E OD2 1 
ATOM   4649 N N   . LYS C 3 213 ? 58.955  42.608  -76.277 1.00 108.57 ? 213 LYS E N   1 
ATOM   4650 C CA  . LYS C 3 213 ? 60.361  42.560  -76.684 1.00 108.14 ? 213 LYS E CA  1 
ATOM   4651 C C   . LYS C 3 213 ? 60.596  41.818  -78.007 1.00 112.56 ? 213 LYS E C   1 
ATOM   4652 O O   . LYS C 3 213 ? 60.073  40.722  -78.203 1.00 113.68 ? 213 LYS E O   1 
ATOM   4653 C CB  . LYS C 3 213 ? 61.233  41.988  -75.562 1.00 110.44 ? 213 LYS E CB  1 
ATOM   4654 C CG  . LYS C 3 213 ? 62.686  42.429  -75.604 1.00 124.62 ? 213 LYS E CG  1 
ATOM   4655 C CD  . LYS C 3 213 ? 62.864  43.878  -75.147 1.00 136.40 ? 213 LYS E CD  1 
ATOM   4656 C CE  . LYS C 3 213 ? 64.315  44.282  -75.120 1.00 148.55 ? 213 LYS E CE  1 
ATOM   4657 N NZ  . LYS C 3 213 ? 65.003  43.692  -73.948 1.00 158.79 ? 213 LYS E NZ  1 
ATOM   4658 N N   . ARG C 3 214 ? 61.389  42.412  -78.907 1.00 108.25 ? 214 ARG E N   1 
ATOM   4659 C CA  . ARG C 3 214 ? 61.737  41.802  -80.190 1.00 108.00 ? 214 ARG E CA  1 
ATOM   4660 C C   . ARG C 3 214 ? 62.987  40.960  -80.010 1.00 110.72 ? 214 ARG E C   1 
ATOM   4661 O O   . ARG C 3 214 ? 64.023  41.466  -79.543 1.00 108.92 ? 214 ARG E O   1 
ATOM   4662 C CB  . ARG C 3 214 ? 61.984  42.849  -81.297 1.00 110.27 ? 214 ARG E CB  1 
ATOM   4663 C CG  . ARG C 3 214 ? 60.741  43.615  -81.742 1.00 126.93 ? 214 ARG E CG  1 
ATOM   4664 C CD  . ARG C 3 214 ? 60.918  44.313  -83.095 1.00 135.13 ? 214 ARG E CD  1 
ATOM   4665 N NE  . ARG C 3 214 ? 61.856  45.441  -83.078 1.00 131.28 ? 214 ARG E NE  1 
ATOM   4666 C CZ  . ARG C 3 214 ? 61.527  46.697  -82.786 1.00 141.19 ? 214 ARG E CZ  1 
ATOM   4667 N NH1 . ARG C 3 214 ? 60.286  46.989  -82.402 1.00 126.93 ? 214 ARG E NH1 1 
ATOM   4668 N NH2 . ARG C 3 214 ? 62.440  47.656  -82.811 1.00 126.72 ? 214 ARG E NH2 1 
ATOM   4669 N N   . VAL C 3 215 ? 62.878  39.660  -80.368 1.00 107.59 ? 215 VAL E N   1 
ATOM   4670 C CA  . VAL C 3 215 ? 63.990  38.712  -80.293 1.00 106.95 ? 215 VAL E CA  1 
ATOM   4671 C C   . VAL C 3 215 ? 64.638  38.644  -81.658 1.00 114.01 ? 215 VAL E C   1 
ATOM   4672 O O   . VAL C 3 215 ? 64.006  38.208  -82.625 1.00 114.33 ? 215 VAL E O   1 
ATOM   4673 C CB  . VAL C 3 215 ? 63.636  37.326  -79.726 1.00 109.13 ? 215 VAL E CB  1 
ATOM   4674 C CG1 . VAL C 3 215 ? 64.907  36.568  -79.373 1.00 108.75 ? 215 VAL E CG1 1 
ATOM   4675 C CG2 . VAL C 3 215 ? 62.734  37.444  -78.502 1.00 108.46 ? 215 VAL E CG2 1 
ATOM   4676 N N   . GLU C 3 216 ? 65.879  39.157  -81.733 1.00 111.71 ? 216 GLU E N   1 
ATOM   4677 C CA  . GLU C 3 216 ? 66.695  39.260  -82.941 1.00 111.51 ? 216 GLU E CA  1 
ATOM   4678 C C   . GLU C 3 216 ? 68.099  38.663  -82.703 1.00 115.44 ? 216 GLU E C   1 
ATOM   4679 O O   . GLU C 3 216 ? 68.640  38.835  -81.604 1.00 115.91 ? 216 GLU E O   1 
ATOM   4680 C CB  . GLU C 3 216 ? 66.771  40.736  -83.409 1.00 112.89 ? 216 GLU E CB  1 
ATOM   4681 C CG  . GLU C 3 216 ? 67.287  41.726  -82.366 1.00 124.86 ? 216 GLU E CG  1 
ATOM   4682 C CD  . GLU C 3 216 ? 66.806  43.169  -82.422 1.00 146.27 ? 216 GLU E CD  1 
ATOM   4683 O OE1 . GLU C 3 216 ? 66.451  43.647  -83.525 1.00 140.73 ? 216 GLU E OE1 1 
ATOM   4684 O OE2 . GLU C 3 216 ? 66.806  43.830  -81.356 1.00 134.09 ? 216 GLU E OE2 1 
ATOM   4685 N N   . PRO C 3 217 ? 68.704  37.955  -83.690 1.00 110.60 ? 217 PRO E N   1 
ATOM   4686 C CA  . PRO C 3 217 ? 70.049  37.381  -83.457 1.00 112.15 ? 217 PRO E CA  1 
ATOM   4687 C C   . PRO C 3 217 ? 71.179  38.413  -83.536 1.00 129.96 ? 217 PRO E C   1 
ATOM   4688 O O   . PRO C 3 217 ? 72.261  38.217  -82.978 1.00 85.58  ? 217 PRO E O   1 
ATOM   4689 C CB  . PRO C 3 217 ? 70.174  36.291  -84.530 1.00 113.22 ? 217 PRO E CB  1 
ATOM   4690 C CG  . PRO C 3 217 ? 68.932  36.409  -85.406 1.00 116.59 ? 217 PRO E CG  1 
ATOM   4691 C CD  . PRO C 3 217 ? 68.207  37.649  -85.049 1.00 111.98 ? 217 PRO E CD  1 
ATOM   4692 N N   . GLN D 4 1   ? 39.086  7.343   -2.517  1.00 88.48  ? 1   GLN H N   1 
ATOM   4693 C CA  . GLN D 4 1   ? 38.309  7.970   -3.583  1.00 88.33  ? 1   GLN H CA  1 
ATOM   4694 C C   . GLN D 4 1   ? 38.131  9.471   -3.331  1.00 89.13  ? 1   GLN H C   1 
ATOM   4695 O O   . GLN D 4 1   ? 38.945  10.281  -3.818  1.00 88.44  ? 1   GLN H O   1 
ATOM   4696 C CB  . GLN D 4 1   ? 36.962  7.252   -3.745  1.00 90.48  ? 1   GLN H CB  1 
ATOM   4697 C CG  . GLN D 4 1   ? 37.016  6.169   -4.817  1.00 126.22 ? 1   GLN H CG  1 
ATOM   4698 C CD  . GLN D 4 1   ? 36.437  6.627   -6.141  1.00 161.44 ? 1   GLN H CD  1 
ATOM   4699 O OE1 . GLN D 4 1   ? 36.572  7.795   -6.564  1.00 161.52 ? 1   GLN H OE1 1 
ATOM   4700 N NE2 . GLN D 4 1   ? 35.780  5.703   -6.832  1.00 152.68 ? 1   GLN H NE2 1 
ATOM   4701 N N   . VAL D 4 2   ? 37.085  9.835   -2.538  1.00 82.09  ? 2   VAL H N   1 
ATOM   4702 C CA  . VAL D 4 2   ? 36.829  11.217  -2.164  1.00 79.90  ? 2   VAL H CA  1 
ATOM   4703 C C   . VAL D 4 2   ? 37.858  11.619  -1.127  1.00 81.37  ? 2   VAL H C   1 
ATOM   4704 O O   . VAL D 4 2   ? 38.042  10.923  -0.122  1.00 80.14  ? 2   VAL H O   1 
ATOM   4705 C CB  . VAL D 4 2   ? 35.369  11.485  -1.743  1.00 83.32  ? 2   VAL H CB  1 
ATOM   4706 C CG1 . VAL D 4 2   ? 35.232  12.807  -0.985  1.00 83.10  ? 2   VAL H CG1 1 
ATOM   4707 C CG2 . VAL D 4 2   ? 34.453  11.477  -2.964  1.00 83.02  ? 2   VAL H CG2 1 
ATOM   4708 N N   . GLN D 4 3   ? 38.592  12.695  -1.439  1.00 77.02  ? 3   GLN H N   1 
ATOM   4709 C CA  . GLN D 4 3   ? 39.634  13.243  -0.590  1.00 76.54  ? 3   GLN H CA  1 
ATOM   4710 C C   . GLN D 4 3   ? 39.500  14.746  -0.405  1.00 78.35  ? 3   GLN H C   1 
ATOM   4711 O O   . GLN D 4 3   ? 38.894  15.438  -1.228  1.00 78.98  ? 3   GLN H O   1 
ATOM   4712 C CB  . GLN D 4 3   ? 41.008  12.912  -1.158  1.00 78.59  ? 3   GLN H CB  1 
ATOM   4713 C CG  . GLN D 4 3   ? 41.707  11.754  -0.457  1.00 105.40 ? 3   GLN H CG  1 
ATOM   4714 C CD  . GLN D 4 3   ? 42.813  11.167  -1.308  1.00 132.06 ? 3   GLN H CD  1 
ATOM   4715 O OE1 . GLN D 4 3   ? 43.055  11.586  -2.458  1.00 124.28 ? 3   GLN H OE1 1 
ATOM   4716 N NE2 . GLN D 4 3   ? 43.501  10.166  -0.763  1.00 130.12 ? 3   GLN H NE2 1 
ATOM   4717 N N   . LEU D 4 4   ? 40.054  15.235  0.708   1.00 71.58  ? 4   LEU H N   1 
ATOM   4718 C CA  . LEU D 4 4   ? 40.081  16.638  1.080   1.00 69.54  ? 4   LEU H CA  1 
ATOM   4719 C C   . LEU D 4 4   ? 41.447  16.886  1.699   1.00 70.94  ? 4   LEU H C   1 
ATOM   4720 O O   . LEU D 4 4   ? 41.663  16.600  2.880   1.00 71.00  ? 4   LEU H O   1 
ATOM   4721 C CB  . LEU D 4 4   ? 38.909  16.993  2.024   1.00 68.75  ? 4   LEU H CB  1 
ATOM   4722 C CG  . LEU D 4 4   ? 37.531  17.163  1.354   1.00 71.86  ? 4   LEU H CG  1 
ATOM   4723 C CD1 . LEU D 4 4   ? 36.504  17.586  2.355   1.00 71.81  ? 4   LEU H CD1 1 
ATOM   4724 C CD2 . LEU D 4 4   ? 37.548  18.202  0.234   1.00 73.05  ? 4   LEU H CD2 1 
ATOM   4725 N N   . VAL D 4 5   ? 42.403  17.304  0.866   1.00 64.86  ? 5   VAL H N   1 
ATOM   4726 C CA  . VAL D 4 5   ? 43.754  17.472  1.363   1.00 64.61  ? 5   VAL H CA  1 
ATOM   4727 C C   . VAL D 4 5   ? 44.000  18.898  1.720   1.00 70.64  ? 5   VAL H C   1 
ATOM   4728 O O   . VAL D 4 5   ? 43.920  19.786  0.857   1.00 72.54  ? 5   VAL H O   1 
ATOM   4729 C CB  . VAL D 4 5   ? 44.869  16.879  0.458   1.00 68.13  ? 5   VAL H CB  1 
ATOM   4730 C CG1 . VAL D 4 5   ? 46.248  17.146  1.051   1.00 68.01  ? 5   VAL H CG1 1 
ATOM   4731 C CG2 . VAL D 4 5   ? 44.682  15.374  0.236   1.00 67.66  ? 5   VAL H CG2 1 
ATOM   4732 N N   . GLN D 4 6   ? 44.325  19.117  3.006   1.00 66.31  ? 6   GLN H N   1 
ATOM   4733 C CA  . GLN D 4 6   ? 44.630  20.443  3.530   1.00 65.87  ? 6   GLN H CA  1 
ATOM   4734 C C   . GLN D 4 6   ? 46.140  20.761  3.527   1.00 70.58  ? 6   GLN H C   1 
ATOM   4735 O O   . GLN D 4 6   ? 46.979  19.849  3.534   1.00 68.66  ? 6   GLN H O   1 
ATOM   4736 C CB  . GLN D 4 6   ? 44.004  20.662  4.911   1.00 66.59  ? 6   GLN H CB  1 
ATOM   4737 C CG  . GLN D 4 6   ? 42.485  20.712  4.875   1.00 72.79  ? 6   GLN H CG  1 
ATOM   4738 C CD  . GLN D 4 6   ? 41.850  20.994  6.213   1.00 89.27  ? 6   GLN H CD  1 
ATOM   4739 O OE1 . GLN D 4 6   ? 40.962  20.273  6.690   1.00 81.88  ? 6   GLN H OE1 1 
ATOM   4740 N NE2 . GLN D 4 6   ? 42.276  22.069  6.836   1.00 85.60  ? 6   GLN H NE2 1 
ATOM   4741 N N   . SER D 4 7   ? 46.455  22.078  3.485   1.00 68.45  ? 7   SER H N   1 
ATOM   4742 C CA  . SER D 4 7   ? 47.788  22.665  3.495   1.00 68.46  ? 7   SER H CA  1 
ATOM   4743 C C   . SER D 4 7   ? 48.456  22.429  4.855   1.00 76.28  ? 7   SER H C   1 
ATOM   4744 O O   . SER D 4 7   ? 47.764  22.267  5.867   1.00 75.56  ? 7   SER H O   1 
ATOM   4745 C CB  . SER D 4 7   ? 47.693  24.163  3.210   1.00 70.65  ? 7   SER H CB  1 
ATOM   4746 O OG  . SER D 4 7   ? 47.114  24.926  4.259   1.00 74.18  ? 7   SER H OG  1 
ATOM   4747 N N   . GLY D 4 8   ? 49.792  22.425  4.862   1.00 76.17  ? 8   GLY H N   1 
ATOM   4748 C CA  . GLY D 4 8   ? 50.608  22.244  6.064   1.00 76.84  ? 8   GLY H CA  1 
ATOM   4749 C C   . GLY D 4 8   ? 50.328  23.257  7.160   1.00 83.06  ? 8   GLY H C   1 
ATOM   4750 O O   . GLY D 4 8   ? 49.863  24.373  6.884   1.00 83.75  ? 8   GLY H O   1 
ATOM   4751 N N   . ALA D 4 9   ? 50.599  22.871  8.416   1.00 80.25  ? 9   ALA H N   1 
ATOM   4752 C CA  . ALA D 4 9   ? 50.392  23.725  9.590   1.00 80.30  ? 9   ALA H CA  1 
ATOM   4753 C C   . ALA D 4 9   ? 51.344  24.893  9.533   1.00 85.18  ? 9   ALA H C   1 
ATOM   4754 O O   . ALA D 4 9   ? 52.425  24.755  8.971   1.00 84.64  ? 9   ALA H O   1 
ATOM   4755 C CB  . ALA D 4 9   ? 50.629  22.933  10.857  1.00 80.95  ? 9   ALA H CB  1 
ATOM   4756 N N   . GLU D 4 10  ? 50.951  26.041  10.089  1.00 83.53  ? 10  GLU H N   1 
ATOM   4757 C CA  . GLU D 4 10  ? 51.802  27.227  10.050  1.00 84.90  ? 10  GLU H CA  1 
ATOM   4758 C C   . GLU D 4 10  ? 51.977  27.933  11.402  1.00 90.92  ? 10  GLU H C   1 
ATOM   4759 O O   . GLU D 4 10  ? 51.104  27.854  12.268  1.00 91.08  ? 10  GLU H O   1 
ATOM   4760 C CB  . GLU D 4 10  ? 51.252  28.245  9.018   1.00 86.83  ? 10  GLU H CB  1 
ATOM   4761 C CG  . GLU D 4 10  ? 50.976  27.675  7.633   1.00 104.86 ? 10  GLU H CG  1 
ATOM   4762 C CD  . GLU D 4 10  ? 51.090  28.636  6.463   1.00 144.22 ? 10  GLU H CD  1 
ATOM   4763 O OE1 . GLU D 4 10  ? 50.102  28.757  5.703   1.00 149.32 ? 10  GLU H OE1 1 
ATOM   4764 O OE2 . GLU D 4 10  ? 52.171  29.249  6.289   1.00 143.75 ? 10  GLU H OE2 1 
ATOM   4765 N N   . VAL D 4 11  ? 53.100  28.663  11.555  1.00 88.80  ? 11  VAL H N   1 
ATOM   4766 C CA  . VAL D 4 11  ? 53.335  29.584  12.677  1.00 89.01  ? 11  VAL H CA  1 
ATOM   4767 C C   . VAL D 4 11  ? 53.018  30.921  12.060  1.00 93.72  ? 11  VAL H C   1 
ATOM   4768 O O   . VAL D 4 11  ? 53.484  31.205  10.946  1.00 92.48  ? 11  VAL H O   1 
ATOM   4769 C CB  . VAL D 4 11  ? 54.758  29.658  13.265  1.00 92.29  ? 11  VAL H CB  1 
ATOM   4770 C CG1 . VAL D 4 11  ? 54.725  30.225  14.690  1.00 91.61  ? 11  VAL H CG1 1 
ATOM   4771 C CG2 . VAL D 4 11  ? 55.453  28.315  13.208  1.00 92.03  ? 11  VAL H CG2 1 
ATOM   4772 N N   . LYS D 4 12  ? 52.244  31.743  12.774  1.00 91.42  ? 12  LYS H N   1 
ATOM   4773 C CA  . LYS D 4 12  ? 51.854  33.059  12.287  1.00 91.67  ? 12  LYS H CA  1 
ATOM   4774 C C   . LYS D 4 12  ? 52.147  34.119  13.305  1.00 97.25  ? 12  LYS H C   1 
ATOM   4775 O O   . LYS D 4 12  ? 51.584  34.070  14.396  1.00 98.20  ? 12  LYS H O   1 
ATOM   4776 C CB  . LYS D 4 12  ? 50.373  33.068  11.841  1.00 93.51  ? 12  LYS H CB  1 
ATOM   4777 C CG  . LYS D 4 12  ? 50.198  33.283  10.331  1.00 106.36 ? 12  LYS H CG  1 
ATOM   4778 C CD  . LYS D 4 12  ? 50.801  32.168  9.434   1.00 107.64 ? 12  LYS H CD  1 
ATOM   4779 C CE  . LYS D 4 12  ? 51.068  32.630  8.016   1.00 101.81 ? 12  LYS H CE  1 
ATOM   4780 N NZ  . LYS D 4 12  ? 52.004  33.774  7.962   1.00 100.43 ? 12  LYS H NZ  1 
ATOM   4781 N N   . LYS D 4 13  ? 53.061  35.053  12.980  1.00 94.05  ? 13  LYS H N   1 
ATOM   4782 C CA  . LYS D 4 13  ? 53.385  36.172  13.872  1.00 94.81  ? 13  LYS H CA  1 
ATOM   4783 C C   . LYS D 4 13  ? 52.103  37.032  14.027  1.00 101.51 ? 13  LYS H C   1 
ATOM   4784 O O   . LYS D 4 13  ? 51.359  37.154  13.047  1.00 100.94 ? 13  LYS H O   1 
ATOM   4785 C CB  . LYS D 4 13  ? 54.523  37.025  13.298  1.00 96.59  ? 13  LYS H CB  1 
ATOM   4786 C CG  . LYS D 4 13  ? 55.867  36.304  13.198  1.00 101.44 ? 13  LYS H CG  1 
ATOM   4787 C CD  . LYS D 4 13  ? 57.043  37.236  12.793  1.00 107.56 ? 13  LYS H CD  1 
ATOM   4788 C CE  . LYS D 4 13  ? 56.962  37.854  11.400  1.00 112.54 ? 13  LYS H CE  1 
ATOM   4789 N NZ  . LYS D 4 13  ? 56.731  39.328  11.446  1.00 116.87 ? 13  LYS H NZ  1 
ATOM   4790 N N   . PRO D 4 14  ? 51.748  37.558  15.226  1.00 99.85  ? 14  PRO H N   1 
ATOM   4791 C CA  . PRO D 4 14  ? 50.503  38.343  15.317  1.00 100.41 ? 14  PRO H CA  1 
ATOM   4792 C C   . PRO D 4 14  ? 50.489  39.481  14.300  1.00 106.50 ? 14  PRO H C   1 
ATOM   4793 O O   . PRO D 4 14  ? 51.543  40.051  13.995  1.00 106.55 ? 14  PRO H O   1 
ATOM   4794 C CB  . PRO D 4 14  ? 50.461  38.827  16.772  1.00 101.98 ? 14  PRO H CB  1 
ATOM   4795 C CG  . PRO D 4 14  ? 51.419  37.960  17.511  1.00 105.97 ? 14  PRO H CG  1 
ATOM   4796 C CD  . PRO D 4 14  ? 52.459  37.508  16.521  1.00 101.51 ? 14  PRO H CD  1 
ATOM   4797 N N   . GLY D 4 15  ? 49.326  39.716  13.702  1.00 104.03 ? 15  GLY H N   1 
ATOM   4798 C CA  . GLY D 4 15  ? 49.163  40.727  12.658  1.00 103.68 ? 15  GLY H CA  1 
ATOM   4799 C C   . GLY D 4 15  ? 49.052  40.135  11.265  1.00 105.79 ? 15  GLY H C   1 
ATOM   4800 O O   . GLY D 4 15  ? 48.259  40.617  10.450  1.00 104.63 ? 15  GLY H O   1 
ATOM   4801 N N   . SER D 4 16  ? 49.837  39.054  11.007  1.00 101.81 ? 16  SER H N   1 
ATOM   4802 C CA  . SER D 4 16  ? 49.919  38.285  9.755   1.00 100.79 ? 16  SER H CA  1 
ATOM   4803 C C   . SER D 4 16  ? 48.583  37.673  9.377   1.00 102.34 ? 16  SER H C   1 
ATOM   4804 O O   . SER D 4 16  ? 47.702  37.504  10.226  1.00 102.52 ? 16  SER H O   1 
ATOM   4805 C CB  . SER D 4 16  ? 50.937  37.147  9.884   1.00 104.55 ? 16  SER H CB  1 
ATOM   4806 O OG  . SER D 4 16  ? 52.291  37.568  9.828   1.00 114.59 ? 16  SER H OG  1 
ATOM   4807 N N   . SER D 4 17  ? 48.448  37.333  8.092   1.00 96.04  ? 17  SER H N   1 
ATOM   4808 C CA  . SER D 4 17  ? 47.290  36.634  7.548   1.00 93.85  ? 17  SER H CA  1 
ATOM   4809 C C   . SER D 4 17  ? 47.729  35.219  7.168   1.00 93.04  ? 17  SER H C   1 
ATOM   4810 O O   . SER D 4 17  ? 48.915  34.983  6.891   1.00 93.12  ? 17  SER H O   1 
ATOM   4811 C CB  . SER D 4 17  ? 46.703  37.365  6.341   1.00 96.45  ? 17  SER H CB  1 
ATOM   4812 O OG  . SER D 4 17  ? 47.702  37.803  5.438   1.00 104.73 ? 17  SER H OG  1 
ATOM   4813 N N   . VAL D 4 18  ? 46.790  34.274  7.188   1.00 84.15  ? 18  VAL H N   1 
ATOM   4814 C CA  . VAL D 4 18  ? 47.071  32.905  6.799   1.00 81.07  ? 18  VAL H CA  1 
ATOM   4815 C C   . VAL D 4 18  ? 46.109  32.493  5.702   1.00 83.23  ? 18  VAL H C   1 
ATOM   4816 O O   . VAL D 4 18  ? 44.956  32.887  5.726   1.00 82.36  ? 18  VAL H O   1 
ATOM   4817 C CB  . VAL D 4 18  ? 47.067  31.936  8.019   1.00 83.52  ? 18  VAL H CB  1 
ATOM   4818 C CG1 . VAL D 4 18  ? 45.658  31.591  8.493   1.00 82.49  ? 18  VAL H CG1 1 
ATOM   4819 C CG2 . VAL D 4 18  ? 47.869  30.670  7.733   1.00 83.37  ? 18  VAL H CG2 1 
ATOM   4820 N N   . LYS D 4 19  ? 46.565  31.708  4.742   1.00 79.47  ? 19  LYS H N   1 
ATOM   4821 C CA  . LYS D 4 19  ? 45.652  31.196  3.733   1.00 78.42  ? 19  LYS H CA  1 
ATOM   4822 C C   . LYS D 4 19  ? 45.797  29.691  3.790   1.00 80.96  ? 19  LYS H C   1 
ATOM   4823 O O   . LYS D 4 19  ? 46.844  29.177  3.412   1.00 81.37  ? 19  LYS H O   1 
ATOM   4824 C CB  . LYS D 4 19  ? 45.949  31.772  2.331   1.00 80.85  ? 19  LYS H CB  1 
ATOM   4825 C CG  . LYS D 4 19  ? 44.703  32.010  1.474   1.00 89.13  ? 19  LYS H CG  1 
ATOM   4826 C CD  . LYS D 4 19  ? 45.065  32.339  0.027   1.00 96.69  ? 19  LYS H CD  1 
ATOM   4827 C CE  . LYS D 4 19  ? 43.842  32.565  -0.838  1.00 111.55 ? 19  LYS H CE  1 
ATOM   4828 N NZ  . LYS D 4 19  ? 44.101  32.322  -2.293  1.00 113.37 ? 19  LYS H NZ  1 
ATOM   4829 N N   . VAL D 4 20  ? 44.816  29.001  4.387   1.00 77.32  ? 20  VAL H N   1 
ATOM   4830 C CA  . VAL D 4 20  ? 44.760  27.532  4.481   1.00 77.70  ? 20  VAL H CA  1 
ATOM   4831 C C   . VAL D 4 20  ? 43.930  27.022  3.278   1.00 83.67  ? 20  VAL H C   1 
ATOM   4832 O O   . VAL D 4 20  ? 42.936  27.651  2.910   1.00 83.32  ? 20  VAL H O   1 
ATOM   4833 C CB  . VAL D 4 20  ? 44.270  27.017  5.874   1.00 82.32  ? 20  VAL H CB  1 
ATOM   4834 C CG1 . VAL D 4 20  ? 43.210  27.933  6.494   1.00 82.27  ? 20  VAL H CG1 1 
ATOM   4835 C CG2 . VAL D 4 20  ? 43.789  25.565  5.837   1.00 82.28  ? 20  VAL H CG2 1 
ATOM   4836 N N   . SER D 4 21  ? 44.381  25.937  2.621   1.00 82.50  ? 21  SER H N   1 
ATOM   4837 C CA  . SER D 4 21  ? 43.698  25.388  1.439   1.00 83.28  ? 21  SER H CA  1 
ATOM   4838 C C   . SER D 4 21  ? 43.102  24.009  1.696   1.00 87.30  ? 21  SER H C   1 
ATOM   4839 O O   . SER D 4 21  ? 43.458  23.350  2.675   1.00 87.51  ? 21  SER H O   1 
ATOM   4840 C CB  . SER D 4 21  ? 44.630  25.360  0.226   1.00 88.91  ? 21  SER H CB  1 
ATOM   4841 O OG  . SER D 4 21  ? 45.681  24.414  0.366   1.00 99.89  ? 21  SER H OG  1 
ATOM   4842 N N   . CYS D 4 22  ? 42.185  23.586  0.811   1.00 83.17  ? 22  CYS H N   1 
ATOM   4843 C CA  . CYS D 4 22  ? 41.475  22.317  0.879   1.00 82.42  ? 22  CYS H CA  1 
ATOM   4844 C C   . CYS D 4 22  ? 41.240  21.858  -0.540  1.00 83.48  ? 22  CYS H C   1 
ATOM   4845 O O   . CYS D 4 22  ? 40.287  22.339  -1.172  1.00 82.35  ? 22  CYS H O   1 
ATOM   4846 C CB  . CYS D 4 22  ? 40.156  22.499  1.629   1.00 83.47  ? 22  CYS H CB  1 
ATOM   4847 S SG  . CYS D 4 22  ? 39.214  20.969  1.884   1.00 87.40  ? 22  CYS H SG  1 
ATOM   4848 N N   . LYS D 4 23  ? 42.131  20.964  -1.064  1.00 78.66  ? 23  LYS H N   1 
ATOM   4849 C CA  . LYS D 4 23  ? 42.024  20.415  -2.419  1.00 77.47  ? 23  LYS H CA  1 
ATOM   4850 C C   . LYS D 4 23  ? 41.105  19.217  -2.437  1.00 82.34  ? 23  LYS H C   1 
ATOM   4851 O O   . LYS D 4 23  ? 41.338  18.242  -1.712  1.00 81.94  ? 23  LYS H O   1 
ATOM   4852 C CB  . LYS D 4 23  ? 43.406  20.069  -3.001  1.00 79.37  ? 23  LYS H CB  1 
ATOM   4853 C CG  . LYS D 4 23  ? 43.379  19.120  -4.218  1.00 88.24  ? 23  LYS H CG  1 
ATOM   4854 C CD  . LYS D 4 23  ? 44.248  19.571  -5.384  1.00 90.37  ? 23  LYS H CD  1 
ATOM   4855 C CE  . LYS D 4 23  ? 44.123  18.595  -6.531  1.00 89.71  ? 23  LYS H CE  1 
ATOM   4856 N NZ  . LYS D 4 23  ? 45.154  17.512  -6.498  1.00 82.20  ? 23  LYS H NZ  1 
ATOM   4857 N N   . ALA D 4 24  ? 40.064  19.292  -3.277  1.00 80.22  ? 24  ALA H N   1 
ATOM   4858 C CA  . ALA D 4 24  ? 39.080  18.227  -3.466  1.00 80.99  ? 24  ALA H CA  1 
ATOM   4859 C C   . ALA D 4 24  ? 39.416  17.318  -4.663  1.00 87.77  ? 24  ALA H C   1 
ATOM   4860 O O   . ALA D 4 24  ? 39.846  17.808  -5.719  1.00 88.67  ? 24  ALA H O   1 
ATOM   4861 C CB  . ALA D 4 24  ? 37.712  18.827  -3.662  1.00 81.72  ? 24  ALA H CB  1 
ATOM   4862 N N   . SER D 4 25  ? 39.222  15.989  -4.485  1.00 83.75  ? 25  SER H N   1 
ATOM   4863 C CA  . SER D 4 25  ? 39.449  14.951  -5.505  1.00 82.67  ? 25  SER H CA  1 
ATOM   4864 C C   . SER D 4 25  ? 38.509  13.780  -5.253  1.00 83.53  ? 25  SER H C   1 
ATOM   4865 O O   . SER D 4 25  ? 38.034  13.596  -4.130  1.00 82.53  ? 25  SER H O   1 
ATOM   4866 C CB  . SER D 4 25  ? 40.899  14.477  -5.498  1.00 86.86  ? 25  SER H CB  1 
ATOM   4867 O OG  . SER D 4 25  ? 41.254  13.880  -4.260  1.00 99.30  ? 25  SER H OG  1 
ATOM   4868 N N   . GLY D 4 26  ? 38.232  13.017  -6.301  1.00 78.32  ? 26  GLY H N   1 
ATOM   4869 C CA  . GLY D 4 26  ? 37.337  11.867  -6.215  1.00 77.09  ? 26  GLY H CA  1 
ATOM   4870 C C   . GLY D 4 26  ? 35.873  12.204  -6.405  1.00 78.22  ? 26  GLY H C   1 
ATOM   4871 O O   . GLY D 4 26  ? 35.020  11.320  -6.320  1.00 78.75  ? 26  GLY H O   1 
ATOM   4872 N N   . TYR D 4 27  ? 35.573  13.486  -6.666  1.00 72.14  ? 27  TYR H N   1 
ATOM   4873 C CA  . TYR D 4 27  ? 34.233  14.034  -6.886  1.00 70.32  ? 27  TYR H CA  1 
ATOM   4874 C C   . TYR D 4 27  ? 34.336  15.380  -7.583  1.00 70.10  ? 27  TYR H C   1 
ATOM   4875 O O   . TYR D 4 27  ? 35.425  15.957  -7.648  1.00 67.05  ? 27  TYR H O   1 
ATOM   4876 C CB  . TYR D 4 27  ? 33.431  14.130  -5.564  1.00 71.59  ? 27  TYR H CB  1 
ATOM   4877 C CG  . TYR D 4 27  ? 33.802  15.299  -4.682  1.00 73.37  ? 27  TYR H CG  1 
ATOM   4878 C CD1 . TYR D 4 27  ? 34.867  15.219  -3.789  1.00 74.91  ? 27  TYR H CD1 1 
ATOM   4879 C CD2 . TYR D 4 27  ? 33.052  16.467  -4.697  1.00 74.81  ? 27  TYR H CD2 1 
ATOM   4880 C CE1 . TYR D 4 27  ? 35.200  16.287  -2.961  1.00 74.78  ? 27  TYR H CE1 1 
ATOM   4881 C CE2 . TYR D 4 27  ? 33.376  17.542  -3.879  1.00 76.41  ? 27  TYR H CE2 1 
ATOM   4882 C CZ  . TYR D 4 27  ? 34.452  17.453  -3.016  1.00 85.02  ? 27  TYR H CZ  1 
ATOM   4883 O OH  . TYR D 4 27  ? 34.732  18.546  -2.226  1.00 89.73  ? 27  TYR H OH  1 
ATOM   4884 N N   . THR D 4 28  ? 33.196  15.881  -8.095  1.00 68.22  ? 28  THR H N   1 
ATOM   4885 C CA  . THR D 4 28  ? 33.113  17.156  -8.816  1.00 68.49  ? 28  THR H CA  1 
ATOM   4886 C C   . THR D 4 28  ? 32.832  18.272  -7.806  1.00 70.82  ? 28  THR H C   1 
ATOM   4887 O O   . THR D 4 28  ? 31.691  18.539  -7.443  1.00 69.24  ? 28  THR H O   1 
ATOM   4888 C CB  . THR D 4 28  ? 32.165  17.058  -10.025 1.00 85.18  ? 28  THR H CB  1 
ATOM   4889 O OG1 . THR D 4 28  ? 30.893  16.570  -9.601  1.00 93.67  ? 28  THR H OG1 1 
ATOM   4890 C CG2 . THR D 4 28  ? 32.709  16.122  -11.111 1.00 84.54  ? 28  THR H CG2 1 
ATOM   4891 N N   . PHE D 4 29  ? 33.934  18.868  -7.321  1.00 67.88  ? 29  PHE H N   1 
ATOM   4892 C CA  . PHE D 4 29  ? 34.095  19.907  -6.314  1.00 68.42  ? 29  PHE H CA  1 
ATOM   4893 C C   . PHE D 4 29  ? 32.915  20.848  -6.183  1.00 74.95  ? 29  PHE H C   1 
ATOM   4894 O O   . PHE D 4 29  ? 32.440  21.117  -5.070  1.00 72.95  ? 29  PHE H O   1 
ATOM   4895 C CB  . PHE D 4 29  ? 35.389  20.675  -6.639  1.00 70.63  ? 29  PHE H CB  1 
ATOM   4896 C CG  . PHE D 4 29  ? 35.752  21.927  -5.854  1.00 72.15  ? 29  PHE H CG  1 
ATOM   4897 C CD1 . PHE D 4 29  ? 36.073  21.855  -4.501  1.00 74.94  ? 29  PHE H CD1 1 
ATOM   4898 C CD2 . PHE D 4 29  ? 35.892  23.147  -6.494  1.00 73.02  ? 29  PHE H CD2 1 
ATOM   4899 C CE1 . PHE D 4 29  ? 36.460  22.996  -3.791  1.00 75.16  ? 29  PHE H CE1 1 
ATOM   4900 C CE2 . PHE D 4 29  ? 36.308  24.275  -5.785  1.00 76.46  ? 29  PHE H CE2 1 
ATOM   4901 C CZ  . PHE D 4 29  ? 36.543  24.201  -4.430  1.00 74.31  ? 29  PHE H CZ  1 
ATOM   4902 N N   . SER D 4 30  ? 32.439  21.312  -7.350  1.00 74.94  ? 30  SER H N   1 
ATOM   4903 C CA  . SER D 4 30  ? 31.376  22.285  -7.546  1.00 75.62  ? 30  SER H CA  1 
ATOM   4904 C C   . SER D 4 30  ? 29.986  21.800  -7.191  1.00 79.29  ? 30  SER H C   1 
ATOM   4905 O O   . SER D 4 30  ? 29.109  22.629  -7.077  1.00 78.69  ? 30  SER H O   1 
ATOM   4906 C CB  . SER D 4 30  ? 31.404  22.830  -8.974  1.00 79.40  ? 30  SER H CB  1 
ATOM   4907 O OG  . SER D 4 30  ? 31.607  21.802  -9.928  1.00 89.62  ? 30  SER H OG  1 
ATOM   4908 N N   . ASP D 4 31  ? 29.773  20.499  -6.997  1.00 75.77  ? 31  ASP H N   1 
ATOM   4909 C CA  . ASP D 4 31  ? 28.450  19.953  -6.649  1.00 75.23  ? 31  ASP H CA  1 
ATOM   4910 C C   . ASP D 4 31  ? 28.239  19.707  -5.144  1.00 78.82  ? 31  ASP H C   1 
ATOM   4911 O O   . ASP D 4 31  ? 27.213  19.142  -4.730  1.00 78.51  ? 31  ASP H O   1 
ATOM   4912 C CB  . ASP D 4 31  ? 28.215  18.669  -7.442  1.00 76.39  ? 31  ASP H CB  1 
ATOM   4913 C CG  . ASP D 4 31  ? 28.228  18.869  -8.941  1.00 80.14  ? 31  ASP H CG  1 
ATOM   4914 O OD1 . ASP D 4 31  ? 28.431  20.020  -9.389  1.00 76.94  ? 31  ASP H OD1 1 
ATOM   4915 O OD2 . ASP D 4 31  ? 28.025  17.882  -9.664  1.00 87.68  ? 31  ASP H OD2 1 
ATOM   4916 N N   . TYR D 4 32  ? 29.214  20.161  -4.333  1.00 74.32  ? 32  TYR H N   1 
ATOM   4917 C CA  . TYR D 4 32  ? 29.266  19.995  -2.889  1.00 72.80  ? 32  TYR H CA  1 
ATOM   4918 C C   . TYR D 4 32  ? 29.710  21.281  -2.198  1.00 75.96  ? 32  TYR H C   1 
ATOM   4919 O O   . TYR D 4 32  ? 30.731  21.846  -2.572  1.00 76.79  ? 32  TYR H O   1 
ATOM   4920 C CB  . TYR D 4 32  ? 30.254  18.859  -2.568  1.00 72.58  ? 32  TYR H CB  1 
ATOM   4921 C CG  . TYR D 4 32  ? 29.688  17.471  -2.766  1.00 71.77  ? 32  TYR H CG  1 
ATOM   4922 C CD1 . TYR D 4 32  ? 29.684  16.868  -4.019  1.00 73.40  ? 32  TYR H CD1 1 
ATOM   4923 C CD2 . TYR D 4 32  ? 29.188  16.743  -1.690  1.00 71.60  ? 32  TYR H CD2 1 
ATOM   4924 C CE1 . TYR D 4 32  ? 29.169  15.581  -4.203  1.00 74.69  ? 32  TYR H CE1 1 
ATOM   4925 C CE2 . TYR D 4 32  ? 28.671  15.460  -1.860  1.00 72.13  ? 32  TYR H CE2 1 
ATOM   4926 C CZ  . TYR D 4 32  ? 28.667  14.879  -3.118  1.00 77.15  ? 32  TYR H CZ  1 
ATOM   4927 O OH  . TYR D 4 32  ? 28.161  13.616  -3.284  1.00 73.05  ? 32  TYR H OH  1 
ATOM   4928 N N   . VAL D 4 33  ? 28.972  21.710  -1.162  1.00 70.09  ? 33  VAL H N   1 
ATOM   4929 C CA  . VAL D 4 33  ? 29.246  22.899  -0.333  1.00 67.82  ? 33  VAL H CA  1 
ATOM   4930 C C   . VAL D 4 33  ? 30.490  22.652  0.533   1.00 74.81  ? 33  VAL H C   1 
ATOM   4931 O O   . VAL D 4 33  ? 30.559  21.604  1.189   1.00 74.67  ? 33  VAL H O   1 
ATOM   4932 C CB  . VAL D 4 33  ? 28.039  23.159  0.590   1.00 68.38  ? 33  VAL H CB  1 
ATOM   4933 C CG1 . VAL D 4 33  ? 28.372  24.187  1.648   1.00 67.79  ? 33  VAL H CG1 1 
ATOM   4934 C CG2 . VAL D 4 33  ? 26.808  23.549  -0.195  1.00 67.04  ? 33  VAL H CG2 1 
ATOM   4935 N N   . ILE D 4 34  ? 31.451  23.607  0.568   1.00 72.92  ? 34  ILE H N   1 
ATOM   4936 C CA  . ILE D 4 34  ? 32.635  23.468  1.425   1.00 73.16  ? 34  ILE H CA  1 
ATOM   4937 C C   . ILE D 4 34  ? 32.455  24.315  2.655   1.00 78.69  ? 34  ILE H C   1 
ATOM   4938 O O   . ILE D 4 34  ? 32.311  25.533  2.540   1.00 79.05  ? 34  ILE H O   1 
ATOM   4939 C CB  . ILE D 4 34  ? 34.018  23.683  0.717   1.00 76.08  ? 34  ILE H CB  1 
ATOM   4940 C CG1 . ILE D 4 34  ? 34.458  22.432  -0.041  1.00 75.85  ? 34  ILE H CG1 1 
ATOM   4941 C CG2 . ILE D 4 34  ? 35.126  24.037  1.718   1.00 77.47  ? 34  ILE H CG2 1 
ATOM   4942 C CD1 . ILE D 4 34  ? 33.895  22.304  -1.383  1.00 85.05  ? 34  ILE H CD1 1 
ATOM   4943 N N   . ASN D 4 35  ? 32.453  23.663  3.831   1.00 75.41  ? 35  ASN H N   1 
ATOM   4944 C CA  . ASN D 4 35  ? 32.337  24.311  5.143   1.00 75.01  ? 35  ASN H CA  1 
ATOM   4945 C C   . ASN D 4 35  ? 33.724  24.422  5.746   1.00 78.53  ? 35  ASN H C   1 
ATOM   4946 O O   . ASN D 4 35  ? 34.576  23.569  5.459   1.00 77.12  ? 35  ASN H O   1 
ATOM   4947 C CB  . ASN D 4 35  ? 31.472  23.480  6.088   1.00 72.29  ? 35  ASN H CB  1 
ATOM   4948 C CG  . ASN D 4 35  ? 30.075  23.275  5.601   1.00 109.00 ? 35  ASN H CG  1 
ATOM   4949 O OD1 . ASN D 4 35  ? 29.111  23.867  6.102   1.00 107.72 ? 35  ASN H OD1 1 
ATOM   4950 N ND2 . ASN D 4 35  ? 29.939  22.425  4.607   1.00 104.76 ? 35  ASN H ND2 1 
ATOM   4951 N N   . TRP D 4 36  ? 33.955  25.455  6.583   1.00 74.74  ? 36  TRP H N   1 
ATOM   4952 C CA  . TRP D 4 36  ? 35.216  25.593  7.307   1.00 74.90  ? 36  TRP H CA  1 
ATOM   4953 C C   . TRP D 4 36  ? 34.924  25.580  8.797   1.00 80.59  ? 36  TRP H C   1 
ATOM   4954 O O   . TRP D 4 36  ? 34.222  26.471  9.290   1.00 80.33  ? 36  TRP H O   1 
ATOM   4955 C CB  . TRP D 4 36  ? 36.024  26.813  6.872   1.00 73.76  ? 36  TRP H CB  1 
ATOM   4956 C CG  . TRP D 4 36  ? 36.720  26.627  5.561   1.00 75.00  ? 36  TRP H CG  1 
ATOM   4957 C CD1 . TRP D 4 36  ? 36.224  26.917  4.328   1.00 77.97  ? 36  TRP H CD1 1 
ATOM   4958 C CD2 . TRP D 4 36  ? 38.034  26.082  5.350   1.00 75.01  ? 36  TRP H CD2 1 
ATOM   4959 N NE1 . TRP D 4 36  ? 37.143  26.579  3.354   1.00 77.65  ? 36  TRP H NE1 1 
ATOM   4960 C CE2 . TRP D 4 36  ? 38.267  26.078  3.953   1.00 78.87  ? 36  TRP H CE2 1 
ATOM   4961 C CE3 . TRP D 4 36  ? 39.026  25.560  6.204   1.00 76.30  ? 36  TRP H CE3 1 
ATOM   4962 C CZ2 . TRP D 4 36  ? 39.463  25.618  3.390   1.00 77.86  ? 36  TRP H CZ2 1 
ATOM   4963 C CZ3 . TRP D 4 36  ? 40.210  25.091  5.645   1.00 77.87  ? 36  TRP H CZ3 1 
ATOM   4964 C CH2 . TRP D 4 36  ? 40.422  25.128  4.256   1.00 78.54  ? 36  TRP H CH2 1 
ATOM   4965 N N   . VAL D 4 37  ? 35.373  24.505  9.500   1.00 77.91  ? 37  VAL H N   1 
ATOM   4966 C CA  . VAL D 4 37  ? 35.147  24.319  10.945  1.00 77.48  ? 37  VAL H CA  1 
ATOM   4967 C C   . VAL D 4 37  ? 36.477  24.480  11.712  1.00 82.07  ? 37  VAL H C   1 
ATOM   4968 O O   . VAL D 4 37  ? 37.507  23.940  11.323  1.00 80.00  ? 37  VAL H O   1 
ATOM   4969 C CB  . VAL D 4 37  ? 34.367  23.007  11.298  1.00 80.12  ? 37  VAL H CB  1 
ATOM   4970 C CG1 . VAL D 4 37  ? 34.358  22.725  12.794  1.00 79.34  ? 37  VAL H CG1 1 
ATOM   4971 C CG2 . VAL D 4 37  ? 32.940  23.052  10.776  1.00 79.85  ? 37  VAL H CG2 1 
ATOM   4972 N N   . ARG D 4 38  ? 36.431  25.274  12.778  1.00 80.58  ? 38  ARG H N   1 
ATOM   4973 C CA  . ARG D 4 38  ? 37.539  25.560  13.678  1.00 81.04  ? 38  ARG H CA  1 
ATOM   4974 C C   . ARG D 4 38  ? 37.443  24.638  14.925  1.00 88.03  ? 38  ARG H C   1 
ATOM   4975 O O   . ARG D 4 38  ? 36.359  24.146  15.273  1.00 88.28  ? 38  ARG H O   1 
ATOM   4976 C CB  . ARG D 4 38  ? 37.465  27.042  14.083  1.00 79.04  ? 38  ARG H CB  1 
ATOM   4977 C CG  . ARG D 4 38  ? 38.574  27.513  14.993  1.00 90.70  ? 38  ARG H CG  1 
ATOM   4978 C CD  . ARG D 4 38  ? 38.414  28.970  15.328  1.00 103.97 ? 38  ARG H CD  1 
ATOM   4979 N NE  . ARG D 4 38  ? 37.579  29.185  16.506  1.00 108.13 ? 38  ARG H NE  1 
ATOM   4980 C CZ  . ARG D 4 38  ? 37.733  30.215  17.332  1.00 127.15 ? 38  ARG H CZ  1 
ATOM   4981 N NH1 . ARG D 4 38  ? 38.703  31.104  17.123  1.00 104.95 ? 38  ARG H NH1 1 
ATOM   4982 N NH2 . ARG D 4 38  ? 36.931  30.358  18.383  1.00 124.12 ? 38  ARG H NH2 1 
ATOM   4983 N N   . GLN D 4 39  ? 38.586  24.387  15.571  1.00 85.16  ? 39  GLN H N   1 
ATOM   4984 C CA  . GLN D 4 39  ? 38.625  23.627  16.799  1.00 85.35  ? 39  GLN H CA  1 
ATOM   4985 C C   . GLN D 4 39  ? 39.792  24.095  17.673  1.00 92.93  ? 39  GLN H C   1 
ATOM   4986 O O   . GLN D 4 39  ? 40.916  23.592  17.573  1.00 90.40  ? 39  GLN H O   1 
ATOM   4987 C CB  . GLN D 4 39  ? 38.574  22.113  16.575  1.00 86.28  ? 39  GLN H CB  1 
ATOM   4988 C CG  . GLN D 4 39  ? 38.034  21.390  17.802  1.00 87.21  ? 39  GLN H CG  1 
ATOM   4989 C CD  . GLN D 4 39  ? 37.995  19.892  17.705  1.00 93.34  ? 39  GLN H CD  1 
ATOM   4990 O OE1 . GLN D 4 39  ? 38.320  19.271  16.690  1.00 86.93  ? 39  GLN H OE1 1 
ATOM   4991 N NE2 . GLN D 4 39  ? 37.591  19.275  18.784  1.00 85.70  ? 39  GLN H NE2 1 
ATOM   4992 N N   . ALA D 4 40  ? 39.500  25.131  18.502  1.00 94.79  ? 40  ALA H N   1 
ATOM   4993 C CA  . ALA D 4 40  ? 40.416  25.733  19.467  1.00 96.03  ? 40  ALA H CA  1 
ATOM   4994 C C   . ALA D 4 40  ? 40.511  24.808  20.657  1.00 104.68 ? 40  ALA H C   1 
ATOM   4995 O O   . ALA D 4 40  ? 39.538  24.112  20.965  1.00 103.80 ? 40  ALA H O   1 
ATOM   4996 C CB  . ALA D 4 40  ? 39.924  27.096  19.892  1.00 96.59  ? 40  ALA H CB  1 
ATOM   4997 N N   . PRO D 4 41  ? 41.691  24.737  21.304  1.00 106.14 ? 41  PRO H N   1 
ATOM   4998 C CA  . PRO D 4 41  ? 41.859  23.795  22.427  1.00 107.77 ? 41  PRO H CA  1 
ATOM   4999 C C   . PRO D 4 41  ? 40.865  23.986  23.573  1.00 114.41 ? 41  PRO H C   1 
ATOM   5000 O O   . PRO D 4 41  ? 40.984  24.927  24.372  1.00 114.17 ? 41  PRO H O   1 
ATOM   5001 C CB  . PRO D 4 41  ? 43.321  24.001  22.852  1.00 109.85 ? 41  PRO H CB  1 
ATOM   5002 C CG  . PRO D 4 41  ? 43.997  24.577  21.620  1.00 114.03 ? 41  PRO H CG  1 
ATOM   5003 C CD  . PRO D 4 41  ? 42.944  25.469  21.025  1.00 108.72 ? 41  PRO H CD  1 
ATOM   5004 N N   . GLY D 4 42  ? 39.870  23.095  23.608  1.00 112.15 ? 42  GLY H N   1 
ATOM   5005 C CA  . GLY D 4 42  ? 38.816  23.109  24.617  1.00 112.26 ? 42  GLY H CA  1 
ATOM   5006 C C   . GLY D 4 42  ? 37.503  23.678  24.118  1.00 115.67 ? 42  GLY H C   1 
ATOM   5007 O O   . GLY D 4 42  ? 36.437  23.155  24.475  1.00 116.77 ? 42  GLY H O   1 
ATOM   5008 N N   . GLN D 4 43  ? 37.578  24.750  23.273  1.00 109.04 ? 43  GLN H N   1 
ATOM   5009 C CA  . GLN D 4 43  ? 36.437  25.470  22.670  1.00 107.25 ? 43  GLN H CA  1 
ATOM   5010 C C   . GLN D 4 43  ? 35.479  24.607  21.837  1.00 106.65 ? 43  GLN H C   1 
ATOM   5011 O O   . GLN D 4 43  ? 34.354  25.045  21.558  1.00 107.20 ? 43  GLN H O   1 
ATOM   5012 C CB  . GLN D 4 43  ? 36.911  26.662  21.826  1.00 108.72 ? 43  GLN H CB  1 
ATOM   5013 C CG  . GLN D 4 43  ? 36.979  27.987  22.581  1.00 126.53 ? 43  GLN H CG  1 
ATOM   5014 C CD  . GLN D 4 43  ? 38.208  28.129  23.453  1.00 149.66 ? 43  GLN H CD  1 
ATOM   5015 O OE1 . GLN D 4 43  ? 39.268  27.540  23.196  1.00 145.95 ? 43  GLN H OE1 1 
ATOM   5016 N NE2 . GLN D 4 43  ? 38.095  28.933  24.502  1.00 143.46 ? 43  GLN H NE2 1 
ATOM   5017 N N   . GLY D 4 44  ? 35.932  23.415  21.442  1.00 97.81  ? 44  GLY H N   1 
ATOM   5018 C CA  . GLY D 4 44  ? 35.139  22.490  20.649  1.00 94.73  ? 44  GLY H CA  1 
ATOM   5019 C C   . GLY D 4 44  ? 35.057  22.898  19.199  1.00 92.16  ? 44  GLY H C   1 
ATOM   5020 O O   . GLY D 4 44  ? 35.842  23.726  18.725  1.00 91.37  ? 44  GLY H O   1 
ATOM   5021 N N   . LEU D 4 45  ? 34.089  22.318  18.497  1.00 84.02  ? 45  LEU H N   1 
ATOM   5022 C CA  . LEU D 4 45  ? 33.878  22.561  17.083  1.00 80.90  ? 45  LEU H CA  1 
ATOM   5023 C C   . LEU D 4 45  ? 33.002  23.778  16.868  1.00 85.04  ? 45  LEU H C   1 
ATOM   5024 O O   . LEU D 4 45  ? 31.928  23.884  17.460  1.00 85.62  ? 45  LEU H O   1 
ATOM   5025 C CB  . LEU D 4 45  ? 33.334  21.298  16.393  1.00 79.46  ? 45  LEU H CB  1 
ATOM   5026 C CG  . LEU D 4 45  ? 34.290  20.094  16.394  1.00 81.88  ? 45  LEU H CG  1 
ATOM   5027 C CD1 . LEU D 4 45  ? 33.544  18.810  16.287  1.00 81.52  ? 45  LEU H CD1 1 
ATOM   5028 C CD2 . LEU D 4 45  ? 35.323  20.196  15.300  1.00 82.31  ? 45  LEU H CD2 1 
ATOM   5029 N N   . GLU D 4 46  ? 33.518  24.745  16.093  1.00 81.20  ? 46  GLU H N   1 
ATOM   5030 C CA  . GLU D 4 46  ? 32.837  25.998  15.753  1.00 80.91  ? 46  GLU H CA  1 
ATOM   5031 C C   . GLU D 4 46  ? 32.798  26.136  14.229  1.00 83.76  ? 46  GLU H C   1 
ATOM   5032 O O   . GLU D 4 46  ? 33.825  25.990  13.577  1.00 83.14  ? 46  GLU H O   1 
ATOM   5033 C CB  . GLU D 4 46  ? 33.534  27.203  16.417  1.00 82.61  ? 46  GLU H CB  1 
ATOM   5034 C CG  . GLU D 4 46  ? 32.587  28.051  17.263  1.00 99.09  ? 46  GLU H CG  1 
ATOM   5035 C CD  . GLU D 4 46  ? 33.164  29.137  18.162  1.00 128.40 ? 46  GLU H CD  1 
ATOM   5036 O OE1 . GLU D 4 46  ? 33.914  28.812  19.114  1.00 125.41 ? 46  GLU H OE1 1 
ATOM   5037 O OE2 . GLU D 4 46  ? 32.820  30.320  17.937  1.00 126.41 ? 46  GLU H OE2 1 
ATOM   5038 N N   . TRP D 4 47  ? 31.611  26.332  13.656  1.00 80.28  ? 47  TRP H N   1 
ATOM   5039 C CA  . TRP D 4 47  ? 31.474  26.460  12.210  1.00 79.98  ? 47  TRP H CA  1 
ATOM   5040 C C   . TRP D 4 47  ? 31.717  27.899  11.821  1.00 84.01  ? 47  TRP H C   1 
ATOM   5041 O O   . TRP D 4 47  ? 30.999  28.782  12.290  1.00 84.17  ? 47  TRP H O   1 
ATOM   5042 C CB  . TRP D 4 47  ? 30.084  26.030  11.765  1.00 78.50  ? 47  TRP H CB  1 
ATOM   5043 C CG  . TRP D 4 47  ? 29.812  26.250  10.305  1.00 79.05  ? 47  TRP H CG  1 
ATOM   5044 C CD1 . TRP D 4 47  ? 30.142  25.418  9.276   1.00 81.82  ? 47  TRP H CD1 1 
ATOM   5045 C CD2 . TRP D 4 47  ? 29.029  27.308  9.733   1.00 78.54  ? 47  TRP H CD2 1 
ATOM   5046 N NE1 . TRP D 4 47  ? 29.620  25.895  8.096   1.00 81.40  ? 47  TRP H NE1 1 
ATOM   5047 C CE2 . TRP D 4 47  ? 28.942  27.062  8.346   1.00 82.92  ? 47  TRP H CE2 1 
ATOM   5048 C CE3 . TRP D 4 47  ? 28.371  28.428  10.260  1.00 79.24  ? 47  TRP H CE3 1 
ATOM   5049 C CZ2 . TRP D 4 47  ? 28.216  27.899  7.481   1.00 82.12  ? 47  TRP H CZ2 1 
ATOM   5050 C CZ3 . TRP D 4 47  ? 27.682  29.270  9.400   1.00 80.38  ? 47  TRP H CZ3 1 
ATOM   5051 C CH2 . TRP D 4 47  ? 27.610  29.008  8.030   1.00 81.10  ? 47  TRP H CH2 1 
ATOM   5052 N N   . MET D 4 48  ? 32.700  28.132  10.947  1.00 79.26  ? 48  MET H N   1 
ATOM   5053 C CA  . MET D 4 48  ? 33.074  29.475  10.532  1.00 78.21  ? 48  MET H CA  1 
ATOM   5054 C C   . MET D 4 48  ? 32.281  29.991  9.356   1.00 83.25  ? 48  MET H C   1 
ATOM   5055 O O   . MET D 4 48  ? 31.787  31.126  9.397   1.00 84.27  ? 48  MET H O   1 
ATOM   5056 C CB  . MET D 4 48  ? 34.561  29.551  10.277  1.00 79.80  ? 48  MET H CB  1 
ATOM   5057 C CG  . MET D 4 48  ? 35.343  29.158  11.477  1.00 83.35  ? 48  MET H CG  1 
ATOM   5058 S SD  . MET D 4 48  ? 37.046  28.947  11.029  1.00 87.70  ? 48  MET H SD  1 
ATOM   5059 C CE  . MET D 4 48  ? 37.540  30.685  10.826  1.00 84.04  ? 48  MET H CE  1 
ATOM   5060 N N   . GLY D 4 49  ? 32.135  29.162  8.334   1.00 78.47  ? 49  GLY H N   1 
ATOM   5061 C CA  . GLY D 4 49  ? 31.384  29.532  7.148   1.00 78.00  ? 49  GLY H CA  1 
ATOM   5062 C C   . GLY D 4 49  ? 31.314  28.444  6.105   1.00 83.62  ? 49  GLY H C   1 
ATOM   5063 O O   . GLY D 4 49  ? 31.769  27.320  6.327   1.00 83.47  ? 49  GLY H O   1 
ATOM   5064 N N   . GLU D 4 50  ? 30.744  28.782  4.949   1.00 82.35  ? 50  GLU H N   1 
ATOM   5065 C CA  . GLU D 4 50  ? 30.610  27.858  3.818   1.00 82.68  ? 50  GLU H CA  1 
ATOM   5066 C C   . GLU D 4 50  ? 30.515  28.562  2.452   1.00 86.49  ? 50  GLU H C   1 
ATOM   5067 O O   . GLU D 4 50  ? 30.112  29.735  2.341   1.00 85.24  ? 50  GLU H O   1 
ATOM   5068 C CB  . GLU D 4 50  ? 29.445  26.868  4.013   1.00 83.98  ? 50  GLU H CB  1 
ATOM   5069 C CG  . GLU D 4 50  ? 28.078  27.532  4.036   1.00 91.41  ? 50  GLU H CG  1 
ATOM   5070 C CD  . GLU D 4 50  ? 26.940  26.552  4.153   1.00 101.38 ? 50  GLU H CD  1 
ATOM   5071 O OE1 . GLU D 4 50  ? 27.060  25.583  4.937   1.00 104.09 ? 50  GLU H OE1 1 
ATOM   5072 O OE2 . GLU D 4 50  ? 25.928  26.745  3.445   1.00 86.38  ? 50  GLU H OE2 1 
ATOM   5073 N N   . ILE D 4 51  ? 30.913  27.820  1.423   1.00 83.13  ? 51  ILE H N   1 
ATOM   5074 C CA  . ILE D 4 51  ? 30.884  28.288  0.048   1.00 83.03  ? 51  ILE H CA  1 
ATOM   5075 C C   . ILE D 4 51  ? 30.132  27.268  -0.787  1.00 87.96  ? 51  ILE H C   1 
ATOM   5076 O O   . ILE D 4 51  ? 30.245  26.064  -0.535  1.00 88.49  ? 51  ILE H O   1 
ATOM   5077 C CB  . ILE D 4 51  ? 32.315  28.638  -0.527  1.00 84.90  ? 51  ILE H CB  1 
ATOM   5078 C CG1 . ILE D 4 51  ? 32.222  29.448  -1.841  1.00 83.81  ? 51  ILE H CG1 1 
ATOM   5079 C CG2 . ILE D 4 51  ? 33.240  27.403  -0.679  1.00 83.80  ? 51  ILE H CG2 1 
ATOM   5080 C CD1 . ILE D 4 51  ? 33.268  30.445  -2.014  1.00 82.11  ? 51  ILE H CD1 1 
ATOM   5081 N N   . TYR D 4 52  ? 29.326  27.764  -1.732  1.00 83.16  ? 52  TYR H N   1 
ATOM   5082 C CA  . TYR D 4 52  ? 28.643  26.975  -2.734  1.00 82.79  ? 52  TYR H CA  1 
ATOM   5083 C C   . TYR D 4 52  ? 29.614  27.155  -3.919  1.00 87.59  ? 52  TYR H C   1 
ATOM   5084 O O   . TYR D 4 52  ? 29.692  28.280  -4.440  1.00 88.24  ? 52  TYR H O   1 
ATOM   5085 C CB  . TYR D 4 52  ? 27.272  27.587  -2.999  1.00 83.57  ? 52  TYR H CB  1 
ATOM   5086 C CG  . TYR D 4 52  ? 26.228  27.096  -2.033  1.00 84.40  ? 52  TYR H CG  1 
ATOM   5087 C CD1 . TYR D 4 52  ? 26.117  27.640  -0.759  1.00 85.58  ? 52  TYR H CD1 1 
ATOM   5088 C CD2 . TYR D 4 52  ? 25.352  26.076  -2.388  1.00 85.80  ? 52  TYR H CD2 1 
ATOM   5089 C CE1 . TYR D 4 52  ? 25.170  27.166  0.149   1.00 86.26  ? 52  TYR H CE1 1 
ATOM   5090 C CE2 . TYR D 4 52  ? 24.383  25.612  -1.499  1.00 87.01  ? 52  TYR H CE2 1 
ATOM   5091 C CZ  . TYR D 4 52  ? 24.304  26.148  -0.226  1.00 91.40  ? 52  TYR H CZ  1 
ATOM   5092 O OH  . TYR D 4 52  ? 23.340  25.680  0.635   1.00 88.05  ? 52  TYR H OH  1 
ATOM   5093 N N   . PRO D 4 53  ? 30.497  26.154  -4.229  1.00 82.01  ? 53  PRO H N   1 
ATOM   5094 C CA  . PRO D 4 53  ? 31.569  26.398  -5.217  1.00 81.45  ? 53  PRO H CA  1 
ATOM   5095 C C   . PRO D 4 53  ? 31.083  26.782  -6.596  1.00 85.92  ? 53  PRO H C   1 
ATOM   5096 O O   . PRO D 4 53  ? 31.577  27.762  -7.151  1.00 85.88  ? 53  PRO H O   1 
ATOM   5097 C CB  . PRO D 4 53  ? 32.379  25.099  -5.205  1.00 82.86  ? 53  PRO H CB  1 
ATOM   5098 C CG  . PRO D 4 53  ? 32.077  24.500  -3.891  1.00 86.95  ? 53  PRO H CG  1 
ATOM   5099 C CD  . PRO D 4 53  ? 30.633  24.811  -3.641  1.00 82.37  ? 53  PRO H CD  1 
ATOM   5100 N N   . GLY D 4 54  ? 30.062  26.067  -7.058  1.00 83.16  ? 54  GLY H N   1 
ATOM   5101 C CA  . GLY D 4 54  ? 29.410  26.230  -8.347  1.00 83.38  ? 54  GLY H CA  1 
ATOM   5102 C C   . GLY D 4 54  ? 29.058  27.646  -8.727  1.00 89.34  ? 54  GLY H C   1 
ATOM   5103 O O   . GLY D 4 54  ? 29.269  28.027  -9.878  1.00 90.63  ? 54  GLY H O   1 
ATOM   5104 N N   . SER D 4 55  ? 28.541  28.441  -7.771  1.00 85.58  ? 55  SER H N   1 
ATOM   5105 C CA  . SER D 4 55  ? 28.179  29.840  -8.015  1.00 84.60  ? 55  SER H CA  1 
ATOM   5106 C C   . SER D 4 55  ? 28.923  30.788  -7.089  1.00 88.82  ? 55  SER H C   1 
ATOM   5107 O O   . SER D 4 55  ? 28.583  31.971  -7.032  1.00 89.74  ? 55  SER H O   1 
ATOM   5108 C CB  . SER D 4 55  ? 26.680  30.040  -7.850  1.00 87.81  ? 55  SER H CB  1 
ATOM   5109 O OG  . SER D 4 55  ? 26.347  29.990  -6.473  1.00 97.14  ? 55  SER H OG  1 
ATOM   5110 N N   . GLY D 4 56  ? 29.900  30.269  -6.353  1.00 84.67  ? 56  GLY H N   1 
ATOM   5111 C CA  . GLY D 4 56  ? 30.708  31.058  -5.425  1.00 84.22  ? 56  GLY H CA  1 
ATOM   5112 C C   . GLY D 4 56  ? 29.950  31.746  -4.304  1.00 87.08  ? 56  GLY H C   1 
ATOM   5113 O O   . GLY D 4 56  ? 30.473  32.697  -3.719  1.00 85.81  ? 56  GLY H O   1 
ATOM   5114 N N   . THR D 4 57  ? 28.721  31.262  -3.982  1.00 84.10  ? 57  THR H N   1 
ATOM   5115 C CA  . THR D 4 57  ? 27.821  31.816  -2.951  1.00 83.66  ? 57  THR H CA  1 
ATOM   5116 C C   . THR D 4 57  ? 28.340  31.500  -1.545  1.00 89.15  ? 57  THR H C   1 
ATOM   5117 O O   . THR D 4 57  ? 28.536  30.337  -1.198  1.00 89.41  ? 57  THR H O   1 
ATOM   5118 C CB  . THR D 4 57  ? 26.375  31.356  -3.225  1.00 86.51  ? 57  THR H CB  1 
ATOM   5119 O OG1 . THR D 4 57  ? 26.005  31.784  -4.533  1.00 89.21  ? 57  THR H OG1 1 
ATOM   5120 C CG2 . THR D 4 57  ? 25.382  31.913  -2.253  1.00 80.31  ? 57  THR H CG2 1 
ATOM   5121 N N   . ASN D 4 58  ? 28.577  32.542  -0.756  1.00 87.21  ? 58  ASN H N   1 
ATOM   5122 C CA  . ASN D 4 58  ? 29.138  32.444  0.588   1.00 88.58  ? 58  ASN H CA  1 
ATOM   5123 C C   . ASN D 4 58  ? 28.154  32.636  1.737   1.00 95.33  ? 58  ASN H C   1 
ATOM   5124 O O   . ASN D 4 58  ? 27.330  33.549  1.690   1.00 95.58  ? 58  ASN H O   1 
ATOM   5125 C CB  . ASN D 4 58  ? 30.237  33.478  0.734   1.00 90.52  ? 58  ASN H CB  1 
ATOM   5126 C CG  . ASN D 4 58  ? 31.607  32.884  0.754   1.00 120.94 ? 58  ASN H CG  1 
ATOM   5127 O OD1 . ASN D 4 58  ? 31.972  32.127  1.664   1.00 119.07 ? 58  ASN H OD1 1 
ATOM   5128 N ND2 . ASN D 4 58  ? 32.397  33.228  -0.247  1.00 113.84 ? 58  ASN H ND2 1 
ATOM   5129 N N   . TYR D 4 59  ? 28.308  31.843  2.810   1.00 93.10  ? 59  TYR H N   1 
ATOM   5130 C CA  . TYR D 4 59  ? 27.507  31.991  4.027   1.00 93.95  ? 59  TYR H CA  1 
ATOM   5131 C C   . TYR D 4 59  ? 28.395  31.927  5.266   1.00 99.64  ? 59  TYR H C   1 
ATOM   5132 O O   . TYR D 4 59  ? 28.911  30.860  5.593   1.00 101.01 ? 59  TYR H O   1 
ATOM   5133 C CB  . TYR D 4 59  ? 26.375  30.966  4.085   1.00 95.43  ? 59  TYR H CB  1 
ATOM   5134 C CG  . TYR D 4 59  ? 25.378  31.176  2.979   1.00 97.70  ? 59  TYR H CG  1 
ATOM   5135 C CD1 . TYR D 4 59  ? 24.463  32.220  3.031   1.00 99.63  ? 59  TYR H CD1 1 
ATOM   5136 C CD2 . TYR D 4 59  ? 25.390  30.376  1.845   1.00 99.01  ? 59  TYR H CD2 1 
ATOM   5137 C CE1 . TYR D 4 59  ? 23.571  32.452  1.989   1.00 100.65 ? 59  TYR H CE1 1 
ATOM   5138 C CE2 . TYR D 4 59  ? 24.482  30.577  0.810   1.00 100.10 ? 59  TYR H CE2 1 
ATOM   5139 C CZ  . TYR D 4 59  ? 23.595  31.638  0.873   1.00 108.18 ? 59  TYR H CZ  1 
ATOM   5140 O OH  . TYR D 4 59  ? 22.710  31.863  -0.147  1.00 111.97 ? 59  TYR H OH  1 
ATOM   5141 N N   . TYR D 4 60  ? 28.598  33.065  5.936   1.00 94.92  ? 60  TYR H N   1 
ATOM   5142 C CA  . TYR D 4 60  ? 29.471  33.135  7.103   1.00 94.67  ? 60  TYR H CA  1 
ATOM   5143 C C   . TYR D 4 60  ? 28.734  33.187  8.433   1.00 101.43 ? 60  TYR H C   1 
ATOM   5144 O O   . TYR D 4 60  ? 27.546  33.533  8.489   1.00 101.51 ? 60  TYR H O   1 
ATOM   5145 C CB  . TYR D 4 60  ? 30.344  34.389  7.016   1.00 94.96  ? 60  TYR H CB  1 
ATOM   5146 C CG  . TYR D 4 60  ? 31.341  34.395  5.884   1.00 95.98  ? 60  TYR H CG  1 
ATOM   5147 C CD1 . TYR D 4 60  ? 30.995  34.880  4.630   1.00 97.28  ? 60  TYR H CD1 1 
ATOM   5148 C CD2 . TYR D 4 60  ? 32.661  34.005  6.093   1.00 96.96  ? 60  TYR H CD2 1 
ATOM   5149 C CE1 . TYR D 4 60  ? 31.927  34.950  3.601   1.00 97.85  ? 60  TYR H CE1 1 
ATOM   5150 C CE2 . TYR D 4 60  ? 33.603  34.068  5.069   1.00 97.87  ? 60  TYR H CE2 1 
ATOM   5151 C CZ  . TYR D 4 60  ? 33.229  34.538  3.822   1.00 105.83 ? 60  TYR H CZ  1 
ATOM   5152 O OH  . TYR D 4 60  ? 34.142  34.611  2.803   1.00 108.67 ? 60  TYR H OH  1 
ATOM   5153 N N   . ASN D 4 61  ? 29.470  32.873  9.518   1.00 99.17  ? 61  ASN H N   1 
ATOM   5154 C CA  . ASN D 4 61  ? 29.013  33.027  10.891  1.00 99.64  ? 61  ASN H CA  1 
ATOM   5155 C C   . ASN D 4 61  ? 29.453  34.466  11.237  1.00 106.94 ? 61  ASN H C   1 
ATOM   5156 O O   . ASN D 4 61  ? 30.648  34.765  11.127  1.00 107.32 ? 61  ASN H O   1 
ATOM   5157 C CB  . ASN D 4 61  ? 29.721  32.019  11.800  1.00 96.45  ? 61  ASN H CB  1 
ATOM   5158 C CG  . ASN D 4 61  ? 29.580  32.260  13.289  1.00 107.38 ? 61  ASN H CG  1 
ATOM   5159 O OD1 . ASN D 4 61  ? 28.898  33.192  13.752  1.00 105.40 ? 61  ASN H OD1 1 
ATOM   5160 N ND2 . ASN D 4 61  ? 30.229  31.405  14.077  1.00 89.76  ? 61  ASN H ND2 1 
ATOM   5161 N N   . GLU D 4 62  ? 28.508  35.354  11.628  1.00 104.17 ? 62  GLU H N   1 
ATOM   5162 C CA  . GLU D 4 62  ? 28.828  36.754  11.966  1.00 104.42 ? 62  GLU H CA  1 
ATOM   5163 C C   . GLU D 4 62  ? 30.098  36.895  12.823  1.00 105.90 ? 62  GLU H C   1 
ATOM   5164 O O   . GLU D 4 62  ? 30.913  37.791  12.564  1.00 105.37 ? 62  GLU H O   1 
ATOM   5165 C CB  . GLU D 4 62  ? 27.636  37.466  12.647  1.00 106.37 ? 62  GLU H CB  1 
ATOM   5166 C CG  . GLU D 4 62  ? 26.596  38.018  11.682  1.00 122.04 ? 62  GLU H CG  1 
ATOM   5167 C CD  . GLU D 4 62  ? 26.990  39.228  10.850  1.00 148.98 ? 62  GLU H CD  1 
ATOM   5168 O OE1 . GLU D 4 62  ? 27.626  40.158  11.400  1.00 143.30 ? 62  GLU H OE1 1 
ATOM   5169 O OE2 . GLU D 4 62  ? 26.643  39.249  9.646   1.00 145.22 ? 62  GLU H OE2 1 
ATOM   5170 N N   . LYS D 4 63  ? 30.261  35.981  13.821  1.00 99.96  ? 63  LYS H N   1 
ATOM   5171 C CA  . LYS D 4 63  ? 31.390  35.889  14.741  1.00 98.48  ? 63  LYS H CA  1 
ATOM   5172 C C   . LYS D 4 63  ? 32.698  35.918  13.938  1.00 102.66 ? 63  LYS H C   1 
ATOM   5173 O O   . LYS D 4 63  ? 33.570  36.756  14.213  1.00 102.69 ? 63  LYS H O   1 
ATOM   5174 C CB  . LYS D 4 63  ? 31.275  34.585  15.564  1.00 99.86  ? 63  LYS H CB  1 
ATOM   5175 C CG  . LYS D 4 63  ? 31.989  34.574  16.926  1.00 105.79 ? 63  LYS H CG  1 
ATOM   5176 C CD  . LYS D 4 63  ? 33.398  33.967  16.884  1.00 106.08 ? 63  LYS H CD  1 
ATOM   5177 C CE  . LYS D 4 63  ? 33.990  33.670  18.240  1.00 99.38  ? 63  LYS H CE  1 
ATOM   5178 N NZ  . LYS D 4 63  ? 35.450  33.395  18.159  1.00 98.57  ? 63  LYS H NZ  1 
ATOM   5179 N N   . PHE D 4 64  ? 32.782  35.065  12.886  1.00 98.60  ? 64  PHE H N   1 
ATOM   5180 C CA  . PHE D 4 64  ? 33.946  34.922  12.015  1.00 98.06  ? 64  PHE H CA  1 
ATOM   5181 C C   . PHE D 4 64  ? 33.877  35.692  10.708  1.00 104.24 ? 64  PHE H C   1 
ATOM   5182 O O   . PHE D 4 64  ? 34.849  35.665  9.951   1.00 104.19 ? 64  PHE H O   1 
ATOM   5183 C CB  . PHE D 4 64  ? 34.230  33.451  11.742  1.00 99.24  ? 64  PHE H CB  1 
ATOM   5184 C CG  . PHE D 4 64  ? 34.485  32.662  12.993  1.00 100.53 ? 64  PHE H CG  1 
ATOM   5185 C CD1 . PHE D 4 64  ? 35.742  32.645  13.577  1.00 103.30 ? 64  PHE H CD1 1 
ATOM   5186 C CD2 . PHE D 4 64  ? 33.467  31.930  13.588  1.00 103.33 ? 64  PHE H CD2 1 
ATOM   5187 C CE1 . PHE D 4 64  ? 35.978  31.912  14.736  1.00 104.81 ? 64  PHE H CE1 1 
ATOM   5188 C CE2 . PHE D 4 64  ? 33.701  31.196  14.747  1.00 106.58 ? 64  PHE H CE2 1 
ATOM   5189 C CZ  . PHE D 4 64  ? 34.956  31.190  15.315  1.00 104.76 ? 64  PHE H CZ  1 
ATOM   5190 N N   . LYS D 4 65  ? 32.781  36.426  10.462  1.00 102.71 ? 65  LYS H N   1 
ATOM   5191 C CA  . LYS D 4 65  ? 32.607  37.242  9.250   1.00 103.80 ? 65  LYS H CA  1 
ATOM   5192 C C   . LYS D 4 65  ? 33.733  38.288  9.110   1.00 109.86 ? 65  LYS H C   1 
ATOM   5193 O O   . LYS D 4 65  ? 34.106  38.645  7.990   1.00 109.81 ? 65  LYS H O   1 
ATOM   5194 C CB  . LYS D 4 65  ? 31.226  37.921  9.276   1.00 106.62 ? 65  LYS H CB  1 
ATOM   5195 C CG  . LYS D 4 65  ? 30.897  38.838  8.096   1.00 125.88 ? 65  LYS H CG  1 
ATOM   5196 C CD  . LYS D 4 65  ? 29.880  39.931  8.493   1.00 144.69 ? 65  LYS H CD  1 
ATOM   5197 C CE  . LYS D 4 65  ? 30.447  41.020  9.393   1.00 158.60 ? 65  LYS H CE  1 
ATOM   5198 N NZ  . LYS D 4 65  ? 29.387  41.911  9.940   1.00 165.52 ? 65  LYS H NZ  1 
ATOM   5199 N N   . ALA D 4 66  ? 34.300  38.717  10.252  1.00 107.60 ? 66  ALA H N   1 
ATOM   5200 C CA  . ALA D 4 66  ? 35.347  39.730  10.360  1.00 108.08 ? 66  ALA H CA  1 
ATOM   5201 C C   . ALA D 4 66  ? 36.658  39.443  9.604   1.00 112.95 ? 66  ALA H C   1 
ATOM   5202 O O   . ALA D 4 66  ? 37.036  40.252  8.756   1.00 112.57 ? 66  ALA H O   1 
ATOM   5203 C CB  . ALA D 4 66  ? 35.645  40.009  11.824  1.00 108.86 ? 66  ALA H CB  1 
ATOM   5204 N N   . LYS D 4 67  ? 37.368  38.334  9.927   1.00 110.08 ? 67  LYS H N   1 
ATOM   5205 C CA  . LYS D 4 67  ? 38.685  38.046  9.336   1.00 109.63 ? 67  LYS H CA  1 
ATOM   5206 C C   . LYS D 4 67  ? 38.707  36.872  8.329   1.00 112.96 ? 67  LYS H C   1 
ATOM   5207 O O   . LYS D 4 67  ? 39.599  36.828  7.466   1.00 112.94 ? 67  LYS H O   1 
ATOM   5208 C CB  . LYS D 4 67  ? 39.758  37.844  10.437  1.00 111.59 ? 67  LYS H CB  1 
ATOM   5209 C CG  . LYS D 4 67  ? 39.901  38.985  11.463  1.00 117.61 ? 67  LYS H CG  1 
ATOM   5210 C CD  . LYS D 4 67  ? 40.195  40.377  10.858  1.00 125.58 ? 67  LYS H CD  1 
ATOM   5211 C CE  . LYS D 4 67  ? 39.532  41.507  11.636  1.00 133.20 ? 67  LYS H CE  1 
ATOM   5212 N NZ  . LYS D 4 67  ? 39.829  42.863  11.081  1.00 133.30 ? 67  LYS H NZ  1 
ATOM   5213 N N   . ALA D 4 68  ? 37.734  35.940  8.426   1.00 107.09 ? 68  ALA H N   1 
ATOM   5214 C CA  . ALA D 4 68  ? 37.646  34.794  7.519   1.00 105.07 ? 68  ALA H CA  1 
ATOM   5215 C C   . ALA D 4 68  ? 37.193  35.193  6.116   1.00 103.99 ? 68  ALA H C   1 
ATOM   5216 O O   . ALA D 4 68  ? 36.264  35.994  5.955   1.00 104.06 ? 68  ALA H O   1 
ATOM   5217 C CB  . ALA D 4 68  ? 36.718  33.744  8.089   1.00 105.89 ? 68  ALA H CB  1 
ATOM   5218 N N   . THR D 4 69  ? 37.863  34.633  5.105   1.00 96.35  ? 69  THR H N   1 
ATOM   5219 C CA  . THR D 4 69  ? 37.578  34.891  3.697   1.00 94.54  ? 69  THR H CA  1 
ATOM   5220 C C   . THR D 4 69  ? 37.541  33.568  2.917   1.00 94.15  ? 69  THR H C   1 
ATOM   5221 O O   . THR D 4 69  ? 38.569  33.096  2.418   1.00 92.98  ? 69  THR H O   1 
ATOM   5222 C CB  . THR D 4 69  ? 38.543  35.957  3.139   1.00 105.34 ? 69  THR H CB  1 
ATOM   5223 O OG1 . THR D 4 69  ? 38.394  37.190  3.875   1.00 108.60 ? 69  THR H OG1 1 
ATOM   5224 C CG2 . THR D 4 69  ? 38.358  36.192  1.640   1.00 101.89 ? 69  THR H CG2 1 
ATOM   5225 N N   . ILE D 4 70  ? 36.341  32.964  2.844   1.00 88.15  ? 70  ILE H N   1 
ATOM   5226 C CA  . ILE D 4 70  ? 36.108  31.707  2.146   1.00 86.53  ? 70  ILE H CA  1 
ATOM   5227 C C   . ILE D 4 70  ? 35.953  31.960  0.668   1.00 91.39  ? 70  ILE H C   1 
ATOM   5228 O O   . ILE D 4 70  ? 35.076  32.705  0.250   1.00 90.22  ? 70  ILE H O   1 
ATOM   5229 C CB  . ILE D 4 70  ? 34.951  30.847  2.732   1.00 88.35  ? 70  ILE H CB  1 
ATOM   5230 C CG1 . ILE D 4 70  ? 35.070  30.728  4.253   1.00 87.10  ? 70  ILE H CG1 1 
ATOM   5231 C CG2 . ILE D 4 70  ? 34.949  29.455  2.084   1.00 89.15  ? 70  ILE H CG2 1 
ATOM   5232 C CD1 . ILE D 4 70  ? 33.975  30.262  4.907   1.00 80.79  ? 70  ILE H CD1 1 
ATOM   5233 N N   . THR D 4 71  ? 36.816  31.333  -0.122  1.00 90.35  ? 71  THR H N   1 
ATOM   5234 C CA  . THR D 4 71  ? 36.784  31.433  -1.574  1.00 90.34  ? 71  THR H CA  1 
ATOM   5235 C C   . THR D 4 71  ? 37.007  30.063  -2.219  1.00 95.02  ? 71  THR H C   1 
ATOM   5236 O O   . THR D 4 71  ? 37.748  29.246  -1.681  1.00 94.12  ? 71  THR H O   1 
ATOM   5237 C CB  . THR D 4 71  ? 37.709  32.526  -2.079  1.00 91.49  ? 71  THR H CB  1 
ATOM   5238 O OG1 . THR D 4 71  ? 37.477  32.633  -3.481  1.00 96.18  ? 71  THR H OG1 1 
ATOM   5239 C CG2 . THR D 4 71  ? 39.195  32.268  -1.752  1.00 83.21  ? 71  THR H CG2 1 
ATOM   5240 N N   . ALA D 4 72  ? 36.345  29.810  -3.350  1.00 93.11  ? 72  ALA H N   1 
ATOM   5241 C CA  . ALA D 4 72  ? 36.460  28.527  -4.046  1.00 93.79  ? 72  ALA H CA  1 
ATOM   5242 C C   . ALA D 4 72  ? 37.036  28.696  -5.449  1.00 98.14  ? 72  ALA H C   1 
ATOM   5243 O O   . ALA D 4 72  ? 36.627  29.598  -6.187  1.00 99.42  ? 72  ALA H O   1 
ATOM   5244 C CB  . ALA D 4 72  ? 35.103  27.840  -4.109  1.00 94.76  ? 72  ALA H CB  1 
ATOM   5245 N N   . ASP D 4 73  ? 37.977  27.832  -5.818  1.00 92.89  ? 73  ASP H N   1 
ATOM   5246 C CA  . ASP D 4 73  ? 38.602  27.914  -7.123  1.00 92.37  ? 73  ASP H CA  1 
ATOM   5247 C C   . ASP D 4 73  ? 38.325  26.682  -8.000  1.00 97.22  ? 73  ASP H C   1 
ATOM   5248 O O   . ASP D 4 73  ? 39.114  25.728  -7.991  1.00 97.12  ? 73  ASP H O   1 
ATOM   5249 C CB  . ASP D 4 73  ? 40.099  28.181  -6.966  1.00 94.14  ? 73  ASP H CB  1 
ATOM   5250 C CG  . ASP D 4 73  ? 40.748  28.513  -8.283  1.00 112.32 ? 73  ASP H CG  1 
ATOM   5251 O OD1 . ASP D 4 73  ? 40.692  29.693  -8.690  1.00 116.95 ? 73  ASP H OD1 1 
ATOM   5252 O OD2 . ASP D 4 73  ? 41.281  27.590  -8.927  1.00 116.95 ? 73  ASP H OD2 1 
ATOM   5253 N N   . LYS D 4 74  ? 37.213  26.716  -8.782  1.00 93.57  ? 74  LYS H N   1 
ATOM   5254 C CA  . LYS D 4 74  ? 36.792  25.632  -9.689  1.00 92.53  ? 74  LYS H CA  1 
ATOM   5255 C C   . LYS D 4 74  ? 37.938  25.095  -10.545 1.00 94.79  ? 74  LYS H C   1 
ATOM   5256 O O   . LYS D 4 74  ? 38.109  23.879  -10.655 1.00 94.05  ? 74  LYS H O   1 
ATOM   5257 C CB  . LYS D 4 74  ? 35.634  26.087  -10.588 1.00 94.01  ? 74  LYS H CB  1 
ATOM   5258 C CG  . LYS D 4 74  ? 34.273  25.897  -9.949  1.00 99.72  ? 74  LYS H CG  1 
ATOM   5259 C CD  . LYS D 4 74  ? 33.153  26.284  -10.889 1.00 106.42 ? 74  LYS H CD  1 
ATOM   5260 C CE  . LYS D 4 74  ? 32.642  27.671  -10.611 1.00 119.99 ? 74  LYS H CE  1 
ATOM   5261 N NZ  . LYS D 4 74  ? 31.648  28.083  -11.626 1.00 134.47 ? 74  LYS H NZ  1 
ATOM   5262 N N   . SER D 4 75  ? 38.745  26.016  -11.088 1.00 90.70  ? 75  SER H N   1 
ATOM   5263 C CA  . SER D 4 75  ? 39.884  25.761  -11.958 1.00 91.00  ? 75  SER H CA  1 
ATOM   5264 C C   . SER D 4 75  ? 40.979  24.872  -11.358 1.00 95.01  ? 75  SER H C   1 
ATOM   5265 O O   . SER D 4 75  ? 41.743  24.294  -12.124 1.00 95.62  ? 75  SER H O   1 
ATOM   5266 C CB  . SER D 4 75  ? 40.479  27.079  -12.452 1.00 96.89  ? 75  SER H CB  1 
ATOM   5267 O OG  . SER D 4 75  ? 40.452  28.119  -11.484 1.00 110.12 ? 75  SER H OG  1 
ATOM   5268 N N   . THR D 4 76  ? 41.092  24.777  -10.018 1.00 90.34  ? 76  THR H N   1 
ATOM   5269 C CA  . THR D 4 76  ? 42.102  23.923  -9.362  1.00 89.14  ? 76  THR H CA  1 
ATOM   5270 C C   . THR D 4 76  ? 41.387  22.894  -8.475  1.00 92.34  ? 76  THR H C   1 
ATOM   5271 O O   . THR D 4 76  ? 42.001  21.928  -8.000  1.00 92.56  ? 76  THR H O   1 
ATOM   5272 C CB  . THR D 4 76  ? 43.158  24.753  -8.568  1.00 92.01  ? 76  THR H CB  1 
ATOM   5273 O OG1 . THR D 4 76  ? 42.583  25.347  -7.396  1.00 87.13  ? 76  THR H OG1 1 
ATOM   5274 C CG2 . THR D 4 76  ? 43.878  25.807  -9.419  1.00 89.15  ? 76  THR H CG2 1 
ATOM   5275 N N   . SER D 4 77  ? 40.066  23.109  -8.280  1.00 87.19  ? 77  SER H N   1 
ATOM   5276 C CA  . SER D 4 77  ? 39.166  22.312  -7.453  1.00 86.04  ? 77  SER H CA  1 
ATOM   5277 C C   . SER D 4 77  ? 39.659  22.312  -6.006  1.00 89.16  ? 77  SER H C   1 
ATOM   5278 O O   . SER D 4 77  ? 39.730  21.274  -5.347  1.00 89.34  ? 77  SER H O   1 
ATOM   5279 C CB  . SER D 4 77  ? 38.929  20.918  -8.044  1.00 88.56  ? 77  SER H CB  1 
ATOM   5280 O OG  . SER D 4 77  ? 38.091  20.958  -9.194  1.00 93.90  ? 77  SER H OG  1 
ATOM   5281 N N   . THR D 4 78  ? 40.012  23.524  -5.531  1.00 84.85  ? 78  THR H N   1 
ATOM   5282 C CA  . THR D 4 78  ? 40.522  23.824  -4.193  1.00 84.38  ? 78  THR H CA  1 
ATOM   5283 C C   . THR D 4 78  ? 39.723  24.960  -3.561  1.00 89.81  ? 78  THR H C   1 
ATOM   5284 O O   . THR D 4 78  ? 39.446  25.974  -4.208  1.00 89.31  ? 78  THR H O   1 
ATOM   5285 C CB  . THR D 4 78  ? 42.001  24.237  -4.248  1.00 86.37  ? 78  THR H CB  1 
ATOM   5286 O OG1 . THR D 4 78  ? 42.736  23.382  -5.129  1.00 80.78  ? 78  THR H OG1 1 
ATOM   5287 C CG2 . THR D 4 78  ? 42.648  24.304  -2.866  1.00 81.87  ? 78  THR H CG2 1 
ATOM   5288 N N   . ALA D 4 79  ? 39.372  24.789  -2.282  1.00 87.70  ? 79  ALA H N   1 
ATOM   5289 C CA  . ALA D 4 79  ? 38.650  25.780  -1.490  1.00 87.50  ? 79  ALA H CA  1 
ATOM   5290 C C   . ALA D 4 79  ? 39.642  26.416  -0.530  1.00 90.67  ? 79  ALA H C   1 
ATOM   5291 O O   . ALA D 4 79  ? 40.452  25.712  0.081   1.00 91.35  ? 79  ALA H O   1 
ATOM   5292 C CB  . ALA D 4 79  ? 37.529  25.109  -0.725  1.00 88.32  ? 79  ALA H CB  1 
ATOM   5293 N N   . TYR D 4 80  ? 39.609  27.744  -0.425  1.00 85.50  ? 80  TYR H N   1 
ATOM   5294 C CA  . TYR D 4 80  ? 40.541  28.509  0.408   1.00 84.38  ? 80  TYR H CA  1 
ATOM   5295 C C   . TYR D 4 80  ? 39.842  29.242  1.527   1.00 87.85  ? 80  TYR H C   1 
ATOM   5296 O O   . TYR D 4 80  ? 38.684  29.639  1.393   1.00 85.28  ? 80  TYR H O   1 
ATOM   5297 C CB  . TYR D 4 80  ? 41.362  29.520  -0.437  1.00 84.08  ? 80  TYR H CB  1 
ATOM   5298 C CG  . TYR D 4 80  ? 42.128  28.899  -1.584  1.00 83.04  ? 80  TYR H CG  1 
ATOM   5299 C CD1 . TYR D 4 80  ? 41.507  28.639  -2.807  1.00 83.69  ? 80  TYR H CD1 1 
ATOM   5300 C CD2 . TYR D 4 80  ? 43.469  28.563  -1.450  1.00 84.05  ? 80  TYR H CD2 1 
ATOM   5301 C CE1 . TYR D 4 80  ? 42.195  28.021  -3.852  1.00 83.74  ? 80  TYR H CE1 1 
ATOM   5302 C CE2 . TYR D 4 80  ? 44.179  27.975  -2.502  1.00 85.19  ? 80  TYR H CE2 1 
ATOM   5303 C CZ  . TYR D 4 80  ? 43.540  27.712  -3.702  1.00 90.45  ? 80  TYR H CZ  1 
ATOM   5304 O OH  . TYR D 4 80  ? 44.249  27.127  -4.721  1.00 90.02  ? 80  TYR H OH  1 
ATOM   5305 N N   . MET D 4 81  ? 40.570  29.395  2.641   1.00 87.02  ? 81  MET H N   1 
ATOM   5306 C CA  . MET D 4 81  ? 40.212  30.149  3.828   1.00 87.90  ? 81  MET H CA  1 
ATOM   5307 C C   . MET D 4 81  ? 41.378  31.092  4.142   1.00 94.36  ? 81  MET H C   1 
ATOM   5308 O O   . MET D 4 81  ? 42.501  30.639  4.405   1.00 94.12  ? 81  MET H O   1 
ATOM   5309 C CB  . MET D 4 81  ? 39.955  29.242  5.020   1.00 90.95  ? 81  MET H CB  1 
ATOM   5310 C CG  . MET D 4 81  ? 40.047  29.993  6.327   1.00 95.69  ? 81  MET H CG  1 
ATOM   5311 S SD  . MET D 4 81  ? 38.681  29.691  7.447   1.00 101.88 ? 81  MET H SD  1 
ATOM   5312 C CE  . MET D 4 81  ? 37.393  30.580  6.641   1.00 98.40  ? 81  MET H CE  1 
ATOM   5313 N N   . GLU D 4 82  ? 41.106  32.400  4.114   1.00 91.70  ? 82  GLU H N   1 
ATOM   5314 C CA  . GLU D 4 82  ? 42.090  33.418  4.438   1.00 91.81  ? 82  GLU H CA  1 
ATOM   5315 C C   . GLU D 4 82  ? 41.746  33.977  5.814   1.00 97.92  ? 82  GLU H C   1 
ATOM   5316 O O   . GLU D 4 82  ? 40.597  34.349  6.058   1.00 97.85  ? 82  GLU H O   1 
ATOM   5317 C CB  . GLU D 4 82  ? 42.086  34.526  3.381   1.00 93.19  ? 82  GLU H CB  1 
ATOM   5318 C CG  . GLU D 4 82  ? 43.005  35.696  3.689   1.00 101.49 ? 82  GLU H CG  1 
ATOM   5319 C CD  . GLU D 4 82  ? 44.071  35.941  2.641   1.00 125.19 ? 82  GLU H CD  1 
ATOM   5320 O OE1 . GLU D 4 82  ? 45.251  36.091  3.036   1.00 119.28 ? 82  GLU H OE1 1 
ATOM   5321 O OE2 . GLU D 4 82  ? 43.735  35.978  1.433   1.00 120.30 ? 82  GLU H OE2 1 
ATOM   5322 N N   . LEU D 4 83  ? 42.728  34.003  6.717   1.00 96.13  ? 83  LEU H N   1 
ATOM   5323 C CA  . LEU D 4 83  ? 42.562  34.550  8.053   1.00 97.17  ? 83  LEU H CA  1 
ATOM   5324 C C   . LEU D 4 83  ? 43.503  35.722  8.258   1.00 104.06 ? 83  LEU H C   1 
ATOM   5325 O O   . LEU D 4 83  ? 44.690  35.535  8.523   1.00 103.64 ? 83  LEU H O   1 
ATOM   5326 C CB  . LEU D 4 83  ? 42.711  33.485  9.148   1.00 97.24  ? 83  LEU H CB  1 
ATOM   5327 C CG  . LEU D 4 83  ? 41.568  32.479  9.257   1.00 102.40 ? 83  LEU H CG  1 
ATOM   5328 C CD1 . LEU D 4 83  ? 41.939  31.324  10.171  1.00 101.62 ? 83  LEU H CD1 1 
ATOM   5329 C CD2 . LEU D 4 83  ? 40.276  33.160  9.727   1.00 107.49 ? 83  LEU H CD2 1 
ATOM   5330 N N   . SER D 4 84  ? 42.964  36.935  8.078   1.00 102.52 ? 84  SER H N   1 
ATOM   5331 C CA  . SER D 4 84  ? 43.680  38.196  8.238   1.00 103.29 ? 84  SER H CA  1 
ATOM   5332 C C   . SER D 4 84  ? 43.722  38.612  9.712   1.00 106.50 ? 84  SER H C   1 
ATOM   5333 O O   . SER D 4 84  ? 43.007  38.016  10.521  1.00 105.05 ? 84  SER H O   1 
ATOM   5334 C CB  . SER D 4 84  ? 43.064  39.286  7.355   1.00 109.26 ? 84  SER H CB  1 
ATOM   5335 O OG  . SER D 4 84  ? 41.643  39.274  7.319   1.00 122.86 ? 84  SER H OG  1 
ATOM   5336 N N   . SER D 4 85  ? 44.567  39.626  10.052  1.00 103.97 ? 85  SER H N   1 
ATOM   5337 C CA  . SER D 4 85  ? 44.786  40.172  11.407  1.00 104.26 ? 85  SER H CA  1 
ATOM   5338 C C   . SER D 4 85  ? 44.817  39.031  12.427  1.00 107.91 ? 85  SER H C   1 
ATOM   5339 O O   . SER D 4 85  ? 43.872  38.879  13.220  1.00 108.23 ? 85  SER H O   1 
ATOM   5340 C CB  . SER D 4 85  ? 43.713  41.195  11.784  1.00 108.30 ? 85  SER H CB  1 
ATOM   5341 O OG  . SER D 4 85  ? 43.504  42.211  10.817  1.00 118.48 ? 85  SER H OG  1 
ATOM   5342 N N   . LEU D 4 86  ? 45.851  38.171  12.347  1.00 102.69 ? 86  LEU H N   1 
ATOM   5343 C CA  . LEU D 4 86  ? 45.878  37.038  13.257  1.00 102.36 ? 86  LEU H CA  1 
ATOM   5344 C C   . LEU D 4 86  ? 46.261  37.410  14.675  1.00 109.19 ? 86  LEU H C   1 
ATOM   5345 O O   . LEU D 4 86  ? 47.326  37.989  14.898  1.00 110.52 ? 86  LEU H O   1 
ATOM   5346 C CB  . LEU D 4 86  ? 46.721  35.878  12.746  1.00 101.63 ? 86  LEU H CB  1 
ATOM   5347 C CG  . LEU D 4 86  ? 45.983  34.975  11.784  1.00 104.52 ? 86  LEU H CG  1 
ATOM   5348 C CD1 . LEU D 4 86  ? 46.927  34.250  10.895  1.00 104.15 ? 86  LEU H CD1 1 
ATOM   5349 C CD2 . LEU D 4 86  ? 45.046  34.036  12.508  1.00 104.18 ? 86  LEU H CD2 1 
ATOM   5350 N N   . ARG D 4 87  ? 45.344  37.103  15.625  1.00 105.12 ? 87  ARG H N   1 
ATOM   5351 C CA  . ARG D 4 87  ? 45.500  37.315  17.062  1.00 104.76 ? 87  ARG H CA  1 
ATOM   5352 C C   . ARG D 4 87  ? 45.824  35.974  17.747  1.00 108.09 ? 87  ARG H C   1 
ATOM   5353 O O   . ARG D 4 87  ? 45.359  34.925  17.294  1.00 106.99 ? 87  ARG H O   1 
ATOM   5354 C CB  . ARG D 4 87  ? 44.247  38.001  17.661  1.00 105.80 ? 87  ARG H CB  1 
ATOM   5355 C CG  . ARG D 4 87  ? 43.058  37.088  17.946  1.00 116.27 ? 87  ARG H CG  1 
ATOM   5356 C CD  . ARG D 4 87  ? 41.724  37.747  17.696  1.00 125.00 ? 87  ARG H CD  1 
ATOM   5357 N NE  . ARG D 4 87  ? 40.623  36.868  18.101  1.00 135.81 ? 87  ARG H NE  1 
ATOM   5358 C CZ  . ARG D 4 87  ? 39.901  37.039  19.205  1.00 151.65 ? 87  ARG H CZ  1 
ATOM   5359 N NH1 . ARG D 4 87  ? 40.131  38.061  20.017  1.00 137.09 ? 87  ARG H NH1 1 
ATOM   5360 N NH2 . ARG D 4 87  ? 38.930  36.181  19.499  1.00 141.74 ? 87  ARG H NH2 1 
ATOM   5361 N N   . SER D 4 88  ? 46.629  36.003  18.827  1.00 105.29 ? 88  SER H N   1 
ATOM   5362 C CA  . SER D 4 88  ? 47.019  34.791  19.561  1.00 105.03 ? 88  SER H CA  1 
ATOM   5363 C C   . SER D 4 88  ? 45.833  33.866  19.777  1.00 108.16 ? 88  SER H C   1 
ATOM   5364 O O   . SER D 4 88  ? 45.921  32.685  19.456  1.00 108.08 ? 88  SER H O   1 
ATOM   5365 C CB  . SER D 4 88  ? 47.684  35.137  20.889  1.00 108.78 ? 88  SER H CB  1 
ATOM   5366 O OG  . SER D 4 88  ? 49.097  35.091  20.774  1.00 118.58 ? 88  SER H OG  1 
ATOM   5367 N N   . GLU D 4 89  ? 44.696  34.442  20.195  1.00 103.30 ? 89  GLU H N   1 
ATOM   5368 C CA  . GLU D 4 89  ? 43.420  33.777  20.462  1.00 102.57 ? 89  GLU H CA  1 
ATOM   5369 C C   . GLU D 4 89  ? 42.911  32.866  19.329  1.00 104.05 ? 89  GLU H C   1 
ATOM   5370 O O   . GLU D 4 89  ? 42.224  31.884  19.627  1.00 101.93 ? 89  GLU H O   1 
ATOM   5371 C CB  . GLU D 4 89  ? 42.350  34.822  20.837  1.00 104.04 ? 89  GLU H CB  1 
ATOM   5372 C CG  . GLU D 4 89  ? 42.690  35.671  22.062  1.00 112.41 ? 89  GLU H CG  1 
ATOM   5373 C CD  . GLU D 4 89  ? 43.341  37.011  21.773  1.00 126.86 ? 89  GLU H CD  1 
ATOM   5374 O OE1 . GLU D 4 89  ? 42.651  37.895  21.216  1.00 125.88 ? 89  GLU H OE1 1 
ATOM   5375 O OE2 . GLU D 4 89  ? 44.533  37.188  22.118  1.00 113.27 ? 89  GLU H OE2 1 
ATOM   5376 N N   . ASP D 4 90  ? 43.276  33.178  18.045  1.00 100.52 ? 90  ASP H N   1 
ATOM   5377 C CA  . ASP D 4 90  ? 42.875  32.447  16.825  1.00 99.90  ? 90  ASP H CA  1 
ATOM   5378 C C   . ASP D 4 90  ? 43.614  31.094  16.591  1.00 101.22 ? 90  ASP H C   1 
ATOM   5379 O O   . ASP D 4 90  ? 43.187  30.316  15.731  1.00 100.52 ? 90  ASP H O   1 
ATOM   5380 C CB  . ASP D 4 90  ? 42.977  33.349  15.577  1.00 102.20 ? 90  ASP H CB  1 
ATOM   5381 C CG  . ASP D 4 90  ? 42.090  34.588  15.611  1.00 121.76 ? 90  ASP H CG  1 
ATOM   5382 O OD1 . ASP D 4 90  ? 41.015  34.534  16.247  1.00 124.80 ? 90  ASP H OD1 1 
ATOM   5383 O OD2 . ASP D 4 90  ? 42.474  35.618  15.002  1.00 130.17 ? 90  ASP H OD2 1 
ATOM   5384 N N   . THR D 4 91  ? 44.682  30.802  17.378  1.00 95.32  ? 91  THR H N   1 
ATOM   5385 C CA  . THR D 4 91  ? 45.446  29.544  17.340  1.00 92.93  ? 91  THR H CA  1 
ATOM   5386 C C   . THR D 4 91  ? 44.468  28.401  17.532  1.00 93.05  ? 91  THR H C   1 
ATOM   5387 O O   . THR D 4 91  ? 43.830  28.344  18.583  1.00 91.72  ? 91  THR H O   1 
ATOM   5388 C CB  . THR D 4 91  ? 46.504  29.541  18.464  1.00 94.25  ? 91  THR H CB  1 
ATOM   5389 O OG1 . THR D 4 91  ? 47.396  30.635  18.269  1.00 94.65  ? 91  THR H OG1 1 
ATOM   5390 C CG2 . THR D 4 91  ? 47.282  28.238  18.556  1.00 89.18  ? 91  THR H CG2 1 
ATOM   5391 N N   . ALA D 4 92  ? 44.321  27.526  16.504  1.00 88.37  ? 92  ALA H N   1 
ATOM   5392 C CA  . ALA D 4 92  ? 43.409  26.363  16.492  1.00 87.47  ? 92  ALA H CA  1 
ATOM   5393 C C   . ALA D 4 92  ? 43.660  25.358  15.343  1.00 90.73  ? 92  ALA H C   1 
ATOM   5394 O O   . ALA D 4 92  ? 44.513  25.581  14.480  1.00 90.66  ? 92  ALA H O   1 
ATOM   5395 C CB  . ALA D 4 92  ? 41.962  26.840  16.428  1.00 88.08  ? 92  ALA H CB  1 
ATOM   5396 N N   . VAL D 4 93  ? 42.881  24.259  15.330  1.00 86.00  ? 93  VAL H N   1 
ATOM   5397 C CA  . VAL D 4 93  ? 42.912  23.259  14.266  1.00 84.52  ? 93  VAL H CA  1 
ATOM   5398 C C   . VAL D 4 93  ? 41.761  23.571  13.325  1.00 85.75  ? 93  VAL H C   1 
ATOM   5399 O O   . VAL D 4 93  ? 40.600  23.602  13.734  1.00 84.70  ? 93  VAL H O   1 
ATOM   5400 C CB  . VAL D 4 93  ? 42.869  21.802  14.757  1.00 87.67  ? 93  VAL H CB  1 
ATOM   5401 C CG1 . VAL D 4 93  ? 43.225  20.850  13.618  1.00 87.33  ? 93  VAL H CG1 1 
ATOM   5402 C CG2 . VAL D 4 93  ? 43.801  21.599  15.951  1.00 87.63  ? 93  VAL H CG2 1 
ATOM   5403 N N   . TYR D 4 94  ? 42.099  23.823  12.071  1.00 81.15  ? 94  TYR H N   1 
ATOM   5404 C CA  . TYR D 4 94  ? 41.159  24.214  11.042  1.00 80.09  ? 94  TYR H CA  1 
ATOM   5405 C C   . TYR D 4 94  ? 40.834  23.097  10.079  1.00 86.60  ? 94  TYR H C   1 
ATOM   5406 O O   . TYR D 4 94  ? 41.737  22.533  9.487   1.00 88.59  ? 94  TYR H O   1 
ATOM   5407 C CB  . TYR D 4 94  ? 41.685  25.445  10.336  1.00 79.38  ? 94  TYR H CB  1 
ATOM   5408 C CG  . TYR D 4 94  ? 41.580  26.665  11.216  1.00 79.41  ? 94  TYR H CG  1 
ATOM   5409 C CD1 . TYR D 4 94  ? 42.611  27.017  12.080  1.00 80.46  ? 94  TYR H CD1 1 
ATOM   5410 C CD2 . TYR D 4 94  ? 40.440  27.458  11.206  1.00 80.69  ? 94  TYR H CD2 1 
ATOM   5411 C CE1 . TYR D 4 94  ? 42.506  28.124  12.917  1.00 81.22  ? 94  TYR H CE1 1 
ATOM   5412 C CE2 . TYR D 4 94  ? 40.329  28.576  12.030  1.00 82.25  ? 94  TYR H CE2 1 
ATOM   5413 C CZ  . TYR D 4 94  ? 41.368  28.912  12.877  1.00 89.05  ? 94  TYR H CZ  1 
ATOM   5414 O OH  . TYR D 4 94  ? 41.247  30.024  13.672  1.00 89.70  ? 94  TYR H OH  1 
ATOM   5415 N N   . TYR D 4 95  ? 39.539  22.775  9.941   1.00 81.97  ? 95  TYR H N   1 
ATOM   5416 C CA  . TYR D 4 95  ? 38.985  21.704  9.118   1.00 80.53  ? 95  TYR H CA  1 
ATOM   5417 C C   . TYR D 4 95  ? 38.143  22.232  7.983   1.00 84.94  ? 95  TYR H C   1 
ATOM   5418 O O   . TYR D 4 95  ? 37.522  23.283  8.116   1.00 84.87  ? 95  TYR H O   1 
ATOM   5419 C CB  . TYR D 4 95  ? 38.052  20.836  9.991   1.00 80.37  ? 95  TYR H CB  1 
ATOM   5420 C CG  . TYR D 4 95  ? 38.739  20.030  11.071  1.00 78.98  ? 95  TYR H CG  1 
ATOM   5421 C CD1 . TYR D 4 95  ? 39.580  18.967  10.750  1.00 80.61  ? 95  TYR H CD1 1 
ATOM   5422 C CD2 . TYR D 4 95  ? 38.481  20.269  12.411  1.00 78.43  ? 95  TYR H CD2 1 
ATOM   5423 C CE1 . TYR D 4 95  ? 40.204  18.214  11.739  1.00 79.43  ? 95  TYR H CE1 1 
ATOM   5424 C CE2 . TYR D 4 95  ? 39.075  19.501  13.409  1.00 78.90  ? 95  TYR H CE2 1 
ATOM   5425 C CZ  . TYR D 4 95  ? 39.924  18.465  13.068  1.00 83.05  ? 95  TYR H CZ  1 
ATOM   5426 O OH  . TYR D 4 95  ? 40.504  17.709  14.053  1.00 83.85  ? 95  TYR H OH  1 
ATOM   5427 N N   . CYS D 4 96  ? 38.059  21.457  6.896   1.00 82.39  ? 96  CYS H N   1 
ATOM   5428 C CA  . CYS D 4 96  ? 37.171  21.717  5.756   1.00 82.33  ? 96  CYS H CA  1 
ATOM   5429 C C   . CYS D 4 96  ? 36.297  20.481  5.600   1.00 83.89  ? 96  CYS H C   1 
ATOM   5430 O O   . CYS D 4 96  ? 36.791  19.364  5.763   1.00 84.21  ? 96  CYS H O   1 
ATOM   5431 C CB  . CYS D 4 96  ? 37.925  22.066  4.471   1.00 82.92  ? 96  CYS H CB  1 
ATOM   5432 S SG  . CYS D 4 96  ? 39.072  20.789  3.917   1.00 87.22  ? 96  CYS H SG  1 
ATOM   5433 N N   . ALA D 4 97  ? 34.997  20.666  5.390   1.00 77.51  ? 97  ALA H N   1 
ATOM   5434 C CA  . ALA D 4 97  ? 34.103  19.524  5.318   1.00 76.20  ? 97  ALA H CA  1 
ATOM   5435 C C   . ALA D 4 97  ? 33.067  19.679  4.243   1.00 78.75  ? 97  ALA H C   1 
ATOM   5436 O O   . ALA D 4 97  ? 32.424  20.722  4.198   1.00 79.89  ? 97  ALA H O   1 
ATOM   5437 C CB  . ALA D 4 97  ? 33.429  19.338  6.660   1.00 76.94  ? 97  ALA H CB  1 
ATOM   5438 N N   . ARG D 4 98  ? 32.868  18.652  3.388   1.00 73.34  ? 98  ARG H N   1 
ATOM   5439 C CA  . ARG D 4 98  ? 31.852  18.746  2.330   1.00 72.25  ? 98  ARG H CA  1 
ATOM   5440 C C   . ARG D 4 98  ? 30.403  18.529  2.907   1.00 74.79  ? 98  ARG H C   1 
ATOM   5441 O O   . ARG D 4 98  ? 30.227  17.943  3.986   1.00 72.52  ? 98  ARG H O   1 
ATOM   5442 C CB  . ARG D 4 98  ? 32.187  17.871  1.093   1.00 70.45  ? 98  ARG H CB  1 
ATOM   5443 C CG  . ARG D 4 98  ? 31.753  16.409  1.133   1.00 72.60  ? 98  ARG H CG  1 
ATOM   5444 C CD  . ARG D 4 98  ? 32.129  15.726  -0.168  1.00 72.24  ? 98  ARG H CD  1 
ATOM   5445 N NE  . ARG D 4 98  ? 31.526  14.400  -0.239  1.00 79.32  ? 98  ARG H NE  1 
ATOM   5446 C CZ  . ARG D 4 98  ? 31.386  13.694  -1.354  1.00 93.03  ? 98  ARG H CZ  1 
ATOM   5447 N NH1 . ARG D 4 98  ? 30.796  12.508  -1.318  1.00 85.67  ? 98  ARG H NH1 1 
ATOM   5448 N NH2 . ARG D 4 98  ? 31.791  14.180  -2.514  1.00 80.48  ? 98  ARG H NH2 1 
ATOM   5449 N N   . ARG D 4 99  ? 29.372  19.032  2.188   1.00 71.68  ? 99  ARG H N   1 
ATOM   5450 C CA  . ARG D 4 99  ? 28.021  19.006  2.732   1.00 71.18  ? 99  ARG H CA  1 
ATOM   5451 C C   . ARG D 4 99  ? 26.834  18.716  1.739   1.00 77.10  ? 99  ARG H C   1 
ATOM   5452 O O   . ARG D 4 99  ? 25.688  19.069  2.044   1.00 79.80  ? 99  ARG H O   1 
ATOM   5453 C CB  . ARG D 4 99  ? 27.844  20.371  3.399   1.00 67.03  ? 99  ARG H CB  1 
ATOM   5454 C CG  . ARG D 4 99  ? 26.830  20.477  4.494   1.00 69.69  ? 99  ARG H CG  1 
ATOM   5455 C CD  . ARG D 4 99  ? 26.302  21.903  4.495   1.00 78.02  ? 99  ARG H CD  1 
ATOM   5456 N NE  . ARG D 4 99  ? 25.527  22.161  3.284   1.00 76.05  ? 99  ARG H NE  1 
ATOM   5457 C CZ  . ARG D 4 99  ? 24.833  23.260  3.064   1.00 88.77  ? 99  ARG H CZ  1 
ATOM   5458 N NH1 . ARG D 4 99  ? 24.793  24.218  3.965   1.00 79.34  ? 99  ARG H NH1 1 
ATOM   5459 N NH2 . ARG D 4 99  ? 24.145  23.395  1.951   1.00 82.39  ? 99  ARG H NH2 1 
ATOM   5460 N N   . GLY D 4 100 ? 27.068  18.024  0.636   1.00 72.39  ? 100 GLY H N   1 
ATOM   5461 C CA  . GLY D 4 100 ? 25.973  17.734  -0.286  1.00 73.08  ? 100 GLY H CA  1 
ATOM   5462 C C   . GLY D 4 100 ? 25.452  16.311  -0.460  1.00 81.53  ? 100 GLY H C   1 
ATOM   5463 O O   . GLY D 4 100 ? 24.476  16.148  -1.198  1.00 84.12  ? 100 GLY H O   1 
ATOM   5464 N N   . ARG D 4 101 ? 26.069  15.260  0.176   1.00 77.15  ? 101 ARG H N   1 
ATOM   5465 C CA  . ARG D 4 101 ? 25.681  13.836  0.010   1.00 76.65  ? 101 ARG H CA  1 
ATOM   5466 C C   . ARG D 4 101 ? 24.199  13.520  0.313   1.00 80.19  ? 101 ARG H C   1 
ATOM   5467 O O   . ARG D 4 101 ? 23.553  12.725  -0.371  1.00 78.51  ? 101 ARG H O   1 
ATOM   5468 C CB  . ARG D 4 101 ? 26.597  12.904  0.835   1.00 76.04  ? 101 ARG H CB  1 
ATOM   5469 C CG  . ARG D 4 101 ? 26.701  11.512  0.220   1.00 81.52  ? 101 ARG H CG  1 
ATOM   5470 C CD  . ARG D 4 101 ? 27.477  10.494  1.015   1.00 92.10  ? 101 ARG H CD  1 
ATOM   5471 N NE  . ARG D 4 101 ? 26.983  9.162   0.683   1.00 107.43 ? 101 ARG H NE  1 
ATOM   5472 C CZ  . ARG D 4 101 ? 27.671  8.036   0.816   1.00 126.98 ? 101 ARG H CZ  1 
ATOM   5473 N NH1 . ARG D 4 101 ? 28.907  8.054   1.281   1.00 117.27 ? 101 ARG H NH1 1 
ATOM   5474 N NH2 . ARG D 4 101 ? 27.133  6.880   0.472   1.00 114.10 ? 101 ARG H NH2 1 
ATOM   5475 N N   . TYR D 4 102 ? 23.713  14.084  1.389   1.00 79.08  ? 102 TYR H N   1 
ATOM   5476 C CA  . TYR D 4 102 ? 22.339  13.987  1.861   1.00 79.64  ? 102 TYR H CA  1 
ATOM   5477 C C   . TYR D 4 102 ? 22.028  15.451  2.049   1.00 88.30  ? 102 TYR H C   1 
ATOM   5478 O O   . TYR D 4 102 ? 22.772  16.151  2.784   1.00 88.64  ? 102 TYR H O   1 
ATOM   5479 C CB  . TYR D 4 102 ? 22.282  13.251  3.209   1.00 79.25  ? 102 TYR H CB  1 
ATOM   5480 C CG  . TYR D 4 102 ? 23.147  12.010  3.292   1.00 78.85  ? 102 TYR H CG  1 
ATOM   5481 C CD1 . TYR D 4 102 ? 22.855  10.881  2.532   1.00 80.81  ? 102 TYR H CD1 1 
ATOM   5482 C CD2 . TYR D 4 102 ? 24.212  11.935  4.186   1.00 78.33  ? 102 TYR H CD2 1 
ATOM   5483 C CE1 . TYR D 4 102 ? 23.636  9.734   2.613   1.00 80.65  ? 102 TYR H CE1 1 
ATOM   5484 C CE2 . TYR D 4 102 ? 24.996  10.792  4.278   1.00 78.80  ? 102 TYR H CE2 1 
ATOM   5485 C CZ  . TYR D 4 102 ? 24.694  9.687   3.500   1.00 84.47  ? 102 TYR H CZ  1 
ATOM   5486 O OH  . TYR D 4 102 ? 25.435  8.535   3.577   1.00 83.18  ? 102 TYR H OH  1 
ATOM   5487 N N   . GLY D 4 103 ? 21.011  15.917  1.319   1.00 85.76  ? 103 GLY H N   1 
ATOM   5488 C CA  . GLY D 4 103 ? 20.606  17.321  1.281   1.00 86.07  ? 103 GLY H CA  1 
ATOM   5489 C C   . GLY D 4 103 ? 20.104  17.869  2.588   1.00 90.51  ? 103 GLY H C   1 
ATOM   5490 O O   . GLY D 4 103 ? 19.502  18.944  2.632   1.00 89.96  ? 103 GLY H O   1 
ATOM   5491 N N   . LEU D 4 104 ? 20.415  17.132  3.656   1.00 87.75  ? 104 LEU H N   1 
ATOM   5492 C CA  . LEU D 4 104 ? 20.041  17.325  5.043   1.00 87.34  ? 104 LEU H CA  1 
ATOM   5493 C C   . LEU D 4 104 ? 21.166  17.914  5.939   1.00 88.26  ? 104 LEU H C   1 
ATOM   5494 O O   . LEU D 4 104 ? 21.189  17.669  7.140   1.00 88.17  ? 104 LEU H O   1 
ATOM   5495 C CB  . LEU D 4 104 ? 19.497  15.985  5.570   1.00 87.60  ? 104 LEU H CB  1 
ATOM   5496 C CG  . LEU D 4 104 ? 18.544  15.269  4.600   1.00 92.99  ? 104 LEU H CG  1 
ATOM   5497 C CD1 . LEU D 4 104 ? 18.518  13.779  4.846   1.00 93.92  ? 104 LEU H CD1 1 
ATOM   5498 C CD2 . LEU D 4 104 ? 17.155  15.856  4.659   1.00 96.39  ? 104 LEU H CD2 1 
ATOM   5499 N N   . TYR D 4 105 ? 22.038  18.743  5.355   1.00 83.63  ? 105 TYR H N   1 
ATOM   5500 C CA  . TYR D 4 105 ? 23.065  19.554  6.023   1.00 83.82  ? 105 TYR H CA  1 
ATOM   5501 C C   . TYR D 4 105 ? 23.969  18.795  7.041   1.00 87.57  ? 105 TYR H C   1 
ATOM   5502 O O   . TYR D 4 105 ? 24.123  19.201  8.202   1.00 86.09  ? 105 TYR H O   1 
ATOM   5503 C CB  . TYR D 4 105 ? 22.403  20.802  6.672   1.00 85.09  ? 105 TYR H CB  1 
ATOM   5504 C CG  . TYR D 4 105 ? 21.327  21.398  5.790   1.00 87.26  ? 105 TYR H CG  1 
ATOM   5505 C CD1 . TYR D 4 105 ? 21.659  22.178  4.685   1.00 89.67  ? 105 TYR H CD1 1 
ATOM   5506 C CD2 . TYR D 4 105 ? 19.984  21.093  5.993   1.00 87.84  ? 105 TYR H CD2 1 
ATOM   5507 C CE1 . TYR D 4 105 ? 20.678  22.676  3.828   1.00 90.54  ? 105 TYR H CE1 1 
ATOM   5508 C CE2 . TYR D 4 105 ? 18.994  21.580  5.142   1.00 89.14  ? 105 TYR H CE2 1 
ATOM   5509 C CZ  . TYR D 4 105 ? 19.346  22.369  4.054   1.00 99.03  ? 105 TYR H CZ  1 
ATOM   5510 O OH  . TYR D 4 105 ? 18.379  22.879  3.209   1.00 101.83 ? 105 TYR H OH  1 
ATOM   5511 N N   . ALA D 4 106 ? 24.618  17.727  6.556   1.00 85.08  ? 106 ALA H N   1 
ATOM   5512 C CA  . ALA D 4 106 ? 25.569  16.929  7.325   1.00 84.59  ? 106 ALA H CA  1 
ATOM   5513 C C   . ALA D 4 106 ? 26.924  16.914  6.619   1.00 88.88  ? 106 ALA H C   1 
ATOM   5514 O O   . ALA D 4 106 ? 27.005  16.847  5.376   1.00 90.03  ? 106 ALA H O   1 
ATOM   5515 C CB  . ALA D 4 106 ? 25.053  15.515  7.510   1.00 85.04  ? 106 ALA H CB  1 
ATOM   5516 N N   . MET D 4 107 ? 27.983  17.000  7.420   1.00 83.19  ? 107 MET H N   1 
ATOM   5517 C CA  . MET D 4 107 ? 29.348  17.007  6.926   1.00 82.10  ? 107 MET H CA  1 
ATOM   5518 C C   . MET D 4 107 ? 29.864  15.591  6.868   1.00 86.21  ? 107 MET H C   1 
ATOM   5519 O O   . MET D 4 107 ? 30.403  15.080  7.855   1.00 86.17  ? 107 MET H O   1 
ATOM   5520 C CB  . MET D 4 107 ? 30.205  17.960  7.760   1.00 83.91  ? 107 MET H CB  1 
ATOM   5521 C CG  . MET D 4 107 ? 29.761  19.382  7.548   1.00 87.03  ? 107 MET H CG  1 
ATOM   5522 S SD  . MET D 4 107 ? 30.109  20.518  8.865   1.00 90.48  ? 107 MET H SD  1 
ATOM   5523 C CE  . MET D 4 107 ? 28.833  21.648  8.616   1.00 86.89  ? 107 MET H CE  1 
ATOM   5524 N N   . ASP D 4 108 ? 29.596  14.926  5.716   1.00 82.00  ? 108 ASP H N   1 
ATOM   5525 C CA  . ASP D 4 108 ? 29.948  13.523  5.455   1.00 81.01  ? 108 ASP H CA  1 
ATOM   5526 C C   . ASP D 4 108 ? 31.453  13.276  5.379   1.00 83.73  ? 108 ASP H C   1 
ATOM   5527 O O   . ASP D 4 108 ? 31.919  12.320  6.016   1.00 83.80  ? 108 ASP H O   1 
ATOM   5528 C CB  . ASP D 4 108 ? 29.226  12.952  4.215   1.00 82.43  ? 108 ASP H CB  1 
ATOM   5529 C CG  . ASP D 4 108 ? 29.417  13.745  2.943   1.00 90.38  ? 108 ASP H CG  1 
ATOM   5530 O OD1 . ASP D 4 108 ? 28.645  14.713  2.727   1.00 90.69  ? 108 ASP H OD1 1 
ATOM   5531 O OD2 . ASP D 4 108 ? 30.338  13.401  2.162   1.00 93.91  ? 108 ASP H OD2 1 
ATOM   5532 N N   . TYR D 4 109 ? 32.204  14.123  4.623   1.00 79.32  ? 109 TYR H N   1 
ATOM   5533 C CA  . TYR D 4 109 ? 33.663  13.995  4.472   1.00 78.88  ? 109 TYR H CA  1 
ATOM   5534 C C   . TYR D 4 109 ? 34.453  15.270  4.935   1.00 81.09  ? 109 TYR H C   1 
ATOM   5535 O O   . TYR D 4 109 ? 34.197  16.395  4.472   1.00 79.04  ? 109 TYR H O   1 
ATOM   5536 C CB  . TYR D 4 109 ? 34.040  13.555  3.045   1.00 79.79  ? 109 TYR H CB  1 
ATOM   5537 C CG  . TYR D 4 109 ? 35.463  13.066  2.942   1.00 81.41  ? 109 TYR H CG  1 
ATOM   5538 C CD1 . TYR D 4 109 ? 36.517  13.960  2.760   1.00 83.22  ? 109 TYR H CD1 1 
ATOM   5539 C CD2 . TYR D 4 109 ? 35.769  11.710  3.043   1.00 82.34  ? 109 TYR H CD2 1 
ATOM   5540 C CE1 . TYR D 4 109 ? 37.845  13.527  2.700   1.00 83.75  ? 109 TYR H CE1 1 
ATOM   5541 C CE2 . TYR D 4 109 ? 37.097  11.265  3.000   1.00 83.35  ? 109 TYR H CE2 1 
ATOM   5542 C CZ  . TYR D 4 109 ? 38.133  12.175  2.817   1.00 88.44  ? 109 TYR H CZ  1 
ATOM   5543 O OH  . TYR D 4 109 ? 39.449  11.784  2.741   1.00 85.10  ? 109 TYR H OH  1 
ATOM   5544 N N   . TRP D 4 110 ? 35.426  15.041  5.856   1.00 76.40  ? 110 TRP H N   1 
ATOM   5545 C CA  . TRP D 4 110 ? 36.259  16.041  6.535   1.00 74.78  ? 110 TRP H CA  1 
ATOM   5546 C C   . TRP D 4 110 ? 37.707  15.932  6.119   1.00 76.03  ? 110 TRP H C   1 
ATOM   5547 O O   . TRP D 4 110 ? 38.212  14.806  5.993   1.00 74.29  ? 110 TRP H O   1 
ATOM   5548 C CB  . TRP D 4 110 ? 36.216  15.782  8.058   1.00 73.56  ? 110 TRP H CB  1 
ATOM   5549 C CG  . TRP D 4 110 ? 34.894  16.037  8.706   1.00 74.51  ? 110 TRP H CG  1 
ATOM   5550 C CD1 . TRP D 4 110 ? 33.730  15.354  8.502   1.00 77.54  ? 110 TRP H CD1 1 
ATOM   5551 C CD2 . TRP D 4 110 ? 34.603  17.049  9.677   1.00 74.46  ? 110 TRP H CD2 1 
ATOM   5552 N NE1 . TRP D 4 110 ? 32.715  15.912  9.249   1.00 77.24  ? 110 TRP H NE1 1 
ATOM   5553 C CE2 . TRP D 4 110 ? 33.224  16.954  9.981   1.00 77.98  ? 110 TRP H CE2 1 
ATOM   5554 C CE3 . TRP D 4 110 ? 35.363  18.065  10.283  1.00 75.20  ? 110 TRP H CE3 1 
ATOM   5555 C CZ2 . TRP D 4 110 ? 32.605  17.789  10.911  1.00 76.71  ? 110 TRP H CZ2 1 
ATOM   5556 C CZ3 . TRP D 4 110 ? 34.751  18.877  11.220  1.00 76.67  ? 110 TRP H CZ3 1 
ATOM   5557 C CH2 . TRP D 4 110 ? 33.389  18.734  11.528  1.00 77.05  ? 110 TRP H CH2 1 
ATOM   5558 N N   . GLY D 4 111 ? 38.377  17.097  5.995   1.00 71.56  ? 111 GLY H N   1 
ATOM   5559 C CA  . GLY D 4 111 ? 39.811  17.224  5.718   1.00 70.36  ? 111 GLY H CA  1 
ATOM   5560 C C   . GLY D 4 111 ? 40.613  16.739  6.920   1.00 72.48  ? 111 GLY H C   1 
ATOM   5561 O O   . GLY D 4 111 ? 40.030  16.265  7.902   1.00 70.42  ? 111 GLY H O   1 
ATOM   5562 N N   . GLN D 4 112 ? 41.940  16.831  6.884   1.00 70.09  ? 112 GLN H N   1 
ATOM   5563 C CA  . GLN D 4 112 ? 42.703  16.297  8.035   1.00 71.43  ? 112 GLN H CA  1 
ATOM   5564 C C   . GLN D 4 112 ? 42.878  17.315  9.206   1.00 75.99  ? 112 GLN H C   1 
ATOM   5565 O O   . GLN D 4 112 ? 43.169  16.923  10.351  1.00 74.40  ? 112 GLN H O   1 
ATOM   5566 C CB  . GLN D 4 112 ? 44.071  15.701  7.581   1.00 73.22  ? 112 GLN H CB  1 
ATOM   5567 C CG  . GLN D 4 112 ? 45.155  16.718  7.142   1.00 88.55  ? 112 GLN H CG  1 
ATOM   5568 C CD  . GLN D 4 112 ? 45.108  17.221  5.708   1.00 107.12 ? 112 GLN H CD  1 
ATOM   5569 O OE1 . GLN D 4 112 ? 44.150  17.026  4.946   1.00 104.72 ? 112 GLN H OE1 1 
ATOM   5570 N NE2 . GLN D 4 112 ? 46.168  17.898  5.315   1.00 98.24  ? 112 GLN H NE2 1 
ATOM   5571 N N   . GLY D 4 113 ? 42.713  18.598  8.872   1.00 72.83  ? 113 GLY H N   1 
ATOM   5572 C CA  . GLY D 4 113 ? 42.941  19.716  9.766   1.00 72.81  ? 113 GLY H CA  1 
ATOM   5573 C C   . GLY D 4 113 ? 44.252  20.424  9.475   1.00 78.27  ? 113 GLY H C   1 
ATOM   5574 O O   . GLY D 4 113 ? 45.174  19.850  8.876   1.00 78.08  ? 113 GLY H O   1 
ATOM   5575 N N   . THR D 4 114 ? 44.342  21.683  9.896   1.00 76.38  ? 114 THR H N   1 
ATOM   5576 C CA  . THR D 4 114 ? 45.537  22.508  9.756   1.00 77.12  ? 114 THR H CA  1 
ATOM   5577 C C   . THR D 4 114 ? 45.758  23.179  11.091  1.00 82.76  ? 114 THR H C   1 
ATOM   5578 O O   . THR D 4 114 ? 44.915  23.955  11.518  1.00 83.22  ? 114 THR H O   1 
ATOM   5579 C CB  . THR D 4 114 ? 45.410  23.482  8.570   1.00 86.30  ? 114 THR H CB  1 
ATOM   5580 O OG1 . THR D 4 114 ? 45.167  22.730  7.372   1.00 89.29  ? 114 THR H OG1 1 
ATOM   5581 C CG2 . THR D 4 114 ? 46.659  24.344  8.384   1.00 80.66  ? 114 THR H CG2 1 
ATOM   5582 N N   . THR D 4 115 ? 46.847  22.842  11.775  1.00 80.86  ? 115 THR H N   1 
ATOM   5583 C CA  . THR D 4 115 ? 47.133  23.414  13.082  1.00 82.41  ? 115 THR H CA  1 
ATOM   5584 C C   . THR D 4 115 ? 47.813  24.779  12.946  1.00 89.88  ? 115 THR H C   1 
ATOM   5585 O O   . THR D 4 115 ? 49.047  24.852  12.841  1.00 90.60  ? 115 THR H O   1 
ATOM   5586 C CB  . THR D 4 115 ? 47.974  22.459  13.913  1.00 98.01  ? 115 THR H CB  1 
ATOM   5587 O OG1 . THR D 4 115 ? 47.648  21.100  13.590  1.00 103.20 ? 115 THR H OG1 1 
ATOM   5588 C CG2 . THR D 4 115 ? 47.829  22.727  15.400  1.00 99.04  ? 115 THR H CG2 1 
ATOM   5589 N N   . VAL D 4 116 ? 47.015  25.865  12.957  1.00 86.38  ? 116 VAL H N   1 
ATOM   5590 C CA  . VAL D 4 116 ? 47.571  27.204  12.869  1.00 86.06  ? 116 VAL H CA  1 
ATOM   5591 C C   . VAL D 4 116 ? 47.900  27.707  14.293  1.00 88.87  ? 116 VAL H C   1 
ATOM   5592 O O   . VAL D 4 116 ? 47.070  27.580  15.209  1.00 85.20  ? 116 VAL H O   1 
ATOM   5593 C CB  . VAL D 4 116 ? 46.736  28.187  12.002  1.00 90.40  ? 116 VAL H CB  1 
ATOM   5594 C CG1 . VAL D 4 116 ? 45.616  28.837  12.803  1.00 90.56  ? 116 VAL H CG1 1 
ATOM   5595 C CG2 . VAL D 4 116 ? 47.628  29.259  11.377  1.00 90.06  ? 116 VAL H CG2 1 
ATOM   5596 N N   . THR D 4 117 ? 49.151  28.225  14.464  1.00 87.39  ? 117 THR H N   1 
ATOM   5597 C CA  . THR D 4 117 ? 49.683  28.722  15.740  1.00 87.50  ? 117 THR H CA  1 
ATOM   5598 C C   . THR D 4 117 ? 50.089  30.203  15.625  1.00 91.81  ? 117 THR H C   1 
ATOM   5599 O O   . THR D 4 117 ? 51.073  30.505  14.947  1.00 92.24  ? 117 THR H O   1 
ATOM   5600 C CB  . THR D 4 117 ? 50.814  27.793  16.285  1.00 90.73  ? 117 THR H CB  1 
ATOM   5601 O OG1 . THR D 4 117 ? 50.476  26.414  16.083  1.00 92.45  ? 117 THR H OG1 1 
ATOM   5602 C CG2 . THR D 4 117 ? 51.106  28.022  17.767  1.00 84.06  ? 117 THR H CG2 1 
ATOM   5603 N N   . VAL D 4 118 ? 49.325  31.117  16.276  1.00 87.62  ? 118 VAL H N   1 
ATOM   5604 C CA  . VAL D 4 118 ? 49.625  32.551  16.270  1.00 88.33  ? 118 VAL H CA  1 
ATOM   5605 C C   . VAL D 4 118 ? 50.580  32.854  17.400  1.00 94.62  ? 118 VAL H C   1 
ATOM   5606 O O   . VAL D 4 118 ? 50.212  32.767  18.579  1.00 94.79  ? 118 VAL H O   1 
ATOM   5607 C CB  . VAL D 4 118 ? 48.391  33.479  16.317  1.00 92.52  ? 118 VAL H CB  1 
ATOM   5608 C CG1 . VAL D 4 118 ? 48.788  34.939  16.027  1.00 91.76  ? 118 VAL H CG1 1 
ATOM   5609 C CG2 . VAL D 4 118 ? 47.301  32.990  15.366  1.00 92.53  ? 118 VAL H CG2 1 
ATOM   5610 N N   . SER D 4 119 ? 51.812  33.201  17.039  1.00 92.33  ? 119 SER H N   1 
ATOM   5611 C CA  . SER D 4 119 ? 52.858  33.467  18.009  1.00 92.72  ? 119 SER H CA  1 
ATOM   5612 C C   . SER D 4 119 ? 53.966  34.321  17.468  1.00 98.72  ? 119 SER H C   1 
ATOM   5613 O O   . SER D 4 119 ? 54.376  34.205  16.309  1.00 97.69  ? 119 SER H O   1 
ATOM   5614 C CB  . SER D 4 119 ? 53.443  32.162  18.550  1.00 95.28  ? 119 SER H CB  1 
ATOM   5615 O OG  . SER D 4 119 ? 54.458  32.419  19.504  1.00 101.50 ? 119 SER H OG  1 
ATOM   5616 N N   . SER D 4 120 ? 54.501  35.136  18.367  1.00 98.06  ? 120 SER H N   1 
ATOM   5617 C CA  . SER D 4 120 ? 55.637  35.998  18.115  1.00 99.08  ? 120 SER H CA  1 
ATOM   5618 C C   . SER D 4 120 ? 56.892  35.128  18.186  1.00 105.67 ? 120 SER H C   1 
ATOM   5619 O O   . SER D 4 120 ? 57.969  35.602  17.837  1.00 106.42 ? 120 SER H O   1 
ATOM   5620 C CB  . SER D 4 120 ? 55.697  37.097  19.167  1.00 103.09 ? 120 SER H CB  1 
ATOM   5621 O OG  . SER D 4 120 ? 54.402  37.622  19.408  1.00 114.51 ? 120 SER H OG  1 
ATOM   5622 N N   . ALA D 4 121 ? 56.752  33.857  18.647  1.00 102.88 ? 121 ALA H N   1 
ATOM   5623 C CA  . ALA D 4 121 ? 57.850  32.898  18.755  1.00 102.90 ? 121 ALA H CA  1 
ATOM   5624 C C   . ALA D 4 121 ? 58.285  32.425  17.376  1.00 107.71 ? 121 ALA H C   1 
ATOM   5625 O O   . ALA D 4 121 ? 57.452  32.216  16.482  1.00 107.59 ? 121 ALA H O   1 
ATOM   5626 C CB  . ALA D 4 121 ? 57.438  31.707  19.605  1.00 103.57 ? 121 ALA H CB  1 
ATOM   5627 N N   . SER D 4 122 ? 59.598  32.270  17.201  1.00 104.20 ? 122 SER H N   1 
ATOM   5628 C CA  . SER D 4 122 ? 60.156  31.817  15.934  1.00 103.84 ? 122 SER H CA  1 
ATOM   5629 C C   . SER D 4 122 ? 60.013  30.296  15.833  1.00 103.89 ? 122 SER H C   1 
ATOM   5630 O O   . SER D 4 122 ? 59.882  29.620  16.857  1.00 103.02 ? 122 SER H O   1 
ATOM   5631 C CB  . SER D 4 122 ? 61.616  32.259  15.806  1.00 109.88 ? 122 SER H CB  1 
ATOM   5632 O OG  . SER D 4 122 ? 61.781  33.664  15.971  1.00 122.27 ? 122 SER H OG  1 
ATOM   5633 N N   . THR D 4 123 ? 59.990  29.768  14.600  1.00 98.18  ? 123 THR H N   1 
ATOM   5634 C CA  . THR D 4 123 ? 59.890  28.329  14.330  1.00 96.65  ? 123 THR H CA  1 
ATOM   5635 C C   . THR D 4 123 ? 61.219  27.665  14.639  1.00 97.65  ? 123 THR H C   1 
ATOM   5636 O O   . THR D 4 123 ? 62.279  28.148  14.238  1.00 97.05  ? 123 THR H O   1 
ATOM   5637 C CB  . THR D 4 123 ? 59.471  28.083  12.876  1.00 101.87 ? 123 THR H CB  1 
ATOM   5638 O OG1 . THR D 4 123 ? 58.172  28.608  12.690  1.00 106.67 ? 123 THR H OG1 1 
ATOM   5639 C CG2 . THR D 4 123 ? 59.446  26.634  12.505  1.00 96.06  ? 123 THR H CG2 1 
ATOM   5640 N N   . LYS D 4 124 ? 61.155  26.584  15.395  1.00 92.57  ? 124 LYS H N   1 
ATOM   5641 C CA  . LYS D 4 124 ? 62.319  25.797  15.747  1.00 91.74  ? 124 LYS H CA  1 
ATOM   5642 C C   . LYS D 4 124 ? 61.943  24.354  15.500  1.00 93.97  ? 124 LYS H C   1 
ATOM   5643 O O   . LYS D 4 124 ? 60.832  23.925  15.799  1.00 92.79  ? 124 LYS H O   1 
ATOM   5644 C CB  . LYS D 4 124 ? 62.784  26.000  17.216  1.00 94.36  ? 124 LYS H CB  1 
ATOM   5645 C CG  . LYS D 4 124 ? 62.706  27.434  17.787  1.00 107.52 ? 124 LYS H CG  1 
ATOM   5646 C CD  . LYS D 4 124 ? 63.780  28.416  17.276  1.00 111.14 ? 124 LYS H CD  1 
ATOM   5647 C CE  . LYS D 4 124 ? 63.631  29.784  17.911  1.00 105.53 ? 124 LYS H CE  1 
ATOM   5648 N NZ  . LYS D 4 124 ? 64.346  30.825  17.141  1.00 104.96 ? 124 LYS H NZ  1 
ATOM   5649 N N   . GLY D 4 125 ? 62.859  23.641  14.881  1.00 89.72  ? 125 GLY H N   1 
ATOM   5650 C CA  . GLY D 4 125 ? 62.700  22.230  14.600  1.00 88.33  ? 125 GLY H CA  1 
ATOM   5651 C C   . GLY D 4 125 ? 63.078  21.461  15.844  1.00 88.96  ? 125 GLY H C   1 
ATOM   5652 O O   . GLY D 4 125 ? 63.785  21.991  16.721  1.00 88.49  ? 125 GLY H O   1 
ATOM   5653 N N   . PRO D 4 126 ? 62.604  20.203  15.949  1.00 82.50  ? 126 PRO H N   1 
ATOM   5654 C CA  . PRO D 4 126 ? 62.943  19.396  17.122  1.00 80.95  ? 126 PRO H CA  1 
ATOM   5655 C C   . PRO D 4 126 ? 64.321  18.773  17.056  1.00 82.24  ? 126 PRO H C   1 
ATOM   5656 O O   . PRO D 4 126 ? 64.885  18.556  15.978  1.00 82.08  ? 126 PRO H O   1 
ATOM   5657 C CB  . PRO D 4 126 ? 61.882  18.304  17.100  1.00 82.95  ? 126 PRO H CB  1 
ATOM   5658 C CG  . PRO D 4 126 ? 61.573  18.118  15.670  1.00 87.82  ? 126 PRO H CG  1 
ATOM   5659 C CD  . PRO D 4 126 ? 61.757  19.448  15.004  1.00 83.61  ? 126 PRO H CD  1 
ATOM   5660 N N   . SER D 4 127 ? 64.845  18.462  18.223  1.00 77.42  ? 127 SER H N   1 
ATOM   5661 C CA  . SER D 4 127 ? 66.086  17.735  18.350  1.00 77.70  ? 127 SER H CA  1 
ATOM   5662 C C   . SER D 4 127 ? 65.598  16.320  18.735  1.00 82.42  ? 127 SER H C   1 
ATOM   5663 O O   . SER D 4 127 ? 64.694  16.202  19.571  1.00 82.24  ? 127 SER H O   1 
ATOM   5664 C CB  . SER D 4 127 ? 66.971  18.383  19.409  1.00 81.48  ? 127 SER H CB  1 
ATOM   5665 O OG  . SER D 4 127 ? 67.174  19.763  19.140  1.00 87.69  ? 127 SER H OG  1 
ATOM   5666 N N   . VAL D 4 128 ? 66.070  15.269  18.039  1.00 78.69  ? 128 VAL H N   1 
ATOM   5667 C CA  . VAL D 4 128 ? 65.565  13.913  18.337  1.00 78.00  ? 128 VAL H CA  1 
ATOM   5668 C C   . VAL D 4 128 ? 66.632  13.091  19.072  1.00 83.04  ? 128 VAL H C   1 
ATOM   5669 O O   . VAL D 4 128 ? 67.675  12.779  18.489  1.00 83.32  ? 128 VAL H O   1 
ATOM   5670 C CB  . VAL D 4 128 ? 64.991  13.149  17.097  1.00 79.99  ? 128 VAL H CB  1 
ATOM   5671 C CG1 . VAL D 4 128 ? 64.325  11.837  17.516  1.00 79.36  ? 128 VAL H CG1 1 
ATOM   5672 C CG2 . VAL D 4 128 ? 64.028  14.011  16.286  1.00 79.01  ? 128 VAL H CG2 1 
ATOM   5673 N N   . PHE D 4 129 ? 66.382  12.755  20.344  1.00 78.18  ? 129 PHE H N   1 
ATOM   5674 C CA  . PHE D 4 129 ? 67.338  11.952  21.107  1.00 77.96  ? 129 PHE H CA  1 
ATOM   5675 C C   . PHE D 4 129 ? 66.764  10.549  21.349  1.00 81.68  ? 129 PHE H C   1 
ATOM   5676 O O   . PHE D 4 129 ? 65.546  10.424  21.506  1.00 80.69  ? 129 PHE H O   1 
ATOM   5677 C CB  . PHE D 4 129 ? 67.709  12.628  22.429  1.00 79.92  ? 129 PHE H CB  1 
ATOM   5678 C CG  . PHE D 4 129 ? 68.057  14.084  22.290  1.00 81.58  ? 129 PHE H CG  1 
ATOM   5679 C CD1 . PHE D 4 129 ? 69.215  14.479  21.627  1.00 84.49  ? 129 PHE H CD1 1 
ATOM   5680 C CD2 . PHE D 4 129 ? 67.230  15.067  22.825  1.00 83.39  ? 129 PHE H CD2 1 
ATOM   5681 C CE1 . PHE D 4 129 ? 69.537  15.833  21.498  1.00 84.95  ? 129 PHE H CE1 1 
ATOM   5682 C CE2 . PHE D 4 129 ? 67.551  16.422  22.693  1.00 85.87  ? 129 PHE H CE2 1 
ATOM   5683 C CZ  . PHE D 4 129 ? 68.708  16.793  22.042  1.00 83.99  ? 129 PHE H CZ  1 
ATOM   5684 N N   . PRO D 4 130 ? 67.601  9.481   21.390  1.00 77.77  ? 130 PRO H N   1 
ATOM   5685 C CA  . PRO D 4 130 ? 67.049  8.133   21.583  1.00 77.79  ? 130 PRO H CA  1 
ATOM   5686 C C   . PRO D 4 130 ? 66.790  7.693   23.024  1.00 82.50  ? 130 PRO H C   1 
ATOM   5687 O O   . PRO D 4 130 ? 67.529  8.027   23.959  1.00 81.50  ? 130 PRO H O   1 
ATOM   5688 C CB  . PRO D 4 130 ? 68.103  7.244   20.935  1.00 78.89  ? 130 PRO H CB  1 
ATOM   5689 C CG  . PRO D 4 130 ? 69.363  7.939   21.225  1.00 82.67  ? 130 PRO H CG  1 
ATOM   5690 C CD  . PRO D 4 130 ? 69.062  9.422   21.198  1.00 78.45  ? 130 PRO H CD  1 
ATOM   5691 N N   . LEU D 4 131 ? 65.746  6.883   23.177  1.00 79.58  ? 131 LEU H N   1 
ATOM   5692 C CA  . LEU D 4 131 ? 65.403  6.268   24.447  1.00 79.40  ? 131 LEU H CA  1 
ATOM   5693 C C   . LEU D 4 131 ? 65.777  4.820   24.195  1.00 84.33  ? 131 LEU H C   1 
ATOM   5694 O O   . LEU D 4 131 ? 64.964  4.045   23.693  1.00 84.96  ? 131 LEU H O   1 
ATOM   5695 C CB  . LEU D 4 131 ? 63.910  6.466   24.815  1.00 78.61  ? 131 LEU H CB  1 
ATOM   5696 C CG  . LEU D 4 131 ? 63.399  7.915   24.810  1.00 81.59  ? 131 LEU H CG  1 
ATOM   5697 C CD1 . LEU D 4 131 ? 61.896  7.958   24.883  1.00 81.12  ? 131 LEU H CD1 1 
ATOM   5698 C CD2 . LEU D 4 131 ? 64.045  8.755   25.902  1.00 81.78  ? 131 LEU H CD2 1 
ATOM   5699 N N   . ALA D 4 132 ? 67.079  4.519   24.383  1.00 80.55  ? 132 ALA H N   1 
ATOM   5700 C CA  . ALA D 4 132 ? 67.693  3.214   24.150  1.00 80.65  ? 132 ALA H CA  1 
ATOM   5701 C C   . ALA D 4 132 ? 67.287  2.140   25.177  1.00 87.13  ? 132 ALA H C   1 
ATOM   5702 O O   . ALA D 4 132 ? 67.260  2.423   26.387  1.00 87.68  ? 132 ALA H O   1 
ATOM   5703 C CB  . ALA D 4 132 ? 69.202  3.346   24.121  1.00 81.11  ? 132 ALA H CB  1 
ATOM   5704 N N   . PRO D 4 133 ? 66.999  0.899   24.717  1.00 83.72  ? 133 PRO H N   1 
ATOM   5705 C CA  . PRO D 4 133 ? 66.660  -0.168  25.668  1.00 84.68  ? 133 PRO H CA  1 
ATOM   5706 C C   . PRO D 4 133 ? 67.854  -0.653  26.503  1.00 92.16  ? 133 PRO H C   1 
ATOM   5707 O O   . PRO D 4 133 ? 69.012  -0.542  26.091  1.00 91.55  ? 133 PRO H O   1 
ATOM   5708 C CB  . PRO D 4 133 ? 66.092  -1.283  24.781  1.00 86.30  ? 133 PRO H CB  1 
ATOM   5709 C CG  . PRO D 4 133 ? 66.026  -0.726  23.400  1.00 90.04  ? 133 PRO H CG  1 
ATOM   5710 C CD  . PRO D 4 133 ? 66.967  0.408   23.328  1.00 85.20  ? 133 PRO H CD  1 
ATOM   5711 N N   . SER D 4 134 ? 67.553  -1.181  27.687  1.00 92.07  ? 134 SER H N   1 
ATOM   5712 C CA  . SER D 4 134 ? 68.505  -1.700  28.658  1.00 94.20  ? 134 SER H CA  1 
ATOM   5713 C C   . SER D 4 134 ? 67.749  -2.699  29.544  1.00 103.60 ? 134 SER H C   1 
ATOM   5714 O O   . SER D 4 134 ? 66.641  -3.076  29.166  1.00 103.55 ? 134 SER H O   1 
ATOM   5715 C CB  . SER D 4 134 ? 69.048  -0.556  29.503  1.00 99.30  ? 134 SER H CB  1 
ATOM   5716 O OG  . SER D 4 134 ? 70.094  -1.015  30.343  1.00 114.87 ? 134 SER H OG  1 
ATOM   5717 N N   . SER D 4 135 ? 68.333  -3.150  30.691  1.00 103.63 ? 135 SER H N   1 
ATOM   5718 C CA  . SER D 4 135 ? 67.651  -4.058  31.620  1.00 105.42 ? 135 SER H CA  1 
ATOM   5719 C C   . SER D 4 135 ? 66.726  -3.221  32.502  1.00 111.63 ? 135 SER H C   1 
ATOM   5720 O O   . SER D 4 135 ? 65.716  -3.721  33.017  1.00 111.55 ? 135 SER H O   1 
ATOM   5721 C CB  . SER D 4 135 ? 68.648  -4.818  32.484  1.00 111.90 ? 135 SER H CB  1 
ATOM   5722 O OG  . SER D 4 135 ? 67.973  -5.736  33.335  1.00 127.95 ? 135 SER H OG  1 
ATOM   5723 N N   . LYS D 4 136 ? 67.074  -1.927  32.651  1.00 109.17 ? 136 LYS H N   1 
ATOM   5724 C CA  . LYS D 4 136 ? 66.284  -0.931  33.376  1.00 109.21 ? 136 LYS H CA  1 
ATOM   5725 C C   . LYS D 4 136 ? 65.212  -0.351  32.407  1.00 112.32 ? 136 LYS H C   1 
ATOM   5726 O O   . LYS D 4 136 ? 64.541  0.647   32.709  1.00 111.04 ? 136 LYS H O   1 
ATOM   5727 C CB  . LYS D 4 136 ? 67.210  0.129   34.005  1.00 111.46 ? 136 LYS H CB  1 
ATOM   5728 C CG  . LYS D 4 136 ? 67.811  -0.372  35.322  1.00 127.94 ? 136 LYS H CG  1 
ATOM   5729 C CD  . LYS D 4 136 ? 69.249  0.085   35.550  1.00 140.25 ? 136 LYS H CD  1 
ATOM   5730 C CE  . LYS D 4 136 ? 69.760  -0.304  36.923  1.00 149.80 ? 136 LYS H CE  1 
ATOM   5731 N NZ  . LYS D 4 136 ? 71.035  0.385   37.268  1.00 153.85 ? 136 LYS H NZ  1 
ATOM   5732 N N   . SER D 4 137 ? 65.020  -1.076  31.266  1.00 107.98 ? 137 SER H N   1 
ATOM   5733 C CA  . SER D 4 137 ? 64.082  -0.808  30.186  1.00 107.36 ? 137 SER H CA  1 
ATOM   5734 C C   . SER D 4 137 ? 63.437  -2.086  29.559  1.00 112.13 ? 137 SER H C   1 
ATOM   5735 O O   . SER D 4 137 ? 62.559  -1.945  28.705  1.00 111.73 ? 137 SER H O   1 
ATOM   5736 C CB  . SER D 4 137 ? 64.762  0.037   29.121  1.00 110.15 ? 137 SER H CB  1 
ATOM   5737 O OG  . SER D 4 137 ? 63.830  0.364   28.109  1.00 118.52 ? 137 SER H OG  1 
ATOM   5738 N N   . THR D 4 138 ? 63.848  -3.311  29.985  1.00 109.70 ? 138 THR H N   1 
ATOM   5739 C CA  . THR D 4 138 ? 63.319  -4.594  29.484  1.00 110.20 ? 138 THR H CA  1 
ATOM   5740 C C   . THR D 4 138 ? 62.658  -5.376  30.628  1.00 117.63 ? 138 THR H C   1 
ATOM   5741 O O   . THR D 4 138 ? 63.314  -5.662  31.630  1.00 117.69 ? 138 THR H O   1 
ATOM   5742 C CB  . THR D 4 138 ? 64.427  -5.419  28.760  1.00 115.24 ? 138 THR H CB  1 
ATOM   5743 O OG1 . THR D 4 138 ? 65.031  -4.632  27.731  1.00 112.85 ? 138 THR H OG1 1 
ATOM   5744 C CG2 . THR D 4 138 ? 63.908  -6.727  28.152  1.00 112.41 ? 138 THR H CG2 1 
ATOM   5745 N N   . SER D 4 139 ? 61.366  -5.733  30.453  1.00 116.80 ? 139 SER H N   1 
ATOM   5746 C CA  . SER D 4 139 ? 60.515  -6.473  31.406  1.00 117.72 ? 139 SER H CA  1 
ATOM   5747 C C   . SER D 4 139 ? 60.570  -8.013  31.162  1.00 122.77 ? 139 SER H C   1 
ATOM   5748 O O   . SER D 4 139 ? 59.556  -8.675  30.877  1.00 122.10 ? 139 SER H O   1 
ATOM   5749 C CB  . SER D 4 139 ? 59.088  -5.923  31.353  1.00 122.39 ? 139 SER H CB  1 
ATOM   5750 O OG  . SER D 4 139 ? 58.120  -6.760  31.966  1.00 134.35 ? 139 SER H OG  1 
ATOM   5751 N N   . GLY D 4 140 ? 61.775  -8.561  31.287  1.00 120.37 ? 140 GLY H N   1 
ATOM   5752 C CA  . GLY D 4 140 ? 62.034  -9.972  31.035  1.00 120.43 ? 140 GLY H CA  1 
ATOM   5753 C C   . GLY D 4 140 ? 62.051  -10.267 29.544  1.00 123.86 ? 140 GLY H C   1 
ATOM   5754 O O   . GLY D 4 140 ? 63.099  -10.154 28.897  1.00 123.19 ? 140 GLY H O   1 
ATOM   5755 N N   . GLY D 4 141 ? 60.877  -10.609 29.000  1.00 119.31 ? 141 GLY H N   1 
ATOM   5756 C CA  . GLY D 4 141 ? 60.707  -10.926 27.584  1.00 117.75 ? 141 GLY H CA  1 
ATOM   5757 C C   . GLY D 4 141 ? 60.093  -9.835  26.720  1.00 117.16 ? 141 GLY H C   1 
ATOM   5758 O O   . GLY D 4 141 ? 59.681  -10.117 25.588  1.00 116.66 ? 141 GLY H O   1 
ATOM   5759 N N   . THR D 4 142 ? 60.036  -8.580  27.227  1.00 109.41 ? 142 THR H N   1 
ATOM   5760 C CA  . THR D 4 142 ? 59.461  -7.466  26.478  1.00 107.61 ? 142 THR H CA  1 
ATOM   5761 C C   . THR D 4 142 ? 60.223  -6.172  26.752  1.00 107.74 ? 142 THR H C   1 
ATOM   5762 O O   . THR D 4 142 ? 60.190  -5.637  27.868  1.00 107.63 ? 142 THR H O   1 
ATOM   5763 C CB  . THR D 4 142 ? 57.932  -7.354  26.677  1.00 118.28 ? 142 THR H CB  1 
ATOM   5764 O OG1 . THR D 4 142 ? 57.461  -6.123  26.120  1.00 117.48 ? 142 THR H OG1 1 
ATOM   5765 C CG2 . THR D 4 142 ? 57.499  -7.469  28.141  1.00 119.72 ? 142 THR H CG2 1 
ATOM   5766 N N   . ALA D 4 143 ? 60.914  -5.674  25.705  1.00 99.81  ? 143 ALA H N   1 
ATOM   5767 C CA  . ALA D 4 143 ? 61.715  -4.448  25.731  1.00 96.66  ? 143 ALA H CA  1 
ATOM   5768 C C   . ALA D 4 143 ? 60.898  -3.205  25.381  1.00 95.24  ? 143 ALA H C   1 
ATOM   5769 O O   . ALA D 4 143 ? 59.961  -3.277  24.592  1.00 94.17  ? 143 ALA H O   1 
ATOM   5770 C CB  . ALA D 4 143 ? 62.886  -4.576  24.769  1.00 97.05  ? 143 ALA H CB  1 
ATOM   5771 N N   . ALA D 4 144 ? 61.277  -2.062  25.964  1.00 88.15  ? 144 ALA H N   1 
ATOM   5772 C CA  . ALA D 4 144 ? 60.682  -0.756  25.719  1.00 85.44  ? 144 ALA H CA  1 
ATOM   5773 C C   . ALA D 4 144 ? 61.787  0.097   25.186  1.00 87.01  ? 144 ALA H C   1 
ATOM   5774 O O   . ALA D 4 144 ? 62.917  -0.011  25.656  1.00 85.86  ? 144 ALA H O   1 
ATOM   5775 C CB  . ALA D 4 144 ? 60.171  -0.166  27.009  1.00 85.78  ? 144 ALA H CB  1 
ATOM   5776 N N   . LEU D 4 145 ? 61.484  0.906   24.171  1.00 83.12  ? 145 LEU H N   1 
ATOM   5777 C CA  . LEU D 4 145 ? 62.425  1.809   23.512  1.00 81.91  ? 145 LEU H CA  1 
ATOM   5778 C C   . LEU D 4 145 ? 61.646  2.951   22.909  1.00 85.25  ? 145 LEU H C   1 
ATOM   5779 O O   . LEU D 4 145 ? 60.428  2.899   22.855  1.00 85.08  ? 145 LEU H O   1 
ATOM   5780 C CB  . LEU D 4 145 ? 63.216  1.077   22.415  1.00 81.74  ? 145 LEU H CB  1 
ATOM   5781 C CG  . LEU D 4 145 ? 62.439  0.698   21.155  1.00 86.34  ? 145 LEU H CG  1 
ATOM   5782 C CD1 . LEU D 4 145 ? 63.093  1.275   19.900  1.00 86.43  ? 145 LEU H CD1 1 
ATOM   5783 C CD2 . LEU D 4 145 ? 62.289  -0.773  21.044  1.00 88.52  ? 145 LEU H CD2 1 
ATOM   5784 N N   . GLY D 4 146 ? 62.348  3.947   22.410  1.00 81.96  ? 146 GLY H N   1 
ATOM   5785 C CA  . GLY D 4 146 ? 61.703  5.085   21.780  1.00 81.44  ? 146 GLY H CA  1 
ATOM   5786 C C   . GLY D 4 146 ? 62.632  6.236   21.485  1.00 83.13  ? 146 GLY H C   1 
ATOM   5787 O O   . GLY D 4 146 ? 63.852  6.061   21.412  1.00 80.30  ? 146 GLY H O   1 
ATOM   5788 N N   . CYS D 4 147 ? 62.040  7.413   21.277  1.00 81.04  ? 147 CYS H N   1 
ATOM   5789 C CA  . CYS D 4 147 ? 62.795  8.627   21.074  1.00 82.25  ? 147 CYS H CA  1 
ATOM   5790 C C   . CYS D 4 147 ? 62.067  9.855   21.613  1.00 82.57  ? 147 CYS H C   1 
ATOM   5791 O O   . CYS D 4 147 ? 60.850  9.964   21.523  1.00 82.51  ? 147 CYS H O   1 
ATOM   5792 C CB  . CYS D 4 147 ? 63.270  8.813   19.628  1.00 84.55  ? 147 CYS H CB  1 
ATOM   5793 S SG  . CYS D 4 147 ? 61.972  8.687   18.362  1.00 89.30  ? 147 CYS H SG  1 
ATOM   5794 N N   . LEU D 4 148 ? 62.827  10.736  22.238  1.00 76.08  ? 148 LEU H N   1 
ATOM   5795 C CA  . LEU D 4 148 ? 62.355  11.982  22.776  1.00 74.83  ? 148 LEU H CA  1 
ATOM   5796 C C   . LEU D 4 148 ? 62.545  13.048  21.688  1.00 80.07  ? 148 LEU H C   1 
ATOM   5797 O O   . LEU D 4 148 ? 63.638  13.222  21.130  1.00 79.78  ? 148 LEU H O   1 
ATOM   5798 C CB  . LEU D 4 148 ? 63.151  12.309  24.047  1.00 74.37  ? 148 LEU H CB  1 
ATOM   5799 C CG  . LEU D 4 148 ? 63.275  13.774  24.447  1.00 78.08  ? 148 LEU H CG  1 
ATOM   5800 C CD1 . LEU D 4 148 ? 62.033  14.267  25.149  1.00 77.17  ? 148 LEU H CD1 1 
ATOM   5801 C CD2 . LEU D 4 148 ? 64.450  13.967  25.337  1.00 81.01  ? 148 LEU H CD2 1 
ATOM   5802 N N   . VAL D 4 149 ? 61.448  13.738  21.383  1.00 77.46  ? 149 VAL H N   1 
ATOM   5803 C CA  . VAL D 4 149 ? 61.342  14.800  20.384  1.00 76.90  ? 149 VAL H CA  1 
ATOM   5804 C C   . VAL D 4 149 ? 61.242  16.131  21.169  1.00 80.57  ? 149 VAL H C   1 
ATOM   5805 O O   . VAL D 4 149 ? 60.157  16.623  21.467  1.00 80.52  ? 149 VAL H O   1 
ATOM   5806 C CB  . VAL D 4 149 ? 60.164  14.501  19.402  1.00 79.89  ? 149 VAL H CB  1 
ATOM   5807 C CG1 . VAL D 4 149 ? 59.993  15.600  18.365  1.00 79.82  ? 149 VAL H CG1 1 
ATOM   5808 C CG2 . VAL D 4 149 ? 60.375  13.159  18.708  1.00 79.17  ? 149 VAL H CG2 1 
ATOM   5809 N N   . LYS D 4 150 ? 62.405  16.673  21.544  1.00 76.87  ? 150 LYS H N   1 
ATOM   5810 C CA  . LYS D 4 150 ? 62.518  17.857  22.374  1.00 76.97  ? 150 LYS H CA  1 
ATOM   5811 C C   . LYS D 4 150 ? 62.682  19.176  21.621  1.00 86.08  ? 150 LYS H C   1 
ATOM   5812 O O   . LYS D 4 150 ? 63.232  19.210  20.519  1.00 86.54  ? 150 LYS H O   1 
ATOM   5813 C CB  . LYS D 4 150 ? 63.688  17.663  23.344  1.00 77.45  ? 150 LYS H CB  1 
ATOM   5814 C CG  . LYS D 4 150 ? 63.370  18.102  24.754  1.00 80.54  ? 150 LYS H CG  1 
ATOM   5815 C CD  . LYS D 4 150 ? 64.484  17.718  25.706  1.00 89.06  ? 150 LYS H CD  1 
ATOM   5816 C CE  . LYS D 4 150 ? 64.516  18.600  26.932  1.00 99.60  ? 150 LYS H CE  1 
ATOM   5817 N NZ  . LYS D 4 150 ? 65.336  19.831  26.720  1.00 98.66  ? 150 LYS H NZ  1 
ATOM   5818 N N   . ASP D 4 151 ? 62.241  20.274  22.265  1.00 84.53  ? 151 ASP H N   1 
ATOM   5819 C CA  . ASP D 4 151 ? 62.392  21.676  21.850  1.00 84.51  ? 151 ASP H CA  1 
ATOM   5820 C C   . ASP D 4 151 ? 62.053  21.986  20.376  1.00 85.20  ? 151 ASP H C   1 
ATOM   5821 O O   . ASP D 4 151 ? 62.948  22.303  19.587  1.00 86.14  ? 151 ASP H O   1 
ATOM   5822 C CB  . ASP D 4 151 ? 63.813  22.198  22.192  1.00 87.15  ? 151 ASP H CB  1 
ATOM   5823 C CG  . ASP D 4 151 ? 64.309  21.966  23.621  1.00 103.01 ? 151 ASP H CG  1 
ATOM   5824 O OD1 . ASP D 4 151 ? 63.462  21.961  24.566  1.00 104.36 ? 151 ASP H OD1 1 
ATOM   5825 O OD2 . ASP D 4 151 ? 65.538  21.811  23.800  1.00 109.69 ? 151 ASP H OD2 1 
ATOM   5826 N N   . TYR D 4 152 ? 60.757  21.982  20.039  1.00 78.86  ? 152 TYR H N   1 
ATOM   5827 C CA  . TYR D 4 152 ? 60.256  22.332  18.711  1.00 78.13  ? 152 TYR H CA  1 
ATOM   5828 C C   . TYR D 4 152 ? 59.113  23.315  18.791  1.00 84.03  ? 152 TYR H C   1 
ATOM   5829 O O   . TYR D 4 152 ? 58.387  23.354  19.781  1.00 83.39  ? 152 TYR H O   1 
ATOM   5830 C CB  . TYR D 4 152 ? 59.834  21.100  17.900  1.00 78.45  ? 152 TYR H CB  1 
ATOM   5831 C CG  . TYR D 4 152 ? 58.659  20.358  18.482  1.00 80.02  ? 152 TYR H CG  1 
ATOM   5832 C CD1 . TYR D 4 152 ? 58.843  19.373  19.453  1.00 82.08  ? 152 TYR H CD1 1 
ATOM   5833 C CD2 . TYR D 4 152 ? 57.358  20.637  18.065  1.00 80.57  ? 152 TYR H CD2 1 
ATOM   5834 C CE1 . TYR D 4 152 ? 57.756  18.711  20.028  1.00 81.30  ? 152 TYR H CE1 1 
ATOM   5835 C CE2 . TYR D 4 152 ? 56.264  19.966  18.617  1.00 81.48  ? 152 TYR H CE2 1 
ATOM   5836 C CZ  . TYR D 4 152 ? 56.471  19.000  19.595  1.00 86.77  ? 152 TYR H CZ  1 
ATOM   5837 O OH  . TYR D 4 152 ? 55.411  18.340  20.154  1.00 84.70  ? 152 TYR H OH  1 
ATOM   5838 N N   . PHE D 4 153 ? 58.938  24.102  17.742  1.00 83.00  ? 153 PHE H N   1 
ATOM   5839 C CA  . PHE D 4 153 ? 57.840  25.040  17.690  1.00 84.36  ? 153 PHE H CA  1 
ATOM   5840 C C   . PHE D 4 153 ? 57.364  25.243  16.260  1.00 93.43  ? 153 PHE H C   1 
ATOM   5841 O O   . PHE D 4 153 ? 58.193  25.500  15.384  1.00 95.75  ? 153 PHE H O   1 
ATOM   5842 C CB  . PHE D 4 153 ? 58.178  26.375  18.378  1.00 85.92  ? 153 PHE H CB  1 
ATOM   5843 C CG  . PHE D 4 153 ? 56.935  27.163  18.715  1.00 87.60  ? 153 PHE H CG  1 
ATOM   5844 C CD1 . PHE D 4 153 ? 56.206  26.884  19.867  1.00 90.77  ? 153 PHE H CD1 1 
ATOM   5845 C CD2 . PHE D 4 153 ? 56.457  28.147  17.852  1.00 89.97  ? 153 PHE H CD2 1 
ATOM   5846 C CE1 . PHE D 4 153 ? 55.040  27.595  20.163  1.00 91.90  ? 153 PHE H CE1 1 
ATOM   5847 C CE2 . PHE D 4 153 ? 55.282  28.850  18.144  1.00 92.77  ? 153 PHE H CE2 1 
ATOM   5848 C CZ  . PHE D 4 153 ? 54.586  28.577  19.301  1.00 90.92  ? 153 PHE H CZ  1 
ATOM   5849 N N   . PRO D 4 154 ? 56.038  25.146  15.993  1.00 90.80  ? 154 PRO H N   1 
ATOM   5850 C CA  . PRO D 4 154 ? 54.950  24.843  16.924  1.00 90.69  ? 154 PRO H CA  1 
ATOM   5851 C C   . PRO D 4 154 ? 54.537  23.389  16.749  1.00 94.48  ? 154 PRO H C   1 
ATOM   5852 O O   . PRO D 4 154 ? 55.270  22.590  16.159  1.00 95.15  ? 154 PRO H O   1 
ATOM   5853 C CB  . PRO D 4 154 ? 53.849  25.773  16.409  1.00 92.57  ? 154 PRO H CB  1 
ATOM   5854 C CG  . PRO D 4 154 ? 54.014  25.707  14.892  1.00 97.48  ? 154 PRO H CG  1 
ATOM   5855 C CD  . PRO D 4 154 ? 55.491  25.364  14.637  1.00 92.97  ? 154 PRO H CD  1 
ATOM   5856 N N   . GLU D 4 155 ? 53.343  23.061  17.208  1.00 89.50  ? 155 GLU H N   1 
ATOM   5857 C CA  . GLU D 4 155 ? 52.789  21.746  16.977  1.00 88.29  ? 155 GLU H CA  1 
ATOM   5858 C C   . GLU D 4 155 ? 52.158  21.809  15.549  1.00 89.91  ? 155 GLU H C   1 
ATOM   5859 O O   . GLU D 4 155 ? 51.852  22.916  15.059  1.00 89.72  ? 155 GLU H O   1 
ATOM   5860 C CB  . GLU D 4 155 ? 51.768  21.420  18.079  1.00 89.68  ? 155 GLU H CB  1 
ATOM   5861 C CG  . GLU D 4 155 ? 52.373  20.641  19.231  1.00 98.24  ? 155 GLU H CG  1 
ATOM   5862 C CD  . GLU D 4 155 ? 51.890  19.205  19.268  1.00 113.47 ? 155 GLU H CD  1 
ATOM   5863 O OE1 . GLU D 4 155 ? 50.872  18.955  19.952  1.00 106.55 ? 155 GLU H OE1 1 
ATOM   5864 O OE2 . GLU D 4 155 ? 52.518  18.333  18.620  1.00 97.46  ? 155 GLU H OE2 1 
ATOM   5865 N N   . PRO D 4 156 ? 52.061  20.691  14.804  1.00 84.41  ? 156 PRO H N   1 
ATOM   5866 C CA  . PRO D 4 156 ? 52.343  19.301  15.166  1.00 83.84  ? 156 PRO H CA  1 
ATOM   5867 C C   . PRO D 4 156 ? 53.662  18.716  14.688  1.00 85.39  ? 156 PRO H C   1 
ATOM   5868 O O   . PRO D 4 156 ? 54.334  19.243  13.790  1.00 84.87  ? 156 PRO H O   1 
ATOM   5869 C CB  . PRO D 4 156 ? 51.181  18.545  14.503  1.00 85.83  ? 156 PRO H CB  1 
ATOM   5870 C CG  . PRO D 4 156 ? 50.674  19.457  13.381  1.00 90.26  ? 156 PRO H CG  1 
ATOM   5871 C CD  . PRO D 4 156 ? 51.450  20.749  13.471  1.00 85.89  ? 156 PRO H CD  1 
ATOM   5872 N N   . VAL D 4 157 ? 53.989  17.573  15.289  1.00 79.71  ? 157 VAL H N   1 
ATOM   5873 C CA  . VAL D 4 157 ? 55.143  16.756  14.956  1.00 78.70  ? 157 VAL H CA  1 
ATOM   5874 C C   . VAL D 4 157 ? 54.587  15.361  14.537  1.00 82.37  ? 157 VAL H C   1 
ATOM   5875 O O   . VAL D 4 157 ? 53.453  15.024  14.923  1.00 83.93  ? 157 VAL H O   1 
ATOM   5876 C CB  . VAL D 4 157 ? 56.204  16.756  16.096  1.00 81.69  ? 157 VAL H CB  1 
ATOM   5877 C CG1 . VAL D 4 157 ? 55.676  16.141  17.385  1.00 81.02  ? 157 VAL H CG1 1 
ATOM   5878 C CG2 . VAL D 4 157 ? 57.501  16.093  15.662  1.00 81.60  ? 157 VAL H CG2 1 
ATOM   5879 N N   . THR D 4 158 ? 55.323  14.601  13.697  1.00 76.01  ? 158 THR H N   1 
ATOM   5880 C CA  . THR D 4 158 ? 54.851  13.299  13.218  1.00 75.33  ? 158 THR H CA  1 
ATOM   5881 C C   . THR D 4 158 ? 55.880  12.204  13.498  1.00 78.09  ? 158 THR H C   1 
ATOM   5882 O O   . THR D 4 158 ? 56.908  12.144  12.814  1.00 78.85  ? 158 THR H O   1 
ATOM   5883 C CB  . THR D 4 158 ? 54.436  13.394  11.725  1.00 86.18  ? 158 THR H CB  1 
ATOM   5884 O OG1 . THR D 4 158 ? 53.384  14.337  11.583  1.00 87.52  ? 158 THR H OG1 1 
ATOM   5885 C CG2 . THR D 4 158 ? 54.008  12.053  11.124  1.00 85.48  ? 158 THR H CG2 1 
ATOM   5886 N N   . VAL D 4 159 ? 55.597  11.314  14.470  1.00 72.60  ? 159 VAL H N   1 
ATOM   5887 C CA  . VAL D 4 159 ? 56.540  10.242  14.755  1.00 72.07  ? 159 VAL H CA  1 
ATOM   5888 C C   . VAL D 4 159 ? 56.028  8.928   14.236  1.00 79.57  ? 159 VAL H C   1 
ATOM   5889 O O   . VAL D 4 159 ? 54.968  8.484   14.654  1.00 81.35  ? 159 VAL H O   1 
ATOM   5890 C CB  . VAL D 4 159 ? 57.044  10.120  16.213  1.00 74.65  ? 159 VAL H CB  1 
ATOM   5891 C CG1 . VAL D 4 159 ? 58.346  9.335   16.254  1.00 74.28  ? 159 VAL H CG1 1 
ATOM   5892 C CG2 . VAL D 4 159 ? 57.252  11.477  16.851  1.00 74.42  ? 159 VAL H CG2 1 
ATOM   5893 N N   . SER D 4 160 ? 56.782  8.308   13.325  1.00 76.99  ? 160 SER H N   1 
ATOM   5894 C CA  . SER D 4 160 ? 56.498  6.978   12.811  1.00 77.16  ? 160 SER H CA  1 
ATOM   5895 C C   . SER D 4 160 ? 57.728  6.110   13.090  1.00 81.81  ? 160 SER H C   1 
ATOM   5896 O O   . SER D 4 160 ? 58.821  6.635   13.333  1.00 80.74  ? 160 SER H O   1 
ATOM   5897 C CB  . SER D 4 160 ? 56.151  7.009   11.325  1.00 81.11  ? 160 SER H CB  1 
ATOM   5898 O OG  . SER D 4 160 ? 57.311  7.005   10.511  1.00 92.61  ? 160 SER H OG  1 
ATOM   5899 N N   . TRP D 4 161 ? 57.546  4.791   13.078  1.00 79.02  ? 161 TRP H N   1 
ATOM   5900 C CA  . TRP D 4 161 ? 58.639  3.864   13.344  1.00 78.87  ? 161 TRP H CA  1 
ATOM   5901 C C   . TRP D 4 161 ? 58.938  3.000   12.144  1.00 83.91  ? 161 TRP H C   1 
ATOM   5902 O O   . TRP D 4 161 ? 58.007  2.455   11.557  1.00 84.44  ? 161 TRP H O   1 
ATOM   5903 C CB  . TRP D 4 161 ? 58.318  3.043   14.589  1.00 77.27  ? 161 TRP H CB  1 
ATOM   5904 C CG  . TRP D 4 161 ? 58.417  3.888   15.816  1.00 77.72  ? 161 TRP H CG  1 
ATOM   5905 C CD1 . TRP D 4 161 ? 57.462  4.726   16.311  1.00 80.44  ? 161 TRP H CD1 1 
ATOM   5906 C CD2 . TRP D 4 161 ? 59.605  4.136   16.580  1.00 77.14  ? 161 TRP H CD2 1 
ATOM   5907 N NE1 . TRP D 4 161 ? 57.958  5.426   17.385  1.00 79.63  ? 161 TRP H NE1 1 
ATOM   5908 C CE2 . TRP D 4 161 ? 59.274  5.086   17.572  1.00 80.98  ? 161 TRP H CE2 1 
ATOM   5909 C CE3 . TRP D 4 161 ? 60.906  3.597   16.561  1.00 78.02  ? 161 TRP H CE3 1 
ATOM   5910 C CZ2 . TRP D 4 161 ? 60.186  5.491   18.548  1.00 79.75  ? 161 TRP H CZ2 1 
ATOM   5911 C CZ3 . TRP D 4 161 ? 61.808  3.999   17.523  1.00 78.79  ? 161 TRP H CZ3 1 
ATOM   5912 C CH2 . TRP D 4 161 ? 61.451  4.946   18.494  1.00 79.83  ? 161 TRP H CH2 1 
ATOM   5913 N N   . ASN D 4 162 ? 60.220  2.919   11.738  1.00 80.83  ? 162 ASN H N   1 
ATOM   5914 C CA  . ASN D 4 162 ? 60.681  2.164   10.565  1.00 81.90  ? 162 ASN H CA  1 
ATOM   5915 C C   . ASN D 4 162 ? 59.887  2.572   9.304   1.00 89.26  ? 162 ASN H C   1 
ATOM   5916 O O   . ASN D 4 162 ? 59.519  1.726   8.467   1.00 87.67  ? 162 ASN H O   1 
ATOM   5917 C CB  . ASN D 4 162 ? 60.637  0.646   10.830  1.00 80.00  ? 162 ASN H CB  1 
ATOM   5918 C CG  . ASN D 4 162 ? 61.574  0.205   11.921  1.00 97.97  ? 162 ASN H CG  1 
ATOM   5919 O OD1 . ASN D 4 162 ? 62.753  0.576   11.980  1.00 96.66  ? 162 ASN H OD1 1 
ATOM   5920 N ND2 . ASN D 4 162 ? 61.074  -0.604  12.806  1.00 89.66  ? 162 ASN H ND2 1 
ATOM   5921 N N   . SER D 4 163 ? 59.605  3.905   9.219   1.00 88.49  ? 163 SER H N   1 
ATOM   5922 C CA  . SER D 4 163 ? 58.813  4.593   8.189   1.00 88.93  ? 163 SER H CA  1 
ATOM   5923 C C   . SER D 4 163 ? 57.404  3.934   8.002   1.00 92.38  ? 163 SER H C   1 
ATOM   5924 O O   . SER D 4 163 ? 57.021  3.522   6.904   1.00 90.68  ? 163 SER H O   1 
ATOM   5925 C CB  . SER D 4 163 ? 59.599  4.750   6.886   1.00 93.15  ? 163 SER H CB  1 
ATOM   5926 O OG  . SER D 4 163 ? 59.832  3.510   6.244   1.00 105.12 ? 163 SER H OG  1 
ATOM   5927 N N   . GLY D 4 164 ? 56.677  3.841   9.121   1.00 90.02  ? 164 GLY H N   1 
ATOM   5928 C CA  . GLY D 4 164 ? 55.326  3.291   9.208   1.00 89.87  ? 164 GLY H CA  1 
ATOM   5929 C C   . GLY D 4 164 ? 55.186  1.776   9.209   1.00 92.67  ? 164 GLY H C   1 
ATOM   5930 O O   . GLY D 4 164 ? 54.063  1.267   9.257   1.00 93.13  ? 164 GLY H O   1 
ATOM   5931 N N   . ALA D 4 165 ? 56.301  1.037   9.134   1.00 87.03  ? 165 ALA H N   1 
ATOM   5932 C CA  . ALA D 4 165 ? 56.276  -0.430  9.150   1.00 85.96  ? 165 ALA H CA  1 
ATOM   5933 C C   . ALA D 4 165 ? 55.942  -0.992  10.568  1.00 87.00  ? 165 ALA H C   1 
ATOM   5934 O O   . ALA D 4 165 ? 55.414  -2.101  10.719  1.00 86.20  ? 165 ALA H O   1 
ATOM   5935 C CB  . ALA D 4 165 ? 57.618  -0.960  8.689   1.00 86.61  ? 165 ALA H CB  1 
ATOM   5936 N N   . LEU D 4 166 ? 56.288  -0.213  11.593  1.00 80.97  ? 166 LEU H N   1 
ATOM   5937 C CA  . LEU D 4 166 ? 56.109  -0.543  12.990  1.00 79.33  ? 166 LEU H CA  1 
ATOM   5938 C C   . LEU D 4 166 ? 55.024  0.375   13.491  1.00 82.90  ? 166 LEU H C   1 
ATOM   5939 O O   . LEU D 4 166 ? 55.214  1.593   13.628  1.00 81.00  ? 166 LEU H O   1 
ATOM   5940 C CB  . LEU D 4 166 ? 57.445  -0.353  13.732  1.00 78.78  ? 166 LEU H CB  1 
ATOM   5941 C CG  . LEU D 4 166 ? 57.553  -0.781  15.184  1.00 82.96  ? 166 LEU H CG  1 
ATOM   5942 C CD1 . LEU D 4 166 ? 56.858  -2.107  15.456  1.00 82.91  ? 166 LEU H CD1 1 
ATOM   5943 C CD2 . LEU D 4 166 ? 58.983  -0.843  15.596  1.00 83.66  ? 166 LEU H CD2 1 
ATOM   5944 N N   . THR D 4 167 ? 53.846  -0.219  13.649  1.00 80.76  ? 167 THR H N   1 
ATOM   5945 C CA  . THR D 4 167 ? 52.640  0.462   14.072  1.00 80.83  ? 167 THR H CA  1 
ATOM   5946 C C   . THR D 4 167 ? 52.092  -0.152  15.368  1.00 86.75  ? 167 THR H C   1 
ATOM   5947 O O   . THR D 4 167 ? 51.529  0.584   16.180  1.00 86.57  ? 167 THR H O   1 
ATOM   5948 C CB  . THR D 4 167 ? 51.634  0.539   12.909  1.00 86.58  ? 167 THR H CB  1 
ATOM   5949 O OG1 . THR D 4 167 ? 51.509  -0.729  12.272  1.00 88.89  ? 167 THR H OG1 1 
ATOM   5950 C CG2 . THR D 4 167 ? 52.046  1.537   11.863  1.00 85.43  ? 167 THR H CG2 1 
ATOM   5951 N N   . SER D 4 168 ? 52.296  -1.471  15.599  1.00 84.85  ? 168 SER H N   1 
ATOM   5952 C CA  . SER D 4 168 ? 51.796  -2.090  16.841  1.00 85.46  ? 168 SER H CA  1 
ATOM   5953 C C   . SER D 4 168 ? 52.709  -1.833  18.053  1.00 87.90  ? 168 SER H C   1 
ATOM   5954 O O   . SER D 4 168 ? 53.937  -1.953  17.954  1.00 86.90  ? 168 SER H O   1 
ATOM   5955 C CB  . SER D 4 168 ? 51.496  -3.582  16.665  1.00 90.83  ? 168 SER H CB  1 
ATOM   5956 O OG  . SER D 4 168 ? 52.639  -4.412  16.505  1.00 103.04 ? 168 SER H OG  1 
ATOM   5957 N N   . GLY D 4 169 ? 52.086  -1.454  19.167  1.00 83.90  ? 169 GLY H N   1 
ATOM   5958 C CA  . GLY D 4 169 ? 52.759  -1.185  20.435  1.00 83.49  ? 169 GLY H CA  1 
ATOM   5959 C C   . GLY D 4 169 ? 53.308  0.218   20.615  1.00 85.69  ? 169 GLY H C   1 
ATOM   5960 O O   . GLY D 4 169 ? 53.852  0.541   21.685  1.00 85.11  ? 169 GLY H O   1 
ATOM   5961 N N   . VAL D 4 170 ? 53.162  1.060   19.572  1.00 80.28  ? 170 VAL H N   1 
ATOM   5962 C CA  . VAL D 4 170 ? 53.660  2.438   19.577  1.00 78.89  ? 170 VAL H CA  1 
ATOM   5963 C C   . VAL D 4 170 ? 52.711  3.350   20.353  1.00 82.89  ? 170 VAL H C   1 
ATOM   5964 O O   . VAL D 4 170 ? 51.496  3.161   20.320  1.00 81.85  ? 170 VAL H O   1 
ATOM   5965 C CB  . VAL D 4 170 ? 53.954  2.980   18.151  1.00 81.15  ? 170 VAL H CB  1 
ATOM   5966 C CG1 . VAL D 4 170 ? 54.743  4.279   18.203  1.00 80.48  ? 170 VAL H CG1 1 
ATOM   5967 C CG2 . VAL D 4 170 ? 54.681  1.948   17.299  1.00 80.64  ? 170 VAL H CG2 1 
ATOM   5968 N N   . HIS D 4 171 ? 53.284  4.327   21.055  1.00 80.54  ? 171 HIS H N   1 
ATOM   5969 C CA  . HIS D 4 171 ? 52.571  5.341   21.819  1.00 80.46  ? 171 HIS H CA  1 
ATOM   5970 C C   . HIS D 4 171 ? 53.285  6.646   21.623  1.00 80.97  ? 171 HIS H C   1 
ATOM   5971 O O   . HIS D 4 171 ? 54.392  6.819   22.125  1.00 80.55  ? 171 HIS H O   1 
ATOM   5972 C CB  . HIS D 4 171 ? 52.532  5.002   23.314  1.00 82.09  ? 171 HIS H CB  1 
ATOM   5973 C CG  . HIS D 4 171 ? 51.801  3.738   23.646  1.00 86.61  ? 171 HIS H CG  1 
ATOM   5974 N ND1 . HIS D 4 171 ? 50.420  3.651   23.547  1.00 88.87  ? 171 HIS H ND1 1 
ATOM   5975 C CD2 . HIS D 4 171 ? 52.281  2.561   24.116  1.00 89.04  ? 171 HIS H CD2 1 
ATOM   5976 C CE1 . HIS D 4 171 ? 50.109  2.428   23.945  1.00 88.63  ? 171 HIS H CE1 1 
ATOM   5977 N NE2 . HIS D 4 171 ? 51.195  1.743   24.320  1.00 88.99  ? 171 HIS H NE2 1 
ATOM   5978 N N   . THR D 4 172 ? 52.702  7.534   20.837  1.00 76.11  ? 172 THR H N   1 
ATOM   5979 C CA  . THR D 4 172 ? 53.269  8.865   20.642  1.00 75.89  ? 172 THR H CA  1 
ATOM   5980 C C   . THR D 4 172 ? 52.405  9.764   21.550  1.00 79.65  ? 172 THR H C   1 
ATOM   5981 O O   . THR D 4 172 ? 51.212  9.981   21.295  1.00 80.51  ? 172 THR H O   1 
ATOM   5982 C CB  . THR D 4 172 ? 53.311  9.260   19.166  1.00 85.91  ? 172 THR H CB  1 
ATOM   5983 O OG1 . THR D 4 172 ? 53.816  8.175   18.374  1.00 87.52  ? 172 THR H OG1 1 
ATOM   5984 C CG2 . THR D 4 172 ? 54.137  10.502  18.935  1.00 86.39  ? 172 THR H CG2 1 
ATOM   5985 N N   . PHE D 4 173 ? 52.988  10.170  22.681  1.00 73.34  ? 173 PHE H N   1 
ATOM   5986 C CA  . PHE D 4 173 ? 52.338  10.951  23.725  1.00 71.01  ? 173 PHE H CA  1 
ATOM   5987 C C   . PHE D 4 173 ? 51.946  12.366  23.309  1.00 75.41  ? 173 PHE H C   1 
ATOM   5988 O O   . PHE D 4 173 ? 52.608  12.958  22.448  1.00 74.66  ? 173 PHE H O   1 
ATOM   5989 C CB  . PHE D 4 173 ? 53.269  11.038  24.937  1.00 71.16  ? 173 PHE H CB  1 
ATOM   5990 C CG  . PHE D 4 173 ? 53.429  9.729   25.648  1.00 70.35  ? 173 PHE H CG  1 
ATOM   5991 C CD1 . PHE D 4 173 ? 52.464  9.288   26.540  1.00 71.84  ? 173 PHE H CD1 1 
ATOM   5992 C CD2 . PHE D 4 173 ? 54.569  8.960   25.466  1.00 69.89  ? 173 PHE H CD2 1 
ATOM   5993 C CE1 . PHE D 4 173 ? 52.606  8.076   27.191  1.00 72.01  ? 173 PHE H CE1 1 
ATOM   5994 C CE2 . PHE D 4 173 ? 54.729  7.768   26.142  1.00 72.02  ? 173 PHE H CE2 1 
ATOM   5995 C CZ  . PHE D 4 173 ? 53.737  7.322   26.986  1.00 70.65  ? 173 PHE H CZ  1 
ATOM   5996 N N   . PRO D 4 174 ? 50.927  12.969  23.963  1.00 72.22  ? 174 PRO H N   1 
ATOM   5997 C CA  . PRO D 4 174 ? 50.615  14.371  23.649  1.00 72.58  ? 174 PRO H CA  1 
ATOM   5998 C C   . PRO D 4 174 ? 51.781  15.291  24.016  1.00 77.07  ? 174 PRO H C   1 
ATOM   5999 O O   . PRO D 4 174 ? 52.476  15.060  25.017  1.00 76.89  ? 174 PRO H O   1 
ATOM   6000 C CB  . PRO D 4 174 ? 49.368  14.682  24.491  1.00 74.23  ? 174 PRO H CB  1 
ATOM   6001 C CG  . PRO D 4 174 ? 49.339  13.657  25.531  1.00 79.18  ? 174 PRO H CG  1 
ATOM   6002 C CD  . PRO D 4 174 ? 50.025  12.429  25.002  1.00 73.93  ? 174 PRO H CD  1 
ATOM   6003 N N   . ALA D 4 175 ? 52.010  16.313  23.169  1.00 72.64  ? 175 ALA H N   1 
ATOM   6004 C CA  . ALA D 4 175 ? 53.049  17.297  23.367  1.00 71.59  ? 175 ALA H CA  1 
ATOM   6005 C C   . ALA D 4 175 ? 52.800  18.085  24.628  1.00 78.59  ? 175 ALA H C   1 
ATOM   6006 O O   . ALA D 4 175 ? 51.643  18.429  24.952  1.00 77.11  ? 175 ALA H O   1 
ATOM   6007 C CB  . ALA D 4 175 ? 53.096  18.229  22.193  1.00 71.90  ? 175 ALA H CB  1 
ATOM   6008 N N   . VAL D 4 176 ? 53.895  18.352  25.362  1.00 78.21  ? 176 VAL H N   1 
ATOM   6009 C CA  . VAL D 4 176 ? 53.838  19.142  26.589  1.00 78.76  ? 176 VAL H CA  1 
ATOM   6010 C C   . VAL D 4 176 ? 54.716  20.373  26.418  1.00 83.84  ? 176 VAL H C   1 
ATOM   6011 O O   . VAL D 4 176 ? 55.944  20.250  26.357  1.00 84.60  ? 176 VAL H O   1 
ATOM   6012 C CB  . VAL D 4 176 ? 54.160  18.331  27.879  1.00 82.31  ? 176 VAL H CB  1 
ATOM   6013 C CG1 . VAL D 4 176 ? 54.351  19.250  29.076  1.00 82.00  ? 176 VAL H CG1 1 
ATOM   6014 C CG2 . VAL D 4 176 ? 53.060  17.328  28.180  1.00 82.21  ? 176 VAL H CG2 1 
ATOM   6015 N N   . LEU D 4 177 ? 54.086  21.555  26.338  1.00 80.12  ? 177 LEU H N   1 
ATOM   6016 C CA  . LEU D 4 177 ? 54.813  22.818  26.238  1.00 80.54  ? 177 LEU H CA  1 
ATOM   6017 C C   . LEU D 4 177 ? 55.652  22.988  27.503  1.00 88.00  ? 177 LEU H C   1 
ATOM   6018 O O   . LEU D 4 177 ? 55.191  22.681  28.599  1.00 88.81  ? 177 LEU H O   1 
ATOM   6019 C CB  . LEU D 4 177 ? 53.845  24.010  26.043  1.00 80.01  ? 177 LEU H CB  1 
ATOM   6020 C CG  . LEU D 4 177 ? 54.432  25.406  25.737  1.00 82.01  ? 177 LEU H CG  1 
ATOM   6021 C CD1 . LEU D 4 177 ? 54.900  25.533  24.282  1.00 80.86  ? 177 LEU H CD1 1 
ATOM   6022 C CD2 . LEU D 4 177 ? 53.393  26.445  25.973  1.00 81.91  ? 177 LEU H CD2 1 
ATOM   6023 N N   . GLN D 4 178 ? 56.899  23.400  27.332  1.00 85.95  ? 178 GLN H N   1 
ATOM   6024 C CA  . GLN D 4 178 ? 57.842  23.584  28.423  1.00 86.23  ? 178 GLN H CA  1 
ATOM   6025 C C   . GLN D 4 178 ? 57.976  25.064  28.792  1.00 90.08  ? 178 GLN H C   1 
ATOM   6026 O O   . GLN D 4 178 ? 57.429  25.926  28.086  1.00 89.02  ? 178 GLN H O   1 
ATOM   6027 C CB  . GLN D 4 178 ? 59.208  23.005  28.029  1.00 87.67  ? 178 GLN H CB  1 
ATOM   6028 C CG  . GLN D 4 178 ? 59.175  21.563  27.545  1.00 90.34  ? 178 GLN H CG  1 
ATOM   6029 C CD  . GLN D 4 178 ? 60.580  21.123  27.244  1.00 106.85 ? 178 GLN H CD  1 
ATOM   6030 O OE1 . GLN D 4 178 ? 61.103  21.327  26.132  1.00 97.70  ? 178 GLN H OE1 1 
ATOM   6031 N NE2 . GLN D 4 178 ? 61.227  20.527  28.244  1.00 101.75 ? 178 GLN H NE2 1 
ATOM   6032 N N   . SER D 4 179 ? 58.731  25.346  29.894  1.00 87.25  ? 179 SER H N   1 
ATOM   6033 C CA  . SER D 4 179 ? 58.998  26.690  30.462  1.00 87.31  ? 179 SER H CA  1 
ATOM   6034 C C   . SER D 4 179 ? 59.839  27.560  29.544  1.00 91.46  ? 179 SER H C   1 
ATOM   6035 O O   . SER D 4 179 ? 59.785  28.787  29.627  1.00 90.75  ? 179 SER H O   1 
ATOM   6036 C CB  . SER D 4 179 ? 59.673  26.576  31.827  1.00 90.91  ? 179 SER H CB  1 
ATOM   6037 O OG  . SER D 4 179 ? 60.833  25.765  31.745  1.00 101.39 ? 179 SER H OG  1 
ATOM   6038 N N   . SER D 4 180 ? 60.618  26.897  28.664  1.00 88.37  ? 180 SER H N   1 
ATOM   6039 C CA  . SER D 4 180 ? 61.497  27.466  27.641  1.00 87.22  ? 180 SER H CA  1 
ATOM   6040 C C   . SER D 4 180 ? 60.673  28.156  26.577  1.00 91.15  ? 180 SER H C   1 
ATOM   6041 O O   . SER D 4 180 ? 61.203  28.995  25.853  1.00 91.68  ? 180 SER H O   1 
ATOM   6042 C CB  . SER D 4 180 ? 62.326  26.359  26.987  1.00 88.88  ? 180 SER H CB  1 
ATOM   6043 O OG  . SER D 4 180 ? 61.552  25.244  26.564  1.00 91.59  ? 180 SER H OG  1 
ATOM   6044 N N   . GLY D 4 181 ? 59.400  27.773  26.487  1.00 87.31  ? 181 GLY H N   1 
ATOM   6045 C CA  . GLY D 4 181 ? 58.448  28.242  25.492  1.00 86.89  ? 181 GLY H CA  1 
ATOM   6046 C C   . GLY D 4 181 ? 58.324  27.267  24.332  1.00 90.86  ? 181 GLY H C   1 
ATOM   6047 O O   . GLY D 4 181 ? 57.538  27.510  23.413  1.00 90.87  ? 181 GLY H O   1 
ATOM   6048 N N   . LEU D 4 182 ? 59.097  26.152  24.362  1.00 86.71  ? 182 LEU H N   1 
ATOM   6049 C CA  . LEU D 4 182 ? 59.113  25.141  23.298  1.00 86.51  ? 182 LEU H CA  1 
ATOM   6050 C C   . LEU D 4 182 ? 58.420  23.860  23.731  1.00 91.66  ? 182 LEU H C   1 
ATOM   6051 O O   . LEU D 4 182 ? 58.351  23.568  24.927  1.00 93.42  ? 182 LEU H O   1 
ATOM   6052 C CB  . LEU D 4 182 ? 60.550  24.814  22.872  1.00 86.49  ? 182 LEU H CB  1 
ATOM   6053 C CG  . LEU D 4 182 ? 61.329  25.951  22.250  1.00 92.02  ? 182 LEU H CG  1 
ATOM   6054 C CD1 . LEU D 4 182 ? 62.365  26.468  23.208  1.00 93.08  ? 182 LEU H CD1 1 
ATOM   6055 C CD2 . LEU D 4 182 ? 61.979  25.528  20.952  1.00 94.26  ? 182 LEU H CD2 1 
ATOM   6056 N N   . TYR D 4 183 ? 57.939  23.079  22.757  1.00 85.24  ? 183 TYR H N   1 
ATOM   6057 C CA  . TYR D 4 183 ? 57.271  21.813  22.982  1.00 83.11  ? 183 TYR H CA  1 
ATOM   6058 C C   . TYR D 4 183 ? 58.280  20.676  23.111  1.00 86.20  ? 183 TYR H C   1 
ATOM   6059 O O   . TYR D 4 183 ? 59.435  20.818  22.732  1.00 85.82  ? 183 TYR H O   1 
ATOM   6060 C CB  . TYR D 4 183 ? 56.310  21.532  21.818  1.00 84.08  ? 183 TYR H CB  1 
ATOM   6061 C CG  . TYR D 4 183 ? 55.063  22.383  21.815  1.00 86.96  ? 183 TYR H CG  1 
ATOM   6062 C CD1 . TYR D 4 183 ? 54.000  22.095  22.670  1.00 89.06  ? 183 TYR H CD1 1 
ATOM   6063 C CD2 . TYR D 4 183 ? 54.935  23.473  20.959  1.00 88.54  ? 183 TYR H CD2 1 
ATOM   6064 C CE1 . TYR D 4 183 ? 52.858  22.889  22.698  1.00 90.89  ? 183 TYR H CE1 1 
ATOM   6065 C CE2 . TYR D 4 183 ? 53.793  24.274  20.972  1.00 89.89  ? 183 TYR H CE2 1 
ATOM   6066 C CZ  . TYR D 4 183 ? 52.754  23.975  21.840  1.00 99.07  ? 183 TYR H CZ  1 
ATOM   6067 O OH  . TYR D 4 183 ? 51.603  24.723  21.853  1.00 100.18 ? 183 TYR H OH  1 
ATOM   6068 N N   . SER D 4 184 ? 57.840  19.553  23.680  1.00 82.84  ? 184 SER H N   1 
ATOM   6069 C CA  . SER D 4 184 ? 58.588  18.303  23.820  1.00 81.99  ? 184 SER H CA  1 
ATOM   6070 C C   . SER D 4 184 ? 57.564  17.199  23.699  1.00 82.78  ? 184 SER H C   1 
ATOM   6071 O O   . SER D 4 184 ? 56.365  17.471  23.806  1.00 83.42  ? 184 SER H O   1 
ATOM   6072 C CB  . SER D 4 184 ? 59.337  18.215  25.147  1.00 87.32  ? 184 SER H CB  1 
ATOM   6073 O OG  . SER D 4 184 ? 59.777  16.890  25.421  1.00 98.59  ? 184 SER H OG  1 
ATOM   6074 N N   . LEU D 4 185 ? 58.037  15.958  23.480  1.00 76.04  ? 185 LEU H N   1 
ATOM   6075 C CA  . LEU D 4 185 ? 57.242  14.771  23.188  1.00 74.01  ? 185 LEU H CA  1 
ATOM   6076 C C   . LEU D 4 185 ? 58.163  13.530  23.240  1.00 75.93  ? 185 LEU H C   1 
ATOM   6077 O O   . LEU D 4 185 ? 59.382  13.656  23.286  1.00 74.59  ? 185 LEU H O   1 
ATOM   6078 C CB  . LEU D 4 185 ? 56.734  14.998  21.759  1.00 73.94  ? 185 LEU H CB  1 
ATOM   6079 C CG  . LEU D 4 185 ? 55.708  14.110  21.158  1.00 78.49  ? 185 LEU H CG  1 
ATOM   6080 C CD1 . LEU D 4 185 ? 54.507  14.914  20.750  1.00 77.86  ? 185 LEU H CD1 1 
ATOM   6081 C CD2 . LEU D 4 185 ? 56.299  13.430  19.934  1.00 82.23  ? 185 LEU H CD2 1 
ATOM   6082 N N   . SER D 4 186 ? 57.575  12.340  23.269  1.00 73.24  ? 186 SER H N   1 
ATOM   6083 C CA  . SER D 4 186 ? 58.306  11.074  23.307  1.00 73.49  ? 186 SER H CA  1 
ATOM   6084 C C   . SER D 4 186 ? 57.428  10.011  22.636  1.00 75.97  ? 186 SER H C   1 
ATOM   6085 O O   . SER D 4 186 ? 56.253  9.877   22.972  1.00 75.83  ? 186 SER H O   1 
ATOM   6086 C CB  . SER D 4 186 ? 58.630  10.637  24.748  1.00 78.26  ? 186 SER H CB  1 
ATOM   6087 O OG  . SER D 4 186 ? 59.289  11.584  25.583  1.00 87.14  ? 186 SER H OG  1 
ATOM   6088 N N   . SER D 4 187 ? 57.980  9.291   21.667  1.00 70.94  ? 187 SER H N   1 
ATOM   6089 C CA  . SER D 4 187 ? 57.259  8.203   21.028  1.00 70.19  ? 187 SER H CA  1 
ATOM   6090 C C   . SER D 4 187 ? 57.906  6.924   21.519  1.00 73.38  ? 187 SER H C   1 
ATOM   6091 O O   . SER D 4 187 ? 59.112  6.717   21.396  1.00 72.56  ? 187 SER H O   1 
ATOM   6092 C CB  . SER D 4 187 ? 57.301  8.306   19.512  1.00 73.39  ? 187 SER H CB  1 
ATOM   6093 O OG  . SER D 4 187 ? 56.491  7.300   18.928  1.00 79.85  ? 187 SER H OG  1 
ATOM   6094 N N   . VAL D 4 188 ? 57.122  6.126   22.193  1.00 70.13  ? 188 VAL H N   1 
ATOM   6095 C CA  . VAL D 4 188 ? 57.644  4.920   22.782  1.00 69.38  ? 188 VAL H CA  1 
ATOM   6096 C C   . VAL D 4 188 ? 57.049  3.711   22.091  1.00 76.98  ? 188 VAL H C   1 
ATOM   6097 O O   . VAL D 4 188 ? 55.891  3.747   21.671  1.00 77.69  ? 188 VAL H O   1 
ATOM   6098 C CB  . VAL D 4 188 ? 57.448  4.962   24.306  1.00 71.30  ? 188 VAL H CB  1 
ATOM   6099 C CG1 . VAL D 4 188 ? 56.043  4.530   24.719  1.00 70.84  ? 188 VAL H CG1 1 
ATOM   6100 C CG2 . VAL D 4 188 ? 58.520  4.161   25.018  1.00 70.74  ? 188 VAL H CG2 1 
ATOM   6101 N N   . VAL D 4 189 ? 57.865  2.681   21.897  1.00 74.61  ? 189 VAL H N   1 
ATOM   6102 C CA  . VAL D 4 189 ? 57.447  1.451   21.249  1.00 74.95  ? 189 VAL H CA  1 
ATOM   6103 C C   . VAL D 4 189 ? 58.008  0.258   22.013  1.00 82.92  ? 189 VAL H C   1 
ATOM   6104 O O   . VAL D 4 189 ? 59.211  0.159   22.268  1.00 82.54  ? 189 VAL H O   1 
ATOM   6105 C CB  . VAL D 4 189 ? 57.708  1.403   19.709  1.00 77.78  ? 189 VAL H CB  1 
ATOM   6106 C CG1 . VAL D 4 189 ? 59.175  1.636   19.355  1.00 77.07  ? 189 VAL H CG1 1 
ATOM   6107 C CG2 . VAL D 4 189 ? 57.208  0.098   19.099  1.00 77.57  ? 189 VAL H CG2 1 
ATOM   6108 N N   . THR D 4 190 ? 57.106  -0.618  22.426  1.00 82.55  ? 190 THR H N   1 
ATOM   6109 C CA  . THR D 4 190 ? 57.490  -1.847  23.095  1.00 83.15  ? 190 THR H CA  1 
ATOM   6110 C C   . THR D 4 190 ? 57.763  -2.816  21.963  1.00 89.96  ? 190 THR H C   1 
ATOM   6111 O O   . THR D 4 190 ? 57.109  -2.753  20.913  1.00 89.26  ? 190 THR H O   1 
ATOM   6112 C CB  . THR D 4 190 ? 56.441  -2.293  24.114  1.00 84.33  ? 190 THR H CB  1 
ATOM   6113 O OG1 . THR D 4 190 ? 55.180  -2.312  23.458  1.00 86.48  ? 190 THR H OG1 1 
ATOM   6114 C CG2 . THR D 4 190 ? 56.377  -1.369  25.338  1.00 77.26  ? 190 THR H CG2 1 
ATOM   6115 N N   . VAL D 4 191 ? 58.789  -3.650  22.149  1.00 89.02  ? 191 VAL H N   1 
ATOM   6116 C CA  . VAL D 4 191 ? 59.317  -4.603  21.173  1.00 89.89  ? 191 VAL H CA  1 
ATOM   6117 C C   . VAL D 4 191 ? 59.759  -5.929  21.871  1.00 96.44  ? 191 VAL H C   1 
ATOM   6118 O O   . VAL D 4 191 ? 60.093  -5.900  23.063  1.00 96.68  ? 191 VAL H O   1 
ATOM   6119 C CB  . VAL D 4 191 ? 60.490  -3.852  20.457  1.00 93.88  ? 191 VAL H CB  1 
ATOM   6120 C CG1 . VAL D 4 191 ? 61.769  -4.678  20.300  1.00 93.59  ? 191 VAL H CG1 1 
ATOM   6121 C CG2 . VAL D 4 191 ? 60.039  -3.225  19.145  1.00 93.54  ? 191 VAL H CG2 1 
ATOM   6122 N N   . PRO D 4 192 ? 59.789  -7.100  21.187  1.00 94.04  ? 192 PRO H N   1 
ATOM   6123 C CA  . PRO D 4 192 ? 60.294  -8.302  21.870  1.00 94.06  ? 192 PRO H CA  1 
ATOM   6124 C C   . PRO D 4 192 ? 61.807  -8.221  22.056  1.00 100.09 ? 192 PRO H C   1 
ATOM   6125 O O   . PRO D 4 192 ? 62.546  -7.948  21.103  1.00 99.41  ? 192 PRO H O   1 
ATOM   6126 C CB  . PRO D 4 192 ? 59.878  -9.456  20.961  1.00 95.57  ? 192 PRO H CB  1 
ATOM   6127 C CG  . PRO D 4 192 ? 59.603  -8.867  19.658  1.00 100.25 ? 192 PRO H CG  1 
ATOM   6128 C CD  . PRO D 4 192 ? 59.442  -7.376  19.778  1.00 95.84  ? 192 PRO H CD  1 
ATOM   6129 N N   . SER D 4 193 ? 62.253  -8.416  23.304  1.00 98.69  ? 193 SER H N   1 
ATOM   6130 C CA  . SER D 4 193 ? 63.656  -8.401  23.706  1.00 99.74  ? 193 SER H CA  1 
ATOM   6131 C C   . SER D 4 193 ? 64.612  -9.229  22.791  1.00 107.53 ? 193 SER H C   1 
ATOM   6132 O O   . SER D 4 193 ? 65.784  -8.854  22.648  1.00 107.85 ? 193 SER H O   1 
ATOM   6133 C CB  . SER D 4 193 ? 63.782  -8.838  25.162  1.00 103.13 ? 193 SER H CB  1 
ATOM   6134 O OG  . SER D 4 193 ? 63.039  -10.027 25.383  1.00 114.36 ? 193 SER H OG  1 
ATOM   6135 N N   . SER D 4 194 ? 64.108  -10.331 22.157  1.00 105.18 ? 194 SER H N   1 
ATOM   6136 C CA  . SER D 4 194 ? 64.879  -11.174 21.230  1.00 105.21 ? 194 SER H CA  1 
ATOM   6137 C C   . SER D 4 194 ? 65.299  -10.373 19.979  1.00 110.59 ? 194 SER H C   1 
ATOM   6138 O O   . SER D 4 194 ? 66.400  -10.576 19.452  1.00 109.51 ? 194 SER H O   1 
ATOM   6139 C CB  . SER D 4 194 ? 64.071  -12.406 20.820  1.00 108.22 ? 194 SER H CB  1 
ATOM   6140 O OG  . SER D 4 194 ? 63.343  -12.271 19.607  1.00 115.05 ? 194 SER H OG  1 
ATOM   6141 N N   . SER D 4 195 ? 64.414  -9.458  19.528  1.00 108.67 ? 195 SER H N   1 
ATOM   6142 C CA  . SER D 4 195 ? 64.638  -8.627  18.361  1.00 109.23 ? 195 SER H CA  1 
ATOM   6143 C C   . SER D 4 195 ? 65.338  -7.348  18.765  1.00 113.83 ? 195 SER H C   1 
ATOM   6144 O O   . SER D 4 195 ? 64.725  -6.283  18.777  1.00 114.65 ? 195 SER H O   1 
ATOM   6145 C CB  . SER D 4 195 ? 63.319  -8.352  17.638  1.00 113.69 ? 195 SER H CB  1 
ATOM   6146 O OG  . SER D 4 195 ? 62.441  -7.541  18.400  1.00 124.00 ? 195 SER H OG  1 
ATOM   6147 N N   . LEU D 4 196 ? 66.613  -7.441  19.144  1.00 109.79 ? 196 LEU H N   1 
ATOM   6148 C CA  . LEU D 4 196 ? 67.327  -6.237  19.567  1.00 109.17 ? 196 LEU H CA  1 
ATOM   6149 C C   . LEU D 4 196 ? 68.662  -6.093  18.893  1.00 115.44 ? 196 LEU H C   1 
ATOM   6150 O O   . LEU D 4 196 ? 68.979  -5.001  18.416  1.00 116.39 ? 196 LEU H O   1 
ATOM   6151 C CB  . LEU D 4 196 ? 67.451  -6.121  21.095  1.00 108.29 ? 196 LEU H CB  1 
ATOM   6152 C CG  . LEU D 4 196 ? 66.252  -5.542  21.835  1.00 111.20 ? 196 LEU H CG  1 
ATOM   6153 C CD1 . LEU D 4 196 ? 66.536  -5.456  23.286  1.00 111.30 ? 196 LEU H CD1 1 
ATOM   6154 C CD2 . LEU D 4 196 ? 65.901  -4.162  21.351  1.00 111.20 ? 196 LEU H CD2 1 
ATOM   6155 N N   . GLY D 4 197 ? 69.409  -7.182  18.838  1.00 111.96 ? 197 GLY H N   1 
ATOM   6156 C CA  . GLY D 4 197 ? 70.704  -7.227  18.168  1.00 111.74 ? 197 GLY H CA  1 
ATOM   6157 C C   . GLY D 4 197 ? 70.557  -7.687  16.731  1.00 114.01 ? 197 GLY H C   1 
ATOM   6158 O O   . GLY D 4 197 ? 71.558  -7.887  16.028  1.00 113.10 ? 197 GLY H O   1 
ATOM   6159 N N   . THR D 4 198 ? 69.281  -7.889  16.309  1.00 108.66 ? 198 THR H N   1 
ATOM   6160 C CA  . THR D 4 198 ? 68.895  -8.319  14.964  1.00 106.71 ? 198 THR H CA  1 
ATOM   6161 C C   . THR D 4 198 ? 68.099  -7.196  14.294  1.00 106.49 ? 198 THR H C   1 
ATOM   6162 O O   . THR D 4 198 ? 68.576  -6.650  13.289  1.00 105.48 ? 198 THR H O   1 
ATOM   6163 C CB  . THR D 4 198 ? 68.199  -9.719  14.947  1.00 108.02 ? 198 THR H CB  1 
ATOM   6164 O OG1 . THR D 4 198 ? 66.875  -9.639  15.486  1.00 107.61 ? 198 THR H OG1 1 
ATOM   6165 C CG2 . THR D 4 198 ? 69.005  -10.800 15.673  1.00 104.09 ? 198 THR H CG2 1 
ATOM   6166 N N   . GLN D 4 199 ? 66.920  -6.815  14.877  1.00 99.67  ? 199 GLN H N   1 
ATOM   6167 C CA  . GLN D 4 199 ? 66.054  -5.772  14.306  1.00 97.84  ? 199 GLN H CA  1 
ATOM   6168 C C   . GLN D 4 199 ? 66.546  -4.355  14.608  1.00 99.65  ? 199 GLN H C   1 
ATOM   6169 O O   . GLN D 4 199 ? 66.719  -3.974  15.778  1.00 99.22  ? 199 GLN H O   1 
ATOM   6170 C CB  . GLN D 4 199 ? 64.567  -5.955  14.695  1.00 98.52  ? 199 GLN H CB  1 
ATOM   6171 C CG  . GLN D 4 199 ? 63.555  -5.108  13.894  1.00 102.72 ? 199 GLN H CG  1 
ATOM   6172 C CD  . GLN D 4 199 ? 63.717  -5.149  12.388  1.00 126.16 ? 199 GLN H CD  1 
ATOM   6173 O OE1 . GLN D 4 199 ? 63.544  -6.186  11.732  1.00 123.63 ? 199 GLN H OE1 1 
ATOM   6174 N NE2 . GLN D 4 199 ? 64.041  -4.004  11.802  1.00 118.64 ? 199 GLN H NE2 1 
ATOM   6175 N N   . THR D 4 200 ? 66.792  -3.584  13.523  1.00 93.63  ? 200 THR H N   1 
ATOM   6176 C CA  . THR D 4 200 ? 67.235  -2.200  13.612  1.00 92.12  ? 200 THR H CA  1 
ATOM   6177 C C   . THR D 4 200 ? 65.986  -1.358  13.712  1.00 94.47  ? 200 THR H C   1 
ATOM   6178 O O   . THR D 4 200 ? 65.074  -1.511  12.884  1.00 93.79  ? 200 THR H O   1 
ATOM   6179 C CB  . THR D 4 200 ? 68.112  -1.789  12.423  1.00 99.06  ? 200 THR H CB  1 
ATOM   6180 O OG1 . THR D 4 200 ? 67.307  -1.682  11.249  1.00 100.69 ? 200 THR H OG1 1 
ATOM   6181 C CG2 . THR D 4 200 ? 69.304  -2.725  12.205  1.00 97.59  ? 200 THR H CG2 1 
ATOM   6182 N N   . TYR D 4 201 ? 65.914  -0.509  14.759  1.00 89.50  ? 201 TYR H N   1 
ATOM   6183 C CA  . TYR D 4 201 ? 64.757  0.351   14.976  1.00 87.79  ? 201 TYR H CA  1 
ATOM   6184 C C   . TYR D 4 201 ? 65.086  1.806   14.698  1.00 90.06  ? 201 TYR H C   1 
ATOM   6185 O O   . TYR D 4 201 ? 66.069  2.317   15.237  1.00 91.01  ? 201 TYR H O   1 
ATOM   6186 C CB  . TYR D 4 201 ? 64.182  0.154   16.375  1.00 87.65  ? 201 TYR H CB  1 
ATOM   6187 C CG  . TYR D 4 201 ? 63.660  -1.246  16.585  1.00 89.23  ? 201 TYR H CG  1 
ATOM   6188 C CD1 . TYR D 4 201 ? 62.400  -1.615  16.130  1.00 91.03  ? 201 TYR H CD1 1 
ATOM   6189 C CD2 . TYR D 4 201 ? 64.418  -2.203  17.254  1.00 90.22  ? 201 TYR H CD2 1 
ATOM   6190 C CE1 . TYR D 4 201 ? 61.910  -2.903  16.330  1.00 91.80  ? 201 TYR H CE1 1 
ATOM   6191 C CE2 . TYR D 4 201 ? 63.932  -3.490  17.470  1.00 90.82  ? 201 TYR H CE2 1 
ATOM   6192 C CZ  . TYR D 4 201 ? 62.678  -3.837  17.002  1.00 96.80  ? 201 TYR H CZ  1 
ATOM   6193 O OH  . TYR D 4 201 ? 62.191  -5.106  17.203  1.00 96.78  ? 201 TYR H OH  1 
ATOM   6194 N N   . ILE D 4 202 ? 64.303  2.450   13.810  1.00 83.13  ? 202 ILE H N   1 
ATOM   6195 C CA  . ILE D 4 202 ? 64.492  3.853   13.471  1.00 82.35  ? 202 ILE H CA  1 
ATOM   6196 C C   . ILE D 4 202 ? 63.200  4.588   13.699  1.00 87.02  ? 202 ILE H C   1 
ATOM   6197 O O   . ILE D 4 202 ? 62.155  4.077   13.298  1.00 85.94  ? 202 ILE H O   1 
ATOM   6198 C CB  . ILE D 4 202 ? 65.010  4.056   12.015  1.00 85.01  ? 202 ILE H CB  1 
ATOM   6199 C CG1 . ILE D 4 202 ? 66.392  3.488   11.849  1.00 85.62  ? 202 ILE H CG1 1 
ATOM   6200 C CG2 . ILE D 4 202 ? 65.027  5.524   11.619  1.00 85.45  ? 202 ILE H CG2 1 
ATOM   6201 C CD1 . ILE D 4 202 ? 66.495  2.704   10.648  1.00 98.48  ? 202 ILE H CD1 1 
ATOM   6202 N N   . CYS D 4 203 ? 63.267  5.790   14.328  1.00 85.00  ? 203 CYS H N   1 
ATOM   6203 C CA  . CYS D 4 203 ? 62.106  6.656   14.489  1.00 85.51  ? 203 CYS H CA  1 
ATOM   6204 C C   . CYS D 4 203 ? 62.169  7.826   13.534  1.00 91.76  ? 203 CYS H C   1 
ATOM   6205 O O   . CYS D 4 203 ? 63.137  8.581   13.512  1.00 91.20  ? 203 CYS H O   1 
ATOM   6206 C CB  . CYS D 4 203 ? 61.850  7.081   15.930  1.00 85.49  ? 203 CYS H CB  1 
ATOM   6207 S SG  . CYS D 4 203 ? 62.990  8.312   16.631  1.00 89.17  ? 203 CYS H SG  1 
ATOM   6208 N N   . ASN D 4 204 ? 61.169  7.902   12.677  1.00 89.94  ? 204 ASN H N   1 
ATOM   6209 C CA  . ASN D 4 204 ? 61.087  8.899   11.641  1.00 90.28  ? 204 ASN H CA  1 
ATOM   6210 C C   . ASN D 4 204 ? 60.160  9.997   12.109  1.00 94.30  ? 204 ASN H C   1 
ATOM   6211 O O   . ASN D 4 204 ? 58.932  9.834   12.189  1.00 92.35  ? 204 ASN H O   1 
ATOM   6212 C CB  . ASN D 4 204 ? 60.643  8.261   10.327  1.00 94.60  ? 204 ASN H CB  1 
ATOM   6213 C CG  . ASN D 4 204 ? 61.442  7.050   9.891   1.00 123.41 ? 204 ASN H CG  1 
ATOM   6214 O OD1 . ASN D 4 204 ? 61.771  6.159   10.678  1.00 112.94 ? 204 ASN H OD1 1 
ATOM   6215 N ND2 . ASN D 4 204 ? 61.746  6.977   8.606   1.00 123.55 ? 204 ASN H ND2 1 
ATOM   6216 N N   . VAL D 4 205 ? 60.797  11.110  12.474  1.00 92.41  ? 205 VAL H N   1 
ATOM   6217 C CA  . VAL D 4 205 ? 60.218  12.345  13.000  1.00 92.31  ? 205 VAL H CA  1 
ATOM   6218 C C   . VAL D 4 205 ? 60.181  13.391  11.907  1.00 97.48  ? 205 VAL H C   1 
ATOM   6219 O O   . VAL D 4 205 ? 61.208  13.668  11.283  1.00 97.43  ? 205 VAL H O   1 
ATOM   6220 C CB  . VAL D 4 205 ? 61.073  12.842  14.176  1.00 96.12  ? 205 VAL H CB  1 
ATOM   6221 C CG1 . VAL D 4 205 ? 60.647  14.230  14.624  1.00 95.94  ? 205 VAL H CG1 1 
ATOM   6222 C CG2 . VAL D 4 205 ? 61.019  11.852  15.327  1.00 96.32  ? 205 VAL H CG2 1 
ATOM   6223 N N   . ASN D 4 206 ? 59.006  13.974  11.675  1.00 94.43  ? 206 ASN H N   1 
ATOM   6224 C CA  . ASN D 4 206 ? 58.883  15.032  10.689  1.00 94.42  ? 206 ASN H CA  1 
ATOM   6225 C C   . ASN D 4 206 ? 58.047  16.187  11.231  1.00 97.74  ? 206 ASN H C   1 
ATOM   6226 O O   . ASN D 4 206 ? 56.946  16.006  11.769  1.00 95.25  ? 206 ASN H O   1 
ATOM   6227 C CB  . ASN D 4 206 ? 58.423  14.540  9.310   1.00 95.58  ? 206 ASN H CB  1 
ATOM   6228 C CG  . ASN D 4 206 ? 57.099  13.864  9.308   1.00 136.04 ? 206 ASN H CG  1 
ATOM   6229 O OD1 . ASN D 4 206 ? 56.968  12.709  9.725   1.00 138.51 ? 206 ASN H OD1 1 
ATOM   6230 N ND2 . ASN D 4 206 ? 56.087  14.574  8.838   1.00 131.65 ? 206 ASN H ND2 1 
ATOM   6231 N N   . HIS D 4 207 ? 58.656  17.377  11.138  1.00 95.81  ? 207 HIS H N   1 
ATOM   6232 C CA  . HIS D 4 207 ? 58.129  18.663  11.555  1.00 95.74  ? 207 HIS H CA  1 
ATOM   6233 C C   . HIS D 4 207 ? 58.028  19.552  10.294  1.00 101.10 ? 207 HIS H C   1 
ATOM   6234 O O   . HIS D 4 207 ? 58.985  20.227  9.897   1.00 100.99 ? 207 HIS H O   1 
ATOM   6235 C CB  . HIS D 4 207 ? 59.005  19.260  12.681  1.00 96.09  ? 207 HIS H CB  1 
ATOM   6236 C CG  . HIS D 4 207 ? 58.467  20.503  13.319  1.00 99.28  ? 207 HIS H CG  1 
ATOM   6237 N ND1 . HIS D 4 207 ? 59.307  21.534  13.700  1.00 101.24 ? 207 HIS H ND1 1 
ATOM   6238 C CD2 . HIS D 4 207 ? 57.198  20.828  13.659  1.00 101.09 ? 207 HIS H CD2 1 
ATOM   6239 C CE1 . HIS D 4 207 ? 58.525  22.476  14.198  1.00 100.39 ? 207 HIS H CE1 1 
ATOM   6240 N NE2 . HIS D 4 207 ? 57.248  22.094  14.210  1.00 101.27 ? 207 HIS H NE2 1 
ATOM   6241 N N   . LYS D 4 208 ? 56.863  19.446  9.632   1.00 97.67  ? 208 LYS H N   1 
ATOM   6242 C CA  . LYS D 4 208 ? 56.420  20.164  8.442   1.00 97.61  ? 208 LYS H CA  1 
ATOM   6243 C C   . LYS D 4 208 ? 56.566  21.733  8.592   1.00 102.33 ? 208 LYS H C   1 
ATOM   6244 O O   . LYS D 4 208 ? 57.142  22.342  7.679   1.00 100.67 ? 208 LYS H O   1 
ATOM   6245 C CB  . LYS D 4 208 ? 54.965  19.744  8.128   1.00 100.14 ? 208 LYS H CB  1 
ATOM   6246 C CG  . LYS D 4 208 ? 54.634  19.551  6.650   1.00 119.49 ? 208 LYS H CG  1 
ATOM   6247 C CD  . LYS D 4 208 ? 53.161  19.149  6.462   1.00 128.81 ? 208 LYS H CD  1 
ATOM   6248 C CE  . LYS D 4 208 ? 52.700  19.226  5.023   1.00 142.25 ? 208 LYS H CE  1 
ATOM   6249 N NZ  . LYS D 4 208 ? 51.342  18.638  4.847   1.00 148.01 ? 208 LYS H NZ  1 
ATOM   6250 N N   . PRO D 4 209 ? 56.124  22.411  9.708   1.00 100.72 ? 209 PRO H N   1 
ATOM   6251 C CA  . PRO D 4 209 ? 56.301  23.883  9.795   1.00 100.66 ? 209 PRO H CA  1 
ATOM   6252 C C   . PRO D 4 209 ? 57.725  24.403  9.617   1.00 105.55 ? 209 PRO H C   1 
ATOM   6253 O O   . PRO D 4 209 ? 57.868  25.558  9.225   1.00 106.15 ? 209 PRO H O   1 
ATOM   6254 C CB  . PRO D 4 209 ? 55.745  24.240  11.179  1.00 102.03 ? 209 PRO H CB  1 
ATOM   6255 C CG  . PRO D 4 209 ? 54.775  23.181  11.476  1.00 106.47 ? 209 PRO H CG  1 
ATOM   6256 C CD  . PRO D 4 209 ? 55.373  21.918  10.886  1.00 102.34 ? 209 PRO H CD  1 
ATOM   6257 N N   . SER D 4 210 ? 58.762  23.576  9.902   1.00 102.25 ? 210 SER H N   1 
ATOM   6258 C CA  . SER D 4 210 ? 60.183  23.928  9.712   1.00 102.89 ? 210 SER H CA  1 
ATOM   6259 C C   . SER D 4 210 ? 60.887  23.055  8.641   1.00 110.15 ? 210 SER H C   1 
ATOM   6260 O O   . SER D 4 210 ? 62.102  23.170  8.427   1.00 110.35 ? 210 SER H O   1 
ATOM   6261 C CB  . SER D 4 210 ? 60.949  23.888  11.028  1.00 105.41 ? 210 SER H CB  1 
ATOM   6262 O OG  . SER D 4 210 ? 60.658  22.729  11.781  1.00 111.53 ? 210 SER H OG  1 
ATOM   6263 N N   . ASN D 4 211 ? 60.094  22.192  7.964   1.00 107.63 ? 211 ASN H N   1 
ATOM   6264 C CA  . ASN D 4 211 ? 60.480  21.248  6.909   1.00 106.85 ? 211 ASN H CA  1 
ATOM   6265 C C   . ASN D 4 211 ? 61.590  20.298  7.364   1.00 110.19 ? 211 ASN H C   1 
ATOM   6266 O O   . ASN D 4 211 ? 62.377  19.814  6.553   1.00 110.58 ? 211 ASN H O   1 
ATOM   6267 C CB  . ASN D 4 211 ? 60.806  21.973  5.602   1.00 106.09 ? 211 ASN H CB  1 
ATOM   6268 C CG  . ASN D 4 211 ? 59.645  22.768  5.062   1.00 120.06 ? 211 ASN H CG  1 
ATOM   6269 O OD1 . ASN D 4 211 ? 59.401  23.912  5.471   1.00 111.94 ? 211 ASN H OD1 1 
ATOM   6270 N ND2 . ASN D 4 211 ? 58.897  22.167  4.145   1.00 107.93 ? 211 ASN H ND2 1 
ATOM   6271 N N   . THR D 4 212 ? 61.610  19.998  8.669   1.00 105.99 ? 212 THR H N   1 
ATOM   6272 C CA  . THR D 4 212 ? 62.564  19.088  9.297   1.00 105.31 ? 212 THR H CA  1 
ATOM   6273 C C   . THR D 4 212 ? 62.098  17.637  9.129   1.00 107.99 ? 212 THR H C   1 
ATOM   6274 O O   . THR D 4 212 ? 60.903  17.355  9.241   1.00 108.28 ? 212 THR H O   1 
ATOM   6275 C CB  . THR D 4 212 ? 62.678  19.386  10.807  1.00 108.28 ? 212 THR H CB  1 
ATOM   6276 O OG1 . THR D 4 212 ? 62.237  20.714  11.078  1.00 105.13 ? 212 THR H OG1 1 
ATOM   6277 C CG2 . THR D 4 212 ? 64.088  19.168  11.346  1.00 104.97 ? 212 THR H CG2 1 
ATOM   6278 N N   . LYS D 4 213 ? 63.039  16.728  8.869   1.00 102.28 ? 213 LYS H N   1 
ATOM   6279 C CA  . LYS D 4 213 ? 62.798  15.292  8.814   1.00 101.45 ? 213 LYS H CA  1 
ATOM   6280 C C   . LYS D 4 213 ? 64.025  14.662  9.410   1.00 104.38 ? 213 LYS H C   1 
ATOM   6281 O O   . LYS D 4 213 ? 65.119  14.832  8.898   1.00 104.23 ? 213 LYS H O   1 
ATOM   6282 C CB  . LYS D 4 213 ? 62.529  14.768  7.397   1.00 104.22 ? 213 LYS H CB  1 
ATOM   6283 C CG  . LYS D 4 213 ? 61.055  14.683  7.026   1.00 121.04 ? 213 LYS H CG  1 
ATOM   6284 C CD  . LYS D 4 213 ? 60.853  14.133  5.602   1.00 130.83 ? 213 LYS H CD  1 
ATOM   6285 C CE  . LYS D 4 213 ? 59.453  14.347  5.063   1.00 133.31 ? 213 LYS H CE  1 
ATOM   6286 N NZ  . LYS D 4 213 ? 59.321  13.872  3.659   1.00 133.12 ? 213 LYS H NZ  1 
ATOM   6287 N N   . VAL D 4 214 ? 63.873  14.040  10.563  1.00 100.84 ? 214 VAL H N   1 
ATOM   6288 C CA  . VAL D 4 214 ? 64.990  13.397  11.249  1.00 100.21 ? 214 VAL H CA  1 
ATOM   6289 C C   . VAL D 4 214 ? 64.656  11.916  11.450  1.00 100.55 ? 214 VAL H C   1 
ATOM   6290 O O   . VAL D 4 214 ? 63.522  11.573  11.800  1.00 99.72  ? 214 VAL H O   1 
ATOM   6291 C CB  . VAL D 4 214 ? 65.370  14.094  12.584  1.00 104.57 ? 214 VAL H CB  1 
ATOM   6292 C CG1 . VAL D 4 214 ? 66.693  13.546  13.129  1.00 104.59 ? 214 VAL H CG1 1 
ATOM   6293 C CG2 . VAL D 4 214 ? 65.447  15.613  12.421  1.00 104.39 ? 214 VAL H CG2 1 
ATOM   6294 N N   . ASP D 4 215 ? 65.632  11.050  11.170  1.00 93.98  ? 215 ASP H N   1 
ATOM   6295 C CA  . ASP D 4 215 ? 65.520  9.615   11.329  1.00 92.66  ? 215 ASP H CA  1 
ATOM   6296 C C   . ASP D 4 215 ? 66.597  9.256   12.354  1.00 95.51  ? 215 ASP H C   1 
ATOM   6297 O O   . ASP D 4 215 ? 67.765  9.601   12.146  1.00 95.46  ? 215 ASP H O   1 
ATOM   6298 C CB  . ASP D 4 215 ? 65.761  8.906   9.977   1.00 94.49  ? 215 ASP H CB  1 
ATOM   6299 C CG  . ASP D 4 215 ? 64.763  9.176   8.847   1.00 102.86 ? 215 ASP H CG  1 
ATOM   6300 O OD1 . ASP D 4 215 ? 63.926  10.082  8.992   1.00 103.57 ? 215 ASP H OD1 1 
ATOM   6301 O OD2 . ASP D 4 215 ? 64.832  8.479   7.817   1.00 109.23 ? 215 ASP H OD2 1 
ATOM   6302 N N   . LYS D 4 216 ? 66.202  8.650   13.500  1.00 91.10  ? 216 LYS H N   1 
ATOM   6303 C CA  . LYS D 4 216 ? 67.136  8.283   14.578  1.00 90.11  ? 216 LYS H CA  1 
ATOM   6304 C C   . LYS D 4 216 ? 67.177  6.774   14.865  1.00 95.02  ? 216 LYS H C   1 
ATOM   6305 O O   . LYS D 4 216 ? 66.206  6.222   15.402  1.00 94.11  ? 216 LYS H O   1 
ATOM   6306 C CB  . LYS D 4 216 ? 66.858  9.072   15.881  1.00 90.39  ? 216 LYS H CB  1 
ATOM   6307 C CG  . LYS D 4 216 ? 67.567  10.418  16.009  1.00 95.53  ? 216 LYS H CG  1 
ATOM   6308 C CD  . LYS D 4 216 ? 69.068  10.331  16.404  1.00 102.70 ? 216 LYS H CD  1 
ATOM   6309 C CE  . LYS D 4 216 ? 69.776  11.687  16.518  1.00 111.55 ? 216 LYS H CE  1 
ATOM   6310 N NZ  . LYS D 4 216 ? 69.719  12.516  15.268  1.00 115.33 ? 216 LYS H NZ  1 
ATOM   6311 N N   . ARG D 4 217 ? 68.319  6.112   14.530  1.00 91.36  ? 217 ARG H N   1 
ATOM   6312 C CA  . ARG D 4 217 ? 68.512  4.686   14.830  1.00 90.46  ? 217 ARG H CA  1 
ATOM   6313 C C   . ARG D 4 217 ? 68.650  4.510   16.375  1.00 92.04  ? 217 ARG H C   1 
ATOM   6314 O O   . ARG D 4 217 ? 69.616  4.999   16.977  1.00 92.07  ? 217 ARG H O   1 
ATOM   6315 C CB  . ARG D 4 217 ? 69.729  4.117   14.064  1.00 91.90  ? 217 ARG H CB  1 
ATOM   6316 C CG  . ARG D 4 217 ? 69.836  2.593   14.090  1.00 100.46 ? 217 ARG H CG  1 
ATOM   6317 C CD  . ARG D 4 217 ? 71.156  2.065   13.549  1.00 104.86 ? 217 ARG H CD  1 
ATOM   6318 N NE  . ARG D 4 217 ? 71.181  0.600   13.622  1.00 116.97 ? 217 ARG H NE  1 
ATOM   6319 C CZ  . ARG D 4 217 ? 72.256  -0.167  13.423  1.00 134.54 ? 217 ARG H CZ  1 
ATOM   6320 N NH1 . ARG D 4 217 ? 73.435  0.380   13.149  1.00 122.62 ? 217 ARG H NH1 1 
ATOM   6321 N NH2 . ARG D 4 217 ? 72.159  -1.490  13.511  1.00 120.30 ? 217 ARG H NH2 1 
ATOM   6322 N N   . VAL D 4 218 ? 67.647  3.865   17.006  1.00 85.79  ? 218 VAL H N   1 
ATOM   6323 C CA  . VAL D 4 218 ? 67.626  3.619   18.447  1.00 83.99  ? 218 VAL H CA  1 
ATOM   6324 C C   . VAL D 4 218 ? 68.425  2.341   18.785  1.00 86.97  ? 218 VAL H C   1 
ATOM   6325 O O   . VAL D 4 218 ? 67.844  1.265   18.920  1.00 87.34  ? 218 VAL H O   1 
ATOM   6326 C CB  . VAL D 4 218 ? 66.183  3.644   19.031  1.00 86.86  ? 218 VAL H CB  1 
ATOM   6327 C CG1 . VAL D 4 218 ? 66.178  3.425   20.549  1.00 86.16  ? 218 VAL H CG1 1 
ATOM   6328 C CG2 . VAL D 4 218 ? 65.493  4.961   18.691  1.00 86.58  ? 218 VAL H CG2 1 
ATOM   6329 N N   . GLU D 4 219 ? 69.766  2.475   18.909  1.00 82.44  ? 219 GLU H N   1 
ATOM   6330 C CA  . GLU D 4 219 ? 70.690  1.375   19.243  1.00 82.14  ? 219 GLU H CA  1 
ATOM   6331 C C   . GLU D 4 219 ? 70.647  1.067   20.751  1.00 84.19  ? 219 GLU H C   1 
ATOM   6332 O O   . GLU D 4 219 ? 70.468  1.994   21.539  1.00 84.27  ? 219 GLU H O   1 
ATOM   6333 C CB  . GLU D 4 219 ? 72.124  1.738   18.825  1.00 84.01  ? 219 GLU H CB  1 
ATOM   6334 C CG  . GLU D 4 219 ? 72.480  1.399   17.384  1.00 97.92  ? 219 GLU H CG  1 
ATOM   6335 C CD  . GLU D 4 219 ? 73.663  2.197   16.862  1.00 131.71 ? 219 GLU H CD  1 
ATOM   6336 O OE1 . GLU D 4 219 ? 74.610  2.445   17.645  1.00 144.69 ? 219 GLU H OE1 1 
ATOM   6337 O OE2 . GLU D 4 219 ? 73.639  2.586   15.671  1.00 122.44 ? 219 GLU H OE2 1 
ATOM   6338 N N   . PRO D 4 220 ? 70.857  -0.181  21.207  1.00 79.81  ? 220 PRO H N   1 
ATOM   6339 C CA  . PRO D 4 220 ? 70.745  -0.447  22.651  1.00 83.20  ? 220 PRO H CA  1 
ATOM   6340 C C   . PRO D 4 220 ? 72.058  -0.335  23.426  1.00 125.92 ? 220 PRO H C   1 
ATOM   6341 O O   . PRO D 4 220 ? 72.039  0.029   24.604  1.00 92.97  ? 220 PRO H O   1 
ATOM   6342 C CB  . PRO D 4 220 ? 70.135  -1.855  22.706  1.00 83.94  ? 220 PRO H CB  1 
ATOM   6343 C CG  . PRO D 4 220 ? 70.196  -2.405  21.229  1.00 86.83  ? 220 PRO H CG  1 
ATOM   6344 C CD  . PRO D 4 220 ? 71.049  -1.437  20.460  1.00 82.15  ? 220 PRO H CD  1 
ATOM   6345 N N   . ASP E 5 1   ? 21.211  32.186  16.777  1.00 116.31 ? 1   ASP L N   1 
ATOM   6346 C CA  . ASP E 5 1   ? 22.250  31.166  16.926  1.00 115.99 ? 1   ASP L CA  1 
ATOM   6347 C C   . ASP E 5 1   ? 21.861  30.134  18.005  1.00 117.84 ? 1   ASP L C   1 
ATOM   6348 O O   . ASP E 5 1   ? 22.085  30.369  19.198  1.00 117.55 ? 1   ASP L O   1 
ATOM   6349 C CB  . ASP E 5 1   ? 23.635  31.804  17.225  1.00 118.23 ? 1   ASP L CB  1 
ATOM   6350 C CG  . ASP E 5 1   ? 24.234  32.715  16.145  1.00 128.11 ? 1   ASP L CG  1 
ATOM   6351 O OD1 . ASP E 5 1   ? 23.450  33.348  15.385  1.00 130.13 ? 1   ASP L OD1 1 
ATOM   6352 O OD2 . ASP E 5 1   ? 25.489  32.808  16.070  1.00 127.06 ? 1   ASP L OD2 1 
ATOM   6353 N N   . ILE E 5 2   ? 21.251  28.999  17.560  1.00 112.08 ? 2   ILE L N   1 
ATOM   6354 C CA  . ILE E 5 2   ? 20.772  27.841  18.355  1.00 110.07 ? 2   ILE L CA  1 
ATOM   6355 C C   . ILE E 5 2   ? 21.903  27.245  19.198  1.00 111.68 ? 2   ILE L C   1 
ATOM   6356 O O   . ILE E 5 2   ? 23.002  27.049  18.688  1.00 109.93 ? 2   ILE L O   1 
ATOM   6357 C CB  . ILE E 5 2   ? 20.103  26.769  17.440  1.00 112.34 ? 2   ILE L CB  1 
ATOM   6358 C CG1 . ILE E 5 2   ? 18.798  27.301  16.807  1.00 111.57 ? 2   ILE L CG1 1 
ATOM   6359 C CG2 . ILE E 5 2   ? 19.861  25.449  18.195  1.00 113.67 ? 2   ILE L CG2 1 
ATOM   6360 C CD1 . ILE E 5 2   ? 18.285  26.534  15.579  1.00 113.59 ? 2   ILE L CD1 1 
ATOM   6361 N N   . GLN E 5 3   ? 21.634  26.976  20.485  1.00 108.07 ? 3   GLN L N   1 
ATOM   6362 C CA  . GLN E 5 3   ? 22.635  26.414  21.388  1.00 107.34 ? 3   GLN L CA  1 
ATOM   6363 C C   . GLN E 5 3   ? 22.349  24.937  21.637  1.00 110.04 ? 3   GLN L C   1 
ATOM   6364 O O   . GLN E 5 3   ? 21.241  24.576  22.045  1.00 109.82 ? 3   GLN L O   1 
ATOM   6365 C CB  . GLN E 5 3   ? 22.734  27.213  22.704  1.00 108.58 ? 3   GLN L CB  1 
ATOM   6366 C CG  . GLN E 5 3   ? 23.004  28.719  22.516  1.00 128.40 ? 3   GLN L CG  1 
ATOM   6367 C CD  . GLN E 5 3   ? 22.888  29.558  23.793  1.00 158.79 ? 3   GLN L CD  1 
ATOM   6368 O OE1 . GLN E 5 3   ? 22.065  29.308  24.696  1.00 151.39 ? 3   GLN L OE1 1 
ATOM   6369 N NE2 . GLN E 5 3   ? 23.704  30.603  23.887  1.00 156.36 ? 3   GLN L NE2 1 
ATOM   6370 N N   . MET E 5 4   ? 23.340  24.080  21.328  1.00 105.15 ? 4   MET L N   1 
ATOM   6371 C CA  . MET E 5 4   ? 23.266  22.625  21.505  1.00 104.06 ? 4   MET L CA  1 
ATOM   6372 C C   . MET E 5 4   ? 23.877  22.232  22.842  1.00 105.58 ? 4   MET L C   1 
ATOM   6373 O O   . MET E 5 4   ? 25.039  22.558  23.108  1.00 104.55 ? 4   MET L O   1 
ATOM   6374 C CB  . MET E 5 4   ? 23.991  21.877  20.375  1.00 106.31 ? 4   MET L CB  1 
ATOM   6375 C CG  . MET E 5 4   ? 23.498  22.205  18.990  1.00 110.10 ? 4   MET L CG  1 
ATOM   6376 S SD  . MET E 5 4   ? 21.703  22.118  18.793  1.00 114.16 ? 4   MET L SD  1 
ATOM   6377 C CE  . MET E 5 4   ? 21.427  20.394  19.007  1.00 110.69 ? 4   MET L CE  1 
ATOM   6378 N N   . THR E 5 5   ? 23.108  21.541  23.692  1.00 100.41 ? 5   THR L N   1 
ATOM   6379 C CA  . THR E 5 5   ? 23.632  21.126  24.984  1.00 99.34  ? 5   THR L CA  1 
ATOM   6380 C C   . THR E 5 5   ? 23.690  19.599  25.061  1.00 101.82 ? 5   THR L C   1 
ATOM   6381 O O   . THR E 5 5   ? 22.666  18.914  25.079  1.00 100.78 ? 5   THR L O   1 
ATOM   6382 C CB  . THR E 5 5   ? 22.908  21.817  26.141  1.00 106.16 ? 5   THR L CB  1 
ATOM   6383 O OG1 . THR E 5 5   ? 21.527  21.466  26.115  1.00 110.30 ? 5   THR L OG1 1 
ATOM   6384 C CG2 . THR E 5 5   ? 23.065  23.344  26.108  1.00 101.69 ? 5   THR L CG2 1 
ATOM   6385 N N   . GLN E 5 6   ? 24.925  19.088  25.053  1.00 98.76  ? 6   GLN L N   1 
ATOM   6386 C CA  . GLN E 5 6   ? 25.210  17.661  25.109  1.00 98.91  ? 6   GLN L CA  1 
ATOM   6387 C C   . GLN E 5 6   ? 25.377  17.170  26.544  1.00 103.67 ? 6   GLN L C   1 
ATOM   6388 O O   . GLN E 5 6   ? 25.867  17.915  27.405  1.00 104.14 ? 6   GLN L O   1 
ATOM   6389 C CB  . GLN E 5 6   ? 26.433  17.315  24.260  1.00 99.92  ? 6   GLN L CB  1 
ATOM   6390 C CG  . GLN E 5 6   ? 26.131  16.258  23.208  1.00 102.19 ? 6   GLN L CG  1 
ATOM   6391 C CD  . GLN E 5 6   ? 27.292  16.032  22.274  1.00 110.48 ? 6   GLN L CD  1 
ATOM   6392 O OE1 . GLN E 5 6   ? 27.933  16.969  21.777  1.00 106.45 ? 6   GLN L OE1 1 
ATOM   6393 N NE2 . GLN E 5 6   ? 27.576  14.773  22.001  1.00 94.10  ? 6   GLN L NE2 1 
ATOM   6394 N N   . SER E 5 7   ? 24.938  15.922  26.806  1.00 98.94  ? 7   SER L N   1 
ATOM   6395 C CA  . SER E 5 7   ? 25.060  15.337  28.142  1.00 98.06  ? 7   SER L CA  1 
ATOM   6396 C C   . SER E 5 7   ? 25.179  13.806  28.137  1.00 100.20 ? 7   SER L C   1 
ATOM   6397 O O   . SER E 5 7   ? 24.428  13.147  27.419  1.00 100.21 ? 7   SER L O   1 
ATOM   6398 C CB  . SER E 5 7   ? 23.923  15.793  29.053  1.00 101.55 ? 7   SER L CB  1 
ATOM   6399 O OG  . SER E 5 7   ? 22.769  16.180  28.324  1.00 111.03 ? 7   SER L OG  1 
ATOM   6400 N N   . PRO E 5 8   ? 26.092  13.195  28.925  1.00 94.84  ? 8   PRO L N   1 
ATOM   6401 C CA  . PRO E 5 8   ? 27.073  13.809  29.843  1.00 94.41  ? 8   PRO L CA  1 
ATOM   6402 C C   . PRO E 5 8   ? 28.353  14.299  29.151  1.00 98.51  ? 8   PRO L C   1 
ATOM   6403 O O   . PRO E 5 8   ? 28.550  13.994  27.991  1.00 98.92  ? 8   PRO L O   1 
ATOM   6404 C CB  . PRO E 5 8   ? 27.365  12.665  30.814  1.00 96.02  ? 8   PRO L CB  1 
ATOM   6405 C CG  . PRO E 5 8   ? 27.223  11.411  29.972  1.00 99.92  ? 8   PRO L CG  1 
ATOM   6406 C CD  . PRO E 5 8   ? 26.191  11.717  28.927  1.00 95.58  ? 8   PRO L CD  1 
ATOM   6407 N N   . SER E 5 9   ? 29.238  15.019  29.856  1.00 94.36  ? 9   SER L N   1 
ATOM   6408 C CA  . SER E 5 9   ? 30.515  15.478  29.288  1.00 94.38  ? 9   SER L CA  1 
ATOM   6409 C C   . SER E 5 9   ? 31.392  14.280  28.862  1.00 96.95  ? 9   SER L C   1 
ATOM   6410 O O   . SER E 5 9   ? 32.080  14.342  27.845  1.00 95.82  ? 9   SER L O   1 
ATOM   6411 C CB  . SER E 5 9   ? 31.274  16.327  30.303  1.00 99.37  ? 9   SER L CB  1 
ATOM   6412 O OG  . SER E 5 9   ? 31.854  15.532  31.328  1.00 110.80 ? 9   SER L OG  1 
ATOM   6413 N N   . SER E 5 10  ? 31.358  13.207  29.675  1.00 93.57  ? 10  SER L N   1 
ATOM   6414 C CA  . SER E 5 10  ? 32.085  11.947  29.511  1.00 92.86  ? 10  SER L CA  1 
ATOM   6415 C C   . SER E 5 10  ? 31.278  10.813  30.152  1.00 94.21  ? 10  SER L C   1 
ATOM   6416 O O   . SER E 5 10  ? 30.342  11.079  30.895  1.00 90.54  ? 10  SER L O   1 
ATOM   6417 C CB  . SER E 5 10  ? 33.463  12.034  30.172  1.00 96.54  ? 10  SER L CB  1 
ATOM   6418 O OG  . SER E 5 10  ? 33.390  12.252  31.573  1.00 108.08 ? 10  SER L OG  1 
ATOM   6419 N N   . LEU E 5 11  ? 31.657  9.559   29.879  1.00 92.74  ? 11  LEU L N   1 
ATOM   6420 C CA  . LEU E 5 11  ? 31.057  8.356   30.457  1.00 93.73  ? 11  LEU L CA  1 
ATOM   6421 C C   . LEU E 5 11  ? 31.960  7.136   30.270  1.00 98.03  ? 11  LEU L C   1 
ATOM   6422 O O   . LEU E 5 11  ? 32.631  7.007   29.240  1.00 96.90  ? 11  LEU L O   1 
ATOM   6423 C CB  . LEU E 5 11  ? 29.618  8.078   29.951  1.00 94.46  ? 11  LEU L CB  1 
ATOM   6424 C CG  . LEU E 5 11  ? 29.392  7.812   28.447  1.00 100.73 ? 11  LEU L CG  1 
ATOM   6425 C CD1 . LEU E 5 11  ? 29.558  6.336   28.132  1.00 101.27 ? 11  LEU L CD1 1 
ATOM   6426 C CD2 . LEU E 5 11  ? 27.985  8.209   28.024  1.00 104.32 ? 11  LEU L CD2 1 
ATOM   6427 N N   . SER E 5 12  ? 31.958  6.238   31.244  1.00 95.53  ? 12  SER L N   1 
ATOM   6428 C CA  . SER E 5 12  ? 32.750  5.012   31.142  1.00 95.57  ? 12  SER L CA  1 
ATOM   6429 C C   . SER E 5 12  ? 31.842  3.798   31.334  1.00 96.06  ? 12  SER L C   1 
ATOM   6430 O O   . SER E 5 12  ? 31.091  3.711   32.311  1.00 94.53  ? 12  SER L O   1 
ATOM   6431 C CB  . SER E 5 12  ? 33.954  5.018   32.088  1.00 102.15 ? 12  SER L CB  1 
ATOM   6432 O OG  . SER E 5 12  ? 33.630  5.411   33.416  1.00 120.26 ? 12  SER L OG  1 
ATOM   6433 N N   . ALA E 5 13  ? 31.894  2.890   30.366  1.00 90.80  ? 13  ALA L N   1 
ATOM   6434 C CA  . ALA E 5 13  ? 31.097  1.662   30.327  1.00 89.43  ? 13  ALA L CA  1 
ATOM   6435 C C   . ALA E 5 13  ? 31.957  0.466   29.968  1.00 93.75  ? 13  ALA L C   1 
ATOM   6436 O O   . ALA E 5 13  ? 33.000  0.617   29.338  1.00 91.69  ? 13  ALA L O   1 
ATOM   6437 C CB  . ALA E 5 13  ? 29.987  1.820   29.316  1.00 89.70  ? 13  ALA L CB  1 
ATOM   6438 N N   . SER E 5 14  ? 31.520  -0.727  30.372  1.00 93.32  ? 14  SER L N   1 
ATOM   6439 C CA  . SER E 5 14  ? 32.192  -2.002  30.084  1.00 94.54  ? 14  SER L CA  1 
ATOM   6440 C C   . SER E 5 14  ? 31.934  -2.399  28.626  1.00 100.67 ? 14  SER L C   1 
ATOM   6441 O O   . SER E 5 14  ? 31.014  -1.867  28.015  1.00 99.18  ? 14  SER L O   1 
ATOM   6442 C CB  . SER E 5 14  ? 31.655  -3.090  31.017  1.00 99.48  ? 14  SER L CB  1 
ATOM   6443 O OG  . SER E 5 14  ? 31.733  -2.719  32.387  1.00 108.10 ? 14  SER L OG  1 
ATOM   6444 N N   . VAL E 5 15  ? 32.733  -3.316  28.059  1.00 101.20 ? 15  VAL L N   1 
ATOM   6445 C CA  . VAL E 5 15  ? 32.481  -3.755  26.684  1.00 102.79 ? 15  VAL L CA  1 
ATOM   6446 C C   . VAL E 5 15  ? 31.179  -4.558  26.624  1.00 111.64 ? 15  VAL L C   1 
ATOM   6447 O O   . VAL E 5 15  ? 30.862  -5.325  27.536  1.00 110.29 ? 15  VAL L O   1 
ATOM   6448 C CB  . VAL E 5 15  ? 33.654  -4.459  25.968  1.00 106.48 ? 15  VAL L CB  1 
ATOM   6449 C CG1 . VAL E 5 15  ? 34.844  -3.526  25.833  1.00 106.60 ? 15  VAL L CG1 1 
ATOM   6450 C CG2 . VAL E 5 15  ? 34.047  -5.751  26.671  1.00 106.21 ? 15  VAL L CG2 1 
ATOM   6451 N N   . GLY E 5 16  ? 30.422  -4.307  25.572  1.00 112.71 ? 16  GLY L N   1 
ATOM   6452 C CA  . GLY E 5 16  ? 29.120  -4.903  25.331  1.00 113.28 ? 16  GLY L CA  1 
ATOM   6453 C C   . GLY E 5 16  ? 28.024  -4.172  26.066  1.00 119.08 ? 16  GLY L C   1 
ATOM   6454 O O   . GLY E 5 16  ? 27.017  -4.795  26.395  1.00 120.65 ? 16  GLY L O   1 
ATOM   6455 N N   . ASP E 5 17  ? 28.201  -2.861  26.345  1.00 115.49 ? 17  ASP L N   1 
ATOM   6456 C CA  . ASP E 5 17  ? 27.212  -2.067  27.081  1.00 116.26 ? 17  ASP L CA  1 
ATOM   6457 C C   . ASP E 5 17  ? 26.431  -1.115  26.182  1.00 119.60 ? 17  ASP L C   1 
ATOM   6458 O O   . ASP E 5 17  ? 26.987  -0.587  25.218  1.00 120.28 ? 17  ASP L O   1 
ATOM   6459 C CB  . ASP E 5 17  ? 27.895  -1.251  28.197  1.00 119.30 ? 17  ASP L CB  1 
ATOM   6460 C CG  . ASP E 5 17  ? 28.223  -1.982  29.500  1.00 136.68 ? 17  ASP L CG  1 
ATOM   6461 O OD1 . ASP E 5 17  ? 28.591  -3.187  29.441  1.00 137.20 ? 17  ASP L OD1 1 
ATOM   6462 O OD2 . ASP E 5 17  ? 28.155  -1.336  30.578  1.00 138.97 ? 17  ASP L OD2 1 
ATOM   6463 N N   . ARG E 5 18  ? 25.150  -0.866  26.523  1.00 114.85 ? 18  ARG L N   1 
ATOM   6464 C CA  . ARG E 5 18  ? 24.277  0.090   25.835  1.00 114.20 ? 18  ARG L CA  1 
ATOM   6465 C C   . ARG E 5 18  ? 24.650  1.482   26.340  1.00 116.05 ? 18  ARG L C   1 
ATOM   6466 O O   . ARG E 5 18  ? 24.575  1.746   27.540  1.00 115.95 ? 18  ARG L O   1 
ATOM   6467 C CB  . ARG E 5 18  ? 22.774  -0.196  26.100  1.00 116.12 ? 18  ARG L CB  1 
ATOM   6468 C CG  . ARG E 5 18  ? 22.068  -0.992  25.009  1.00 134.03 ? 18  ARG L CG  1 
ATOM   6469 C CD  . ARG E 5 18  ? 20.710  -1.503  25.427  1.00 156.61 ? 18  ARG L CD  1 
ATOM   6470 N NE  . ARG E 5 18  ? 20.516  -2.908  25.030  1.00 182.51 ? 18  ARG L NE  1 
ATOM   6471 C CZ  . ARG E 5 18  ? 19.446  -3.635  25.350  1.00 212.29 ? 18  ARG L CZ  1 
ATOM   6472 N NH1 . ARG E 5 18  ? 18.471  -3.120  26.089  1.00 205.58 ? 18  ARG L NH1 1 
ATOM   6473 N NH2 . ARG E 5 18  ? 19.353  -4.902  24.952  1.00 201.91 ? 18  ARG L NH2 1 
ATOM   6474 N N   . VAL E 5 19  ? 25.082  2.356   25.438  1.00 111.08 ? 19  VAL L N   1 
ATOM   6475 C CA  . VAL E 5 19  ? 25.474  3.717   25.808  1.00 110.40 ? 19  VAL L CA  1 
ATOM   6476 C C   . VAL E 5 19  ? 24.474  4.704   25.211  1.00 115.35 ? 19  VAL L C   1 
ATOM   6477 O O   . VAL E 5 19  ? 24.076  4.541   24.061  1.00 114.53 ? 19  VAL L O   1 
ATOM   6478 C CB  . VAL E 5 19  ? 26.951  3.990   25.407  1.00 113.36 ? 19  VAL L CB  1 
ATOM   6479 C CG1 . VAL E 5 19  ? 27.280  5.486   25.365  1.00 112.88 ? 19  VAL L CG1 1 
ATOM   6480 C CG2 . VAL E 5 19  ? 27.907  3.248   26.336  1.00 112.91 ? 19  VAL L CG2 1 
ATOM   6481 N N   . THR E 5 20  ? 24.042  5.696   26.002  1.00 112.87 ? 20  THR L N   1 
ATOM   6482 C CA  . THR E 5 20  ? 23.086  6.707   25.555  1.00 112.57 ? 20  THR L CA  1 
ATOM   6483 C C   . THR E 5 20  ? 23.583  8.134   25.843  1.00 116.20 ? 20  THR L C   1 
ATOM   6484 O O   . THR E 5 20  ? 23.729  8.526   27.003  1.00 117.52 ? 20  THR L O   1 
ATOM   6485 C CB  . THR E 5 20  ? 21.699  6.423   26.143  1.00 118.17 ? 20  THR L CB  1 
ATOM   6486 O OG1 . THR E 5 20  ? 21.333  5.081   25.835  1.00 116.24 ? 20  THR L OG1 1 
ATOM   6487 C CG2 . THR E 5 20  ? 20.635  7.368   25.624  1.00 116.14 ? 20  THR L CG2 1 
ATOM   6488 N N   . ILE E 5 21  ? 23.815  8.906   24.779  1.00 109.84 ? 21  ILE L N   1 
ATOM   6489 C CA  . ILE E 5 21  ? 24.221  10.306  24.854  1.00 108.15 ? 21  ILE L CA  1 
ATOM   6490 C C   . ILE E 5 21  ? 22.957  11.166  24.613  1.00 110.53 ? 21  ILE L C   1 
ATOM   6491 O O   . ILE E 5 21  ? 22.153  10.838  23.752  1.00 109.91 ? 21  ILE L O   1 
ATOM   6492 C CB  . ILE E 5 21  ? 25.375  10.610  23.842  1.00 110.35 ? 21  ILE L CB  1 
ATOM   6493 C CG1 . ILE E 5 21  ? 26.625  9.781   24.167  1.00 110.52 ? 21  ILE L CG1 1 
ATOM   6494 C CG2 . ILE E 5 21  ? 25.720  12.096  23.807  1.00 110.38 ? 21  ILE L CG2 1 
ATOM   6495 C CD1 . ILE E 5 21  ? 27.600  9.621   23.046  1.00 117.82 ? 21  ILE L CD1 1 
ATOM   6496 N N   . THR E 5 22  ? 22.784  12.236  25.375  1.00 106.27 ? 22  THR L N   1 
ATOM   6497 C CA  . THR E 5 22  ? 21.678  13.168  25.220  1.00 106.35 ? 22  THR L CA  1 
ATOM   6498 C C   . THR E 5 22  ? 22.163  14.453  24.568  1.00 111.25 ? 22  THR L C   1 
ATOM   6499 O O   . THR E 5 22  ? 23.316  14.843  24.753  1.00 111.15 ? 22  THR L O   1 
ATOM   6500 C CB  . THR E 5 22  ? 20.916  13.411  26.538  1.00 121.09 ? 22  THR L CB  1 
ATOM   6501 O OG1 . THR E 5 22  ? 21.775  13.506  27.678  1.00 127.96 ? 22  THR L OG1 1 
ATOM   6502 C CG2 . THR E 5 22  ? 19.849  12.373  26.787  1.00 119.05 ? 22  THR L CG2 1 
ATOM   6503 N N   . CYS E 5 23  ? 21.278  15.093  23.795  1.00 108.39 ? 23  CYS L N   1 
ATOM   6504 C CA  . CYS E 5 23  ? 21.519  16.340  23.071  1.00 108.01 ? 23  CYS L CA  1 
ATOM   6505 C C   . CYS E 5 23  ? 20.224  17.155  23.073  1.00 112.76 ? 23  CYS L C   1 
ATOM   6506 O O   . CYS E 5 23  ? 19.166  16.638  22.709  1.00 111.39 ? 23  CYS L O   1 
ATOM   6507 C CB  . CYS E 5 23  ? 22.015  16.054  21.652  1.00 107.90 ? 23  CYS L CB  1 
ATOM   6508 S SG  . CYS E 5 23  ? 22.511  17.531  20.715  1.00 111.26 ? 23  CYS L SG  1 
ATOM   6509 N N   . ARG E 5 24  ? 20.309  18.419  23.521  1.00 111.21 ? 24  ARG L N   1 
ATOM   6510 C CA  . ARG E 5 24  ? 19.169  19.340  23.588  1.00 111.74 ? 24  ARG L CA  1 
ATOM   6511 C C   . ARG E 5 24  ? 19.423  20.641  22.800  1.00 117.77 ? 24  ARG L C   1 
ATOM   6512 O O   . ARG E 5 24  ? 20.481  21.258  22.960  1.00 117.86 ? 24  ARG L O   1 
ATOM   6513 C CB  . ARG E 5 24  ? 18.811  19.652  25.052  1.00 112.15 ? 24  ARG L CB  1 
ATOM   6514 C CG  . ARG E 5 24  ? 17.486  20.385  25.242  1.00 122.81 ? 24  ARG L CG  1 
ATOM   6515 C CD  . ARG E 5 24  ? 17.456  21.086  26.577  1.00 132.01 ? 24  ARG L CD  1 
ATOM   6516 N NE  . ARG E 5 24  ? 16.109  21.546  26.910  1.00 149.75 ? 24  ARG L NE  1 
ATOM   6517 C CZ  . ARG E 5 24  ? 15.217  20.831  27.591  1.00 172.05 ? 24  ARG L CZ  1 
ATOM   6518 N NH1 . ARG E 5 24  ? 15.512  19.608  28.014  1.00 163.21 ? 24  ARG L NH1 1 
ATOM   6519 N NH2 . ARG E 5 24  ? 14.015  21.335  27.849  1.00 160.41 ? 24  ARG L NH2 1 
ATOM   6520 N N   . ALA E 5 25  ? 18.440  21.065  21.966  1.00 114.50 ? 25  ALA L N   1 
ATOM   6521 C CA  . ALA E 5 25  ? 18.529  22.307  21.172  1.00 113.75 ? 25  ALA L CA  1 
ATOM   6522 C C   . ALA E 5 25  ? 17.696  23.431  21.812  1.00 117.15 ? 25  ALA L C   1 
ATOM   6523 O O   . ALA E 5 25  ? 16.669  23.139  22.434  1.00 115.42 ? 25  ALA L O   1 
ATOM   6524 C CB  . ALA E 5 25  ? 18.059  22.055  19.752  1.00 114.31 ? 25  ALA L CB  1 
ATOM   6525 N N   . SER E 5 26  ? 18.136  24.714  21.671  1.00 113.98 ? 26  SER L N   1 
ATOM   6526 C CA  . SER E 5 26  ? 17.405  25.865  22.243  1.00 113.30 ? 26  SER L CA  1 
ATOM   6527 C C   . SER E 5 26  ? 16.040  26.047  21.556  1.00 117.21 ? 26  SER L C   1 
ATOM   6528 O O   . SER E 5 26  ? 15.067  26.466  22.180  1.00 115.23 ? 26  SER L O   1 
ATOM   6529 C CB  . SER E 5 26  ? 18.192  27.164  22.074  1.00 115.84 ? 26  SER L CB  1 
ATOM   6530 O OG  . SER E 5 26  ? 19.538  27.152  22.503  1.00 123.27 ? 26  SER L OG  1 
ATOM   6531 N N   . GLN E 5 27  ? 16.007  25.755  20.250  1.00 115.98 ? 27  GLN L N   1 
ATOM   6532 C CA  . GLN E 5 27  ? 14.853  25.910  19.374  1.00 116.20 ? 27  GLN L CA  1 
ATOM   6533 C C   . GLN E 5 27  ? 14.510  24.580  18.764  1.00 121.15 ? 27  GLN L C   1 
ATOM   6534 O O   . GLN E 5 27  ? 15.345  23.679  18.772  1.00 120.68 ? 27  GLN L O   1 
ATOM   6535 C CB  . GLN E 5 27  ? 15.207  26.923  18.265  1.00 117.29 ? 27  GLN L CB  1 
ATOM   6536 C CG  . GLN E 5 27  ? 15.596  28.281  18.842  1.00 130.76 ? 27  GLN L CG  1 
ATOM   6537 C CD  . GLN E 5 27  ? 16.010  29.301  17.818  1.00 146.64 ? 27  GLN L CD  1 
ATOM   6538 O OE1 . GLN E 5 27  ? 15.493  29.346  16.700  1.00 142.17 ? 27  GLN L OE1 1 
ATOM   6539 N NE2 . GLN E 5 27  ? 16.960  30.153  18.188  1.00 137.12 ? 27  GLN L NE2 1 
ATOM   6540 N N   . ASP E 5 28  ? 13.270  24.438  18.259  1.00 118.51 ? 28  ASP L N   1 
ATOM   6541 C CA  . ASP E 5 28  ? 12.809  23.242  17.553  1.00 118.27 ? 28  ASP L CA  1 
ATOM   6542 C C   . ASP E 5 28  ? 13.607  23.197  16.246  1.00 121.48 ? 28  ASP L C   1 
ATOM   6543 O O   . ASP E 5 28  ? 13.577  24.146  15.450  1.00 121.01 ? 28  ASP L O   1 
ATOM   6544 C CB  . ASP E 5 28  ? 11.278  23.291  17.313  1.00 120.33 ? 28  ASP L CB  1 
ATOM   6545 C CG  . ASP E 5 28  ? 10.666  22.327  16.289  1.00 131.12 ? 28  ASP L CG  1 
ATOM   6546 O OD1 . ASP E 5 28  ? 11.344  21.340  15.903  1.00 131.37 ? 28  ASP L OD1 1 
ATOM   6547 O OD2 . ASP E 5 28  ? 9.508   22.561  15.872  1.00 138.45 ? 28  ASP L OD2 1 
ATOM   6548 N N   . ILE E 5 29  ? 14.399  22.137  16.100  1.00 117.10 ? 29  ILE L N   1 
ATOM   6549 C CA  . ILE E 5 29  ? 15.272  21.950  14.950  1.00 116.01 ? 29  ILE L CA  1 
ATOM   6550 C C   . ILE E 5 29  ? 14.733  20.840  14.039  1.00 119.36 ? 29  ILE L C   1 
ATOM   6551 O O   . ILE E 5 29  ? 15.392  20.448  13.071  1.00 119.10 ? 29  ILE L O   1 
ATOM   6552 C CB  . ILE E 5 29  ? 16.758  21.764  15.390  1.00 118.41 ? 29  ILE L CB  1 
ATOM   6553 C CG1 . ILE E 5 29  ? 16.949  20.536  16.304  1.00 118.28 ? 29  ILE L CG1 1 
ATOM   6554 C CG2 . ILE E 5 29  ? 17.302  23.049  16.039  1.00 118.11 ? 29  ILE L CG2 1 
ATOM   6555 C CD1 . ILE E 5 29  ? 18.315  19.939  16.270  1.00 125.07 ? 29  ILE L CD1 1 
ATOM   6556 N N   . SER E 5 30  ? 13.488  20.394  14.321  1.00 115.47 ? 30  SER L N   1 
ATOM   6557 C CA  . SER E 5 30  ? 12.768  19.344  13.594  1.00 115.09 ? 30  SER L CA  1 
ATOM   6558 C C   . SER E 5 30  ? 13.545  18.031  13.763  1.00 115.53 ? 30  SER L C   1 
ATOM   6559 O O   . SER E 5 30  ? 13.584  17.470  14.868  1.00 115.45 ? 30  SER L O   1 
ATOM   6560 C CB  . SER E 5 30  ? 12.563  19.737  12.124  1.00 119.94 ? 30  SER L CB  1 
ATOM   6561 O OG  . SER E 5 30  ? 11.989  18.711  11.331  1.00 131.04 ? 30  SER L OG  1 
ATOM   6562 N N   . ASN E 5 31  ? 14.187  17.580  12.687  1.00 108.36 ? 31  ASN L N   1 
ATOM   6563 C CA  . ASN E 5 31  ? 15.019  16.386  12.657  1.00 106.70 ? 31  ASN L CA  1 
ATOM   6564 C C   . ASN E 5 31  ? 16.393  16.685  12.073  1.00 105.94 ? 31  ASN L C   1 
ATOM   6565 O O   . ASN E 5 31  ? 17.173  15.759  11.857  1.00 103.58 ? 31  ASN L O   1 
ATOM   6566 C CB  . ASN E 5 31  ? 14.328  15.268  11.887  1.00 107.66 ? 31  ASN L CB  1 
ATOM   6567 C CG  . ASN E 5 31  ? 13.213  14.650  12.655  1.00 127.73 ? 31  ASN L CG  1 
ATOM   6568 O OD1 . ASN E 5 31  ? 12.091  15.151  12.649  1.00 123.17 ? 31  ASN L OD1 1 
ATOM   6569 N ND2 . ASN E 5 31  ? 13.508  13.555  13.343  1.00 120.83 ? 31  ASN L ND2 1 
ATOM   6570 N N   . TYR E 5 32  ? 16.692  17.976  11.827  1.00 101.08 ? 32  TYR L N   1 
ATOM   6571 C CA  . TYR E 5 32  ? 17.969  18.403  11.274  1.00 100.50 ? 32  TYR L CA  1 
ATOM   6572 C C   . TYR E 5 32  ? 19.090  18.326  12.316  1.00 102.82 ? 32  TYR L C   1 
ATOM   6573 O O   . TYR E 5 32  ? 19.671  19.345  12.706  1.00 101.72 ? 32  TYR L O   1 
ATOM   6574 C CB  . TYR E 5 32  ? 17.875  19.779  10.610  1.00 101.98 ? 32  TYR L CB  1 
ATOM   6575 C CG  . TYR E 5 32  ? 16.813  19.874  9.546   1.00 104.52 ? 32  TYR L CG  1 
ATOM   6576 C CD1 . TYR E 5 32  ? 17.058  19.429  8.255   1.00 106.26 ? 32  TYR L CD1 1 
ATOM   6577 C CD2 . TYR E 5 32  ? 15.598  20.496  9.799   1.00 106.25 ? 32  TYR L CD2 1 
ATOM   6578 C CE1 . TYR E 5 32  ? 16.094  19.556  7.251   1.00 107.23 ? 32  TYR L CE1 1 
ATOM   6579 C CE2 . TYR E 5 32  ? 14.632  20.633  8.807   1.00 107.64 ? 32  TYR L CE2 1 
ATOM   6580 C CZ  . TYR E 5 32  ? 14.881  20.156  7.535   1.00 115.72 ? 32  TYR L CZ  1 
ATOM   6581 O OH  . TYR E 5 32  ? 13.920  20.282  6.567   1.00 118.74 ? 32  TYR L OH  1 
ATOM   6582 N N   . LEU E 5 33  ? 19.394  17.085  12.753  1.00 98.50  ? 33  LEU L N   1 
ATOM   6583 C CA  . LEU E 5 33  ? 20.442  16.767  13.708  1.00 97.93  ? 33  LEU L CA  1 
ATOM   6584 C C   . LEU E 5 33  ? 21.388  15.682  13.178  1.00 103.03 ? 33  LEU L C   1 
ATOM   6585 O O   . LEU E 5 33  ? 20.937  14.676  12.624  1.00 104.33 ? 33  LEU L O   1 
ATOM   6586 C CB  . LEU E 5 33  ? 19.846  16.354  15.051  1.00 97.62  ? 33  LEU L CB  1 
ATOM   6587 C CG  . LEU E 5 33  ? 20.882  16.177  16.175  1.00 101.51 ? 33  LEU L CG  1 
ATOM   6588 C CD1 . LEU E 5 33  ? 20.967  17.388  17.068  1.00 100.53 ? 33  LEU L CD1 1 
ATOM   6589 C CD2 . LEU E 5 33  ? 20.632  14.915  16.953  1.00 103.33 ? 33  LEU L CD2 1 
ATOM   6590 N N   . ASN E 5 34  ? 22.703  15.900  13.352  1.00 97.97  ? 34  ASN L N   1 
ATOM   6591 C CA  . ASN E 5 34  ? 23.749  14.962  12.953  1.00 96.87  ? 34  ASN L CA  1 
ATOM   6592 C C   . ASN E 5 34  ? 24.621  14.607  14.156  1.00 98.98  ? 34  ASN L C   1 
ATOM   6593 O O   . ASN E 5 34  ? 24.650  15.372  15.118  1.00 97.70  ? 34  ASN L O   1 
ATOM   6594 C CB  . ASN E 5 34  ? 24.573  15.538  11.822  1.00 97.08  ? 34  ASN L CB  1 
ATOM   6595 C CG  . ASN E 5 34  ? 23.714  16.216  10.761  1.00 119.64 ? 34  ASN L CG  1 
ATOM   6596 O OD1 . ASN E 5 34  ? 22.660  15.704  10.334  1.00 104.99 ? 34  ASN L OD1 1 
ATOM   6597 N ND2 . ASN E 5 34  ? 24.139  17.398  10.324  1.00 114.40 ? 34  ASN L ND2 1 
ATOM   6598 N N   . TRP E 5 35  ? 25.289  13.428  14.121  1.00 93.98  ? 35  TRP L N   1 
ATOM   6599 C CA  . TRP E 5 35  ? 26.172  12.907  15.173  1.00 92.32  ? 35  TRP L CA  1 
ATOM   6600 C C   . TRP E 5 35  ? 27.518  12.554  14.576  1.00 90.37  ? 35  TRP L C   1 
ATOM   6601 O O   . TRP E 5 35  ? 27.574  11.923  13.524  1.00 88.97  ? 35  TRP L O   1 
ATOM   6602 C CB  . TRP E 5 35  ? 25.576  11.658  15.836  1.00 91.80  ? 35  TRP L CB  1 
ATOM   6603 C CG  . TRP E 5 35  ? 24.389  11.923  16.715  1.00 93.32  ? 35  TRP L CG  1 
ATOM   6604 C CD1 . TRP E 5 35  ? 23.075  11.766  16.381  1.00 96.53  ? 35  TRP L CD1 1 
ATOM   6605 C CD2 . TRP E 5 35  ? 24.409  12.326  18.096  1.00 93.92  ? 35  TRP L CD2 1 
ATOM   6606 N NE1 . TRP E 5 35  ? 22.271  12.044  17.465  1.00 96.51  ? 35  TRP L NE1 1 
ATOM   6607 C CE2 . TRP E 5 35  ? 23.062  12.401  18.532  1.00 98.21  ? 35  TRP L CE2 1 
ATOM   6608 C CE3 . TRP E 5 35  ? 25.436  12.648  19.007  1.00 95.29  ? 35  TRP L CE3 1 
ATOM   6609 C CZ2 . TRP E 5 35  ? 22.715  12.779  19.844  1.00 97.63  ? 35  TRP L CZ2 1 
ATOM   6610 C CZ3 . TRP E 5 35  ? 25.092  12.989  20.310  1.00 97.15  ? 35  TRP L CZ3 1 
ATOM   6611 C CH2 . TRP E 5 35  ? 23.746  13.054  20.716  1.00 97.78  ? 35  TRP L CH2 1 
ATOM   6612 N N   . TYR E 5 36  ? 28.602  12.948  15.246  1.00 84.43  ? 36  TYR L N   1 
ATOM   6613 C CA  . TYR E 5 36  ? 29.971  12.701  14.796  1.00 83.01  ? 36  TYR L CA  1 
ATOM   6614 C C   . TYR E 5 36  ? 30.774  11.980  15.844  1.00 85.45  ? 36  TYR L C   1 
ATOM   6615 O O   . TYR E 5 36  ? 30.616  12.230  17.032  1.00 85.03  ? 36  TYR L O   1 
ATOM   6616 C CB  . TYR E 5 36  ? 30.693  14.019  14.418  1.00 83.52  ? 36  TYR L CB  1 
ATOM   6617 C CG  . TYR E 5 36  ? 29.945  14.821  13.380  1.00 84.51  ? 36  TYR L CG  1 
ATOM   6618 C CD1 . TYR E 5 36  ? 28.949  15.720  13.752  1.00 85.46  ? 36  TYR L CD1 1 
ATOM   6619 C CD2 . TYR E 5 36  ? 30.191  14.644  12.018  1.00 85.32  ? 36  TYR L CD2 1 
ATOM   6620 C CE1 . TYR E 5 36  ? 28.190  16.397  12.800  1.00 84.14  ? 36  TYR L CE1 1 
ATOM   6621 C CE2 . TYR E 5 36  ? 29.460  15.347  11.055  1.00 86.05  ? 36  TYR L CE2 1 
ATOM   6622 C CZ  . TYR E 5 36  ? 28.441  16.202  11.455  1.00 91.07  ? 36  TYR L CZ  1 
ATOM   6623 O OH  . TYR E 5 36  ? 27.675  16.901  10.557  1.00 91.39  ? 36  TYR L OH  1 
ATOM   6624 N N   . GLN E 5 37  ? 31.660  11.102  15.396  1.00 81.68  ? 37  GLN L N   1 
ATOM   6625 C CA  . GLN E 5 37  ? 32.599  10.382  16.246  1.00 80.75  ? 37  GLN L CA  1 
ATOM   6626 C C   . GLN E 5 37  ? 33.965  10.968  15.940  1.00 85.85  ? 37  GLN L C   1 
ATOM   6627 O O   . GLN E 5 37  ? 34.366  11.002  14.768  1.00 86.89  ? 37  GLN L O   1 
ATOM   6628 C CB  . GLN E 5 37  ? 32.579  8.874   15.925  1.00 81.08  ? 37  GLN L CB  1 
ATOM   6629 C CG  . GLN E 5 37  ? 33.514  8.055   16.789  1.00 77.33  ? 37  GLN L CG  1 
ATOM   6630 C CD  . GLN E 5 37  ? 33.819  6.704   16.205  1.00 95.06  ? 37  GLN L CD  1 
ATOM   6631 O OE1 . GLN E 5 37  ? 34.461  6.596   15.154  1.00 98.52  ? 37  GLN L OE1 1 
ATOM   6632 N NE2 . GLN E 5 37  ? 33.385  5.630   16.887  1.00 75.07  ? 37  GLN L NE2 1 
ATOM   6633 N N   . GLN E 5 38  ? 34.670  11.454  16.963  1.00 81.90  ? 38  GLN L N   1 
ATOM   6634 C CA  . GLN E 5 38  ? 36.014  11.997  16.746  1.00 82.08  ? 38  GLN L CA  1 
ATOM   6635 C C   . GLN E 5 38  ? 37.027  11.229  17.557  1.00 87.76  ? 38  GLN L C   1 
ATOM   6636 O O   . GLN E 5 38  ? 36.970  11.254  18.788  1.00 88.19  ? 38  GLN L O   1 
ATOM   6637 C CB  . GLN E 5 38  ? 36.088  13.503  17.020  1.00 83.09  ? 38  GLN L CB  1 
ATOM   6638 C CG  . GLN E 5 38  ? 37.390  14.111  16.500  1.00 92.34  ? 38  GLN L CG  1 
ATOM   6639 C CD  . GLN E 5 38  ? 37.636  15.530  16.939  1.00 95.59  ? 38  GLN L CD  1 
ATOM   6640 O OE1 . GLN E 5 38  ? 37.129  15.998  17.961  1.00 96.27  ? 38  GLN L OE1 1 
ATOM   6641 N NE2 . GLN E 5 38  ? 38.446  16.242  16.177  1.00 69.15  ? 38  GLN L NE2 1 
ATOM   6642 N N   . LYS E 5 39  ? 37.921  10.503  16.885  1.00 85.22  ? 39  LYS L N   1 
ATOM   6643 C CA  . LYS E 5 39  ? 38.899  9.717   17.626  1.00 86.39  ? 39  LYS L CA  1 
ATOM   6644 C C   . LYS E 5 39  ? 40.117  10.583  17.962  1.00 92.84  ? 39  LYS L C   1 
ATOM   6645 O O   . LYS E 5 39  ? 40.295  11.617  17.310  1.00 94.49  ? 39  LYS L O   1 
ATOM   6646 C CB  . LYS E 5 39  ? 39.265  8.410   16.893  1.00 89.24  ? 39  LYS L CB  1 
ATOM   6647 C CG  . LYS E 5 39  ? 38.066  7.573   16.406  1.00 102.44 ? 39  LYS L CG  1 
ATOM   6648 C CD  . LYS E 5 39  ? 37.778  6.290   17.210  1.00 110.29 ? 39  LYS L CD  1 
ATOM   6649 C CE  . LYS E 5 39  ? 38.668  5.088   17.023  1.00 123.48 ? 39  LYS L CE  1 
ATOM   6650 N NZ  . LYS E 5 39  ? 39.062  4.523   18.342  1.00 128.53 ? 39  LYS L NZ  1 
ATOM   6651 N N   . PRO E 5 40  ? 40.929  10.260  18.995  1.00 88.72  ? 40  PRO L N   1 
ATOM   6652 C CA  . PRO E 5 40  ? 42.067  11.148  19.322  1.00 88.22  ? 40  PRO L CA  1 
ATOM   6653 C C   . PRO E 5 40  ? 43.008  11.348  18.139  1.00 91.50  ? 40  PRO L C   1 
ATOM   6654 O O   . PRO E 5 40  ? 43.441  10.369  17.522  1.00 91.09  ? 40  PRO L O   1 
ATOM   6655 C CB  . PRO E 5 40  ? 42.757  10.448  20.488  1.00 90.45  ? 40  PRO L CB  1 
ATOM   6656 C CG  . PRO E 5 40  ? 41.706  9.499   21.046  1.00 95.37  ? 40  PRO L CG  1 
ATOM   6657 C CD  . PRO E 5 40  ? 40.871  9.083   19.886  1.00 90.52  ? 40  PRO L CD  1 
ATOM   6658 N N   . GLY E 5 41  ? 43.237  12.619  17.800  1.00 87.33  ? 41  GLY L N   1 
ATOM   6659 C CA  . GLY E 5 41  ? 44.104  13.042  16.707  1.00 86.34  ? 41  GLY L CA  1 
ATOM   6660 C C   . GLY E 5 41  ? 43.373  13.270  15.403  1.00 88.33  ? 41  GLY L C   1 
ATOM   6661 O O   . GLY E 5 41  ? 43.520  14.328  14.786  1.00 90.16  ? 41  GLY L O   1 
ATOM   6662 N N   . LYS E 5 42  ? 42.577  12.283  14.980  1.00 80.39  ? 42  LYS L N   1 
ATOM   6663 C CA  . LYS E 5 42  ? 41.805  12.311  13.734  1.00 78.64  ? 42  LYS L CA  1 
ATOM   6664 C C   . LYS E 5 42  ? 40.699  13.424  13.663  1.00 77.86  ? 42  LYS L C   1 
ATOM   6665 O O   . LYS E 5 42  ? 40.385  14.079  14.663  1.00 76.29  ? 42  LYS L O   1 
ATOM   6666 C CB  . LYS E 5 42  ? 41.208  10.914  13.471  1.00 80.66  ? 42  LYS L CB  1 
ATOM   6667 C CG  . LYS E 5 42  ? 42.228  9.884   12.987  1.00 99.13  ? 42  LYS L CG  1 
ATOM   6668 C CD  . LYS E 5 42  ? 41.806  8.449   13.248  1.00 112.86 ? 42  LYS L CD  1 
ATOM   6669 C CE  . LYS E 5 42  ? 40.873  7.860   12.215  1.00 129.49 ? 42  LYS L CE  1 
ATOM   6670 N NZ  . LYS E 5 42  ? 40.341  6.536   12.647  1.00 134.37 ? 42  LYS L NZ  1 
ATOM   6671 N N   . ALA E 5 43  ? 40.136  13.625  12.455  1.00 71.09  ? 43  ALA L N   1 
ATOM   6672 C CA  . ALA E 5 43  ? 39.051  14.565  12.193  1.00 69.14  ? 43  ALA L CA  1 
ATOM   6673 C C   . ALA E 5 43  ? 37.713  13.897  12.490  1.00 69.90  ? 43  ALA L C   1 
ATOM   6674 O O   . ALA E 5 43  ? 37.618  12.680  12.343  1.00 69.28  ? 43  ALA L O   1 
ATOM   6675 C CB  . ALA E 5 43  ? 39.075  14.990  10.735  1.00 69.53  ? 43  ALA L CB  1 
ATOM   6676 N N   . PRO E 5 44  ? 36.646  14.656  12.823  1.00 64.92  ? 44  PRO L N   1 
ATOM   6677 C CA  . PRO E 5 44  ? 35.343  14.022  13.028  1.00 65.28  ? 44  PRO L CA  1 
ATOM   6678 C C   . PRO E 5 44  ? 34.870  13.223  11.813  1.00 74.54  ? 44  PRO L C   1 
ATOM   6679 O O   . PRO E 5 44  ? 35.147  13.592  10.661  1.00 74.02  ? 44  PRO L O   1 
ATOM   6680 C CB  . PRO E 5 44  ? 34.406  15.206  13.289  1.00 66.27  ? 44  PRO L CB  1 
ATOM   6681 C CG  . PRO E 5 44  ? 35.259  16.287  13.722  1.00 69.87  ? 44  PRO L CG  1 
ATOM   6682 C CD  . PRO E 5 44  ? 36.563  16.111  13.040  1.00 65.91  ? 44  PRO L CD  1 
ATOM   6683 N N   . LYS E 5 45  ? 34.172  12.102  12.085  1.00 75.28  ? 45  LYS L N   1 
ATOM   6684 C CA  . LYS E 5 45  ? 33.586  11.209  11.074  1.00 76.49  ? 45  LYS L CA  1 
ATOM   6685 C C   . LYS E 5 45  ? 32.063  11.275  11.271  1.00 80.75  ? 45  LYS L C   1 
ATOM   6686 O O   . LYS E 5 45  ? 31.615  11.209  12.413  1.00 79.03  ? 45  LYS L O   1 
ATOM   6687 C CB  . LYS E 5 45  ? 34.071  9.749   11.269  1.00 79.58  ? 45  LYS L CB  1 
ATOM   6688 C CG  . LYS E 5 45  ? 35.551  9.457   11.023  1.00 102.51 ? 45  LYS L CG  1 
ATOM   6689 C CD  . LYS E 5 45  ? 35.888  8.012   11.449  1.00 113.38 ? 45  LYS L CD  1 
ATOM   6690 C CE  . LYS E 5 45  ? 37.326  7.619   11.169  1.00 114.55 ? 45  LYS L CE  1 
ATOM   6691 N NZ  . LYS E 5 45  ? 37.606  6.204   11.570  1.00 118.77 ? 45  LYS L NZ  1 
ATOM   6692 N N   . LEU E 5 46  ? 31.274  11.417  10.175  1.00 78.72  ? 46  LEU L N   1 
ATOM   6693 C CA  . LEU E 5 46  ? 29.810  11.452  10.271  1.00 78.48  ? 46  LEU L CA  1 
ATOM   6694 C C   . LEU E 5 46  ? 29.320  10.076  10.639  1.00 84.01  ? 46  LEU L C   1 
ATOM   6695 O O   . LEU E 5 46  ? 29.682  9.101   9.986   1.00 83.20  ? 46  LEU L O   1 
ATOM   6696 C CB  . LEU E 5 46  ? 29.153  11.917  8.950   1.00 78.19  ? 46  LEU L CB  1 
ATOM   6697 C CG  . LEU E 5 46  ? 27.601  11.902  8.871   1.00 82.44  ? 46  LEU L CG  1 
ATOM   6698 C CD1 . LEU E 5 46  ? 26.970  13.081  9.638   1.00 82.27  ? 46  LEU L CD1 1 
ATOM   6699 C CD2 . LEU E 5 46  ? 27.115  11.892  7.429   1.00 83.46  ? 46  LEU L CD2 1 
ATOM   6700 N N   . LEU E 5 47  ? 28.510  10.006  11.696  1.00 83.32  ? 47  LEU L N   1 
ATOM   6701 C CA  . LEU E 5 47  ? 27.911  8.775   12.185  1.00 83.59  ? 47  LEU L CA  1 
ATOM   6702 C C   . LEU E 5 47  ? 26.443  8.692   11.790  1.00 87.08  ? 47  LEU L C   1 
ATOM   6703 O O   . LEU E 5 47  ? 26.058  7.792   11.040  1.00 85.04  ? 47  LEU L O   1 
ATOM   6704 C CB  . LEU E 5 47  ? 28.070  8.704   13.708  1.00 83.86  ? 47  LEU L CB  1 
ATOM   6705 C CG  . LEU E 5 47  ? 28.774  7.495   14.273  1.00 88.54  ? 47  LEU L CG  1 
ATOM   6706 C CD1 . LEU E 5 47  ? 30.120  7.262   13.627  1.00 88.21  ? 47  LEU L CD1 1 
ATOM   6707 C CD2 . LEU E 5 47  ? 29.024  7.704   15.711  1.00 91.58  ? 47  LEU L CD2 1 
ATOM   6708 N N   . ILE E 5 48  ? 25.639  9.655   12.276  1.00 85.72  ? 48  ILE L N   1 
ATOM   6709 C CA  . ILE E 5 48  ? 24.192  9.711   12.076  1.00 86.64  ? 48  ILE L CA  1 
ATOM   6710 C C   . ILE E 5 48  ? 23.808  11.047  11.481  1.00 92.31  ? 48  ILE L C   1 
ATOM   6711 O O   . ILE E 5 48  ? 24.228  12.071  11.996  1.00 92.43  ? 48  ILE L O   1 
ATOM   6712 C CB  . ILE E 5 48  ? 23.443  9.490   13.432  1.00 90.37  ? 48  ILE L CB  1 
ATOM   6713 C CG1 . ILE E 5 48  ? 23.635  8.055   14.024  1.00 91.53  ? 48  ILE L CG1 1 
ATOM   6714 C CG2 . ILE E 5 48  ? 21.976  9.866   13.348  1.00 91.59  ? 48  ILE L CG2 1 
ATOM   6715 C CD1 . ILE E 5 48  ? 22.909  6.872   13.342  1.00 99.61  ? 48  ILE L CD1 1 
ATOM   6716 N N   . TYR E 5 49  ? 22.988  11.044  10.419  1.00 89.16  ? 49  TYR L N   1 
ATOM   6717 C CA  . TYR E 5 49  ? 22.461  12.264  9.796   1.00 87.81  ? 49  TYR L CA  1 
ATOM   6718 C C   . TYR E 5 49  ? 20.920  12.235  9.911   1.00 89.01  ? 49  TYR L C   1 
ATOM   6719 O O   . TYR E 5 49  ? 20.350  11.160  10.121  1.00 86.92  ? 49  TYR L O   1 
ATOM   6720 C CB  . TYR E 5 49  ? 22.979  12.443  8.346   1.00 88.05  ? 49  TYR L CB  1 
ATOM   6721 C CG  . TYR E 5 49  ? 22.410  11.475  7.335   1.00 88.78  ? 49  TYR L CG  1 
ATOM   6722 C CD1 . TYR E 5 49  ? 22.958  10.207  7.168   1.00 90.58  ? 49  TYR L CD1 1 
ATOM   6723 C CD2 . TYR E 5 49  ? 21.332  11.832  6.529   1.00 89.20  ? 49  TYR L CD2 1 
ATOM   6724 C CE1 . TYR E 5 49  ? 22.423  9.306   6.248   1.00 91.44  ? 49  TYR L CE1 1 
ATOM   6725 C CE2 . TYR E 5 49  ? 20.790  10.940  5.607   1.00 89.78  ? 49  TYR L CE2 1 
ATOM   6726 C CZ  . TYR E 5 49  ? 21.343  9.683   5.464   1.00 96.67  ? 49  TYR L CZ  1 
ATOM   6727 O OH  . TYR E 5 49  ? 20.807  8.821   4.542   1.00 97.11  ? 49  TYR L OH  1 
ATOM   6728 N N   . TYR E 5 50  ? 20.265  13.409  9.829   1.00 84.66  ? 50  TYR L N   1 
ATOM   6729 C CA  . TYR E 5 50  ? 18.810  13.559  9.927   1.00 83.58  ? 50  TYR L CA  1 
ATOM   6730 C C   . TYR E 5 50  ? 18.195  12.749  11.088  1.00 89.70  ? 50  TYR L C   1 
ATOM   6731 O O   . TYR E 5 50  ? 17.310  11.907  10.884  1.00 88.97  ? 50  TYR L O   1 
ATOM   6732 C CB  . TYR E 5 50  ? 18.123  13.259  8.585   1.00 83.38  ? 50  TYR L CB  1 
ATOM   6733 C CG  . TYR E 5 50  ? 16.788  13.957  8.454   1.00 84.11  ? 50  TYR L CG  1 
ATOM   6734 C CD1 . TYR E 5 50  ? 16.714  15.345  8.348   1.00 85.90  ? 50  TYR L CD1 1 
ATOM   6735 C CD2 . TYR E 5 50  ? 15.593  13.237  8.474   1.00 85.11  ? 50  TYR L CD2 1 
ATOM   6736 C CE1 . TYR E 5 50  ? 15.480  16.000  8.309   1.00 87.27  ? 50  TYR L CE1 1 
ATOM   6737 C CE2 . TYR E 5 50  ? 14.352  13.884  8.391   1.00 85.83  ? 50  TYR L CE2 1 
ATOM   6738 C CZ  . TYR E 5 50  ? 14.301  15.267  8.317   1.00 89.76  ? 50  TYR L CZ  1 
ATOM   6739 O OH  . TYR E 5 50  ? 13.095  15.923  8.236   1.00 84.62  ? 50  TYR L OH  1 
ATOM   6740 N N   . THR E 5 51  ? 18.736  12.979  12.304  1.00 87.91  ? 51  THR L N   1 
ATOM   6741 C CA  . THR E 5 51  ? 18.355  12.401  13.612  1.00 87.76  ? 51  THR L CA  1 
ATOM   6742 C C   . THR E 5 51  ? 18.624  10.889  13.769  1.00 90.86  ? 51  THR L C   1 
ATOM   6743 O O   . THR E 5 51  ? 19.252  10.480  14.752  1.00 90.00  ? 51  THR L O   1 
ATOM   6744 C CB  . THR E 5 51  ? 16.884  12.735  13.955  1.00 94.46  ? 51  THR L CB  1 
ATOM   6745 O OG1 . THR E 5 51  ? 16.768  14.141  14.052  1.00 98.40  ? 51  THR L OG1 1 
ATOM   6746 C CG2 . THR E 5 51  ? 16.416  12.134  15.259  1.00 93.11  ? 51  THR L CG2 1 
ATOM   6747 N N   . SER E 5 52  ? 18.105  10.081  12.836  1.00 87.31  ? 52  SER L N   1 
ATOM   6748 C CA  . SER E 5 52  ? 18.089  8.631   12.916  1.00 87.32  ? 52  SER L CA  1 
ATOM   6749 C C   . SER E 5 52  ? 18.784  7.882   11.798  1.00 92.11  ? 52  SER L C   1 
ATOM   6750 O O   . SER E 5 52  ? 18.979  6.674   11.931  1.00 92.79  ? 52  SER L O   1 
ATOM   6751 C CB  . SER E 5 52  ? 16.644  8.160   13.002  1.00 90.77  ? 52  SER L CB  1 
ATOM   6752 O OG  . SER E 5 52  ? 15.853  8.716   11.965  1.00 102.20 ? 52  SER L OG  1 
ATOM   6753 N N   . ARG E 5 53  ? 19.126  8.548   10.696  1.00 88.34  ? 53  ARG L N   1 
ATOM   6754 C CA  . ARG E 5 53  ? 19.760  7.890   9.548   1.00 88.35  ? 53  ARG L CA  1 
ATOM   6755 C C   . ARG E 5 53  ? 21.267  7.573   9.711   1.00 91.91  ? 53  ARG L C   1 
ATOM   6756 O O   . ARG E 5 53  ? 22.078  8.446   10.034  1.00 92.14  ? 53  ARG L O   1 
ATOM   6757 C CB  . ARG E 5 53  ? 19.525  8.701   8.277   1.00 88.00  ? 53  ARG L CB  1 
ATOM   6758 C CG  . ARG E 5 53  ? 18.169  8.458   7.695   1.00 96.03  ? 53  ARG L CG  1 
ATOM   6759 C CD  . ARG E 5 53  ? 17.585  9.703   7.067   1.00 107.35 ? 53  ARG L CD  1 
ATOM   6760 N NE  . ARG E 5 53  ? 16.125  9.573   6.924   1.00 125.44 ? 53  ARG L NE  1 
ATOM   6761 C CZ  . ARG E 5 53  ? 15.364  10.376  6.188   1.00 141.76 ? 53  ARG L CZ  1 
ATOM   6762 N NH1 . ARG E 5 53  ? 15.913  11.367  5.488   1.00 132.02 ? 53  ARG L NH1 1 
ATOM   6763 N NH2 . ARG E 5 53  ? 14.052  10.190  6.128   1.00 123.37 ? 53  ARG L NH2 1 
ATOM   6764 N N   . LEU E 5 54  ? 21.608  6.321   9.367   1.00 86.71  ? 54  LEU L N   1 
ATOM   6765 C CA  . LEU E 5 54  ? 22.951  5.746   9.429   1.00 85.69  ? 54  LEU L CA  1 
ATOM   6766 C C   . LEU E 5 54  ? 23.783  5.958   8.158   1.00 84.07  ? 54  LEU L C   1 
ATOM   6767 O O   . LEU E 5 54  ? 23.455  5.416   7.090   1.00 82.21  ? 54  LEU L O   1 
ATOM   6768 C CB  . LEU E 5 54  ? 22.838  4.247   9.738   1.00 86.02  ? 54  LEU L CB  1 
ATOM   6769 C CG  . LEU E 5 54  ? 23.879  3.668   10.667  1.00 91.02  ? 54  LEU L CG  1 
ATOM   6770 C CD1 . LEU E 5 54  ? 23.416  3.767   12.071  1.00 91.21  ? 54  LEU L CD1 1 
ATOM   6771 C CD2 . LEU E 5 54  ? 24.088  2.207   10.370  1.00 93.78  ? 54  LEU L CD2 1 
ATOM   6772 N N   . HIS E 5 55  ? 24.896  6.716   8.302   1.00 76.62  ? 55  HIS L N   1 
ATOM   6773 C CA  . HIS E 5 55  ? 25.833  7.000   7.220   1.00 73.94  ? 55  HIS L CA  1 
ATOM   6774 C C   . HIS E 5 55  ? 26.615  5.741   6.767   1.00 81.66  ? 55  HIS L C   1 
ATOM   6775 O O   . HIS E 5 55  ? 27.041  4.937   7.588   1.00 81.74  ? 55  HIS L O   1 
ATOM   6776 C CB  . HIS E 5 55  ? 26.795  8.108   7.637   1.00 72.65  ? 55  HIS L CB  1 
ATOM   6777 C CG  . HIS E 5 55  ? 27.794  8.461   6.580   1.00 74.17  ? 55  HIS L CG  1 
ATOM   6778 N ND1 . HIS E 5 55  ? 27.412  8.635   5.274   1.00 74.64  ? 55  HIS L ND1 1 
ATOM   6779 C CD2 . HIS E 5 55  ? 29.130  8.622   6.668   1.00 74.57  ? 55  HIS L CD2 1 
ATOM   6780 C CE1 . HIS E 5 55  ? 28.512  8.893   4.605   1.00 73.53  ? 55  HIS L CE1 1 
ATOM   6781 N NE2 . HIS E 5 55  ? 29.571  8.906   5.405   1.00 74.24  ? 55  HIS L NE2 1 
ATOM   6782 N N   . SER E 5 56  ? 26.823  5.614   5.456   1.00 80.74  ? 56  SER L N   1 
ATOM   6783 C CA  . SER E 5 56  ? 27.514  4.516   4.787   1.00 81.30  ? 56  SER L CA  1 
ATOM   6784 C C   . SER E 5 56  ? 28.873  4.181   5.421   1.00 88.69  ? 56  SER L C   1 
ATOM   6785 O O   . SER E 5 56  ? 29.802  4.987   5.370   1.00 87.44  ? 56  SER L O   1 
ATOM   6786 C CB  . SER E 5 56  ? 27.622  4.813   3.298   1.00 84.38  ? 56  SER L CB  1 
ATOM   6787 O OG  . SER E 5 56  ? 28.704  4.126   2.703   1.00 97.67  ? 56  SER L OG  1 
ATOM   6788 N N   . GLY E 5 57  ? 28.955  3.003   6.037   1.00 89.56  ? 57  GLY L N   1 
ATOM   6789 C CA  . GLY E 5 57  ? 30.166  2.529   6.697   1.00 90.69  ? 57  GLY L CA  1 
ATOM   6790 C C   . GLY E 5 57  ? 29.996  2.336   8.193   1.00 96.57  ? 57  GLY L C   1 
ATOM   6791 O O   . GLY E 5 57  ? 30.608  1.431   8.769   1.00 97.26  ? 57  GLY L O   1 
ATOM   6792 N N   . VAL E 5 58  ? 29.171  3.194   8.833   1.00 93.46  ? 58  VAL L N   1 
ATOM   6793 C CA  . VAL E 5 58  ? 28.866  3.208   10.265  1.00 93.84  ? 58  VAL L CA  1 
ATOM   6794 C C   . VAL E 5 58  ? 28.140  1.901   10.659  1.00 99.25  ? 58  VAL L C   1 
ATOM   6795 O O   . VAL E 5 58  ? 27.156  1.547   10.023  1.00 98.12  ? 58  VAL L O   1 
ATOM   6796 C CB  . VAL E 5 58  ? 28.038  4.478   10.617  1.00 97.90  ? 58  VAL L CB  1 
ATOM   6797 C CG1 . VAL E 5 58  ? 27.511  4.436   12.058  1.00 98.06  ? 58  VAL L CG1 1 
ATOM   6798 C CG2 . VAL E 5 58  ? 28.847  5.752   10.340  1.00 97.58  ? 58  VAL L CG2 1 
ATOM   6799 N N   . PRO E 5 59  ? 28.632  1.144   11.685  1.00 98.39  ? 59  PRO L N   1 
ATOM   6800 C CA  . PRO E 5 59  ? 27.986  -0.133  12.024  1.00 99.41  ? 59  PRO L CA  1 
ATOM   6801 C C   . PRO E 5 59  ? 26.616  -0.047  12.665  1.00 105.66 ? 59  PRO L C   1 
ATOM   6802 O O   . PRO E 5 59  ? 26.305  0.918   13.369  1.00 105.48 ? 59  PRO L O   1 
ATOM   6803 C CB  . PRO E 5 59  ? 28.977  -0.813  12.985  1.00 101.28 ? 59  PRO L CB  1 
ATOM   6804 C CG  . PRO E 5 59  ? 30.181  0.042   12.986  1.00 105.30 ? 59  PRO L CG  1 
ATOM   6805 C CD  . PRO E 5 59  ? 29.795  1.404   12.543  1.00 100.32 ? 59  PRO L CD  1 
ATOM   6806 N N   . SER E 5 60  ? 25.824  -1.123  12.454  1.00 103.45 ? 60  SER L N   1 
ATOM   6807 C CA  . SER E 5 60  ? 24.448  -1.370  12.891  1.00 103.83 ? 60  SER L CA  1 
ATOM   6808 C C   . SER E 5 60  ? 24.146  -0.939  14.320  1.00 107.87 ? 60  SER L C   1 
ATOM   6809 O O   . SER E 5 60  ? 23.065  -0.420  14.575  1.00 107.74 ? 60  SER L O   1 
ATOM   6810 C CB  . SER E 5 60  ? 24.115  -2.847  12.713  1.00 109.28 ? 60  SER L CB  1 
ATOM   6811 O OG  . SER E 5 60  ? 24.257  -3.270  11.366  1.00 124.03 ? 60  SER L OG  1 
ATOM   6812 N N   . ARG E 5 61  ? 25.088  -1.174  15.248  1.00 104.48 ? 61  ARG L N   1 
ATOM   6813 C CA  . ARG E 5 61  ? 25.007  -0.867  16.677  1.00 103.95 ? 61  ARG L CA  1 
ATOM   6814 C C   . ARG E 5 61  ? 24.719  0.586   16.993  1.00 104.89 ? 61  ARG L C   1 
ATOM   6815 O O   . ARG E 5 61  ? 24.045  0.862   17.996  1.00 105.64 ? 61  ARG L O   1 
ATOM   6816 C CB  . ARG E 5 61  ? 26.284  -1.311  17.381  1.00 107.79 ? 61  ARG L CB  1 
ATOM   6817 C CG  . ARG E 5 61  ? 26.464  -2.810  17.283  1.00 134.83 ? 61  ARG L CG  1 
ATOM   6818 C CD  . ARG E 5 61  ? 27.419  -3.316  18.320  1.00 164.77 ? 61  ARG L CD  1 
ATOM   6819 N NE  . ARG E 5 61  ? 28.804  -3.169  17.885  1.00 184.57 ? 61  ARG L NE  1 
ATOM   6820 C CZ  . ARG E 5 61  ? 29.537  -4.145  17.359  1.00 201.17 ? 61  ARG L CZ  1 
ATOM   6821 N NH1 . ARG E 5 61  ? 29.029  -5.366  17.218  1.00 182.99 ? 61  ARG L NH1 1 
ATOM   6822 N NH2 . ARG E 5 61  ? 30.789  -3.916  16.989  1.00 192.91 ? 61  ARG L NH2 1 
ATOM   6823 N N   . PHE E 5 62  ? 25.214  1.513   16.144  1.00 97.29  ? 62  PHE L N   1 
ATOM   6824 C CA  . PHE E 5 62  ? 24.999  2.942   16.332  1.00 96.07  ? 62  PHE L CA  1 
ATOM   6825 C C   . PHE E 5 62  ? 23.593  3.304   15.920  1.00 101.16 ? 62  PHE L C   1 
ATOM   6826 O O   . PHE E 5 62  ? 23.065  2.704   14.993  1.00 100.52 ? 62  PHE L O   1 
ATOM   6827 C CB  . PHE E 5 62  ? 26.019  3.744   15.542  1.00 97.38  ? 62  PHE L CB  1 
ATOM   6828 C CG  . PHE E 5 62  ? 27.429  3.578   16.050  1.00 98.07  ? 62  PHE L CG  1 
ATOM   6829 C CD1 . PHE E 5 62  ? 28.244  2.553   15.573  1.00 99.62  ? 62  PHE L CD1 1 
ATOM   6830 C CD2 . PHE E 5 62  ? 27.942  4.440   17.011  1.00 99.26  ? 62  PHE L CD2 1 
ATOM   6831 C CE1 . PHE E 5 62  ? 29.539  2.387   16.070  1.00 99.78  ? 62  PHE L CE1 1 
ATOM   6832 C CE2 . PHE E 5 62  ? 29.243  4.295   17.485  1.00 101.45 ? 62  PHE L CE2 1 
ATOM   6833 C CZ  . PHE E 5 62  ? 30.032  3.263   17.018  1.00 99.21  ? 62  PHE L CZ  1 
ATOM   6834 N N   . SER E 5 63  ? 22.982  4.269   16.620  1.00 99.16  ? 63  SER L N   1 
ATOM   6835 C CA  . SER E 5 63  ? 21.599  4.699   16.396  1.00 99.36  ? 63  SER L CA  1 
ATOM   6836 C C   . SER E 5 63  ? 21.309  6.042   17.057  1.00 103.15 ? 63  SER L C   1 
ATOM   6837 O O   . SER E 5 63  ? 22.028  6.457   17.964  1.00 102.42 ? 63  SER L O   1 
ATOM   6838 C CB  . SER E 5 63  ? 20.622  3.647   16.919  1.00 103.11 ? 63  SER L CB  1 
ATOM   6839 O OG  . SER E 5 63  ? 21.079  3.020   18.107  1.00 108.76 ? 63  SER L OG  1 
ATOM   6840 N N   . GLY E 5 64  ? 20.259  6.700   16.583  1.00 99.53  ? 64  GLY L N   1 
ATOM   6841 C CA  . GLY E 5 64  ? 19.831  8.004   17.066  1.00 99.00  ? 64  GLY L CA  1 
ATOM   6842 C C   . GLY E 5 64  ? 18.329  8.137   17.061  1.00 102.47 ? 64  GLY L C   1 
ATOM   6843 O O   . GLY E 5 64  ? 17.659  7.604   16.173  1.00 101.00 ? 64  GLY L O   1 
ATOM   6844 N N   . SER E 5 65  ? 17.797  8.845   18.061  1.00 100.83 ? 65  SER L N   1 
ATOM   6845 C CA  . SER E 5 65  ? 16.358  9.054   18.243  1.00 101.23 ? 65  SER L CA  1 
ATOM   6846 C C   . SER E 5 65  ? 16.023  10.503  18.600  1.00 104.02 ? 65  SER L C   1 
ATOM   6847 O O   . SER E 5 65  ? 16.890  11.248  19.064  1.00 103.75 ? 65  SER L O   1 
ATOM   6848 C CB  . SER E 5 65  ? 15.826  8.112   19.323  1.00 105.70 ? 65  SER L CB  1 
ATOM   6849 O OG  . SER E 5 65  ? 14.523  8.468   19.765  1.00 116.29 ? 65  SER L OG  1 
ATOM   6850 N N   . GLY E 5 66  ? 14.765  10.878  18.400  1.00 99.68  ? 66  GLY L N   1 
ATOM   6851 C CA  . GLY E 5 66  ? 14.321  12.210  18.769  1.00 99.77  ? 66  GLY L CA  1 
ATOM   6852 C C   . GLY E 5 66  ? 13.385  12.911  17.817  1.00 104.59 ? 66  GLY L C   1 
ATOM   6853 O O   . GLY E 5 66  ? 12.801  12.304  16.911  1.00 104.21 ? 66  GLY L O   1 
ATOM   6854 N N   . SER E 5 67  ? 13.222  14.214  18.092  1.00 101.76 ? 67  SER L N   1 
ATOM   6855 C CA  . SER E 5 67  ? 12.426  15.225  17.406  1.00 101.80 ? 67  SER L CA  1 
ATOM   6856 C C   . SER E 5 67  ? 12.485  16.519  18.235  1.00 105.82 ? 67  SER L C   1 
ATOM   6857 O O   . SER E 5 67  ? 12.787  16.487  19.433  1.00 104.26 ? 67  SER L O   1 
ATOM   6858 C CB  . SER E 5 67  ? 10.973  14.771  17.249  1.00 105.74 ? 67  SER L CB  1 
ATOM   6859 O OG  . SER E 5 67  ? 10.259  14.757  18.475  1.00 113.17 ? 67  SER L OG  1 
ATOM   6860 N N   . GLY E 5 68  ? 12.191  17.636  17.580  1.00 103.50 ? 68  GLY L N   1 
ATOM   6861 C CA  . GLY E 5 68  ? 12.110  18.949  18.205  1.00 103.27 ? 68  GLY L CA  1 
ATOM   6862 C C   . GLY E 5 68  ? 13.395  19.467  18.805  1.00 106.30 ? 68  GLY L C   1 
ATOM   6863 O O   . GLY E 5 68  ? 14.239  20.006  18.081  1.00 105.59 ? 68  GLY L O   1 
ATOM   6864 N N   . THR E 5 69  ? 13.525  19.326  20.149  1.00 101.76 ? 69  THR L N   1 
ATOM   6865 C CA  . THR E 5 69  ? 14.675  19.801  20.941  1.00 100.86 ? 69  THR L CA  1 
ATOM   6866 C C   . THR E 5 69  ? 15.417  18.687  21.698  1.00 101.40 ? 69  THR L C   1 
ATOM   6867 O O   . THR E 5 69  ? 16.591  18.851  22.031  1.00 99.12  ? 69  THR L O   1 
ATOM   6868 C CB  . THR E 5 69  ? 14.261  20.936  21.906  1.00 110.58 ? 69  THR L CB  1 
ATOM   6869 O OG1 . THR E 5 69  ? 13.237  20.486  22.798  1.00 111.42 ? 69  THR L OG1 1 
ATOM   6870 C CG2 . THR E 5 69  ? 13.832  22.201  21.180  1.00 107.40 ? 69  THR L CG2 1 
ATOM   6871 N N   . ASP E 5 70  ? 14.739  17.571  21.972  1.00 97.77  ? 70  ASP L N   1 
ATOM   6872 C CA  . ASP E 5 70  ? 15.311  16.448  22.711  1.00 98.35  ? 70  ASP L CA  1 
ATOM   6873 C C   . ASP E 5 70  ? 15.755  15.326  21.795  1.00 100.07 ? 70  ASP L C   1 
ATOM   6874 O O   . ASP E 5 70  ? 14.950  14.790  21.029  1.00 98.16  ? 70  ASP L O   1 
ATOM   6875 C CB  . ASP E 5 70  ? 14.329  15.956  23.801  1.00 101.88 ? 70  ASP L CB  1 
ATOM   6876 C CG  . ASP E 5 70  ? 14.083  16.950  24.936  1.00 119.58 ? 70  ASP L CG  1 
ATOM   6877 O OD1 . ASP E 5 70  ? 14.879  17.916  25.076  1.00 121.72 ? 70  ASP L OD1 1 
ATOM   6878 O OD2 . ASP E 5 70  ? 13.108  16.755  25.694  1.00 127.55 ? 70  ASP L OD2 1 
ATOM   6879 N N   . PHE E 5 71  ? 17.058  14.993  21.857  1.00 97.99  ? 71  PHE L N   1 
ATOM   6880 C CA  . PHE E 5 71  ? 17.679  13.972  20.994  1.00 98.26  ? 71  PHE L CA  1 
ATOM   6881 C C   . PHE E 5 71  ? 18.664  13.042  21.714  1.00 103.87 ? 71  PHE L C   1 
ATOM   6882 O O   . PHE E 5 71  ? 19.364  13.475  22.634  1.00 104.63 ? 71  PHE L O   1 
ATOM   6883 C CB  . PHE E 5 71  ? 18.391  14.633  19.809  1.00 99.19  ? 71  PHE L CB  1 
ATOM   6884 C CG  . PHE E 5 71  ? 17.504  15.411  18.871  1.00 99.80  ? 71  PHE L CG  1 
ATOM   6885 C CD1 . PHE E 5 71  ? 16.870  14.784  17.807  1.00 102.62 ? 71  PHE L CD1 1 
ATOM   6886 C CD2 . PHE E 5 71  ? 17.330  16.780  19.030  1.00 100.86 ? 71  PHE L CD2 1 
ATOM   6887 C CE1 . PHE E 5 71  ? 16.061  15.513  16.932  1.00 103.54 ? 71  PHE L CE1 1 
ATOM   6888 C CE2 . PHE E 5 71  ? 16.502  17.502  18.171  1.00 103.42 ? 71  PHE L CE2 1 
ATOM   6889 C CZ  . PHE E 5 71  ? 15.884  16.871  17.120  1.00 102.03 ? 71  PHE L CZ  1 
ATOM   6890 N N   . THR E 5 72  ? 18.727  11.758  21.288  1.00 99.15  ? 72  THR L N   1 
ATOM   6891 C CA  . THR E 5 72  ? 19.659  10.816  21.903  1.00 98.56  ? 72  THR L CA  1 
ATOM   6892 C C   . THR E 5 72  ? 20.372  9.907   20.916  1.00 101.15 ? 72  THR L C   1 
ATOM   6893 O O   . THR E 5 72  ? 19.728  9.346   20.030  1.00 101.57 ? 72  THR L O   1 
ATOM   6894 C CB  . THR E 5 72  ? 19.035  9.942   23.009  1.00 112.04 ? 72  THR L CB  1 
ATOM   6895 O OG1 . THR E 5 72  ? 18.623  8.697   22.451  1.00 114.22 ? 72  THR L OG1 1 
ATOM   6896 C CG2 . THR E 5 72  ? 17.905  10.615  23.797  1.00 113.27 ? 72  THR L CG2 1 
ATOM   6897 N N   . PHE E 5 73  ? 21.661  9.637   21.194  1.00 95.97  ? 73  PHE L N   1 
ATOM   6898 C CA  . PHE E 5 73  ? 22.555  8.762   20.424  1.00 94.96  ? 73  PHE L CA  1 
ATOM   6899 C C   . PHE E 5 73  ? 22.879  7.508   21.221  1.00 96.02  ? 73  PHE L C   1 
ATOM   6900 O O   . PHE E 5 73  ? 23.343  7.617   22.353  1.00 96.10  ? 73  PHE L O   1 
ATOM   6901 C CB  . PHE E 5 73  ? 23.859  9.498   20.078  1.00 96.60  ? 73  PHE L CB  1 
ATOM   6902 C CG  . PHE E 5 73  ? 24.946  8.659   19.452  1.00 97.92  ? 73  PHE L CG  1 
ATOM   6903 C CD1 . PHE E 5 73  ? 24.878  8.291   18.113  1.00 101.03 ? 73  PHE L CD1 1 
ATOM   6904 C CD2 . PHE E 5 73  ? 26.060  8.274   20.190  1.00 99.75  ? 73  PHE L CD2 1 
ATOM   6905 C CE1 . PHE E 5 73  ? 25.890  7.528   17.536  1.00 101.95 ? 73  PHE L CE1 1 
ATOM   6906 C CE2 . PHE E 5 73  ? 27.071  7.515   19.613  1.00 102.21 ? 73  PHE L CE2 1 
ATOM   6907 C CZ  . PHE E 5 73  ? 26.975  7.142   18.296  1.00 100.58 ? 73  PHE L CZ  1 
ATOM   6908 N N   . THR E 5 74  ? 22.688  6.327   20.627  1.00 90.06  ? 74  THR L N   1 
ATOM   6909 C CA  . THR E 5 74  ? 22.949  5.090   21.346  1.00 89.03  ? 74  THR L CA  1 
ATOM   6910 C C   . THR E 5 74  ? 23.891  4.174   20.626  1.00 91.01  ? 74  THR L C   1 
ATOM   6911 O O   . THR E 5 74  ? 23.939  4.163   19.403  1.00 90.64  ? 74  THR L O   1 
ATOM   6912 C CB  . THR E 5 74  ? 21.633  4.326   21.750  1.00 96.40  ? 74  THR L CB  1 
ATOM   6913 O OG1 . THR E 5 74  ? 20.889  3.953   20.596  1.00 98.32  ? 74  THR L OG1 1 
ATOM   6914 C CG2 . THR E 5 74  ? 20.737  5.113   22.684  1.00 92.44  ? 74  THR L CG2 1 
ATOM   6915 N N   . ILE E 5 75  ? 24.633  3.393   21.414  1.00 86.52  ? 75  ILE L N   1 
ATOM   6916 C CA  . ILE E 5 75  ? 25.509  2.298   21.009  1.00 85.47  ? 75  ILE L CA  1 
ATOM   6917 C C   . ILE E 5 75  ? 24.853  1.080   21.697  1.00 92.68  ? 75  ILE L C   1 
ATOM   6918 O O   . ILE E 5 75  ? 24.631  1.109   22.916  1.00 91.63  ? 75  ILE L O   1 
ATOM   6919 C CB  . ILE E 5 75  ? 26.991  2.514   21.447  1.00 86.84  ? 75  ILE L CB  1 
ATOM   6920 C CG1 . ILE E 5 75  ? 27.578  3.787   20.805  1.00 85.80  ? 75  ILE L CG1 1 
ATOM   6921 C CG2 . ILE E 5 75  ? 27.838  1.289   21.082  1.00 87.10  ? 75  ILE L CG2 1 
ATOM   6922 C CD1 . ILE E 5 75  ? 28.652  4.467   21.571  1.00 86.15  ? 75  ILE L CD1 1 
ATOM   6923 N N   . SER E 5 76  ? 24.461  0.059   20.911  1.00 91.66  ? 76  SER L N   1 
ATOM   6924 C CA  . SER E 5 76  ? 23.798  -1.138  21.441  1.00 92.14  ? 76  SER L CA  1 
ATOM   6925 C C   . SER E 5 76  ? 24.709  -1.926  22.374  1.00 96.71  ? 76  SER L C   1 
ATOM   6926 O O   . SER E 5 76  ? 24.290  -2.291  23.479  1.00 95.96  ? 76  SER L O   1 
ATOM   6927 C CB  . SER E 5 76  ? 23.275  -2.028  20.311  1.00 95.54  ? 76  SER L CB  1 
ATOM   6928 O OG  . SER E 5 76  ? 24.276  -2.839  19.712  1.00 103.24 ? 76  SER L OG  1 
ATOM   6929 N N   . SER E 5 77  ? 25.954  -2.206  21.913  1.00 93.66  ? 77  SER L N   1 
ATOM   6930 C CA  . SER E 5 77  ? 26.976  -2.939  22.664  1.00 93.89  ? 77  SER L CA  1 
ATOM   6931 C C   . SER E 5 77  ? 28.371  -2.374  22.384  1.00 96.33  ? 77  SER L C   1 
ATOM   6932 O O   . SER E 5 77  ? 29.004  -2.694  21.369  1.00 96.16  ? 77  SER L O   1 
ATOM   6933 C CB  . SER E 5 77  ? 26.909  -4.436  22.373  1.00 98.73  ? 77  SER L CB  1 
ATOM   6934 O OG  . SER E 5 77  ? 27.176  -4.696  21.005  1.00 108.07 ? 77  SER L OG  1 
ATOM   6935 N N   . LEU E 5 78  ? 28.834  -1.522  23.306  1.00 91.37  ? 78  LEU L N   1 
ATOM   6936 C CA  . LEU E 5 78  ? 30.108  -0.834  23.268  1.00 90.73  ? 78  LEU L CA  1 
ATOM   6937 C C   . LEU E 5 78  ? 31.269  -1.745  22.944  1.00 93.67  ? 78  LEU L C   1 
ATOM   6938 O O   . LEU E 5 78  ? 31.439  -2.797  23.555  1.00 91.94  ? 78  LEU L O   1 
ATOM   6939 C CB  . LEU E 5 78  ? 30.316  -0.129  24.602  1.00 90.74  ? 78  LEU L CB  1 
ATOM   6940 C CG  . LEU E 5 78  ? 31.193  1.119   24.602  1.00 95.86  ? 78  LEU L CG  1 
ATOM   6941 C CD1 . LEU E 5 78  ? 30.572  2.253   23.837  1.00 96.62  ? 78  LEU L CD1 1 
ATOM   6942 C CD2 . LEU E 5 78  ? 31.375  1.602   25.975  1.00 97.62  ? 78  LEU L CD2 1 
ATOM   6943 N N   . GLN E 5 79  ? 32.042  -1.326  21.942  1.00 91.81  ? 79  GLN L N   1 
ATOM   6944 C CA  . GLN E 5 79  ? 33.236  -2.011  21.451  1.00 92.08  ? 79  GLN L CA  1 
ATOM   6945 C C   . GLN E 5 79  ? 34.476  -1.185  21.797  1.00 94.83  ? 79  GLN L C   1 
ATOM   6946 O O   . GLN E 5 79  ? 34.399  0.045   21.750  1.00 93.48  ? 79  GLN L O   1 
ATOM   6947 C CB  . GLN E 5 79  ? 33.137  -2.270  19.930  1.00 93.43  ? 79  GLN L CB  1 
ATOM   6948 C CG  . GLN E 5 79  ? 33.292  -3.749  19.544  1.00 102.51 ? 79  GLN L CG  1 
ATOM   6949 C CD  . GLN E 5 79  ? 32.241  -4.677  20.133  1.00 124.93 ? 79  GLN L CD  1 
ATOM   6950 O OE1 . GLN E 5 79  ? 31.106  -4.285  20.454  1.00 116.96 ? 79  GLN L OE1 1 
ATOM   6951 N NE2 . GLN E 5 79  ? 32.597  -5.948  20.277  1.00 123.03 ? 79  GLN L NE2 1 
ATOM   6952 N N   . PRO E 5 80  ? 35.612  -1.837  22.158  1.00 91.66  ? 80  PRO L N   1 
ATOM   6953 C CA  . PRO E 5 80  ? 36.834  -1.090  22.516  1.00 91.60  ? 80  PRO L CA  1 
ATOM   6954 C C   . PRO E 5 80  ? 37.216  0.069   21.579  1.00 94.57  ? 80  PRO L C   1 
ATOM   6955 O O   . PRO E 5 80  ? 37.746  1.071   22.066  1.00 93.24  ? 80  PRO L O   1 
ATOM   6956 C CB  . PRO E 5 80  ? 37.915  -2.182  22.567  1.00 93.42  ? 80  PRO L CB  1 
ATOM   6957 C CG  . PRO E 5 80  ? 37.304  -3.388  21.902  1.00 97.80  ? 80  PRO L CG  1 
ATOM   6958 C CD  . PRO E 5 80  ? 35.856  -3.286  22.254  1.00 93.48  ? 80  PRO L CD  1 
ATOM   6959 N N   . GLU E 5 81  ? 36.923  -0.056  20.261  1.00 90.09  ? 81  GLU L N   1 
ATOM   6960 C CA  . GLU E 5 81  ? 37.200  0.973   19.256  1.00 88.73  ? 81  GLU L CA  1 
ATOM   6961 C C   . GLU E 5 81  ? 36.269  2.160   19.384  1.00 92.68  ? 81  GLU L C   1 
ATOM   6962 O O   . GLU E 5 81  ? 36.712  3.266   19.113  1.00 93.87  ? 81  GLU L O   1 
ATOM   6963 C CB  . GLU E 5 81  ? 37.222  0.428   17.808  1.00 89.39  ? 81  GLU L CB  1 
ATOM   6964 C CG  . GLU E 5 81  ? 35.975  -0.319  17.359  1.00 96.08  ? 81  GLU L CG  1 
ATOM   6965 C CD  . GLU E 5 81  ? 35.949  -1.820  17.595  1.00 111.46 ? 81  GLU L CD  1 
ATOM   6966 O OE1 . GLU E 5 81  ? 35.585  -2.544  16.643  1.00 108.78 ? 81  GLU L OE1 1 
ATOM   6967 O OE2 . GLU E 5 81  ? 36.277  -2.280  18.714  1.00 100.52 ? 81  GLU L OE2 1 
ATOM   6968 N N   . ASP E 5 82  ? 34.993  1.951   19.798  1.00 87.99  ? 82  ASP L N   1 
ATOM   6969 C CA  . ASP E 5 82  ? 33.991  3.019   19.968  1.00 87.24  ? 82  ASP L CA  1 
ATOM   6970 C C   . ASP E 5 82  ? 34.437  4.099   20.970  1.00 88.65  ? 82  ASP L C   1 
ATOM   6971 O O   . ASP E 5 82  ? 33.714  5.067   21.180  1.00 87.82  ? 82  ASP L O   1 
ATOM   6972 C CB  . ASP E 5 82  ? 32.596  2.425   20.339  1.00 89.38  ? 82  ASP L CB  1 
ATOM   6973 C CG  . ASP E 5 82  ? 32.074  1.336   19.398  1.00 99.92  ? 82  ASP L CG  1 
ATOM   6974 O OD1 . ASP E 5 82  ? 32.557  1.254   18.244  1.00 100.68 ? 82  ASP L OD1 1 
ATOM   6975 O OD2 . ASP E 5 82  ? 31.182  0.572   19.814  1.00 105.15 ? 82  ASP L OD2 1 
ATOM   6976 N N   . ILE E 5 83  ? 35.637  3.957   21.559  1.00 85.03  ? 83  ILE L N   1 
ATOM   6977 C CA  . ILE E 5 83  ? 36.160  4.963   22.479  1.00 86.00  ? 83  ILE L CA  1 
ATOM   6978 C C   . ILE E 5 83  ? 36.509  6.213   21.687  1.00 90.54  ? 83  ILE L C   1 
ATOM   6979 O O   . ILE E 5 83  ? 37.404  6.163   20.859  1.00 90.47  ? 83  ILE L O   1 
ATOM   6980 C CB  . ILE E 5 83  ? 37.343  4.500   23.404  1.00 89.95  ? 83  ILE L CB  1 
ATOM   6981 C CG1 . ILE E 5 83  ? 38.450  3.751   22.674  1.00 91.16  ? 83  ILE L CG1 1 
ATOM   6982 C CG2 . ILE E 5 83  ? 36.896  3.703   24.590  1.00 92.09  ? 83  ILE L CG2 1 
ATOM   6983 C CD1 . ILE E 5 83  ? 39.571  4.594   22.196  1.00 103.74 ? 83  ILE L CD1 1 
ATOM   6984 N N   . ALA E 5 84  ? 35.728  7.286   21.842  1.00 87.06  ? 84  ALA L N   1 
ATOM   6985 C CA  . ALA E 5 84  ? 35.965  8.551   21.148  1.00 86.44  ? 84  ALA L CA  1 
ATOM   6986 C C   . ALA E 5 84  ? 35.122  9.659   21.792  1.00 90.89  ? 84  ALA L C   1 
ATOM   6987 O O   . ALA E 5 84  ? 34.440  9.399   22.789  1.00 90.72  ? 84  ALA L O   1 
ATOM   6988 C CB  . ALA E 5 84  ? 35.620  8.410   19.679  1.00 86.93  ? 84  ALA L CB  1 
ATOM   6989 N N   . THR E 5 85  ? 35.207  10.901  21.259  1.00 86.91  ? 85  THR L N   1 
ATOM   6990 C CA  . THR E 5 85  ? 34.412  12.047  21.722  1.00 86.34  ? 85  THR L CA  1 
ATOM   6991 C C   . THR E 5 85  ? 33.292  12.246  20.685  1.00 89.92  ? 85  THR L C   1 
ATOM   6992 O O   . THR E 5 85  ? 33.574  12.462  19.503  1.00 90.02  ? 85  THR L O   1 
ATOM   6993 C CB  . THR E 5 85  ? 35.302  13.303  21.938  1.00 92.11  ? 85  THR L CB  1 
ATOM   6994 O OG1 . THR E 5 85  ? 36.334  13.004  22.887  1.00 94.06  ? 85  THR L OG1 1 
ATOM   6995 C CG2 . THR E 5 85  ? 34.507  14.531  22.399  1.00 86.72  ? 85  THR L CG2 1 
ATOM   6996 N N   . TYR E 5 86  ? 32.036  12.130  21.117  1.00 85.60  ? 86  TYR L N   1 
ATOM   6997 C CA  . TYR E 5 86  ? 30.885  12.261  20.232  1.00 84.65  ? 86  TYR L CA  1 
ATOM   6998 C C   . TYR E 5 86  ? 30.291  13.652  20.268  1.00 93.47  ? 86  TYR L C   1 
ATOM   6999 O O   . TYR E 5 86  ? 30.301  14.292  21.321  1.00 94.51  ? 86  TYR L O   1 
ATOM   7000 C CB  . TYR E 5 86  ? 29.862  11.183  20.534  1.00 83.90  ? 86  TYR L CB  1 
ATOM   7001 C CG  . TYR E 5 86  ? 30.401  9.798   20.257  1.00 84.72  ? 86  TYR L CG  1 
ATOM   7002 C CD1 . TYR E 5 86  ? 31.243  9.158   21.166  1.00 86.65  ? 86  TYR L CD1 1 
ATOM   7003 C CD2 . TYR E 5 86  ? 30.124  9.149   19.060  1.00 85.31  ? 86  TYR L CD2 1 
ATOM   7004 C CE1 . TYR E 5 86  ? 31.788  7.903   20.891  1.00 86.45  ? 86  TYR L CE1 1 
ATOM   7005 C CE2 . TYR E 5 86  ? 30.620  7.873   18.799  1.00 85.94  ? 86  TYR L CE2 1 
ATOM   7006 C CZ  . TYR E 5 86  ? 31.461  7.260   19.711  1.00 92.70  ? 86  TYR L CZ  1 
ATOM   7007 O OH  . TYR E 5 86  ? 31.938  6.007   19.433  1.00 96.76  ? 86  TYR L OH  1 
ATOM   7008 N N   . PHE E 5 87  ? 29.821  14.146  19.110  1.00 92.45  ? 87  PHE L N   1 
ATOM   7009 C CA  . PHE E 5 87  ? 29.243  15.484  18.989  1.00 93.58  ? 87  PHE L CA  1 
ATOM   7010 C C   . PHE E 5 87  ? 27.966  15.423  18.199  1.00 102.60 ? 87  PHE L C   1 
ATOM   7011 O O   . PHE E 5 87  ? 27.906  14.705  17.212  1.00 103.24 ? 87  PHE L O   1 
ATOM   7012 C CB  . PHE E 5 87  ? 30.192  16.423  18.237  1.00 94.94  ? 87  PHE L CB  1 
ATOM   7013 C CG  . PHE E 5 87  ? 31.535  16.718  18.860  1.00 96.19  ? 87  PHE L CG  1 
ATOM   7014 C CD1 . PHE E 5 87  ? 31.724  17.852  19.636  1.00 99.18  ? 87  PHE L CD1 1 
ATOM   7015 C CD2 . PHE E 5 87  ? 32.642  15.939  18.560  1.00 98.15  ? 87  PHE L CD2 1 
ATOM   7016 C CE1 . PHE E 5 87  ? 32.982  18.157  20.167  1.00 100.10 ? 87  PHE L CE1 1 
ATOM   7017 C CE2 . PHE E 5 87  ? 33.900  16.242  19.093  1.00 101.10 ? 87  PHE L CE2 1 
ATOM   7018 C CZ  . PHE E 5 87  ? 34.063  17.350  19.888  1.00 99.18  ? 87  PHE L CZ  1 
ATOM   7019 N N   . CYS E 5 88  ? 26.969  16.229  18.591  1.00 101.48 ? 88  CYS L N   1 
ATOM   7020 C CA  . CYS E 5 88  ? 25.720  16.380  17.857  1.00 102.30 ? 88  CYS L CA  1 
ATOM   7021 C C   . CYS E 5 88  ? 25.761  17.744  17.206  1.00 102.88 ? 88  CYS L C   1 
ATOM   7022 O O   . CYS E 5 88  ? 26.431  18.634  17.720  1.00 102.44 ? 88  CYS L O   1 
ATOM   7023 C CB  . CYS E 5 88  ? 24.492  16.212  18.753  1.00 104.32 ? 88  CYS L CB  1 
ATOM   7024 S SG  . CYS E 5 88  ? 24.482  17.246  20.239  1.00 109.46 ? 88  CYS L SG  1 
ATOM   7025 N N   . GLN E 5 89  ? 25.104  17.910  16.064  1.00 97.15  ? 89  GLN L N   1 
ATOM   7026 C CA  . GLN E 5 89  ? 25.109  19.191  15.363  1.00 96.01  ? 89  GLN L CA  1 
ATOM   7027 C C   . GLN E 5 89  ? 23.740  19.428  14.774  1.00 100.46 ? 89  GLN L C   1 
ATOM   7028 O O   . GLN E 5 89  ? 23.079  18.463  14.395  1.00 100.52 ? 89  GLN L O   1 
ATOM   7029 C CB  . GLN E 5 89  ? 26.174  19.203  14.259  1.00 96.62  ? 89  GLN L CB  1 
ATOM   7030 C CG  . GLN E 5 89  ? 25.586  18.990  12.860  1.00 101.77 ? 89  GLN L CG  1 
ATOM   7031 C CD  . GLN E 5 89  ? 26.126  19.924  11.845  1.00 111.52 ? 89  GLN L CD  1 
ATOM   7032 O OE1 . GLN E 5 89  ? 27.339  20.059  11.728  1.00 106.80 ? 89  GLN L OE1 1 
ATOM   7033 N NE2 . GLN E 5 89  ? 25.249  20.560  11.073  1.00 103.41 ? 89  GLN L NE2 1 
ATOM   7034 N N   . GLN E 5 90  ? 23.309  20.694  14.694  1.00 96.84  ? 90  GLN L N   1 
ATOM   7035 C CA  . GLN E 5 90  ? 22.033  21.052  14.069  1.00 96.64  ? 90  GLN L CA  1 
ATOM   7036 C C   . GLN E 5 90  ? 22.287  21.640  12.655  1.00 101.81 ? 90  GLN L C   1 
ATOM   7037 O O   . GLN E 5 90  ? 23.326  22.268  12.406  1.00 101.86 ? 90  GLN L O   1 
ATOM   7038 C CB  . GLN E 5 90  ? 21.166  21.985  14.952  1.00 97.32  ? 90  GLN L CB  1 
ATOM   7039 C CG  . GLN E 5 90  ? 21.582  23.452  14.969  1.00 98.60  ? 90  GLN L CG  1 
ATOM   7040 C CD  . GLN E 5 90  ? 21.039  24.425  14.008  1.00 110.36 ? 90  GLN L CD  1 
ATOM   7041 O OE1 . GLN E 5 90  ? 20.228  24.120  13.171  1.00 106.81 ? 90  GLN L OE1 1 
ATOM   7042 N NE2 . GLN E 5 90  ? 21.483  25.641  14.136  1.00 99.26  ? 90  GLN L NE2 1 
ATOM   7043 N N   . GLY E 5 91  ? 21.328  21.388  11.762  1.00 97.41  ? 91  GLY L N   1 
ATOM   7044 C CA  . GLY E 5 91  ? 21.338  21.849  10.385  1.00 96.88  ? 91  GLY L CA  1 
ATOM   7045 C C   . GLY E 5 91  ? 20.028  22.504  10.003  1.00 101.44 ? 91  GLY L C   1 
ATOM   7046 O O   . GLY E 5 91  ? 19.663  22.512  8.830   1.00 103.18 ? 91  GLY L O   1 
ATOM   7047 N N   . ASN E 5 92  ? 19.304  23.050  10.987  1.00 96.51  ? 92  ASN L N   1 
ATOM   7048 C CA  . ASN E 5 92  ? 18.014  23.721  10.807  1.00 95.70  ? 92  ASN L CA  1 
ATOM   7049 C C   . ASN E 5 92  ? 18.205  25.193  10.373  1.00 98.08  ? 92  ASN L C   1 
ATOM   7050 O O   . ASN E 5 92  ? 17.653  25.613  9.353   1.00 96.82  ? 92  ASN L O   1 
ATOM   7051 C CB  . ASN E 5 92  ? 17.171  23.596  12.085  1.00 94.57  ? 92  ASN L CB  1 
ATOM   7052 C CG  . ASN E 5 92  ? 15.871  24.359  12.055  1.00 120.86 ? 92  ASN L CG  1 
ATOM   7053 O OD1 . ASN E 5 92  ? 15.718  25.427  12.665  1.00 118.11 ? 92  ASN L OD1 1 
ATOM   7054 N ND2 . ASN E 5 92  ? 14.882  23.790  11.371  1.00 110.40 ? 92  ASN L ND2 1 
ATOM   7055 N N   . THR E 5 93  ? 18.981  25.970  11.147  1.00 94.29  ? 93  THR L N   1 
ATOM   7056 C CA  . THR E 5 93  ? 19.278  27.361  10.806  1.00 93.70  ? 93  THR L CA  1 
ATOM   7057 C C   . THR E 5 93  ? 20.770  27.686  10.925  1.00 96.68  ? 93  THR L C   1 
ATOM   7058 O O   . THR E 5 93  ? 21.478  27.125  11.769  1.00 96.88  ? 93  THR L O   1 
ATOM   7059 C CB  . THR E 5 93  ? 18.457  28.375  11.608  1.00 102.43 ? 93  THR L CB  1 
ATOM   7060 O OG1 . THR E 5 93  ? 18.784  28.254  12.990  1.00 105.13 ? 93  THR L OG1 1 
ATOM   7061 C CG2 . THR E 5 93  ? 16.951  28.290  11.347  1.00 100.70 ? 93  THR L CG2 1 
ATOM   7062 N N   . ARG E 5 94  ? 21.231  28.612  10.072  1.00 91.57  ? 94  ARG L N   1 
ATOM   7063 C CA  . ARG E 5 94  ? 22.601  29.086  10.071  1.00 90.62  ? 94  ARG L CA  1 
ATOM   7064 C C   . ARG E 5 94  ? 22.828  30.091  11.237  1.00 94.68  ? 94  ARG L C   1 
ATOM   7065 O O   . ARG E 5 94  ? 21.942  30.900  11.494  1.00 95.41  ? 94  ARG L O   1 
ATOM   7066 C CB  . ARG E 5 94  ? 22.970  29.640  8.700   1.00 88.88  ? 94  ARG L CB  1 
ATOM   7067 C CG  . ARG E 5 94  ? 23.901  28.681  7.972   1.00 89.68  ? 94  ARG L CG  1 
ATOM   7068 C CD  . ARG E 5 94  ? 23.718  28.704  6.461   1.00 101.96 ? 94  ARG L CD  1 
ATOM   7069 N NE  . ARG E 5 94  ? 22.431  28.150  6.048   1.00 109.27 ? 94  ARG L NE  1 
ATOM   7070 C CZ  . ARG E 5 94  ? 22.175  27.659  4.841   1.00 116.83 ? 94  ARG L CZ  1 
ATOM   7071 N NH1 . ARG E 5 94  ? 23.127  27.628  3.907   1.00 106.22 ? 94  ARG L NH1 1 
ATOM   7072 N NH2 . ARG E 5 94  ? 20.973  27.186  4.553   1.00 95.90  ? 94  ARG L NH2 1 
ATOM   7073 N N   . PRO E 5 95  ? 23.948  30.045  11.997  1.00 90.04  ? 95  PRO L N   1 
ATOM   7074 C CA  . PRO E 5 95  ? 25.114  29.175  11.846  1.00 89.86  ? 95  PRO L CA  1 
ATOM   7075 C C   . PRO E 5 95  ? 24.895  27.774  12.374  1.00 95.26  ? 95  PRO L C   1 
ATOM   7076 O O   . PRO E 5 95  ? 24.123  27.600  13.322  1.00 96.07  ? 95  PRO L O   1 
ATOM   7077 C CB  . PRO E 5 95  ? 26.199  29.920  12.628  1.00 91.15  ? 95  PRO L CB  1 
ATOM   7078 C CG  . PRO E 5 95  ? 25.475  30.595  13.699  1.00 95.64  ? 95  PRO L CG  1 
ATOM   7079 C CD  . PRO E 5 95  ? 24.140  30.986  13.113  1.00 91.27  ? 95  PRO L CD  1 
ATOM   7080 N N   . TRP E 5 96  ? 25.567  26.770  11.745  1.00 91.15  ? 96  TRP L N   1 
ATOM   7081 C CA  . TRP E 5 96  ? 25.489  25.387  12.203  1.00 90.23  ? 96  TRP L CA  1 
ATOM   7082 C C   . TRP E 5 96  ? 26.197  25.378  13.543  1.00 96.63  ? 96  TRP L C   1 
ATOM   7083 O O   . TRP E 5 96  ? 27.258  26.003  13.707  1.00 96.96  ? 96  TRP L O   1 
ATOM   7084 C CB  . TRP E 5 96  ? 26.139  24.391  11.221  1.00 87.67  ? 96  TRP L CB  1 
ATOM   7085 C CG  . TRP E 5 96  ? 25.787  24.544  9.764   1.00 88.02  ? 96  TRP L CG  1 
ATOM   7086 C CD1 . TRP E 5 96  ? 26.660  24.526  8.718   1.00 90.82  ? 96  TRP L CD1 1 
ATOM   7087 C CD2 . TRP E 5 96  ? 24.479  24.708  9.188   1.00 87.62  ? 96  TRP L CD2 1 
ATOM   7088 N NE1 . TRP E 5 96  ? 25.984  24.678  7.525   1.00 89.78  ? 96  TRP L NE1 1 
ATOM   7089 C CE2 . TRP E 5 96  ? 24.647  24.802  7.785   1.00 90.62  ? 96  TRP L CE2 1 
ATOM   7090 C CE3 . TRP E 5 96  ? 23.186  24.828  9.721   1.00 88.94  ? 96  TRP L CE3 1 
ATOM   7091 C CZ2 . TRP E 5 96  ? 23.575  24.984  6.912   1.00 89.66  ? 96  TRP L CZ2 1 
ATOM   7092 C CZ3 . TRP E 5 96  ? 22.126  25.032  8.851   1.00 90.25  ? 96  TRP L CZ3 1 
ATOM   7093 C CH2 . TRP E 5 96  ? 22.326  25.097  7.464   1.00 90.56  ? 96  TRP L CH2 1 
ATOM   7094 N N   . THR E 5 97  ? 25.560  24.759  14.517  1.00 93.54  ? 97  THR L N   1 
ATOM   7095 C CA  . THR E 5 97  ? 26.084  24.718  15.868  1.00 93.66  ? 97  THR L CA  1 
ATOM   7096 C C   . THR E 5 97  ? 26.278  23.288  16.276  1.00 96.76  ? 97  THR L C   1 
ATOM   7097 O O   . THR E 5 97  ? 25.486  22.427  15.886  1.00 96.77  ? 97  THR L O   1 
ATOM   7098 C CB  . THR E 5 97  ? 25.158  25.496  16.787  1.00 106.63 ? 97  THR L CB  1 
ATOM   7099 O OG1 . THR E 5 97  ? 23.936  25.715  16.066  1.00 111.05 ? 97  THR L OG1 1 
ATOM   7100 C CG2 . THR E 5 97  ? 25.748  26.857  17.154  1.00 104.77 ? 97  THR L CG2 1 
ATOM   7101 N N   . PHE E 5 98  ? 27.339  23.037  17.042  1.00 91.67  ? 98  PHE L N   1 
ATOM   7102 C CA  . PHE E 5 98  ? 27.707  21.723  17.545  1.00 90.77  ? 98  PHE L CA  1 
ATOM   7103 C C   . PHE E 5 98  ? 27.510  21.670  19.058  1.00 95.32  ? 98  PHE L C   1 
ATOM   7104 O O   . PHE E 5 98  ? 27.548  22.703  19.726  1.00 94.89  ? 98  PHE L O   1 
ATOM   7105 C CB  . PHE E 5 98  ? 29.189  21.433  17.225  1.00 92.31  ? 98  PHE L CB  1 
ATOM   7106 C CG  . PHE E 5 98  ? 29.550  21.307  15.762  1.00 93.40  ? 98  PHE L CG  1 
ATOM   7107 C CD1 . PHE E 5 98  ? 29.837  22.432  14.999  1.00 95.40  ? 98  PHE L CD1 1 
ATOM   7108 C CD2 . PHE E 5 98  ? 29.667  20.062  15.166  1.00 95.13  ? 98  PHE L CD2 1 
ATOM   7109 C CE1 . PHE E 5 98  ? 30.183  22.313  13.653  1.00 96.43  ? 98  PHE L CE1 1 
ATOM   7110 C CE2 . PHE E 5 98  ? 30.013  19.947  13.821  1.00 97.71  ? 98  PHE L CE2 1 
ATOM   7111 C CZ  . PHE E 5 98  ? 30.255  21.073  13.067  1.00 95.90  ? 98  PHE L CZ  1 
ATOM   7112 N N   . GLY E 5 99  ? 27.313  20.462  19.585  1.00 92.67  ? 99  GLY L N   1 
ATOM   7113 C CA  . GLY E 5 99  ? 27.230  20.206  21.017  1.00 92.22  ? 99  GLY L CA  1 
ATOM   7114 C C   . GLY E 5 99  ? 28.627  20.240  21.611  1.00 97.02  ? 99  GLY L C   1 
ATOM   7115 O O   . GLY E 5 99  ? 29.602  20.051  20.887  1.00 98.16  ? 99  GLY L O   1 
ATOM   7116 N N   . GLY E 5 100 ? 28.722  20.560  22.899  1.00 93.82  ? 100 GLY L N   1 
ATOM   7117 C CA  . GLY E 5 100 ? 30.028  20.652  23.573  1.00 93.89  ? 100 GLY L CA  1 
ATOM   7118 C C   . GLY E 5 100 ? 30.809  19.365  23.433  1.00 97.52  ? 100 GLY L C   1 
ATOM   7119 O O   . GLY E 5 100 ? 32.025  19.382  23.653  1.00 95.13  ? 100 GLY L O   1 
ATOM   7120 N N   . GLY E 5 101 ? 30.117  18.273  23.126  1.00 95.66  ? 101 GLY L N   1 
ATOM   7121 C CA  . GLY E 5 101 ? 30.795  16.978  22.949  1.00 95.77  ? 101 GLY L CA  1 
ATOM   7122 C C   . GLY E 5 101 ? 30.850  16.177  24.229  1.00 99.35  ? 101 GLY L C   1 
ATOM   7123 O O   . GLY E 5 101 ? 31.111  16.758  25.281  1.00 99.36  ? 101 GLY L O   1 
ATOM   7124 N N   . THR E 5 102 ? 30.605  14.873  24.130  1.00 94.31  ? 102 THR L N   1 
ATOM   7125 C CA  . THR E 5 102 ? 30.656  13.987  25.316  1.00 93.35  ? 102 THR L CA  1 
ATOM   7126 C C   . THR E 5 102 ? 31.669  12.880  25.039  1.00 95.04  ? 102 THR L C   1 
ATOM   7127 O O   . THR E 5 102 ? 31.478  12.149  24.076  1.00 93.44  ? 102 THR L O   1 
ATOM   7128 C CB  . THR E 5 102 ? 29.266  13.453  25.670  1.00 98.10  ? 102 THR L CB  1 
ATOM   7129 O OG1 . THR E 5 102 ? 29.154  12.123  25.172  1.00 95.06  ? 102 THR L OG1 1 
ATOM   7130 C CG2 . THR E 5 102 ? 28.154  14.298  25.093  1.00 97.08  ? 102 THR L CG2 1 
ATOM   7131 N N   . LYS E 5 103 ? 32.686  12.762  25.888  1.00 89.64  ? 103 LYS L N   1 
ATOM   7132 C CA  . LYS E 5 103 ? 33.747  11.741  25.717  1.00 87.73  ? 103 LYS L CA  1 
ATOM   7133 C C   . LYS E 5 103 ? 33.212  10.379  26.153  1.00 91.98  ? 103 LYS L C   1 
ATOM   7134 O O   . LYS E 5 103 ? 32.252  10.341  26.913  1.00 92.05  ? 103 LYS L O   1 
ATOM   7135 C CB  . LYS E 5 103 ? 34.949  12.134  26.575  1.00 88.79  ? 103 LYS L CB  1 
ATOM   7136 C CG  . LYS E 5 103 ? 36.313  11.935  25.933  1.00 101.63 ? 103 LYS L CG  1 
ATOM   7137 C CD  . LYS E 5 103 ? 37.259  11.133  26.798  1.00 109.52 ? 103 LYS L CD  1 
ATOM   7138 C CE  . LYS E 5 103 ? 38.258  11.991  27.544  1.00 116.67 ? 103 LYS L CE  1 
ATOM   7139 N NZ  . LYS E 5 103 ? 38.990  11.212  28.568  1.00 125.17 ? 103 LYS L NZ  1 
ATOM   7140 N N   . VAL E 5 104 ? 33.838  9.299   25.696  1.00 88.02  ? 104 VAL L N   1 
ATOM   7141 C CA  . VAL E 5 104 ? 33.395  7.932   26.086  1.00 87.28  ? 104 VAL L CA  1 
ATOM   7142 C C   . VAL E 5 104 ? 34.642  7.098   26.355  1.00 89.55  ? 104 VAL L C   1 
ATOM   7143 O O   . VAL E 5 104 ? 35.562  7.162   25.547  1.00 89.86  ? 104 VAL L O   1 
ATOM   7144 C CB  . VAL E 5 104 ? 32.529  7.289   24.992  1.00 90.27  ? 104 VAL L CB  1 
ATOM   7145 C CG1 . VAL E 5 104 ? 32.439  5.787   25.170  1.00 90.03  ? 104 VAL L CG1 1 
ATOM   7146 C CG2 . VAL E 5 104 ? 31.143  7.897   24.944  1.00 90.00  ? 104 VAL L CG2 1 
ATOM   7147 N N   . GLU E 5 105 ? 34.663  6.366   27.465  1.00 84.08  ? 105 GLU L N   1 
ATOM   7148 C CA  . GLU E 5 105 ? 35.836  5.525   27.807  1.00 83.38  ? 105 GLU L CA  1 
ATOM   7149 C C   . GLU E 5 105 ? 35.361  4.112   28.123  1.00 87.91  ? 105 GLU L C   1 
ATOM   7150 O O   . GLU E 5 105 ? 34.165  3.916   28.290  1.00 88.46  ? 105 GLU L O   1 
ATOM   7151 C CB  . GLU E 5 105 ? 36.543  6.080   29.038  1.00 84.55  ? 105 GLU L CB  1 
ATOM   7152 C CG  . GLU E 5 105 ? 37.065  7.483   28.850  1.00 96.10  ? 105 GLU L CG  1 
ATOM   7153 C CD  . GLU E 5 105 ? 38.575  7.563   28.916  1.00 135.42 ? 105 GLU L CD  1 
ATOM   7154 O OE1 . GLU E 5 105 ? 39.128  8.553   28.420  1.00 138.46 ? 105 GLU L OE1 1 
ATOM   7155 O OE2 . GLU E 5 105 ? 39.191  6.634   29.460  1.00 144.62 ? 105 GLU L OE2 1 
ATOM   7156 N N   . ILE E 5 106 ? 36.285  3.169   28.234  1.00 83.51  ? 106 ILE L N   1 
ATOM   7157 C CA  . ILE E 5 106 ? 35.854  1.826   28.527  1.00 83.59  ? 106 ILE L CA  1 
ATOM   7158 C C   . ILE E 5 106 ? 36.424  1.332   29.861  1.00 89.67  ? 106 ILE L C   1 
ATOM   7159 O O   . ILE E 5 106 ? 37.641  1.340   30.066  1.00 90.12  ? 106 ILE L O   1 
ATOM   7160 C CB  . ILE E 5 106 ? 36.081  0.854   27.323  1.00 85.93  ? 106 ILE L CB  1 
ATOM   7161 C CG1 . ILE E 5 106 ? 34.904  1.048   26.344  1.00 85.81  ? 106 ILE L CG1 1 
ATOM   7162 C CG2 . ILE E 5 106 ? 36.153  -0.635  27.769  1.00 85.75  ? 106 ILE L CG2 1 
ATOM   7163 C CD1 . ILE E 5 106 ? 35.017  0.529   25.049  1.00 90.31  ? 106 ILE L CD1 1 
ATOM   7164 N N   . LYS E 5 107 ? 35.506  0.898   30.764  1.00 85.86  ? 107 LYS L N   1 
ATOM   7165 C CA  . LYS E 5 107 ? 35.822  0.277   32.055  1.00 84.94  ? 107 LYS L CA  1 
ATOM   7166 C C   . LYS E 5 107 ? 36.221  -1.192  31.825  1.00 88.06  ? 107 LYS L C   1 
ATOM   7167 O O   . LYS E 5 107 ? 35.483  -1.937  31.165  1.00 88.20  ? 107 LYS L O   1 
ATOM   7168 C CB  . LYS E 5 107 ? 34.645  0.383   33.044  1.00 86.88  ? 107 LYS L CB  1 
ATOM   7169 C CG  . LYS E 5 107 ? 34.473  1.781   33.636  1.00 106.88 ? 107 LYS L CG  1 
ATOM   7170 C CD  . LYS E 5 107 ? 33.969  1.770   35.087  1.00 118.70 ? 107 LYS L CD  1 
ATOM   7171 C CE  . LYS E 5 107 ? 34.392  2.998   35.877  1.00 132.68 ? 107 LYS L CE  1 
ATOM   7172 N NZ  . LYS E 5 107 ? 35.828  2.951   36.292  1.00 139.68 ? 107 LYS L NZ  1 
ATOM   7173 N N   . ARG E 5 108 ? 37.420  -1.583  32.315  1.00 82.64  ? 108 ARG L N   1 
ATOM   7174 C CA  . ARG E 5 108 ? 37.981  -2.942  32.183  1.00 80.86  ? 108 ARG L CA  1 
ATOM   7175 C C   . ARG E 5 108 ? 38.786  -3.348  33.435  1.00 82.39  ? 108 ARG L C   1 
ATOM   7176 O O   . ARG E 5 108 ? 39.033  -2.517  34.308  1.00 81.90  ? 108 ARG L O   1 
ATOM   7177 C CB  . ARG E 5 108 ? 38.853  -3.069  30.915  1.00 78.58  ? 108 ARG L CB  1 
ATOM   7178 C CG  . ARG E 5 108 ? 40.151  -2.258  31.002  1.00 87.30  ? 108 ARG L CG  1 
ATOM   7179 C CD  . ARG E 5 108 ? 41.171  -2.628  29.946  1.00 84.68  ? 108 ARG L CD  1 
ATOM   7180 N NE  . ARG E 5 108 ? 41.861  -3.888  30.209  1.00 71.71  ? 108 ARG L NE  1 
ATOM   7181 C CZ  . ARG E 5 108 ? 42.885  -4.020  31.034  1.00 85.39  ? 108 ARG L CZ  1 
ATOM   7182 N NH1 . ARG E 5 108 ? 43.304  -2.984  31.744  1.00 86.03  ? 108 ARG L NH1 1 
ATOM   7183 N NH2 . ARG E 5 108 ? 43.461  -5.197  31.214  1.00 76.58  ? 108 ARG L NH2 1 
ATOM   7184 N N   . THR E 5 109 ? 39.206  -4.620  33.495  1.00 76.80  ? 109 THR L N   1 
ATOM   7185 C CA  . THR E 5 109 ? 39.998  -5.203  34.571  1.00 75.89  ? 109 THR L CA  1 
ATOM   7186 C C   . THR E 5 109 ? 41.257  -4.393  34.817  1.00 82.24  ? 109 THR L C   1 
ATOM   7187 O O   . THR E 5 109 ? 42.056  -4.225  33.889  1.00 83.12  ? 109 THR L O   1 
ATOM   7188 C CB  . THR E 5 109 ? 40.466  -6.581  34.152  1.00 78.51  ? 109 THR L CB  1 
ATOM   7189 O OG1 . THR E 5 109 ? 39.508  -7.191  33.278  1.00 74.61  ? 109 THR L OG1 1 
ATOM   7190 C CG2 . THR E 5 109 ? 40.819  -7.449  35.334  1.00 78.59  ? 109 THR L CG2 1 
ATOM   7191 N N   . VAL E 5 110 ? 41.444  -3.912  36.073  1.00 78.32  ? 110 VAL L N   1 
ATOM   7192 C CA  . VAL E 5 110 ? 42.606  -3.153  36.561  1.00 77.04  ? 110 VAL L CA  1 
ATOM   7193 C C   . VAL E 5 110 ? 43.884  -3.846  36.117  1.00 78.83  ? 110 VAL L C   1 
ATOM   7194 O O   . VAL E 5 110 ? 44.035  -5.058  36.309  1.00 77.53  ? 110 VAL L O   1 
ATOM   7195 C CB  . VAL E 5 110 ? 42.573  -2.965  38.103  1.00 80.44  ? 110 VAL L CB  1 
ATOM   7196 C CG1 . VAL E 5 110 ? 43.741  -2.125  38.596  1.00 80.23  ? 110 VAL L CG1 1 
ATOM   7197 C CG2 . VAL E 5 110 ? 41.262  -2.331  38.539  1.00 80.78  ? 110 VAL L CG2 1 
ATOM   7198 N N   . ALA E 5 111 ? 44.757  -3.087  35.455  1.00 73.97  ? 111 ALA L N   1 
ATOM   7199 C CA  . ALA E 5 111 ? 46.035  -3.599  35.032  1.00 73.89  ? 111 ALA L CA  1 
ATOM   7200 C C   . ALA E 5 111 ? 47.113  -2.649  35.513  1.00 75.52  ? 111 ALA L C   1 
ATOM   7201 O O   . ALA E 5 111 ? 47.038  -1.445  35.264  1.00 74.29  ? 111 ALA L O   1 
ATOM   7202 C CB  . ALA E 5 111 ? 46.076  -3.750  33.529  1.00 75.11  ? 111 ALA L CB  1 
ATOM   7203 N N   . ALA E 5 112 ? 48.088  -3.195  36.247  1.00 70.96  ? 112 ALA L N   1 
ATOM   7204 C CA  . ALA E 5 112 ? 49.207  -2.434  36.768  1.00 70.61  ? 112 ALA L CA  1 
ATOM   7205 C C   . ALA E 5 112 ? 50.122  -1.973  35.621  1.00 74.81  ? 112 ALA L C   1 
ATOM   7206 O O   . ALA E 5 112 ? 50.223  -2.653  34.589  1.00 73.89  ? 112 ALA L O   1 
ATOM   7207 C CB  . ALA E 5 112 ? 49.981  -3.281  37.768  1.00 71.32  ? 112 ALA L CB  1 
ATOM   7208 N N   . PRO E 5 113 ? 50.771  -0.799  35.731  1.00 73.28  ? 113 PRO L N   1 
ATOM   7209 C CA  . PRO E 5 113 ? 51.659  -0.384  34.636  1.00 73.73  ? 113 PRO L CA  1 
ATOM   7210 C C   . PRO E 5 113 ? 52.994  -1.125  34.680  1.00 81.22  ? 113 PRO L C   1 
ATOM   7211 O O   . PRO E 5 113 ? 53.452  -1.573  35.756  1.00 82.67  ? 113 PRO L O   1 
ATOM   7212 C CB  . PRO E 5 113 ? 51.838  1.112   34.869  1.00 74.67  ? 113 PRO L CB  1 
ATOM   7213 C CG  . PRO E 5 113 ? 51.681  1.290   36.317  1.00 78.86  ? 113 PRO L CG  1 
ATOM   7214 C CD  . PRO E 5 113 ? 50.791  0.177   36.841  1.00 74.49  ? 113 PRO L CD  1 
ATOM   7215 N N   . SER E 5 114 ? 53.596  -1.278  33.493  1.00 76.90  ? 114 SER L N   1 
ATOM   7216 C CA  . SER E 5 114 ? 54.927  -1.833  33.306  1.00 75.41  ? 114 SER L CA  1 
ATOM   7217 C C   . SER E 5 114 ? 55.765  -0.563  33.347  1.00 76.82  ? 114 SER L C   1 
ATOM   7218 O O   . SER E 5 114 ? 55.544  0.355   32.555  1.00 74.85  ? 114 SER L O   1 
ATOM   7219 C CB  . SER E 5 114 ? 55.047  -2.512  31.943  1.00 79.26  ? 114 SER L CB  1 
ATOM   7220 O OG  . SER E 5 114 ? 53.958  -3.370  31.649  1.00 92.40  ? 114 SER L OG  1 
ATOM   7221 N N   . VAL E 5 115 ? 56.620  -0.443  34.352  1.00 73.61  ? 115 VAL L N   1 
ATOM   7222 C CA  . VAL E 5 115 ? 57.444  0.758   34.516  1.00 72.57  ? 115 VAL L CA  1 
ATOM   7223 C C   . VAL E 5 115 ? 58.795  0.532   33.830  1.00 78.64  ? 115 VAL L C   1 
ATOM   7224 O O   . VAL E 5 115 ? 59.359  -0.558  33.943  1.00 79.39  ? 115 VAL L O   1 
ATOM   7225 C CB  . VAL E 5 115 ? 57.603  1.179   35.997  1.00 73.72  ? 115 VAL L CB  1 
ATOM   7226 C CG1 . VAL E 5 115 ? 58.210  2.568   36.103  1.00 73.72  ? 115 VAL L CG1 1 
ATOM   7227 C CG2 . VAL E 5 115 ? 56.275  1.116   36.736  1.00 72.23  ? 115 VAL L CG2 1 
ATOM   7228 N N   . PHE E 5 116 ? 59.278  1.544   33.080  1.00 74.96  ? 116 PHE L N   1 
ATOM   7229 C CA  . PHE E 5 116 ? 60.562  1.536   32.367  1.00 74.00  ? 116 PHE L CA  1 
ATOM   7230 C C   . PHE E 5 116 ? 61.248  2.883   32.533  1.00 72.88  ? 116 PHE L C   1 
ATOM   7231 O O   . PHE E 5 116 ? 60.580  3.917   32.448  1.00 71.31  ? 116 PHE L O   1 
ATOM   7232 C CB  . PHE E 5 116 ? 60.358  1.251   30.880  1.00 76.38  ? 116 PHE L CB  1 
ATOM   7233 C CG  . PHE E 5 116 ? 59.569  0.007   30.541  1.00 78.33  ? 116 PHE L CG  1 
ATOM   7234 C CD1 . PHE E 5 116 ? 60.107  -1.257  30.756  1.00 81.47  ? 116 PHE L CD1 1 
ATOM   7235 C CD2 . PHE E 5 116 ? 58.317  0.100   29.942  1.00 80.02  ? 116 PHE L CD2 1 
ATOM   7236 C CE1 . PHE E 5 116 ? 59.401  -2.411  30.393  1.00 81.85  ? 116 PHE L CE1 1 
ATOM   7237 C CE2 . PHE E 5 116 ? 57.625  -1.049  29.552  1.00 82.64  ? 116 PHE L CE2 1 
ATOM   7238 C CZ  . PHE E 5 116 ? 58.169  -2.298  29.790  1.00 80.72  ? 116 PHE L CZ  1 
ATOM   7239 N N   . ILE E 5 117 ? 62.563  2.879   32.777  1.00 67.20  ? 117 ILE L N   1 
ATOM   7240 C CA  . ILE E 5 117 ? 63.307  4.123   32.954  1.00 66.91  ? 117 ILE L CA  1 
ATOM   7241 C C   . ILE E 5 117 ? 64.372  4.256   31.840  1.00 76.83  ? 117 ILE L C   1 
ATOM   7242 O O   . ILE E 5 117 ? 64.968  3.252   31.422  1.00 79.06  ? 117 ILE L O   1 
ATOM   7243 C CB  . ILE E 5 117 ? 63.847  4.302   34.408  1.00 68.91  ? 117 ILE L CB  1 
ATOM   7244 C CG1 . ILE E 5 117 ? 64.276  5.738   34.679  1.00 69.22  ? 117 ILE L CG1 1 
ATOM   7245 C CG2 . ILE E 5 117 ? 64.946  3.318   34.800  1.00 69.28  ? 117 ILE L CG2 1 
ATOM   7246 C CD1 . ILE E 5 117 ? 64.093  6.168   36.112  1.00 81.80  ? 117 ILE L CD1 1 
ATOM   7247 N N   . PHE E 5 118 ? 64.557  5.485   31.321  1.00 73.45  ? 118 PHE L N   1 
ATOM   7248 C CA  . PHE E 5 118 ? 65.516  5.766   30.261  1.00 72.93  ? 118 PHE L CA  1 
ATOM   7249 C C   . PHE E 5 118 ? 66.435  6.887   30.717  1.00 82.64  ? 118 PHE L C   1 
ATOM   7250 O O   . PHE E 5 118 ? 65.967  8.004   30.954  1.00 84.11  ? 118 PHE L O   1 
ATOM   7251 C CB  . PHE E 5 118 ? 64.809  6.167   28.969  1.00 73.84  ? 118 PHE L CB  1 
ATOM   7252 C CG  . PHE E 5 118 ? 63.854  5.150   28.398  1.00 74.99  ? 118 PHE L CG  1 
ATOM   7253 C CD1 . PHE E 5 118 ? 64.288  4.205   27.482  1.00 78.55  ? 118 PHE L CD1 1 
ATOM   7254 C CD2 . PHE E 5 118 ? 62.505  5.161   28.754  1.00 75.90  ? 118 PHE L CD2 1 
ATOM   7255 C CE1 . PHE E 5 118 ? 63.395  3.287   26.927  1.00 79.52  ? 118 PHE L CE1 1 
ATOM   7256 C CE2 . PHE E 5 118 ? 61.615  4.229   28.221  1.00 78.67  ? 118 PHE L CE2 1 
ATOM   7257 C CZ  . PHE E 5 118 ? 62.057  3.313   27.287  1.00 77.91  ? 118 PHE L CZ  1 
ATOM   7258 N N   . PRO E 5 119 ? 67.749  6.614   30.857  1.00 81.28  ? 119 PRO L N   1 
ATOM   7259 C CA  . PRO E 5 119 ? 68.683  7.667   31.288  1.00 80.98  ? 119 PRO L CA  1 
ATOM   7260 C C   . PRO E 5 119 ? 68.956  8.667   30.165  1.00 85.87  ? 119 PRO L C   1 
ATOM   7261 O O   . PRO E 5 119 ? 68.666  8.365   29.009  1.00 85.40  ? 119 PRO L O   1 
ATOM   7262 C CB  . PRO E 5 119 ? 69.949  6.880   31.667  1.00 82.80  ? 119 PRO L CB  1 
ATOM   7263 C CG  . PRO E 5 119 ? 69.555  5.415   31.630  1.00 87.67  ? 119 PRO L CG  1 
ATOM   7264 C CD  . PRO E 5 119 ? 68.458  5.341   30.637  1.00 83.52  ? 119 PRO L CD  1 
ATOM   7265 N N   . PRO E 5 120 ? 69.517  9.859   30.464  1.00 84.59  ? 120 PRO L N   1 
ATOM   7266 C CA  . PRO E 5 120 ? 69.810  10.807  29.389  1.00 85.50  ? 120 PRO L CA  1 
ATOM   7267 C C   . PRO E 5 120 ? 70.781  10.224  28.372  1.00 94.02  ? 120 PRO L C   1 
ATOM   7268 O O   . PRO E 5 120 ? 71.807  9.635   28.745  1.00 93.94  ? 120 PRO L O   1 
ATOM   7269 C CB  . PRO E 5 120 ? 70.443  11.989  30.127  1.00 86.81  ? 120 PRO L CB  1 
ATOM   7270 C CG  . PRO E 5 120 ? 69.961  11.872  31.514  1.00 91.10  ? 120 PRO L CG  1 
ATOM   7271 C CD  . PRO E 5 120 ? 69.910  10.417  31.773  1.00 86.49  ? 120 PRO L CD  1 
ATOM   7272 N N   . SER E 5 121 ? 70.432  10.376  27.081  1.00 92.56  ? 121 SER L N   1 
ATOM   7273 C CA  . SER E 5 121 ? 71.247  9.945   25.950  1.00 92.51  ? 121 SER L CA  1 
ATOM   7274 C C   . SER E 5 121 ? 72.574  10.714  25.926  1.00 99.26  ? 121 SER L C   1 
ATOM   7275 O O   . SER E 5 121 ? 72.629  11.864  26.362  1.00 98.87  ? 121 SER L O   1 
ATOM   7276 C CB  . SER E 5 121 ? 70.477  10.126  24.644  1.00 94.81  ? 121 SER L CB  1 
ATOM   7277 O OG  . SER E 5 121 ? 70.693  11.358  23.979  1.00 104.23 ? 121 SER L OG  1 
ATOM   7278 N N   . ASP E 5 122 ? 73.638  10.090  25.422  1.00 98.64  ? 122 ASP L N   1 
ATOM   7279 C CA  . ASP E 5 122 ? 74.946  10.748  25.346  1.00 99.52  ? 122 ASP L CA  1 
ATOM   7280 C C   . ASP E 5 122 ? 74.942  11.935  24.396  1.00 103.53 ? 122 ASP L C   1 
ATOM   7281 O O   . ASP E 5 122 ? 75.692  12.881  24.615  1.00 102.34 ? 122 ASP L O   1 
ATOM   7282 C CB  . ASP E 5 122 ? 76.050  9.751   24.984  1.00 101.82 ? 122 ASP L CB  1 
ATOM   7283 C CG  . ASP E 5 122 ? 76.435  8.838   26.138  1.00 113.66 ? 122 ASP L CG  1 
ATOM   7284 O OD1 . ASP E 5 122 ? 77.100  9.326   27.087  1.00 115.54 ? 122 ASP L OD1 1 
ATOM   7285 O OD2 . ASP E 5 122 ? 76.074  7.636   26.092  1.00 116.37 ? 122 ASP L OD2 1 
ATOM   7286 N N   . GLU E 5 123 ? 74.067  11.892  23.365  1.00 101.19 ? 123 GLU L N   1 
ATOM   7287 C CA  . GLU E 5 123 ? 73.874  12.943  22.357  1.00 100.94 ? 123 GLU L CA  1 
ATOM   7288 C C   . GLU E 5 123 ? 73.262  14.159  23.032  1.00 103.57 ? 123 GLU L C   1 
ATOM   7289 O O   . GLU E 5 123 ? 73.732  15.268  22.812  1.00 104.14 ? 123 GLU L O   1 
ATOM   7290 C CB  . GLU E 5 123 ? 72.952  12.451  21.213  1.00 102.70 ? 123 GLU L CB  1 
ATOM   7291 C CG  . GLU E 5 123 ? 73.560  11.424  20.260  1.00 114.89 ? 123 GLU L CG  1 
ATOM   7292 C CD  . GLU E 5 123 ? 73.994  10.092  20.852  1.00 132.49 ? 123 GLU L CD  1 
ATOM   7293 O OE1 . GLU E 5 123 ? 75.137  9.667   20.560  1.00 135.40 ? 123 GLU L OE1 1 
ATOM   7294 O OE2 . GLU E 5 123 ? 73.211  9.490   21.628  1.00 107.69 ? 123 GLU L OE2 1 
ATOM   7295 N N   . GLN E 5 124 ? 72.233  13.954  23.871  1.00 98.90  ? 124 GLN L N   1 
ATOM   7296 C CA  . GLN E 5 124 ? 71.586  15.038  24.611  1.00 98.34  ? 124 GLN L CA  1 
ATOM   7297 C C   . GLN E 5 124 ? 72.556  15.638  25.624  1.00 103.62 ? 124 GLN L C   1 
ATOM   7298 O O   . GLN E 5 124 ? 72.664  16.858  25.721  1.00 102.56 ? 124 GLN L O   1 
ATOM   7299 C CB  . GLN E 5 124 ? 70.314  14.552  25.308  1.00 98.98  ? 124 GLN L CB  1 
ATOM   7300 C CG  . GLN E 5 124 ? 69.400  15.703  25.672  1.00 99.08  ? 124 GLN L CG  1 
ATOM   7301 C CD  . GLN E 5 124 ? 68.363  15.336  26.685  1.00 106.51 ? 124 GLN L CD  1 
ATOM   7302 O OE1 . GLN E 5 124 ? 67.786  16.207  27.332  1.00 95.94  ? 124 GLN L OE1 1 
ATOM   7303 N NE2 . GLN E 5 124 ? 68.109  14.042  26.859  1.00 98.68  ? 124 GLN L NE2 1 
ATOM   7304 N N   . LEU E 5 125 ? 73.300  14.778  26.336  1.00 102.10 ? 125 LEU L N   1 
ATOM   7305 C CA  . LEU E 5 125 ? 74.299  15.216  27.304  1.00 102.73 ? 125 LEU L CA  1 
ATOM   7306 C C   . LEU E 5 125 ? 75.342  16.085  26.615  1.00 111.04 ? 125 LEU L C   1 
ATOM   7307 O O   . LEU E 5 125 ? 75.829  17.016  27.241  1.00 111.97 ? 125 LEU L O   1 
ATOM   7308 C CB  . LEU E 5 125 ? 74.961  14.018  27.968  1.00 102.64 ? 125 LEU L CB  1 
ATOM   7309 C CG  . LEU E 5 125 ? 74.141  13.287  28.995  1.00 107.47 ? 125 LEU L CG  1 
ATOM   7310 C CD1 . LEU E 5 125 ? 74.680  11.883  29.204  1.00 107.42 ? 125 LEU L CD1 1 
ATOM   7311 C CD2 . LEU E 5 125 ? 74.079  14.071  30.291  1.00 110.39 ? 125 LEU L CD2 1 
ATOM   7312 N N   . LYS E 5 126 ? 75.654  15.811  25.315  1.00 109.23 ? 126 LYS L N   1 
ATOM   7313 C CA  . LYS E 5 126 ? 76.575  16.616  24.508  1.00 110.08 ? 126 LYS L CA  1 
ATOM   7314 C C   . LYS E 5 126 ? 76.081  18.072  24.543  1.00 115.32 ? 126 LYS L C   1 
ATOM   7315 O O   . LYS E 5 126 ? 76.836  18.954  24.975  1.00 114.68 ? 126 LYS L O   1 
ATOM   7316 C CB  . LYS E 5 126 ? 76.639  16.122  23.032  1.00 112.85 ? 126 LYS L CB  1 
ATOM   7317 C CG  . LYS E 5 126 ? 77.835  15.250  22.662  1.00 124.54 ? 126 LYS L CG  1 
ATOM   7318 C CD  . LYS E 5 126 ? 77.454  14.257  21.563  1.00 133.12 ? 126 LYS L CD  1 
ATOM   7319 C CE  . LYS E 5 126 ? 78.479  13.158  21.367  1.00 141.85 ? 126 LYS L CE  1 
ATOM   7320 N NZ  . LYS E 5 126 ? 77.922  11.995  20.613  1.00 145.94 ? 126 LYS L NZ  1 
ATOM   7321 N N   . SER E 5 127 ? 74.781  18.296  24.169  1.00 112.52 ? 127 SER L N   1 
ATOM   7322 C CA  . SER E 5 127 ? 74.113  19.609  24.147  1.00 112.26 ? 127 SER L CA  1 
ATOM   7323 C C   . SER E 5 127 ? 74.363  20.405  25.442  1.00 114.96 ? 127 SER L C   1 
ATOM   7324 O O   . SER E 5 127 ? 74.803  21.559  25.380  1.00 116.19 ? 127 SER L O   1 
ATOM   7325 C CB  . SER E 5 127 ? 72.615  19.463  23.878  1.00 115.40 ? 127 SER L CB  1 
ATOM   7326 O OG  . SER E 5 127 ? 71.857  19.358  25.075  1.00 123.19 ? 127 SER L OG  1 
ATOM   7327 N N   . GLY E 5 128 ? 74.168  19.750  26.584  1.00 107.53 ? 128 GLY L N   1 
ATOM   7328 C CA  . GLY E 5 128 ? 74.376  20.373  27.877  1.00 105.79 ? 128 GLY L CA  1 
ATOM   7329 C C   . GLY E 5 128 ? 73.148  20.312  28.748  1.00 105.60 ? 128 GLY L C   1 
ATOM   7330 O O   . GLY E 5 128 ? 73.104  20.996  29.775  1.00 104.99 ? 128 GLY L O   1 
ATOM   7331 N N   . THR E 5 129 ? 72.181  19.428  28.408  1.00 98.36  ? 129 THR L N   1 
ATOM   7332 C CA  . THR E 5 129 ? 70.923  19.205  29.140  1.00 95.62  ? 129 THR L CA  1 
ATOM   7333 C C   . THR E 5 129 ? 70.636  17.690  29.218  1.00 93.60  ? 129 THR L C   1 
ATOM   7334 O O   . THR E 5 129 ? 70.864  16.978  28.253  1.00 92.89  ? 129 THR L O   1 
ATOM   7335 C CB  . THR E 5 129 ? 69.809  20.095  28.520  1.00 105.61 ? 129 THR L CB  1 
ATOM   7336 O OG1 . THR E 5 129 ? 69.605  21.225  29.370  1.00 107.28 ? 129 THR L OG1 1 
ATOM   7337 C CG2 . THR E 5 129 ? 68.479  19.371  28.272  1.00 103.90 ? 129 THR L CG2 1 
ATOM   7338 N N   . ALA E 5 130 ? 70.155  17.205  30.365  1.00 87.49  ? 130 ALA L N   1 
ATOM   7339 C CA  . ALA E 5 130 ? 69.843  15.786  30.607  1.00 85.21  ? 130 ALA L CA  1 
ATOM   7340 C C   . ALA E 5 130 ? 68.379  15.542  30.959  1.00 83.14  ? 130 ALA L C   1 
ATOM   7341 O O   . ALA E 5 130 ? 67.918  16.045  31.973  1.00 80.55  ? 130 ALA L O   1 
ATOM   7342 C CB  . ALA E 5 130 ? 70.725  15.251  31.718  1.00 85.87  ? 130 ALA L CB  1 
ATOM   7343 N N   . SER E 5 131 ? 67.647  14.797  30.112  1.00 79.07  ? 131 SER L N   1 
ATOM   7344 C CA  . SER E 5 131 ? 66.257  14.437  30.406  1.00 78.92  ? 131 SER L CA  1 
ATOM   7345 C C   . SER E 5 131 ? 66.109  12.936  30.632  1.00 80.40  ? 131 SER L C   1 
ATOM   7346 O O   . SER E 5 131 ? 66.462  12.131  29.773  1.00 78.75  ? 131 SER L O   1 
ATOM   7347 C CB  . SER E 5 131 ? 65.276  14.923  29.344  1.00 83.40  ? 131 SER L CB  1 
ATOM   7348 O OG  . SER E 5 131 ? 65.478  16.285  29.019  1.00 92.13  ? 131 SER L OG  1 
ATOM   7349 N N   . VAL E 5 132 ? 65.615  12.578  31.818  1.00 76.53  ? 132 VAL L N   1 
ATOM   7350 C CA  . VAL E 5 132 ? 65.375  11.201  32.232  1.00 76.02  ? 132 VAL L CA  1 
ATOM   7351 C C   . VAL E 5 132 ? 63.892  10.914  31.982  1.00 79.77  ? 132 VAL L C   1 
ATOM   7352 O O   . VAL E 5 132 ? 63.052  11.742  32.339  1.00 79.29  ? 132 VAL L O   1 
ATOM   7353 C CB  . VAL E 5 132 ? 65.778  10.959  33.706  1.00 79.17  ? 132 VAL L CB  1 
ATOM   7354 C CG1 . VAL E 5 132 ? 65.794  9.478   34.018  1.00 78.96  ? 132 VAL L CG1 1 
ATOM   7355 C CG2 . VAL E 5 132 ? 67.136  11.580  34.026  1.00 78.91  ? 132 VAL L CG2 1 
ATOM   7356 N N   . VAL E 5 133 ? 63.576  9.771   31.338  1.00 76.55  ? 133 VAL L N   1 
ATOM   7357 C CA  . VAL E 5 133 ? 62.198  9.413   30.997  1.00 76.47  ? 133 VAL L CA  1 
ATOM   7358 C C   . VAL E 5 133 ? 61.702  8.196   31.768  1.00 82.00  ? 133 VAL L C   1 
ATOM   7359 O O   . VAL E 5 133 ? 62.343  7.149   31.760  1.00 82.30  ? 133 VAL L O   1 
ATOM   7360 C CB  . VAL E 5 133 ? 61.970  9.260   29.466  1.00 79.79  ? 133 VAL L CB  1 
ATOM   7361 C CG1 . VAL E 5 133 ? 60.556  8.731   29.151  1.00 79.32  ? 133 VAL L CG1 1 
ATOM   7362 C CG2 . VAL E 5 133 ? 62.224  10.585  28.741  1.00 79.53  ? 133 VAL L CG2 1 
ATOM   7363 N N   . CYS E 5 134 ? 60.534  8.342   32.404  1.00 79.50  ? 134 CYS L N   1 
ATOM   7364 C CA  . CYS E 5 134 ? 59.861  7.296   33.162  1.00 79.60  ? 134 CYS L CA  1 
ATOM   7365 C C   . CYS E 5 134 ? 58.586  6.929   32.414  1.00 81.13  ? 134 CYS L C   1 
ATOM   7366 O O   . CYS E 5 134 ? 57.639  7.714   32.386  1.00 82.31  ? 134 CYS L O   1 
ATOM   7367 C CB  . CYS E 5 134 ? 59.562  7.768   34.585  1.00 80.54  ? 134 CYS L CB  1 
ATOM   7368 S SG  . CYS E 5 134 ? 58.792  6.513   35.639  1.00 84.92  ? 134 CYS L SG  1 
ATOM   7369 N N   . LEU E 5 135 ? 58.564  5.749   31.811  1.00 73.94  ? 135 LEU L N   1 
ATOM   7370 C CA  . LEU E 5 135 ? 57.396  5.266   31.097  1.00 73.05  ? 135 LEU L CA  1 
ATOM   7371 C C   . LEU E 5 135 ? 56.612  4.190   31.896  1.00 78.52  ? 135 LEU L C   1 
ATOM   7372 O O   . LEU E 5 135 ? 57.191  3.180   32.306  1.00 78.44  ? 135 LEU L O   1 
ATOM   7373 C CB  . LEU E 5 135 ? 57.848  4.724   29.758  1.00 72.91  ? 135 LEU L CB  1 
ATOM   7374 C CG  . LEU E 5 135 ? 56.849  3.886   28.976  1.00 77.09  ? 135 LEU L CG  1 
ATOM   7375 C CD1 . LEU E 5 135 ? 55.788  4.762   28.352  1.00 77.18  ? 135 LEU L CD1 1 
ATOM   7376 C CD2 . LEU E 5 135 ? 57.552  3.023   27.961  1.00 75.70  ? 135 LEU L CD2 1 
ATOM   7377 N N   . LEU E 5 136 ? 55.295  4.426   32.105  1.00 74.48  ? 136 LEU L N   1 
ATOM   7378 C CA  . LEU E 5 136 ? 54.327  3.531   32.760  1.00 73.43  ? 136 LEU L CA  1 
ATOM   7379 C C   . LEU E 5 136 ? 53.504  3.064   31.596  1.00 80.23  ? 136 LEU L C   1 
ATOM   7380 O O   . LEU E 5 136 ? 52.847  3.871   30.943  1.00 80.71  ? 136 LEU L O   1 
ATOM   7381 C CB  . LEU E 5 136 ? 53.437  4.301   33.730  1.00 72.80  ? 136 LEU L CB  1 
ATOM   7382 C CG  . LEU E 5 136 ? 54.035  4.703   35.068  1.00 77.51  ? 136 LEU L CG  1 
ATOM   7383 C CD1 . LEU E 5 136 ? 55.214  5.720   34.901  1.00 77.86  ? 136 LEU L CD1 1 
ATOM   7384 C CD2 . LEU E 5 136 ? 52.960  5.298   35.948  1.00 79.50  ? 136 LEU L CD2 1 
ATOM   7385 N N   . ASN E 5 137 ? 53.610  1.799   31.254  1.00 78.41  ? 137 ASN L N   1 
ATOM   7386 C CA  . ASN E 5 137 ? 53.000  1.353   30.020  1.00 78.91  ? 137 ASN L CA  1 
ATOM   7387 C C   . ASN E 5 137 ? 51.876  0.304   30.211  1.00 83.01  ? 137 ASN L C   1 
ATOM   7388 O O   . ASN E 5 137 ? 52.009  -0.640  30.989  1.00 81.40  ? 137 ASN L O   1 
ATOM   7389 C CB  . ASN E 5 137 ? 54.127  0.878   29.063  1.00 78.64  ? 137 ASN L CB  1 
ATOM   7390 C CG  . ASN E 5 137 ? 53.704  0.310   27.740  1.00 98.05  ? 137 ASN L CG  1 
ATOM   7391 O OD1 . ASN E 5 137 ? 53.579  -0.917  27.615  1.00 99.23  ? 137 ASN L OD1 1 
ATOM   7392 N ND2 . ASN E 5 137 ? 53.518  1.150   26.726  1.00 80.11  ? 137 ASN L ND2 1 
ATOM   7393 N N   . ASN E 5 138 ? 50.754  0.539   29.483  1.00 80.28  ? 138 ASN L N   1 
ATOM   7394 C CA  . ASN E 5 138 ? 49.523  -0.240  29.380  1.00 79.60  ? 138 ASN L CA  1 
ATOM   7395 C C   . ASN E 5 138 ? 48.915  -0.545  30.741  1.00 82.41  ? 138 ASN L C   1 
ATOM   7396 O O   . ASN E 5 138 ? 49.036  -1.663  31.269  1.00 83.01  ? 138 ASN L O   1 
ATOM   7397 C CB  . ASN E 5 138 ? 49.725  -1.501  28.519  1.00 80.61  ? 138 ASN L CB  1 
ATOM   7398 C CG  . ASN E 5 138 ? 49.944  -1.241  27.044  1.00 91.43  ? 138 ASN L CG  1 
ATOM   7399 O OD1 . ASN E 5 138 ? 49.352  -0.342  26.420  1.00 76.42  ? 138 ASN L OD1 1 
ATOM   7400 N ND2 . ASN E 5 138 ? 50.781  -2.068  26.445  1.00 87.45  ? 138 ASN L ND2 1 
ATOM   7401 N N   . PHE E 5 139 ? 48.262  0.473   31.309  1.00 77.80  ? 139 PHE L N   1 
ATOM   7402 C CA  . PHE E 5 139 ? 47.614  0.373   32.615  1.00 76.86  ? 139 PHE L CA  1 
ATOM   7403 C C   . PHE E 5 139 ? 46.198  0.895   32.602  1.00 83.89  ? 139 PHE L C   1 
ATOM   7404 O O   . PHE E 5 139 ? 45.812  1.655   31.708  1.00 83.69  ? 139 PHE L O   1 
ATOM   7405 C CB  . PHE E 5 139 ? 48.431  1.109   33.687  1.00 76.95  ? 139 PHE L CB  1 
ATOM   7406 C CG  . PHE E 5 139 ? 48.565  2.602   33.489  1.00 76.59  ? 139 PHE L CG  1 
ATOM   7407 C CD1 . PHE E 5 139 ? 47.620  3.476   34.005  1.00 77.98  ? 139 PHE L CD1 1 
ATOM   7408 C CD2 . PHE E 5 139 ? 49.658  3.137   32.816  1.00 77.45  ? 139 PHE L CD2 1 
ATOM   7409 C CE1 . PHE E 5 139 ? 47.750  4.854   33.826  1.00 77.63  ? 139 PHE L CE1 1 
ATOM   7410 C CE2 . PHE E 5 139 ? 49.787  4.518   32.640  1.00 78.83  ? 139 PHE L CE2 1 
ATOM   7411 C CZ  . PHE E 5 139 ? 48.835  5.366   33.154  1.00 76.23  ? 139 PHE L CZ  1 
ATOM   7412 N N   . TYR E 5 140 ? 45.452  0.544   33.646  1.00 82.47  ? 140 TYR L N   1 
ATOM   7413 C CA  . TYR E 5 140 ? 44.080  0.964   33.856  1.00 83.74  ? 140 TYR L CA  1 
ATOM   7414 C C   . TYR E 5 140 ? 43.719  0.791   35.337  1.00 90.81  ? 140 TYR L C   1 
ATOM   7415 O O   . TYR E 5 140 ? 44.017  -0.271  35.895  1.00 90.62  ? 140 TYR L O   1 
ATOM   7416 C CB  . TYR E 5 140 ? 43.109  0.146   32.979  1.00 84.99  ? 140 TYR L CB  1 
ATOM   7417 C CG  . TYR E 5 140 ? 41.679  0.619   33.110  1.00 87.10  ? 140 TYR L CG  1 
ATOM   7418 C CD1 . TYR E 5 140 ? 41.210  1.687   32.359  1.00 89.53  ? 140 TYR L CD1 1 
ATOM   7419 C CD2 . TYR E 5 140 ? 40.819  0.061   34.045  1.00 87.92  ? 140 TYR L CD2 1 
ATOM   7420 C CE1 . TYR E 5 140 ? 39.910  2.155   32.504  1.00 89.78  ? 140 TYR L CE1 1 
ATOM   7421 C CE2 . TYR E 5 140 ? 39.527  0.543   34.215  1.00 88.74  ? 140 TYR L CE2 1 
ATOM   7422 C CZ  . TYR E 5 140 ? 39.078  1.583   33.437  1.00 94.89  ? 140 TYR L CZ  1 
ATOM   7423 O OH  . TYR E 5 140 ? 37.817  2.077   33.597  1.00 99.49  ? 140 TYR L OH  1 
ATOM   7424 N N   . PRO E 5 141 ? 43.021  1.764   35.985  1.00 88.47  ? 141 PRO L N   1 
ATOM   7425 C CA  . PRO E 5 141 ? 42.567  3.079   35.470  1.00 88.38  ? 141 PRO L CA  1 
ATOM   7426 C C   . PRO E 5 141 ? 43.704  4.070   35.251  1.00 91.34  ? 141 PRO L C   1 
ATOM   7427 O O   . PRO E 5 141 ? 44.835  3.805   35.671  1.00 90.56  ? 141 PRO L O   1 
ATOM   7428 C CB  . PRO E 5 141 ? 41.601  3.555   36.554  1.00 90.25  ? 141 PRO L CB  1 
ATOM   7429 C CG  . PRO E 5 141 ? 42.152  2.954   37.804  1.00 94.57  ? 141 PRO L CG  1 
ATOM   7430 C CD  . PRO E 5 141 ? 42.635  1.587   37.398  1.00 89.89  ? 141 PRO L CD  1 
ATOM   7431 N N   . ARG E 5 142 ? 43.387  5.215   34.602  1.00 87.13  ? 142 ARG L N   1 
ATOM   7432 C CA  . ARG E 5 142 ? 44.302  6.312   34.230  1.00 86.01  ? 142 ARG L CA  1 
ATOM   7433 C C   . ARG E 5 142 ? 45.045  6.885   35.430  1.00 85.20  ? 142 ARG L C   1 
ATOM   7434 O O   . ARG E 5 142 ? 46.227  7.211   35.320  1.00 83.88  ? 142 ARG L O   1 
ATOM   7435 C CB  . ARG E 5 142 ? 43.491  7.396   33.509  1.00 89.10  ? 142 ARG L CB  1 
ATOM   7436 C CG  . ARG E 5 142 ? 44.253  8.584   32.964  1.00 108.28 ? 142 ARG L CG  1 
ATOM   7437 C CD  . ARG E 5 142 ? 43.298  9.746   32.684  1.00 131.18 ? 142 ARG L CD  1 
ATOM   7438 N NE  . ARG E 5 142 ? 42.465  10.164  33.819  1.00 158.27 ? 142 ARG L NE  1 
ATOM   7439 C CZ  . ARG E 5 142 ? 42.614  11.301  34.502  1.00 179.88 ? 142 ARG L CZ  1 
ATOM   7440 N NH1 . ARG E 5 142 ? 43.566  12.167  34.167  1.00 171.86 ? 142 ARG L NH1 1 
ATOM   7441 N NH2 . ARG E 5 142 ? 41.799  11.588  35.515  1.00 164.67 ? 142 ARG L NH2 1 
ATOM   7442 N N   . GLU E 5 143 ? 44.357  6.974   36.576  1.00 80.55  ? 143 GLU L N   1 
ATOM   7443 C CA  . GLU E 5 143 ? 44.891  7.495   37.837  1.00 80.34  ? 143 GLU L CA  1 
ATOM   7444 C C   . GLU E 5 143 ? 46.129  6.724   38.229  1.00 83.28  ? 143 GLU L C   1 
ATOM   7445 O O   . GLU E 5 143 ? 46.073  5.520   38.456  1.00 85.16  ? 143 GLU L O   1 
ATOM   7446 C CB  . GLU E 5 143 ? 43.824  7.471   38.951  1.00 82.09  ? 143 GLU L CB  1 
ATOM   7447 C CG  . GLU E 5 143 ? 42.663  8.442   38.740  1.00 98.33  ? 143 GLU L CG  1 
ATOM   7448 C CD  . GLU E 5 143 ? 41.664  8.124   37.635  1.00 132.47 ? 143 GLU L CD  1 
ATOM   7449 O OE1 . GLU E 5 143 ? 41.187  6.966   37.587  1.00 129.76 ? 143 GLU L OE1 1 
ATOM   7450 O OE2 . GLU E 5 143 ? 41.353  9.029   36.825  1.00 132.58 ? 143 GLU L OE2 1 
ATOM   7451 N N   . ALA E 5 144 ? 47.262  7.396   38.133  1.00 76.92  ? 144 ALA L N   1 
ATOM   7452 C CA  . ALA E 5 144 ? 48.595  6.886   38.406  1.00 74.75  ? 144 ALA L CA  1 
ATOM   7453 C C   . ALA E 5 144 ? 49.412  8.006   39.076  1.00 77.86  ? 144 ALA L C   1 
ATOM   7454 O O   . ALA E 5 144 ? 49.214  9.189   38.765  1.00 78.91  ? 144 ALA L O   1 
ATOM   7455 C CB  . ALA E 5 144 ? 49.242  6.499   37.100  1.00 74.95  ? 144 ALA L CB  1 
ATOM   7456 N N   . LYS E 5 145 ? 50.307  7.653   39.998  1.00 71.95  ? 145 LYS L N   1 
ATOM   7457 C CA  . LYS E 5 145 ? 51.135  8.652   40.660  1.00 71.51  ? 145 LYS L CA  1 
ATOM   7458 C C   . LYS E 5 145 ? 52.604  8.347   40.412  1.00 74.12  ? 145 LYS L C   1 
ATOM   7459 O O   . LYS E 5 145 ? 53.087  7.280   40.778  1.00 73.25  ? 145 LYS L O   1 
ATOM   7460 C CB  . LYS E 5 145 ? 50.816  8.732   42.166  1.00 74.85  ? 145 LYS L CB  1 
ATOM   7461 C CG  . LYS E 5 145 ? 51.554  9.836   42.935  1.00 95.33  ? 145 LYS L CG  1 
ATOM   7462 C CD  . LYS E 5 145 ? 50.734  11.134  43.037  1.00 108.32 ? 145 LYS L CD  1 
ATOM   7463 C CE  . LYS E 5 145 ? 51.418  12.239  43.823  1.00 115.99 ? 145 LYS L CE  1 
ATOM   7464 N NZ  . LYS E 5 145 ? 50.651  13.518  43.766  1.00 119.84 ? 145 LYS L NZ  1 
ATOM   7465 N N   . VAL E 5 146 ? 53.319  9.273   39.796  1.00 69.96  ? 146 VAL L N   1 
ATOM   7466 C CA  . VAL E 5 146 ? 54.737  9.020   39.589  1.00 69.82  ? 146 VAL L CA  1 
ATOM   7467 C C   . VAL E 5 146 ? 55.564  10.135  40.238  1.00 72.93  ? 146 VAL L C   1 
ATOM   7468 O O   . VAL E 5 146 ? 55.356  11.311  39.932  1.00 73.86  ? 146 VAL L O   1 
ATOM   7469 C CB  . VAL E 5 146 ? 55.125  8.727   38.107  1.00 73.91  ? 146 VAL L CB  1 
ATOM   7470 C CG1 . VAL E 5 146 ? 54.588  9.779   37.150  1.00 73.45  ? 146 VAL L CG1 1 
ATOM   7471 C CG2 . VAL E 5 146 ? 56.638  8.575   37.935  1.00 73.77  ? 146 VAL L CG2 1 
ATOM   7472 N N   . GLN E 5 147 ? 56.451  9.771   41.174  1.00 67.45  ? 147 GLN L N   1 
ATOM   7473 C CA  . GLN E 5 147 ? 57.321  10.729  41.839  1.00 67.51  ? 147 GLN L CA  1 
ATOM   7474 C C   . GLN E 5 147 ? 58.732  10.480  41.376  1.00 74.98  ? 147 GLN L C   1 
ATOM   7475 O O   . GLN E 5 147 ? 59.079  9.349   41.050  1.00 73.71  ? 147 GLN L O   1 
ATOM   7476 C CB  . GLN E 5 147 ? 57.205  10.650  43.368  1.00 68.88  ? 147 GLN L CB  1 
ATOM   7477 C CG  . GLN E 5 147 ? 55.990  11.431  43.904  1.00 92.48  ? 147 GLN L CG  1 
ATOM   7478 C CD  . GLN E 5 147 ? 55.546  11.090  45.324  1.00 113.25 ? 147 GLN L CD  1 
ATOM   7479 O OE1 . GLN E 5 147 ? 56.284  10.529  46.143  1.00 103.57 ? 147 GLN L OE1 1 
ATOM   7480 N NE2 . GLN E 5 147 ? 54.304  11.419  45.637  1.00 116.56 ? 147 GLN L NE2 1 
ATOM   7481 N N   . TRP E 5 148 ? 59.532  11.539  41.271  1.00 74.38  ? 148 TRP L N   1 
ATOM   7482 C CA  . TRP E 5 148 ? 60.920  11.451  40.848  1.00 74.33  ? 148 TRP L CA  1 
ATOM   7483 C C   . TRP E 5 148 ? 61.798  11.658  42.081  1.00 73.43  ? 148 TRP L C   1 
ATOM   7484 O O   . TRP E 5 148 ? 61.550  12.582  42.851  1.00 71.78  ? 148 TRP L O   1 
ATOM   7485 C CB  . TRP E 5 148 ? 61.192  12.541  39.805  1.00 74.86  ? 148 TRP L CB  1 
ATOM   7486 C CG  . TRP E 5 148 ? 60.909  12.163  38.369  1.00 77.33  ? 148 TRP L CG  1 
ATOM   7487 C CD1 . TRP E 5 148 ? 59.940  12.683  37.561  1.00 80.41  ? 148 TRP L CD1 1 
ATOM   7488 C CD2 . TRP E 5 148 ? 61.685  11.281  37.542  1.00 77.43  ? 148 TRP L CD2 1 
ATOM   7489 N NE1 . TRP E 5 148 ? 60.039  12.148  36.292  1.00 79.99  ? 148 TRP L NE1 1 
ATOM   7490 C CE2 . TRP E 5 148 ? 61.084  11.266  36.262  1.00 81.51  ? 148 TRP L CE2 1 
ATOM   7491 C CE3 . TRP E 5 148 ? 62.804  10.465  37.772  1.00 79.30  ? 148 TRP L CE3 1 
ATOM   7492 C CZ2 . TRP E 5 148 ? 61.594  10.512  35.208  1.00 81.25  ? 148 TRP L CZ2 1 
ATOM   7493 C CZ3 . TRP E 5 148 ? 63.282  9.679   36.735  1.00 81.03  ? 148 TRP L CZ3 1 
ATOM   7494 C CH2 . TRP E 5 148 ? 62.672  9.699   35.473  1.00 81.96  ? 148 TRP L CH2 1 
ATOM   7495 N N   . LYS E 5 149 ? 62.789  10.780  42.304  1.00 69.31  ? 149 LYS L N   1 
ATOM   7496 C CA  . LYS E 5 149 ? 63.714  10.875  43.445  1.00 68.72  ? 149 LYS L CA  1 
ATOM   7497 C C   . LYS E 5 149 ? 65.165  10.911  43.013  1.00 73.80  ? 149 LYS L C   1 
ATOM   7498 O O   . LYS E 5 149 ? 65.743  9.861   42.712  1.00 73.88  ? 149 LYS L O   1 
ATOM   7499 C CB  . LYS E 5 149 ? 63.502  9.747   44.476  1.00 69.96  ? 149 LYS L CB  1 
ATOM   7500 C CG  . LYS E 5 149 ? 62.304  9.960   45.404  1.00 80.57  ? 149 LYS L CG  1 
ATOM   7501 C CD  . LYS E 5 149 ? 62.488  9.220   46.721  1.00 77.22  ? 149 LYS L CD  1 
ATOM   7502 C CE  . LYS E 5 149 ? 61.431  8.204   46.990  1.00 72.83  ? 149 LYS L CE  1 
ATOM   7503 N NZ  . LYS E 5 149 ? 61.950  7.093   47.838  1.00 89.45  ? 149 LYS L NZ  1 
ATOM   7504 N N   . VAL E 5 150 ? 65.764  12.102  42.974  1.00 69.70  ? 150 VAL L N   1 
ATOM   7505 C CA  . VAL E 5 150 ? 67.172  12.205  42.623  1.00 68.62  ? 150 VAL L CA  1 
ATOM   7506 C C   . VAL E 5 150 ? 67.930  12.130  43.939  1.00 71.40  ? 150 VAL L C   1 
ATOM   7507 O O   . VAL E 5 150 ? 67.638  12.925  44.841  1.00 70.87  ? 150 VAL L O   1 
ATOM   7508 C CB  . VAL E 5 150 ? 67.461  13.484  41.845  1.00 72.81  ? 150 VAL L CB  1 
ATOM   7509 C CG1 . VAL E 5 150 ? 68.959  13.616  41.557  1.00 72.80  ? 150 VAL L CG1 1 
ATOM   7510 C CG2 . VAL E 5 150 ? 66.621  13.543  40.563  1.00 72.45  ? 150 VAL L CG2 1 
ATOM   7511 N N   . ASP E 5 151 ? 68.837  11.121  44.081  1.00 67.06  ? 151 ASP L N   1 
ATOM   7512 C CA  . ASP E 5 151 ? 69.587  10.838  45.316  1.00 66.10  ? 151 ASP L CA  1 
ATOM   7513 C C   . ASP E 5 151 ? 68.640  10.823  46.543  1.00 67.71  ? 151 ASP L C   1 
ATOM   7514 O O   . ASP E 5 151 ? 68.831  11.564  47.514  1.00 65.91  ? 151 ASP L O   1 
ATOM   7515 C CB  . ASP E 5 151 ? 70.753  11.813  45.491  1.00 68.13  ? 151 ASP L CB  1 
ATOM   7516 C CG  . ASP E 5 151 ? 72.019  11.404  44.789  1.00 82.04  ? 151 ASP L CG  1 
ATOM   7517 O OD1 . ASP E 5 151 ? 71.980  10.412  44.013  1.00 83.73  ? 151 ASP L OD1 1 
ATOM   7518 O OD2 . ASP E 5 151 ? 73.057  12.078  45.004  1.00 89.63  ? 151 ASP L OD2 1 
ATOM   7519 N N   . ASN E 5 152 ? 67.556  10.039  46.407  1.00 64.12  ? 152 ASN L N   1 
ATOM   7520 C CA  . ASN E 5 152 ? 66.480  9.803   47.355  1.00 63.75  ? 152 ASN L CA  1 
ATOM   7521 C C   . ASN E 5 152 ? 65.680  11.039  47.754  1.00 68.54  ? 152 ASN L C   1 
ATOM   7522 O O   . ASN E 5 152 ? 64.658  10.886  48.428  1.00 67.55  ? 152 ASN L O   1 
ATOM   7523 C CB  . ASN E 5 152 ? 66.977  9.072   48.579  1.00 64.45  ? 152 ASN L CB  1 
ATOM   7524 C CG  . ASN E 5 152 ? 66.075  7.959   48.985  1.00 84.49  ? 152 ASN L CG  1 
ATOM   7525 O OD1 . ASN E 5 152 ? 65.388  7.337   48.172  1.00 77.85  ? 152 ASN L OD1 1 
ATOM   7526 N ND2 . ASN E 5 152 ? 66.067  7.680   50.256  1.00 81.84  ? 152 ASN L ND2 1 
ATOM   7527 N N   . ALA E 5 153 ? 66.131  12.250  47.358  1.00 66.71  ? 153 ALA L N   1 
ATOM   7528 C CA  . ALA E 5 153 ? 65.411  13.508  47.559  1.00 65.93  ? 153 ALA L CA  1 
ATOM   7529 C C   . ALA E 5 153 ? 64.319  13.624  46.467  1.00 74.07  ? 153 ALA L C   1 
ATOM   7530 O O   . ALA E 5 153 ? 64.606  13.364  45.288  1.00 72.79  ? 153 ALA L O   1 
ATOM   7531 C CB  . ALA E 5 153 ? 66.365  14.657  47.442  1.00 65.60  ? 153 ALA L CB  1 
ATOM   7532 N N   . LEU E 5 154 ? 63.066  14.001  46.866  1.00 73.85  ? 154 LEU L N   1 
ATOM   7533 C CA  . LEU E 5 154 ? 61.909  14.187  45.966  1.00 74.08  ? 154 LEU L CA  1 
ATOM   7534 C C   . LEU E 5 154 ? 62.122  15.374  45.060  1.00 80.40  ? 154 LEU L C   1 
ATOM   7535 O O   . LEU E 5 154 ? 62.192  16.509  45.523  1.00 78.65  ? 154 LEU L O   1 
ATOM   7536 C CB  . LEU E 5 154 ? 60.607  14.455  46.735  1.00 74.00  ? 154 LEU L CB  1 
ATOM   7537 C CG  . LEU E 5 154 ? 59.850  13.311  47.344  1.00 78.14  ? 154 LEU L CG  1 
ATOM   7538 C CD1 . LEU E 5 154 ? 58.656  13.834  48.048  1.00 77.28  ? 154 LEU L CD1 1 
ATOM   7539 C CD2 . LEU E 5 154 ? 59.452  12.270  46.303  1.00 82.32  ? 154 LEU L CD2 1 
ATOM   7540 N N   . GLN E 5 155 ? 62.162  15.117  43.770  1.00 80.61  ? 155 GLN L N   1 
ATOM   7541 C CA  . GLN E 5 155 ? 62.344  16.152  42.791  1.00 81.22  ? 155 GLN L CA  1 
ATOM   7542 C C   . GLN E 5 155 ? 61.015  16.638  42.264  1.00 91.54  ? 155 GLN L C   1 
ATOM   7543 O O   . GLN E 5 155 ? 60.458  16.156  41.264  1.00 92.64  ? 155 GLN L O   1 
ATOM   7544 C CB  . GLN E 5 155 ? 63.328  15.732  41.723  1.00 81.57  ? 155 GLN L CB  1 
ATOM   7545 C CG  . GLN E 5 155 ? 64.732  15.688  42.310  1.00 90.35  ? 155 GLN L CG  1 
ATOM   7546 C CD  . GLN E 5 155 ? 65.317  16.999  42.815  1.00 101.91 ? 155 GLN L CD  1 
ATOM   7547 O OE1 . GLN E 5 155 ? 64.895  18.110  42.448  1.00 96.67  ? 155 GLN L OE1 1 
ATOM   7548 N NE2 . GLN E 5 155 ? 66.331  16.885  43.667  1.00 90.19  ? 155 GLN L NE2 1 
ATOM   7549 N N   . SER E 5 156 ? 60.509  17.614  43.019  1.00 90.38  ? 156 SER L N   1 
ATOM   7550 C CA  . SER E 5 156 ? 59.288  18.377  42.820  1.00 91.36  ? 156 SER L CA  1 
ATOM   7551 C C   . SER E 5 156 ? 59.547  19.670  41.976  1.00 92.90  ? 156 SER L C   1 
ATOM   7552 O O   . SER E 5 156 ? 60.347  20.536  42.375  1.00 91.03  ? 156 SER L O   1 
ATOM   7553 C CB  . SER E 5 156 ? 58.691  18.734  44.183  1.00 98.66  ? 156 SER L CB  1 
ATOM   7554 O OG  . SER E 5 156 ? 59.659  19.289  45.065  1.00 112.59 ? 156 SER L OG  1 
ATOM   7555 N N   . GLY E 5 157 ? 58.895  19.742  40.809  1.00 88.69  ? 157 GLY L N   1 
ATOM   7556 C CA  . GLY E 5 157 ? 58.970  20.897  39.918  1.00 88.09  ? 157 GLY L CA  1 
ATOM   7557 C C   . GLY E 5 157 ? 59.889  20.822  38.716  1.00 91.52  ? 157 GLY L C   1 
ATOM   7558 O O   . GLY E 5 157 ? 59.855  21.721  37.870  1.00 92.31  ? 157 GLY L O   1 
ATOM   7559 N N   . ASN E 5 158 ? 60.711  19.759  38.623  1.00 85.60  ? 158 ASN L N   1 
ATOM   7560 C CA  . ASN E 5 158 ? 61.660  19.558  37.527  1.00 83.84  ? 158 ASN L CA  1 
ATOM   7561 C C   . ASN E 5 158 ? 61.094  18.639  36.456  1.00 84.34  ? 158 ASN L C   1 
ATOM   7562 O O   . ASN E 5 158 ? 61.826  18.263  35.533  1.00 84.99  ? 158 ASN L O   1 
ATOM   7563 C CB  . ASN E 5 158 ? 62.940  18.922  38.077  1.00 86.14  ? 158 ASN L CB  1 
ATOM   7564 C CG  . ASN E 5 158 ? 63.950  19.886  38.633  1.00 118.48 ? 158 ASN L CG  1 
ATOM   7565 O OD1 . ASN E 5 158 ? 64.755  20.479  37.896  1.00 114.86 ? 158 ASN L OD1 1 
ATOM   7566 N ND2 . ASN E 5 158 ? 63.947  20.038  39.953  1.00 111.03 ? 158 ASN L ND2 1 
ATOM   7567 N N   . SER E 5 159 ? 59.815  18.256  36.566  1.00 77.21  ? 159 SER L N   1 
ATOM   7568 C CA  . SER E 5 159 ? 59.262  17.270  35.656  1.00 75.61  ? 159 SER L CA  1 
ATOM   7569 C C   . SER E 5 159 ? 57.865  17.575  35.143  1.00 78.24  ? 159 SER L C   1 
ATOM   7570 O O   . SER E 5 159 ? 57.089  18.279  35.798  1.00 77.90  ? 159 SER L O   1 
ATOM   7571 C CB  . SER E 5 159 ? 59.306  15.892  36.308  1.00 78.99  ? 159 SER L CB  1 
ATOM   7572 O OG  . SER E 5 159 ? 58.568  15.844  37.519  1.00 89.73  ? 159 SER L OG  1 
ATOM   7573 N N   . GLN E 5 160 ? 57.553  17.026  33.951  1.00 73.98  ? 160 GLN L N   1 
ATOM   7574 C CA  . GLN E 5 160 ? 56.267  17.157  33.263  1.00 73.17  ? 160 GLN L CA  1 
ATOM   7575 C C   . GLN E 5 160 ? 55.723  15.768  32.847  1.00 75.57  ? 160 GLN L C   1 
ATOM   7576 O O   . GLN E 5 160 ? 56.464  14.947  32.299  1.00 75.34  ? 160 GLN L O   1 
ATOM   7577 C CB  . GLN E 5 160 ? 56.384  18.073  32.053  1.00 74.22  ? 160 GLN L CB  1 
ATOM   7578 C CG  . GLN E 5 160 ? 56.874  19.472  32.362  1.00 90.80  ? 160 GLN L CG  1 
ATOM   7579 C CD  . GLN E 5 160 ? 57.006  20.278  31.111  1.00 125.48 ? 160 GLN L CD  1 
ATOM   7580 O OE1 . GLN E 5 160 ? 57.663  19.878  30.128  1.00 126.94 ? 160 GLN L OE1 1 
ATOM   7581 N NE2 . GLN E 5 160 ? 56.365  21.429  31.107  1.00 116.34 ? 160 GLN L NE2 1 
ATOM   7582 N N   . GLU E 5 161 ? 54.439  15.498  33.155  1.00 70.91  ? 161 GLU L N   1 
ATOM   7583 C CA  . GLU E 5 161 ? 53.761  14.236  32.814  1.00 70.43  ? 161 GLU L CA  1 
ATOM   7584 C C   . GLU E 5 161 ? 53.002  14.393  31.508  1.00 73.38  ? 161 GLU L C   1 
ATOM   7585 O O   . GLU E 5 161 ? 52.732  15.515  31.086  1.00 72.62  ? 161 GLU L O   1 
ATOM   7586 C CB  . GLU E 5 161 ? 52.768  13.804  33.924  1.00 71.90  ? 161 GLU L CB  1 
ATOM   7587 C CG  . GLU E 5 161 ? 53.369  12.989  35.062  1.00 85.10  ? 161 GLU L CG  1 
ATOM   7588 C CD  . GLU E 5 161 ? 52.433  12.604  36.198  1.00 116.34 ? 161 GLU L CD  1 
ATOM   7589 O OE1 . GLU E 5 161 ? 51.224  12.386  35.941  1.00 112.15 ? 161 GLU L OE1 1 
ATOM   7590 O OE2 . GLU E 5 161 ? 52.914  12.515  37.351  1.00 120.81 ? 161 GLU L OE2 1 
ATOM   7591 N N   . SER E 5 162 ? 52.675  13.265  30.862  1.00 70.93  ? 162 SER L N   1 
ATOM   7592 C CA  . SER E 5 162 ? 51.877  13.197  29.635  1.00 71.65  ? 162 SER L CA  1 
ATOM   7593 C C   . SER E 5 162 ? 51.250  11.833  29.532  1.00 76.40  ? 162 SER L C   1 
ATOM   7594 O O   . SER E 5 162 ? 51.976  10.831  29.555  1.00 77.30  ? 162 SER L O   1 
ATOM   7595 C CB  . SER E 5 162 ? 52.717  13.467  28.395  1.00 76.07  ? 162 SER L CB  1 
ATOM   7596 O OG  . SER E 5 162 ? 51.877  14.011  27.399  1.00 86.86  ? 162 SER L OG  1 
ATOM   7597 N N   . VAL E 5 163 ? 49.906  11.788  29.459  1.00 71.25  ? 163 VAL L N   1 
ATOM   7598 C CA  . VAL E 5 163 ? 49.166  10.524  29.390  1.00 70.25  ? 163 VAL L CA  1 
ATOM   7599 C C   . VAL E 5 163 ? 48.468  10.400  28.028  1.00 74.97  ? 163 VAL L C   1 
ATOM   7600 O O   . VAL E 5 163 ? 47.994  11.400  27.501  1.00 73.54  ? 163 VAL L O   1 
ATOM   7601 C CB  . VAL E 5 163 ? 48.227  10.305  30.619  1.00 72.63  ? 163 VAL L CB  1 
ATOM   7602 C CG1 . VAL E 5 163 ? 47.074  11.283  30.622  1.00 72.81  ? 163 VAL L CG1 1 
ATOM   7603 C CG2 . VAL E 5 163 ? 47.709  8.865   30.731  1.00 71.78  ? 163 VAL L CG2 1 
ATOM   7604 N N   . THR E 5 164 ? 48.464  9.179   27.450  1.00 73.68  ? 164 THR L N   1 
ATOM   7605 C CA  . THR E 5 164 ? 47.839  8.864   26.164  1.00 75.19  ? 164 THR L CA  1 
ATOM   7606 C C   . THR E 5 164 ? 46.354  8.683   26.311  1.00 84.16  ? 164 THR L C   1 
ATOM   7607 O O   . THR E 5 164 ? 45.873  8.320   27.393  1.00 84.18  ? 164 THR L O   1 
ATOM   7608 C CB  . THR E 5 164 ? 48.348  7.526   25.628  1.00 84.92  ? 164 THR L CB  1 
ATOM   7609 O OG1 . THR E 5 164 ? 48.245  6.546   26.664  1.00 89.36  ? 164 THR L OG1 1 
ATOM   7610 C CG2 . THR E 5 164 ? 49.745  7.601   25.068  1.00 81.13  ? 164 THR L CG2 1 
ATOM   7611 N N   . GLU E 5 165 ? 45.624  8.851   25.195  1.00 85.08  ? 165 GLU L N   1 
ATOM   7612 C CA  . GLU E 5 165 ? 44.190  8.590   25.198  1.00 87.24  ? 165 GLU L CA  1 
ATOM   7613 C C   . GLU E 5 165 ? 44.030  7.087   25.169  1.00 91.32  ? 165 GLU L C   1 
ATOM   7614 O O   . GLU E 5 165 ? 44.919  6.390   24.670  1.00 93.37  ? 165 GLU L O   1 
ATOM   7615 C CB  . GLU E 5 165 ? 43.481  9.270   24.023  1.00 89.52  ? 165 GLU L CB  1 
ATOM   7616 C CG  . GLU E 5 165 ? 43.330  10.776  24.233  1.00 111.21 ? 165 GLU L CG  1 
ATOM   7617 C CD  . GLU E 5 165 ? 44.254  11.696  23.442  1.00 163.51 ? 165 GLU L CD  1 
ATOM   7618 O OE1 . GLU E 5 165 ? 45.256  11.212  22.858  1.00 176.00 ? 165 GLU L OE1 1 
ATOM   7619 O OE2 . GLU E 5 165 ? 43.946  12.909  23.379  1.00 166.28 ? 165 GLU L OE2 1 
ATOM   7620 N N   . GLN E 5 166 ? 42.966  6.578   25.786  1.00 84.98  ? 166 GLN L N   1 
ATOM   7621 C CA  . GLN E 5 166 ? 42.701  5.143   25.901  1.00 84.60  ? 166 GLN L CA  1 
ATOM   7622 C C   . GLN E 5 166 ? 42.851  4.375   24.582  1.00 86.61  ? 166 GLN L C   1 
ATOM   7623 O O   . GLN E 5 166 ? 42.289  4.770   23.563  1.00 84.87  ? 166 GLN L O   1 
ATOM   7624 C CB  . GLN E 5 166 ? 41.319  4.904   26.534  1.00 86.27  ? 166 GLN L CB  1 
ATOM   7625 C CG  . GLN E 5 166 ? 41.135  3.515   27.112  1.00 91.36  ? 166 GLN L CG  1 
ATOM   7626 C CD  . GLN E 5 166 ? 39.868  3.383   27.887  1.00 102.70 ? 166 GLN L CD  1 
ATOM   7627 O OE1 . GLN E 5 166 ? 38.832  3.947   27.543  1.00 99.85  ? 166 GLN L OE1 1 
ATOM   7628 N NE2 . GLN E 5 166 ? 39.928  2.614   28.950  1.00 93.86  ? 166 GLN L NE2 1 
ATOM   7629 N N   . ASP E 5 167 ? 43.655  3.311   24.616  1.00 84.22  ? 167 ASP L N   1 
ATOM   7630 C CA  . ASP E 5 167 ? 43.935  2.452   23.474  1.00 84.99  ? 167 ASP L CA  1 
ATOM   7631 C C   . ASP E 5 167 ? 42.651  1.784   22.998  1.00 92.65  ? 167 ASP L C   1 
ATOM   7632 O O   . ASP E 5 167 ? 41.938  1.175   23.788  1.00 94.19  ? 167 ASP L O   1 
ATOM   7633 C CB  . ASP E 5 167 ? 44.974  1.395   23.870  1.00 86.74  ? 167 ASP L CB  1 
ATOM   7634 C CG  . ASP E 5 167 ? 45.589  0.604   22.732  1.00 99.06  ? 167 ASP L CG  1 
ATOM   7635 O OD1 . ASP E 5 167 ? 44.951  0.509   21.651  1.00 98.79  ? 167 ASP L OD1 1 
ATOM   7636 O OD2 . ASP E 5 167 ? 46.704  0.057   22.926  1.00 108.95 ? 167 ASP L OD2 1 
ATOM   7637 N N   . SER E 5 168 ? 42.337  1.930   21.711  1.00 90.15  ? 168 SER L N   1 
ATOM   7638 C CA  . SER E 5 168 ? 41.136  1.353   21.085  1.00 90.38  ? 168 SER L CA  1 
ATOM   7639 C C   . SER E 5 168 ? 41.163  -0.198  20.977  1.00 92.81  ? 168 SER L C   1 
ATOM   7640 O O   . SER E 5 168 ? 40.179  -0.792  20.524  1.00 91.45  ? 168 SER L O   1 
ATOM   7641 C CB  . SER E 5 168 ? 40.929  1.975   19.703  1.00 96.36  ? 168 SER L CB  1 
ATOM   7642 O OG  . SER E 5 168 ? 42.021  1.698   18.836  1.00 110.04 ? 168 SER L OG  1 
ATOM   7643 N N   . LYS E 5 169 ? 42.296  -0.835  21.367  1.00 88.81  ? 169 LYS L N   1 
ATOM   7644 C CA  . LYS E 5 169 ? 42.503  -2.275  21.290  1.00 87.87  ? 169 LYS L CA  1 
ATOM   7645 C C   . LYS E 5 169 ? 42.377  -2.911  22.661  1.00 92.02  ? 169 LYS L C   1 
ATOM   7646 O O   . LYS E 5 169 ? 41.381  -3.596  22.900  1.00 93.03  ? 169 LYS L O   1 
ATOM   7647 C CB  . LYS E 5 169 ? 43.858  -2.601  20.648  1.00 90.05  ? 169 LYS L CB  1 
ATOM   7648 C CG  . LYS E 5 169 ? 44.111  -1.905  19.307  1.00 104.45 ? 169 LYS L CG  1 
ATOM   7649 C CD  . LYS E 5 169 ? 43.394  -2.563  18.126  1.00 112.51 ? 169 LYS L CD  1 
ATOM   7650 C CE  . LYS E 5 169 ? 43.519  -1.736  16.870  1.00 127.72 ? 169 LYS L CE  1 
ATOM   7651 N NZ  . LYS E 5 169 ? 42.673  -0.512  16.910  1.00 137.43 ? 169 LYS L NZ  1 
ATOM   7652 N N   . ASP E 5 170 ? 43.338  -2.659  23.591  1.00 87.03  ? 170 ASP L N   1 
ATOM   7653 C CA  . ASP E 5 170 ? 43.269  -3.271  24.932  1.00 85.36  ? 170 ASP L CA  1 
ATOM   7654 C C   . ASP E 5 170 ? 42.695  -2.357  26.034  1.00 86.29  ? 170 ASP L C   1 
ATOM   7655 O O   . ASP E 5 170 ? 42.842  -2.675  27.211  1.00 84.06  ? 170 ASP L O   1 
ATOM   7656 C CB  . ASP E 5 170 ? 44.647  -3.828  25.344  1.00 87.01  ? 170 ASP L CB  1 
ATOM   7657 C CG  . ASP E 5 170 ? 45.756  -2.806  25.507  1.00 96.28  ? 170 ASP L CG  1 
ATOM   7658 O OD1 . ASP E 5 170 ? 45.567  -1.651  25.084  1.00 99.55  ? 170 ASP L OD1 1 
ATOM   7659 O OD2 . ASP E 5 170 ? 46.819  -3.164  26.057  1.00 99.40  ? 170 ASP L OD2 1 
ATOM   7660 N N   . SER E 5 171 ? 42.062  -1.226  25.648  1.00 83.04  ? 171 SER L N   1 
ATOM   7661 C CA  . SER E 5 171 ? 41.425  -0.238  26.523  1.00 82.54  ? 171 SER L CA  1 
ATOM   7662 C C   . SER E 5 171 ? 42.322  0.261   27.676  1.00 87.41  ? 171 SER L C   1 
ATOM   7663 O O   . SER E 5 171 ? 41.821  0.510   28.781  1.00 88.32  ? 171 SER L O   1 
ATOM   7664 C CB  . SER E 5 171 ? 40.091  -0.768  27.039  1.00 85.65  ? 171 SER L CB  1 
ATOM   7665 O OG  . SER E 5 171 ? 39.321  -1.304  25.976  1.00 96.36  ? 171 SER L OG  1 
ATOM   7666 N N   . THR E 5 172 ? 43.633  0.459   27.412  1.00 82.57  ? 172 THR L N   1 
ATOM   7667 C CA  . THR E 5 172 ? 44.556  0.936   28.449  1.00 81.66  ? 172 THR L CA  1 
ATOM   7668 C C   . THR E 5 172 ? 45.110  2.337   28.186  1.00 84.80  ? 172 THR L C   1 
ATOM   7669 O O   . THR E 5 172 ? 44.936  2.901   27.102  1.00 86.46  ? 172 THR L O   1 
ATOM   7670 C CB  . THR E 5 172 ? 45.695  -0.068  28.702  1.00 86.51  ? 172 THR L CB  1 
ATOM   7671 O OG1 . THR E 5 172 ? 46.348  -0.357  27.470  1.00 86.12  ? 172 THR L OG1 1 
ATOM   7672 C CG2 . THR E 5 172 ? 45.220  -1.347  29.351  1.00 82.08  ? 172 THR L CG2 1 
ATOM   7673 N N   . TYR E 5 173 ? 45.785  2.888   29.201  1.00 77.84  ? 173 TYR L N   1 
ATOM   7674 C CA  . TYR E 5 173 ? 46.453  4.172   29.144  1.00 76.08  ? 173 TYR L CA  1 
ATOM   7675 C C   . TYR E 5 173 ? 47.949  3.915   29.332  1.00 77.92  ? 173 TYR L C   1 
ATOM   7676 O O   . TYR E 5 173 ? 48.332  2.906   29.929  1.00 78.79  ? 173 TYR L O   1 
ATOM   7677 C CB  . TYR E 5 173 ? 45.959  5.075   30.273  1.00 77.37  ? 173 TYR L CB  1 
ATOM   7678 C CG  . TYR E 5 173 ? 44.467  5.323   30.282  1.00 80.94  ? 173 TYR L CG  1 
ATOM   7679 C CD1 . TYR E 5 173 ? 43.908  6.363   29.557  1.00 83.53  ? 173 TYR L CD1 1 
ATOM   7680 C CD2 . TYR E 5 173 ? 43.619  4.549   31.072  1.00 82.28  ? 173 TYR L CD2 1 
ATOM   7681 C CE1 . TYR E 5 173 ? 42.534  6.606   29.578  1.00 84.77  ? 173 TYR L CE1 1 
ATOM   7682 C CE2 . TYR E 5 173 ? 42.245  4.775   31.090  1.00 83.32  ? 173 TYR L CE2 1 
ATOM   7683 C CZ  . TYR E 5 173 ? 41.708  5.805   30.339  1.00 92.94  ? 173 TYR L CZ  1 
ATOM   7684 O OH  . TYR E 5 173 ? 40.357  6.027   30.378  1.00 100.46 ? 173 TYR L OH  1 
ATOM   7685 N N   . SER E 5 174 ? 48.791  4.811   28.803  1.00 70.28  ? 174 SER L N   1 
ATOM   7686 C CA  . SER E 5 174 ? 50.241  4.790   28.970  1.00 67.83  ? 174 SER L CA  1 
ATOM   7687 C C   . SER E 5 174 ? 50.653  6.209   29.386  1.00 68.77  ? 174 SER L C   1 
ATOM   7688 O O   . SER E 5 174 ? 50.021  7.188   28.985  1.00 67.87  ? 174 SER L O   1 
ATOM   7689 C CB  . SER E 5 174 ? 50.947  4.333   27.699  1.00 69.36  ? 174 SER L CB  1 
ATOM   7690 O OG  . SER E 5 174 ? 50.718  2.956   27.463  1.00 73.75  ? 174 SER L OG  1 
ATOM   7691 N N   . LEU E 5 175 ? 51.657  6.323   30.231  1.00 63.69  ? 175 LEU L N   1 
ATOM   7692 C CA  . LEU E 5 175 ? 52.047  7.619   30.753  1.00 63.40  ? 175 LEU L CA  1 
ATOM   7693 C C   . LEU E 5 175 ? 53.561  7.786   30.741  1.00 69.62  ? 175 LEU L C   1 
ATOM   7694 O O   . LEU E 5 175 ? 54.296  6.855   31.075  1.00 68.02  ? 175 LEU L O   1 
ATOM   7695 C CB  . LEU E 5 175 ? 51.462  7.752   32.189  1.00 62.95  ? 175 LEU L CB  1 
ATOM   7696 C CG  . LEU E 5 175 ? 51.776  9.004   33.027  1.00 65.61  ? 175 LEU L CG  1 
ATOM   7697 C CD1 . LEU E 5 175 ? 50.531  9.558   33.637  1.00 64.59  ? 175 LEU L CD1 1 
ATOM   7698 C CD2 . LEU E 5 175 ? 52.727  8.682   34.135  1.00 66.19  ? 175 LEU L CD2 1 
ATOM   7699 N N   . SER E 5 176 ? 54.019  8.982   30.368  1.00 69.89  ? 176 SER L N   1 
ATOM   7700 C CA  . SER E 5 176 ? 55.442  9.350   30.359  1.00 71.00  ? 176 SER L CA  1 
ATOM   7701 C C   . SER E 5 176 ? 55.671  10.457  31.371  1.00 77.97  ? 176 SER L C   1 
ATOM   7702 O O   . SER E 5 176 ? 54.854  11.383  31.481  1.00 77.63  ? 176 SER L O   1 
ATOM   7703 C CB  . SER E 5 176 ? 55.890  9.837   28.980  1.00 74.04  ? 176 SER L CB  1 
ATOM   7704 O OG  . SER E 5 176 ? 55.640  11.226  28.823  1.00 83.11  ? 176 SER L OG  1 
ATOM   7705 N N   . SER E 5 177 ? 56.790  10.369  32.087  1.00 75.42  ? 177 SER L N   1 
ATOM   7706 C CA  . SER E 5 177 ? 57.196  11.399  33.030  1.00 75.38  ? 177 SER L CA  1 
ATOM   7707 C C   . SER E 5 177 ? 58.637  11.780  32.680  1.00 78.66  ? 177 SER L C   1 
ATOM   7708 O O   . SER E 5 177 ? 59.524  10.933  32.757  1.00 78.53  ? 177 SER L O   1 
ATOM   7709 C CB  . SER E 5 177 ? 57.061  10.922  34.471  1.00 78.68  ? 177 SER L CB  1 
ATOM   7710 O OG  . SER E 5 177 ? 56.986  12.052  35.325  1.00 90.41  ? 177 SER L OG  1 
ATOM   7711 N N   . THR E 5 178 ? 58.851  13.026  32.211  1.00 73.36  ? 178 THR L N   1 
ATOM   7712 C CA  . THR E 5 178 ? 60.183  13.484  31.845  1.00 71.89  ? 178 THR L CA  1 
ATOM   7713 C C   . THR E 5 178 ? 60.745  14.476  32.854  1.00 74.65  ? 178 THR L C   1 
ATOM   7714 O O   . THR E 5 178 ? 60.206  15.561  33.022  1.00 73.67  ? 178 THR L O   1 
ATOM   7715 C CB  . THR E 5 178 ? 60.209  14.014  30.408  1.00 78.28  ? 178 THR L CB  1 
ATOM   7716 O OG1 . THR E 5 178 ? 59.774  12.983  29.517  1.00 83.40  ? 178 THR L OG1 1 
ATOM   7717 C CG2 . THR E 5 178 ? 61.593  14.494  29.987  1.00 72.65  ? 178 THR L CG2 1 
ATOM   7718 N N   . LEU E 5 179 ? 61.850  14.106  33.482  1.00 72.24  ? 179 LEU L N   1 
ATOM   7719 C CA  . LEU E 5 179 ? 62.595  14.930  34.427  1.00 73.15  ? 179 LEU L CA  1 
ATOM   7720 C C   . LEU E 5 179 ? 63.680  15.672  33.645  1.00 80.37  ? 179 LEU L C   1 
ATOM   7721 O O   . LEU E 5 179 ? 64.600  15.041  33.125  1.00 79.11  ? 179 LEU L O   1 
ATOM   7722 C CB  . LEU E 5 179 ? 63.236  13.991  35.477  1.00 73.39  ? 179 LEU L CB  1 
ATOM   7723 C CG  . LEU E 5 179 ? 64.238  14.560  36.485  1.00 76.70  ? 179 LEU L CG  1 
ATOM   7724 C CD1 . LEU E 5 179 ? 63.546  15.310  37.589  1.00 76.16  ? 179 LEU L CD1 1 
ATOM   7725 C CD2 . LEU E 5 179 ? 65.043  13.456  37.106  1.00 78.84  ? 179 LEU L CD2 1 
ATOM   7726 N N   . THR E 5 180 ? 63.551  17.000  33.524  1.00 80.67  ? 180 THR L N   1 
ATOM   7727 C CA  . THR E 5 180 ? 64.531  17.819  32.792  1.00 81.69  ? 180 THR L CA  1 
ATOM   7728 C C   . THR E 5 180 ? 65.479  18.602  33.727  1.00 84.78  ? 180 THR L C   1 
ATOM   7729 O O   . THR E 5 180 ? 65.062  19.448  34.534  1.00 84.28  ? 180 THR L O   1 
ATOM   7730 C CB  . THR E 5 180 ? 63.858  18.730  31.767  1.00 104.00 ? 180 THR L CB  1 
ATOM   7731 O OG1 . THR E 5 180 ? 62.843  19.523  32.403  1.00 115.26 ? 180 THR L OG1 1 
ATOM   7732 C CG2 . THR E 5 180 ? 63.307  17.980  30.579  1.00 105.73 ? 180 THR L CG2 1 
ATOM   7733 N N   . LEU E 5 181 ? 66.771  18.291  33.613  1.00 80.97  ? 181 LEU L N   1 
ATOM   7734 C CA  . LEU E 5 181 ? 67.864  18.894  34.381  1.00 80.46  ? 181 LEU L CA  1 
ATOM   7735 C C   . LEU E 5 181 ? 68.976  19.320  33.448  1.00 84.11  ? 181 LEU L C   1 
ATOM   7736 O O   . LEU E 5 181 ? 69.054  18.822  32.319  1.00 82.17  ? 181 LEU L O   1 
ATOM   7737 C CB  . LEU E 5 181 ? 68.449  17.867  35.357  1.00 80.33  ? 181 LEU L CB  1 
ATOM   7738 C CG  . LEU E 5 181 ? 67.670  17.637  36.622  1.00 84.34  ? 181 LEU L CG  1 
ATOM   7739 C CD1 . LEU E 5 181 ? 67.004  16.400  36.557  1.00 85.18  ? 181 LEU L CD1 1 
ATOM   7740 C CD2 . LEU E 5 181 ? 68.599  17.439  37.805  1.00 84.38  ? 181 LEU L CD2 1 
ATOM   7741 N N   . SER E 5 182 ? 69.869  20.199  33.943  1.00 81.24  ? 182 SER L N   1 
ATOM   7742 C CA  . SER E 5 182 ? 71.037  20.622  33.187  1.00 80.64  ? 182 SER L CA  1 
ATOM   7743 C C   . SER E 5 182 ? 72.097  19.537  33.361  1.00 86.74  ? 182 SER L C   1 
ATOM   7744 O O   . SER E 5 182 ? 72.056  18.782  34.347  1.00 85.77  ? 182 SER L O   1 
ATOM   7745 C CB  . SER E 5 182 ? 71.564  21.936  33.730  1.00 83.14  ? 182 SER L CB  1 
ATOM   7746 O OG  . SER E 5 182 ? 72.052  21.762  35.047  1.00 92.05  ? 182 SER L OG  1 
ATOM   7747 N N   . LYS E 5 183 ? 73.064  19.478  32.420  1.00 85.57  ? 183 LYS L N   1 
ATOM   7748 C CA  . LYS E 5 183 ? 74.184  18.528  32.440  1.00 86.32  ? 183 LYS L CA  1 
ATOM   7749 C C   . LYS E 5 183 ? 74.863  18.607  33.817  1.00 89.31  ? 183 LYS L C   1 
ATOM   7750 O O   . LYS E 5 183 ? 75.048  17.585  34.475  1.00 87.79  ? 183 LYS L O   1 
ATOM   7751 C CB  . LYS E 5 183 ? 75.174  18.875  31.306  1.00 90.36  ? 183 LYS L CB  1 
ATOM   7752 C CG  . LYS E 5 183 ? 76.095  17.733  30.877  1.00 114.58 ? 183 LYS L CG  1 
ATOM   7753 C CD  . LYS E 5 183 ? 77.295  18.264  30.096  1.00 128.71 ? 183 LYS L CD  1 
ATOM   7754 C CE  . LYS E 5 183 ? 78.386  17.233  29.930  1.00 144.18 ? 183 LYS L CE  1 
ATOM   7755 N NZ  . LYS E 5 183 ? 78.069  16.231  28.876  1.00 157.54 ? 183 LYS L NZ  1 
ATOM   7756 N N   . ALA E 5 184 ? 75.128  19.847  34.272  1.00 86.87  ? 184 ALA L N   1 
ATOM   7757 C CA  . ALA E 5 184 ? 75.714  20.207  35.565  1.00 87.26  ? 184 ALA L CA  1 
ATOM   7758 C C   . ALA E 5 184 ? 74.906  19.648  36.783  1.00 91.77  ? 184 ALA L C   1 
ATOM   7759 O O   . ALA E 5 184 ? 75.501  19.126  37.734  1.00 91.12  ? 184 ALA L O   1 
ATOM   7760 C CB  . ALA E 5 184 ? 75.823  21.724  35.655  1.00 87.93  ? 184 ALA L CB  1 
ATOM   7761 N N   . ASP E 5 185 ? 73.561  19.773  36.736  1.00 88.17  ? 185 ASP L N   1 
ATOM   7762 C CA  . ASP E 5 185 ? 72.647  19.298  37.768  1.00 88.51  ? 185 ASP L CA  1 
ATOM   7763 C C   . ASP E 5 185 ? 72.573  17.771  37.765  1.00 89.18  ? 185 ASP L C   1 
ATOM   7764 O O   . ASP E 5 185 ? 72.413  17.145  38.815  1.00 87.29  ? 185 ASP L O   1 
ATOM   7765 C CB  . ASP E 5 185 ? 71.235  19.852  37.523  1.00 91.80  ? 185 ASP L CB  1 
ATOM   7766 C CG  . ASP E 5 185 ? 70.982  21.313  37.847  1.00 105.22 ? 185 ASP L CG  1 
ATOM   7767 O OD1 . ASP E 5 185 ? 71.775  21.898  38.623  1.00 105.61 ? 185 ASP L OD1 1 
ATOM   7768 O OD2 . ASP E 5 185 ? 69.982  21.873  37.322  1.00 110.80 ? 185 ASP L OD2 1 
ATOM   7769 N N   . TYR E 5 186 ? 72.644  17.186  36.583  1.00 85.28  ? 186 TYR L N   1 
ATOM   7770 C CA  . TYR E 5 186 ? 72.584  15.745  36.431  1.00 84.93  ? 186 TYR L CA  1 
ATOM   7771 C C   . TYR E 5 186 ? 73.900  15.092  36.921  1.00 89.33  ? 186 TYR L C   1 
ATOM   7772 O O   . TYR E 5 186 ? 73.867  14.205  37.769  1.00 87.49  ? 186 TYR L O   1 
ATOM   7773 C CB  . TYR E 5 186 ? 72.214  15.371  34.978  1.00 85.46  ? 186 TYR L CB  1 
ATOM   7774 C CG  . TYR E 5 186 ? 72.258  13.891  34.668  1.00 86.45  ? 186 TYR L CG  1 
ATOM   7775 C CD1 . TYR E 5 186 ? 71.327  13.017  35.214  1.00 88.60  ? 186 TYR L CD1 1 
ATOM   7776 C CD2 . TYR E 5 186 ? 73.221  13.364  33.821  1.00 87.47  ? 186 TYR L CD2 1 
ATOM   7777 C CE1 . TYR E 5 186 ? 71.376  11.647  34.953  1.00 89.09  ? 186 TYR L CE1 1 
ATOM   7778 C CE2 . TYR E 5 186 ? 73.252  12.005  33.517  1.00 88.92  ? 186 TYR L CE2 1 
ATOM   7779 C CZ  . TYR E 5 186 ? 72.343  11.143  34.106  1.00 94.40  ? 186 TYR L CZ  1 
ATOM   7780 O OH  . TYR E 5 186 ? 72.391  9.798   33.826  1.00 96.05  ? 186 TYR L OH  1 
ATOM   7781 N N   . GLU E 5 187 ? 75.049  15.607  36.473  1.00 88.05  ? 187 GLU L N   1 
ATOM   7782 C CA  . GLU E 5 187 ? 76.366  15.084  36.857  1.00 88.66  ? 187 GLU L CA  1 
ATOM   7783 C C   . GLU E 5 187 ? 76.688  15.257  38.355  1.00 94.50  ? 187 GLU L C   1 
ATOM   7784 O O   . GLU E 5 187 ? 77.609  14.614  38.863  1.00 93.91  ? 187 GLU L O   1 
ATOM   7785 C CB  . GLU E 5 187 ? 77.465  15.680  35.973  1.00 90.00  ? 187 GLU L CB  1 
ATOM   7786 C CG  . GLU E 5 187 ? 77.405  15.158  34.542  1.00 101.93 ? 187 GLU L CG  1 
ATOM   7787 C CD  . GLU E 5 187 ? 78.284  15.858  33.530  1.00 126.94 ? 187 GLU L CD  1 
ATOM   7788 O OE1 . GLU E 5 187 ? 78.807  15.164  32.628  1.00 119.69 ? 187 GLU L OE1 1 
ATOM   7789 O OE2 . GLU E 5 187 ? 78.444  17.096  33.632  1.00 126.52 ? 187 GLU L OE2 1 
ATOM   7790 N N   . LYS E 5 188 ? 75.897  16.086  39.060  1.00 92.63  ? 188 LYS L N   1 
ATOM   7791 C CA  . LYS E 5 188 ? 76.032  16.371  40.495  1.00 93.37  ? 188 LYS L CA  1 
ATOM   7792 C C   . LYS E 5 188 ? 75.535  15.205  41.401  1.00 98.90  ? 188 LYS L C   1 
ATOM   7793 O O   . LYS E 5 188 ? 76.092  15.023  42.491  1.00 98.32  ? 188 LYS L O   1 
ATOM   7794 C CB  . LYS E 5 188 ? 75.311  17.697  40.826  1.00 95.89  ? 188 LYS L CB  1 
ATOM   7795 C CG  . LYS E 5 188 ? 75.658  18.333  42.162  1.00 117.19 ? 188 LYS L CG  1 
ATOM   7796 C CD  . LYS E 5 188 ? 74.922  19.643  42.291  1.00 136.30 ? 188 LYS L CD  1 
ATOM   7797 C CE  . LYS E 5 188 ? 74.509  20.035  43.679  1.00 153.54 ? 188 LYS L CE  1 
ATOM   7798 N NZ  . LYS E 5 188 ? 73.709  21.280  43.626  1.00 160.43 ? 188 LYS L NZ  1 
ATOM   7799 N N   . HIS E 5 189 ? 74.519  14.409  40.937  1.00 95.55  ? 189 HIS L N   1 
ATOM   7800 C CA  . HIS E 5 189 ? 73.899  13.292  41.687  1.00 94.38  ? 189 HIS L CA  1 
ATOM   7801 C C   . HIS E 5 189 ? 74.048  11.932  41.015  1.00 94.12  ? 189 HIS L C   1 
ATOM   7802 O O   . HIS E 5 189 ? 74.267  11.870  39.803  1.00 93.66  ? 189 HIS L O   1 
ATOM   7803 C CB  . HIS E 5 189 ? 72.426  13.588  41.993  1.00 95.51  ? 189 HIS L CB  1 
ATOM   7804 C CG  . HIS E 5 189 ? 72.214  14.955  42.544  1.00 99.34  ? 189 HIS L CG  1 
ATOM   7805 N ND1 . HIS E 5 189 ? 72.438  15.227  43.865  1.00 101.55 ? 189 HIS L ND1 1 
ATOM   7806 C CD2 . HIS E 5 189 ? 71.880  16.101  41.909  1.00 101.61 ? 189 HIS L CD2 1 
ATOM   7807 C CE1 . HIS E 5 189 ? 72.215  16.521  44.007  1.00 101.49 ? 189 HIS L CE1 1 
ATOM   7808 N NE2 . HIS E 5 189 ? 71.879  17.088  42.849  1.00 101.74 ? 189 HIS L NE2 1 
ATOM   7809 N N   . LYS E 5 190 ? 73.933  10.846  41.819  1.00 88.06  ? 190 LYS L N   1 
ATOM   7810 C CA  . LYS E 5 190 ? 74.138  9.450   41.392  1.00 86.52  ? 190 LYS L CA  1 
ATOM   7811 C C   . LYS E 5 190 ? 72.882  8.675   40.943  1.00 87.89  ? 190 LYS L C   1 
ATOM   7812 O O   . LYS E 5 190 ? 72.790  8.291   39.766  1.00 86.96  ? 190 LYS L O   1 
ATOM   7813 C CB  . LYS E 5 190 ? 74.853  8.651   42.507  1.00 87.49  ? 190 LYS L CB  1 
ATOM   7814 C CG  . LYS E 5 190 ? 75.383  7.310   42.046  1.00 89.50  ? 190 LYS L CG  1 
ATOM   7815 C CD  . LYS E 5 190 ? 75.534  6.340   43.185  1.00 106.14 ? 190 LYS L CD  1 
ATOM   7816 C CE  . LYS E 5 190 ? 76.410  5.170   42.789  1.00 129.40 ? 190 LYS L CE  1 
ATOM   7817 N NZ  . LYS E 5 190 ? 76.341  4.042   43.763  1.00 142.47 ? 190 LYS L NZ  1 
ATOM   7818 N N   . VAL E 5 191 ? 71.980  8.369   41.901  1.00 81.63  ? 191 VAL L N   1 
ATOM   7819 C CA  . VAL E 5 191 ? 70.813  7.512   41.697  1.00 80.28  ? 191 VAL L CA  1 
ATOM   7820 C C   . VAL E 5 191 ? 69.619  8.336   41.257  1.00 83.22  ? 191 VAL L C   1 
ATOM   7821 O O   . VAL E 5 191 ? 69.318  9.381   41.833  1.00 83.83  ? 191 VAL L O   1 
ATOM   7822 C CB  . VAL E 5 191 ? 70.496  6.522   42.879  1.00 82.61  ? 191 VAL L CB  1 
ATOM   7823 C CG1 . VAL E 5 191 ? 71.769  6.029   43.564  1.00 82.03  ? 191 VAL L CG1 1 
ATOM   7824 C CG2 . VAL E 5 191 ? 69.503  7.085   43.875  1.00 82.56  ? 191 VAL L CG2 1 
ATOM   7825 N N   . TYR E 5 192 ? 68.968  7.880   40.185  1.00 77.63  ? 192 TYR L N   1 
ATOM   7826 C CA  . TYR E 5 192 ? 67.807  8.535   39.589  1.00 75.96  ? 192 TYR L CA  1 
ATOM   7827 C C   . TYR E 5 192 ? 66.678  7.539   39.492  1.00 80.74  ? 192 TYR L C   1 
ATOM   7828 O O   . TYR E 5 192 ? 66.811  6.537   38.781  1.00 81.62  ? 192 TYR L O   1 
ATOM   7829 C CB  . TYR E 5 192 ? 68.154  9.093   38.196  1.00 75.87  ? 192 TYR L CB  1 
ATOM   7830 C CG  . TYR E 5 192 ? 69.046  10.304  38.258  1.00 76.29  ? 192 TYR L CG  1 
ATOM   7831 C CD1 . TYR E 5 192 ? 70.416  10.175  38.456  1.00 78.24  ? 192 TYR L CD1 1 
ATOM   7832 C CD2 . TYR E 5 192 ? 68.520  11.585  38.156  1.00 76.76  ? 192 TYR L CD2 1 
ATOM   7833 C CE1 . TYR E 5 192 ? 71.232  11.293  38.587  1.00 79.41  ? 192 TYR L CE1 1 
ATOM   7834 C CE2 . TYR E 5 192 ? 69.333  12.712  38.245  1.00 77.57  ? 192 TYR L CE2 1 
ATOM   7835 C CZ  . TYR E 5 192 ? 70.680  12.562  38.494  1.00 86.98  ? 192 TYR L CZ  1 
ATOM   7836 O OH  . TYR E 5 192 ? 71.454  13.681  38.609  1.00 91.18  ? 192 TYR L OH  1 
ATOM   7837 N N   . ALA E 5 193 ? 65.580  7.785   40.226  1.00 76.70  ? 193 ALA L N   1 
ATOM   7838 C CA  . ALA E 5 193 ? 64.454  6.856   40.267  1.00 76.46  ? 193 ALA L CA  1 
ATOM   7839 C C   . ALA E 5 193 ? 63.087  7.500   40.117  1.00 81.29  ? 193 ALA L C   1 
ATOM   7840 O O   . ALA E 5 193 ? 62.866  8.643   40.544  1.00 81.20  ? 193 ALA L O   1 
ATOM   7841 C CB  . ALA E 5 193 ? 64.497  6.050   41.568  1.00 76.95  ? 193 ALA L CB  1 
ATOM   7842 N N   . CYS E 5 194 ? 62.151  6.738   39.547  1.00 77.97  ? 194 CYS L N   1 
ATOM   7843 C CA  . CYS E 5 194 ? 60.772  7.166   39.494  1.00 78.43  ? 194 CYS L CA  1 
ATOM   7844 C C   . CYS E 5 194 ? 59.941  6.129   40.213  1.00 79.66  ? 194 CYS L C   1 
ATOM   7845 O O   . CYS E 5 194 ? 60.063  4.930   39.947  1.00 80.41  ? 194 CYS L O   1 
ATOM   7846 C CB  . CYS E 5 194 ? 60.279  7.457   38.082  1.00 80.13  ? 194 CYS L CB  1 
ATOM   7847 S SG  . CYS E 5 194 ? 60.251  6.031   36.976  1.00 84.93  ? 194 CYS L SG  1 
ATOM   7848 N N   . GLU E 5 195 ? 59.201  6.590   41.226  1.00 72.54  ? 195 GLU L N   1 
ATOM   7849 C CA  . GLU E 5 195 ? 58.378  5.782   42.101  1.00 69.81  ? 195 GLU L CA  1 
ATOM   7850 C C   . GLU E 5 195 ? 56.929  5.880   41.660  1.00 70.25  ? 195 GLU L C   1 
ATOM   7851 O O   . GLU E 5 195 ? 56.336  6.961   41.648  1.00 68.08  ? 195 GLU L O   1 
ATOM   7852 C CB  . GLU E 5 195 ? 58.553  6.285   43.510  1.00 70.99  ? 195 GLU L CB  1 
ATOM   7853 C CG  . GLU E 5 195 ? 58.277  5.255   44.568  1.00 86.72  ? 195 GLU L CG  1 
ATOM   7854 C CD  . GLU E 5 195 ? 58.684  5.792   45.919  1.00 112.93 ? 195 GLU L CD  1 
ATOM   7855 O OE1 . GLU E 5 195 ? 58.059  6.781   46.359  1.00 99.61  ? 195 GLU L OE1 1 
ATOM   7856 O OE2 . GLU E 5 195 ? 59.629  5.239   46.528  1.00 114.56 ? 195 GLU L OE2 1 
ATOM   7857 N N   . VAL E 5 196 ? 56.367  4.731   41.297  1.00 66.82  ? 196 VAL L N   1 
ATOM   7858 C CA  . VAL E 5 196 ? 55.019  4.606   40.769  1.00 66.23  ? 196 VAL L CA  1 
ATOM   7859 C C   . VAL E 5 196 ? 54.015  4.018   41.766  1.00 70.90  ? 196 VAL L C   1 
ATOM   7860 O O   . VAL E 5 196 ? 54.254  2.976   42.369  1.00 70.86  ? 196 VAL L O   1 
ATOM   7861 C CB  . VAL E 5 196 ? 55.072  3.806   39.450  1.00 69.09  ? 196 VAL L CB  1 
ATOM   7862 C CG1 . VAL E 5 196 ? 53.680  3.387   38.976  1.00 68.62  ? 196 VAL L CG1 1 
ATOM   7863 C CG2 . VAL E 5 196 ? 55.832  4.590   38.369  1.00 68.56  ? 196 VAL L CG2 1 
ATOM   7864 N N   . THR E 5 197 ? 52.869  4.696   41.896  1.00 67.26  ? 197 THR L N   1 
ATOM   7865 C CA  . THR E 5 197 ? 51.719  4.319   42.717  1.00 66.32  ? 197 THR L CA  1 
ATOM   7866 C C   . THR E 5 197 ? 50.488  4.200   41.811  1.00 68.65  ? 197 THR L C   1 
ATOM   7867 O O   . THR E 5 197 ? 50.186  5.105   41.016  1.00 66.11  ? 197 THR L O   1 
ATOM   7868 C CB  . THR E 5 197 ? 51.628  5.268   43.904  1.00 68.79  ? 197 THR L CB  1 
ATOM   7869 O OG1 . THR E 5 197 ? 52.235  4.569   44.981  1.00 68.07  ? 197 THR L OG1 1 
ATOM   7870 C CG2 . THR E 5 197 ? 50.229  5.696   44.243  1.00 65.01  ? 197 THR L CG2 1 
ATOM   7871 N N   . HIS E 5 198 ? 49.830  3.047   41.887  1.00 66.26  ? 198 HIS L N   1 
ATOM   7872 C CA  . HIS E 5 198 ? 48.671  2.714   41.058  1.00 67.38  ? 198 HIS L CA  1 
ATOM   7873 C C   . HIS E 5 198 ? 47.807  1.680   41.785  1.00 71.83  ? 198 HIS L C   1 
ATOM   7874 O O   . HIS E 5 198 ? 48.319  0.897   42.585  1.00 72.66  ? 198 HIS L O   1 
ATOM   7875 C CB  . HIS E 5 198 ? 49.139  2.181   39.673  1.00 68.77  ? 198 HIS L CB  1 
ATOM   7876 C CG  . HIS E 5 198 ? 48.037  1.882   38.715  1.00 72.73  ? 198 HIS L CG  1 
ATOM   7877 N ND1 . HIS E 5 198 ? 47.521  0.597   38.583  1.00 75.21  ? 198 HIS L ND1 1 
ATOM   7878 C CD2 . HIS E 5 198 ? 47.370  2.714   37.886  1.00 75.24  ? 198 HIS L CD2 1 
ATOM   7879 C CE1 . HIS E 5 198 ? 46.562  0.688   37.677  1.00 75.13  ? 198 HIS L CE1 1 
ATOM   7880 N NE2 . HIS E 5 198 ? 46.437  1.948   37.225  1.00 75.33  ? 198 HIS L NE2 1 
ATOM   7881 N N   . GLN E 5 199 ? 46.504  1.679   41.493  1.00 67.09  ? 199 GLN L N   1 
ATOM   7882 C CA  . GLN E 5 199 ? 45.513  0.768   42.050  1.00 66.63  ? 199 GLN L CA  1 
ATOM   7883 C C   . GLN E 5 199 ? 45.957  -0.688  41.917  1.00 75.55  ? 199 GLN L C   1 
ATOM   7884 O O   . GLN E 5 199 ? 45.892  -1.423  42.906  1.00 77.97  ? 199 GLN L O   1 
ATOM   7885 C CB  . GLN E 5 199 ? 44.186  0.970   41.328  1.00 67.13  ? 199 GLN L CB  1 
ATOM   7886 C CG  . GLN E 5 199 ? 42.993  0.394   42.055  1.00 68.32  ? 199 GLN L CG  1 
ATOM   7887 C CD  . GLN E 5 199 ? 41.711  0.730   41.349  1.00 82.77  ? 199 GLN L CD  1 
ATOM   7888 O OE1 . GLN E 5 199 ? 41.500  1.875   40.897  1.00 68.46  ? 199 GLN L OE1 1 
ATOM   7889 N NE2 . GLN E 5 199 ? 40.815  -0.261  41.273  1.00 81.54  ? 199 GLN L NE2 1 
ATOM   7890 N N   . GLY E 5 200 ? 46.431  -1.079  40.720  1.00 72.23  ? 200 GLY L N   1 
ATOM   7891 C CA  . GLY E 5 200 ? 46.881  -2.437  40.413  1.00 72.08  ? 200 GLY L CA  1 
ATOM   7892 C C   . GLY E 5 200 ? 48.183  -2.855  41.064  1.00 77.36  ? 200 GLY L C   1 
ATOM   7893 O O   . GLY E 5 200 ? 48.642  -3.988  40.862  1.00 78.71  ? 200 GLY L O   1 
ATOM   7894 N N   . LEU E 5 201 ? 48.796  -1.934  41.835  1.00 71.50  ? 201 LEU L N   1 
ATOM   7895 C CA  . LEU E 5 201 ? 50.037  -2.181  42.552  1.00 69.58  ? 201 LEU L CA  1 
ATOM   7896 C C   . LEU E 5 201 ? 49.777  -2.228  44.037  1.00 76.97  ? 201 LEU L C   1 
ATOM   7897 O O   . LEU E 5 201 ? 49.278  -1.255  44.606  1.00 77.29  ? 201 LEU L O   1 
ATOM   7898 C CB  . LEU E 5 201 ? 51.071  -1.111  42.227  1.00 67.64  ? 201 LEU L CB  1 
ATOM   7899 C CG  . LEU E 5 201 ? 51.599  -1.131  40.830  1.00 69.22  ? 201 LEU L CG  1 
ATOM   7900 C CD1 . LEU E 5 201 ? 52.360  0.111   40.547  1.00 68.51  ? 201 LEU L CD1 1 
ATOM   7901 C CD2 . LEU E 5 201 ? 52.427  -2.356  40.586  1.00 70.12  ? 201 LEU L CD2 1 
ATOM   7902 N N   . SER E 5 202 ? 50.100  -3.362  44.668  1.00 75.08  ? 202 SER L N   1 
ATOM   7903 C CA  . SER E 5 202 ? 49.925  -3.525  46.113  1.00 75.68  ? 202 SER L CA  1 
ATOM   7904 C C   . SER E 5 202 ? 50.949  -2.668  46.877  1.00 82.19  ? 202 SER L C   1 
ATOM   7905 O O   . SER E 5 202 ? 50.631  -2.105  47.922  1.00 82.16  ? 202 SER L O   1 
ATOM   7906 C CB  . SER E 5 202 ? 50.070  -4.989  46.502  1.00 80.13  ? 202 SER L CB  1 
ATOM   7907 O OG  . SER E 5 202 ? 51.251  -5.520  45.927  1.00 97.88  ? 202 SER L OG  1 
ATOM   7908 N N   . SER E 5 203 ? 52.158  -2.534  46.319  1.00 80.22  ? 203 SER L N   1 
ATOM   7909 C CA  . SER E 5 203 ? 53.251  -1.738  46.872  1.00 80.29  ? 203 SER L CA  1 
ATOM   7910 C C   . SER E 5 203 ? 53.766  -0.787  45.751  1.00 82.62  ? 203 SER L C   1 
ATOM   7911 O O   . SER E 5 203 ? 53.599  -1.119  44.577  1.00 85.09  ? 203 SER L O   1 
ATOM   7912 C CB  . SER E 5 203 ? 54.350  -2.670  47.393  1.00 85.82  ? 203 SER L CB  1 
ATOM   7913 O OG  . SER E 5 203 ? 55.672  -2.347  46.979  1.00 100.11 ? 203 SER L OG  1 
ATOM   7914 N N   . PRO E 5 204 ? 54.378  0.381   46.040  1.00 74.43  ? 204 PRO L N   1 
ATOM   7915 C CA  . PRO E 5 204 ? 54.835  1.237   44.934  1.00 72.97  ? 204 PRO L CA  1 
ATOM   7916 C C   . PRO E 5 204 ? 56.101  0.695   44.316  1.00 74.33  ? 204 PRO L C   1 
ATOM   7917 O O   . PRO E 5 204 ? 56.988  0.238   45.038  1.00 73.60  ? 204 PRO L O   1 
ATOM   7918 C CB  . PRO E 5 204 ? 55.063  2.604   45.591  1.00 74.83  ? 204 PRO L CB  1 
ATOM   7919 C CG  . PRO E 5 204 ? 54.584  2.463   47.017  1.00 79.61  ? 204 PRO L CG  1 
ATOM   7920 C CD  . PRO E 5 204 ? 54.689  0.998   47.339  1.00 75.25  ? 204 PRO L CD  1 
ATOM   7921 N N   . VAL E 5 205 ? 56.172  0.737   42.982  1.00 69.88  ? 205 VAL L N   1 
ATOM   7922 C CA  . VAL E 5 205 ? 57.307  0.277   42.177  1.00 69.12  ? 205 VAL L CA  1 
ATOM   7923 C C   . VAL E 5 205 ? 58.342  1.408   42.052  1.00 75.68  ? 205 VAL L C   1 
ATOM   7924 O O   . VAL E 5 205 ? 57.977  2.550   41.756  1.00 74.95  ? 205 VAL L O   1 
ATOM   7925 C CB  . VAL E 5 205 ? 56.803  -0.197  40.796  1.00 72.11  ? 205 VAL L CB  1 
ATOM   7926 C CG1 . VAL E 5 205 ? 57.950  -0.516  39.844  1.00 71.58  ? 205 VAL L CG1 1 
ATOM   7927 C CG2 . VAL E 5 205 ? 55.879  -1.394  40.942  1.00 72.06  ? 205 VAL L CG2 1 
ATOM   7928 N N   . THR E 5 206 ? 59.625  1.099   42.292  1.00 74.08  ? 206 THR L N   1 
ATOM   7929 C CA  . THR E 5 206 ? 60.667  2.114   42.192  1.00 74.90  ? 206 THR L CA  1 
ATOM   7930 C C   . THR E 5 206 ? 61.681  1.722   41.126  1.00 81.00  ? 206 THR L C   1 
ATOM   7931 O O   . THR E 5 206 ? 62.620  0.987   41.418  1.00 82.63  ? 206 THR L O   1 
ATOM   7932 C CB  . THR E 5 206 ? 61.286  2.440   43.574  1.00 90.12  ? 206 THR L CB  1 
ATOM   7933 O OG1 . THR E 5 206 ? 60.263  2.565   44.570  1.00 99.04  ? 206 THR L OG1 1 
ATOM   7934 C CG2 . THR E 5 206 ? 62.112  3.708   43.553  1.00 89.90  ? 206 THR L CG2 1 
ATOM   7935 N N   . LYS E 5 207 ? 61.496  2.209   39.893  1.00 78.28  ? 207 LYS L N   1 
ATOM   7936 C CA  . LYS E 5 207 ? 62.417  1.954   38.784  1.00 79.21  ? 207 LYS L CA  1 
ATOM   7937 C C   . LYS E 5 207 ? 63.555  2.992   38.851  1.00 84.10  ? 207 LYS L C   1 
ATOM   7938 O O   . LYS E 5 207 ? 63.279  4.194   38.796  1.00 84.91  ? 207 LYS L O   1 
ATOM   7939 C CB  . LYS E 5 207 ? 61.658  2.017   37.442  1.00 82.00  ? 207 LYS L CB  1 
ATOM   7940 C CG  . LYS E 5 207 ? 62.179  1.087   36.368  1.00 88.72  ? 207 LYS L CG  1 
ATOM   7941 C CD  . LYS E 5 207 ? 61.595  -0.322  36.464  1.00 101.63 ? 207 LYS L CD  1 
ATOM   7942 C CE  . LYS E 5 207 ? 62.216  -1.276  35.448  1.00 126.33 ? 207 LYS L CE  1 
ATOM   7943 N NZ  . LYS E 5 207 ? 63.606  -1.695  35.793  1.00 142.70 ? 207 LYS L NZ  1 
ATOM   7944 N N   . SER E 5 208 ? 64.816  2.534   39.033  1.00 79.68  ? 208 SER L N   1 
ATOM   7945 C CA  . SER E 5 208 ? 65.992  3.412   39.167  1.00 78.88  ? 208 SER L CA  1 
ATOM   7946 C C   . SER E 5 208 ? 67.208  2.974   38.352  1.00 81.85  ? 208 SER L C   1 
ATOM   7947 O O   . SER E 5 208 ? 67.240  1.863   37.806  1.00 81.76  ? 208 SER L O   1 
ATOM   7948 C CB  . SER E 5 208 ? 66.404  3.529   40.632  1.00 81.68  ? 208 SER L CB  1 
ATOM   7949 O OG  . SER E 5 208 ? 66.889  2.306   41.159  1.00 90.34  ? 208 SER L OG  1 
ATOM   7950 N N   . PHE E 5 209 ? 68.231  3.840   38.326  1.00 76.56  ? 209 PHE L N   1 
ATOM   7951 C CA  . PHE E 5 209 ? 69.519  3.585   37.679  1.00 75.48  ? 209 PHE L CA  1 
ATOM   7952 C C   . PHE E 5 209 ? 70.598  4.441   38.327  1.00 80.30  ? 209 PHE L C   1 
ATOM   7953 O O   . PHE E 5 209 ? 70.282  5.471   38.957  1.00 79.34  ? 209 PHE L O   1 
ATOM   7954 C CB  . PHE E 5 209 ? 69.473  3.847   36.157  1.00 75.79  ? 209 PHE L CB  1 
ATOM   7955 C CG  . PHE E 5 209 ? 69.350  5.294   35.724  1.00 75.27  ? 209 PHE L CG  1 
ATOM   7956 C CD1 . PHE E 5 209 ? 70.458  6.133   35.702  1.00 76.24  ? 209 PHE L CD1 1 
ATOM   7957 C CD2 . PHE E 5 209 ? 68.154  5.789   35.250  1.00 75.60  ? 209 PHE L CD2 1 
ATOM   7958 C CE1 . PHE E 5 209 ? 70.337  7.467   35.313  1.00 76.38  ? 209 PHE L CE1 1 
ATOM   7959 C CE2 . PHE E 5 209 ? 68.049  7.111   34.826  1.00 77.47  ? 209 PHE L CE2 1 
ATOM   7960 C CZ  . PHE E 5 209 ? 69.126  7.953   34.897  1.00 75.10  ? 209 PHE L CZ  1 
ATOM   7961 N N   . ASN E 5 210 ? 71.873  4.042   38.117  1.00 76.59  ? 210 ASN L N   1 
ATOM   7962 C CA  . ASN E 5 210 ? 73.016  4.820   38.599  1.00 76.59  ? 210 ASN L CA  1 
ATOM   7963 C C   . ASN E 5 210 ? 73.777  5.419   37.411  1.00 82.81  ? 210 ASN L C   1 
ATOM   7964 O O   . ASN E 5 210 ? 73.994  4.741   36.405  1.00 84.63  ? 210 ASN L O   1 
ATOM   7965 C CB  . ASN E 5 210 ? 73.927  3.987   39.500  1.00 75.71  ? 210 ASN L CB  1 
ATOM   7966 C CG  . ASN E 5 210 ? 73.273  3.455   40.766  1.00 99.04  ? 210 ASN L CG  1 
ATOM   7967 O OD1 . ASN E 5 210 ? 72.039  3.520   40.950  1.00 89.60  ? 210 ASN L OD1 1 
ATOM   7968 N ND2 . ASN E 5 210 ? 74.105  2.950   41.695  1.00 92.11  ? 210 ASN L ND2 1 
ATOM   7969 N N   . ARG E 5 211 ? 74.123  6.699   37.518  1.00 78.63  ? 211 ARG L N   1 
ATOM   7970 C CA  . ARG E 5 211 ? 74.828  7.496   36.516  1.00 69.31  ? 211 ARG L CA  1 
ATOM   7971 C C   . ARG E 5 211 ? 76.272  7.008   36.385  1.00 89.73  ? 211 ARG L C   1 
ATOM   7972 O O   . ARG E 5 211 ? 76.649  6.407   35.376  1.00 68.25  ? 211 ARG L O   1 
ATOM   7973 C CB  . ARG E 5 211 ? 74.803  8.950   36.990  1.00 69.31  ? 211 ARG L CB  1 
ATOM   7974 C CG  . ARG E 5 211 ? 75.129  9.952   35.928  1.00 87.74  ? 211 ARG L CG  1 
ATOM   7975 C CD  . ARG E 5 211 ? 75.123  11.379  36.462  1.00 99.91  ? 211 ARG L CD  1 
ATOM   7976 N NE  . ARG E 5 211 ? 76.098  11.585  37.532  1.00 109.30 ? 211 ARG L NE  1 
ATOM   7977 C CZ  . ARG E 5 211 ? 77.403  11.716  37.337  1.00 124.59 ? 211 ARG L CZ  1 
ATOM   7978 N NH1 . ARG E 5 211 ? 77.908  11.663  36.108  1.00 107.62 ? 211 ARG L NH1 1 
ATOM   7979 N NH2 . ARG E 5 211 ? 78.218  11.903  38.368  1.00 116.55 ? 211 ARG L NH2 1 
HETATM 7980 O O   . HOH F 6 .   ? 24.682  15.258  -4.447  1.00 57.86  ? 201 HOH A O   1 
HETATM 7981 O O   . HOH F 6 .   ? 34.375  3.776   -22.049 1.00 72.86  ? 202 HOH A O   1 
HETATM 7982 O O   . HOH F 6 .   ? -13.708 12.266  -4.488  1.00 94.10  ? 203 HOH A O   1 
HETATM 7983 O O   . HOH F 6 .   ? -7.469  12.281  -3.311  1.00 86.30  ? 204 HOH A O   1 
HETATM 7984 O O   . HOH F 6 .   ? 26.975  3.479   -28.796 1.00 72.36  ? 205 HOH A O   1 
HETATM 7985 O O   . HOH F 6 .   ? -3.127  15.114  -2.608  1.00 92.85  ? 206 HOH A O   1 
HETATM 7986 O O   . HOH F 6 .   ? 4.858   10.324  -17.761 1.00 80.66  ? 207 HOH A O   1 
HETATM 7987 O O   . HOH F 6 .   ? 16.542  32.056  -2.378  1.00 56.59  ? 208 HOH A O   1 
HETATM 7988 O O   . HOH F 6 .   ? 17.195  34.549  -9.546  1.00 60.72  ? 209 HOH A O   1 
HETATM 7989 O O   . HOH F 6 .   ? 14.842  24.212  -18.405 1.00 61.84  ? 210 HOH A O   1 
HETATM 7990 O O   . HOH F 6 .   ? -8.271  14.987  -2.240  1.00 68.67  ? 211 HOH A O   1 
HETATM 7991 O O   . HOH F 6 .   ? -11.257 14.526  -3.485  1.00 89.46  ? 212 HOH A O   1 
HETATM 7992 O O   . HOH F 6 .   ? 2.367   8.036   -17.217 1.00 77.42  ? 213 HOH A O   1 
HETATM 7993 O O   . HOH F 6 .   ? 6.801   17.351  -18.649 1.00 64.58  ? 214 HOH A O   1 
HETATM 7994 O O   . HOH F 6 .   ? 29.711  26.897  -24.911 1.00 71.16  ? 215 HOH A O   1 
HETATM 7995 O O   . HOH F 6 .   ? 23.127  22.325  -28.341 1.00 57.73  ? 216 HOH A O   1 
HETATM 7996 O O   . HOH F 6 .   ? 4.202   13.005  -19.146 1.00 63.15  ? 217 HOH A O   1 
HETATM 7997 O O   . HOH F 6 .   ? -14.252 15.320  -4.537  1.00 80.19  ? 218 HOH A O   1 
HETATM 7998 O O   . HOH F 6 .   ? 25.692  27.380  -10.740 1.00 50.26  ? 219 HOH A O   1 
HETATM 7999 O O   . HOH F 6 .   ? 32.244  4.812   -24.450 1.00 80.77  ? 220 HOH A O   1 
HETATM 8000 O O   . HOH F 6 .   ? 4.670   6.372   -14.565 1.00 73.43  ? 221 HOH A O   1 
HETATM 8001 O O   . HOH F 6 .   ? -17.189 15.965  -6.018  1.00 103.93 ? 222 HOH A O   1 
HETATM 8002 O O   . HOH F 6 .   ? 16.317  16.769  -52.040 1.00 109.05 ? 223 HOH A O   1 
HETATM 8003 O O   . HOH F 6 .   ? 34.804  5.310   -25.548 1.00 73.58  ? 224 HOH A O   1 
HETATM 8004 O O   . HOH F 6 .   ? 10.667  22.868  -37.681 1.00 77.21  ? 225 HOH A O   1 
HETATM 8005 O O   . HOH F 6 .   ? 36.961  11.667  -14.468 1.00 73.55  ? 226 HOH A O   1 
HETATM 8006 O O   . HOH F 6 .   ? -13.808 35.121  -4.220  1.00 74.23  ? 227 HOH A O   1 
HETATM 8007 O O   . HOH F 6 .   ? -6.465  -1.883  -13.348 1.00 107.62 ? 228 HOH A O   1 
HETATM 8008 O O   . HOH F 6 .   ? -4.781  -2.612  -15.387 1.00 89.91  ? 229 HOH A O   1 
HETATM 8009 O O   . HOH F 6 .   ? 6.195   3.142   1.833   1.00 79.15  ? 230 HOH A O   1 
HETATM 8010 O O   . HOH G 6 .   ? 41.876  11.947  -40.728 1.00 54.03  ? 301 HOH D O   1 
HETATM 8011 O O   . HOH G 6 .   ? 43.640  26.761  -60.307 1.00 89.27  ? 302 HOH D O   1 
HETATM 8012 O O   . HOH G 6 .   ? 85.012  33.874  -56.165 1.00 75.55  ? 303 HOH D O   1 
HETATM 8013 O O   . HOH G 6 .   ? 35.149  13.449  -68.419 1.00 97.79  ? 304 HOH D O   1 
HETATM 8014 O O   . HOH G 6 .   ? 41.088  4.265   -77.328 1.00 50.43  ? 305 HOH D O   1 
HETATM 8015 O O   . HOH G 6 .   ? 79.934  21.826  -77.323 1.00 60.11  ? 306 HOH D O   1 
HETATM 8016 O O   . HOH G 6 .   ? 39.027  17.894  -64.319 1.00 72.23  ? 307 HOH D O   1 
HETATM 8017 O O   . HOH G 6 .   ? 46.585  22.210  -61.436 1.00 81.11  ? 308 HOH D O   1 
HETATM 8018 O O   . HOH G 6 .   ? 57.565  10.515  -68.534 1.00 68.26  ? 309 HOH D O   1 
HETATM 8019 O O   . HOH G 6 .   ? 30.607  6.148   -72.420 1.00 69.23  ? 310 HOH D O   1 
HETATM 8020 O O   . HOH G 6 .   ? 33.522  5.116   -72.152 1.00 72.47  ? 311 HOH D O   1 
HETATM 8021 O O   . HOH G 6 .   ? 72.464  34.545  -57.601 1.00 78.77  ? 312 HOH D O   1 
HETATM 8022 O O   . HOH G 6 .   ? 37.346  18.494  -68.447 1.00 67.20  ? 313 HOH D O   1 
HETATM 8023 O O   . HOH G 6 .   ? 46.043  24.722  -59.840 1.00 67.51  ? 314 HOH D O   1 
HETATM 8024 O O   . HOH G 6 .   ? 75.574  18.963  -58.413 1.00 74.28  ? 315 HOH D O   1 
HETATM 8025 O O   . HOH G 6 .   ? 33.020  10.588  -73.383 1.00 83.56  ? 316 HOH D O   1 
HETATM 8026 O O   . HOH G 6 .   ? 33.980  16.290  -69.052 1.00 75.46  ? 317 HOH D O   1 
HETATM 8027 O O   . HOH G 6 .   ? 32.666  7.499   -74.799 1.00 97.13  ? 318 HOH D O   1 
HETATM 8028 O O   . HOH G 6 .   ? 31.220  15.160  -70.139 1.00 72.10  ? 319 HOH D O   1 
HETATM 8029 O O   . HOH G 6 .   ? 38.935  -5.379  -48.834 1.00 76.44  ? 320 HOH D O   1 
HETATM 8030 O O   . HOH G 6 .   ? 75.546  15.561  -57.533 1.00 97.36  ? 321 HOH D O   1 
HETATM 8031 O O   . HOH G 6 .   ? 73.465  32.490  -56.114 1.00 71.74  ? 322 HOH D O   1 
HETATM 8032 O O   . HOH G 6 .   ? 36.356  15.660  -70.710 1.00 67.23  ? 323 HOH D O   1 
HETATM 8033 O O   . HOH G 6 .   ? 32.009  11.976  -76.238 1.00 77.72  ? 324 HOH D O   1 
HETATM 8034 O O   . HOH G 6 .   ? 57.842  12.205  -44.209 1.00 104.27 ? 325 HOH D O   1 
HETATM 8035 O O   . HOH G 6 .   ? 44.659  -14.348 -47.271 1.00 86.08  ? 326 HOH D O   1 
HETATM 8036 O O   . HOH G 6 .   ? 69.555  21.986  -42.198 1.00 73.96  ? 327 HOH D O   1 
HETATM 8037 O O   . HOH H 6 .   ? 46.384  42.360  -50.893 1.00 72.39  ? 301 HOH E O   1 
HETATM 8038 O O   . HOH H 6 .   ? 74.219  39.473  -84.432 1.00 88.26  ? 302 HOH E O   1 
HETATM 8039 O O   . HOH H 6 .   ? 37.941  28.542  -34.005 1.00 83.15  ? 303 HOH E O   1 
HETATM 8040 O O   . HOH H 6 .   ? 64.384  40.339  -89.603 1.00 84.88  ? 304 HOH E O   1 
HETATM 8041 O O   . HOH H 6 .   ? 76.622  24.492  -84.142 1.00 102.59 ? 305 HOH E O   1 
HETATM 8042 O O   . HOH H 6 .   ? 22.894  15.438  -52.159 1.00 57.46  ? 306 HOH E O   1 
HETATM 8043 O O   . HOH H 6 .   ? 39.668  30.792  -34.764 1.00 82.94  ? 307 HOH E O   1 
HETATM 8044 O O   . HOH H 6 .   ? 46.729  25.102  -34.889 1.00 75.96  ? 308 HOH E O   1 
HETATM 8045 O O   . HOH H 6 .   ? 52.213  31.271  -65.352 1.00 102.51 ? 309 HOH E O   1 
HETATM 8046 O O   . HOH H 6 .   ? 54.581  28.785  -58.481 1.00 52.79  ? 310 HOH E O   1 
HETATM 8047 O O   . HOH H 6 .   ? 21.543  30.232  -54.462 1.00 78.02  ? 311 HOH E O   1 
HETATM 8048 O O   . HOH H 6 .   ? 53.691  47.582  -75.141 1.00 78.61  ? 312 HOH E O   1 
HETATM 8049 O O   . HOH H 6 .   ? 21.466  20.642  -56.680 1.00 83.89  ? 313 HOH E O   1 
HETATM 8050 O O   . HOH H 6 .   ? 18.960  22.436  -54.259 1.00 64.74  ? 314 HOH E O   1 
HETATM 8051 O O   . HOH H 6 .   ? 29.586  24.726  -34.204 1.00 58.12  ? 315 HOH E O   1 
HETATM 8052 O O   . HOH H 6 .   ? 19.637  30.238  -57.649 1.00 54.81  ? 316 HOH E O   1 
HETATM 8053 O O   . HOH H 6 .   ? 21.717  17.601  -56.405 1.00 70.65  ? 317 HOH E O   1 
HETATM 8054 O O   . HOH H 6 .   ? 48.718  24.888  -56.937 1.00 65.41  ? 318 HOH E O   1 
HETATM 8055 O O   . HOH H 6 .   ? 36.986  39.278  -50.580 1.00 53.90  ? 319 HOH E O   1 
HETATM 8056 O O   . HOH H 6 .   ? 23.352  9.952   -53.577 1.00 62.72  ? 320 HOH E O   1 
HETATM 8057 O O   . HOH H 6 .   ? 57.640  21.916  -49.736 1.00 93.86  ? 321 HOH E O   1 
HETATM 8058 O O   . HOH H 6 .   ? 49.995  27.318  -56.253 1.00 85.28  ? 322 HOH E O   1 
HETATM 8059 O O   . HOH H 6 .   ? 75.085  36.318  -84.216 1.00 73.43  ? 323 HOH E O   1 
HETATM 8060 O O   . HOH H 6 .   ? 65.509  38.498  -50.559 1.00 78.27  ? 324 HOH E O   1 
HETATM 8061 O O   . HOH H 6 .   ? 23.205  15.062  -54.974 1.00 81.05  ? 325 HOH E O   1 
HETATM 8062 O O   . HOH H 6 .   ? 52.105  45.803  -53.072 1.00 77.96  ? 326 HOH E O   1 
HETATM 8063 O O   . HOH H 6 .   ? 41.492  30.449  -61.303 1.00 51.26  ? 327 HOH E O   1 
HETATM 8064 O O   . HOH H 6 .   ? 17.557  25.953  -38.362 1.00 72.34  ? 328 HOH E O   1 
HETATM 8065 O O   . HOH H 6 .   ? 51.814  29.005  -57.427 1.00 66.00  ? 329 HOH E O   1 
HETATM 8066 O O   . HOH H 6 .   ? 40.316  41.162  -54.204 1.00 74.77  ? 330 HOH E O   1 
HETATM 8067 O O   . HOH H 6 .   ? 29.100  27.096  -68.082 1.00 75.73  ? 331 HOH E O   1 
HETATM 8068 O O   . HOH H 6 .   ? 43.653  29.627  -59.714 1.00 54.31  ? 332 HOH E O   1 
HETATM 8069 O O   . HOH H 6 .   ? 56.465  27.506  -56.495 1.00 61.10  ? 333 HOH E O   1 
HETATM 8070 O O   . HOH H 6 .   ? 47.197  31.448  -61.386 1.00 68.32  ? 334 HOH E O   1 
HETATM 8071 O O   . HOH H 6 .   ? 83.971  27.582  -81.558 1.00 73.92  ? 335 HOH E O   1 
HETATM 8072 O O   . HOH H 6 .   ? 49.373  52.305  -69.172 1.00 67.18  ? 336 HOH E O   1 
HETATM 8073 O O   . HOH H 6 .   ? 77.358  38.763  -84.162 1.00 83.98  ? 337 HOH E O   1 
HETATM 8074 O O   . HOH H 6 .   ? 59.741  24.030  -48.694 1.00 61.57  ? 338 HOH E O   1 
HETATM 8075 O O   . HOH H 6 .   ? 59.799  22.972  -36.471 1.00 73.36  ? 339 HOH E O   1 
HETATM 8076 O O   . HOH H 6 .   ? 39.748  46.925  -50.759 1.00 102.47 ? 340 HOH E O   1 
HETATM 8077 O O   . HOH H 6 .   ? 63.143  25.033  -47.095 1.00 71.24  ? 341 HOH E O   1 
HETATM 8078 O O   . HOH H 6 .   ? 42.503  50.737  -51.282 1.00 80.85  ? 342 HOH E O   1 
HETATM 8079 O O   . HOH H 6 .   ? 38.990  49.411  -50.000 1.00 93.59  ? 343 HOH E O   1 
HETATM 8080 O O   . HOH H 6 .   ? 62.010  18.071  -44.445 1.00 66.78  ? 344 HOH E O   1 
HETATM 8081 O O   . HOH I 6 .   ? 72.407  -1.128  26.935  1.00 80.02  ? 301 HOH H O   1 
HETATM 8082 O O   . HOH I 6 .   ? 73.786  -3.689  12.955  1.00 76.74  ? 302 HOH H O   1 
HETATM 8083 O O   . HOH I 6 .   ? 34.336  4.494   -4.756  1.00 58.38  ? 303 HOH H O   1 
HETATM 8084 O O   . HOH I 6 .   ? 37.496  20.745  21.207  1.00 79.93  ? 304 HOH H O   1 
HETATM 8085 O O   . HOH I 6 .   ? 72.069  -6.543  13.416  1.00 80.72  ? 305 HOH H O   1 
HETATM 8086 O O   . HOH I 6 .   ? 50.905  37.204  6.364   1.00 76.76  ? 306 HOH H O   1 
HETATM 8087 O O   . HOH I 6 .   ? 45.835  18.815  12.781  1.00 67.95  ? 307 HOH H O   1 
HETATM 8088 O O   . HOH I 6 .   ? 56.486  -9.302  30.801  1.00 108.89 ? 308 HOH H O   1 
HETATM 8089 O O   . HOH I 6 .   ? 53.169  -3.291  13.005  1.00 56.31  ? 309 HOH H O   1 
HETATM 8090 O O   . HOH I 6 .   ? 47.952  19.341  10.821  1.00 80.73  ? 310 HOH H O   1 
HETATM 8091 O O   . HOH I 6 .   ? 24.471  7.972   -1.134  1.00 68.40  ? 311 HOH H O   1 
HETATM 8092 O O   . HOH I 6 .   ? 70.866  8.454   12.669  1.00 80.75  ? 312 HOH H O   1 
HETATM 8093 O O   . HOH I 6 .   ? 37.825  30.072  -10.552 1.00 75.77  ? 313 HOH H O   1 
HETATM 8094 O O   . HOH I 6 .   ? 54.656  23.992  6.030   1.00 75.78  ? 314 HOH H O   1 
HETATM 8095 O O   . HOH I 6 .   ? 51.774  14.990  17.930  1.00 63.97  ? 315 HOH H O   1 
HETATM 8096 O O   . HOH I 6 .   ? 70.715  -4.269  15.029  1.00 52.34  ? 316 HOH H O   1 
HETATM 8097 O O   . HOH I 6 .   ? 43.861  21.810  19.800  1.00 83.19  ? 317 HOH H O   1 
HETATM 8098 O O   . HOH I 6 .   ? 30.968  28.095  21.736  1.00 78.56  ? 318 HOH H O   1 
HETATM 8099 O O   . HOH I 6 .   ? 39.371  35.828  23.760  1.00 71.85  ? 319 HOH H O   1 
HETATM 8100 O O   . HOH I 6 .   ? 37.264  4.406   0.441   1.00 72.86  ? 320 HOH H O   1 
HETATM 8101 O O   . HOH I 6 .   ? 32.158  5.885   -3.339  1.00 101.40 ? 321 HOH H O   1 
HETATM 8102 O O   . HOH I 6 .   ? 35.274  3.913   -1.719  1.00 60.48  ? 322 HOH H O   1 
HETATM 8103 O O   . HOH I 6 .   ? 49.343  15.261  -8.585  1.00 79.33  ? 323 HOH H O   1 
HETATM 8104 O O   . HOH I 6 .   ? 46.817  23.543  19.211  1.00 57.42  ? 324 HOH H O   1 
HETATM 8105 O O   . HOH I 6 .   ? 58.640  36.339  6.982   1.00 94.32  ? 325 HOH H O   1 
HETATM 8106 O O   . HOH I 6 .   ? 21.462  40.158  6.321   1.00 86.92  ? 326 HOH H O   1 
HETATM 8107 O O   . HOH I 6 .   ? 39.489  10.945  -12.700 1.00 86.01  ? 327 HOH H O   1 
HETATM 8108 O O   . HOH I 6 .   ? 20.113  37.841  7.236   1.00 71.28  ? 328 HOH H O   1 
HETATM 8109 O O   . HOH I 6 .   ? 41.988  5.180   4.669   1.00 90.51  ? 329 HOH H O   1 
HETATM 8110 O O   . HOH I 6 .   ? 31.441  29.925  29.912  1.00 70.71  ? 330 HOH H O   1 
HETATM 8111 O O   . HOH J 6 .   ? 76.750  3.707   35.024  1.00 64.29  ? 301 HOH L O   1 
HETATM 8112 O O   . HOH J 6 .   ? 48.076  10.776  36.858  1.00 75.69  ? 302 HOH L O   1 
HETATM 8113 O O   . HOH J 6 .   ? 28.604  3.203   33.328  1.00 81.80  ? 303 HOH L O   1 
HETATM 8114 O O   . HOH J 6 .   ? 30.530  -1.059  17.329  1.00 55.17  ? 304 HOH L O   1 
HETATM 8115 O O   . HOH J 6 .   ? 35.019  -4.368  29.810  1.00 65.42  ? 305 HOH L O   1 
HETATM 8116 O O   . HOH J 6 .   ? 50.219  1.401   44.860  1.00 75.59  ? 306 HOH L O   1 
HETATM 8117 O O   . HOH J 6 .   ? 53.482  17.433  35.005  1.00 58.97  ? 307 HOH L O   1 
HETATM 8118 O O   . HOH J 6 .   ? 39.712  -1.753  17.875  1.00 59.77  ? 308 HOH L O   1 
HETATM 8119 O O   . HOH J 6 .   ? 65.271  -3.916  36.631  1.00 60.37  ? 309 HOH L O   1 
HETATM 8120 O O   . HOH J 6 .   ? 47.987  2.201   26.121  1.00 70.95  ? 310 HOH L O   1 
HETATM 8121 O O   . HOH J 6 .   ? 41.976  0.019   14.073  1.00 79.72  ? 311 HOH L O   1 
HETATM 8122 O O   . HOH J 6 .   ? 14.152  24.711  8.609   1.00 75.89  ? 312 HOH L O   1 
HETATM 8123 O O   . HOH J 6 .   ? 38.837  12.844  21.219  1.00 55.45  ? 313 HOH L O   1 
HETATM 8124 O O   . HOH J 6 .   ? 77.052  23.337  26.940  1.00 73.24  ? 314 HOH L O   1 
HETATM 8125 O O   . HOH J 6 .   ? 51.765  -6.001  42.541  1.00 59.79  ? 315 HOH L O   1 
HETATM 8126 O O   . HOH J 6 .   ? 73.215  5.258   32.926  1.00 61.62  ? 316 HOH L O   1 
HETATM 8127 O O   . HOH J 6 .   ? 40.367  4.146   9.875   1.00 89.25  ? 317 HOH L O   1 
HETATM 8128 O O   . HOH J 6 .   ? 25.413  20.184  30.467  1.00 75.50  ? 318 HOH L O   1 
HETATM 8129 O O   . HOH J 6 .   ? 26.599  0.774   2.999   1.00 75.04  ? 319 HOH L O   1 
HETATM 8130 O O   . HOH J 6 .   ? 51.499  9.808   47.954  1.00 64.10  ? 320 HOH L O   1 
HETATM 8131 O O   . HOH J 6 .   ? 75.427  2.233   33.078  1.00 70.43  ? 321 HOH L O   1 
HETATM 8132 O O   . HOH J 6 .   ? 22.957  37.646  18.444  1.00 74.82  ? 322 HOH L O   1 
HETATM 8133 O O   . HOH J 6 .   ? 42.770  4.142   7.438   1.00 97.68  ? 323 HOH L O   1 
HETATM 8134 O O   . HOH J 6 .   ? 44.782  17.591  30.767  1.00 67.45  ? 324 HOH L O   1 
HETATM 8135 O O   . HOH J 6 .   ? 41.867  1.448   8.499   1.00 86.56  ? 325 HOH L O   1 
HETATM 8136 O O   . HOH J 6 .   ? 13.751  36.189  16.451  1.00 75.66  ? 326 HOH L O   1 
HETATM 8137 O O   . HOH J 6 .   ? 43.996  3.070   5.365   1.00 69.87  ? 327 HOH L O   1 
HETATM 8138 O O   . HOH J 6 .   ? 8.870   1.367   2.391   1.00 79.55  ? 328 HOH L O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 1   ? 1.7460 1.1606 1.3234 0.0308  -0.0272 0.0335  1   THR A N   
2    C CA  . THR A 1   ? 1.7335 1.1891 1.2979 -0.0010 -0.0199 0.0402  1   THR A CA  
3    C C   . THR A 1   ? 1.7109 1.2480 1.3181 -0.0068 -0.0088 0.0498  1   THR A C   
4    O O   . THR A 1   ? 1.6754 1.2693 1.3436 0.0117  -0.0050 0.0538  1   THR A O   
5    C CB  . THR A 1   ? 1.9375 1.3368 1.4182 -0.0390 -0.0277 0.0354  1   THR A CB  
6    O OG1 . THR A 1   ? 1.9698 1.3346 1.4180 -0.0440 -0.0372 0.0332  1   THR A OG1 
7    C CG2 . THR A 1   ? 1.9568 1.2856 1.3957 -0.0399 -0.0385 0.0258  1   THR A CG2 
8    N N   . LEU A 2   ? 1.6242 1.1650 1.1999 -0.0308 -0.0064 0.0522  2   LEU A N   
9    C CA  . LEU A 2   ? 1.5565 1.1626 1.1640 -0.0369 0.0033  0.0581  2   LEU A CA  
10   C C   . LEU A 2   ? 1.5125 1.1137 1.1341 -0.0210 0.0020  0.0628  2   LEU A C   
11   O O   . LEU A 2   ? 1.5290 1.0999 1.1112 -0.0336 -0.0022 0.0621  2   LEU A O   
12   C CB  . LEU A 2   ? 1.5646 1.1846 1.1309 -0.0749 0.0095  0.0551  2   LEU A CB  
13   C CG  . LEU A 2   ? 1.5867 1.2799 1.1895 -0.0824 0.0193  0.0528  2   LEU A CG  
14   C CD1 . LEU A 2   ? 1.5568 1.3009 1.2078 -0.0736 0.0177  0.0469  2   LEU A CD1 
15   C CD2 . LEU A 2   ? 1.6296 1.3282 1.1878 -0.1181 0.0266  0.0458  2   LEU A CD2 
16   N N   . PRO A 3   ? 1.3664 0.9972 1.0440 0.0065  0.0033  0.0669  3   PRO A N   
17   C CA  . PRO A 3   ? 1.3386 0.9637 1.0289 0.0205  0.0019  0.0692  3   PRO A CA  
18   C C   . PRO A 3   ? 1.3698 1.0122 1.0456 0.0038  0.0059  0.0736  3   PRO A C   
19   O O   . PRO A 3   ? 1.3493 1.0282 1.0276 -0.0117 0.0133  0.0766  3   PRO A O   
20   C CB  . PRO A 3   ? 1.3212 0.9866 1.0733 0.0456  0.0041  0.0746  3   PRO A CB  
21   C CG  . PRO A 3   ? 1.3641 1.0672 1.1398 0.0434  0.0045  0.0758  3   PRO A CG  
22   C CD  . PRO A 3   ? 1.3438 1.0122 1.0747 0.0266  0.0032  0.0688  3   PRO A CD  
23   N N   . LYS A 4   ? 1.3314 0.9477 0.9931 0.0081  -0.0005 0.0706  4   LYS A N   
24   C CA  . LYS A 4   ? 1.3267 0.9589 0.9781 -0.0037 0.0012  0.0749  4   LYS A CA  
25   C C   . LYS A 4   ? 1.3073 0.9893 1.0044 0.0053  0.0106  0.0833  4   LYS A C   
26   O O   . LYS A 4   ? 1.2878 0.9753 1.0157 0.0231  0.0094  0.0832  4   LYS A O   
27   C CB  . LYS A 4   ? 1.3974 0.9922 1.0231 -0.0017 -0.0137 0.0662  4   LYS A CB  
28   C CG  . LYS A 4   ? 1.7421 1.2747 1.3176 -0.0091 -0.0300 0.0543  4   LYS A CG  
29   C CD  . LYS A 4   ? 1.7978 1.3107 1.3239 -0.0327 -0.0400 0.0551  4   LYS A CD  
30   C CE  . LYS A 4   ? 1.7793 1.2223 1.2512 -0.0408 -0.0610 0.0421  4   LYS A CE  
31   N NZ  . LYS A 4   ? 1.8238 1.2517 1.2836 -0.0475 -0.0524 0.0435  4   LYS A NZ  
32   N N   . PRO A 5   ? 1.2364 0.9515 0.9365 -0.0069 0.0192  0.0889  5   PRO A N   
33   C CA  . PRO A 5   ? 1.2088 0.9644 0.9481 0.0009  0.0251  0.0953  5   PRO A CA  
34   C C   . PRO A 5   ? 1.2899 1.0480 1.0400 0.0086  0.0236  0.0988  5   PRO A C   
35   O O   . PRO A 5   ? 1.3163 1.0509 1.0454 0.0078  0.0165  0.0941  5   PRO A O   
36   C CB  . PRO A 5   ? 1.2188 0.9985 0.9507 -0.0142 0.0331  0.0941  5   PRO A CB  
37   C CG  . PRO A 5   ? 1.2944 1.0474 0.9821 -0.0296 0.0328  0.0907  5   PRO A CG  
38   C CD  . PRO A 5   ? 1.2606 0.9748 0.9272 -0.0283 0.0233  0.0871  5   PRO A CD  
39   N N   . PHE A 6   ? 1.2150 1.0031 0.9977 0.0149  0.0274  0.1050  6   PHE A N   
40   C CA  . PHE A 6   ? 1.2016 0.9997 0.9958 0.0183  0.0276  0.1084  6   PHE A CA  
41   C C   . PHE A 6   ? 1.2240 1.0482 1.0266 0.0124  0.0343  0.1147  6   PHE A C   
42   O O   . PHE A 6   ? 1.1867 1.0265 1.0039 0.0120  0.0354  0.1160  6   PHE A O   
43   C CB  . PHE A 6   ? 1.2209 1.0224 1.0412 0.0302  0.0248  0.1085  6   PHE A CB  
44   C CG  . PHE A 6   ? 1.2436 1.0565 1.0715 0.0296  0.0248  0.1079  6   PHE A CG  
45   C CD1 . PHE A 6   ? 1.2914 1.0928 1.1025 0.0278  0.0186  0.0978  6   PHE A CD1 
46   C CD2 . PHE A 6   ? 1.2698 1.1062 1.1210 0.0294  0.0279  0.1156  6   PHE A CD2 
47   C CE1 . PHE A 6   ? 1.2970 1.1180 1.1191 0.0260  0.0168  0.0941  6   PHE A CE1 
48   C CE2 . PHE A 6   ? 1.3040 1.1548 1.1611 0.0253  0.0286  0.1139  6   PHE A CE2 
49   C CZ  . PHE A 6   ? 1.2839 1.1305 1.1289 0.0240  0.0236  0.1023  6   PHE A CZ  
50   N N   . ILE A 7   ? 1.2079 1.0362 1.0021 0.0092  0.0362  0.1161  7   ILE A N   
51   C CA  . ILE A 7   ? 1.2016 1.0501 1.0031 0.0068  0.0432  0.1208  7   ILE A CA  
52   C C   . ILE A 7   ? 1.2700 1.1345 1.0905 0.0102  0.0426  0.1261  7   ILE A C   
53   O O   . ILE A 7   ? 1.2799 1.1424 1.1005 0.0121  0.0365  0.1225  7   ILE A O   
54   C CB  . ILE A 7   ? 1.2373 1.0811 1.0165 0.0019  0.0462  0.1187  7   ILE A CB  
55   C CG1 . ILE A 7   ? 1.2077 1.0677 0.9943 0.0024  0.0560  0.1197  7   ILE A CG1 
56   C CG2 . ILE A 7   ? 1.2571 1.0959 1.0283 0.0039  0.0368  0.1182  7   ILE A CG2 
57   C CD1 . ILE A 7   ? 1.0679 0.9236 0.8343 -0.0016 0.0616  0.1154  7   ILE A CD1 
58   N N   . TRP A 8   ? 1.2237 1.1028 1.0581 0.0095  0.0469  0.1315  8   TRP A N   
59   C CA  . TRP A 8   ? 1.2118 1.1066 1.0608 0.0087  0.0473  0.1372  8   TRP A CA  
60   C C   . TRP A 8   ? 1.2271 1.1287 1.0808 0.0076  0.0521  0.1412  8   TRP A C   
61   O O   . TRP A 8   ? 1.2100 1.1035 1.0594 0.0080  0.0525  0.1368  8   TRP A O   
62   C CB  . TRP A 8   ? 1.2040 1.0997 1.0648 0.0077  0.0424  0.1383  8   TRP A CB  
63   C CG  . TRP A 8   ? 1.2242 1.1163 1.0932 0.0073  0.0382  0.1422  8   TRP A CG  
64   C CD1 . TRP A 8   ? 1.2597 1.1574 1.1362 0.0019  0.0347  0.1487  8   TRP A CD1 
65   C CD2 . TRP A 8   ? 1.2275 1.1108 1.0983 0.0121  0.0328  0.1388  8   TRP A CD2 
66   N NE1 . TRP A 8   ? 1.2580 1.1509 1.1415 0.0039  0.0244  0.1488  8   TRP A NE1 
67   C CE2 . TRP A 8   ? 1.2757 1.1638 1.1592 0.0110  0.0235  0.1426  8   TRP A CE2 
68   C CE3 . TRP A 8   ? 1.2462 1.1182 1.1082 0.0163  0.0327  0.1322  8   TRP A CE3 
69   C CZ2 . TRP A 8   ? 1.2595 1.1489 1.1539 0.0164  0.0130  0.1394  8   TRP A CZ2 
70   C CZ3 . TRP A 8   ? 1.2647 1.1369 1.1360 0.0205  0.0258  0.1298  8   TRP A CZ3 
71   C CH2 . TRP A 8   ? 1.2601 1.1446 1.1503 0.0215  0.0155  0.1329  8   TRP A CH2 
72   N N   . ALA A 9   ? 1.1883 1.1045 1.0507 0.0063  0.0543  0.1464  9   ALA A N   
73   C CA  . ALA A 9   ? 1.1868 1.1039 1.0520 0.0068  0.0584  0.1493  9   ALA A CA  
74   C C   . ALA A 9   ? 1.2547 1.1701 1.1243 -0.0019 0.0531  0.1551  9   ALA A C   
75   O O   . ALA A 9   ? 1.2579 1.1863 1.1336 -0.0091 0.0517  0.1594  9   ALA A O   
76   C CB  . ALA A 9   ? 1.1837 1.1190 1.0562 0.0122  0.0639  0.1519  9   ALA A CB  
77   N N   . GLU A 10  ? 1.2061 1.1045 1.0704 -0.0027 0.0482  0.1524  10  GLU A N   
78   C CA  . GLU A 10  ? 1.1957 1.0857 1.0580 -0.0127 0.0388  0.1579  10  GLU A CA  
79   C C   . GLU A 10  ? 1.2226 1.1009 1.0789 -0.0123 0.0405  0.1569  10  GLU A C   
80   O O   . GLU A 10  ? 1.2197 1.0848 1.0721 -0.0026 0.0423  0.1458  10  GLU A O   
81   C CB  . GLU A 10  ? 1.2174 1.0943 1.0785 -0.0152 0.0227  0.1543  10  GLU A CB  
82   C CG  . GLU A 10  ? 1.3459 1.2334 1.2160 -0.0166 0.0205  0.1596  10  GLU A CG  
83   C CD  . GLU A 10  ? 1.6694 1.5500 1.5453 -0.0153 0.0028  0.1574  10  GLU A CD  
84   O OE1 . GLU A 10  ? 1.4545 1.3388 1.3371 -0.0067 0.0017  0.1507  10  GLU A OE1 
85   O OE2 . GLU A 10  ? 1.7103 1.5827 1.5841 -0.0236 -0.0122 0.1624  10  GLU A OE2 
86   N N   . PRO A 11  ? 1.1800 1.0638 1.0357 -0.0222 0.0416  0.1664  11  PRO A N   
87   C CA  . PRO A 11  ? 1.1693 1.0707 1.0279 -0.0374 0.0402  0.1759  11  PRO A CA  
88   C C   . PRO A 11  ? 1.2067 1.1419 1.0799 -0.0352 0.0500  0.1753  11  PRO A C   
89   O O   . PRO A 11  ? 1.1936 1.1390 1.0700 -0.0426 0.0476  0.1748  11  PRO A O   
90   C CB  . PRO A 11  ? 1.1877 1.0812 1.0363 -0.0504 0.0382  0.1824  11  PRO A CB  
91   C CG  . PRO A 11  ? 1.2478 1.1332 1.0981 -0.0356 0.0455  0.1774  11  PRO A CG  
92   C CD  . PRO A 11  ? 1.2067 1.0749 1.0557 -0.0204 0.0430  0.1653  11  PRO A CD  
93   N N   . HIS A 12  ? 1.1530 1.1040 1.0354 -0.0237 0.0584  0.1728  12  HIS A N   
94   C CA  . HIS A 12  ? 1.1254 1.1100 1.0222 -0.0211 0.0612  0.1691  12  HIS A CA  
95   C C   . HIS A 12  ? 1.1388 1.1287 1.0419 -0.0034 0.0650  0.1660  12  HIS A C   
96   O O   . HIS A 12  ? 1.1516 1.1240 1.0506 0.0057  0.0698  0.1670  12  HIS A O   
97   C CB  . HIS A 12  ? 1.1244 1.1377 1.0307 -0.0332 0.0628  0.1724  12  HIS A CB  
98   C CG  . HIS A 12  ? 1.1478 1.2036 1.0723 -0.0342 0.0603  0.1636  12  HIS A CG  
99   N ND1 . HIS A 12  ? 1.1747 1.2358 1.0995 -0.0371 0.0544  0.1519  12  HIS A ND1 
100  C CD2 . HIS A 12  ? 1.1572 1.2522 1.1015 -0.0321 0.0600  0.1617  12  HIS A CD2 
101  C CE1 . HIS A 12  ? 1.1510 1.2529 1.0935 -0.0379 0.0486  0.1404  12  HIS A CE1 
102  N NE2 . HIS A 12  ? 1.1421 1.2697 1.0990 -0.0351 0.0510  0.1466  12  HIS A NE2 
103  N N   . PHE A 13  ? 1.0492 1.0615 0.9614 0.0015  0.0609  0.1600  13  PHE A N   
104  C CA  . PHE A 13  ? 1.0260 1.0431 0.9423 0.0170  0.0614  0.1585  13  PHE A CA  
105  C C   . PHE A 13  ? 1.0593 1.1028 0.9959 0.0268  0.0650  0.1634  13  PHE A C   
106  O O   . PHE A 13  ? 1.0550 1.0991 0.9963 0.0423  0.0673  0.1640  13  PHE A O   
107  C CB  . PHE A 13  ? 1.0329 1.0584 0.9478 0.0189  0.0498  0.1493  13  PHE A CB  
108  C CG  . PHE A 13  ? 1.0169 1.0838 0.9522 0.0169  0.0383  0.1420  13  PHE A CG  
109  C CD1 . PHE A 13  ? 1.0358 1.1169 0.9755 0.0032  0.0341  0.1337  13  PHE A CD1 
110  C CD2 . PHE A 13  ? 1.0136 1.1094 0.9661 0.0288  0.0297  0.1410  13  PHE A CD2 
111  C CE1 . PHE A 13  ? 1.0211 1.1457 0.9808 -0.0003 0.0214  0.1203  13  PHE A CE1 
112  C CE2 . PHE A 13  ? 1.0198 1.1613 0.9956 0.0270  0.0141  0.1302  13  PHE A CE2 
113  C CZ  . PHE A 13  ? 0.9898 1.1461 0.9685 0.0116  0.0098  0.1179  13  PHE A CZ  
114  N N   . MET A 14  ? 0.9815 1.0490 0.9310 0.0174  0.0651  0.1665  14  MET A N   
115  C CA  . MET A 14  ? 0.9387 1.0335 0.9101 0.0262  0.0685  0.1717  14  MET A CA  
116  C C   . MET A 14  ? 1.0022 1.0617 0.9611 0.0271  0.0790  0.1780  14  MET A C   
117  O O   . MET A 14  ? 0.9980 1.0451 0.9448 0.0099  0.0791  0.1812  14  MET A O   
118  C CB  . MET A 14  ? 0.9362 1.0788 0.9271 0.0130  0.0614  0.1683  14  MET A CB  
119  C CG  . MET A 14  ? 0.9588 1.1406 0.9678 0.0172  0.0459  0.1563  14  MET A CG  
120  S SD  . MET A 14  ? 0.9851 1.2291 1.0189 -0.0011 0.0371  0.1455  14  MET A SD  
121  C CE  . MET A 14  ? 0.9501 1.1875 0.9684 -0.0168 0.0262  0.1254  14  MET A CE  
122  N N   . VAL A 15  ? 0.9733 1.0117 0.9314 0.0465  0.0858  0.1770  15  VAL A N   
123  C CA  . VAL A 15  ? 0.9879 0.9851 0.9317 0.0508  0.0926  0.1755  15  VAL A CA  
124  C C   . VAL A 15  ? 1.0235 1.0314 0.9883 0.0700  0.0999  0.1781  15  VAL A C   
125  O O   . VAL A 15  ? 1.0237 1.0417 1.0044 0.0924  0.1048  0.1758  15  VAL A O   
126  C CB  . VAL A 15  ? 1.0511 1.0107 0.9757 0.0578  0.0950  0.1647  15  VAL A CB  
127  C CG1 . VAL A 15  ? 1.0694 0.9831 0.9737 0.0550  0.0936  0.1562  15  VAL A CG1 
128  C CG2 . VAL A 15  ? 1.0479 1.0091 0.9611 0.0459  0.0884  0.1630  15  VAL A CG2 
129  N N   . PRO A 16  ? 0.9449 0.9477 0.9087 0.0619  0.1005  0.1829  16  PRO A N   
130  C CA  . PRO A 16  ? 0.9185 0.9254 0.9023 0.0829  0.1080  0.1847  16  PRO A CA  
131  C C   . PRO A 16  ? 0.9724 0.9312 0.9459 0.1058  0.1157  0.1720  16  PRO A C   
132  O O   . PRO A 16  ? 0.9659 0.8824 0.9105 0.0975  0.1122  0.1611  16  PRO A O   
133  C CB  . PRO A 16  ? 0.9468 0.9390 0.9159 0.0625  0.1051  0.1899  16  PRO A CB  
134  C CG  . PRO A 16  ? 1.0121 1.0160 0.9657 0.0317  0.0967  0.1935  16  PRO A CG  
135  C CD  . PRO A 16  ? 0.9765 0.9658 0.9187 0.0333  0.0938  0.1869  16  PRO A CD  
136  N N   . LYS A 17  ? 0.9362 0.9048 0.9362 0.1356  0.1249  0.1709  17  LYS A N   
137  C CA  . LYS A 17  ? 0.9507 0.8769 0.9460 0.1617  0.1345  0.1543  17  LYS A CA  
138  C C   . LYS A 17  ? 1.0494 0.9081 1.0074 0.1524  0.1302  0.1377  17  LYS A C   
139  O O   . LYS A 17  ? 1.0525 0.8947 0.9950 0.1339  0.1220  0.1433  17  LYS A O   
140  C CB  . LYS A 17  ? 0.9485 0.8949 0.9811 0.1952  0.1443  0.1576  17  LYS A CB  
141  N N   . GLU A 18  ? 1.0346 0.8555 0.9774 0.1637  0.1332  0.1149  18  GLU A N   
142  C CA  . GLU A 18  ? 1.0819 0.8392 0.9918 0.1597  0.1245  0.0890  18  GLU A CA  
143  C C   . GLU A 18  ? 1.2372 0.9761 1.1175 0.1263  0.1048  0.0933  18  GLU A C   
144  O O   . GLU A 18  ? 1.2731 0.9598 1.1273 0.1204  0.0908  0.0778  18  GLU A O   
145  C CB  . GLU A 18  ? 1.1067 0.8192 1.0170 0.1848  0.1291  0.0717  18  GLU A CB  
146  C CG  . GLU A 18  ? 1.1968 0.9238 1.1261 0.1918  0.1333  0.0917  18  GLU A CG  
147  C CD  . GLU A 18  ? 1.4918 1.1896 1.4368 0.2290  0.1450  0.0766  18  GLU A CD  
148  O OE1 . GLU A 18  ? 1.1489 0.8644 1.1207 0.2590  0.1603  0.0690  18  GLU A OE1 
149  O OE2 . GLU A 18  ? 1.6180 1.2726 1.5472 0.2283  0.1382  0.0722  18  GLU A OE2 
150  N N   . LYS A 19  ? 1.9095 0.6150 0.8575 -0.1305 0.0417  0.0962  19  LYS A N   
151  C CA  . LYS A 19  ? 1.9477 0.6212 0.8829 -0.1186 0.0632  0.0868  19  LYS A CA  
152  C C   . LYS A 19  ? 1.9748 0.7552 1.0028 -0.0948 0.0607  0.0861  19  LYS A C   
153  O O   . LYS A 19  ? 1.9096 0.7744 1.0080 -0.0959 0.0560  0.0904  19  LYS A O   
154  C CB  . LYS A 19  ? 1.9969 0.6101 0.9112 -0.1507 0.1128  0.0747  19  LYS A CB  
155  C CG  . LYS A 19  ? 2.1856 0.7248 1.0504 -0.1465 0.1374  0.0599  19  LYS A CG  
156  C CD  . LYS A 19  ? 2.3419 0.7861 1.1588 -0.1820 0.1826  0.0447  19  LYS A CD  
157  C CE  . LYS A 19  ? 2.4668 0.9242 1.3246 -0.1863 0.2233  0.0242  19  LYS A CE  
158  N NZ  . LYS A 19  ? 2.6005 0.9307 1.3709 -0.2010 0.2578  0.0032  19  LYS A NZ  
159  N N   . GLN A 20  ? 1.9653 0.7363 0.9885 -0.0762 0.0680  0.0800  20  GLN A N   
160  C CA  . GLN A 20  ? 1.9134 0.7786 1.0177 -0.0559 0.0659  0.0797  20  GLN A CA  
161  C C   . GLN A 20  ? 1.8806 0.7863 1.0368 -0.0719 0.1020  0.0704  20  GLN A C   
162  O O   . GLN A 20  ? 1.9165 0.7660 1.0404 -0.0903 0.1328  0.0590  20  GLN A O   
163  C CB  . GLN A 20  ? 1.9588 0.8003 1.0375 -0.0294 0.0589  0.0783  20  GLN A CB  
164  C CG  . GLN A 20  ? 2.2760 1.1520 1.3726 -0.0007 0.0162  0.0896  20  GLN A CG  
165  C CD  . GLN A 20  ? 2.5444 1.4118 1.6350 0.0256  0.0166  0.0893  20  GLN A CD  
166  O OE1 . GLN A 20  ? 2.5754 1.3703 1.6040 0.0252  0.0399  0.0828  20  GLN A OE1 
167  N NE2 . GLN A 20  ? 2.3291 1.2673 1.4843 0.0471  -0.0044 0.0947  20  GLN A NE2 
168  N N   . VAL A 21  ? 1.7416 0.7399 0.9754 -0.0643 0.0975  0.0739  21  VAL A N   
169  C CA  . VAL A 21  ? 1.6971 0.7423 0.9834 -0.0749 0.1249  0.0670  21  VAL A CA  
170  C C   . VAL A 21  ? 1.6746 0.7925 1.0156 -0.0554 0.1169  0.0678  21  VAL A C   
171  O O   . VAL A 21  ? 1.6533 0.8087 1.0182 -0.0402 0.0932  0.0754  21  VAL A O   
172  C CB  . VAL A 21  ? 1.7240 0.7983 1.0425 -0.0927 0.1339  0.0721  21  VAL A CB  
173  C CG1 . VAL A 21  ? 1.6882 0.8239 1.0452 -0.0819 0.1113  0.0820  21  VAL A CG1 
174  C CG2 . VAL A 21  ? 1.6902 0.8025 1.0562 -0.1010 0.1596  0.0655  21  VAL A CG2 
175  N N   . THR A 22  ? 1.5984 0.7324 0.9582 -0.0581 0.1377  0.0581  22  THR A N   
176  C CA  . THR A 22  ? 1.5743 0.7693 0.9789 -0.0444 0.1342  0.0582  22  THR A CA  
177  C C   . THR A 22  ? 1.6129 0.8587 1.0642 -0.0544 0.1484  0.0548  22  THR A C   
178  O O   . THR A 22  ? 1.6153 0.8434 1.0613 -0.0680 0.1686  0.0440  22  THR A O   
179  C CB  . THR A 22  ? 1.6341 0.7990 1.0100 -0.0371 0.1442  0.0497  22  THR A CB  
180  O OG1 . THR A 22  ? 1.5154 0.7327 0.9320 -0.0372 0.1549  0.0445  22  THR A OG1 
181  C CG2 . THR A 22  ? 1.6816 0.7751 1.0041 -0.0507 0.1675  0.0364  22  THR A CG2 
182  N N   . ILE A 23  ? 1.5294 0.8322 1.0237 -0.0473 0.1383  0.0626  23  ILE A N   
183  C CA  . ILE A 23  ? 1.4904 0.8392 1.0238 -0.0526 0.1484  0.0617  23  ILE A CA  
184  C C   . ILE A 23  ? 1.5579 0.9356 1.1063 -0.0464 0.1501  0.0560  23  ILE A C   
185  O O   . ILE A 23  ? 1.5333 0.9217 1.0862 -0.0356 0.1408  0.0592  23  ILE A O   
186  C CB  . ILE A 23  ? 1.4926 0.8762 1.0534 -0.0494 0.1423  0.0720  23  ILE A CB  
187  C CG1 . ILE A 23  ? 1.4862 0.8432 1.0335 -0.0618 0.1483  0.0768  23  ILE A CG1 
188  C CG2 . ILE A 23  ? 1.4767 0.9058 1.0710 -0.0473 0.1484  0.0728  23  ILE A CG2 
189  C CD1 . ILE A 23  ? 1.3992 0.7687 0.9518 -0.0586 0.1386  0.0841  23  ILE A CD1 
190  N N   . CYS A 24  ? 1.5526 0.9409 1.1098 -0.0550 0.1628  0.0462  24  CYS A N   
191  C CA  . CYS A 24  ? 1.5539 0.9680 1.1199 -0.0535 0.1658  0.0394  24  CYS A CA  
192  C C   . CYS A 24  ? 1.5369 1.0002 1.1362 -0.0531 0.1614  0.0425  24  CYS A C   
193  O O   . CYS A 24  ? 1.4983 0.9717 1.1142 -0.0573 0.1636  0.0427  24  CYS A O   
194  C CB  . CYS A 24  ? 1.5894 0.9787 1.1361 -0.0643 0.1837  0.0217  24  CYS A CB  
195  S SG  . CYS A 24  ? 1.6904 1.0082 1.1827 -0.0614 0.1912  0.0185  24  CYS A SG  
196  N N   . CYS A 25  ? 1.4816 0.9680 1.0873 -0.0480 0.1564  0.0451  25  CYS A N   
197  C CA  . CYS A 25  ? 1.4551 0.9784 1.0790 -0.0463 0.1507  0.0483  25  CYS A CA  
198  C C   . CYS A 25  ? 1.4986 1.0357 1.1171 -0.0531 0.1537  0.0394  25  CYS A C   
199  O O   . CYS A 25  ? 1.4988 1.0248 1.1057 -0.0535 0.1580  0.0394  25  CYS A O   
200  C CB  . CYS A 25  ? 1.4493 0.9790 1.0794 -0.0362 0.1443  0.0601  25  CYS A CB  
201  S SG  . CYS A 25  ? 1.4833 1.0418 1.1198 -0.0320 0.1392  0.0648  25  CYS A SG  
202  N N   . GLN A 26  ? 1.4502 1.0128 1.0799 -0.0593 0.1518  0.0314  26  GLN A N   
203  C CA  . GLN A 26  ? 1.4512 1.0313 1.0747 -0.0690 0.1534  0.0212  26  GLN A CA  
204  C C   . GLN A 26  ? 1.5168 1.1220 1.1432 -0.0637 0.1379  0.0301  26  GLN A C   
205  O O   . GLN A 26  ? 1.5078 1.1366 1.1519 -0.0576 0.1258  0.0327  26  GLN A O   
206  C CB  . GLN A 26  ? 1.4575 1.0494 1.0910 -0.0811 0.1614  0.0012  26  GLN A CB  
207  C CG  . GLN A 26  ? 1.5585 1.1663 1.1816 -0.0954 0.1678  -0.0132 26  GLN A CG  
208  C CD  . GLN A 26  ? 1.7076 1.3418 1.3522 -0.1065 0.1710  -0.0357 26  GLN A CD  
209  O OE1 . GLN A 26  ? 1.6201 1.2348 1.2599 -0.1170 0.1930  -0.0546 26  GLN A OE1 
210  N NE2 . GLN A 26  ? 1.6267 1.3035 1.2950 -0.1038 0.1498  -0.0358 26  GLN A NE2 
211  N N   . GLY A 27  ? 1.4911 1.0844 1.0983 -0.0653 0.1399  0.0349  27  GLY A N   
212  C CA  . GLY A 27  ? 1.4939 1.0946 1.0890 -0.0620 0.1287  0.0421  27  GLY A CA  
213  C C   . GLY A 27  ? 1.5691 1.1818 1.1478 -0.0777 0.1273  0.0320  27  GLY A C   
214  O O   . GLY A 27  ? 1.5661 1.2069 1.1573 -0.0845 0.1220  0.0202  27  GLY A O   
215  N N   . ASN A 28  ? 1.5385 1.1280 1.0904 -0.0862 0.1350  0.0342  28  ASN A N   
216  C CA  . ASN A 28  ? 1.5439 1.1376 1.0720 -0.1055 0.1366  0.0254  28  ASN A CA  
217  C C   . ASN A 28  ? 1.6306 1.1898 1.1421 -0.1206 0.1628  0.0231  28  ASN A C   
218  O O   . ASN A 28  ? 1.6304 1.1643 1.1508 -0.1121 0.1737  0.0296  28  ASN A O   
219  C CB  . ASN A 28  ? 1.5380 1.1313 1.0403 -0.1020 0.1167  0.0327  28  ASN A CB  
220  C CG  . ASN A 28  ? 1.8147 1.4215 1.2914 -0.1209 0.1079  0.0236  28  ASN A CG  
221  O OD1 . ASN A 28  ? 1.7820 1.4016 1.2606 -0.1408 0.1208  0.0092  28  ASN A OD1 
222  N ND2 . ASN A 28  ? 1.6684 1.2688 1.1152 -0.1155 0.0868  0.0312  28  ASN A ND2 
223  N N   . TYR A 29  ? 1.6034 1.1636 1.0944 -0.1438 0.1744  0.0126  29  TYR A N   
224  C CA  . TYR A 29  ? 1.6179 1.1433 1.0926 -0.1613 0.2041  0.0107  29  TYR A CA  
225  C C   . TYR A 29  ? 1.6466 1.1346 1.0975 -0.1653 0.2067  0.0194  29  TYR A C   
226  O O   . TYR A 29  ? 1.6546 1.1434 1.0810 -0.1656 0.1878  0.0223  29  TYR A O   
227  C CB  . TYR A 29  ? 1.6405 1.1759 1.0955 -0.1888 0.2203  -0.0039 29  TYR A CB  
228  C CG  . TYR A 29  ? 1.6489 1.2073 1.1216 -0.1900 0.2312  -0.0181 29  TYR A CG  
229  C CD1 . TYR A 29  ? 1.6842 1.2168 1.1583 -0.1918 0.2619  -0.0205 29  TYR A CD1 
230  C CD2 . TYR A 29  ? 1.6387 1.2402 1.1235 -0.1917 0.2144  -0.0318 29  TYR A CD2 
231  C CE1 . TYR A 29  ? 1.6824 1.2238 1.1610 -0.1943 0.2773  -0.0360 29  TYR A CE1 
232  C CE2 . TYR A 29  ? 1.6388 1.2536 1.1362 -0.1972 0.2314  -0.0506 29  TYR A CE2 
233  C CZ  . TYR A 29  ? 1.7129 1.2936 1.2022 -0.1989 0.2644  -0.0527 29  TYR A CZ  
234  O OH  . TYR A 29  ? 1.6945 1.2761 1.1858 -0.2046 0.2862  -0.0729 29  TYR A OH  
235  N N   . GLY A 30  ? 1.5751 1.0268 1.0323 -0.1681 0.2311  0.0220  30  GLY A N   
236  C CA  . GLY A 30  ? 1.5787 0.9857 1.0181 -0.1746 0.2420  0.0256  30  GLY A CA  
237  C C   . GLY A 30  ? 1.5981 0.9993 1.0461 -0.1518 0.2258  0.0319  30  GLY A C   
238  O O   . GLY A 30  ? 1.6360 1.0033 1.0525 -0.1564 0.2268  0.0328  30  GLY A O   
239  N N   . ALA A 31  ? 1.4821 0.9108 0.9667 -0.1286 0.2136  0.0354  31  ALA A N   
240  C CA  . ALA A 31  ? 1.4519 0.8788 0.9491 -0.1078 0.2033  0.0403  31  ALA A CA  
241  C C   . ALA A 31  ? 1.4789 0.8866 1.0092 -0.1025 0.2205  0.0372  31  ALA A C   
242  O O   . ALA A 31  ? 1.4795 0.8990 1.0355 -0.0997 0.2241  0.0367  31  ALA A O   
243  C CB  . ALA A 31  ? 1.4369 0.9053 0.9527 -0.0903 0.1811  0.0452  31  ALA A CB  
244  N N   . VAL A 32  ? 1.4155 0.7907 0.9439 -0.1013 0.2321  0.0332  32  VAL A N   
245  C CA  . VAL A 32  ? 1.4060 0.7625 0.9718 -0.0980 0.2494  0.0255  32  VAL A CA  
246  C C   . VAL A 32  ? 1.4086 0.7948 1.0163 -0.0760 0.2363  0.0264  32  VAL A C   
247  O O   . VAL A 32  ? 1.3958 0.7841 1.0409 -0.0718 0.2411  0.0226  32  VAL A O   
248  C CB  . VAL A 32  ? 1.5027 0.8093 1.0496 -0.1068 0.2704  0.0155  32  VAL A CB  
249  C CG1 . VAL A 32  ? 1.4986 0.7784 1.0856 -0.1141 0.2964  0.0030  32  VAL A CG1 
250  C CG2 . VAL A 32  ? 1.5378 0.8110 1.0233 -0.1260 0.2750  0.0173  32  VAL A CG2 
251  N N   . GLU A 33  ? 1.3454 0.7502 0.9461 -0.0628 0.2214  0.0311  33  GLU A N   
252  C CA  . GLU A 33  ? 1.3116 0.7407 0.9437 -0.0461 0.2109  0.0318  33  GLU A CA  
253  C C   . GLU A 33  ? 1.3502 0.8099 0.9723 -0.0389 0.1910  0.0433  33  GLU A C   
254  O O   . GLU A 33  ? 1.3767 0.8404 0.9709 -0.0431 0.1852  0.0485  33  GLU A O   
255  C CB  . GLU A 33  ? 1.3296 0.7423 0.9585 -0.0410 0.2225  0.0242  33  GLU A CB  
256  C CG  . GLU A 33  ? 1.3541 0.7857 1.0184 -0.0291 0.2201  0.0190  33  GLU A CG  
257  C CD  . GLU A 33  ? 1.5855 0.9938 1.2707 -0.0310 0.2428  -0.0006 33  GLU A CD  
258  O OE1 . GLU A 33  ? 1.4401 0.8555 1.1342 -0.0242 0.2486  -0.0075 33  GLU A OE1 
259  O OE2 . GLU A 33  ? 1.5451 0.9257 1.2385 -0.0414 0.2587  -0.0110 33  GLU A OE2 
260  N N   . TYR A 34  ? 1.2669 0.7458 0.9116 -0.0288 0.1806  0.0461  34  TYR A N   
261  C CA  . TYR A 34  ? 1.2479 0.7482 0.8867 -0.0242 0.1667  0.0549  34  TYR A CA  
262  C C   . TYR A 34  ? 1.2882 0.7950 0.9452 -0.0154 0.1646  0.0551  34  TYR A C   
263  O O   . TYR A 34  ? 1.2854 0.7904 0.9635 -0.0122 0.1620  0.0505  34  TYR A O   
264  C CB  . TYR A 34  ? 1.2540 0.7588 0.8920 -0.0280 0.1602  0.0562  34  TYR A CB  
265  C CG  . TYR A 34  ? 1.2640 0.7724 0.8821 -0.0388 0.1619  0.0550  34  TYR A CG  
266  C CD1 . TYR A 34  ? 1.2957 0.7896 0.9050 -0.0497 0.1736  0.0502  34  TYR A CD1 
267  C CD2 . TYR A 34  ? 1.2667 0.7935 0.8780 -0.0403 0.1536  0.0568  34  TYR A CD2 
268  C CE1 . TYR A 34  ? 1.3226 0.8219 0.9115 -0.0630 0.1763  0.0471  34  TYR A CE1 
269  C CE2 . TYR A 34  ? 1.2816 0.8180 0.8795 -0.0513 0.1538  0.0519  34  TYR A CE2 
270  C CZ  . TYR A 34  ? 1.4258 0.9491 1.0099 -0.0633 0.1648  0.0469  34  TYR A CZ  
271  O OH  . TYR A 34  ? 1.4745 1.0089 1.0430 -0.0775 0.1662  0.0401  34  TYR A OH  
272  N N   . GLN A 35  ? 1.2400 0.7539 0.8892 -0.0115 0.1663  0.0601  35  GLN A N   
273  C CA  . GLN A 35  ? 1.2254 0.7445 0.8878 -0.0068 0.1695  0.0596  35  GLN A CA  
274  C C   . GLN A 35  ? 1.2651 0.7951 0.9247 -0.0072 0.1626  0.0696  35  GLN A C   
275  O O   . GLN A 35  ? 1.2297 0.7659 0.8788 -0.0078 0.1603  0.0770  35  GLN A O   
276  C CB  . GLN A 35  ? 1.2456 0.7550 0.9008 -0.0036 0.1880  0.0543  35  GLN A CB  
277  C CG  . GLN A 35  ? 1.3113 0.7988 0.9666 -0.0066 0.2007  0.0411  35  GLN A CG  
278  C CD  . GLN A 35  ? 1.4823 0.9505 1.1301 -0.0047 0.2247  0.0297  35  GLN A CD  
279  O OE1 . GLN A 35  ? 1.4525 0.9190 1.0810 0.0004  0.2343  0.0352  35  GLN A OE1 
280  N NE2 . GLN A 35  ? 1.3175 0.7662 0.9801 -0.0093 0.2390  0.0121  35  GLN A NE2 
281  N N   . LEU A 36  ? 1.2380 0.7682 0.9086 -0.0080 0.1592  0.0684  36  LEU A N   
282  C CA  . LEU A 36  ? 1.2351 0.7648 0.9007 -0.0124 0.1576  0.0759  36  LEU A CA  
283  C C   . LEU A 36  ? 1.3060 0.8404 0.9761 -0.0126 0.1726  0.0751  36  LEU A C   
284  O O   . LEU A 36  ? 1.3152 0.8522 0.9980 -0.0115 0.1755  0.0647  36  LEU A O   
285  C CB  . LEU A 36  ? 1.2361 0.7530 0.8992 -0.0152 0.1433  0.0747  36  LEU A CB  
286  C CG  . LEU A 36  ? 1.3000 0.8019 0.9482 -0.0242 0.1435  0.0814  36  LEU A CG  
287  C CD1 . LEU A 36  ? 1.3052 0.8041 0.9466 -0.0289 0.1488  0.0855  36  LEU A CD1 
288  C CD2 . LEU A 36  ? 1.3295 0.8075 0.9631 -0.0254 0.1283  0.0796  36  LEU A CD2 
289  N N   . HIS A 37  ? 1.2528 0.7889 0.9151 -0.0139 0.1850  0.0843  37  HIS A N   
290  C CA  . HIS A 37  ? 1.2423 0.7793 0.9041 -0.0154 0.2059  0.0842  37  HIS A CA  
291  C C   . HIS A 37  ? 1.3095 0.8406 0.9687 -0.0271 0.2093  0.0918  37  HIS A C   
292  O O   . HIS A 37  ? 1.3100 0.8352 0.9662 -0.0311 0.2059  0.1008  37  HIS A O   
293  C CB  . HIS A 37  ? 1.2518 0.7881 0.9020 -0.0068 0.2232  0.0901  37  HIS A CB  
294  C CG  . HIS A 37  ? 1.3010 0.8294 0.9438 0.0007  0.2300  0.0790  37  HIS A CG  
295  N ND1 . HIS A 37  ? 1.3328 0.8566 0.9664 0.0057  0.2178  0.0792  37  HIS A ND1 
296  C CD2 . HIS A 37  ? 1.3288 0.8487 0.9713 0.0009  0.2506  0.0650  37  HIS A CD2 
297  C CE1 . HIS A 37  ? 1.3331 0.8400 0.9579 0.0082  0.2317  0.0668  37  HIS A CE1 
298  N NE2 . HIS A 37  ? 1.3347 0.8386 0.9659 0.0061  0.2529  0.0568  37  HIS A NE2 
299  N N   . PHE A 38  ? 1.2493 0.7799 0.9104 -0.0348 0.2167  0.0855  38  PHE A N   
300  C CA  . PHE A 38  ? 1.2288 0.7476 0.8809 -0.0502 0.2240  0.0916  38  PHE A CA  
301  C C   . PHE A 38  ? 1.2759 0.7981 0.9258 -0.0555 0.2572  0.0927  38  PHE A C   
302  O O   . PHE A 38  ? 1.2525 0.7856 0.9082 -0.0516 0.2693  0.0800  38  PHE A O   
303  C CB  . PHE A 38  ? 1.2463 0.7589 0.8956 -0.0572 0.2036  0.0837  38  PHE A CB  
304  C CG  . PHE A 38  ? 1.2832 0.7713 0.9115 -0.0765 0.2088  0.0911  38  PHE A CG  
305  C CD1 . PHE A 38  ? 1.3369 0.8012 0.9528 -0.0846 0.2158  0.1027  38  PHE A CD1 
306  C CD2 . PHE A 38  ? 1.3170 0.8037 0.9385 -0.0887 0.2081  0.0846  38  PHE A CD2 
307  C CE1 . PHE A 38  ? 1.3731 0.8043 0.9663 -0.1060 0.2251  0.1082  38  PHE A CE1 
308  C CE2 . PHE A 38  ? 1.3816 0.8375 0.9757 -0.1104 0.2147  0.0917  38  PHE A CE2 
309  C CZ  . PHE A 38  ? 1.3763 0.8005 0.9546 -0.1195 0.2247  0.1039  38  PHE A CZ  
310  N N   . GLU A 39  ? 1.2546 0.7647 0.8972 -0.0649 0.2765  0.1064  39  GLU A N   
311  C CA  . GLU A 39  ? 1.2582 0.7655 0.8954 -0.0721 0.3146  0.1115  39  GLU A CA  
312  C C   . GLU A 39  ? 1.3440 0.8623 0.9799 -0.0590 0.3347  0.1019  39  GLU A C   
313  O O   . GLU A 39  ? 1.3447 0.8652 0.9768 -0.0680 0.3580  0.0905  39  GLU A O   
314  C CB  . GLU A 39  ? 1.2815 0.7765 0.9081 -0.0966 0.3253  0.1090  39  GLU A CB  
315  C CG  . GLU A 39  ? 1.4766 0.9439 1.0934 -0.1130 0.3165  0.1195  39  GLU A CG  
316  C CD  . GLU A 39  ? 1.8332 1.2830 1.4512 -0.1236 0.3491  0.1350  39  GLU A CD  
317  O OE1 . GLU A 39  ? 1.6551 1.0967 1.2841 -0.1192 0.3415  0.1424  39  GLU A OE1 
318  O OE2 . GLU A 39  ? 1.8481 1.2928 1.4592 -0.1372 0.3846  0.1382  39  GLU A OE2 
319  N N   . GLY A 40  ? 1.5229 0.6019 0.9985 0.4845  0.4427  0.2590  40  GLY A N   
320  C CA  . GLY A 40  ? 1.4826 0.6067 1.0252 0.4680  0.4121  0.2692  40  GLY A CA  
321  C C   . GLY A 40  ? 1.5326 0.6840 1.0514 0.3931  0.3259  0.2318  40  GLY A C   
322  O O   . GLY A 40  ? 1.5796 0.6487 1.0433 0.3590  0.3190  0.2158  40  GLY A O   
323  N N   . SER A 41  ? 1.4155 0.6810 0.9750 0.3676  0.2622  0.2244  41  SER A N   
324  C CA  . SER A 41  ? 1.3791 0.6960 0.9347 0.3062  0.1852  0.2063  41  SER A CA  
325  C C   . SER A 41  ? 1.3172 0.7692 0.9481 0.3060  0.1392  0.2139  41  SER A C   
326  O O   . SER A 41  ? 1.3202 0.7814 0.9475 0.3260  0.1569  0.2140  41  SER A O   
327  C CB  . SER A 41  ? 1.5152 0.7042 0.9220 0.2402  0.1732  0.1706  41  SER A CB  
328  O OG  . SER A 41  ? 1.7757 0.8380 1.0707 0.2472  0.2284  0.1483  41  SER A OG  
329  N N   . LEU A 42  ? 1.1768 0.7316 0.8774 0.2880  0.0847  0.2239  42  LEU A N   
330  C CA  . LEU A 42  ? 1.1044 0.7710 0.8692 0.2889  0.0467  0.2307  42  LEU A CA  
331  C C   . LEU A 42  ? 1.2194 0.8596 0.9174 0.2561  0.0328  0.2139  42  LEU A C   
332  O O   . LEU A 42  ? 1.2784 0.8623 0.8974 0.2075  0.0164  0.2035  42  LEU A O   
333  C CB  . LEU A 42  ? 1.0436 0.7981 0.8699 0.2759  0.0009  0.2439  42  LEU A CB  
334  C CG  . LEU A 42  ? 1.0434 0.9002 0.9385 0.2884  -0.0247 0.2528  42  LEU A CG  
335  C CD1 . LEU A 42  ? 1.0332 0.9220 0.9751 0.3232  -0.0011 0.2611  42  LEU A CD1 
336  C CD2 . LEU A 42  ? 0.9963 0.9232 0.9421 0.2866  -0.0542 0.2673  42  LEU A CD2 
337  N N   . PHE A 43  ? 1.1569 0.8370 0.8826 0.2776  0.0397  0.2164  43  PHE A N   
338  C CA  . PHE A 43  ? 1.1773 0.8514 0.8572 0.2518  0.0293  0.2065  43  PHE A CA  
339  C C   . PHE A 43  ? 1.1328 0.9123 0.8830 0.2461  -0.0105 0.2207  43  PHE A C   
340  O O   . PHE A 43  ? 1.1481 0.9476 0.8759 0.2072  -0.0369 0.2257  43  PHE A O   
341  C CB  . PHE A 43  ? 1.2331 0.8731 0.8948 0.2863  0.0721  0.2050  43  PHE A CB  
342  C CG  . PHE A 43  ? 1.3012 0.9176 0.8991 0.2607  0.0716  0.1928  43  PHE A CG  
343  C CD1 . PHE A 43  ? 1.4303 0.9409 0.9045 0.2171  0.0841  0.1695  43  PHE A CD1 
344  C CD2 . PHE A 43  ? 1.3003 0.9939 0.9539 0.2771  0.0610  0.2058  43  PHE A CD2 
345  C CE1 . PHE A 43  ? 1.4782 0.9715 0.8872 0.1882  0.0849  0.1597  43  PHE A CE1 
346  C CE2 . PHE A 43  ? 1.3638 1.0470 0.9663 0.2548  0.0619  0.1987  43  PHE A CE2 
347  C CZ  . PHE A 43  ? 1.4156 1.0029 0.8965 0.2102  0.0741  0.1759  43  PHE A CZ  
348  N N   . ALA A 44  ? 0.9859 0.8293 0.8162 0.2821  -0.0113 0.2324  44  ALA A N   
349  C CA  . ALA A 44  ? 0.9076 0.8267 0.7962 0.2846  -0.0371 0.2429  44  ALA A CA  
350  C C   . ALA A 44  ? 0.9285 0.8893 0.8759 0.3089  -0.0398 0.2509  44  ALA A C   
351  O O   . ALA A 44  ? 0.9129 0.8671 0.8737 0.3271  -0.0215 0.2569  44  ALA A O   
352  C CB  . ALA A 44  ? 0.9005 0.8363 0.7947 0.2886  -0.0346 0.2450  44  ALA A CB  
353  N N   . VAL A 45  ? 0.8796 0.8827 0.8573 0.3070  -0.0593 0.2558  45  VAL A N   
354  C CA  . VAL A 45  ? 0.8501 0.8836 0.8624 0.3193  -0.0645 0.2589  45  VAL A CA  
355  C C   . VAL A 45  ? 0.9999 1.0463 1.0244 0.3218  -0.0700 0.2596  45  VAL A C   
356  O O   . VAL A 45  ? 1.0058 1.0584 1.0300 0.3175  -0.0729 0.2662  45  VAL A O   
357  C CB  . VAL A 45  ? 0.8391 0.8880 0.8568 0.3171  -0.0740 0.2636  45  VAL A CB  
358  C CG1 . VAL A 45  ? 0.8029 0.8758 0.8393 0.3277  -0.0768 0.2641  45  VAL A CG1 
359  C CG2 . VAL A 45  ? 0.8402 0.8741 0.8530 0.3154  -0.0681 0.2644  45  VAL A CG2 
360  N N   . ASP A 46  ? 0.9971 1.0476 1.0305 0.3240  -0.0706 0.2589  46  ASP A N   
361  C CA  . ASP A 46  ? 1.0135 1.0541 1.0441 0.3219  -0.0737 0.2564  46  ASP A CA  
362  C C   . ASP A 46  ? 1.0878 1.1187 1.1027 0.3163  -0.0749 0.2498  46  ASP A C   
363  O O   . ASP A 46  ? 1.0713 1.1189 1.0871 0.3037  -0.0809 0.2556  46  ASP A O   
364  C CB  . ASP A 46  ? 1.0421 1.0845 1.0787 0.3160  -0.0783 0.2639  46  ASP A CB  
365  C CG  . ASP A 46  ? 1.3040 1.3259 1.3374 0.3132  -0.0799 0.2621  46  ASP A CG  
366  O OD1 . ASP A 46  ? 1.3660 1.3643 1.3887 0.3207  -0.0695 0.2557  46  ASP A OD1 
367  O OD2 . ASP A 46  ? 1.3948 1.4235 1.4383 0.3073  -0.0875 0.2719  46  ASP A OD2 
368  N N   . ARG A 47  ? 1.0748 1.0813 1.0734 0.3257  -0.0652 0.2435  47  ARG A N   
369  C CA  . ARG A 47  ? 1.1004 1.0790 1.0634 0.3212  -0.0592 0.2321  47  ARG A CA  
370  C C   . ARG A 47  ? 1.2138 1.1303 1.1361 0.3109  -0.0515 0.2216  47  ARG A C   
371  O O   . ARG A 47  ? 1.2230 1.1095 1.1446 0.3320  -0.0312 0.2247  47  ARG A O   
372  C CB  . ARG A 47  ? 1.0756 1.0635 1.0413 0.3454  -0.0455 0.2377  47  ARG A CB  
373  C CG  . ARG A 47  ? 1.0914 1.1304 1.0837 0.3427  -0.0591 0.2448  47  ARG A CG  
374  C CD  . ARG A 47  ? 1.0288 1.0893 1.0275 0.3631  -0.0523 0.2577  47  ARG A CD  
375  N NE  . ARG A 47  ? 1.0930 1.1805 1.1191 0.3722  -0.0558 0.2825  47  ARG A NE  
376  C CZ  . ARG A 47  ? 1.2412 1.3651 1.2880 0.3650  -0.0720 0.2970  47  ARG A CZ  
377  N NH1 . ARG A 47  ? 0.8715 1.0122 0.9272 0.3581  -0.0812 0.2896  47  ARG A NH1 
378  N NH2 . ARG A 47  ? 1.2141 1.3583 1.2706 0.3592  -0.0797 0.3236  47  ARG A NH2 
379  N N   . PRO A 48  ? 1.2121 1.1151 1.1066 0.2754  -0.0687 0.2185  48  PRO A N   
380  C CA  . PRO A 48  ? 1.2701 1.1038 1.1176 0.2558  -0.0670 0.2100  48  PRO A CA  
381  C C   . PRO A 48  ? 1.4279 1.1718 1.2066 0.2643  -0.0362 0.1877  48  PRO A C   
382  O O   . PRO A 48  ? 1.4613 1.1811 1.1846 0.2421  -0.0365 0.1740  48  PRO A O   
383  C CB  . PRO A 48  ? 1.2915 1.1424 1.1157 0.2050  -0.0975 0.2216  48  PRO A CB  
384  C CG  . PRO A 48  ? 1.2806 1.2222 1.1656 0.2120  -0.1088 0.2450  48  PRO A CG  
385  C CD  . PRO A 48  ? 1.2085 1.1633 1.1150 0.2480  -0.0902 0.2329  48  PRO A CD  
386  N N   . LYS A 49  ? 1.4309 1.1301 1.2146 0.2990  -0.0044 0.1897  49  LYS A N   
387  C CA  . LYS A 49  ? 1.4992 1.1056 1.2188 0.3230  0.0412  0.1767  49  LYS A CA  
388  C C   . LYS A 49  ? 1.6988 1.2034 1.3040 0.2755  0.0399  0.1449  49  LYS A C   
389  O O   . LYS A 49  ? 1.7527 1.2540 1.3168 0.2697  0.0445  0.1326  49  LYS A O   
390  C CB  . LYS A 49  ? 1.5245 1.0963 1.2691 0.3666  0.0826  0.1960  49  LYS A CB  
391  C CG  . LYS A 49  ? 1.6650 1.3348 1.5002 0.4096  0.0920  0.2356  49  LYS A CG  
392  C CD  . LYS A 49  ? 1.9004 1.5619 1.7793 0.4417  0.1266  0.2699  49  LYS A CD  
393  C CE  . LYS A 49  ? 1.8627 1.6396 1.8381 0.4413  0.1023  0.3068  49  LYS A CE  
394  N NZ  . LYS A 49  ? 1.7858 1.5662 1.8090 0.4678  0.1368  0.3478  49  LYS A NZ  
395  N N   . PRO A 50  ? 1.6944 1.1337 1.2457 0.2282  0.0226  0.1349  50  PRO A N   
396  C CA  . PRO A 50  ? 1.7560 1.1140 1.1873 0.1632  0.0096  0.1098  50  PRO A CA  
397  C C   . PRO A 50  ? 1.7331 1.2124 1.2092 0.1149  -0.0479 0.1326  50  PRO A C   
398  O O   . PRO A 50  ? 1.6997 1.2373 1.2274 0.0940  -0.0824 0.1590  50  PRO A O   
399  C CB  . PRO A 50  ? 1.8433 1.0766 1.1984 0.1324  0.0166  0.0980  50  PRO A CB  
400  C CG  . PRO A 50  ? 1.8419 1.1420 1.3116 0.1725  0.0132  0.1266  50  PRO A CG  
401  C CD  . PRO A 50  ? 1.6981 1.1391 1.2887 0.2223  0.0090  0.1501  50  PRO A CD  
402  N N   . PRO A 51  ? 1.6382 1.1768 1.1178 0.1075  -0.0551 0.1337  51  PRO A N   
403  C CA  . PRO A 51  ? 1.5672 1.2322 1.1127 0.0758  -0.0984 0.1686  51  PRO A CA  
404  C C   . PRO A 51  ? 1.6463 1.3078 1.1294 -0.0103 -0.1377 0.1876  51  PRO A C   
405  O O   . PRO A 51  ? 1.5969 1.3552 1.1492 -0.0278 -0.1697 0.2326  51  PRO A O   
406  C CB  . PRO A 51  ? 1.5564 1.2812 1.1282 0.0979  -0.0884 0.1670  51  PRO A CB  
407  C CG  . PRO A 51  ? 1.6450 1.2918 1.1829 0.1515  -0.0423 0.1373  51  PRO A CG  
408  C CD  . PRO A 51  ? 1.6754 1.1819 1.1114 0.1331  -0.0216 0.1120  51  PRO A CD  
409  N N   . GLU A 52  ? 1.8394 0.9700 1.1236 -0.2632 0.2839  0.0551  52  GLU A N   
410  C CA  . GLU A 52  ? 1.8631 0.9600 1.0706 -0.3216 0.2754  0.0664  52  GLU A CA  
411  C C   . GLU A 52  ? 1.8713 0.9571 1.0620 -0.3093 0.2725  0.0753  52  GLU A C   
412  O O   . GLU A 52  ? 1.8831 0.9748 1.0321 -0.3505 0.2518  0.0899  52  GLU A O   
413  C CB  . GLU A 52  ? 1.9417 0.9547 1.0602 -0.3796 0.3152  0.0518  52  GLU A CB  
414  C CG  . GLU A 52  ? 2.1459 1.0698 1.2129 -0.3706 0.3707  0.0339  52  GLU A CG  
415  C CD  . GLU A 52  ? 2.5200 1.4217 1.6217 -0.3270 0.4151  0.0102  52  GLU A CD  
416  O OE1 . GLU A 52  ? 2.4114 1.3636 1.5684 -0.3156 0.4078  0.0036  52  GLU A OE1 
417  O OE2 . GLU A 52  ? 2.5318 1.3633 1.6014 -0.3052 0.4588  -0.0015 52  GLU A OE2 
418  N N   . ARG A 53  ? 1.7844 0.8599 1.0089 -0.2536 0.2906  0.0681  53  ARG A N   
419  C CA  . ARG A 53  ? 1.7773 0.8316 0.9824 -0.2372 0.2908  0.0745  53  ARG A CA  
420  C C   . ARG A 53  ? 1.7382 0.8771 1.0110 -0.2067 0.2458  0.0907  53  ARG A C   
421  O O   . ARG A 53  ? 1.7392 0.8687 0.9908 -0.2046 0.2398  0.0974  53  ARG A O   
422  C CB  . ARG A 53  ? 1.7801 0.7692 0.9787 -0.1927 0.3340  0.0606  53  ARG A CB  
423  N N   . ILE A 54  ? 1.6245 0.8389 0.9693 -0.1883 0.2164  0.0957  54  ILE A N   
424  C CA  . ILE A 54  ? 1.5647 0.8543 0.9752 -0.1567 0.1791  0.1081  54  ILE A CA  
425  C C   . ILE A 54  ? 1.5970 0.9478 1.0300 -0.1785 0.1419  0.1213  54  ILE A C   
426  O O   . ILE A 54  ? 1.6004 0.9520 1.0305 -0.1977 0.1396  0.1196  54  ILE A O   
427  C CB  . ILE A 54  ? 1.5612 0.8761 1.0401 -0.0999 0.1835  0.1015  54  ILE A CB  
428  C CG1 . ILE A 54  ? 1.5766 0.8483 1.0463 -0.0668 0.2072  0.0973  54  ILE A CG1 
429  C CG2 . ILE A 54  ? 1.5113 0.9019 1.0568 -0.0746 0.1476  0.1110  54  ILE A CG2 
430  C CD1 . ILE A 54  ? 1.6077 0.8888 1.1277 -0.0222 0.2244  0.0891  54  ILE A CD1 
431  N N   . ASN A 55  ? 1.5167 0.9192 0.9754 -0.1710 0.1134  0.1342  55  ASN A N   
432  C CA  . ASN A 55  ? 1.4648 0.9319 0.9559 -0.1782 0.0773  0.1493  55  ASN A CA  
433  C C   . ASN A 55  ? 1.4431 0.9655 1.0029 -0.1310 0.0578  0.1526  55  ASN A C   
434  O O   . ASN A 55  ? 1.4240 0.9971 1.0161 -0.1265 0.0312  0.1641  55  ASN A O   
435  C CB  . ASN A 55  ? 1.4666 0.9483 0.9167 -0.2227 0.0652  0.1624  55  ASN A CB  
436  C CG  . ASN A 55  ? 1.7102 1.1920 1.1467 -0.2193 0.0712  0.1613  55  ASN A CG  
437  O OD1 . ASN A 55  ? 1.6261 1.0491 1.0305 -0.2112 0.0983  0.1495  55  ASN A OD1 
438  N ND2 . ASN A 55  ? 1.5875 1.1342 1.0475 -0.2244 0.0468  0.1735  55  ASN A ND2 
439  N N   . LYS A 56  ? 1.3641 0.8740 0.9431 -0.0967 0.0714  0.1436  56  LYS A N   
440  C CA  . LYS A 56  ? 1.3196 0.8733 0.9527 -0.0591 0.0560  0.1457  56  LYS A CA  
441  C C   . LYS A 56  ? 1.3337 0.8747 0.9938 -0.0235 0.0689  0.1368  56  LYS A C   
442  O O   . LYS A 56  ? 1.3242 0.8230 0.9638 -0.0202 0.0923  0.1294  56  LYS A O   
443  C CB  . LYS A 56  ? 1.3500 0.9234 0.9756 -0.0644 0.0484  0.1509  56  LYS A CB  
444  C CG  . LYS A 56  ? 1.5574 1.1672 1.2275 -0.0322 0.0372  0.1510  56  LYS A CG  
445  C CD  . LYS A 56  ? 1.7690 1.3554 1.4107 -0.0344 0.0465  0.1482  56  LYS A CD  
446  C CE  . LYS A 56  ? 1.8413 1.4529 1.5170 -0.0080 0.0380  0.1472  56  LYS A CE  
447  N NZ  . LYS A 56  ? 1.8720 1.4597 1.5109 -0.0182 0.0436  0.1456  56  LYS A NZ  
448  N N   . VAL A 57  ? 1.2750 0.8549 0.9809 0.0027  0.0539  0.1387  57  VAL A N   
449  C CA  . VAL A 57  ? 1.2634 0.8488 1.0005 0.0320  0.0593  0.1340  57  VAL A CA  
450  C C   . VAL A 57  ? 1.2756 0.8892 1.0389 0.0520  0.0456  0.1382  57  VAL A C   
451  O O   . VAL A 57  ? 1.2609 0.8999 1.0319 0.0477  0.0310  0.1422  57  VAL A O   
452  C CB  . VAL A 57  ? 1.3132 0.9116 1.0684 0.0312  0.0572  0.1298  57  VAL A CB  
453  C CG1 . VAL A 57  ? 1.2916 0.9211 1.0849 0.0545  0.0496  0.1292  57  VAL A CG1 
454  C CG2 . VAL A 57  ? 1.3291 0.8957 1.0646 0.0200  0.0807  0.1208  57  VAL A CG2 
455  N N   . LYS A 58  ? 1.2198 0.8307 0.9974 0.0738  0.0508  0.1379  58  LYS A N   
456  C CA  . LYS A 58  ? 1.2000 0.8318 0.9949 0.0874  0.0383  0.1423  58  LYS A CA  
457  C C   . LYS A 58  ? 1.2432 0.9027 1.0724 0.1034  0.0332  0.1429  58  LYS A C   
458  O O   . LYS A 58  ? 1.2556 0.9148 1.0970 0.1142  0.0432  0.1417  58  LYS A O   
459  C CB  . LYS A 58  ? 1.2370 0.8377 1.0065 0.0921  0.0440  0.1457  58  LYS A CB  
460  C CG  . LYS A 58  ? 1.3769 0.9617 1.1087 0.0681  0.0442  0.1452  58  LYS A CG  
461  C CD  . LYS A 58  ? 1.6305 1.1629 1.3167 0.0656  0.0556  0.1467  58  LYS A CD  
462  C CE  . LYS A 58  ? 1.9240 1.4066 1.5706 0.0542  0.0768  0.1432  58  LYS A CE  
463  N NZ  . LYS A 58  ? 2.0269 1.4903 1.6906 0.0815  0.0917  0.1421  58  LYS A NZ  
464  N N   . PHE A 59  ? 1.1783 0.8631 1.0212 0.1024  0.0199  0.1437  59  PHE A N   
465  C CA  . PHE A 59  ? 1.1620 0.8727 1.0270 0.1086  0.0136  0.1446  59  PHE A CA  
466  C C   . PHE A 59  ? 1.2784 0.9964 1.1434 0.1117  0.0042  0.1499  59  PHE A C   
467  O O   . PHE A 59  ? 1.2743 0.9872 1.1275 0.1048  0.0011  0.1479  59  PHE A O   
468  C CB  . PHE A 59  ? 1.1673 0.8846 1.0315 0.0984  0.0090  0.1400  59  PHE A CB  
469  C CG  . PHE A 59  ? 1.1866 0.8927 1.0429 0.0888  0.0150  0.1354  59  PHE A CG  
470  C CD1 . PHE A 59  ? 1.2034 0.9181 1.0679 0.0863  0.0228  0.1312  59  PHE A CD1 
471  C CD2 . PHE A 59  ? 1.2043 0.8959 1.0450 0.0794  0.0118  0.1360  59  PHE A CD2 
472  C CE1 . PHE A 59  ? 1.2044 0.9046 1.0549 0.0716  0.0294  0.1252  59  PHE A CE1 
473  C CE2 . PHE A 59  ? 1.2244 0.9018 1.0512 0.0654  0.0145  0.1334  59  PHE A CE2 
474  C CZ  . PHE A 59  ? 1.1986 0.8760 1.0269 0.0600  0.0242  0.1269  59  PHE A CZ  
475  N N   . TYR A 60  ? 1.2756 1.0075 1.1531 0.1206  -0.0004 0.1572  60  TYR A N   
476  C CA  . TYR A 60  ? 1.3031 1.0351 1.1708 0.1163  -0.0106 0.1623  60  TYR A CA  
477  C C   . TYR A 60  ? 1.3045 1.0648 1.1828 0.1100  -0.0208 0.1675  60  TYR A C   
478  O O   . TYR A 60  ? 1.2980 1.0854 1.1979 0.1162  -0.0231 0.1733  60  TYR A O   
479  C CB  . TYR A 60  ? 1.3807 1.0889 1.2339 0.1252  -0.0115 0.1702  60  TYR A CB  
480  C CG  . TYR A 60  ? 1.4701 1.1869 1.3422 0.1461  -0.0134 0.1820  60  TYR A CG  
481  C CD1 . TYR A 60  ? 1.5230 1.2296 1.4047 0.1622  0.0013  0.1802  60  TYR A CD1 
482  C CD2 . TYR A 60  ? 1.4830 1.2180 1.3628 0.1500  -0.0293 0.1962  60  TYR A CD2 
483  C CE1 . TYR A 60  ? 1.5627 1.2814 1.4688 0.1880  0.0028  0.1911  60  TYR A CE1 
484  C CE2 . TYR A 60  ? 1.4903 1.2429 1.3959 0.1746  -0.0331 0.2106  60  TYR A CE2 
485  C CZ  . TYR A 60  ? 1.6412 1.3870 1.5631 0.1968  -0.0157 0.2076  60  TYR A CZ  
486  O OH  . TYR A 60  ? 1.6494 1.4164 1.6034 0.2273  -0.0161 0.2216  60  TYR A OH  
487  N N   . ILE A 61  ? 1.2275 0.9831 1.0885 0.0949  -0.0253 0.1649  61  ILE A N   
488  C CA  . ILE A 61  ? 1.2110 0.9840 1.0671 0.0796  -0.0342 0.1699  61  ILE A CA  
489  C C   . ILE A 61  ? 1.2660 1.0365 1.1125 0.0774  -0.0462 0.1822  61  ILE A C   
490  O O   . ILE A 61  ? 1.2801 1.0240 1.1065 0.0745  -0.0437 0.1784  61  ILE A O   
491  C CB  . ILE A 61  ? 1.2597 1.0165 1.0931 0.0627  -0.0272 0.1582  61  ILE A CB  
492  C CG1 . ILE A 61  ? 1.2538 1.0071 1.0889 0.0636  -0.0194 0.1499  61  ILE A CG1 
493  C CG2 . ILE A 61  ? 1.2771 1.0371 1.0888 0.0392  -0.0338 0.1626  61  ILE A CG2 
494  C CD1 . ILE A 61  ? 1.1900 0.9266 1.0296 0.0769  -0.0113 0.1425  61  ILE A CD1 
495  N N   . PRO A 62  ? 1.2043 1.0042 1.0638 0.0775  -0.0607 0.1982  62  PRO A N   
496  C CA  . PRO A 62  ? 1.2115 1.0040 1.0585 0.0767  -0.0759 0.2136  62  PRO A CA  
497  C C   . PRO A 62  ? 1.2984 1.0802 1.1097 0.0434  -0.0833 0.2137  62  PRO A C   
498  O O   . PRO A 62  ? 1.3147 1.0680 1.0984 0.0353  -0.0888 0.2169  62  PRO A O   
499  C CB  . PRO A 62  ? 1.2003 1.0359 1.0834 0.0956  -0.0891 0.2335  62  PRO A CB  
500  C CG  . PRO A 62  ? 1.2291 1.1046 1.1369 0.0908  -0.0822 0.2267  62  PRO A CG  
501  C CD  . PRO A 62  ? 1.1950 1.0405 1.0808 0.0766  -0.0653 0.2045  62  PRO A CD  
502  N N   . ASP A 63  ? 1.2427 1.0409 1.0464 0.0198  -0.0814 0.2089  63  ASP A N   
503  C CA  . ASP A 63  ? 1.2503 1.0316 1.0127 -0.0168 -0.0821 0.2056  63  ASP A CA  
504  C C   . ASP A 63  ? 1.2701 1.0323 1.0194 -0.0249 -0.0604 0.1847  63  ASP A C   
505  O O   . ASP A 63  ? 1.2610 1.0410 1.0234 -0.0221 -0.0574 0.1830  63  ASP A O   
506  C CB  . ASP A 63  ? 1.2735 1.0913 1.0314 -0.0408 -0.1030 0.2257  63  ASP A CB  
507  C CG  . ASP A 63  ? 1.5479 1.3867 1.3218 -0.0278 -0.1282 0.2514  63  ASP A CG  
508  O OD1 . ASP A 63  ? 1.6394 1.4493 1.3788 -0.0451 -0.1379 0.2576  63  ASP A OD1 
509  O OD2 . ASP A 63  ? 1.5506 1.4325 1.3701 0.0006  -0.1375 0.2657  63  ASP A OD2 
510  N N   . MET A 64  ? 1.2071 0.9328 0.9318 -0.0320 -0.0442 0.1685  64  MET A N   
511  C CA  . MET A 64  ? 1.1956 0.8979 0.9097 -0.0313 -0.0223 0.1499  64  MET A CA  
512  C C   . MET A 64  ? 1.2676 0.9479 0.9369 -0.0662 -0.0145 0.1452  64  MET A C   
513  O O   . MET A 64  ? 1.2754 0.9409 0.9125 -0.0937 -0.0149 0.1457  64  MET A O   
514  C CB  . MET A 64  ? 1.2224 0.9065 0.9414 -0.0163 -0.0067 0.1355  64  MET A CB  
515  C CG  . MET A 64  ? 1.2701 0.9295 0.9788 -0.0121 0.0165  0.1182  64  MET A CG  
516  S SD  . MET A 64  ? 1.3069 0.9679 1.0354 0.0111  0.0181  0.1181  64  MET A SD  
517  C CE  . MET A 64  ? 1.2725 0.9116 1.0043 0.0311  0.0403  0.1028  64  MET A CE  
518  N N   . ASN A 65  ? 1.2402 0.9117 0.8992 -0.0693 -0.0064 0.1402  65  ASN A N   
519  C CA  . ASN A 65  ? 1.2667 0.9061 0.8714 -0.1054 0.0049  0.1344  65  ASN A CA  
520  C C   . ASN A 65  ? 1.3360 0.9276 0.9214 -0.0921 0.0303  0.1166  65  ASN A C   
521  O O   . ASN A 65  ? 1.3158 0.9110 0.9363 -0.0560 0.0336  0.1124  65  ASN A O   
522  C CB  . ASN A 65  ? 1.2802 0.9561 0.8788 -0.1311 -0.0140 0.1503  65  ASN A CB  
523  C CG  . ASN A 65  ? 1.3648 1.0739 1.0021 -0.1077 -0.0208 0.1540  65  ASN A CG  
524  O OD1 . ASN A 65  ? 1.3816 1.0641 1.0218 -0.0868 -0.0069 0.1418  65  ASN A OD1 
525  N ND2 . ASN A 65  ? 1.0860 0.8554 0.7546 -0.1105 -0.0422 0.1716  65  ASN A ND2 
526  N N   . SER A 66  ? 1.3306 0.8742 0.8555 -0.1225 0.0473  0.1080  66  SER A N   
527  C CA  . SER A 66  ? 1.3532 0.8367 0.8451 -0.1122 0.0725  0.0930  66  SER A CA  
528  C C   . SER A 66  ? 1.4089 0.9013 0.9108 -0.1008 0.0629  0.0979  66  SER A C   
529  O O   . SER A 66  ? 1.4125 0.8731 0.9176 -0.0717 0.0739  0.0906  66  SER A O   
530  C CB  . SER A 66  ? 1.4178 0.8408 0.8284 -0.1566 0.0928  0.0843  66  SER A CB  
531  O OG  . SER A 66  ? 1.4396 0.8821 0.8175 -0.2012 0.0763  0.0964  66  SER A OG  
532  N N   . ARG A 67  ? 1.3655 0.9045 0.8730 -0.1249 0.0417  0.1111  67  ARG A N   
533  C CA  . ARG A 67  ? 1.3695 0.9279 0.8850 -0.1241 0.0324  0.1151  67  ARG A CA  
534  C C   . ARG A 67  ? 1.4008 0.9779 0.9740 -0.0779 0.0275  0.1150  67  ARG A C   
535  O O   . ARG A 67  ? 1.4160 0.9843 0.9842 -0.0740 0.0271  0.1131  67  ARG A O   
536  C CB  . ARG A 67  ? 1.3822 1.0107 0.9127 -0.1536 0.0099  0.1310  67  ARG A CB  
537  C CG  . ARG A 67  ? 1.5537 1.2000 1.0652 -0.1783 0.0056  0.1324  67  ARG A CG  
538  C CD  . ARG A 67  ? 1.7444 1.4859 1.3048 -0.1884 -0.0181 0.1499  67  ARG A CD  
539  N NE  . ARG A 67  ? 1.9476 1.7219 1.5031 -0.2149 -0.0318 0.1644  67  ARG A NE  
540  C CZ  . ARG A 67  ? 2.0948 1.9515 1.7028 -0.2118 -0.0555 0.1846  67  ARG A CZ  
541  N NH1 . ARG A 67  ? 1.9473 1.8629 1.6194 -0.1815 -0.0639 0.1902  67  ARG A NH1 
542  N NH2 . ARG A 67  ? 1.8531 1.7311 1.4482 -0.2384 -0.0701 0.1997  67  ARG A NH2 
543  N N   . MET A 68  ? 1.3303 0.9290 0.9498 -0.0490 0.0242  0.1168  68  MET A N   
544  C CA  . MET A 68  ? 1.3009 0.9176 0.9687 -0.0121 0.0197  0.1177  68  MET A CA  
545  C C   . MET A 68  ? 1.3389 0.9289 1.0156 0.0151  0.0327  0.1097  68  MET A C   
546  O O   . MET A 68  ? 1.3075 0.9203 1.0241 0.0401  0.0276  0.1121  68  MET A O   
547  C CB  . MET A 68  ? 1.2937 0.9677 1.0092 -0.0039 0.0028  0.1291  68  MET A CB  
548  C CG  . MET A 68  ? 1.3291 1.0413 1.0503 -0.0214 -0.0087 0.1377  68  MET A CG  
549  S SD  . MET A 68  ? 1.3601 1.1288 1.1399 0.0009  -0.0233 0.1507  68  MET A SD  
550  C CE  . MET A 68  ? 1.3263 1.1116 1.0984 -0.0159 -0.0353 0.1628  68  MET A CE  
551  N N   . ALA A 69  ? 1.3075 0.8505 0.9452 0.0085  0.0514  0.0999  69  ALA A N   
552  C CA  . ALA A 69  ? 1.2977 0.8201 0.9460 0.0360  0.0678  0.0913  69  ALA A CA  
553  C C   . ALA A 69  ? 1.3600 0.8390 0.9911 0.0557  0.0749  0.0893  69  ALA A C   
554  O O   . ALA A 69  ? 1.3858 0.8207 0.9660 0.0362  0.0795  0.0874  69  ALA A O   
555  C CB  . ALA A 69  ? 1.3268 0.8179 0.9403 0.0188  0.0885  0.0805  69  ALA A CB  
556  N N   . GLY A 70  ? 1.3020 0.7948 0.9718 0.0908  0.0734  0.0917  70  GLY A N   
557  C CA  . GLY A 70  ? 1.3173 0.7714 0.9752 0.1140  0.0752  0.0942  70  GLY A CA  
558  C C   . GLY A 70  ? 1.3393 0.8327 1.0467 0.1406  0.0590  0.1045  70  GLY A C   
559  O O   . GLY A 70  ? 1.2961 0.8442 1.0488 0.1468  0.0529  0.1070  70  GLY A O   
560  N N   . GLN A 71  ? 1.3135 0.7744 1.0033 0.1504  0.0511  0.1112  71  GLN A N   
561  C CA  . GLN A 71  ? 1.2847 0.7732 1.0100 0.1710  0.0343  0.1233  71  GLN A CA  
562  C C   . GLN A 71  ? 1.2943 0.8090 1.0257 0.1489  0.0161  0.1288  71  GLN A C   
563  O O   . GLN A 71  ? 1.3004 0.7884 0.9957 0.1257  0.0135  0.1264  71  GLN A O   
564  C CB  . GLN A 71  ? 1.3277 0.7638 1.0313 0.1982  0.0353  0.1300  71  GLN A CB  
565  C CG  . GLN A 71  ? 1.5974 1.0314 1.3217 0.2332  0.0536  0.1271  71  GLN A CG  
566  C CD  . GLN A 71  ? 1.8819 1.2500 1.5773 0.2653  0.0592  0.1334  71  GLN A CD  
567  O OE1 . GLN A 71  ? 1.8269 1.2128 1.5526 0.2950  0.0441  0.1493  71  GLN A OE1 
568  N NE2 . GLN A 71  ? 1.7463 1.0337 1.3779 0.2589  0.0809  0.1224  71  GLN A NE2 
569  N N   . TYR A 72  ? 1.3082 0.8530 0.8347 0.0217  0.0406  0.1372  72  TYR A N   
570  C CA  . TYR A 72  ? 1.3160 0.8389 0.8395 0.0210  0.0388  0.1372  72  TYR A CA  
571  C C   . TYR A 72  ? 1.3631 0.9059 0.8974 0.0172  0.0412  0.1288  72  TYR A C   
572  O O   . TYR A 72  ? 1.3564 0.9190 0.8922 0.0069  0.0464  0.1222  72  TYR A O   
573  C CB  . TYR A 72  ? 1.3426 0.8337 0.8457 0.0075  0.0392  0.1415  72  TYR A CB  
574  C CG  . TYR A 72  ? 1.3704 0.8304 0.8597 0.0133  0.0338  0.1487  72  TYR A CG  
575  C CD1 . TYR A 72  ? 1.4049 0.8379 0.8928 0.0239  0.0257  0.1487  72  TYR A CD1 
576  C CD2 . TYR A 72  ? 1.3843 0.8418 0.8622 0.0081  0.0363  0.1534  72  TYR A CD2 
577  C CE1 . TYR A 72  ? 1.4304 0.8322 0.9051 0.0309  0.0196  0.1524  72  TYR A CE1 
578  C CE2 . TYR A 72  ? 1.4125 0.8385 0.8767 0.0146  0.0310  0.1595  72  TYR A CE2 
579  C CZ  . TYR A 72  ? 1.5398 0.9367 1.0021 0.0270  0.0223  0.1585  72  TYR A CZ  
580  O OH  . TYR A 72  ? 1.6062 0.9711 1.0556 0.0358  0.0160  0.1617  72  TYR A OH  
581  N N   . SER A 73  ? 1.3136 0.8510 0.8555 0.0251  0.0376  0.1273  73  SER A N   
582  C CA  . SER A 73  ? 1.3009 0.8524 0.8526 0.0226  0.0393  0.1199  73  SER A CA  
583  C C   . SER A 73  ? 1.3746 0.9064 0.9273 0.0219  0.0364  0.1210  73  SER A C   
584  O O   . SER A 73  ? 1.3506 0.8616 0.8991 0.0273  0.0312  0.1244  73  SER A O   
585  C CB  . SER A 73  ? 1.3183 0.8906 0.8800 0.0330  0.0364  0.1143  73  SER A CB  
586  O OG  . SER A 73  ? 1.4165 0.9796 0.9782 0.0446  0.0313  0.1177  73  SER A OG  
587  N N   . CYS A 74  ? 1.3787 0.9176 0.9380 0.0152  0.0391  0.1163  74  CYS A N   
588  C CA  . CYS A 74  ? 1.4101 0.9356 0.9740 0.0134  0.0355  0.1159  74  CYS A CA  
589  C C   . CYS A 74  ? 1.4323 0.9729 1.0119 0.0182  0.0351  0.1097  74  CYS A C   
590  O O   . CYS A 74  ? 1.4436 1.0037 1.0290 0.0184  0.0394  0.1045  74  CYS A O   
591  C CB  . CYS A 74  ? 1.4508 0.9663 1.0075 0.0003  0.0378  0.1175  74  CYS A CB  
592  S SG  . CYS A 74  ? 1.5305 1.0246 1.0911 -0.0009 0.0282  0.1176  74  CYS A SG  
593  N N   . ILE A 75  ? 1.3424 0.8734 0.9284 0.0217  0.0293  0.1081  75  ILE A N   
594  C CA  . ILE A 75  ? 1.3106 0.8532 0.9096 0.0246  0.0285  0.1020  75  ILE A CA  
595  C C   . ILE A 75  ? 1.3392 0.8742 0.9481 0.0209  0.0232  0.0992  75  ILE A C   
596  O O   . ILE A 75  ? 1.3369 0.8541 0.9409 0.0210  0.0168  0.0997  75  ILE A O   
597  C CB  . ILE A 75  ? 1.3424 0.8853 0.9371 0.0329  0.0264  0.1001  75  ILE A CB  
598  C CG1 . ILE A 75  ? 1.3649 0.9222 0.9558 0.0365  0.0290  0.0990  75  ILE A CG1 
599  C CG2 . ILE A 75  ? 1.3004 0.8417 0.9018 0.0336  0.0230  0.0937  75  ILE A CG2 
600  C CD1 . ILE A 75  ? 1.6481 1.2033 1.2285 0.0430  0.0276  0.1029  75  ILE A CD1 
601  N N   . TYR A 76  ? 1.2827 0.8310 0.9064 0.0183  0.0244  0.0949  76  TYR A N   
602  C CA  . TYR A 76  ? 1.2635 0.8092 0.9008 0.0149  0.0176  0.0908  76  TYR A CA  
603  C C   . TYR A 76  ? 1.2562 0.8158 0.9087 0.0157  0.0167  0.0829  76  TYR A C   
604  O O   . TYR A 76  ? 1.2463 0.8166 0.8981 0.0179  0.0221  0.0819  76  TYR A O   
605  C CB  . TYR A 76  ? 1.2747 0.8205 0.9165 0.0082  0.0180  0.0939  76  TYR A CB  
606  C CG  . TYR A 76  ? 1.2786 0.8448 0.9313 0.0068  0.0267  0.0928  76  TYR A CG  
607  C CD1 . TYR A 76  ? 1.2814 0.8618 0.9552 0.0066  0.0254  0.0882  76  TYR A CD1 
608  C CD2 . TYR A 76  ? 1.2902 0.8626 0.9337 0.0055  0.0357  0.0944  76  TYR A CD2 
609  C CE1 . TYR A 76  ? 1.2677 0.8658 0.9524 0.0070  0.0334  0.0861  76  TYR A CE1 
610  C CE2 . TYR A 76  ? 1.2865 0.8773 0.9408 0.0054  0.0434  0.0898  76  TYR A CE2 
611  C CZ  . TYR A 76  ? 1.3132 0.9157 0.9878 0.0071  0.0423  0.0861  76  TYR A CZ  
612  O OH  . TYR A 76  ? 1.2494 0.8691 0.9357 0.0089  0.0498  0.0804  76  TYR A OH  
613  N N   . ARG A 77  ? 1.1732 0.7311 0.8377 0.0134  0.0085  0.0757  77  ARG A N   
614  C CA  . ARG A 77  ? 1.1450 0.7164 0.8235 0.0113  0.0075  0.0664  77  ARG A CA  
615  C C   . ARG A 77  ? 1.1716 0.7588 0.8741 0.0069  0.0044  0.0628  77  ARG A C   
616  O O   . ARG A 77  ? 1.1643 0.7482 0.8758 0.0049  -0.0035 0.0622  77  ARG A O   
617  C CB  . ARG A 77  ? 1.0893 0.6533 0.7658 0.0109  0.0013  0.0558  77  ARG A CB  
618  C CG  . ARG A 77  ? 1.0666 0.6430 0.7499 0.0060  0.0031  0.0459  77  ARG A CG  
619  C CD  . ARG A 77  ? 1.1023 0.6740 0.7835 0.0035  -0.0011 0.0320  77  ARG A CD  
620  N NE  . ARG A 77  ? 1.1787 0.7539 0.8789 0.0004  -0.0124 0.0188  77  ARG A NE  
621  C CZ  . ARG A 77  ? 1.4444 1.0056 1.1408 0.0042  -0.0202 0.0102  77  ARG A CZ  
622  N NH1 . ARG A 77  ? 1.4392 0.9837 1.1154 0.0111  -0.0162 0.0155  77  ARG A NH1 
623  N NH2 . ARG A 77  ? 1.1876 0.7517 0.9015 0.0020  -0.0334 -0.0049 77  ARG A NH2 
624  N N   . VAL A 78  ? 1.0854 0.6882 0.7972 0.0056  0.0095  0.0599  78  VAL A N   
625  C CA  . VAL A 78  ? 1.0488 0.6704 0.7863 0.0021  0.0074  0.0556  78  VAL A CA  
626  C C   . VAL A 78  ? 1.0787 0.7080 0.8201 -0.0025 0.0072  0.0457  78  VAL A C   
627  O O   . VAL A 78  ? 1.0907 0.7180 0.8192 -0.0015 0.0138  0.0470  78  VAL A O   
628  C CB  . VAL A 78  ? 1.0721 0.7042 0.8173 0.0051  0.0149  0.0623  78  VAL A CB  
629  C CG1 . VAL A 78  ? 1.0442 0.6973 0.8149 0.0034  0.0150  0.0571  78  VAL A CG1 
630  C CG2 . VAL A 78  ? 1.0735 0.7000 0.8189 0.0048  0.0131  0.0688  78  VAL A CG2 
631  N N   . GLY A 79  ? 1.0167 0.6521 0.7724 -0.0083 -0.0014 0.0341  79  GLY A N   
632  C CA  . GLY A 79  ? 1.0145 0.6578 0.7733 -0.0164 -0.0019 0.0211  79  GLY A CA  
633  C C   . GLY A 79  ? 1.0949 0.7200 0.8267 -0.0164 0.0008  0.0186  79  GLY A C   
634  O O   . GLY A 79  ? 1.1188 0.7347 0.8474 -0.0148 -0.0049 0.0132  79  GLY A O   
635  N N   . GLU A 80  ? 1.0425 0.6603 0.7535 -0.0170 0.0085  0.0226  80  GLU A N   
636  C CA  . GLU A 80  ? 1.0582 0.6585 0.7421 -0.0160 0.0112  0.0220  80  GLU A CA  
637  C C   . GLU A 80  ? 1.1661 0.7547 0.8289 -0.0075 0.0162  0.0358  80  GLU A C   
638  O O   . GLU A 80  ? 1.2055 0.7803 0.8449 -0.0053 0.0180  0.0376  80  GLU A O   
639  C CB  . GLU A 80  ? 1.0773 0.6777 0.7524 -0.0282 0.0125  0.0081  80  GLU A CB  
640  C CG  . GLU A 80  ? 1.2046 0.8152 0.8971 -0.0362 0.0067  -0.0108 80  GLU A CG  
641  C CD  . GLU A 80  ? 1.3575 0.9583 1.0475 -0.0303 0.0023  -0.0169 80  GLU A CD  
642  O OE1 . GLU A 80  ? 0.8107 0.3952 0.4829 -0.0199 0.0048  -0.0048 80  GLU A OE1 
643  O OE2 . GLU A 80  ? 1.2267 0.8371 0.9336 -0.0361 -0.0046 -0.0362 80  GLU A OE2 
644  N N   . LEU A 81  ? 1.0987 0.6946 0.7715 -0.0022 0.0179  0.0440  81  LEU A N   
645  C CA  . LEU A 81  ? 1.0839 0.6742 0.7431 0.0061  0.0215  0.0532  81  LEU A CA  
646  C C   . LEU A 81  ? 1.1326 0.7179 0.7885 0.0122  0.0216  0.0607  81  LEU A C   
647  O O   . LEU A 81  ? 1.1323 0.7198 0.8014 0.0108  0.0187  0.0608  81  LEU A O   
648  C CB  . LEU A 81  ? 1.0645 0.6682 0.7409 0.0079  0.0239  0.0542  81  LEU A CB  
649  C CG  . LEU A 81  ? 1.1076 0.7073 0.7715 0.0123  0.0259  0.0537  81  LEU A CG  
650  C CD1 . LEU A 81  ? 1.1104 0.6996 0.7579 0.0058  0.0236  0.0476  81  LEU A CD1 
651  C CD2 . LEU A 81  ? 1.1121 0.7265 0.7974 0.0152  0.0288  0.0528  81  LEU A CD2 
652  N N   . TRP A 82  ? 1.0953 0.6732 0.7331 0.0185  0.0235  0.0661  82  TRP A N   
653  C CA  . TRP A 82  ? 1.0854 0.6595 0.7184 0.0231  0.0244  0.0731  82  TRP A CA  
654  C C   . TRP A 82  ? 1.1193 0.7007 0.7510 0.0271  0.0281  0.0758  82  TRP A C   
655  O O   . TRP A 82  ? 1.0832 0.6653 0.7062 0.0308  0.0276  0.0726  82  TRP A O   
656  C CB  . TRP A 82  ? 1.0754 0.6375 0.6905 0.0267  0.0228  0.0750  82  TRP A CB  
657  C CG  . TRP A 82  ? 1.0885 0.6432 0.7059 0.0239  0.0198  0.0702  82  TRP A CG  
658  C CD1 . TRP A 82  ? 1.1315 0.6831 0.7446 0.0196  0.0188  0.0615  82  TRP A CD1 
659  C CD2 . TRP A 82  ? 1.0870 0.6358 0.7116 0.0242  0.0166  0.0705  82  TRP A CD2 
660  N NE1 . TRP A 82  ? 1.1214 0.6686 0.7412 0.0181  0.0155  0.0544  82  TRP A NE1 
661  C CE2 . TRP A 82  ? 1.1369 0.6807 0.7635 0.0219  0.0129  0.0599  82  TRP A CE2 
662  C CE3 . TRP A 82  ? 1.1012 0.6461 0.7281 0.0252  0.0158  0.0773  82  TRP A CE3 
663  C CZ2 . TRP A 82  ? 1.1286 0.6630 0.7605 0.0233  0.0067  0.0548  82  TRP A CZ2 
664  C CZ3 . TRP A 82  ? 1.1234 0.6552 0.7515 0.0256  0.0095  0.0749  82  TRP A CZ3 
665  C CH2 . TRP A 82  ? 1.1341 0.6608 0.7657 0.0258  0.0041  0.0632  82  TRP A CH2 
666  N N   . SER A 83  ? 1.1261 0.7113 0.7646 0.0259  0.0309  0.0796  83  SER A N   
667  C CA  . SER A 83  ? 1.1397 0.7341 0.7772 0.0279  0.0356  0.0787  83  SER A CA  
668  C C   . SER A 83  ? 1.2590 0.8505 0.8796 0.0329  0.0342  0.0792  83  SER A C   
669  O O   . SER A 83  ? 1.2752 0.8568 0.8866 0.0338  0.0315  0.0841  83  SER A O   
670  C CB  . SER A 83  ? 1.1656 0.7617 0.8091 0.0222  0.0395  0.0824  83  SER A CB  
671  O OG  . SER A 83  ? 1.2628 0.8462 0.8940 0.0203  0.0377  0.0887  83  SER A OG  
672  N N   . GLU A 84  ? 1.2320 0.8331 0.8500 0.0370  0.0349  0.0724  84  GLU A N   
673  C CA  . GLU A 84  ? 1.2472 0.8492 0.8522 0.0418  0.0313  0.0712  84  GLU A CA  
674  C C   . GLU A 84  ? 1.3148 0.9191 0.9187 0.0370  0.0356  0.0767  84  GLU A C   
675  O O   . GLU A 84  ? 1.3255 0.9320 0.9365 0.0298  0.0416  0.0780  84  GLU A O   
676  C CB  . GLU A 84  ? 1.2717 0.8833 0.8747 0.0478  0.0277  0.0587  84  GLU A CB  
677  C CG  . GLU A 84  ? 1.5410 1.1409 1.1306 0.0542  0.0180  0.0554  84  GLU A CG  
678  C CD  . GLU A 84  ? 1.9108 1.5123 1.4951 0.0615  0.0105  0.0412  84  GLU A CD  
679  O OE1 . GLU A 84  ? 1.6205 1.2356 1.2078 0.0651  0.0088  0.0306  84  GLU A OE1 
680  O OE2 . GLU A 84  ? 1.8778 1.4657 1.4538 0.0632  0.0054  0.0389  84  GLU A OE2 
681  N N   . PRO A 85  ? 1.2560 0.8569 0.8498 0.0401  0.0324  0.0812  85  PRO A N   
682  C CA  . PRO A 85  ? 1.2466 0.8459 0.8373 0.0346  0.0363  0.0873  85  PRO A CA  
683  C C   . PRO A 85  ? 1.3267 0.9388 0.9204 0.0262  0.0431  0.0817  85  PRO A C   
684  O O   . PRO A 85  ? 1.3302 0.9588 0.9288 0.0273  0.0440  0.0697  85  PRO A O   
685  C CB  . PRO A 85  ? 1.2594 0.8597 0.8418 0.0415  0.0312  0.0898  85  PRO A CB  
686  C CG  . PRO A 85  ? 1.3094 0.9138 0.8894 0.0496  0.0242  0.0833  85  PRO A CG  
687  C CD  . PRO A 85  ? 1.2642 0.8608 0.8478 0.0482  0.0248  0.0814  85  PRO A CD  
688  N N   . SER A 86  ? 1.2994 0.9014 0.8880 0.0171  0.0475  0.0888  86  SER A N   
689  C CA  . SER A 86  ? 1.2897 0.8982 0.8749 0.0048  0.0552  0.0850  86  SER A CA  
690  C C   . SER A 86  ? 1.3449 0.9698 0.9262 0.0041  0.0556  0.0788  86  SER A C   
691  O O   . SER A 86  ? 1.3314 0.9603 0.9131 0.0145  0.0487  0.0795  86  SER A O   
692  C CB  . SER A 86  ? 1.3236 0.9086 0.8969 -0.0043 0.0561  0.0961  86  SER A CB  
693  O OG  . SER A 86  ? 1.3764 0.9520 0.9396 -0.0012 0.0524  0.1031  86  SER A OG  
694  N N   . ASN A 87  ? 1.3185 0.9525 0.8952 -0.0092 0.0634  0.0724  87  ASN A N   
695  C CA  . ASN A 87  ? 1.3215 0.9744 0.8963 -0.0122 0.0636  0.0645  87  ASN A CA  
696  C C   . ASN A 87  ? 1.3715 1.0085 0.9355 -0.0106 0.0597  0.0792  87  ASN A C   
697  O O   . ASN A 87  ? 1.3811 0.9912 0.9375 -0.0092 0.0580  0.0929  87  ASN A O   
698  C CB  . ASN A 87  ? 1.4022 1.0695 0.9736 -0.0300 0.0742  0.0514  87  ASN A CB  
699  C CG  . ASN A 87  ? 1.7434 1.3872 1.2965 -0.0473 0.0816  0.0620  87  ASN A CG  
700  O OD1 . ASN A 87  ? 1.5576 1.1797 1.1069 -0.0486 0.0820  0.0713  87  ASN A OD1 
701  N ND2 . ASN A 87  ? 1.6461 1.2935 1.1865 -0.0616 0.0863  0.0599  87  ASN A ND2 
702  N N   . LEU A 88  ? 1.1671 0.9107 1.0252 0.1724  0.0882  0.2704  88  LEU A N   
703  C CA  . LEU A 88  ? 1.1403 0.8777 1.0032 0.1408  0.1041  0.2630  88  LEU A CA  
704  C C   . LEU A 88  ? 1.0535 0.8571 0.9574 0.1121  0.0855  0.2650  88  LEU A C   
705  O O   . LEU A 88  ? 1.0032 0.8545 0.9240 0.1200  0.0724  0.2686  88  LEU A O   
706  C CB  . LEU A 88  ? 1.1700 0.8758 1.0013 0.1538  0.1331  0.2530  88  LEU A CB  
707  C CG  . LEU A 88  ? 1.2648 0.8965 1.0470 0.1837  0.1594  0.2491  88  LEU A CG  
708  C CD1 . LEU A 88  ? 1.2827 0.8969 1.0421 0.1908  0.1848  0.2393  88  LEU A CD1 
709  C CD2 . LEU A 88  ? 1.3094 0.8873 1.0832 0.1706  0.1736  0.2468  88  LEU A CD2 
710  N N   . LEU A 89  ? 0.9633 0.7667 0.8822 0.0798  0.0849  0.2610  89  LEU A N   
711  C CA  . LEU A 89  ? 0.9126 0.7685 0.8632 0.0519  0.0705  0.2611  89  LEU A CA  
712  C C   . LEU A 89  ? 1.0192 0.8615 0.9608 0.0412  0.0914  0.2478  89  LEU A C   
713  O O   . LEU A 89  ? 1.0422 0.8387 0.9703 0.0347  0.1089  0.2366  89  LEU A O   
714  C CB  . LEU A 89  ? 0.8828 0.7505 0.8560 0.0253  0.0504  0.2641  89  LEU A CB  
715  C CG  . LEU A 89  ? 0.8992 0.8060 0.8961 -0.0054 0.0387  0.2607  89  LEU A CG  
716  C CD1 . LEU A 89  ? 0.8734 0.8373 0.8897 -0.0029 0.0280  0.2688  89  LEU A CD1 
717  C CD2 . LEU A 89  ? 0.9109 0.8246 0.9248 -0.0276 0.0176  0.2633  89  LEU A CD2 
718  N N   . ASP A 90  ? 0.9938 0.8750 0.9441 0.0412  0.0907  0.2479  90  ASP A N   
719  C CA  . ASP A 90  ? 1.0025 0.8776 0.9474 0.0333  0.1079  0.2357  90  ASP A CA  
720  C C   . ASP A 90  ? 1.0380 0.9488 1.0072 0.0061  0.0934  0.2335  90  ASP A C   
721  O O   . ASP A 90  ? 1.0220 0.9792 1.0063 0.0037  0.0814  0.2415  90  ASP A O   
722  C CB  . ASP A 90  ? 1.0217 0.9109 0.9551 0.0542  0.1182  0.2366  90  ASP A CB  
723  C CG  . ASP A 90  ? 1.1687 1.0215 1.0729 0.0844  0.1304  0.2379  90  ASP A CG  
724  O OD1 . ASP A 90  ? 1.1671 0.9693 1.0470 0.0917  0.1532  0.2291  90  ASP A OD1 
725  O OD2 . ASP A 90  ? 1.2844 1.1576 1.1898 0.1022  0.1176  0.2462  90  ASP A OD2 
726  N N   . LEU A 91  ? 1.0063 0.8938 0.9786 -0.0133 0.0940  0.2218  91  LEU A N   
727  C CA  . LEU A 91  ? 0.9999 0.9161 0.9898 -0.0374 0.0791  0.2166  91  LEU A CA  
728  C C   . LEU A 91  ? 1.0749 0.9933 1.0615 -0.0370 0.0930  0.2029  91  LEU A C   
729  O O   . LEU A 91  ? 1.0923 0.9737 1.0716 -0.0363 0.1103  0.1855  91  LEU A O   
730  C CB  . LEU A 91  ? 1.0043 0.8948 0.9987 -0.0570 0.0715  0.2063  91  LEU A CB  
731  C CG  . LEU A 91  ? 1.0189 0.9435 1.0296 -0.0795 0.0465  0.2081  91  LEU A CG  
732  C CD1 . LEU A 91  ? 0.9986 0.9711 1.0216 -0.0750 0.0304  0.2298  91  LEU A CD1 
733  C CD2 . LEU A 91  ? 1.0264 0.9287 1.0413 -0.0963 0.0345  0.2023  91  LEU A CD2 
734  N N   . VAL A 92  ? 1.0185 0.9790 1.0121 -0.0367 0.0860  0.2101  92  VAL A N   
735  C CA  . VAL A 92  ? 1.0207 0.9876 1.0109 -0.0328 0.0976  0.1991  92  VAL A CA  
736  C C   . VAL A 92  ? 1.0728 1.0541 1.0704 -0.0503 0.0850  0.1897  92  VAL A C   
737  O O   . VAL A 92  ? 1.0767 1.0858 1.0822 -0.0609 0.0676  0.2013  92  VAL A O   
738  C CB  . VAL A 92  ? 1.0586 1.0596 1.0482 -0.0180 0.1001  0.2127  92  VAL A CB  
739  C CG1 . VAL A 92  ? 1.0460 1.0622 1.0347 -0.0161 0.1066  0.2047  92  VAL A CG1 
740  C CG2 . VAL A 92  ? 1.0666 1.0495 1.0431 0.0031  0.1134  0.2169  92  VAL A CG2 
741  N N   . VAL A 93  ? 1.0273 0.9892 1.0225 -0.0513 0.0941  0.1678  93  VAL A N   
742  C CA  . VAL A 93  ? 1.0287 1.0010 1.0262 -0.0632 0.0817  0.1550  93  VAL A CA  
743  C C   . VAL A 93  ? 1.0735 1.0718 1.0669 -0.0509 0.0869  0.1579  93  VAL A C   
744  O O   . VAL A 93  ? 1.0785 1.0674 1.0700 -0.0367 0.1031  0.1492  93  VAL A O   
745  C CB  . VAL A 93  ? 1.1004 1.0362 1.1002 -0.0700 0.0859  0.1245  93  VAL A CB  
746  C CG1 . VAL A 93  ? 1.1075 1.0272 1.1082 -0.0544 0.1069  0.1066  93  VAL A CG1 
747  C CG2 . VAL A 93  ? 1.0980 1.0409 1.0971 -0.0832 0.0674  0.1105  93  VAL A CG2 
748  N N   . THR A 94  ? 1.0121 1.0417 1.0045 -0.0559 0.0744  0.1707  94  THR A N   
749  C CA  . THR A 94  ? 0.9886 1.0421 0.9755 -0.0441 0.0798  0.1752  94  THR A CA  
750  C C   . THR A 94  ? 1.0377 1.0840 1.0157 -0.0450 0.0741  0.1555  94  THR A C   
751  O O   . THR A 94  ? 1.0452 1.0687 1.0231 -0.0550 0.0660  0.1368  94  THR A O   
752  C CB  . THR A 94  ? 0.9595 1.0487 0.9506 -0.0468 0.0737  0.2003  94  THR A CB  
753  O OG1 . THR A 94  ? 0.9235 1.0161 0.9177 -0.0643 0.0571  0.2044  94  THR A OG1 
754  C CG2 . THR A 94  ? 0.8633 0.9621 0.8628 -0.0391 0.0797  0.2155  94  THR A CG2 
755  N N   . GLU A 95  ? 0.9869 1.0504 0.9570 -0.0328 0.0785  0.1581  95  GLU A N   
756  C CA  . GLU A 95  ? 0.9913 1.0486 0.9480 -0.0277 0.0728  0.1405  95  GLU A CA  
757  C C   . GLU A 95  ? 1.0451 1.0732 1.0050 -0.0211 0.0754  0.1079  95  GLU A C   
758  O O   . GLU A 95  ? 1.0413 1.0542 0.9931 -0.0234 0.0644  0.0860  95  GLU A O   
759  C CB  . GLU A 95  ? 1.0075 1.0676 0.9536 -0.0427 0.0560  0.1440  95  GLU A CB  
760  C CG  . GLU A 95  ? 1.1030 1.1928 1.0477 -0.0476 0.0552  0.1730  95  GLU A CG  
761  C CD  . GLU A 95  ? 1.2854 1.3753 1.2178 -0.0612 0.0402  0.1746  95  GLU A CD  
762  O OE1 . GLU A 95  ? 1.0943 1.1609 1.0138 -0.0637 0.0295  0.1513  95  GLU A OE1 
763  O OE2 . GLU A 95  ? 1.1654 1.2784 1.1024 -0.0693 0.0391  0.1973  95  GLU A OE2 
764  N N   . MET A 96  ? 1.0130 1.0320 0.9849 -0.0123 0.0903  0.1023  96  MET A N   
765  C CA  . MET A 96  ? 1.0195 1.0098 1.0014 -0.0067 0.0962  0.0694  96  MET A CA  
766  C C   . MET A 96  ? 1.0959 1.0867 1.0745 0.0124  0.0960  0.0466  96  MET A C   
767  O O   . MET A 96  ? 1.1250 1.1010 1.0991 0.0113  0.0841  0.0214  96  MET A O   
768  C CB  . MET A 96  ? 1.0384 1.0140 1.0333 -0.0029 0.1146  0.0690  96  MET A CB  
769  C CG  . MET A 96  ? 1.0692 1.0260 1.0677 -0.0199 0.1137  0.0751  96  MET A CG  
770  S SD  . MET A 96  ? 1.1162 1.0427 1.1210 -0.0360 0.1019  0.0431  96  MET A SD  
771  C CE  . MET A 96  ? 1.0778 0.9677 1.1021 -0.0266 0.1258  0.0109  96  MET A CE  
772  N N   . TYR A 97  ? 0.9945 1.0017 0.9745 0.0312  0.1072  0.0533  97  TYR A N   
773  C CA  . TYR A 97  ? 0.9787 0.9838 0.9579 0.0517  0.1055  0.0282  97  TYR A CA  
774  C C   . TYR A 97  ? 0.9977 1.0274 0.9594 0.0685  0.1029  0.0427  97  TYR A C   
775  O O   . TYR A 97  ? 0.9756 1.0002 0.9237 0.0810  0.0932  0.0261  97  TYR A O   
776  C CB  . TYR A 97  ? 0.9895 0.9842 0.9913 0.0651  0.1212  0.0079  97  TYR A CB  
777  C CG  . TYR A 97  ? 1.0270 0.9899 1.0473 0.0530  0.1271  -0.0158 97  TYR A CG  
778  C CD1 . TYR A 97  ? 1.0733 1.0137 1.1019 0.0524  0.1187  -0.0530 97  TYR A CD1 
779  C CD2 . TYR A 97  ? 1.0360 0.9881 1.0650 0.0445  0.1427  -0.0040 97  TYR A CD2 
780  C CE1 . TYR A 97  ? 1.1147 1.0240 1.1635 0.0409  0.1266  -0.0776 97  TYR A CE1 
781  C CE2 . TYR A 97  ? 1.0549 0.9731 1.1001 0.0345  0.1519  -0.0261 97  TYR A CE2 
782  C CZ  . TYR A 97  ? 1.1726 1.0701 1.2295 0.0314  0.1444  -0.0627 97  TYR A CZ  
783  O OH  . TYR A 97  ? 1.1254 0.9883 1.2009 0.0208  0.1556  -0.0863 97  TYR A OH  
784  N N   . ASP A 98  ? 0.9410 0.9943 0.9032 0.0718  0.1127  0.0700  98  ASP A N   
785  C CA  . ASP A 98  ? 0.9366 1.0134 0.8874 0.0888  0.1150  0.0840  98  ASP A CA  
786  C C   . ASP A 98  ? 1.0118 1.1120 0.9541 0.0773  0.1167  0.1190  98  ASP A C   
787  O O   . ASP A 98  ? 1.0003 1.1012 0.9493 0.0595  0.1171  0.1323  98  ASP A O   
788  C CB  . ASP A 98  ? 0.9517 1.0362 0.9186 0.1071  0.1273  0.0770  98  ASP A CB  
789  C CG  . ASP A 98  ? 1.0618 1.1243 1.0487 0.1176  0.1306  0.0406  98  ASP A CG  
790  O OD1 . ASP A 98  ? 1.0890 1.1370 1.0736 0.1257  0.1212  0.0146  98  ASP A OD1 
791  O OD2 . ASP A 98  ? 1.0689 1.1280 1.0739 0.1192  0.1434  0.0368  98  ASP A OD2 
792  N N   . THR A 99  ? 1.0062 1.1250 0.9353 0.0892  0.1186  0.1325  99  THR A N   
793  C CA  . THR A 99  ? 1.0172 1.1601 0.9424 0.0807  0.1229  0.1626  99  THR A CA  
794  C C   . THR A 99  ? 1.1190 1.2839 1.0519 0.0945  0.1335  0.1720  99  THR A C   
795  O O   . THR A 99  ? 1.1040 1.2724 1.0323 0.1152  0.1357  0.1635  99  THR A O   
796  C CB  . THR A 99  ? 1.0947 1.2390 0.9979 0.0808  0.1191  0.1716  99  THR A CB  
797  O OG1 . THR A 99  ? 1.1268 1.2514 1.0231 0.0665  0.1078  0.1624  99  THR A OG1 
798  C CG2 . THR A 99  ? 1.0668 1.2362 0.9710 0.0720  0.1265  0.2002  99  THR A CG2 
799  N N   . PRO A 100 ? 1.1161 1.2958 1.0603 0.0850  0.1387  0.1879  100 PRO A N   
800  C CA  . PRO A 100 ? 1.1188 1.3201 1.0679 0.0973  0.1472  0.1961  100 PRO A CA  
801  C C   . PRO A 100 ? 1.2025 1.4283 1.1438 0.1001  0.1505  0.2148  100 PRO A C   
802  O O   . PRO A 100 ? 1.1957 1.4214 1.1298 0.0899  0.1485  0.2240  100 PRO A O   
803  C CB  . PRO A 100 ? 1.1324 1.3344 1.0921 0.0873  0.1500  0.2024  100 PRO A CB  
804  C CG  . PRO A 100 ? 1.1890 1.3729 1.1507 0.0691  0.1431  0.2013  100 PRO A CG  
805  C CD  . PRO A 100 ? 1.1359 1.3140 1.0877 0.0650  0.1358  0.1981  100 PRO A CD  
806  N N   . THR A 101 ? 1.1865 1.4323 1.1294 0.1140  0.1566  0.2196  101 THR A N   
807  C CA  . THR A 101 ? 1.1968 1.4656 1.1345 0.1168  0.1622  0.2365  101 THR A CA  
808  C C   . THR A 101 ? 1.2530 1.5436 1.2038 0.1071  0.1659  0.2488  101 THR A C   
809  O O   . THR A 101 ? 1.2403 1.5330 1.1984 0.1099  0.1656  0.2439  101 THR A O   
810  C CB  . THR A 101 ? 1.3383 1.6149 1.2675 0.1395  0.1650  0.2333  101 THR A CB  
811  O OG1 . THR A 101 ? 1.3438 1.6232 1.2828 0.1513  0.1641  0.2215  101 THR A OG1 
812  C CG2 . THR A 101 ? 1.3387 1.5952 1.2498 0.1511  0.1617  0.2241  101 THR A CG2 
813  N N   . LEU A 102 ? 1.2129 1.5172 1.1669 0.0964  0.1699  0.2628  102 LEU A N   
814  C CA  . LEU A 102 ? 1.2023 1.5280 1.1723 0.0882  0.1723  0.2705  102 LEU A CA  
815  C C   . LEU A 102 ? 1.2619 1.6131 1.2352 0.0922  0.1816  0.2802  102 LEU A C   
816  O O   . LEU A 102 ? 1.2445 1.6006 1.2196 0.0848  0.1886  0.2892  102 LEU A O   
817  C CB  . LEU A 102 ? 1.1960 1.5173 1.1775 0.0703  0.1682  0.2742  102 LEU A CB  
818  C CG  . LEU A 102 ? 1.2283 1.5716 1.2303 0.0633  0.1691  0.2792  102 LEU A CG  
819  C CD1 . LEU A 102 ? 1.2209 1.5660 1.2244 0.0722  0.1656  0.2716  102 LEU A CD1 
820  C CD2 . LEU A 102 ? 1.2367 1.5768 1.2517 0.0477  0.1643  0.2829  102 LEU A CD2 
821  N N   . SER A 103 ? 1.2451 1.6115 1.2194 0.1037  0.1824  0.2776  103 SER A N   
822  C CA  . SER A 103 ? 1.2507 1.6429 1.2302 0.1072  0.1902  0.2846  103 SER A CA  
823  C C   . SER A 103 ? 1.3583 1.7700 1.3566 0.0995  0.1892  0.2829  103 SER A C   
824  O O   . SER A 103 ? 1.3743 1.7778 1.3765 0.0966  0.1818  0.2765  103 SER A O   
825  C CB  . SER A 103 ? 1.2659 1.6658 1.2352 0.1255  0.1900  0.2820  103 SER A CB  
826  O OG  . SER A 103 ? 1.2898 1.6835 1.2575 0.1331  0.1823  0.2716  103 SER A OG  
827  N N   . VAL A 104 ? 1.3350 1.7701 1.3450 0.0973  0.1972  0.2871  104 VAL A N   
828  C CA  . VAL A 104 ? 1.3358 1.7914 1.3662 0.0925  0.1960  0.2813  104 VAL A CA  
829  C C   . VAL A 104 ? 1.4410 1.9209 1.4729 0.1011  0.1991  0.2786  104 VAL A C   
830  O O   . VAL A 104 ? 1.4407 1.9255 1.4656 0.1053  0.2074  0.2859  104 VAL A O   
831  C CB  . VAL A 104 ? 1.3714 1.8322 1.4247 0.0773  0.2020  0.2842  104 VAL A CB  
832  C CG1 . VAL A 104 ? 1.3623 1.8259 1.4170 0.0721  0.2180  0.2945  104 VAL A CG1 
833  C CG2 . VAL A 104 ? 1.3533 1.8356 1.4317 0.0756  0.1989  0.2733  104 VAL A CG2 
834  N N   . HIS A 105 ? 1.4370 1.9298 1.4746 0.1057  0.1915  0.2675  105 HIS A N   
835  C CA  . HIS A 105 ? 1.4447 1.9619 1.4835 0.1135  0.1911  0.2617  105 HIS A CA  
836  C C   . HIS A 105 ? 1.4844 2.0214 1.5474 0.1084  0.1906  0.2494  105 HIS A C   
837  O O   . HIS A 105 ? 1.4858 2.0156 1.5526 0.1096  0.1820  0.2401  105 HIS A O   
838  C CB  . HIS A 105 ? 1.4731 1.9846 1.4906 0.1278  0.1805  0.2560  105 HIS A CB  
839  C CG  . HIS A 105 ? 1.5113 2.0471 1.5257 0.1370  0.1769  0.2497  105 HIS A CG  
840  N ND1 . HIS A 105 ? 1.5368 2.0764 1.5441 0.1450  0.1669  0.2360  105 HIS A ND1 
841  C CD2 . HIS A 105 ? 1.5320 2.0864 1.5456 0.1410  0.1812  0.2553  105 HIS A CD2 
842  C CE1 . HIS A 105 ? 1.5252 2.0880 1.5295 0.1516  0.1645  0.2330  105 HIS A CE1 
843  N NE2 . HIS A 105 ? 1.5191 2.0926 1.5284 0.1491  0.1727  0.2448  105 HIS A NE2 
844  N N   . PRO A 106 ? 1.4234 1.9835 1.5048 0.1037  0.2003  0.2476  106 PRO A N   
845  C CA  . PRO A 106 ? 1.4219 1.9896 1.4986 0.1039  0.2123  0.2586  106 PRO A CA  
846  C C   . PRO A 106 ? 1.4843 2.0379 1.5640 0.0944  0.2284  0.2732  106 PRO A C   
847  O O   . PRO A 106 ? 1.4884 2.0329 1.5488 0.1004  0.2345  0.2852  106 PRO A O   
848  C CB  . PRO A 106 ? 1.4288 2.0258 1.5249 0.1031  0.2151  0.2457  106 PRO A CB  
849  C CG  . PRO A 106 ? 1.4748 2.0789 1.5973 0.0977  0.2109  0.2288  106 PRO A CG  
850  C CD  . PRO A 106 ? 1.4281 2.0086 1.5381 0.1001  0.1998  0.2308  106 PRO A CD  
851  N N   . GLY A 107 ? 1.4397 1.9908 1.5416 0.0818  0.2347  0.2715  107 GLY A N   
852  C CA  . GLY A 107 ? 1.4421 1.9784 1.5454 0.0724  0.2509  0.2846  107 GLY A CA  
853  C C   . GLY A 107 ? 1.4887 2.0131 1.6049 0.0613  0.2491  0.2853  107 GLY A C   
854  O O   . GLY A 107 ? 1.4734 2.0035 1.6033 0.0607  0.2359  0.2744  107 GLY A O   
855  N N   . PRO A 108 ? 1.4543 1.9610 1.5649 0.0537  0.2621  0.2978  108 PRO A N   
856  C CA  . PRO A 108 ? 1.4529 1.9487 1.5745 0.0424  0.2588  0.2996  108 PRO A CA  
857  C C   . PRO A 108 ? 1.4807 1.9981 1.6469 0.0319  0.2616  0.2888  108 PRO A C   
858  O O   . PRO A 108 ? 1.4795 1.9938 1.6574 0.0265  0.2509  0.2865  108 PRO A O   
859  C CB  . PRO A 108 ? 1.4883 1.9604 1.5893 0.0389  0.2738  0.3144  108 PRO A CB  
860  C CG  . PRO A 108 ? 1.5583 2.0223 1.6284 0.0534  0.2785  0.3203  108 PRO A CG  
861  C CD  . PRO A 108 ? 1.4864 1.9786 1.5744 0.0576  0.2789  0.3111  108 PRO A CD  
862  N N   . GLU A 109 ? 1.4063 1.9456 1.5990 0.0298  0.2760  0.2809  109 GLU A N   
863  C CA  . GLU A 109 ? 1.3726 1.9365 1.6140 0.0227  0.2799  0.2651  109 GLU A CA  
864  C C   . GLU A 109 ? 1.4147 2.0023 1.6725 0.0279  0.2855  0.2502  109 GLU A C   
865  O O   . GLU A 109 ? 1.4042 1.9899 1.6495 0.0285  0.3012  0.2572  109 GLU A O   
866  C CB  . GLU A 109 ? 1.3786 1.9395 1.6449 0.0082  0.3000  0.2714  109 GLU A CB  
867  C CG  . GLU A 109 ? 1.4574 2.0104 1.7305 0.0019  0.2873  0.2748  109 GLU A CG  
868  C CD  . GLU A 109 ? 1.6120 2.1597 1.9045 -0.0125 0.3057  0.2832  109 GLU A CD  
869  O OE1 . GLU A 109 ? 1.3780 1.9053 1.6457 -0.0159 0.3250  0.2978  109 GLU A OE1 
870  O OE2 . GLU A 109 ? 1.4870 2.0497 1.8183 -0.0188 0.3007  0.2749  109 GLU A OE2 
871  N N   . VAL A 110 ? 1.3696 1.9778 1.6516 0.0339  0.2709  0.2286  110 VAL A N   
872  C CA  . VAL A 110 ? 1.3631 1.9943 1.6582 0.0407  0.2707  0.2098  110 VAL A CA  
873  C C   . VAL A 110 ? 1.3757 2.0335 1.7236 0.0404  0.2695  0.1815  110 VAL A C   
874  O O   . VAL A 110 ? 1.3654 2.0243 1.7387 0.0374  0.2655  0.1772  110 VAL A O   
875  C CB  . VAL A 110 ? 1.4388 2.0643 1.6939 0.0559  0.2489  0.2090  110 VAL A CB  
876  C CG1 . VAL A 110 ? 1.4341 2.0589 1.6905 0.0661  0.2262  0.1946  110 VAL A CG1 
877  C CG2 . VAL A 110 ? 1.4345 2.0777 1.6858 0.0618  0.2510  0.1993  110 VAL A CG2 
878  N N   . ILE A 111 ? 1.2977 1.9778 1.6632 0.0447  0.2720  0.1604  111 ILE A N   
879  C CA  . ILE A 111 ? 1.2575 1.9644 1.6721 0.0487  0.2685  0.1267  111 ILE A CA  
880  C C   . ILE A 111 ? 1.2894 1.9950 1.6901 0.0669  0.2385  0.1119  111 ILE A C   
881  O O   . ILE A 111 ? 1.2998 1.9910 1.6531 0.0769  0.2233  0.1209  111 ILE A O   
882  C CB  . ILE A 111 ? 1.2800 2.0077 1.7096 0.0486  0.2784  0.1082  111 ILE A CB  
883  N N   . SER A 112 ? 1.2150 1.9338 1.6565 0.0727  0.2309  0.0888  112 SER A N   
884  C CA  . SER A 112 ? 1.2139 1.9283 1.6431 0.0934  0.2037  0.0724  112 SER A CA  
885  C C   . SER A 112 ? 1.2682 1.9862 1.6688 0.1112  0.1876  0.0528  112 SER A C   
886  O O   . SER A 112 ? 1.2540 1.9907 1.6674 0.1084  0.1956  0.0381  112 SER A O   
887  C CB  . SER A 112 ? 1.2202 1.9526 1.7051 0.0994  0.1996  0.0467  112 SER A CB  
888  O OG  . SER A 112 ? 1.3000 2.0239 1.7684 0.1231  0.1734  0.0314  112 SER A OG  
889  N N   . GLY A 113 ? 1.2280 1.9257 1.5881 0.1289  0.1663  0.0532  113 GLY A N   
890  C CA  . GLY A 113 ? 1.2257 1.9205 1.5505 0.1482  0.1496  0.0361  113 GLY A CA  
891  C C   . GLY A 113 ? 1.2661 1.9480 1.5422 0.1439  0.1517  0.0592  113 GLY A C   
892  O O   . GLY A 113 ? 1.2700 1.9481 1.5127 0.1591  0.1382  0.0479  113 GLY A O   
893  N N   . GLU A 114 ? 1.2133 1.8883 1.4847 0.1250  0.1681  0.0901  114 GLU A N   
894  C CA  . GLU A 114 ? 1.2211 1.8845 1.4508 0.1221  0.1707  0.1130  114 GLU A CA  
895  C C   . GLU A 114 ? 1.2637 1.8958 1.4513 0.1315  0.1587  0.1272  114 GLU A C   
896  O O   . GLU A 114 ? 1.2561 1.8726 1.4486 0.1306  0.1564  0.1329  114 GLU A O   
897  C CB  . GLU A 114 ? 1.2367 1.9010 1.4763 0.1026  0.1927  0.1376  114 GLU A CB  
898  C CG  . GLU A 114 ? 1.3742 2.0349 1.5800 0.1025  0.1960  0.1549  114 GLU A CG  
899  C CD  . GLU A 114 ? 1.5870 2.2675 1.8111 0.0929  0.2134  0.1556  114 GLU A CD  
900  O OE1 . GLU A 114 ? 1.4666 2.1376 1.6736 0.0875  0.2253  0.1790  114 GLU A OE1 
901  O OE2 . GLU A 114 ? 1.4863 2.1903 1.7414 0.0922  0.2156  0.1314  114 GLU A OE2 
902  N N   . LYS A 115 ? 1.2268 1.8498 1.3749 0.1405  0.1517  0.1320  115 LYS A N   
903  C CA  . LYS A 115 ? 1.2448 1.8362 1.3536 0.1494  0.1436  0.1438  115 LYS A CA  
904  C C   . LYS A 115 ? 1.3125 1.8887 1.4146 0.1355  0.1548  0.1723  115 LYS A C   
905  O O   . LYS A 115 ? 1.3191 1.9027 1.4151 0.1296  0.1630  0.1850  115 LYS A O   
906  C CB  . LYS A 115 ? 1.2804 1.8675 1.3516 0.1651  0.1332  0.1364  115 LYS A CB  
907  C CG  . LYS A 115 ? 1.3708 1.9839 1.4499 0.1740  0.1254  0.1100  115 LYS A CG  
908  C CD  . LYS A 115 ? 1.3975 2.0337 1.4735 0.1681  0.1297  0.1153  115 LYS A CD  
909  C CE  . LYS A 115 ? 1.3653 2.0217 1.4745 0.1491  0.1468  0.1273  115 LYS A CE  
910  N NZ  . LYS A 115 ? 1.3745 2.0526 1.5272 0.1434  0.1516  0.1058  115 LYS A NZ  
911  N N   . VAL A 116 ? 1.2549 1.8102 1.3593 0.1314  0.1544  0.1806  116 VAL A N   
912  C CA  . VAL A 116 ? 1.2460 1.7839 1.3434 0.1194  0.1625  0.2031  116 VAL A CA  
913  C C   . VAL A 116 ? 1.2850 1.7912 1.3490 0.1277  0.1555  0.2086  116 VAL A C   
914  O O   . VAL A 116 ? 1.2901 1.7810 1.3453 0.1379  0.1465  0.1989  116 VAL A O   
915  C CB  . VAL A 116 ? 1.2849 1.8253 1.4135 0.1051  0.1691  0.2085  116 VAL A CB  
916  C CG1 . VAL A 116 ? 1.2970 1.8103 1.4112 0.0974  0.1700  0.2259  116 VAL A CG1 
917  C CG2 . VAL A 116 ? 1.2648 1.8288 1.4203 0.0931  0.1845  0.2113  116 VAL A CG2 
918  N N   . THR A 117 ? 1.2252 1.7206 1.2704 0.1256  0.1602  0.2221  117 THR A N   
919  C CA  . THR A 117 ? 1.2291 1.6937 1.2475 0.1320  0.1568  0.2258  117 THR A CA  
920  C C   . THR A 117 ? 1.2343 1.6862 1.2523 0.1213  0.1635  0.2405  117 THR A C   
921  O O   . THR A 117 ? 1.2177 1.6794 1.2336 0.1204  0.1692  0.2478  117 THR A O   
922  C CB  . THR A 117 ? 1.3756 1.8372 1.3681 0.1474  0.1530  0.2192  117 THR A CB  
923  O OG1 . THR A 117 ? 1.4368 1.9137 1.4276 0.1467  0.1577  0.2269  117 THR A OG1 
924  C CG2 . THR A 117 ? 1.3257 1.8004 1.3148 0.1593  0.1452  0.2021  117 THR A CG2 
925  N N   . PHE A 118 ? 1.3525 1.5351 1.0953 0.0897  0.1203  -0.0184 118 PHE A N   
926  C CA  . PHE A 118 ? 1.3415 1.5206 1.0776 0.0800  0.1180  -0.0006 118 PHE A CA  
927  C C   . PHE A 118 ? 1.3841 1.5455 1.0936 0.0806  0.1066  -0.0010 118 PHE A C   
928  O O   . PHE A 118 ? 1.3809 1.5299 1.0865 0.0852  0.0982  -0.0096 118 PHE A O   
929  C CB  . PHE A 118 ? 1.3494 1.5289 1.1118 0.0757  0.1141  0.0084  118 PHE A CB  
930  C CG  . PHE A 118 ? 1.3428 1.5396 1.1320 0.0714  0.1224  0.0169  118 PHE A CG  
931  C CD1 . PHE A 118 ? 1.3750 1.5753 1.1573 0.0617  0.1257  0.0309  118 PHE A CD1 
932  C CD2 . PHE A 118 ? 1.3434 1.5505 1.1652 0.0780  0.1254  0.0108  118 PHE A CD2 
933  C CE1 . PHE A 118 ? 1.3658 1.5809 1.1734 0.0567  0.1322  0.0400  118 PHE A CE1 
934  C CE2 . PHE A 118 ? 1.3604 1.5842 1.2117 0.0745  0.1317  0.0191  118 PHE A CE2 
935  C CZ  . PHE A 118 ? 1.3348 1.5630 1.1790 0.0628  0.1351  0.0344  118 PHE A CZ  
936  N N   . TYR A 119 ? 1.3332 1.4910 1.0246 0.0765  0.1055  0.0078  119 TYR A N   
937  C CA  . TYR A 119 ? 1.3416 1.4819 1.0123 0.0785  0.0936  0.0069  119 TYR A CA  
938  C C   . TYR A 119 ? 1.3915 1.5212 1.0643 0.0704  0.0877  0.0177  119 TYR A C   
939  O O   . TYR A 119 ? 1.3798 1.5149 1.0569 0.0642  0.0923  0.0272  119 TYR A O   
940  C CB  . TYR A 119 ? 1.3622 1.5039 1.0070 0.0859  0.0931  0.0021  119 TYR A CB  
941  C CG  . TYR A 119 ? 1.3852 1.5341 1.0254 0.0948  0.0920  -0.0134 119 TYR A CG  
942  C CD1 . TYR A 119 ? 1.4003 1.5681 1.0484 0.0965  0.1039  -0.0202 119 TYR A CD1 
943  C CD2 . TYR A 119 ? 1.4064 1.5433 1.0344 0.1017  0.0780  -0.0227 119 TYR A CD2 
944  C CE1 . TYR A 119 ? 1.4003 1.5744 1.0439 0.1050  0.1006  -0.0383 119 TYR A CE1 
945  C CE2 . TYR A 119 ? 1.4231 1.5653 1.0451 0.1100  0.0734  -0.0389 119 TYR A CE2 
946  C CZ  . TYR A 119 ? 1.4981 1.6590 1.1274 0.1118  0.0841  -0.0478 119 TYR A CZ  
947  O OH  . TYR A 119 ? 1.4878 1.6536 1.1118 0.1201  0.0773  -0.0675 119 TYR A OH  
948  N N   . CYS A 120 ? 1.3543 1.4681 1.0254 0.0700  0.0767  0.0150  120 CYS A N   
949  C CA  . CYS A 120 ? 1.3534 1.4560 1.0287 0.0626  0.0691  0.0206  120 CYS A CA  
950  C C   . CYS A 120 ? 1.4222 1.5055 1.0841 0.0663  0.0582  0.0152  120 CYS A C   
951  O O   . CYS A 120 ? 1.4220 1.4983 1.0858 0.0686  0.0541  0.0089  120 CYS A O   
952  C CB  . CYS A 120 ? 1.3459 1.4533 1.0473 0.0553  0.0680  0.0228  120 CYS A CB  
953  S SG  . CYS A 120 ? 1.3967 1.4973 1.1079 0.0447  0.0580  0.0276  120 CYS A SG  
954  N N   . ARG A 121 ? 1.3845 1.4570 1.0326 0.0676  0.0529  0.0172  121 ARG A N   
955  C CA  . ARG A 121 ? 1.3854 1.4384 1.0231 0.0738  0.0413  0.0107  121 ARG A CA  
956  C C   . ARG A 121 ? 1.4061 1.4444 1.0534 0.0665  0.0326  0.0095  121 ARG A C   
957  O O   . ARG A 121 ? 1.4025 1.4438 1.0536 0.0591  0.0334  0.0149  121 ARG A O   
958  C CB  . ARG A 121 ? 1.4215 1.4708 1.0330 0.0860  0.0399  0.0102  121 ARG A CB  
959  C CG  . ARG A 121 ? 1.6380 1.6736 1.2407 0.0987  0.0277  0.0014  121 ARG A CG  
960  C CD  . ARG A 121 ? 1.8573 1.8833 1.4356 0.1123  0.0221  0.0005  121 ARG A CD  
961  N NE  . ARG A 121 ? 2.0704 2.1138 1.6308 0.1166  0.0332  0.0054  121 ARG A NE  
962  C CZ  . ARG A 121 ? 2.3567 2.3946 1.8919 0.1263  0.0333  0.0078  121 ARG A CZ  
963  N NH1 . ARG A 121 ? 2.2404 2.2966 1.7613 0.1282  0.0460  0.0120  121 ARG A NH1 
964  N NH2 . ARG A 121 ? 2.2398 2.2526 1.7638 0.1348  0.0211  0.0049  121 ARG A NH2 
965  N N   . LEU A 122 ? 1.3379 1.3602 0.9905 0.0686  0.0230  0.0012  122 LEU A N   
966  C CA  . LEU A 122 ? 1.3162 1.3214 0.9800 0.0636  0.0126  -0.0057 122 LEU A CA  
967  C C   . LEU A 122 ? 1.3766 1.3686 1.0484 0.0677  0.0063  -0.0148 122 LEU A C   
968  O O   . LEU A 122 ? 1.3601 1.3568 1.0468 0.0606  0.0105  -0.0152 122 LEU A O   
969  C CB  . LEU A 122 ? 1.2938 1.3077 0.9794 0.0486  0.0135  -0.0041 122 LEU A CB  
970  C CG  . LEU A 122 ? 1.3280 1.3275 1.0301 0.0416  0.0021  -0.0152 122 LEU A CG  
971  C CD1 . LEU A 122 ? 1.3435 1.3224 1.0319 0.0470  -0.0098 -0.0217 122 LEU A CD1 
972  C CD2 . LEU A 122 ? 1.3035 1.3181 1.0280 0.0281  0.0025  -0.0139 122 LEU A CD2 
973  N N   . ASP A 123 ? 1.3660 1.3399 1.0278 0.0801  -0.0041 -0.0220 123 ASP A N   
974  C CA  . ASP A 123 ? 1.3774 1.3362 1.0508 0.0854  -0.0126 -0.0318 123 ASP A CA  
975  C C   . ASP A 123 ? 1.4335 1.3812 1.1293 0.0739  -0.0169 -0.0405 123 ASP A C   
976  O O   . ASP A 123 ? 1.4510 1.4022 1.1479 0.0656  -0.0166 -0.0393 123 ASP A O   
977  C CB  . ASP A 123 ? 1.4205 1.3638 1.0788 0.1052  -0.0247 -0.0380 123 ASP A CB  
978  C CG  . ASP A 123 ? 1.6647 1.5978 1.3040 0.1115  -0.0290 -0.0382 123 ASP A CG  
979  O OD1 . ASP A 123 ? 1.6907 1.6374 1.3098 0.1118  -0.0204 -0.0279 123 ASP A OD1 
980  O OD2 . ASP A 123 ? 1.7659 1.6755 1.4099 0.1163  -0.0409 -0.0497 123 ASP A OD2 
981  N N   . THR A 124 ? 1.3593 1.2946 1.0745 0.0727  -0.0216 -0.0502 124 THR A N   
982  C CA  . THR A 124 ? 1.3372 1.2639 1.0771 0.0609  -0.0250 -0.0615 124 THR A CA  
983  C C   . THR A 124 ? 1.3700 1.3174 1.1211 0.0428  -0.0139 -0.0545 124 THR A C   
984  O O   . THR A 124 ? 1.3689 1.3184 1.1324 0.0331  -0.0174 -0.0605 124 THR A O   
985  C CB  . THR A 124 ? 1.3361 1.2428 1.0738 0.0673  -0.0393 -0.0747 124 THR A CB  
986  O OG1 . THR A 124 ? 1.2252 1.1405 0.9504 0.0611  -0.0385 -0.0685 124 THR A OG1 
987  C CG2 . THR A 124 ? 1.3703 1.2568 1.0921 0.0896  -0.0507 -0.0802 124 THR A CG2 
988  N N   . ALA A 125 ? 1.3018 1.2636 1.0480 0.0402  -0.0025 -0.0432 125 ALA A N   
989  C CA  . ALA A 125 ? 1.2709 1.2511 1.0258 0.0277  0.0079  -0.0359 125 ALA A CA  
990  C C   . ALA A 125 ? 1.2949 1.2736 1.0485 0.0268  0.0161  -0.0319 125 ALA A C   
991  O O   . ALA A 125 ? 1.3096 1.2745 1.0576 0.0347  0.0120  -0.0348 125 ALA A O   
992  C CB  . ALA A 125 ? 1.2749 1.2722 1.0156 0.0304  0.0121  -0.0249 125 ALA A CB  
993  N N   . THR A 126 ? 1.2043 1.1956 0.9620 0.0188  0.0259  -0.0255 126 THR A N   
994  C CA  . THR A 126 ? 1.1903 1.1758 0.9403 0.0187  0.0332  -0.0213 126 THR A CA  
995  C C   . THR A 126 ? 1.2558 1.2466 0.9836 0.0297  0.0342  -0.0148 126 THR A C   
996  O O   . THR A 126 ? 1.2466 1.2471 0.9671 0.0363  0.0315  -0.0128 126 THR A O   
997  C CB  . THR A 126 ? 1.1618 1.1531 0.9235 0.0073  0.0427  -0.0193 126 THR A CB  
998  O OG1 . THR A 126 ? 1.1004 1.1121 0.8659 0.0068  0.0453  -0.0142 126 THR A OG1 
999  C CG2 . THR A 126 ? 1.0740 1.0594 0.8583 -0.0044 0.0429  -0.0283 126 THR A CG2 
1000 N N   . SER A 127 ? 1.2433 1.2260 0.9594 0.0315  0.0379  -0.0127 127 SER A N   
1001 C CA  . SER A 127 ? 1.2562 1.2416 0.9521 0.0415  0.0377  -0.0106 127 SER A CA  
1002 C C   . SER A 127 ? 1.3176 1.3191 1.0151 0.0417  0.0455  -0.0063 127 SER A C   
1003 O O   . SER A 127 ? 1.3059 1.3139 0.9916 0.0503  0.0457  -0.0067 127 SER A O   
1004 C CB  . SER A 127 ? 1.3105 1.2768 0.9929 0.0428  0.0359  -0.0122 127 SER A CB  
1005 O OG  . SER A 127 ? 1.4637 1.4156 1.1499 0.0429  0.0280  -0.0159 127 SER A OG  
1006 N N   . MET A 128 ? 1.2836 1.2928 0.9987 0.0328  0.0507  -0.0039 128 MET A N   
1007 C CA  . MET A 128 ? 1.2759 1.3015 0.9992 0.0339  0.0559  -0.0001 128 MET A CA  
1008 C C   . MET A 128 ? 1.2850 1.3307 1.0217 0.0331  0.0535  0.0026  128 MET A C   
1009 O O   . MET A 128 ? 1.2747 1.3218 1.0220 0.0262  0.0486  0.0011  128 MET A O   
1010 C CB  . MET A 128 ? 1.3098 1.3338 1.0439 0.0270  0.0611  0.0009  128 MET A CB  
1011 C CG  . MET A 128 ? 1.3591 1.3949 1.0981 0.0334  0.0650  0.0036  128 MET A CG  
1012 S SD  . MET A 128 ? 1.4157 1.4577 1.1724 0.0264  0.0692  0.0049  128 MET A SD  
1013 C CE  . MET A 128 ? 1.3577 1.4263 1.1434 0.0186  0.0619  0.0048  128 MET A CE  
1014 N N   . PHE A 129 ? 1.2003 1.2591 0.9363 0.0403  0.0564  0.0054  129 PHE A N   
1015 C CA  . PHE A 129 ? 1.1680 1.2449 0.9145 0.0400  0.0555  0.0097  129 PHE A CA  
1016 C C   . PHE A 129 ? 1.1906 1.2838 0.9540 0.0436  0.0592  0.0126  129 PHE A C   
1017 O O   . PHE A 129 ? 1.1933 1.2813 0.9534 0.0503  0.0630  0.0099  129 PHE A O   
1018 C CB  . PHE A 129 ? 1.1866 1.2635 0.9155 0.0469  0.0563  0.0096  129 PHE A CB  
1019 C CG  . PHE A 129 ? 1.2036 1.2673 0.9187 0.0466  0.0501  0.0070  129 PHE A CG  
1020 C CD1 . PHE A 129 ? 1.2392 1.2857 0.9440 0.0487  0.0465  0.0016  129 PHE A CD1 
1021 C CD2 . PHE A 129 ? 1.2224 1.2888 0.9341 0.0458  0.0469  0.0095  129 PHE A CD2 
1022 C CE1 . PHE A 129 ? 1.2524 1.2867 0.9488 0.0512  0.0389  -0.0019 129 PHE A CE1 
1023 C CE2 . PHE A 129 ? 1.2631 1.3145 0.9615 0.0491  0.0398  0.0056  129 PHE A CE2 
1024 C CZ  . PHE A 129 ? 1.2412 1.2778 0.9343 0.0526  0.0354  -0.0005 129 PHE A CZ  
1025 N N   . LEU A 130 ? 1.1213 1.2323 0.9030 0.0403  0.0564  0.0174  130 LEU A N   
1026 C CA  . LEU A 130 ? 1.1036 1.2324 0.9072 0.0453  0.0576  0.0202  130 LEU A CA  
1027 C C   . LEU A 130 ? 1.1460 1.2902 0.9579 0.0475  0.0593  0.0253  130 LEU A C   
1028 O O   . LEU A 130 ? 1.1279 1.2734 0.9354 0.0406  0.0560  0.0292  130 LEU A O   
1029 C CB  . LEU A 130 ? 1.0930 1.2323 0.9194 0.0394  0.0506  0.0210  130 LEU A CB  
1030 C CG  . LEU A 130 ? 1.1631 1.2888 0.9831 0.0372  0.0522  0.0164  130 LEU A CG  
1031 C CD1 . LEU A 130 ? 1.1569 1.2779 0.9789 0.0244  0.0464  0.0132  130 LEU A CD1 
1032 C CD2 . LEU A 130 ? 1.2038 1.3370 1.0378 0.0450  0.0534  0.0162  130 LEU A CD2 
1033 N N   . LEU A 131 ? 1.1028 1.2558 0.9255 0.0576  0.0648  0.0241  131 LEU A N   
1034 C CA  . LEU A 131 ? 1.0945 1.2634 0.9305 0.0603  0.0689  0.0282  131 LEU A CA  
1035 C C   . LEU A 131 ? 1.1731 1.3607 1.0445 0.0641  0.0635  0.0312  131 LEU A C   
1036 O O   . LEU A 131 ? 1.1496 1.3363 1.0316 0.0737  0.0624  0.0261  131 LEU A O   
1037 C CB  . LEU A 131 ? 1.0929 1.2582 0.9185 0.0702  0.0786  0.0209  131 LEU A CB  
1038 C CG  . LEU A 131 ? 1.1391 1.3186 0.9717 0.0696  0.0862  0.0246  131 LEU A CG  
1039 C CD1 . LEU A 131 ? 1.1488 1.3205 0.9513 0.0643  0.0902  0.0259  131 LEU A CD1 
1040 C CD2 . LEU A 131 ? 1.1614 1.3477 1.0099 0.0820  0.0934  0.0153  131 LEU A CD2 
1041 N N   . LEU A 132 ? 1.1739 1.3770 1.0627 0.0577  0.0588  0.0394  132 LEU A N   
1042 C CA  . LEU A 132 ? 1.1790 1.4029 1.1052 0.0610  0.0498  0.0431  132 LEU A CA  
1043 C C   . LEU A 132 ? 1.3264 1.5666 1.2747 0.0632  0.0535  0.0490  132 LEU A C   
1044 O O   . LEU A 132 ? 1.3390 1.5773 1.2739 0.0539  0.0576  0.0554  132 LEU A O   
1045 C CB  . LEU A 132 ? 1.1645 1.3927 1.0959 0.0494  0.0350  0.0463  132 LEU A CB  
1046 C CG  . LEU A 132 ? 1.1843 1.4364 1.1540 0.0511  0.0206  0.0497  132 LEU A CG  
1047 C CD1 . LEU A 132 ? 1.1771 1.4322 1.1533 0.0486  0.0094  0.0447  132 LEU A CD1 
1048 C CD2 . LEU A 132 ? 1.2078 1.4676 1.1836 0.0402  0.0120  0.0579  132 LEU A CD2 
1049 N N   . LYS A 133 ? 1.3347 1.5900 1.3178 0.0760  0.0516  0.0470  133 LYS A N   
1050 C CA  . LYS A 133 ? 1.3481 1.6207 1.3609 0.0790  0.0544  0.0519  133 LYS A CA  
1051 C C   . LYS A 133 ? 1.4570 1.7507 1.5056 0.0765  0.0362  0.0601  133 LYS A C   
1052 O O   . LYS A 133 ? 1.4372 1.7435 1.5163 0.0891  0.0256  0.0564  133 LYS A O   
1053 C CB  . LYS A 133 ? 1.3705 1.6443 1.4014 0.0971  0.0637  0.0411  133 LYS A CB  
1054 C CG  . LYS A 133 ? 1.5496 1.8393 1.6116 0.0998  0.0709  0.0438  133 LYS A CG  
1055 C CD  . LYS A 133 ? 1.6534 1.9614 1.7670 0.1159  0.0598  0.0418  133 LYS A CD  
1056 C CE  . LYS A 133 ? 1.7392 2.0609 1.8893 0.1225  0.0684  0.0402  133 LYS A CE  
1057 N NZ  . LYS A 133 ? 1.8098 2.1193 1.9546 0.1355  0.0829  0.0225  133 LYS A NZ  
1058 N N   . GLU A 134 ? 1.6092 1.4057 1.7504 0.1104  -0.0433 0.2607  134 GLU A N   
1059 C CA  . GLU A 134 ? 1.6422 1.3858 1.8306 0.1166  -0.0420 0.2517  134 GLU A CA  
1060 C C   . GLU A 134 ? 1.7868 1.4533 1.9587 0.0991  -0.0786 0.2317  134 GLU A C   
1061 O O   . GLU A 134 ? 1.7804 1.4666 1.9545 0.0759  -0.1182 0.2581  134 GLU A O   
1062 C CB  . GLU A 134 ? 1.6024 1.4158 1.9038 0.1155  -0.0431 0.3021  134 GLU A CB  
1063 C CG  . GLU A 134 ? 1.7312 1.6069 2.0502 0.1271  -0.0035 0.3223  134 GLU A CG  
1064 C CD  . GLU A 134 ? 1.8712 1.8229 2.3086 0.1203  0.0022  0.3750  134 GLU A CD  
1065 O OE1 . GLU A 134 ? 1.8889 1.8384 2.3571 0.1312  0.0386  0.3864  134 GLU A OE1 
1066 O OE2 . GLU A 134 ? 1.6092 1.6350 2.1142 0.1039  -0.0287 0.4127  134 GLU A OE2 
1067 N N   . GLY A 135 ? 1.8218 1.3998 1.9730 0.1106  -0.0647 0.1885  135 GLY A N   
1068 C CA  . GLY A 135 ? 1.8802 1.3635 2.0066 0.0926  -0.0974 0.1584  135 GLY A CA  
1069 C C   . GLY A 135 ? 2.0129 1.4634 2.0347 0.0677  -0.1168 0.1297  135 GLY A C   
1070 O O   . GLY A 135 ? 2.0143 1.4810 1.9683 0.0776  -0.0878 0.1036  135 GLY A O   
1071 N N   . ARG A 136 ? 2.0183 1.4302 2.0348 0.0313  -0.1694 0.1430  136 ARG A N   
1072 C CA  . ARG A 136 ? 2.0661 1.4503 1.9930 -0.0073 -0.1977 0.1331  136 ARG A CA  
1073 C C   . ARG A 136 ? 2.1282 1.5859 2.0026 -0.0059 -0.1693 0.1365  136 ARG A C   
1074 O O   . ARG A 136 ? 2.0860 1.6302 1.9977 -0.0027 -0.1684 0.1872  136 ARG A O   
1075 C CB  . ARG A 136 ? 2.0552 1.4483 2.0156 -0.0457 -0.2613 0.1937  136 ARG A CB  
1076 C CG  . ARG A 136 ? 2.2079 1.5007 2.1916 -0.0631 -0.3039 0.1797  136 ARG A CG  
1077 C CD  . ARG A 136 ? 2.2732 1.5977 2.3149 -0.0953 -0.3730 0.2588  136 ARG A CD  
1078 N NE  . ARG A 136 ? 2.2388 1.6462 2.4135 -0.0699 -0.3801 0.3132  136 ARG A NE  
1079 C CZ  . ARG A 136 ? 2.2510 1.7834 2.4754 -0.0602 -0.3815 0.3794  136 ARG A CZ  
1080 N NH1 . ARG A 136 ? 2.0359 1.6159 2.1914 -0.0708 -0.3744 0.4021  136 ARG A NH1 
1081 N NH2 . ARG A 136 ? 1.9514 1.5677 2.2987 -0.0403 -0.3880 0.4253  136 ARG A NH2 
1082 N N   . SER A 137 ? 2.1194 1.5461 1.9135 -0.0048 -0.1442 0.0813  137 SER A N   
1083 C CA  . SER A 137 ? 2.1017 1.5980 1.8553 -0.0015 -0.1157 0.0773  137 SER A CA  
1084 C C   . SER A 137 ? 2.0806 1.6436 1.8828 0.0422  -0.0775 0.0912  137 SER A C   
1085 O O   . SER A 137 ? 2.0381 1.6761 1.8647 0.0412  -0.0739 0.1311  137 SER A O   
1086 C CB  . SER A 137 ? 2.1425 1.6904 1.8759 -0.0454 -0.1403 0.1228  137 SER A CB  
1087 O OG  . SER A 137 ? 2.2101 1.8035 2.0008 -0.0512 -0.1623 0.1897  137 SER A OG  
1088 N N   . SER A 138 ? 2.0188 1.5483 1.8316 0.0797  -0.0484 0.0603  138 SER A N   
1089 C CA  . SER A 138 ? 1.9663 1.5473 1.8176 0.1168  -0.0139 0.0766  138 SER A CA  
1090 C C   . SER A 138 ? 1.9589 1.5993 1.7710 0.1282  0.0074  0.0698  138 SER A C   
1091 O O   . SER A 138 ? 1.9715 1.6077 1.7588 0.1583  0.0337  0.0460  138 SER A O   
1092 C CB  . SER A 138 ? 2.0126 1.5413 1.8906 0.1496  0.0111  0.0599  138 SER A CB  
1093 O OG  . SER A 138 ? 2.1143 1.5912 1.9294 0.1707  0.0329  0.0088  138 SER A OG  
1094 N N   . HIS A 139 ? 1.8352 1.5360 1.6487 0.1056  -0.0049 0.0970  139 HIS A N   
1095 C CA  . HIS A 139 ? 1.7840 1.5522 1.5819 0.1108  0.0090  0.1002  139 HIS A CA  
1096 C C   . HIS A 139 ? 1.7011 1.5191 1.5397 0.1307  0.0225  0.1321  139 HIS A C   
1097 O O   . HIS A 139 ? 1.6823 1.5000 1.5577 0.1284  0.0172  0.1575  139 HIS A O   
1098 C CB  . HIS A 139 ? 1.7927 1.5978 1.5754 0.0721  -0.0077 0.1147  139 HIS A CB  
1099 C CG  . HIS A 139 ? 1.8629 1.6389 1.5925 0.0453  -0.0189 0.0829  139 HIS A CG  
1100 N ND1 . HIS A 139 ? 1.8819 1.7008 1.5823 0.0478  -0.0065 0.0583  139 HIS A ND1 
1101 C CD2 . HIS A 139 ? 1.9124 1.6267 1.6135 0.0126  -0.0446 0.0752  139 HIS A CD2 
1102 C CE1 . HIS A 139 ? 1.8994 1.6809 1.5480 0.0151  -0.0210 0.0310  139 HIS A CE1 
1103 N NE2 . HIS A 139 ? 1.9364 1.6467 1.5801 -0.0085 -0.0455 0.0395  139 HIS A NE2 
1104 N N   . VAL A 140 ? 1.5569 1.4226 1.3898 0.1481  0.0365  0.1332  140 VAL A N   
1105 C CA  . VAL A 140 ? 1.4887 1.3946 1.3501 0.1619  0.0447  0.1622  140 VAL A CA  
1106 C C   . VAL A 140 ? 1.4264 1.3869 1.2987 0.1475  0.0390  0.1777  140 VAL A C   
1107 O O   . VAL A 140 ? 1.4151 1.4080 1.2790 0.1379  0.0358  0.1697  140 VAL A O   
1108 C CB  . VAL A 140 ? 1.5304 1.4449 1.3888 0.1943  0.0611  0.1678  140 VAL A CB  
1109 C CG1 . VAL A 140 ? 1.5412 1.4019 1.4051 0.2094  0.0745  0.1638  140 VAL A CG1 
1110 C CG2 . VAL A 140 ? 1.5261 1.4764 1.3604 0.2087  0.0628  0.1541  140 VAL A CG2 
1111 N N   . GLN A 141 ? 1.3000 1.2741 1.1950 0.1442  0.0393  0.2005  141 GLN A N   
1112 C CA  . GLN A 141 ? 1.2442 1.2592 1.1557 0.1352  0.0391  0.2163  141 GLN A CA  
1113 C C   . GLN A 141 ? 1.2253 1.2559 1.1454 0.1506  0.0432  0.2266  141 GLN A C   
1114 O O   . GLN A 141 ? 1.2199 1.2320 1.1375 0.1553  0.0463  0.2334  141 GLN A O   
1115 C CB  . GLN A 141 ? 1.2601 1.2695 1.1808 0.1196  0.0367  0.2336  141 GLN A CB  
1116 C CG  . GLN A 141 ? 1.4352 1.4244 1.3452 0.0985  0.0241  0.2365  141 GLN A CG  
1117 C CD  . GLN A 141 ? 1.4602 1.4186 1.3767 0.0965  0.0114  0.2472  141 GLN A CD  
1118 O OE1 . GLN A 141 ? 1.2395 1.1715 1.1623 0.1075  0.0102  0.2350  141 GLN A OE1 
1119 N NE2 . GLN A 141 ? 1.2856 1.2557 1.2100 0.0819  0.0006  0.2792  141 GLN A NE2 
1120 N N   . ARG A 142 ? 1.1369 1.2084 1.0714 0.1548  0.0398  0.2326  142 ARG A N   
1121 C CA  . ARG A 142 ? 1.1027 1.1902 1.0455 0.1654  0.0346  0.2478  142 ARG A CA  
1122 C C   . ARG A 142 ? 1.1404 1.2266 1.0985 0.1564  0.0361  0.2535  142 ARG A C   
1123 O O   . ARG A 142 ? 1.1211 1.2257 1.1032 0.1473  0.0414  0.2550  142 ARG A O   
1124 C CB  . ARG A 142 ? 1.0209 1.1634 0.9834 0.1756  0.0238  0.2569  142 ARG A CB  
1125 C CG  . ARG A 142 ? 1.0775 1.2343 1.0392 0.1915  0.0115  0.2818  142 ARG A CG  
1126 C CD  . ARG A 142 ? 1.1022 1.3318 1.0907 0.2063  -0.0034 0.2984  142 ARG A CD  
1127 N NE  . ARG A 142 ? 1.2149 1.4492 1.1764 0.2247  0.0058  0.2875  142 ARG A NE  
1128 C CZ  . ARG A 142 ? 1.3951 1.6959 1.3673 0.2464  -0.0038 0.3031  142 ARG A CZ  
1129 N NH1 . ARG A 142 ? 0.9046 1.2832 0.9257 0.2499  -0.0284 0.3372  142 ARG A NH1 
1130 N NH2 . ARG A 142 ? 1.5369 1.8299 1.4744 0.2665  0.0101  0.2858  142 ARG A NH2 
1131 N N   . GLY A 143 ? 1.1089 1.1740 1.0517 0.1575  0.0338  0.2592  143 GLY A N   
1132 C CA  . GLY A 143 ? 1.1130 1.1634 1.0567 0.1517  0.0371  0.2562  143 GLY A CA  
1133 C C   . GLY A 143 ? 1.1715 1.2169 1.1096 0.1503  0.0211  0.2665  143 GLY A C   
1134 O O   . GLY A 143 ? 1.1688 1.2153 1.0886 0.1504  0.0097  0.2839  143 GLY A O   
1135 N N   . TYR A 144 ? 1.1262 1.1640 1.0819 0.1480  0.0199  0.2611  144 TYR A N   
1136 C CA  . TYR A 144 ? 1.1287 1.1531 1.0822 0.1427  -0.0020 0.2702  144 TYR A CA  
1137 C C   . TYR A 144 ? 1.2285 1.1989 1.1432 0.1338  0.0074  0.2473  144 TYR A C   
1138 O O   . TYR A 144 ? 1.2434 1.1991 1.1575 0.1399  0.0328  0.2271  144 TYR A O   
1139 C CB  . TYR A 144 ? 1.0996 1.1673 1.1205 0.1479  -0.0188 0.2865  144 TYR A CB  
1140 C CG  . TYR A 144 ? 1.0870 1.2212 1.1379 0.1570  -0.0319 0.3103  144 TYR A CG  
1141 C CD1 . TYR A 144 ? 1.1078 1.2648 1.1506 0.1625  -0.0597 0.3414  144 TYR A CD1 
1142 C CD2 . TYR A 144 ? 1.0705 1.2453 1.1488 0.1596  -0.0155 0.3048  144 TYR A CD2 
1143 C CE1 . TYR A 144 ? 1.0937 1.3131 1.1550 0.1780  -0.0670 0.3616  144 TYR A CE1 
1144 C CE2 . TYR A 144 ? 1.0583 1.2908 1.1504 0.1684  -0.0247 0.3182  144 TYR A CE2 
1145 C CZ  . TYR A 144 ? 1.1928 1.4488 1.2771 0.1813  -0.0488 0.3444  144 TYR A CZ  
1146 O OH  . TYR A 144 ? 1.2436 1.5634 1.3402 0.1969  -0.0558 0.3585  144 TYR A OH  
1147 N N   . GLY A 145 ? 1.1987 1.1430 1.0749 0.1186  -0.0125 0.2545  145 GLY A N   
1148 C CA  . GLY A 145 ? 1.2274 1.1196 1.0524 0.1048  -0.0064 0.2287  145 GLY A CA  
1149 C C   . GLY A 145 ? 1.2913 1.1678 1.0657 0.0773  -0.0305 0.2481  145 GLY A C   
1150 O O   . GLY A 145 ? 1.2752 1.1834 1.0415 0.0695  -0.0341 0.2796  145 GLY A O   
1151 N N   . LYS A 146 ? 1.2863 1.1121 1.0274 0.0603  -0.0466 0.2335  146 LYS A N   
1152 C CA  . LYS A 146 ? 1.3182 1.1247 1.0022 0.0240  -0.0737 0.2566  146 LYS A CA  
1153 C C   . LYS A 146 ? 1.4109 1.2210 1.0390 0.0041  -0.0481 0.2390  146 LYS A C   
1154 O O   . LYS A 146 ? 1.4403 1.2216 1.0415 0.0096  -0.0250 0.1911  146 LYS A O   
1155 C CB  . LYS A 146 ? 1.3699 1.1111 1.0335 0.0085  -0.1037 0.2416  146 LYS A CB  
1156 C CG  . LYS A 146 ? 1.3479 1.1038 1.0780 0.0194  -0.1423 0.2764  146 LYS A CG  
1157 C CD  . LYS A 146 ? 1.4558 1.1378 1.1682 0.0002  -0.1750 0.2600  146 LYS A CD  
1158 C CE  . LYS A 146 ? 1.4951 1.2027 1.2713 -0.0006 -0.2305 0.3141  146 LYS A CE  
1159 N NZ  . LYS A 146 ? 1.5531 1.1848 1.3383 -0.0124 -0.2599 0.2905  146 LYS A NZ  
1160 N N   . VAL A 147 ? 1.3554 1.2127 0.9768 -0.0152 -0.0488 0.2823  147 VAL A N   
1161 C CA  . VAL A 147 ? 1.3532 1.2428 0.9438 -0.0404 -0.0283 0.2826  147 VAL A CA  
1162 C C   . VAL A 147 ? 1.3812 1.3083 1.0095 -0.0112 0.0062  0.2575  147 VAL A C   
1163 O O   . VAL A 147 ? 1.3522 1.3358 1.0047 -0.0194 0.0181  0.2852  147 VAL A O   
1164 C CB  . VAL A 147 ? 1.4387 1.2904 0.9524 -0.0797 -0.0362 0.2570  147 VAL A CB  
1165 C CG1 . VAL A 147 ? 1.4310 1.3313 0.9254 -0.0945 -0.0081 0.2397  147 VAL A CG1 
1166 C CG2 . VAL A 147 ? 1.4514 1.2940 0.9269 -0.1263 -0.0726 0.3100  147 VAL A CG2 
1167 N N   . GLN A 148 ? 1.3511 1.2510 0.9904 0.0206  0.0207  0.2147  148 GLN A N   
1168 C CA  . GLN A 148 ? 1.3334 1.2687 1.0066 0.0473  0.0467  0.2027  148 GLN A CA  
1169 C C   . GLN A 148 ? 1.4082 1.3284 1.1265 0.0806  0.0507  0.1964  148 GLN A C   
1170 O O   . GLN A 148 ? 1.4284 1.3067 1.1466 0.0912  0.0487  0.1768  148 GLN A O   
1171 C CB  . GLN A 148 ? 1.3609 1.2954 0.9964 0.0501  0.0664  0.1673  148 GLN A CB  
1172 C CG  . GLN A 148 ? 1.5067 1.5092 1.1740 0.0629  0.0836  0.1780  148 GLN A CG  
1173 C CD  . GLN A 148 ? 1.7799 1.7988 1.4048 0.0657  0.1007  0.1498  148 GLN A CD  
1174 O OE1 . GLN A 148 ? 1.6701 1.7134 1.2541 0.0330  0.0975  0.1460  148 GLN A OE1 
1175 N NE2 . GLN A 148 ? 1.7252 1.7371 1.3571 0.1042  0.1206  0.1339  148 GLN A NE2 
1176 N N   . ALA A 149 ? 1.3463 1.3032 1.1079 0.0935  0.0557  0.2154  149 ALA A N   
1177 C CA  . ALA A 149 ? 1.3384 1.2940 1.1412 0.1166  0.0592  0.2146  149 ALA A CA  
1178 C C   . ALA A 149 ? 1.3974 1.3713 1.2166 0.1332  0.0789  0.2101  149 ALA A C   
1179 O O   . ALA A 149 ? 1.3648 1.3698 1.1838 0.1300  0.0830  0.2187  149 ALA A O   
1180 C CB  . ALA A 149 ? 1.3314 1.3076 1.1620 0.1174  0.0464  0.2393  149 ALA A CB  
1181 N N   . GLU A 150 ? 1.3799 1.3434 1.2216 0.1493  0.0894  0.2059  150 GLU A N   
1182 C CA  . GLU A 150 ? 1.3709 1.3519 1.2297 0.1650  0.1075  0.2156  150 GLU A CA  
1183 C C   . GLU A 150 ? 1.3885 1.3925 1.2858 0.1630  0.1007  0.2373  150 GLU A C   
1184 O O   . GLU A 150 ? 1.3678 1.3737 1.2913 0.1601  0.0960  0.2401  150 GLU A O   
1185 C CB  . GLU A 150 ? 1.3981 1.3537 1.2573 0.1812  0.1297  0.2054  150 GLU A CB  
1186 C CG  . GLU A 150 ? 1.5068 1.4819 1.3713 0.2014  0.1539  0.2245  150 GLU A CG  
1187 C CD  . GLU A 150 ? 1.7140 1.6579 1.5773 0.2224  0.1837  0.2151  150 GLU A CD  
1188 O OE1 . GLU A 150 ? 1.6473 1.6022 1.5558 0.2302  0.2007  0.2431  150 GLU A OE1 
1189 O OE2 . GLU A 150 ? 1.5223 1.4307 1.3405 0.2288  0.1917  0.1810  150 GLU A OE2 
1190 N N   . PHE A 151 ? 1.3233 1.3499 1.2255 0.1622  0.0973  0.2540  151 PHE A N   
1191 C CA  . PHE A 151 ? 1.2908 1.3304 1.2163 0.1554  0.0880  0.2719  151 PHE A CA  
1192 C C   . PHE A 151 ? 1.2868 1.3453 1.2230 0.1607  0.0966  0.3029  151 PHE A C   
1193 O O   . PHE A 151 ? 1.2494 1.3257 1.1872 0.1610  0.0862  0.3221  151 PHE A O   
1194 C CB  . PHE A 151 ? 1.3063 1.3484 1.2325 0.1472  0.0712  0.2716  151 PHE A CB  
1195 C CG  . PHE A 151 ? 1.3249 1.3541 1.2442 0.1434  0.0652  0.2570  151 PHE A CG  
1196 C CD1 . PHE A 151 ? 1.3579 1.3827 1.2840 0.1424  0.0589  0.2528  151 PHE A CD1 
1197 C CD2 . PHE A 151 ? 1.3592 1.3884 1.2630 0.1398  0.0658  0.2536  151 PHE A CD2 
1198 C CE1 . PHE A 151 ? 1.3723 1.3937 1.2920 0.1452  0.0538  0.2498  151 PHE A CE1 
1199 C CE2 . PHE A 151 ? 1.3994 1.4217 1.2966 0.1358  0.0593  0.2556  151 PHE A CE2 
1200 C CZ  . PHE A 151 ? 1.3692 1.3882 1.2756 0.1422  0.0536  0.2558  151 PHE A CZ  
1201 N N   . PRO A 152 ? 1.2267 1.2892 1.1787 0.1644  0.1147  0.3175  152 PRO A N   
1202 C CA  . PRO A 152 ? 1.2113 1.2971 1.1742 0.1690  0.1258  0.3624  152 PRO A CA  
1203 C C   . PRO A 152 ? 1.2733 1.3749 1.2480 0.1452  0.1062  0.3923  152 PRO A C   
1204 O O   . PRO A 152 ? 1.2728 1.3721 1.2560 0.1261  0.0971  0.3790  152 PRO A O   
1205 C CB  . PRO A 152 ? 1.2204 1.3065 1.2069 0.1776  0.1559  0.3721  152 PRO A CB  
1206 C CG  . PRO A 152 ? 1.2878 1.3464 1.2732 0.1791  0.1544  0.3262  152 PRO A CG  
1207 C CD  . PRO A 152 ? 1.2371 1.2926 1.2094 0.1637  0.1252  0.3047  152 PRO A CD  
1208 N N   . LEU A 153 ? 1.2443 1.3645 1.2168 0.1459  0.0966  0.4345  153 LEU A N   
1209 C CA  . LEU A 153 ? 1.2496 1.3773 1.2257 0.1190  0.0714  0.4689  153 LEU A CA  
1210 C C   . LEU A 153 ? 1.3099 1.4699 1.2987 0.1137  0.0851  0.5374  153 LEU A C   
1211 O O   . LEU A 153 ? 1.2863 1.4558 1.2781 0.0808  0.0712  0.5722  153 LEU A O   
1212 C CB  . LEU A 153 ? 1.2539 1.3834 1.2272 0.1218  0.0402  0.4768  153 LEU A CB  
1213 C CG  . LEU A 153 ? 1.3347 1.4334 1.3061 0.1123  0.0191  0.4308  153 LEU A CG  
1214 C CD1 . LEU A 153 ? 1.3487 1.4324 1.3129 0.1259  0.0378  0.3791  153 LEU A CD1 
1215 C CD2 . LEU A 153 ? 1.3540 1.4697 1.3461 0.1154  -0.0093 0.4516  153 LEU A CD2 
1216 N N   . GLY A 154 ? 1.1429 1.3544 1.5699 0.0440  0.0157  0.3497  154 GLY A N   
1217 C CA  . GLY A 154 ? 1.1529 1.3714 1.5806 0.0427  0.0174  0.3591  154 GLY A CA  
1218 C C   . GLY A 154 ? 1.2425 1.4608 1.6556 0.0393  0.0091  0.3626  154 GLY A C   
1219 O O   . GLY A 154 ? 1.2367 1.4507 1.6449 0.0394  0.0036  0.3569  154 GLY A O   
1220 N N   . PRO A 155 ? 1.2243 1.4486 1.6329 0.0369  0.0091  0.3732  155 PRO A N   
1221 C CA  . PRO A 155 ? 1.2300 1.4539 1.6304 0.0336  0.0006  0.3778  155 PRO A CA  
1222 C C   . PRO A 155 ? 1.2933 1.5115 1.6875 0.0311  -0.0070 0.3709  155 PRO A C   
1223 O O   . PRO A 155 ? 1.2757 1.4954 1.6643 0.0303  -0.0088 0.3685  155 PRO A O   
1224 C CB  . PRO A 155 ? 1.2475 1.4801 1.6451 0.0315  0.0031  0.3898  155 PRO A CB  
1225 C CG  . PRO A 155 ? 1.2941 1.5321 1.7000 0.0348  0.0150  0.3930  155 PRO A CG  
1226 C CD  . PRO A 155 ? 1.2377 1.4715 1.6508 0.0378  0.0178  0.3825  155 PRO A CD  
1227 N N   . VAL A 156 ? 1.2860 1.4998 1.6823 0.0321  -0.0105 0.3672  156 VAL A N   
1228 C CA  . VAL A 156 ? 1.3079 1.5158 1.7016 0.0300  -0.0159 0.3610  156 VAL A CA  
1229 C C   . VAL A 156 ? 1.3917 1.5999 1.7863 0.0251  -0.0239 0.3639  156 VAL A C   
1230 O O   . VAL A 156 ? 1.3936 1.6070 1.7932 0.0235  -0.0261 0.3734  156 VAL A O   
1231 C CB  . VAL A 156 ? 1.3577 1.5661 1.7579 0.0343  -0.0151 0.3600  156 VAL A CB  
1232 C CG1 . VAL A 156 ? 1.3576 1.5600 1.7521 0.0345  -0.0135 0.3500  156 VAL A CG1 
1233 C CG2 . VAL A 156 ? 1.3516 1.5674 1.7570 0.0420  -0.0105 0.3624  156 VAL A CG2 
1234 N N   . THR A 157 ? 1.3605 1.5632 1.7510 0.0230  -0.0289 0.3553  157 THR A N   
1235 C CA  . THR A 157 ? 1.3649 1.5674 1.7603 0.0188  -0.0385 0.3531  157 THR A CA  
1236 C C   . THR A 157 ? 1.4422 1.6365 1.8437 0.0173  -0.0415 0.3466  157 THR A C   
1237 O O   . THR A 157 ? 1.4408 1.6317 1.8399 0.0201  -0.0347 0.3455  157 THR A O   
1238 C CB  . THR A 157 ? 1.4658 1.6745 1.8512 0.0201  -0.0425 0.3483  157 THR A CB  
1239 O OG1 . THR A 157 ? 1.4467 1.6538 1.8194 0.0255  -0.0374 0.3435  157 THR A OG1 
1240 C CG2 . THR A 157 ? 1.4553 1.6758 1.8415 0.0203  -0.0399 0.3580  157 THR A CG2 
1241 N N   . THR A 158 ? 1.4062 1.5986 1.8182 0.0134  -0.0510 0.3419  158 THR A N   
1242 C CA  . THR A 158 ? 1.4032 1.5881 1.8266 0.0116  -0.0529 0.3364  158 THR A CA  
1243 C C   . THR A 158 ? 1.4562 1.6332 1.8598 0.0135  -0.0519 0.3252  158 THR A C   
1244 O O   . THR A 158 ? 1.4501 1.6209 1.8575 0.0131  -0.0481 0.3230  158 THR A O   
1245 C CB  . THR A 158 ? 1.5028 1.6879 1.9501 0.0067  -0.0638 0.3340  158 THR A CB  
1246 O OG1 . THR A 158 ? 1.5302 1.7143 1.9677 0.0060  -0.0746 0.3192  158 THR A OG1 
1247 C CG2 . THR A 158 ? 1.4628 1.6561 1.9259 0.0053  -0.0659 0.3470  158 THR A CG2 
1248 N N   . ALA A 159 ? 1.4150 1.5939 1.7985 0.0170  -0.0540 0.3204  159 ALA A N   
1249 C CA  . ALA A 159 ? 1.4213 1.5940 1.7845 0.0215  -0.0531 0.3135  159 ALA A CA  
1250 C C   . ALA A 159 ? 1.4747 1.6440 1.8305 0.0234  -0.0408 0.3189  159 ALA A C   
1251 O O   . ALA A 159 ? 1.4718 1.6333 1.8170 0.0245  -0.0375 0.3157  159 ALA A O   
1252 C CB  . ALA A 159 ? 1.4326 1.6135 1.7815 0.0289  -0.0573 0.3110  159 ALA A CB  
1253 N N   . HIS A 160 ? 1.4308 1.6068 1.7934 0.0238  -0.0344 0.3266  160 HIS A N   
1254 C CA  . HIS A 160 ? 1.4337 1.6101 1.7948 0.0265  -0.0245 0.3294  160 HIS A CA  
1255 C C   . HIS A 160 ? 1.4774 1.6526 1.8446 0.0264  -0.0195 0.3291  160 HIS A C   
1256 O O   . HIS A 160 ? 1.4721 1.6516 1.8399 0.0303  -0.0118 0.3297  160 HIS A O   
1257 C CB  . HIS A 160 ? 1.4341 1.6190 1.8043 0.0278  -0.0211 0.3360  160 HIS A CB  
1258 C CG  . HIS A 160 ? 1.4857 1.6745 1.8515 0.0303  -0.0198 0.3380  160 HIS A CG  
1259 N ND1 . HIS A 160 ? 1.5068 1.6994 1.8677 0.0311  -0.0256 0.3378  160 HIS A ND1 
1260 C CD2 . HIS A 160 ? 1.5055 1.6977 1.8752 0.0338  -0.0125 0.3405  160 HIS A CD2 
1261 C CE1 . HIS A 160 ? 1.5048 1.7046 1.8659 0.0362  -0.0198 0.3424  160 HIS A CE1 
1262 N NE2 . HIS A 160 ? 1.5022 1.7006 1.8706 0.0371  -0.0117 0.3444  160 HIS A NE2 
1263 N N   . ARG A 161 ? 1.4253 1.5972 1.8003 0.0232  -0.0233 0.3278  161 ARG A N   
1264 C CA  . ARG A 161 ? 1.4085 1.5819 1.7933 0.0244  -0.0165 0.3295  161 ARG A CA  
1265 C C   . ARG A 161 ? 1.4527 1.6177 1.8176 0.0249  -0.0121 0.3235  161 ARG A C   
1266 O O   . ARG A 161 ? 1.4533 1.6098 1.8004 0.0241  -0.0176 0.3186  161 ARG A O   
1267 C CB  . ARG A 161 ? 1.3840 1.5562 1.7907 0.0206  -0.0219 0.3309  161 ARG A CB  
1268 C CG  . ARG A 161 ? 1.4488 1.6321 1.8821 0.0232  -0.0206 0.3424  161 ARG A CG  
1269 C CD  . ARG A 161 ? 1.5264 1.7085 1.9887 0.0199  -0.0244 0.3449  161 ARG A CD  
1270 N NE  . ARG A 161 ? 1.6020 1.7954 2.0924 0.0242  -0.0232 0.3595  161 ARG A NE  
1271 C CZ  . ARG A 161 ? 1.7789 1.9718 2.2865 0.0197  -0.0333 0.3633  161 ARG A CZ  
1272 N NH1 . ARG A 161 ? 1.6599 1.8441 2.1603 0.0115  -0.0457 0.3510  161 ARG A NH1 
1273 N NH2 . ARG A 161 ? 1.6016 1.8049 2.1339 0.0252  -0.0313 0.3798  161 ARG A NH2 
1274 N N   . GLY A 162 ? 1.3978 1.5674 1.7657 0.0280  -0.0016 0.3255  162 GLY A N   
1275 C CA  . GLY A 162 ? 1.3974 1.5602 1.7459 0.0284  0.0046  0.3219  162 GLY A CA  
1276 C C   . GLY A 162 ? 1.4269 1.5999 1.7699 0.0347  0.0162  0.3228  162 GLY A C   
1277 O O   . GLY A 162 ? 1.4170 1.6027 1.7709 0.0398  0.0182  0.3243  162 GLY A O   
1278 N N   . THR A 163 ? 1.3648 1.5334 1.6908 0.0350  0.0236  0.3213  163 THR A N   
1279 C CA  . THR A 163 ? 1.3458 1.5246 1.6637 0.0410  0.0348  0.3203  163 THR A CA  
1280 C C   . THR A 163 ? 1.3718 1.5400 1.6708 0.0397  0.0304  0.3167  163 THR A C   
1281 O O   . THR A 163 ? 1.3814 1.5341 1.6621 0.0364  0.0261  0.3176  163 THR A O   
1282 C CB  . THR A 163 ? 1.4351 1.6198 1.7506 0.0433  0.0481  0.3236  163 THR A CB  
1283 O OG1 . THR A 163 ? 1.4547 1.6533 1.7618 0.0504  0.0591  0.3217  163 THR A OG1 
1284 C CG2 . THR A 163 ? 1.4076 1.5728 1.7052 0.0364  0.0460  0.3238  163 THR A CG2 
1285 N N   . TYR A 164 ? 1.2850 1.4626 1.5923 0.0439  0.0308  0.3133  164 TYR A N   
1286 C CA  . TYR A 164 ? 1.2659 1.4363 1.5671 0.0438  0.0275  0.3111  164 TYR A CA  
1287 C C   . TYR A 164 ? 1.2750 1.4514 1.5694 0.0477  0.0358  0.3070  164 TYR A C   
1288 O O   . TYR A 164 ? 1.2756 1.4690 1.5748 0.0532  0.0439  0.3034  164 TYR A O   
1289 C CB  . TYR A 164 ? 1.2720 1.4476 1.5923 0.0450  0.0218  0.3091  164 TYR A CB  
1290 C CG  . TYR A 164 ? 1.3015 1.4713 1.6260 0.0410  0.0135  0.3138  164 TYR A CG  
1291 C CD1 . TYR A 164 ? 1.3240 1.4968 1.6545 0.0391  0.0114  0.3163  164 TYR A CD1 
1292 C CD2 . TYR A 164 ? 1.3187 1.4830 1.6453 0.0407  0.0086  0.3163  164 TYR A CD2 
1293 C CE1 . TYR A 164 ? 1.3363 1.5054 1.6717 0.0354  0.0030  0.3193  164 TYR A CE1 
1294 C CE2 . TYR A 164 ? 1.3330 1.4963 1.6628 0.0386  0.0019  0.3200  164 TYR A CE2 
1295 C CZ  . TYR A 164 ? 1.4306 1.5958 1.7636 0.0354  -0.0017 0.3205  164 TYR A CZ  
1296 O OH  . TYR A 164 ? 1.4544 1.6200 1.7913 0.0333  -0.0090 0.3229  164 TYR A OH  
1297 N N   . ARG A 165 ? 1.1796 1.3445 1.4644 0.0468  0.0342  0.3087  165 ARG A N   
1298 C CA  . ARG A 165 ? 1.1416 1.3098 1.4207 0.0497  0.0407  0.3057  165 ARG A CA  
1299 C C   . ARG A 165 ? 1.1371 1.3001 1.4301 0.0508  0.0364  0.3051  165 ARG A C   
1300 O O   . ARG A 165 ? 1.1120 1.2647 1.4091 0.0500  0.0304  0.3120  165 ARG A O   
1301 C CB  . ARG A 165 ? 1.1061 1.2638 1.3564 0.0478  0.0464  0.3130  165 ARG A CB  
1302 C CG  . ARG A 165 ? 1.1573 1.3302 1.4005 0.0505  0.0585  0.3101  165 ARG A CG  
1303 C CD  . ARG A 165 ? 1.1905 1.3525 1.4041 0.0482  0.0657  0.3185  165 ARG A CD  
1304 N NE  . ARG A 165 ? 1.0839 1.2640 1.2909 0.0523  0.0808  0.3169  165 ARG A NE  
1305 C CZ  . ARG A 165 ? 1.3102 1.5017 1.5202 0.0541  0.0900  0.3191  165 ARG A CZ  
1306 N NH1 . ARG A 165 ? 1.0834 1.2677 1.3043 0.0505  0.0839  0.3216  165 ARG A NH1 
1307 N NH2 . ARG A 165 ? 1.2705 1.4828 1.4760 0.0604  0.1062  0.3193  165 ARG A NH2 
1308 N N   . CYS A 166 ? 1.0793 1.2520 1.3832 0.0542  0.0400  0.2967  166 CYS A N   
1309 C CA  . CYS A 166 ? 1.0754 1.2439 1.4003 0.0555  0.0369  0.2958  166 CYS A CA  
1310 C C   . CYS A 166 ? 1.0717 1.2357 1.3886 0.0566  0.0411  0.2984  166 CYS A C   
1311 O O   . CYS A 166 ? 1.0680 1.2425 1.3733 0.0582  0.0473  0.2917  166 CYS A O   
1312 C CB  . CYS A 166 ? 1.0878 1.2705 1.4452 0.0587  0.0340  0.2817  166 CYS A CB  
1313 S SG  . CYS A 166 ? 1.1437 1.3211 1.5378 0.0600  0.0312  0.2803  166 CYS A SG  
1314 N N   . PHE A 167 ? 0.9725 1.1237 1.2998 0.0576  0.0385  0.3091  167 PHE A N   
1315 C CA  . PHE A 167 ? 0.9326 1.0774 1.2601 0.0596  0.0412  0.3156  167 PHE A CA  
1316 C C   . PHE A 167 ? 0.9398 1.0873 1.3128 0.0622  0.0383  0.3115  167 PHE A C   
1317 O O   . PHE A 167 ? 0.9252 1.0720 1.3221 0.0633  0.0352  0.3140  167 PHE A O   
1318 C CB  . PHE A 167 ? 0.9566 1.0840 1.2597 0.0619  0.0408  0.3372  167 PHE A CB  
1319 C CG  . PHE A 167 ? 0.9815 1.1033 1.2412 0.0595  0.0436  0.3418  167 PHE A CG  
1320 C CD1 . PHE A 167 ? 1.0218 1.1417 1.2559 0.0587  0.0505  0.3449  167 PHE A CD1 
1321 C CD2 . PHE A 167 ? 1.0060 1.1247 1.2527 0.0580  0.0398  0.3434  167 PHE A CD2 
1322 C CE1 . PHE A 167 ? 1.0430 1.1574 1.2398 0.0565  0.0547  0.3499  167 PHE A CE1 
1323 C CE2 . PHE A 167 ? 1.0487 1.1616 1.2614 0.0557  0.0422  0.3466  167 PHE A CE2 
1324 C CZ  . PHE A 167 ? 1.0330 1.1435 1.2215 0.0550  0.0502  0.3502  167 PHE A CZ  
1325 N N   . GLY A 168 ? 1.2052 1.0521 0.8815 0.0584  0.0671  0.1709  168 GLY A N   
1326 C CA  . GLY A 168 ? 1.1985 1.0331 0.8673 0.0613  0.0595  0.1656  168 GLY A CA  
1327 C C   . GLY A 168 ? 1.2347 1.0542 0.9071 0.0517  0.0658  0.1683  168 GLY A C   
1328 O O   . GLY A 168 ? 1.2338 1.0527 0.9068 0.0472  0.0746  0.1713  168 GLY A O   
1329 N N   . SER A 169 ? 1.1656 0.9757 0.8423 0.0516  0.0597  0.1705  169 SER A N   
1330 C CA  . SER A 169 ? 1.1504 0.9542 0.8348 0.0487  0.0674  0.1817  169 SER A CA  
1331 C C   . SER A 169 ? 1.2268 1.0258 0.9359 0.0489  0.0582  0.1929  169 SER A C   
1332 O O   . SER A 169 ? 1.2190 1.0143 0.9376 0.0520  0.0399  0.1878  169 SER A O   
1333 C CB  . SER A 169 ? 1.1545 0.9571 0.8292 0.0515  0.0719  0.1822  169 SER A CB  
1334 O OG  . SER A 169 ? 1.1379 0.9416 0.8215 0.0519  0.0628  0.1825  169 SER A OG  
1335 N N   . TYR A 170 ? 1.1928 0.9910 0.9132 0.0481  0.0674  0.2103  170 TYR A N   
1336 C CA  . TYR A 170 ? 1.1773 0.9713 0.9309 0.0478  0.0584  0.2301  170 TYR A CA  
1337 C C   . TYR A 170 ? 1.2154 1.0198 0.9867 0.0537  0.0634  0.2539  170 TYR A C   
1338 O O   . TYR A 170 ? 1.1945 1.0009 1.0047 0.0546  0.0540  0.2783  170 TYR A O   
1339 C CB  . TYR A 170 ? 1.1881 0.9764 0.9448 0.0440  0.0657  0.2373  170 TYR A CB  
1340 C CG  . TYR A 170 ? 1.2060 0.9900 0.9511 0.0426  0.0614  0.2149  170 TYR A CG  
1341 C CD1 . TYR A 170 ? 1.2155 0.9891 0.9754 0.0486  0.0391  0.2062  170 TYR A CD1 
1342 C CD2 . TYR A 170 ? 1.2332 1.0257 0.9546 0.0404  0.0762  0.2030  170 TYR A CD2 
1343 C CE1 . TYR A 170 ? 1.2086 0.9838 0.9556 0.0565  0.0361  0.1874  170 TYR A CE1 
1344 C CE2 . TYR A 170 ? 1.2471 1.0450 0.9646 0.0436  0.0742  0.1876  170 TYR A CE2 
1345 C CZ  . TYR A 170 ? 1.2701 1.0611 0.9981 0.0538  0.0563  0.1803  170 TYR A CZ  
1346 O OH  . TYR A 170 ? 1.2163 1.0174 0.9388 0.0654  0.0557  0.1678  170 TYR A OH  
1347 N N   . ASN A 171 ? 1.1966 1.0085 0.9426 0.0605  0.0763  0.2476  171 ASN A N   
1348 C CA  . ASN A 171 ? 1.2063 1.0317 0.9555 0.0739  0.0854  0.2623  171 ASN A CA  
1349 C C   . ASN A 171 ? 1.3167 1.1374 1.0239 0.0813  0.0952  0.2414  171 ASN A C   
1350 O O   . ASN A 171 ? 1.3421 1.1522 1.0265 0.0755  0.0953  0.2250  171 ASN A O   
1351 C CB  . ASN A 171 ? 1.1799 1.0201 0.9514 0.0877  0.0954  0.3000  171 ASN A CB  
1352 C CG  . ASN A 171 ? 1.3890 1.2256 1.1314 0.0953  0.1089  0.3051  171 ASN A CG  
1353 O OD1 . ASN A 171 ? 1.2741 1.1066 0.9769 0.1067  0.1166  0.2904  171 ASN A OD1 
1354 N ND2 . ASN A 171 ? 1.3231 1.1591 1.0855 0.0902  0.1090  0.3269  171 ASN A ND2 
1355 N N   . ASN A 172 ? 1.2778 1.1063 0.9792 0.0958  0.1016  0.2436  172 ASN A N   
1356 C CA  . ASN A 172 ? 1.2881 1.1060 0.9533 0.1058  0.1055  0.2231  172 ASN A CA  
1357 C C   . ASN A 172 ? 1.3134 1.1192 0.9494 0.1161  0.1070  0.2179  172 ASN A C   
1358 O O   . ASN A 172 ? 1.3214 1.1117 0.9345 0.1188  0.1008  0.1980  172 ASN A O   
1359 C CB  . ASN A 172 ? 1.3296 1.1596 0.9955 0.1275  0.1140  0.2306  172 ASN A CB  
1360 C CG  . ASN A 172 ? 1.6808 1.5193 1.3678 0.1159  0.1102  0.2261  172 ASN A CG  
1361 O OD1 . ASN A 172 ? 1.7342 1.5687 1.4342 0.0937  0.0977  0.2181  172 ASN A OD1 
1362 N ND2 . ASN A 172 ? 1.4951 1.3466 1.1841 0.1342  0.1197  0.2305  172 ASN A ND2 
1363 N N   . HIS A 173 ? 1.2430 1.0548 0.8824 0.1215  0.1122  0.2372  173 HIS A N   
1364 C CA  . HIS A 173 ? 1.2456 1.0481 0.8557 0.1340  0.1122  0.2353  173 HIS A CA  
1365 C C   . HIS A 173 ? 1.2415 1.0412 0.8574 0.1137  0.1114  0.2353  173 HIS A C   
1366 O O   . HIS A 173 ? 1.2482 1.0408 0.8410 0.1207  0.1099  0.2323  173 HIS A O   
1367 C CB  . HIS A 173 ? 1.2637 1.0783 0.8597 0.1698  0.1217  0.2605  173 HIS A CB  
1368 C CG  . HIS A 173 ? 1.3137 1.1301 0.8968 0.1975  0.1226  0.2558  173 HIS A CG  
1369 N ND1 . HIS A 173 ? 1.3594 1.1569 0.9022 0.2254  0.1130  0.2383  173 HIS A ND1 
1370 C CD2 . HIS A 173 ? 1.3196 1.1519 0.9264 0.2007  0.1291  0.2634  173 HIS A CD2 
1371 C CE1 . HIS A 173 ? 1.3493 1.1513 0.8902 0.2465  0.1165  0.2355  173 HIS A CE1 
1372 N NE2 . HIS A 173 ? 1.3325 1.1575 0.9117 0.2309  0.1282  0.2504  173 HIS A NE2 
1373 N N   . ALA A 174 ? 1.1451 0.9488 0.7900 0.0916  0.1102  0.2369  174 ALA A N   
1374 C CA  . ALA A 174 ? 1.1229 0.9240 0.7744 0.0750  0.1102  0.2342  174 ALA A CA  
1375 C C   . ALA A 174 ? 1.1727 0.9719 0.8345 0.0593  0.1013  0.2137  174 ALA A C   
1376 O O   . ALA A 174 ? 1.1601 0.9608 0.8421 0.0534  0.0947  0.2141  174 ALA A O   
1377 C CB  . ALA A 174 ? 1.1179 0.9240 0.7940 0.0721  0.1147  0.2595  174 ALA A CB  
1378 N N   . TRP A 175 ? 1.1284 0.9255 0.7777 0.0565  0.0980  0.1980  175 TRP A N   
1379 C CA  . TRP A 175 ? 1.1036 0.9061 0.7629 0.0476  0.0912  0.1851  175 TRP A CA  
1380 C C   . TRP A 175 ? 1.1762 0.9868 0.8463 0.0400  0.0943  0.1836  175 TRP A C   
1381 O O   . TRP A 175 ? 1.1886 0.9981 0.8538 0.0380  0.1008  0.1875  175 TRP A O   
1382 C CB  . TRP A 175 ? 1.0750 0.8749 0.7266 0.0501  0.0838  0.1760  175 TRP A CB  
1383 C CG  . TRP A 175 ? 1.0748 0.8632 0.7117 0.0608  0.0809  0.1739  175 TRP A CG  
1384 C CD1 . TRP A 175 ? 1.1065 0.8943 0.7401 0.0684  0.0865  0.1805  175 TRP A CD1 
1385 C CD2 . TRP A 175 ? 1.0762 0.8532 0.7048 0.0668  0.0705  0.1657  175 TRP A CD2 
1386 N NE1 . TRP A 175 ? 1.0952 0.8737 0.7144 0.0805  0.0837  0.1746  175 TRP A NE1 
1387 C CE2 . TRP A 175 ? 1.1182 0.8860 0.7319 0.0801  0.0725  0.1641  175 TRP A CE2 
1388 C CE3 . TRP A 175 ? 1.0877 0.8617 0.7261 0.0637  0.0573  0.1620  175 TRP A CE3 
1389 C CZ2 . TRP A 175 ? 1.1161 0.8664 0.7176 0.0915  0.0620  0.1545  175 TRP A CZ2 
1390 C CZ3 . TRP A 175 ? 1.1101 0.8652 0.7420 0.0731  0.0429  0.1555  175 TRP A CZ3 
1391 C CH2 . TRP A 175 ? 1.1294 0.8703 0.7397 0.0874  0.0455  0.1496  175 TRP A CH2 
1392 N N   . SER A 176 ? 1.1351 0.9558 0.8170 0.0395  0.0898  0.1779  176 SER A N   
1393 C CA  . SER A 176 ? 1.1405 0.9738 0.8345 0.0387  0.0933  0.1756  176 SER A CA  
1394 C C   . SER A 176 ? 1.2005 1.0493 0.9024 0.0355  0.0961  0.1755  176 SER A C   
1395 O O   . SER A 176 ? 1.1918 1.0350 0.8887 0.0338  0.0910  0.1761  176 SER A O   
1396 C CB  . SER A 176 ? 1.1872 1.0288 0.8867 0.0498  0.0846  0.1712  176 SER A CB  
1397 O OG  . SER A 176 ? 1.2915 1.1481 0.9906 0.0559  0.0805  0.1719  176 SER A OG  
1398 N N   . PHE A 177 ? 1.1686 1.0372 0.8869 0.0374  0.1013  0.1754  177 PHE A N   
1399 C CA  . PHE A 177 ? 1.1654 1.0568 0.9047 0.0352  0.1019  0.1800  177 PHE A CA  
1400 C C   . PHE A 177 ? 1.2371 1.1426 0.9902 0.0423  0.0916  0.1882  177 PHE A C   
1401 O O   . PHE A 177 ? 1.2362 1.1405 0.9791 0.0519  0.0885  0.1880  177 PHE A O   
1402 C CB  . PHE A 177 ? 1.1748 1.0911 0.9324 0.0413  0.1123  0.1803  177 PHE A CB  
1403 C CG  . PHE A 177 ? 1.1972 1.1089 0.9527 0.0301  0.1235  0.1756  177 PHE A CG  
1404 C CD1 . PHE A 177 ? 1.2583 1.1482 0.9969 0.0280  0.1297  0.1702  177 PHE A CD1 
1405 C CD2 . PHE A 177 ? 1.2178 1.1486 0.9926 0.0220  0.1262  0.1789  177 PHE A CD2 
1406 C CE1 . PHE A 177 ? 1.2816 1.1672 1.0164 0.0172  0.1418  0.1682  177 PHE A CE1 
1407 C CE2 . PHE A 177 ? 1.2672 1.1950 1.0362 0.0113  0.1377  0.1737  177 PHE A CE2 
1408 C CZ  . PHE A 177 ? 1.2669 1.1717 1.0130 0.0088  0.1473  0.1684  177 PHE A CZ  
1409 N N   . PRO A 178 ? 1.2001 1.1190 0.9788 0.0387  0.0835  0.1976  178 PRO A N   
1410 C CA  . PRO A 178 ? 1.1967 1.1302 0.9954 0.0456  0.0731  0.2120  178 PRO A CA  
1411 C C   . PRO A 178 ? 1.2893 1.2636 1.1094 0.0628  0.0810  0.2268  178 PRO A C   
1412 O O   . PRO A 178 ? 1.2837 1.2810 1.1187 0.0679  0.0918  0.2279  178 PRO A O   
1413 C CB  . PRO A 178 ? 1.2015 1.1364 1.0313 0.0376  0.0574  0.2205  178 PRO A CB  
1414 C CG  . PRO A 178 ? 1.2447 1.1893 1.0833 0.0308  0.0649  0.2156  178 PRO A CG  
1415 C CD  . PRO A 178 ? 1.2120 1.1337 1.0069 0.0289  0.0798  0.1982  178 PRO A CD  
1416 N N   . SER A 179 ? 1.2841 1.2678 1.1013 0.0756  0.0766  0.2380  179 SER A N   
1417 C CA  . SER A 179 ? 1.2827 1.3080 1.1131 0.1020  0.0822  0.2563  179 SER A CA  
1418 C C   . SER A 179 ? 1.3364 1.4047 1.2239 0.1068  0.0797  0.2886  179 SER A C   
1419 O O   . SER A 179 ? 1.3300 1.3870 1.2428 0.0892  0.0665  0.2962  179 SER A O   
1420 C CB  . SER A 179 ? 1.3528 1.3715 1.1532 0.1155  0.0765  0.2584  179 SER A CB  
1421 O OG  . SER A 179 ? 1.4759 1.4938 1.2916 0.1079  0.0672  0.2758  179 SER A OG  
1422 N N   . GLU A 180 ? 1.2996 1.4182 1.2111 0.1346  0.0892  0.3104  180 GLU A N   
1423 C CA  . GLU A 180 ? 1.2752 1.4456 1.2537 0.1429  0.0874  0.3502  180 GLU A CA  
1424 C C   . GLU A 180 ? 1.3401 1.5090 1.3404 0.1381  0.0707  0.3775  180 GLU A C   
1425 O O   . GLU A 180 ? 1.3707 1.5245 1.3317 0.1471  0.0691  0.3756  180 GLU A O   
1426 C CB  . GLU A 180 ? 1.2741 1.5047 1.2713 0.1830  0.1032  0.3721  180 GLU A CB  
1427 C CG  . GLU A 180 ? 1.4508 1.6913 1.4548 0.1827  0.1178  0.3536  180 GLU A CG  
1428 C CD  . GLU A 180 ? 1.7710 1.9725 1.7144 0.1864  0.1248  0.3127  180 GLU A CD  
1429 O OE1 . GLU A 180 ? 1.8154 1.9690 1.7094 0.1774  0.1155  0.2906  180 GLU A OE1 
1430 O OE2 . GLU A 180 ? 1.5845 1.8041 1.5350 0.1986  0.1385  0.3045  180 GLU A OE2 
1431 N N   . PRO A 181 ? 1.2740 1.4500 1.3345 0.1212  0.0544  0.3988  181 PRO A N   
1432 C CA  . PRO A 181 ? 1.2667 1.4324 1.3528 0.1146  0.0338  0.4239  181 PRO A CA  
1433 C C   . PRO A 181 ? 1.2761 1.4879 1.3840 0.1427  0.0373  0.4708  181 PRO A C   
1434 O O   . PRO A 181 ? 1.2333 1.5047 1.3629 0.1739  0.0529  0.4990  181 PRO A O   
1435 C CB  . PRO A 181 ? 1.2628 1.4350 1.4228 0.0974  0.0109  0.4415  181 PRO A CB  
1436 C CG  . PRO A 181 ? 1.2913 1.5075 1.4803 0.1046  0.0266  0.4442  181 PRO A CG  
1437 C CD  . PRO A 181 ? 1.2700 1.4616 1.3807 0.1077  0.0501  0.4011  181 PRO A CD  
1438 N N   . VAL A 182 ? 1.2310 1.4153 1.3328 0.1343  0.0223  0.4810  182 VAL A N   
1439 C CA  . VAL A 182 ? 1.1557 1.3744 1.2744 0.1564  0.0223  0.5282  182 VAL A CA  
1440 C C   . VAL A 182 ? 1.7914 1.9970 1.9754 0.1383  -0.0066 0.5614  182 VAL A C   
1441 O O   . VAL A 182 ? 1.2640 1.5211 1.5213 0.1536  -0.0138 0.6223  182 VAL A O   
1442 C CB  . VAL A 182 ? 1.2245 1.4194 1.2563 0.1679  0.0343  0.5053  182 VAL A CB  
1443 C CG1 . VAL A 182 ? 1.2008 1.4271 1.2424 0.1899  0.0334  0.5544  182 VAL A CG1 
1444 C CG2 . VAL A 182 ? 1.2332 1.4430 1.2140 0.1920  0.0538  0.4798  182 VAL A CG2 
1445 N N   . ASP B 1   ? 1.6510 1.0428 0.8888 0.1488  -0.0050 0.0341  1   ASP D N   
1446 C CA  . ASP B 1   ? 1.6187 1.0567 0.9158 0.1321  0.0009  0.0203  1   ASP D CA  
1447 C C   . ASP B 1   ? 1.6191 1.1154 0.9950 0.1497  -0.0127 0.0231  1   ASP D C   
1448 O O   . ASP B 1   ? 1.6038 1.1489 1.0013 0.1570  -0.0444 0.0174  1   ASP D O   
1449 C CB  . ASP B 1   ? 1.6451 1.1121 0.9252 0.1020  -0.0167 -0.0055 1   ASP D CB  
1450 C CG  . ASP B 1   ? 1.8067 1.3147 1.1415 0.0849  -0.0079 -0.0219 1   ASP D CG  
1451 O OD1 . ASP B 1   ? 1.7745 1.3475 1.1719 0.0909  -0.0311 -0.0289 1   ASP D OD1 
1452 O OD2 . ASP B 1   ? 1.9228 1.3930 1.2344 0.0677  0.0254  -0.0267 1   ASP D OD2 
1453 N N   . ILE B 2   ? 1.5283 1.0208 0.9454 0.1565  0.0122  0.0325  2   ILE D N   
1454 C CA  . ILE B 2   ? 1.4664 1.0012 0.9480 0.1692  0.0054  0.0348  2   ILE D CA  
1455 C C   . ILE B 2   ? 1.4796 1.0699 1.0088 0.1563  -0.0078 0.0173  2   ILE D C   
1456 O O   . ILE B 2   ? 1.4777 1.0676 1.0091 0.1395  0.0068  0.0078  2   ILE D O   
1457 C CB  . ILE B 2   ? 1.4897 1.0059 0.9953 0.1767  0.0339  0.0481  2   ILE D CB  
1458 C CG1 . ILE B 2   ? 1.5209 0.9820 0.9853 0.1911  0.0485  0.0645  2   ILE D CG1 
1459 C CG2 . ILE B 2   ? 1.4501 1.0085 1.0171 0.1817  0.0287  0.0456  2   ILE D CG2 
1460 C CD1 . ILE B 2   ? 1.5999 1.0394 1.0798 0.1925  0.0811  0.0758  2   ILE D CD1 
1461 N N   . GLN B 3   ? 1.4092 1.0429 0.9745 0.1666  -0.0311 0.0143  3   GLN D N   
1462 C CA  . GLN B 3   ? 1.3609 1.0469 0.9760 0.1560  -0.0418 -0.0020 3   GLN D CA  
1463 C C   . GLN B 3   ? 1.3327 1.0311 0.9975 0.1644  -0.0311 0.0027  3   GLN D C   
1464 O O   . GLN B 3   ? 1.3173 1.0107 0.9906 0.1828  -0.0321 0.0151  3   GLN D O   
1465 C CB  . GLN B 3   ? 1.3648 1.0982 0.9885 0.1590  -0.0746 -0.0103 3   GLN D CB  
1466 C CG  . GLN B 3   ? 1.7672 1.4948 1.3373 0.1436  -0.0888 -0.0199 3   GLN D CG  
1467 C CD  . GLN B 3   ? 2.1641 1.9511 1.7433 0.1483  -0.1260 -0.0269 3   GLN D CD  
1468 O OE1 . GLN B 3   ? 2.1396 1.9584 1.7482 0.1763  -0.1418 -0.0142 3   GLN D OE1 
1469 N NE2 . GLN B 3   ? 2.1055 1.9097 1.6574 0.1208  -0.1392 -0.0470 3   GLN D NE2 
1470 N N   . MET B 4   ? 1.2635 0.9710 0.9532 0.1506  -0.0171 -0.0071 4   MET D N   
1471 C CA  . MET B 4   ? 1.2384 0.9579 0.9697 0.1540  -0.0074 -0.0057 4   MET D CA  
1472 C C   . MET B 4   ? 1.2566 1.0143 1.0285 0.1516  -0.0197 -0.0183 4   MET D C   
1473 O O   . MET B 4   ? 1.2370 1.0111 1.0142 0.1372  -0.0218 -0.0343 4   MET D O   
1474 C CB  . MET B 4   ? 1.2651 0.9729 0.9954 0.1454  0.0149  -0.0066 4   MET D CB  
1475 C CG  . MET B 4   ? 1.3262 1.0015 1.0240 0.1488  0.0315  0.0073  4   MET D CG  
1476 S SD  . MET B 4   ? 1.3769 1.0342 1.0719 0.1618  0.0335  0.0233  4   MET D SD  
1477 C CE  . MET B 4   ? 1.3029 0.9865 1.0444 0.1593  0.0391  0.0211  4   MET D CE  
1478 N N   . THR B 5   ? 1.2009 0.9685 0.9996 0.1650  -0.0235 -0.0115 5   THR D N   
1479 C CA  . THR B 5   ? 1.1788 0.9798 1.0186 0.1655  -0.0308 -0.0206 5   THR D CA  
1480 C C   . THR B 5   ? 1.2121 1.0033 1.0755 0.1628  -0.0139 -0.0213 5   THR D C   
1481 O O   . THR B 5   ? 1.2009 0.9742 1.0637 0.1713  -0.0054 -0.0106 5   THR D O   
1482 C CB  . THR B 5   ? 1.2796 1.1056 1.1291 0.1848  -0.0496 -0.0128 5   THR D CB  
1483 O OG1 . THR B 5   ? 1.3821 1.1790 1.2179 0.2042  -0.0407 0.0055  5   THR D OG1 
1484 C CG2 . THR B 5   ? 1.2129 1.0571 1.0355 0.1833  -0.0714 -0.0160 5   THR D CG2 
1485 N N   . GLN B 6   ? 1.1673 0.9644 1.0437 0.1488  -0.0058 -0.0353 6   GLN D N   
1486 C CA  . GLN B 6   ? 1.1651 0.9528 1.0566 0.1440  0.0089  -0.0387 6   GLN D CA  
1487 C C   . GLN B 6   ? 1.2084 1.0103 1.1354 0.1458  0.0093  -0.0460 6   GLN D C   
1488 O O   . GLN B 6   ? 1.2028 1.0272 1.1467 0.1417  0.0033  -0.0572 6   GLN D O   
1489 C CB  . GLN B 6   ? 1.1889 0.9680 1.0646 0.1335  0.0205  -0.0469 6   GLN D CB  
1490 C CG  . GLN B 6   ? 1.2141 0.9830 1.0876 0.1321  0.0322  -0.0437 6   GLN D CG  
1491 C CD  . GLN B 6   ? 1.2786 1.0405 1.1338 0.1294  0.0450  -0.0487 6   GLN D CD  
1492 O OE1 . GLN B 6   ? 1.0605 0.8149 0.8923 0.1292  0.0501  -0.0479 6   GLN D OE1 
1493 N NE2 . GLN B 6   ? 1.3076 1.0658 1.1664 0.1285  0.0533  -0.0530 6   GLN D NE2 
1494 N N   . SER B 7   ? 1.1671 0.9545 1.1048 0.1498  0.0191  -0.0408 7   SER D N   
1495 C CA  . SER B 7   ? 1.1535 0.9450 1.1223 0.1545  0.0254  -0.0436 7   SER D CA  
1496 C C   . SER B 7   ? 1.2021 0.9647 1.1685 0.1452  0.0441  -0.0481 7   SER D C   
1497 O O   . SER B 7   ? 1.2094 0.9520 1.1545 0.1399  0.0504  -0.0431 7   SER D O   
1498 C CB  . SER B 7   ? 1.2079 1.0040 1.1849 0.1748  0.0216  -0.0279 7   SER D CB  
1499 O OG  . SER B 7   ? 1.3431 1.1402 1.3501 0.1838  0.0326  -0.0261 7   SER D OG  
1500 N N   . PRO B 8   ? 1.1458 0.9051 1.1326 0.1414  0.0543  -0.0585 8   PRO D N   
1501 C CA  . PRO B 8   ? 1.1294 0.9152 1.1491 0.1430  0.0517  -0.0684 8   PRO D CA  
1502 C C   . PRO B 8   ? 1.2217 1.0146 1.2311 0.1301  0.0507  -0.0839 8   PRO D C   
1503 O O   . PRO B 8   ? 1.2365 1.0103 1.2124 0.1244  0.0545  -0.0844 8   PRO D O   
1504 C CB  . PRO B 8   ? 1.1475 0.9102 1.1857 0.1428  0.0724  -0.0722 8   PRO D CB  
1505 C CG  . PRO B 8   ? 1.2172 0.9390 1.2189 0.1323  0.0841  -0.0734 8   PRO D CG  
1506 C CD  . PRO B 8   ? 1.1703 0.8955 1.1461 0.1323  0.0723  -0.0630 8   PRO D CD  
1507 N N   . SER B 9   ? 1.1877 1.0088 1.2254 0.1253  0.0486  -0.0969 9   SER D N   
1508 C CA  . SER B 9   ? 1.1941 1.0129 1.2175 0.1096  0.0561  -0.1150 9   SER D CA  
1509 C C   . SER B 9   ? 1.2409 1.0164 1.2445 0.1044  0.0816  -0.1237 9   SER D C   
1510 O O   . SER B 9   ? 1.2422 0.9963 1.2102 0.0991  0.0923  -0.1293 9   SER D O   
1511 C CB  . SER B 9   ? 1.2414 1.1016 1.3044 0.1000  0.0522  -0.1313 9   SER D CB  
1512 O OG  . SER B 9   ? 1.4575 1.3553 1.5175 0.0999  0.0274  -0.1276 9   SER D OG  
1513 N N   . SER B 10  ? 1.1979 0.9563 1.2201 0.1084  0.0938  -0.1236 10  SER D N   
1514 C CA  . SER B 10  ? 1.2065 0.9185 1.2058 0.1060  0.1177  -0.1307 10  SER D CA  
1515 C C   . SER B 10  ? 1.2167 0.9071 1.2195 0.1118  0.1220  -0.1208 10  SER D C   
1516 O O   . SER B 10  ? 1.1694 0.8792 1.1992 0.1186  0.1131  -0.1102 10  SER D O   
1517 C CB  . SER B 10  ? 1.2321 0.9343 1.2498 0.0968  0.1406  -0.1517 10  SER D CB  
1518 O OG  . SER B 10  ? 1.2426 0.9724 1.3162 0.0969  0.1411  -0.1550 10  SER D OG  
1519 N N   . LEU B 11  ? 1.2160 0.8636 1.1853 0.1099  0.1374  -0.1236 11  LEU D N   
1520 C CA  . LEU B 11  ? 1.2490 0.8644 1.2114 0.1095  0.1472  -0.1186 11  LEU D CA  
1521 C C   . LEU B 11  ? 1.3498 0.9156 1.2758 0.1062  0.1680  -0.1283 11  LEU D C   
1522 O O   . LEU B 11  ? 1.3751 0.9340 1.2663 0.1081  0.1684  -0.1321 11  LEU D O   
1523 C CB  . LEU B 11  ? 1.2597 0.8809 1.2063 0.1084  0.1329  -0.1044 11  LEU D CB  
1524 C CG  . LEU B 11  ? 1.3434 0.9740 1.2531 0.1048  0.1192  -0.1009 11  LEU D CG  
1525 C CD1 . LEU B 11  ? 1.3879 0.9861 1.2584 0.0974  0.1279  -0.1056 11  LEU D CD1 
1526 C CD2 . LEU B 11  ? 1.3462 0.9978 1.2592 0.1034  0.1048  -0.0886 11  LEU D CD2 
1527 N N   . SER B 12  ? 1.3095 0.8364 1.2391 0.1040  0.1881  -0.1308 12  SER D N   
1528 C CA  . SER B 12  ? 1.3349 0.8053 1.2230 0.1014  0.2097  -0.1399 12  SER D CA  
1529 C C   . SER B 12  ? 1.3974 0.8337 1.2503 0.0932  0.2118  -0.1349 12  SER D C   
1530 O O   . SER B 12  ? 1.3920 0.8158 1.2638 0.0898  0.2206  -0.1288 12  SER D O   
1531 C CB  . SER B 12  ? 1.3778 0.8187 1.2915 0.1027  0.2395  -0.1522 12  SER D CB  
1532 O OG  . SER B 12  ? 1.5515 0.9937 1.4585 0.1045  0.2478  -0.1646 12  SER D OG  
1533 N N   . ALA B 13  ? 1.3685 0.7927 1.1678 0.0899  0.2041  -0.1366 13  ALA D N   
1534 C CA  . ALA B 13  ? 1.3838 0.7812 1.1424 0.0759  0.2033  -0.1360 13  ALA D CA  
1535 C C   . ALA B 13  ? 1.4195 0.7767 1.1182 0.0767  0.2109  -0.1440 13  ALA D C   
1536 O O   . ALA B 13  ? 1.3975 0.7640 1.0790 0.0915  0.2081  -0.1452 13  ALA D O   
1537 C CB  . ALA B 13  ? 1.3831 0.8301 1.1400 0.0673  0.1758  -0.1284 13  ALA D CB  
1538 N N   . SER B 14  ? 1.3891 0.6967 1.0496 0.0614  0.2231  -0.1487 14  SER D N   
1539 C CA  . SER B 14  ? 1.4160 0.6791 1.0081 0.0593  0.2289  -0.1564 14  SER D CA  
1540 C C   . SER B 14  ? 1.4449 0.7625 1.0045 0.0549  0.1949  -0.1537 14  SER D C   
1541 O O   . SER B 14  ? 1.4288 0.8044 1.0186 0.0461  0.1733  -0.1479 14  SER D O   
1542 C CB  . SER B 14  ? 1.4938 0.6871 1.0552 0.0393  0.2528  -0.1625 14  SER D CB  
1543 O OG  . SER B 14  ? 1.6356 0.7862 1.2353 0.0453  0.2855  -0.1619 14  SER D OG  
1544 N N   . VAL B 15  ? 1.3952 0.6973 0.8942 0.0629  0.1907  -0.1569 15  VAL D N   
1545 C CA  . VAL B 15  ? 1.3645 0.7294 0.8368 0.0605  0.1569  -0.1533 15  VAL D CA  
1546 C C   . VAL B 15  ? 1.4583 0.8310 0.9174 0.0226  0.1459  -0.1616 15  VAL D C   
1547 O O   . VAL B 15  ? 1.5075 0.8125 0.9391 0.0024  0.1679  -0.1712 15  VAL D O   
1548 C CB  . VAL B 15  ? 1.4166 0.7758 0.8272 0.0858  0.1521  -0.1509 15  VAL D CB  
1549 C CG1 . VAL B 15  ? 1.4064 0.7587 0.8290 0.1214  0.1679  -0.1428 15  VAL D CG1 
1550 C CG2 . VAL B 15  ? 1.4711 0.7499 0.8148 0.0786  0.1707  -0.1619 15  VAL D CG2 
1551 N N   . GLY B 16  ? 1.3846 0.8353 0.8655 0.0118  0.1174  -0.1581 16  GLY D N   
1552 C CA  . GLY B 16  ? 1.3777 0.8477 0.8529 -0.0284 0.1078  -0.1681 16  GLY D CA  
1553 C C   . GLY B 16  ? 1.4067 0.8577 0.9274 -0.0438 0.1262  -0.1672 16  GLY D C   
1554 O O   . GLY B 16  ? 1.4634 0.8850 0.9660 -0.0777 0.1383  -0.1776 16  GLY D O   
1555 N N   . ASP B 17  ? 1.2837 0.7460 0.8572 -0.0190 0.1312  -0.1548 17  ASP D N   
1556 C CA  . ASP B 17  ? 1.2557 0.7038 0.8715 -0.0245 0.1472  -0.1501 17  ASP D CA  
1557 C C   . ASP B 17  ? 1.2746 0.7902 0.9301 -0.0249 0.1277  -0.1424 17  ASP D C   
1558 O O   . ASP B 17  ? 1.2480 0.8206 0.9176 -0.0077 0.1055  -0.1355 17  ASP D O   
1559 C CB  . ASP B 17  ? 1.2725 0.6867 0.9208 0.0023  0.1670  -0.1427 17  ASP D CB  
1560 C CG  . ASP B 17  ? 1.5621 0.8956 1.1883 0.0001  0.1996  -0.1482 17  ASP D CG  
1561 O OD1 . ASP B 17  ? 1.6240 0.9185 1.1937 -0.0126 0.2048  -0.1583 17  ASP D OD1 
1562 O OD2 . ASP B 17  ? 1.6681 0.9789 1.3329 0.0124  0.2201  -0.1419 17  ASP D OD2 
1563 N N   . ARG B 18  ? 1.2166 0.7178 0.8870 -0.0416 0.1413  -0.1420 18  ARG D N   
1564 C CA  . ARG B 18  ? 1.1697 0.7210 0.8749 -0.0406 0.1293  -0.1344 18  ARG D CA  
1565 C C   . ARG B 18  ? 1.1960 0.7504 0.9423 -0.0078 0.1307  -0.1199 18  ARG D C   
1566 O O   . ARG B 18  ? 1.2243 0.7342 0.9802 0.0023  0.1512  -0.1165 18  ARG D O   
1567 C CB  . ARG B 18  ? 1.1528 0.6768 0.8488 -0.0698 0.1494  -0.1401 18  ARG D CB  
1568 C CG  . ARG B 18  ? 1.1347 0.7029 0.8574 -0.0727 0.1410  -0.1350 18  ARG D CG  
1569 C CD  . ARG B 18  ? 1.2516 0.8083 0.9503 -0.1144 0.1562  -0.1497 18  ARG D CD  
1570 N NE  . ARG B 18  ? 1.4203 1.0213 1.1442 -0.1190 0.1495  -0.1469 18  ARG D NE  
1571 C CZ  . ARG B 18  ? 1.7856 1.3651 1.5270 -0.1030 0.1653  -0.1344 18  ARG D CZ  
1572 N NH1 . ARG B 18  ? 1.6626 1.1876 1.4039 -0.0795 0.1855  -0.1223 18  ARG D NH1 
1573 N NH2 . ARG B 18  ? 1.7756 1.3902 1.5348 -0.1080 0.1613  -0.1329 18  ARG D NH2 
1574 N N   . VAL B 19  ? 1.0950 0.7034 0.8647 0.0085  0.1097  -0.1118 19  VAL D N   
1575 C CA  . VAL B 19  ? 1.0584 0.6778 0.8621 0.0350  0.1069  -0.1007 19  VAL D CA  
1576 C C   . VAL B 19  ? 1.0925 0.7445 0.9164 0.0358  0.0981  -0.0918 19  VAL D C   
1577 O O   . VAL B 19  ? 1.0667 0.7543 0.8856 0.0252  0.0865  -0.0926 19  VAL D O   
1578 C CB  . VAL B 19  ? 1.0842 0.7210 0.8844 0.0544  0.0976  -0.1001 19  VAL D CB  
1579 C CG1 . VAL B 19  ? 1.0561 0.7142 0.8856 0.0741  0.0921  -0.0916 19  VAL D CG1 
1580 C CG2 . VAL B 19  ? 1.1023 0.6925 0.8841 0.0574  0.1139  -0.1085 19  VAL D CG2 
1581 N N   . THR B 20  ? 1.0635 0.7046 0.9099 0.0495  0.1043  -0.0830 20  THR D N   
1582 C CA  . THR B 20  ? 1.0597 0.7215 0.9185 0.0545  0.0982  -0.0734 20  THR D CA  
1583 C C   . THR B 20  ? 1.1343 0.8124 1.0157 0.0791  0.0880  -0.0641 20  THR D C   
1584 O O   . THR B 20  ? 1.1540 0.8173 1.0509 0.0915  0.0944  -0.0609 20  THR D O   
1585 C CB  . THR B 20  ? 1.2261 0.8529 1.0767 0.0445  0.1187  -0.0714 20  THR D CB  
1586 O OG1 . THR B 20  ? 1.2913 0.8989 1.1160 0.0150  0.1306  -0.0845 20  THR D OG1 
1587 C CG2 . THR B 20  ? 1.2367 0.8762 1.0914 0.0489  0.1168  -0.0623 20  THR D CG2 
1588 N N   . ILE B 21  ? 1.0912 0.8012 0.9739 0.0852  0.0736  -0.0597 21  ILE D N   
1589 C CA  . ILE B 21  ? 1.0883 0.8124 0.9834 0.1025  0.0641  -0.0533 21  ILE D CA  
1590 C C   . ILE B 21  ? 1.1481 0.8742 1.0417 0.1070  0.0617  -0.0425 21  ILE D C   
1591 O O   . ILE B 21  ? 1.1353 0.8655 1.0193 0.0967  0.0644  -0.0409 21  ILE D O   
1592 C CB  . ILE B 21  ? 1.1271 0.8710 1.0137 0.1071  0.0572  -0.0549 21  ILE D CB  
1593 C CG1 . ILE B 21  ? 1.1341 0.8660 1.0144 0.1062  0.0645  -0.0652 21  ILE D CG1 
1594 C CG2 . ILE B 21  ? 1.1412 0.8942 1.0319 0.1183  0.0504  -0.0507 21  ILE D CG2 
1595 C CD1 . ILE B 21  ? 1.1688 0.9125 1.0281 0.1121  0.0645  -0.0645 21  ILE D CD1 
1596 N N   . THR B 22  ? 1.1164 0.8405 1.0191 0.1224  0.0575  -0.0357 22  THR D N   
1597 C CA  . THR B 22  ? 1.1251 0.8440 1.0188 0.1322  0.0557  -0.0240 22  THR D CA  
1598 C C   . THR B 22  ? 1.2124 0.9499 1.1002 0.1399  0.0409  -0.0207 22  THR D C   
1599 O O   . THR B 22  ? 1.2241 0.9770 1.1200 0.1409  0.0330  -0.0275 22  THR D O   
1600 C CB  . THR B 22  ? 1.2011 0.9027 1.1008 0.1474  0.0630  -0.0161 22  THR D CB  
1601 O OG1 . THR B 22  ? 1.1895 0.8578 1.0754 0.1380  0.0849  -0.0153 22  THR D OG1 
1602 C CG2 . THR B 22  ? 1.1970 0.9055 1.0903 0.1691  0.0515  -0.0035 22  THR D CG2 
1603 N N   . CYS B 23  ? 1.1735 0.9033 1.0432 0.1431  0.0414  -0.0117 23  CYS D N   
1604 C CA  . CYS B 23  ? 1.1644 0.8994 1.0180 0.1495  0.0319  -0.0066 23  CYS D CA  
1605 C C   . CYS B 23  ? 1.2059 0.9180 1.0388 0.1616  0.0346  0.0058  23  CYS D C   
1606 O O   . CYS B 23  ? 1.2148 0.9071 1.0408 0.1572  0.0500  0.0095  23  CYS D O   
1607 C CB  . CYS B 23  ? 1.1640 0.9077 1.0105 0.1403  0.0366  -0.0076 23  CYS D CB  
1608 S SG  . CYS B 23  ? 1.2185 0.9562 1.0370 0.1464  0.0333  -0.0012 23  CYS D SG  
1609 N N   . ARG B 24  ? 1.1411 0.8551 0.9620 0.1760  0.0208  0.0108  24  ARG D N   
1610 C CA  . ARG B 24  ? 1.1419 0.8310 0.9346 0.1935  0.0215  0.0241  24  ARG D CA  
1611 C C   . ARG B 24  ? 1.2026 0.8885 0.9647 0.1957  0.0097  0.0269  24  ARG D C   
1612 O O   . ARG B 24  ? 1.1835 0.8942 0.9483 0.1917  -0.0070 0.0190  24  ARG D O   
1613 C CB  . ARG B 24  ? 1.1062 0.8028 0.9084 0.2137  0.0147  0.0300  24  ARG D CB  
1614 C CG  . ARG B 24  ? 1.3501 1.0109 1.1232 0.2377  0.0263  0.0466  24  ARG D CG  
1615 C CD  . ARG B 24  ? 1.6340 1.3061 1.4234 0.2613  0.0253  0.0551  24  ARG D CD  
1616 N NE  . ARG B 24  ? 1.8262 1.5504 1.6329 0.2733  -0.0056 0.0545  24  ARG D NE  
1617 C CZ  . ARG B 24  ? 1.8657 1.6341 1.7160 0.2637  -0.0168 0.0427  24  ARG D CZ  
1618 N NH1 . ARG B 24  ? 1.5974 1.3588 1.4733 0.2451  -0.0005 0.0322  24  ARG D NH1 
1619 N NH2 . ARG B 24  ? 1.5662 1.3863 1.4331 0.2711  -0.0439 0.0398  24  ARG D NH2 
1620 N N   . ALA B 25  ? 1.1771 0.8281 0.9081 0.1984  0.0226  0.0362  25  ALA D N   
1621 C CA  . ALA B 25  ? 1.2004 0.8332 0.8929 0.2000  0.0184  0.0407  25  ALA D CA  
1622 C C   . ALA B 25  ? 1.3007 0.9122 0.9560 0.2223  0.0083  0.0515  25  ALA D C   
1623 O O   . ALA B 25  ? 1.3175 0.9107 0.9701 0.2387  0.0176  0.0603  25  ALA D O   
1624 C CB  . ALA B 25  ? 1.2188 0.8250 0.9007 0.1920  0.0416  0.0460  25  ALA D CB  
1625 N N   . SER B 26  ? 1.2764 0.8870 0.8975 0.2235  -0.0087 0.0509  26  SER D N   
1626 C CA  . SER B 26  ? 1.3103 0.9052 0.8889 0.2468  -0.0230 0.0617  26  SER D CA  
1627 C C   . SER B 26  ? 1.4451 0.9744 0.9788 0.2613  0.0013  0.0771  26  SER D C   
1628 O O   . SER B 26  ? 1.4607 0.9658 0.9637 0.2884  0.0010  0.0900  26  SER D O   
1629 C CB  . SER B 26  ? 1.3446 0.9547 0.8922 0.2378  -0.0471 0.0538  26  SER D CB  
1630 O OG  . SER B 26  ? 1.4769 1.0435 0.9858 0.2232  -0.0307 0.0537  26  SER D OG  
1631 N N   . GLU B 27  ? 1.4304 0.9312 0.9609 0.2452  0.0251  0.0762  27  GLU D N   
1632 C CA  . GLU B 27  ? 1.4609 0.8996 0.9546 0.2527  0.0536  0.0878  27  GLU D CA  
1633 C C   . GLU B 27  ? 1.4607 0.9026 0.9982 0.2375  0.0812  0.0841  27  GLU D C   
1634 O O   . GLU B 27  ? 1.4160 0.9049 1.0018 0.2206  0.0757  0.0737  27  GLU D O   
1635 C CB  . GLU B 27  ? 1.5026 0.9098 0.9524 0.2441  0.0572  0.0897  27  GLU D CB  
1636 C CG  . GLU B 27  ? 1.6739 1.0067 1.0650 0.2568  0.0812  0.1031  27  GLU D CG  
1637 C CD  . GLU B 27  ? 2.0416 1.3405 1.3841 0.2478  0.0844  0.1049  27  GLU D CD  
1638 O OE1 . GLU B 27  ? 1.7683 1.0889 1.0911 0.2406  0.0577  0.0971  27  GLU D OE1 
1639 O OE2 . GLU B 27  ? 2.1581 1.4065 1.4812 0.2461  0.1168  0.1133  27  GLU D OE2 
1640 N N   . ASN B 28  ? 1.4212 0.8132 0.9393 0.2426  0.1118  0.0914  28  ASN D N   
1641 C CA  . ASN B 28  ? 1.3975 0.7947 0.9545 0.2237  0.1396  0.0858  28  ASN D CA  
1642 C C   . ASN B 28  ? 1.4128 0.8263 0.9842 0.2081  0.1450  0.0853  28  ASN D C   
1643 O O   . ASN B 28  ? 1.4106 0.7857 0.9424 0.2143  0.1530  0.0942  28  ASN D O   
1644 C CB  . ASN B 28  ? 1.4682 0.8026 0.9970 0.2312  0.1760  0.0914  28  ASN D CB  
1645 C CG  . ASN B 28  ? 1.7526 1.0959 1.3228 0.2056  0.2071  0.0814  28  ASN D CG  
1646 O OD1 . ASN B 28  ? 1.6262 1.0168 1.2398 0.1847  0.2053  0.0751  28  ASN D OD1 
1647 N ND2 . ASN B 28  ? 1.6932 0.9908 1.2479 0.2066  0.2388  0.0797  28  ASN D ND2 
1648 N N   . ILE B 29  ? 1.3520 0.8222 0.9758 0.1907  0.1393  0.0762  29  ILE D N   
1649 C CA  . ILE B 29  ? 1.3216 0.8237 0.9726 0.1786  0.1460  0.0767  29  ILE D CA  
1650 C C   . ILE B 29  ? 1.3686 0.8869 1.0584 0.1635  0.1687  0.0715  29  ILE D C   
1651 O O   . ILE B 29  ? 1.3987 0.9218 1.1025 0.1565  0.1693  0.0622  29  ILE D O   
1652 C CB  . ILE B 29  ? 1.3219 0.8737 0.9950 0.1740  0.1221  0.0698  29  ILE D CB  
1653 C CG1 . ILE B 29  ? 1.2952 0.8912 1.0113 0.1639  0.1109  0.0574  29  ILE D CG1 
1654 C CG2 . ILE B 29  ? 1.3320 0.8655 0.9652 0.1834  0.1012  0.0695  29  ILE D CG2 
1655 C CD1 . ILE B 29  ? 1.3053 0.9441 1.0422 0.1596  0.0941  0.0503  29  ILE D CD1 
1656 N N   . TYR B 30  ? 1.2931 0.8101 0.9938 0.1582  0.1918  0.0774  30  TYR D N   
1657 C CA  . TYR B 30  ? 1.2598 0.7915 0.9955 0.1397  0.2148  0.0690  30  TYR D CA  
1658 C C   . TYR B 30  ? 1.2742 0.8880 1.0694 0.1223  0.2068  0.0615  30  TYR D C   
1659 O O   . TYR B 30  ? 1.2597 0.9067 1.0882 0.1138  0.2234  0.0646  30  TYR D O   
1660 C CB  . TYR B 30  ? 1.2845 0.7644 0.9997 0.1427  0.2496  0.0775  30  TYR D CB  
1661 C CG  . TYR B 30  ? 1.3418 0.7366 0.9911 0.1612  0.2579  0.0833  30  TYR D CG  
1662 C CD1 . TYR B 30  ? 1.3897 0.7501 0.9872 0.1828  0.2388  0.0944  30  TYR D CD1 
1663 C CD2 . TYR B 30  ? 1.3791 0.7278 1.0135 0.1572  0.2855  0.0771  30  TYR D CD2 
1664 C CE1 . TYR B 30  ? 1.4533 0.7445 0.9879 0.2031  0.2411  0.1007  30  TYR D CE1 
1665 C CE2 . TYR B 30  ? 1.4476 0.7157 1.0148 0.1810  0.2945  0.0857  30  TYR D CE2 
1666 C CZ  . TYR B 30  ? 1.5807 0.8242 1.0988 0.2056  0.2695  0.0984  30  TYR D CZ  
1667 O OH  . TYR B 30  ? 1.6188 0.7900 1.0680 0.2320  0.2748  0.1080  30  TYR D OH  
1668 N N   . SER B 31  ? 1.2042 0.8523 1.0115 0.1193  0.1804  0.0528  31  SER D N   
1669 C CA  . SER B 31  ? 1.1614 0.8817 1.0117 0.1070  0.1649  0.0448  31  SER D CA  
1670 C C   . SER B 31  ? 1.1390 0.8889 0.9917 0.1226  0.1539  0.0568  31  SER D C   
1671 O O   . SER B 31  ? 1.1048 0.9135 0.9876 0.1187  0.1428  0.0539  31  SER D O   
1672 C CB  . SER B 31  ? 1.2451 1.0124 1.1395 0.0814  0.1794  0.0342  31  SER D CB  
1673 O OG  . SER B 31  ? 1.4949 1.2968 1.4142 0.0859  0.1912  0.0462  31  SER D OG  
1674 N N   . ASN B 32  ? 1.3388 0.5928 0.8462 -0.0217 0.2533  -0.0247 32  ASN D N   
1675 C CA  . ASN B 32  ? 1.2870 0.5996 0.8396 -0.0239 0.2374  -0.0265 32  ASN D CA  
1676 C C   . ASN B 32  ? 1.2634 0.6369 0.8453 -0.0068 0.1925  -0.0225 32  ASN D C   
1677 O O   . ASN B 32  ? 1.2500 0.6223 0.8033 0.0051  0.1693  -0.0174 32  ASN D O   
1678 C CB  . ASN B 32  ? 1.3367 0.5915 0.8263 -0.0234 0.2505  -0.0221 32  ASN D CB  
1679 C CG  . ASN B 32  ? 1.6270 0.8300 1.0991 -0.0447 0.3018  -0.0292 32  ASN D CG  
1680 O OD1 . ASN B 32  ? 1.5313 0.7726 1.0613 -0.0610 0.3237  -0.0397 32  ASN D OD1 
1681 N ND2 . ASN B 32  ? 1.5174 0.6329 0.9114 -0.0444 0.3244  -0.0250 32  ASN D ND2 
1682 N N   . LEU B 33  ? 1.1739 0.5986 0.8103 -0.0087 0.1828  -0.0272 33  LEU D N   
1683 C CA  . LEU B 33  ? 1.1411 0.6208 0.8079 0.0034  0.1496  -0.0261 33  LEU D CA  
1684 C C   . LEU B 33  ? 1.1392 0.6803 0.8737 -0.0102 0.1469  -0.0336 33  LEU D C   
1685 O O   . LEU B 33  ? 1.1357 0.6831 0.8974 -0.0228 0.1627  -0.0405 33  LEU D O   
1686 C CB  . LEU B 33  ? 1.1540 0.6183 0.7988 0.0231  0.1392  -0.0227 33  LEU D CB  
1687 C CG  . LEU B 33  ? 1.1994 0.7225 0.8762 0.0374  0.1084  -0.0236 33  LEU D CG  
1688 C CD1 . LEU B 33  ? 1.2242 0.7412 0.8653 0.0611  0.0838  -0.0185 33  LEU D CD1 
1689 C CD2 . LEU B 33  ? 1.2452 0.7802 0.9417 0.0433  0.1102  -0.0268 33  LEU D CD2 
1690 N N   . ALA B 34  ? 1.0391 0.6225 0.7956 -0.0084 0.1259  -0.0334 34  ALA D N   
1691 C CA  . ALA B 34  ? 0.9810 0.6110 0.7846 -0.0165 0.1196  -0.0381 34  ALA D CA  
1692 C C   . ALA B 34  ? 1.0075 0.6709 0.8224 -0.0107 0.0992  -0.0388 34  ALA D C   
1693 O O   . ALA B 34  ? 0.9993 0.6629 0.7958 -0.0007 0.0870  -0.0370 34  ALA D O   
1694 C CB  . ALA B 34  ? 0.9829 0.6176 0.7931 -0.0222 0.1230  -0.0381 34  ALA D CB  
1695 N N   . TRP B 35  ? 0.9498 0.6419 0.7943 -0.0165 0.0960  -0.0430 35  TRP D N   
1696 C CA  . TRP B 35  ? 0.9252 0.6462 0.7813 -0.0154 0.0846  -0.0458 35  TRP D CA  
1697 C C   . TRP B 35  ? 0.9484 0.6845 0.8146 -0.0256 0.0816  -0.0471 35  TRP D C   
1698 O O   . TRP B 35  ? 0.9491 0.6820 0.8238 -0.0284 0.0845  -0.0472 35  TRP D O   
1699 C CB  . TRP B 35  ? 0.9125 0.6341 0.7756 -0.0123 0.0881  -0.0495 35  TRP D CB  
1700 C CG  . TRP B 35  ? 0.9472 0.6452 0.7905 0.0027  0.0917  -0.0476 35  TRP D CG  
1701 C CD1 . TRP B 35  ? 1.0078 0.6651 0.8300 0.0035  0.1055  -0.0465 35  TRP D CD1 
1702 C CD2 . TRP B 35  ? 0.9361 0.6465 0.7758 0.0210  0.0828  -0.0476 35  TRP D CD2 
1703 N NE1 . TRP B 35  ? 1.0177 0.6489 0.8120 0.0238  0.1057  -0.0432 35  TRP D NE1 
1704 C CE2 . TRP B 35  ? 1.0143 0.6828 0.8230 0.0382  0.0892  -0.0437 35  TRP D CE2 
1705 C CE3 . TRP B 35  ? 0.9256 0.6800 0.7870 0.0245  0.0715  -0.0522 35  TRP D CE3 
1706 C CZ2 . TRP B 35  ? 1.0081 0.6780 0.8063 0.0660  0.0804  -0.0425 35  TRP D CZ2 
1707 C CZ3 . TRP B 35  ? 0.9417 0.7111 0.8058 0.0481  0.0635  -0.0540 35  TRP D CZ3 
1708 C CH2 . TRP B 35  ? 0.9779 0.7056 0.8102 0.0723  0.0657  -0.0482 35  TRP D CH2 
1709 N N   . PHE B 36  ? 0.8818 0.6333 0.7456 -0.0309 0.0763  -0.0494 36  PHE D N   
1710 C CA  . PHE B 36  ? 0.8691 0.6184 0.7262 -0.0417 0.0776  -0.0501 36  PHE D CA  
1711 C C   . PHE B 36  ? 0.9297 0.6959 0.7906 -0.0490 0.0791  -0.0561 36  PHE D C   
1712 O O   . PHE B 36  ? 0.9122 0.7036 0.7876 -0.0476 0.0783  -0.0618 36  PHE D O   
1713 C CB  . PHE B 36  ? 0.8917 0.6284 0.7301 -0.0501 0.0788  -0.0497 36  PHE D CB  
1714 C CG  . PHE B 36  ? 0.9163 0.6296 0.7444 -0.0434 0.0823  -0.0447 36  PHE D CG  
1715 C CD1 . PHE B 36  ? 0.9377 0.6472 0.7580 -0.0384 0.0795  -0.0443 36  PHE D CD1 
1716 C CD2 . PHE B 36  ? 0.9474 0.6400 0.7709 -0.0394 0.0894  -0.0407 36  PHE D CD2 
1717 C CE1 . PHE B 36  ? 0.9574 0.6365 0.7606 -0.0343 0.0884  -0.0403 36  PHE D CE1 
1718 C CE2 . PHE B 36  ? 0.9893 0.6624 0.8078 -0.0338 0.0986  -0.0383 36  PHE D CE2 
1719 C CZ  . PHE B 36  ? 0.9705 0.6339 0.7767 -0.0336 0.1004  -0.0382 36  PHE D CZ  
1720 N N   . GLN B 37  ? 0.9106 0.6607 0.7558 -0.0546 0.0820  -0.0552 37  GLN D N   
1721 C CA  . GLN B 37  ? 0.9168 0.6684 0.7521 -0.0655 0.0897  -0.0609 37  GLN D CA  
1722 C C   . GLN B 37  ? 0.9573 0.6854 0.7636 -0.0811 0.0981  -0.0614 37  GLN D C   
1723 O O   . GLN B 37  ? 0.9528 0.6468 0.7326 -0.0763 0.0959  -0.0539 37  GLN D O   
1724 C CB  . GLN B 37  ? 0.9473 0.6817 0.7677 -0.0605 0.0870  -0.0594 37  GLN D CB  
1725 C CG  . GLN B 37  ? 1.0304 0.7540 0.8285 -0.0721 0.0991  -0.0652 37  GLN D CG  
1726 C CD  . GLN B 37  ? 1.3474 1.0378 1.1093 -0.0680 0.0924  -0.0620 37  GLN D CD  
1727 O OE1 . GLN B 37  ? 1.4120 1.0723 1.1431 -0.0629 0.0842  -0.0550 37  GLN D OE1 
1728 N NE2 . GLN B 37  ? 1.1569 0.8483 0.9162 -0.0680 0.0947  -0.0675 37  GLN D NE2 
1729 N N   . GLN B 38  ? 0.9226 0.6689 0.7347 -0.0996 0.1092  -0.0718 38  GLN D N   
1730 C CA  . GLN B 38  ? 0.9539 0.6707 0.7325 -0.1221 0.1228  -0.0754 38  GLN D CA  
1731 C C   . GLN B 38  ? 1.0807 0.7885 0.8426 -0.1418 0.1436  -0.0845 38  GLN D C   
1732 O O   . GLN B 38  ? 1.0557 0.8108 0.8552 -0.1512 0.1515  -0.0975 38  GLN D O   
1733 C CB  . GLN B 38  ? 0.9359 0.6769 0.7305 -0.1361 0.1210  -0.0837 38  GLN D CB  
1734 C CG  . GLN B 38  ? 0.9460 0.6401 0.6946 -0.1605 0.1365  -0.0868 38  GLN D CG  
1735 C CD  . GLN B 38  ? 1.1485 0.8695 0.9105 -0.1837 0.1359  -0.1007 38  GLN D CD  
1736 O OE1 . GLN B 38  ? 0.9994 0.7863 0.8111 -0.1852 0.1249  -0.1122 38  GLN D OE1 
1737 N NE2 . GLN B 38  ? 1.0867 0.7546 0.8009 -0.2007 0.1467  -0.1009 38  GLN D NE2 
1738 N N   . LYS B 39  ? 1.1077 0.7528 0.8107 -0.1453 0.1534  -0.0778 39  LYS D N   
1739 C CA  . LYS B 39  ? 1.1309 0.7528 0.8038 -0.1663 0.1784  -0.0862 39  LYS D CA  
1740 C C   . LYS B 39  ? 1.2065 0.8098 0.8578 -0.2028 0.2046  -0.0985 39  LYS D C   
1741 O O   . LYS B 39  ? 1.1605 0.7487 0.8009 -0.2072 0.2001  -0.0962 39  LYS D O   
1742 C CB  . LYS B 39  ? 1.1993 0.7553 0.8075 -0.1517 0.1759  -0.0741 39  LYS D CB  
1743 C CG  . LYS B 39  ? 1.2417 0.8189 0.8732 -0.1208 0.1474  -0.0653 39  LYS D CG  
1744 C CD  . LYS B 39  ? 1.2799 0.8558 0.9025 -0.1191 0.1508  -0.0693 39  LYS D CD  
1745 C CE  . LYS B 39  ? 1.5022 1.0356 1.0790 -0.0973 0.1278  -0.0577 39  LYS D CE  
1746 N NZ  . LYS B 39  ? 1.6910 1.1746 1.2047 -0.1020 0.1362  -0.0593 39  LYS D NZ  
1747 N N   . PRO B 40  ? 1.2515 0.8581 0.8992 -0.2328 0.2350  -0.1143 40  PRO D N   
1748 C CA  . PRO B 40  ? 1.2714 0.8639 0.9025 -0.2754 0.2636  -0.1305 40  PRO D CA  
1749 C C   . PRO B 40  ? 1.4290 0.9208 0.9703 -0.2806 0.2722  -0.1185 40  PRO D C   
1750 O O   . PRO B 40  ? 1.4933 0.9061 0.9611 -0.2655 0.2763  -0.1038 40  PRO D O   
1751 C CB  . PRO B 40  ? 1.2876 0.8821 0.9155 -0.3047 0.3013  -0.1477 40  PRO D CB  
1752 C CG  . PRO B 40  ? 1.3361 0.9736 1.0041 -0.2755 0.2886  -0.1442 40  PRO D CG  
1753 C CD  . PRO B 40  ? 1.2910 0.9116 0.9479 -0.2325 0.2493  -0.1207 40  PRO D CD  
1754 N N   . GLY B 41  ? 1.3915 0.8840 0.9351 -0.2982 0.2723  -0.1248 41  GLY D N   
1755 C CA  . GLY B 41  ? 1.4531 0.8473 0.9112 -0.3035 0.2836  -0.1155 41  GLY D CA  
1756 C C   . GLY B 41  ? 1.5200 0.8971 0.9713 -0.2606 0.2523  -0.0947 41  GLY D C   
1757 O O   . GLY B 41  ? 1.5324 0.8914 0.9713 -0.2670 0.2515  -0.0959 41  GLY D O   
1758 N N   . LYS B 42  ? 1.4426 0.8283 0.9045 -0.2189 0.2281  -0.0781 42  LYS D N   
1759 C CA  . LYS B 42  ? 1.4162 0.7942 0.8808 -0.1767 0.2006  -0.0604 42  LYS D CA  
1760 C C   . LYS B 42  ? 1.3855 0.8300 0.9171 -0.1704 0.1821  -0.0636 42  LYS D C   
1761 O O   . LYS B 42  ? 1.3523 0.8587 0.9339 -0.1926 0.1823  -0.0784 42  LYS D O   
1762 C CB  . LYS B 42  ? 1.4441 0.8312 0.9150 -0.1429 0.1798  -0.0487 42  LYS D CB  
1763 C CG  . LYS B 42  ? 1.6259 0.9242 1.0076 -0.1324 0.1876  -0.0383 42  LYS D CG  
1764 C CD  . LYS B 42  ? 1.8063 1.1241 1.1957 -0.1134 0.1697  -0.0344 42  LYS D CD  
1765 C CE  . LYS B 42  ? 2.0335 1.3834 1.4569 -0.0715 0.1324  -0.0237 42  LYS D CE  
1766 N NZ  . LYS B 42  ? 1.9811 1.4224 1.4989 -0.0703 0.1186  -0.0302 42  LYS D NZ  
1767 N N   . ALA B 43  ? 1.3190 0.7491 0.8490 -0.1381 0.1664  -0.0503 43  ALA D N   
1768 C CA  . ALA B 43  ? 1.2670 0.7413 0.8443 -0.1284 0.1523  -0.0508 43  ALA D CA  
1769 C C   . ALA B 43  ? 1.2440 0.7831 0.8831 -0.1078 0.1317  -0.0481 43  ALA D C   
1770 O O   . ALA B 43  ? 1.2435 0.7814 0.8819 -0.0917 0.1245  -0.0422 43  ALA D O   
1771 C CB  . ALA B 43  ? 1.3004 0.7240 0.8455 -0.1043 0.1529  -0.0396 43  ALA D CB  
1772 N N   . PRO B 44  ? 1.1366 0.7237 0.8204 -0.1071 0.1219  -0.0522 44  PRO D N   
1773 C CA  . PRO B 44  ? 1.0867 0.7200 0.8178 -0.0882 0.1070  -0.0495 44  PRO D CA  
1774 C C   . PRO B 44  ? 1.1346 0.7550 0.8682 -0.0614 0.0996  -0.0393 44  PRO D C   
1775 O O   . PRO B 44  ? 1.1400 0.7272 0.8528 -0.0498 0.1033  -0.0335 44  PRO D O   
1776 C CB  . PRO B 44  ? 1.0832 0.7431 0.8372 -0.0893 0.1008  -0.0531 44  PRO D CB  
1777 C CG  . PRO B 44  ? 1.1509 0.8020 0.8837 -0.1143 0.1074  -0.0625 44  PRO D CG  
1778 C CD  . PRO B 44  ? 1.1420 0.7358 0.8258 -0.1240 0.1235  -0.0602 44  PRO D CD  
1779 N N   . LYS B 45  ? 1.0690 0.7179 0.8297 -0.0517 0.0896  -0.0392 45  LYS D N   
1780 C CA  . LYS B 45  ? 1.0536 0.7089 0.8306 -0.0306 0.0786  -0.0349 45  LYS D CA  
1781 C C   . LYS B 45  ? 1.0634 0.7562 0.8845 -0.0288 0.0757  -0.0386 45  LYS D C   
1782 O O   . LYS B 45  ? 1.0578 0.7688 0.8894 -0.0375 0.0764  -0.0429 45  LYS D O   
1783 C CB  . LYS B 45  ? 1.1079 0.7553 0.8664 -0.0270 0.0698  -0.0346 45  LYS D CB  
1784 C CG  . LYS B 45  ? 1.4415 1.1118 1.2257 -0.0095 0.0522  -0.0352 45  LYS D CG  
1785 C CD  . LYS B 45  ? 1.5441 1.2115 1.3096 -0.0118 0.0417  -0.0383 45  LYS D CD  
1786 C CE  . LYS B 45  ? 1.4125 1.1145 1.2121 -0.0043 0.0238  -0.0448 45  LYS D CE  
1787 N NZ  . LYS B 45  ? 1.2988 0.9896 1.0691 -0.0091 0.0137  -0.0490 45  LYS D NZ  
1788 N N   . LEU B 46  ? 0.9740 0.6749 0.8187 -0.0172 0.0758  -0.0379 46  LEU D N   
1789 C CA  . LEU B 46  ? 0.9153 0.6379 0.7913 -0.0190 0.0794  -0.0421 46  LEU D CA  
1790 C C   . LEU B 46  ? 1.0048 0.7486 0.8983 -0.0209 0.0703  -0.0477 46  LEU D C   
1791 O O   . LEU B 46  ? 1.0141 0.7672 0.9137 -0.0143 0.0586  -0.0497 46  LEU D O   
1792 C CB  . LEU B 46  ? 0.8883 0.6126 0.7852 -0.0109 0.0888  -0.0430 46  LEU D CB  
1793 C CG  . LEU B 46  ? 0.9084 0.6451 0.8320 -0.0167 0.0997  -0.0491 46  LEU D CG  
1794 C CD1 . LEU B 46  ? 0.9217 0.6318 0.8186 -0.0228 0.1108  -0.0458 46  LEU D CD1 
1795 C CD2 . LEU B 46  ? 0.8772 0.6295 0.8357 -0.0104 0.1104  -0.0547 46  LEU D CD2 
1796 N N   . LEU B 47  ? 0.9813 0.7285 0.8768 -0.0281 0.0745  -0.0505 47  LEU D N   
1797 C CA  . LEU B 47  ? 0.9666 0.7233 0.8703 -0.0325 0.0707  -0.0571 47  LEU D CA  
1798 C C   . LEU B 47  ? 1.0366 0.7957 0.9605 -0.0372 0.0803  -0.0630 47  LEU D C   
1799 O O   . LEU B 47  ? 1.0262 0.8019 0.9715 -0.0427 0.0762  -0.0717 47  LEU D O   
1800 C CB  . LEU B 47  ? 0.9610 0.7126 0.8486 -0.0349 0.0736  -0.0573 47  LEU D CB  
1801 C CG  . LEU B 47  ? 1.0264 0.7770 0.9002 -0.0386 0.0687  -0.0610 47  LEU D CG  
1802 C CD1 . LEU B 47  ? 1.0639 0.8060 0.9186 -0.0379 0.0608  -0.0575 47  LEU D CD1 
1803 C CD2 . LEU B 47  ? 1.0592 0.8116 0.9260 -0.0392 0.0768  -0.0625 47  LEU D CD2 
1804 N N   . VAL B 48  ? 1.0177 0.7578 0.9308 -0.0364 0.0931  -0.0597 48  VAL D N   
1805 C CA  . VAL B 48  ? 1.0308 0.7544 0.9462 -0.0429 0.1093  -0.0645 48  VAL D CA  
1806 C C   . VAL B 48  ? 1.0906 0.7951 0.9974 -0.0405 0.1228  -0.0598 48  VAL D C   
1807 O O   . VAL B 48  ? 1.1108 0.8017 0.9932 -0.0321 0.1189  -0.0518 48  VAL D O   
1808 C CB  . VAL B 48  ? 1.0958 0.7929 0.9849 -0.0406 0.1148  -0.0644 48  VAL D CB  
1809 C CG1 . VAL B 48  ? 1.1108 0.7715 0.9855 -0.0485 0.1365  -0.0684 48  VAL D CG1 
1810 C CG2 . VAL B 48  ? 1.0824 0.7911 0.9745 -0.0446 0.1064  -0.0707 48  VAL D CG2 
1811 N N   . TYR B 49  ? 1.0376 0.7419 0.9639 -0.0500 0.1398  -0.0670 49  TYR D N   
1812 C CA  . TYR B 49  ? 1.0616 0.7384 0.9738 -0.0504 0.1603  -0.0645 49  TYR D CA  
1813 C C   . TYR B 49  ? 1.1730 0.8105 1.0658 -0.0634 0.1868  -0.0701 49  TYR D C   
1814 O O   . TYR B 49  ? 1.1803 0.8234 1.0856 -0.0757 0.1900  -0.0794 49  TYR D O   
1815 C CB  . TYR B 49  ? 1.0538 0.7601 1.0045 -0.0490 0.1653  -0.0692 49  TYR D CB  
1816 C CG  . TYR B 49  ? 1.0743 0.8216 1.0809 -0.0609 0.1732  -0.0853 49  TYR D CG  
1817 C CD1 . TYR B 49  ? 1.0716 0.8654 1.1128 -0.0593 0.1489  -0.0919 49  TYR D CD1 
1818 C CD2 . TYR B 49  ? 1.1055 0.8462 1.1297 -0.0754 0.2054  -0.0960 49  TYR D CD2 
1819 C CE1 . TYR B 49  ? 1.0532 0.8947 1.1505 -0.0712 0.1504  -0.1101 49  TYR D CE1 
1820 C CE2 . TYR B 49  ? 1.0944 0.8856 1.1815 -0.0906 0.2129  -0.1157 49  TYR D CE2 
1821 C CZ  . TYR B 49  ? 1.1906 1.0369 1.3170 -0.0879 0.1822  -0.1233 49  TYR D CZ  
1822 O OH  . TYR B 49  ? 1.2378 1.1436 1.4302 -0.1034 0.1834  -0.1457 49  TYR D OH  
1823 N N   . ALA B 50  ? 1.1599 0.7476 1.0114 -0.0623 0.2071  -0.0648 50  ALA D N   
1824 C CA  . ALA B 50  ? 1.1966 0.7251 1.0087 -0.0741 0.2375  -0.0679 50  ALA D CA  
1825 C C   . ALA B 50  ? 1.2879 0.7906 1.0731 -0.0728 0.2331  -0.0674 50  ALA D C   
1826 O O   . ALA B 50  ? 1.3051 0.7953 1.0973 -0.0936 0.2539  -0.0795 50  ALA D O   
1827 C CB  . ALA B 50  ? 1.1874 0.7307 1.0415 -0.0990 0.2697  -0.0847 50  ALA D CB  
1828 N N   . ALA B 51  ? 1.2415 0.7410 1.0004 -0.0493 0.2065  -0.0557 51  ALA D N   
1829 C CA  . ALA B 51  ? 1.2432 0.7191 0.9734 -0.0368 0.1987  -0.0526 51  ALA D CA  
1830 C C   . ALA B 51  ? 1.2805 0.7919 1.0487 -0.0486 0.1933  -0.0632 51  ALA D C   
1831 O O   . ALA B 51  ? 1.2739 0.8041 1.0446 -0.0336 0.1739  -0.0600 51  ALA D O   
1832 C CB  . ALA B 51  ? 1.2965 0.6849 0.9565 -0.0342 0.2246  -0.0491 51  ALA D CB  
1833 N N   . THR B 52  ? 1.2176 0.7370 1.0132 -0.0765 0.2117  -0.0779 52  THR D N   
1834 C CA  . THR B 52  ? 1.1907 0.7313 1.0102 -0.0932 0.2090  -0.0914 52  THR D CA  
1835 C C   . THR B 52  ? 1.1860 0.8002 1.0722 -0.1087 0.1941  -0.1039 52  THR D C   
1836 O O   . THR B 52  ? 1.1733 0.8095 1.0741 -0.1181 0.1822  -0.1136 52  THR D O   
1837 C CB  . THR B 52  ? 1.3180 0.7963 1.1031 -0.1166 0.2439  -0.1024 52  THR D CB  
1838 O OG1 . THR B 52  ? 1.2997 0.7897 1.1142 -0.1423 0.2671  -0.1142 52  THR D OG1 
1839 C CG2 . THR B 52  ? 1.3465 0.7347 1.0499 -0.0959 0.2599  -0.0886 52  THR D CG2 
1840 N N   . ASN B 53  ? 1.1272 0.7749 1.0487 -0.1094 0.1949  -0.1044 53  ASN D N   
1841 C CA  . ASN B 53  ? 1.0831 0.8005 1.0678 -0.1168 0.1792  -0.1163 53  ASN D CA  
1842 C C   . ASN B 53  ? 1.0967 0.8504 1.0906 -0.0960 0.1440  -0.1072 53  ASN D C   
1843 O O   . ASN B 53  ? 1.1045 0.8489 1.0801 -0.0773 0.1374  -0.0926 53  ASN D O   
1844 C CB  . ASN B 53  ? 1.0849 0.8208 1.1036 -0.1213 0.1980  -0.1212 53  ASN D CB  
1845 C CG  . ASN B 53  ? 1.4061 1.1335 1.4418 -0.1525 0.2319  -0.1404 53  ASN D CG  
1846 O OD1 . ASN B 53  ? 1.4913 1.1602 1.4878 -0.1598 0.2650  -0.1372 53  ASN D OD1 
1847 N ND2 . ASN B 53  ? 1.2369 1.0185 1.3258 -0.1734 0.2245  -0.1619 53  ASN D ND2 
1848 N N   . LEU B 54  ? 0.9976 0.7869 1.0131 -0.1017 0.1226  -0.1172 54  LEU D N   
1849 C CA  . LEU B 54  ? 0.9716 0.7817 0.9828 -0.0833 0.0931  -0.1087 54  LEU D CA  
1850 C C   . LEU B 54  ? 1.0122 0.8611 1.0589 -0.0692 0.0813  -0.1075 54  LEU D C   
1851 O O   . LEU B 54  ? 0.9750 0.8629 1.0697 -0.0766 0.0837  -0.1215 54  LEU D O   
1852 C CB  . LEU B 54  ? 0.9500 0.7725 0.9563 -0.0920 0.0732  -0.1192 54  LEU D CB  
1853 C CG  . LEU B 54  ? 0.9930 0.7739 0.9546 -0.0976 0.0798  -0.1182 54  LEU D CG  
1854 C CD1 . LEU B 54  ? 0.9671 0.7570 0.9172 -0.1043 0.0592  -0.1277 54  LEU D CD1 
1855 C CD2 . LEU B 54  ? 1.0378 0.7936 0.9684 -0.0790 0.0828  -0.1014 54  LEU D CD2 
1856 N N   . ALA B 55  ? 1.0051 0.8440 1.0291 -0.0494 0.0695  -0.0929 55  ALA D N   
1857 C CA  . ALA B 55  ? 1.0041 0.8647 1.0476 -0.0306 0.0593  -0.0895 55  ALA D CA  
1858 C C   . ALA B 55  ? 1.1025 0.9952 1.1588 -0.0213 0.0290  -0.0962 55  ALA D C   
1859 O O   . ALA B 55  ? 1.0960 0.9752 1.1210 -0.0260 0.0148  -0.0960 55  ALA D O   
1860 C CB  . ALA B 55  ? 1.0357 0.8605 1.0378 -0.0172 0.0612  -0.0730 55  ALA D CB  
1861 N N   . ASP B 56  ? 1.1029 1.0386 1.2044 -0.0063 0.0186  -0.1033 56  ASP D N   
1862 C CA  . ASP B 56  ? 1.1174 1.0880 1.2308 0.0098  -0.0173 -0.1100 56  ASP D CA  
1863 C C   . ASP B 56  ? 1.2137 1.1365 1.2560 0.0261  -0.0366 -0.0942 56  ASP D C   
1864 O O   . ASP B 56  ? 1.2499 1.1341 1.2572 0.0425  -0.0289 -0.0787 56  ASP D O   
1865 C CB  . ASP B 56  ? 1.1260 1.1495 1.2987 0.0343  -0.0252 -0.1172 56  ASP D CB  
1866 C CG  . ASP B 56  ? 1.4056 1.3980 1.5620 0.0602  -0.0095 -0.1014 56  ASP D CG  
1867 O OD1 . ASP B 56  ? 1.4684 1.4056 1.5803 0.0500  0.0148  -0.0883 56  ASP D OD1 
1868 O OD2 . ASP B 56  ? 1.4761 1.5000 1.6643 0.0917  -0.0220 -0.1036 56  ASP D OD2 
1869 N N   . GLY B 57  ? 1.1625 1.0807 1.1778 0.0168  -0.0564 -0.0997 57  GLY D N   
1870 C CA  . GLY B 57  ? 1.1928 1.0594 1.1337 0.0259  -0.0699 -0.0878 57  GLY D CA  
1871 C C   . GLY B 57  ? 1.2579 1.0873 1.1601 0.0009  -0.0522 -0.0867 57  GLY D C   
1872 O O   . GLY B 57  ? 1.2883 1.0873 1.1387 -0.0011 -0.0637 -0.0860 57  GLY D O   
1873 N N   . VAL B 58  ? 1.1819 1.0108 1.1060 -0.0157 -0.0234 -0.0869 58  VAL D N   
1874 C CA  . VAL B 58  ? 1.1784 0.9790 1.0774 -0.0334 -0.0039 -0.0863 58  VAL D CA  
1875 C C   . VAL B 58  ? 1.2368 1.0409 1.1304 -0.0500 -0.0116 -0.1009 58  VAL D C   
1876 O O   . VAL B 58  ? 1.2147 1.0515 1.1481 -0.0609 -0.0157 -0.1149 58  VAL D O   
1877 C CB  . VAL B 58  ? 1.1941 0.9940 1.1162 -0.0393 0.0223  -0.0830 58  VAL D CB  
1878 C CG1 . VAL B 58  ? 1.1953 0.9717 1.0971 -0.0500 0.0389  -0.0835 58  VAL D CG1 
1879 C CG2 . VAL B 58  ? 1.1947 0.9831 1.1098 -0.0267 0.0293  -0.0702 58  VAL D CG2 
1880 N N   . PRO B 59  ? 1.2229 0.9919 1.0659 -0.0549 -0.0111 -0.1003 59  PRO D N   
1881 C CA  . PRO B 59  ? 1.2223 0.9852 1.0497 -0.0717 -0.0177 -0.1154 59  PRO D CA  
1882 C C   . PRO B 59  ? 1.2594 1.0164 1.1024 -0.0897 0.0059  -0.1244 59  PRO D C   
1883 O O   . PRO B 59  ? 1.2700 1.0135 1.1176 -0.0859 0.0298  -0.1161 59  PRO D O   
1884 C CB  . PRO B 59  ? 1.2865 1.0031 1.0478 -0.0702 -0.0162 -0.1106 59  PRO D CB  
1885 C CG  . PRO B 59  ? 1.3596 1.0619 1.1052 -0.0549 -0.0102 -0.0946 59  PRO D CG  
1886 C CD  . PRO B 59  ? 1.2760 1.0073 1.0723 -0.0485 -0.0012 -0.0883 59  PRO D CD  
1887 N N   . SER B 60  ? 1.2076 0.9692 1.0506 -0.1091 -0.0022 -0.1424 60  SER D N   
1888 C CA  . SER B 60  ? 1.2032 0.9466 1.0479 -0.1315 0.0200  -0.1555 60  SER D CA  
1889 C C   . SER B 60  ? 1.2539 0.9485 1.0661 -0.1253 0.0511  -0.1463 60  SER D C   
1890 O O   . SER B 60  ? 1.2633 0.9402 1.0829 -0.1309 0.0744  -0.1480 60  SER D O   
1891 C CB  . SER B 60  ? 1.2652 1.0026 1.0862 -0.1543 0.0043  -0.1764 60  SER D CB  
1892 O OG  . SER B 60  ? 1.3608 1.1527 1.2157 -0.1585 -0.0305 -0.1888 60  SER D OG  
1893 N N   . ARG B 61  ? 1.1966 0.8679 0.9709 -0.1127 0.0524  -0.1377 61  ARG D N   
1894 C CA  . ARG B 61  ? 1.1895 0.8272 0.9403 -0.1019 0.0792  -0.1312 61  ARG D CA  
1895 C C   . ARG B 61  ? 1.1751 0.8251 0.9555 -0.0842 0.0930  -0.1178 61  ARG D C   
1896 O O   . ARG B 61  ? 1.1811 0.8110 0.9510 -0.0720 0.1126  -0.1148 61  ARG D O   
1897 C CB  . ARG B 61  ? 1.1858 0.8059 0.8978 -0.0963 0.0793  -0.1282 61  ARG D CB  
1898 C CG  . ARG B 61  ? 1.2903 0.9314 1.0093 -0.0856 0.0675  -0.1160 61  ARG D CG  
1899 C CD  . ARG B 61  ? 1.3528 0.9629 1.0198 -0.0871 0.0711  -0.1161 61  ARG D CD  
1900 N NE  . ARG B 61  ? 1.2859 0.9005 0.9459 -0.0799 0.0648  -0.1051 61  ARG D NE  
1901 C CZ  . ARG B 61  ? 1.4284 1.0335 1.0599 -0.0773 0.0399  -0.1018 61  ARG D CZ  
1902 N NH1 . ARG B 61  ? 1.1958 0.8006 0.8134 -0.0812 0.0135  -0.1103 61  ARG D NH1 
1903 N NH2 . ARG B 61  ? 1.3803 0.9744 0.9941 -0.0704 0.0405  -0.0912 61  ARG D NH2 
1904 N N   . PHE B 62  ? 1.0519 0.7340 0.8665 -0.0807 0.0819  -0.1109 62  PHE D N   
1905 C CA  . PHE B 62  ? 1.0212 0.7106 0.8557 -0.0669 0.0915  -0.1000 62  PHE D CA  
1906 C C   . PHE B 62  ? 1.1306 0.8060 0.9739 -0.0746 0.1034  -0.1043 62  PHE D C   
1907 O O   . PHE B 62  ? 1.1347 0.8216 0.9936 -0.0926 0.0982  -0.1150 62  PHE D O   
1908 C CB  . PHE B 62  ? 1.0094 0.7278 0.8636 -0.0606 0.0780  -0.0909 62  PHE D CB  
1909 C CG  . PHE B 62  ? 1.0248 0.7438 0.8605 -0.0559 0.0736  -0.0864 62  PHE D CG  
1910 C CD1 . PHE B 62  ? 1.0708 0.7836 0.8834 -0.0612 0.0598  -0.0896 62  PHE D CD1 
1911 C CD2 . PHE B 62  ? 1.0426 0.7659 0.8798 -0.0477 0.0842  -0.0807 62  PHE D CD2 
1912 C CE1 . PHE B 62  ? 1.0974 0.7959 0.8797 -0.0599 0.0622  -0.0857 62  PHE D CE1 
1913 C CE2 . PHE B 62  ? 1.0851 0.8066 0.9050 -0.0501 0.0871  -0.0799 62  PHE D CE2 
1914 C CZ  . PHE B 62  ? 1.0815 0.7845 0.8696 -0.0570 0.0788  -0.0816 62  PHE D CZ  
1915 N N   . SER B 63  ? 1.1067 0.7549 0.9369 -0.0611 0.1202  -0.0978 63  SER D N   
1916 C CA  . SER B 63  ? 1.1180 0.7316 0.9372 -0.0669 0.1380  -0.1000 63  SER D CA  
1917 C C   . SER B 63  ? 1.2066 0.8059 1.0177 -0.0463 0.1442  -0.0867 63  SER D C   
1918 O O   . SER B 63  ? 1.2069 0.8032 1.0064 -0.0223 0.1416  -0.0786 63  SER D O   
1919 C CB  . SER B 63  ? 1.1740 0.7367 0.9553 -0.0724 0.1557  -0.1088 63  SER D CB  
1920 O OG  . SER B 63  ? 1.3013 0.8160 1.0485 -0.0497 0.1726  -0.1003 63  SER D OG  
1921 N N   . GLY B 64  ? 1.1933 0.7838 1.0094 -0.0559 0.1529  -0.0864 64  GLY D N   
1922 C CA  . GLY B 64  ? 1.2317 0.7961 1.0260 -0.0385 0.1591  -0.0745 64  GLY D CA  
1923 C C   . GLY B 64  ? 1.3871 0.8788 1.1318 -0.0386 0.1845  -0.0748 64  GLY D C   
1924 O O   . GLY B 64  ? 1.4141 0.8836 1.1552 -0.0650 0.2029  -0.0875 64  GLY D O   
1925 N N   . SER B 65  ? 1.3911 0.8417 1.0926 -0.0092 0.1855  -0.0623 65  SER D N   
1926 C CA  . SER B 65  ? 1.4516 0.8134 1.0865 -0.0028 0.2108  -0.0597 65  SER D CA  
1927 C C   . SER B 65  ? 1.5509 0.8709 1.1367 0.0288  0.2064  -0.0441 65  SER D C   
1928 O O   . SER B 65  ? 1.5306 0.8993 1.1390 0.0496  0.1793  -0.0368 65  SER D O   
1929 C CB  . SER B 65  ? 1.5067 0.8346 1.1148 0.0086  0.2180  -0.0634 65  SER D CB  
1930 O OG  . SER B 65  ? 1.5988 0.9536 1.2126 0.0474  0.1967  -0.0547 65  SER D OG  
1931 N N   . GLY B 66  ? 1.5568 0.6639 1.1857 -0.0624 0.2596  0.0658  66  GLY D N   
1932 C CA  . GLY B 66  ? 1.6075 0.6558 1.1814 -0.0391 0.2565  0.0926  66  GLY D CA  
1933 C C   . GLY B 66  ? 1.7235 0.7357 1.2582 -0.0555 0.2807  0.0944  66  GLY D C   
1934 O O   . GLY B 66  ? 1.6842 0.7339 1.2453 -0.0844 0.2944  0.0723  66  GLY D O   
1935 N N   . SER B 67  ? 1.7765 0.7193 1.2463 -0.0349 0.2851  0.1198  67  SER D N   
1936 C CA  . SER B 67  ? 1.8490 0.7442 1.2710 -0.0536 0.3150  0.1216  67  SER D CA  
1937 C C   . SER B 67  ? 1.9858 0.8636 1.3566 -0.0307 0.2970  0.1450  67  SER D C   
1938 O O   . SER B 67  ? 2.0105 0.8667 1.3511 -0.0507 0.3185  0.1420  67  SER D O   
1939 C CB  . SER B 67  ? 1.9725 0.7693 1.3427 -0.0659 0.3632  0.1246  67  SER D CB  
1940 O OG  . SER B 67  ? 2.1069 0.9151 1.5198 -0.0908 0.3858  0.0990  67  SER D OG  
1941 N N   . GLY B 68  ? 1.9532 0.8440 1.3152 0.0085  0.2600  0.1637  68  GLY D N   
1942 C CA  . GLY B 68  ? 1.9676 0.8520 1.2818 0.0329  0.2395  0.1823  68  GLY D CA  
1943 C C   . GLY B 68  ? 2.0030 0.8986 1.3119 0.0780  0.2041  0.1970  68  GLY D C   
1944 O O   . GLY B 68  ? 2.0520 0.8952 1.3371 0.0987  0.2121  0.2094  68  GLY D O   
1945 N N   . THR B 69  ? 1.8678 0.8349 1.2049 0.0914  0.1680  0.1910  69  THR D N   
1946 C CA  . THR B 69  ? 1.8214 0.8301 1.1738 0.1293  0.1303  0.1927  69  THR D CA  
1947 C C   . THR B 69  ? 1.7829 0.8253 1.2009 0.1268  0.1245  0.1782  69  THR D C   
1948 O O   . THR B 69  ? 1.7464 0.8597 1.2159 0.1269  0.1012  0.1614  69  THR D O   
1949 C CB  . THR B 69  ? 1.9247 0.8867 1.2053 0.1765  0.1173  0.2173  69  THR D CB  
1950 O OG1 . THR B 69  ? 2.0181 0.8989 1.2646 0.1890  0.1412  0.2339  69  THR D OG1 
1951 C CG2 . THR B 69  ? 1.9306 0.8655 1.1411 0.1809  0.1196  0.2311  69  THR D CG2 
1952 N N   . ASP B 70  ? 1.7022 0.6940 1.1186 0.1203  0.1495  0.1814  70  ASP D N   
1953 C CA  . ASP B 70  ? 1.6525 0.6732 1.1268 0.1164  0.1465  0.1665  70  ASP D CA  
1954 C C   . ASP B 70  ? 1.6300 0.6831 1.1544 0.0739  0.1637  0.1457  70  ASP D C   
1955 O O   . ASP B 70  ? 1.6725 0.6886 1.1827 0.0483  0.1952  0.1430  70  ASP D O   
1956 C CB  . ASP B 70  ? 1.7083 0.6605 1.1543 0.1389  0.1618  0.1791  70  ASP D CB  
1957 C CG  . ASP B 70  ? 1.9004 0.8331 1.3052 0.1928  0.1375  0.1983  70  ASP D CG  
1958 O OD1 . ASP B 70  ? 1.8916 0.8842 1.3040 0.2113  0.1034  0.1948  70  ASP D OD1 
1959 O OD2 . ASP B 70  ? 2.0064 0.8653 1.3712 0.2181  0.1536  0.2150  70  ASP D OD2 
1960 N N   . TYR B 71  ? 1.4772 0.6000 1.0572 0.0672  0.1445  0.1294  71  TYR D N   
1961 C CA  . TYR B 71  ? 1.4218 0.5842 1.0464 0.0362  0.1537  0.1113  71  TYR D CA  
1962 C C   . TYR B 71  ? 1.4102 0.6142 1.0800 0.0392  0.1399  0.0987  71  TYR D C   
1963 O O   . TYR B 71  ? 1.3805 0.6060 1.0592 0.0596  0.1188  0.0984  71  TYR D O   
1964 C CB  . TYR B 71  ? 1.4118 0.6123 1.0453 0.0236  0.1480  0.1069  71  TYR D CB  
1965 C CG  . TYR B 71  ? 1.4474 0.6128 1.0403 0.0151  0.1642  0.1149  71  TYR D CG  
1966 C CD1 . TYR B 71  ? 1.4969 0.6379 1.0457 0.0342  0.1550  0.1299  71  TYR D CD1 
1967 C CD2 . TYR B 71  ? 1.4474 0.6101 1.0463 -0.0128 0.1889  0.1039  71  TYR D CD2 
1968 C CE1 . TYR B 71  ? 1.5385 0.6395 1.0418 0.0250  0.1733  0.1377  71  TYR D CE1 
1969 C CE2 . TYR B 71  ? 1.4898 0.6172 1.0512 -0.0245 0.2088  0.1076  71  TYR D CE2 
1970 C CZ  . TYR B 71  ? 1.5986 0.6898 1.1087 -0.0062 0.2022  0.1263  71  TYR D CZ  
1971 O OH  . TYR B 71  ? 1.5283 0.5795 0.9937 -0.0188 0.2239  0.1306  71  TYR D OH  
1972 N N   . THR B 72  ? 1.3466 0.5647 1.0441 0.0180  0.1532  0.0849  72  THR D N   
1973 C CA  . THR B 72  ? 1.3207 0.5758 1.0557 0.0164  0.1441  0.0720  72  THR D CA  
1974 C C   . THR B 72  ? 1.3413 0.6395 1.1003 -0.0054 0.1476  0.0593  72  THR D C   
1975 O O   . THR B 72  ? 1.3470 0.6448 1.1045 -0.0234 0.1639  0.0525  72  THR D O   
1976 C CB  . THR B 72  ? 1.4340 0.6622 1.1756 0.0197  0.1549  0.0667  72  THR D CB  
1977 O OG1 . THR B 72  ? 1.4494 0.6815 1.2040 -0.0074 0.1762  0.0522  72  THR D OG1 
1978 C CG2 . THR B 72  ? 1.4027 0.5708 1.1088 0.0434  0.1604  0.0823  72  THR D CG2 
1979 N N   . LEU B 73  ? 1.2477 0.5826 1.0264 -0.0026 0.1340  0.0544  73  LEU D N   
1980 C CA  . LEU B 73  ? 1.2082 0.5800 1.0017 -0.0149 0.1352  0.0455  73  LEU D CA  
1981 C C   . LEU B 73  ? 1.2534 0.6327 1.0626 -0.0200 0.1376  0.0341  73  LEU D C   
1982 O O   . LEU B 73  ? 1.2492 0.6215 1.0650 -0.0106 0.1314  0.0331  73  LEU D O   
1983 C CB  . LEU B 73  ? 1.1918 0.5841 0.9852 -0.0076 0.1252  0.0500  73  LEU D CB  
1984 C CG  . LEU B 73  ? 1.2091 0.6305 1.0079 -0.0111 0.1252  0.0449  73  LEU D CG  
1985 C CD1 . LEU B 73  ? 1.1911 0.6369 0.9883 -0.0126 0.1269  0.0445  73  LEU D CD1 
1986 C CD2 . LEU B 73  ? 1.1856 0.6050 0.9799 -0.0038 0.1224  0.0478  73  LEU D CD2 
1987 N N   . THR B 74  ? 1.2118 0.6112 1.0296 -0.0357 0.1470  0.0215  74  THR D N   
1988 C CA  . THR B 74  ? 1.2058 0.6157 1.0371 -0.0442 0.1512  0.0078  74  THR D CA  
1989 C C   . THR B 74  ? 1.2556 0.7099 1.0880 -0.0514 0.1478  -0.0007 74  THR D C   
1990 O O   . THR B 74  ? 1.2403 0.7228 1.0707 -0.0548 0.1473  -0.0040 74  THR D O   
1991 C CB  . THR B 74  ? 1.3168 0.7028 1.1550 -0.0567 0.1699  -0.0040 74  THR D CB  
1992 O OG1 . THR B 74  ? 1.3324 0.7517 1.1788 -0.0781 0.1810  -0.0228 74  THR D OG1 
1993 C CG2 . THR B 74  ? 1.3214 0.6578 1.1429 -0.0497 0.1795  0.0074  74  THR D CG2 
1994 N N   . ILE B 75  ? 1.2225 0.6844 1.0564 -0.0526 0.1461  -0.0060 75  ILE D N   
1995 C CA  . ILE B 75  ? 1.2079 0.7060 1.0325 -0.0568 0.1436  -0.0129 75  ILE D CA  
1996 C C   . ILE B 75  ? 1.2582 0.7669 1.0968 -0.0763 0.1553  -0.0348 75  ILE D C   
1997 O O   . ILE B 75  ? 1.2619 0.7467 1.1109 -0.0796 0.1616  -0.0397 75  ILE D O   
1998 C CB  . ILE B 75  ? 1.2480 0.7397 1.0508 -0.0446 0.1380  -0.0012 75  ILE D CB  
1999 C CG1 . ILE B 75  ? 1.2495 0.7182 1.0447 -0.0294 0.1331  0.0162  75  ILE D CG1 
2000 C CG2 . ILE B 75  ? 1.2586 0.7847 1.0375 -0.0395 0.1331  -0.0010 75  ILE D CG2 
2001 C CD1 . ILE B 75  ? 1.2084 0.6556 0.9834 -0.0227 0.1376  0.0234  75  ILE D CD1 
2002 N N   . SER B 76  ? 1.1972 0.7454 1.0403 -0.0899 0.1596  -0.0519 76  SER D N   
2003 C CA  . SER B 76  ? 1.1902 0.7533 1.0480 -0.1132 0.1746  -0.0780 76  SER D CA  
2004 C C   . SER B 76  ? 1.2959 0.8668 1.1444 -0.1171 0.1741  -0.0841 76  SER D C   
2005 O O   . SER B 76  ? 1.2875 0.8397 1.1521 -0.1310 0.1884  -0.0982 76  SER D O   
2006 C CB  . SER B 76  ? 1.1981 0.8151 1.0642 -0.1287 0.1791  -0.1011 76  SER D CB  
2007 O OG  . SER B 76  ? 1.2753 0.9489 1.1237 -0.1178 0.1613  -0.1020 76  SER D OG  
2008 N N   . SER B 77  ? 1.2960 0.8886 1.1149 -0.1037 0.1603  -0.0732 77  SER D N   
2009 C CA  . SER B 77  ? 1.3078 0.8979 1.1055 -0.1069 0.1630  -0.0757 77  SER D CA  
2010 C C   . SER B 77  ? 1.3559 0.9283 1.1173 -0.0837 0.1531  -0.0500 77  SER D C   
2011 O O   . SER B 77  ? 1.3503 0.9477 1.0866 -0.0658 0.1405  -0.0386 77  SER D O   
2012 C CB  . SER B 77  ? 1.3554 0.9962 1.1439 -0.1225 0.1652  -0.0988 77  SER D CB  
2013 O OG  . SER B 77  ? 1.5438 1.2299 1.3020 -0.1047 0.1480  -0.0917 77  SER D OG  
2014 N N   . LEU B 78  ? 1.3109 0.8393 1.0737 -0.0830 0.1608  -0.0432 78  LEU D N   
2015 C CA  . LEU B 78  ? 1.3219 0.8183 1.0542 -0.0679 0.1616  -0.0238 78  LEU D CA  
2016 C C   . LEU B 78  ? 1.3829 0.8809 1.0611 -0.0613 0.1642  -0.0164 78  LEU D C   
2017 O O   . LEU B 78  ? 1.3682 0.8726 1.0358 -0.0766 0.1730  -0.0306 78  LEU D O   
2018 C CB  . LEU B 78  ? 1.3270 0.7896 1.0819 -0.0775 0.1738  -0.0323 78  LEU D CB  
2019 C CG  . LEU B 78  ? 1.4188 0.8506 1.1658 -0.0668 0.1767  -0.0199 78  LEU D CG  
2020 C CD1 . LEU B 78  ? 1.4149 0.8512 1.1781 -0.0526 0.1630  -0.0074 78  LEU D CD1 
2021 C CD2 . LEU B 78  ? 1.4927 0.9096 1.2678 -0.0788 0.1885  -0.0386 78  LEU D CD2 
2022 N N   . GLN B 79  ? 1.3574 0.8494 0.9976 -0.0361 0.1567  0.0063  79  GLN D N   
2023 C CA  . GLN B 79  ? 1.3630 0.8474 0.9385 -0.0201 0.1586  0.0200  79  GLN D CA  
2024 C C   . GLN B 79  ? 1.4059 0.8206 0.9442 -0.0152 0.1797  0.0360  79  GLN D C   
2025 O O   . GLN B 79  ? 1.3940 0.7845 0.9626 -0.0199 0.1859  0.0359  79  GLN D O   
2026 C CB  . GLN B 79  ? 1.3773 0.9004 0.9325 0.0118  0.1372  0.0347  79  GLN D CB  
2027 C CG  . GLN B 79  ? 1.5943 1.1954 1.1857 0.0045  0.1197  0.0122  79  GLN D CG  
2028 C CD  . GLN B 79  ? 1.7701 1.4077 1.3441 -0.0094 0.1199  -0.0069 79  GLN D CD  
2029 O OE1 . GLN B 79  ? 1.6575 1.3139 1.1775 0.0124  0.1110  0.0020  79  GLN D OE1 
2030 N NE2 . GLN B 79  ? 1.7102 1.3571 1.3264 -0.0437 0.1306  -0.0333 79  GLN D NE2 
2031 N N   . PRO B 80  ? 1.3889 0.7676 0.8577 -0.0050 0.1933  0.0497  80  PRO D N   
2032 C CA  . PRO B 80  ? 1.4192 0.7210 0.8507 -0.0049 0.2224  0.0619  80  PRO D CA  
2033 C C   . PRO B 80  ? 1.4668 0.7431 0.9002 0.0165  0.2220  0.0808  80  PRO D C   
2034 O O   . PRO B 80  ? 1.4778 0.7149 0.9281 0.0017  0.2427  0.0742  80  PRO D O   
2035 C CB  . PRO B 80  ? 1.4815 0.7482 0.8257 0.0085  0.2356  0.0779  80  PRO D CB  
2036 C CG  . PRO B 80  ? 1.5102 0.8396 0.8623 -0.0012 0.2180  0.0610  80  PRO D CG  
2037 C CD  . PRO B 80  ? 1.4144 0.8164 0.8303 0.0050  0.1868  0.0526  80  PRO D CD  
2038 N N   . GLU B 81  ? 1.4062 0.7136 0.8299 0.0493  0.1984  0.0988  81  GLU D N   
2039 C CA  . GLU B 81  ? 1.3889 0.6788 0.8158 0.0725  0.1964  0.1162  81  GLU D CA  
2040 C C   . GLU B 81  ? 1.3822 0.6886 0.8796 0.0529  0.1922  0.1009  81  GLU D C   
2041 O O   . GLU B 81  ? 1.4151 0.6878 0.9128 0.0594  0.2033  0.1093  81  GLU D O   
2042 C CB  . GLU B 81  ? 1.3926 0.7270 0.8015 0.1128  0.1694  0.1328  81  GLU D CB  
2043 C CG  . GLU B 81  ? 1.5202 0.9447 0.9702 0.1068  0.1399  0.1128  81  GLU D CG  
2044 C CD  . GLU B 81  ? 1.9871 1.4460 1.3877 0.1263  0.1271  0.1158  81  GLU D CD  
2045 O OE1 . GLU B 81  ? 1.9906 1.4588 1.3868 0.1011  0.1325  0.0997  81  GLU D OE1 
2046 O OE2 . GLU B 81  ? 1.9690 1.4485 1.3344 0.1688  0.1113  0.1330  81  GLU D OE2 
2047 N N   . ASP B 82  ? 1.2599 0.6124 0.8114 0.0299  0.1791  0.0787  82  ASP D N   
2048 C CA  . ASP B 82  ? 1.2078 0.5766 0.8178 0.0163  0.1722  0.0666  82  ASP D CA  
2049 C C   . ASP B 82  ? 1.2516 0.5851 0.8793 -0.0036 0.1916  0.0540  82  ASP D C   
2050 O O   . ASP B 82  ? 1.2091 0.5555 0.8784 -0.0104 0.1848  0.0450  82  ASP D O   
2051 C CB  . ASP B 82  ? 1.1921 0.6124 0.8450 0.0026  0.1555  0.0493  82  ASP D CB  
2052 C CG  . ASP B 82  ? 1.3157 0.7861 0.9613 0.0142  0.1386  0.0495  82  ASP D CG  
2053 O OD1 . ASP B 82  ? 1.3377 0.8150 0.9550 0.0405  0.1312  0.0655  82  ASP D OD1 
2054 O OD2 . ASP B 82  ? 1.3877 0.8935 1.0584 -0.0027 0.1339  0.0307  82  ASP D OD2 
2055 N N   . PHE B 83  ? 1.2666 0.5585 0.8623 -0.0136 0.2168  0.0503  83  PHE D N   
2056 C CA  . PHE B 83  ? 1.2704 0.5416 0.8907 -0.0351 0.2365  0.0297  83  PHE D CA  
2057 C C   . PHE B 83  ? 1.3605 0.6023 0.9723 -0.0268 0.2479  0.0385  83  PHE D C   
2058 O O   . PHE B 83  ? 1.4102 0.6048 0.9707 -0.0144 0.2671  0.0562  83  PHE D O   
2059 C CB  . PHE B 83  ? 1.3007 0.5433 0.8999 -0.0567 0.2639  0.0132  83  PHE D CB  
2060 C CG  . PHE B 83  ? 1.2888 0.5676 0.9080 -0.0676 0.2518  -0.0003 83  PHE D CG  
2061 C CD1 . PHE B 83  ? 1.2920 0.6054 0.9723 -0.0827 0.2437  -0.0263 83  PHE D CD1 
2062 C CD2 . PHE B 83  ? 1.3173 0.5979 0.8936 -0.0601 0.2482  0.0122  83  PHE D CD2 
2063 C CE1 . PHE B 83  ? 1.2815 0.6224 0.9811 -0.0928 0.2369  -0.0397 83  PHE D CE1 
2064 C CE2 . PHE B 83  ? 1.3315 0.6474 0.9283 -0.0739 0.2401  -0.0044 83  PHE D CE2 
2065 C CZ  . PHE B 83  ? 1.2720 0.6139 0.9311 -0.0914 0.2368  -0.0302 83  PHE D CZ  
2066 N N   . ALA B 84  ? 1.2896 0.5597 0.9475 -0.0293 0.2341  0.0290  84  ALA D N   
2067 C CA  . ALA B 84  ? 1.2936 0.5476 0.9526 -0.0247 0.2420  0.0324  84  ALA D CA  
2068 C C   . ALA B 84  ? 1.3375 0.6288 1.0480 -0.0345 0.2283  0.0122  84  ALA D C   
2069 O O   . ALA B 84  ? 1.3360 0.6589 1.0786 -0.0416 0.2146  -0.0028 84  ALA D O   
2070 C CB  . ALA B 84  ? 1.3129 0.5676 0.9517 0.0019  0.2281  0.0600  84  ALA D CB  
2071 N N   . THR B 85  ? 1.2964 0.5831 1.0117 -0.0323 0.2322  0.0120  85  THR D N   
2072 C CA  . THR B 85  ? 1.2518 0.5738 1.0052 -0.0366 0.2179  -0.0042 85  THR D CA  
2073 C C   . THR B 85  ? 1.2055 0.5428 0.9598 -0.0190 0.1938  0.0176  85  THR D C   
2074 O O   . THR B 85  ? 1.1860 0.5041 0.9185 -0.0085 0.1993  0.0351  85  THR D O   
2075 C CB  . THR B 85  ? 1.4166 0.7247 1.1716 -0.0517 0.2443  -0.0251 85  THR D CB  
2076 O OG1 . THR B 85  ? 1.4528 0.7280 1.1921 -0.0700 0.2783  -0.0414 85  THR D OG1 
2077 C CG2 . THR B 85  ? 1.3785 0.7349 1.1734 -0.0582 0.2297  -0.0515 85  THR D CG2 
2078 N N   . TYR B 86  ? 1.1265 0.4942 0.9040 -0.0153 0.1703  0.0157  86  TYR D N   
2079 C CA  . TYR B 86  ? 1.1319 0.5094 0.9083 -0.0037 0.1530  0.0325  86  TYR D CA  
2080 C C   . TYR B 86  ? 1.2076 0.5977 0.9940 -0.0025 0.1444  0.0268  86  TYR D C   
2081 O O   . TYR B 86  ? 1.1978 0.6048 1.0010 -0.0058 0.1402  0.0086  86  TYR D O   
2082 C CB  . TYR B 86  ? 1.1383 0.5284 0.9222 -0.0009 0.1393  0.0373  86  TYR D CB  
2083 C CG  . TYR B 86  ? 1.1743 0.5601 0.9436 -0.0010 0.1454  0.0431  86  TYR D CG  
2084 C CD1 . TYR B 86  ? 1.1932 0.5712 0.9597 -0.0097 0.1562  0.0325  86  TYR D CD1 
2085 C CD2 . TYR B 86  ? 1.1850 0.5784 0.9415 0.0081  0.1410  0.0566  86  TYR D CD2 
2086 C CE1 . TYR B 86  ? 1.1685 0.5410 0.9119 -0.0083 0.1618  0.0392  86  TYR D CE1 
2087 C CE2 . TYR B 86  ? 1.1967 0.5950 0.9360 0.0122  0.1429  0.0607  86  TYR D CE2 
2088 C CZ  . TYR B 86  ? 1.2086 0.5935 0.9373 0.0046  0.1530  0.0540  86  TYR D CZ  
2089 O OH  . TYR B 86  ? 1.1744 0.5640 0.8780 0.0105  0.1540  0.0595  86  TYR D OH  
2090 N N   . TYR B 87  ? 1.1792 0.5652 0.9550 0.0030  0.1421  0.0397  87  TYR D N   
2091 C CA  . TYR B 87  ? 1.1690 0.5640 0.9455 0.0035  0.1355  0.0359  87  TYR D CA  
2092 C C   . TYR B 87  ? 1.2325 0.6247 0.9995 0.0092  0.1267  0.0511  87  TYR D C   
2093 O O   . TYR B 87  ? 1.2105 0.5978 0.9732 0.0109  0.1314  0.0612  87  TYR D O   
2094 C CB  . TYR B 87  ? 1.1925 0.5784 0.9626 -0.0026 0.1528  0.0301  87  TYR D CB  
2095 C CG  . TYR B 87  ? 1.2379 0.6195 1.0142 -0.0147 0.1721  0.0095  87  TYR D CG  
2096 C CD1 . TYR B 87  ? 1.2574 0.6653 1.0489 -0.0244 0.1720  -0.0169 87  TYR D CD1 
2097 C CD2 . TYR B 87  ? 1.2614 0.6120 1.0244 -0.0169 0.1937  0.0141  87  TYR D CD2 
2098 C CE1 . TYR B 87  ? 1.2550 0.6617 1.0557 -0.0416 0.1960  -0.0435 87  TYR D CE1 
2099 C CE2 . TYR B 87  ? 1.2805 0.6158 1.0433 -0.0324 0.2202  -0.0067 87  TYR D CE2 
2100 C CZ  . TYR B 87  ? 1.3314 0.6961 1.1165 -0.0477 0.2231  -0.0381 87  TYR D CZ  
2101 O OH  . TYR B 87  ? 1.3374 0.6892 1.1256 -0.0684 0.2548  -0.0652 87  TYR D OH  
2102 N N   . CYS B 88  ? 1.2301 0.6258 0.9910 0.0132  0.1153  0.0513  88  CYS D N   
2103 C CA  . CYS B 88  ? 1.2429 0.6266 0.9870 0.0146  0.1135  0.0637  88  CYS D CA  
2104 C C   . CYS B 88  ? 1.2603 0.6458 0.9923 0.0117  0.1170  0.0610  88  CYS D C   
2105 O O   . CYS B 88  ? 1.2511 0.6509 0.9880 0.0102  0.1165  0.0477  88  CYS D O   
2106 C CB  . CYS B 88  ? 1.2744 0.6462 1.0073 0.0228  0.1036  0.0691  88  CYS D CB  
2107 S SG  . CYS B 88  ? 1.3471 0.7328 1.0744 0.0385  0.0863  0.0605  88  CYS D SG  
2108 N N   . GLN B 89  ? 1.2040 0.5788 0.9232 0.0076  0.1237  0.0687  89  GLN D N   
2109 C CA  . GLN B 89  ? 1.1922 0.5677 0.8985 0.0024  0.1295  0.0649  89  GLN D CA  
2110 C C   . GLN B 89  ? 1.2194 0.5769 0.9014 -0.0010 0.1326  0.0737  89  GLN D C   
2111 O O   . GLN B 89  ? 1.2002 0.5487 0.8855 -0.0041 0.1381  0.0790  89  GLN D O   
2112 C CB  . GLN B 89  ? 1.2059 0.5847 0.9275 -0.0027 0.1454  0.0601  89  GLN D CB  
2113 C CG  . GLN B 89  ? 1.3388 0.7165 1.0524 -0.0107 0.1573  0.0540  89  GLN D CG  
2114 C CD  . GLN B 89  ? 1.4768 0.8506 1.1980 -0.0113 0.1701  0.0581  89  GLN D CD  
2115 O OE1 . GLN B 89  ? 1.2955 0.6717 1.0325 -0.0025 0.1746  0.0617  89  GLN D OE1 
2116 N NE2 . GLN B 89  ? 1.4608 0.8314 1.1694 -0.0199 0.1763  0.0562  89  GLN D NE2 
2117 N N   . HIS B 90  ? 1.1996 0.5525 0.8551 -0.0024 0.1314  0.0727  90  HIS D N   
2118 C CA  . HIS B 90  ? 1.2087 0.5352 0.8310 -0.0085 0.1401  0.0808  90  HIS D CA  
2119 C C   . HIS B 90  ? 1.2818 0.6147 0.9086 -0.0229 0.1564  0.0724  90  HIS D C   
2120 O O   . HIS B 90  ? 1.2477 0.6003 0.8903 -0.0250 0.1584  0.0616  90  HIS D O   
2121 C CB  . HIS B 90  ? 1.2279 0.5359 0.8032 0.0038  0.1282  0.0894  90  HIS D CB  
2122 C CG  . HIS B 90  ? 1.2623 0.5876 0.8175 0.0029  0.1236  0.0808  90  HIS D CG  
2123 N ND1 . HIS B 90  ? 1.2618 0.6280 0.8447 0.0017  0.1171  0.0624  90  HIS D ND1 
2124 C CD2 . HIS B 90  ? 1.2896 0.5962 0.8020 -0.0035 0.1316  0.0844  90  HIS D CD2 
2125 C CE1 . HIS B 90  ? 1.2396 0.6157 0.7966 -0.0036 0.1180  0.0544  90  HIS D CE1 
2126 N NE2 . HIS B 90  ? 1.2738 0.6151 0.7862 -0.0056 0.1250  0.0685  90  HIS D NE2 
2127 N N   . PHE B 91  ? 1.2840 0.5994 0.8990 -0.0343 0.1717  0.0741  91  PHE D N   
2128 C CA  . PHE B 91  ? 1.2887 0.6095 0.9078 -0.0481 0.1889  0.0641  91  PHE D CA  
2129 C C   . PHE B 91  ? 1.4048 0.6938 0.9813 -0.0614 0.2031  0.0669  91  PHE D C   
2130 O O   . PHE B 91  ? 1.4284 0.7188 1.0140 -0.0769 0.2229  0.0565  91  PHE D O   
2131 C CB  . PHE B 91  ? 1.2865 0.6313 0.9516 -0.0487 0.1983  0.0553  91  PHE D CB  
2132 C CG  . PHE B 91  ? 1.2957 0.6477 0.9800 -0.0476 0.1985  0.0556  91  PHE D CG  
2133 C CD1 . PHE B 91  ? 1.3308 0.6935 1.0320 -0.0348 0.1845  0.0611  91  PHE D CD1 
2134 C CD2 . PHE B 91  ? 1.3125 0.6669 1.0018 -0.0622 0.2154  0.0451  91  PHE D CD2 
2135 C CE1 . PHE B 91  ? 1.3328 0.7091 1.0523 -0.0359 0.1852  0.0572  91  PHE D CE1 
2136 C CE2 . PHE B 91  ? 1.3338 0.7060 1.0461 -0.0643 0.2173  0.0378  91  PHE D CE2 
2137 C CZ  . PHE B 91  ? 1.3028 0.6868 1.0291 -0.0508 0.2012  0.0444  91  PHE D CZ  
2138 N N   . TRP B 92  ? 1.3835 0.6417 0.9108 -0.0533 0.1946  0.0805  92  TRP D N   
2139 C CA  . TRP B 92  ? 1.4277 0.6410 0.8959 -0.0621 0.2094  0.0880  92  TRP D CA  
2140 C C   . TRP B 92  ? 1.5048 0.7263 0.9448 -0.0671 0.2094  0.0822  92  TRP D C   
2141 O O   . TRP B 92  ? 1.5469 0.7544 0.9714 -0.0877 0.2324  0.0743  92  TRP D O   
2142 C CB  . TRP B 92  ? 1.4490 0.6187 0.8688 -0.0438 0.2004  0.1086  92  TRP D CB  
2143 C CG  . TRP B 92  ? 1.5153 0.6282 0.8543 -0.0436 0.2125  0.1226  92  TRP D CG  
2144 C CD1 . TRP B 92  ? 1.5746 0.6805 0.8593 -0.0224 0.1939  0.1342  92  TRP D CD1 
2145 C CD2 . TRP B 92  ? 1.5428 0.6028 0.8442 -0.0673 0.2481  0.1226  92  TRP D CD2 
2146 N NE1 . TRP B 92  ? 1.6169 0.6606 0.8234 -0.0277 0.2145  0.1471  92  TRP D NE1 
2147 C CE2 . TRP B 92  ? 1.6454 0.6545 0.8598 -0.0573 0.2509  0.1403  92  TRP D CE2 
2148 C CE3 . TRP B 92  ? 1.5532 0.6050 0.8840 -0.0957 0.2791  0.1072  92  TRP D CE3 
2149 C CZ2 . TRP B 92  ? 1.6844 0.6226 0.8350 -0.0773 0.2881  0.1455  92  TRP D CZ2 
2150 C CZ3 . TRP B 92  ? 1.6153 0.6069 0.8931 -0.1190 0.3165  0.1062  92  TRP D CZ3 
2151 C CH2 . TRP B 92  ? 1.6752 0.6042 0.8609 -0.1109 0.3231  0.1266  92  TRP D CH2 
2152 N N   . GLY B 93  ? 1.4204 0.6691 0.8568 -0.0512 0.1861  0.0814  93  GLY D N   
2153 C CA  . GLY B 93  ? 1.4200 0.6853 0.8301 -0.0567 0.1848  0.0712  93  GLY D CA  
2154 C C   . GLY B 93  ? 1.4583 0.7765 0.9145 -0.0570 0.1754  0.0511  93  GLY D C   
2155 O O   . GLY B 93  ? 1.4501 0.7900 0.9428 -0.0451 0.1616  0.0492  93  GLY D O   
2156 N N   . THR B 94  ? 1.4036 0.7394 0.8561 -0.0735 0.1869  0.0335  94  THR D N   
2157 C CA  . THR B 94  ? 1.3520 0.7310 0.8433 -0.0809 0.1883  0.0088  94  THR D CA  
2158 C C   . THR B 94  ? 1.3775 0.7941 0.8490 -0.0671 0.1621  -0.0006 94  THR D C   
2159 O O   . THR B 94  ? 1.3986 0.8113 0.8123 -0.0571 0.1483  0.0072  94  THR D O   
2160 C CB  . THR B 94  ? 1.3695 0.7489 0.8565 -0.1052 0.2136  -0.0080 94  THR D CB  
2161 O OG1 . THR B 94  ? 1.3791 0.7251 0.8680 -0.1153 0.2345  0.0008  94  THR D OG1 
2162 C CG2 . THR B 94  ? 1.3094 0.7177 0.8423 -0.1180 0.2287  -0.0344 94  THR D CG2 
2163 N N   . PRO B 95  ? 1.3576 0.8282 0.6734 0.1631  0.1631  0.0638  95  PRO D N   
2164 C CA  . PRO B 95  ? 1.2936 0.8373 0.7127 0.1249  0.1400  0.0446  95  PRO D CA  
2165 C C   . PRO B 95  ? 1.3146 0.8773 0.8015 0.0966  0.1477  0.0488  95  PRO D C   
2166 O O   . PRO B 95  ? 1.3476 0.8827 0.8067 0.1094  0.1521  0.0620  95  PRO D O   
2167 C CB  . PRO B 95  ? 1.2969 0.8808 0.7154 0.1422  0.0817  0.0250  95  PRO D CB  
2168 C CG  . PRO B 95  ? 1.3910 0.9328 0.7324 0.1820  0.0675  0.0328  95  PRO D CG  
2169 C CD  . PRO B 95  ? 1.3913 0.8568 0.6518 0.2006  0.1172  0.0577  95  PRO D CD  
2170 N N   . ARG B 96  ? 1.1893 0.7973 0.7621 0.0609  0.1469  0.0364  96  ARG D N   
2171 C CA  . ARG B 96  ? 1.1251 0.7550 0.7635 0.0370  0.1478  0.0363  96  ARG D CA  
2172 C C   . ARG B 96  ? 1.1563 0.8150 0.7972 0.0453  0.1038  0.0310  96  ARG D C   
2173 O O   . ARG B 96  ? 1.1368 0.8254 0.7775 0.0524  0.0683  0.0171  96  ARG D O   
2174 C CB  . ARG B 96  ? 1.0181 0.6870 0.7401 0.0032  0.1496  0.0203  96  ARG D CB  
2175 C CG  . ARG B 96  ? 1.0377 0.6877 0.7706 -0.0072 0.1860  0.0165  96  ARG D CG  
2176 C CD  . ARG B 96  ? 0.9338 0.5266 0.6458 -0.0025 0.2414  0.0321  96  ARG D CD  
2177 N NE  . ARG B 96  ? 0.9658 0.5414 0.6865 -0.0110 0.2746  0.0252  96  ARG D NE  
2178 C CZ  . ARG B 96  ? 1.2270 0.7507 0.8805 0.0078  0.3102  0.0381  96  ARG D CZ  
2179 N NH1 . ARG B 96  ? 1.1541 0.6323 0.7220 0.0385  0.3181  0.0598  96  ARG D NH1 
2180 N NH2 . ARG B 96  ? 0.9332 0.4458 0.6026 -0.0029 0.3396  0.0288  96  ARG D NH2 
2181 N N   . THR B 97  ? 1.1155 0.7625 0.7592 0.0465  0.1080  0.0411  97  THR D N   
2182 C CA  . THR B 97  ? 1.1021 0.7711 0.7500 0.0543  0.0710  0.0358  97  THR D CA  
2183 C C   . THR B 97  ? 1.1533 0.8516 0.8693 0.0285  0.0698  0.0330  97  THR D C   
2184 O O   . THR B 97  ? 1.1604 0.8449 0.9017 0.0153  0.1005  0.0409  97  THR D O   
2185 C CB  . THR B 97  ? 1.2018 0.8247 0.7772 0.0863  0.0722  0.0490  97  THR D CB  
2186 O OG1 . THR B 97  ? 1.2614 0.8605 0.7695 0.1158  0.0627  0.0464  97  THR D OG1 
2187 C CG2 . THR B 97  ? 1.1826 0.8221 0.7692 0.0926  0.0398  0.0435  97  THR D CG2 
2188 N N   . PHE B 98  ? 1.0895 0.8271 0.8383 0.0225  0.0354  0.0199  98  PHE D N   
2189 C CA  . PHE B 98  ? 1.0565 0.8208 0.8617 0.0022  0.0296  0.0163  98  PHE D CA  
2190 C C   . PHE B 98  ? 1.0963 0.8580 0.8911 0.0136  0.0129  0.0190  98  PHE D C   
2191 O O   . PHE B 98  ? 1.1226 0.8737 0.8778 0.0360  -0.0058 0.0160  98  PHE D O   
2192 C CB  . PHE B 98  ? 1.0475 0.8522 0.8954 -0.0134 0.0084  -0.0001 98  PHE D CB  
2193 C CG  . PHE B 98  ? 1.0549 0.8669 0.9235 -0.0276 0.0201  -0.0060 98  PHE D CG  
2194 C CD1 . PHE B 98  ? 1.0883 0.8975 0.9319 -0.0196 0.0187  -0.0101 98  PHE D CD1 
2195 C CD2 . PHE B 98  ? 1.0627 0.8854 0.9775 -0.0473 0.0288  -0.0106 98  PHE D CD2 
2196 C CE1 . PHE B 98  ? 1.0721 0.8897 0.9390 -0.0339 0.0279  -0.0176 98  PHE D CE1 
2197 C CE2 . PHE B 98  ? 1.0729 0.9023 1.0102 -0.0593 0.0351  -0.0203 98  PHE D CE2 
2198 C CZ  . PHE B 98  ? 1.0417 0.8691 0.9562 -0.0540 0.0355  -0.0232 98  PHE D CZ  
2199 N N   . GLY B 99  ? 1.0091 0.7810 0.8416 -0.0001 0.0169  0.0214  99  GLY D N   
2200 C CA  . GLY B 99  ? 0.9971 0.7735 0.8326 0.0058  -0.0001 0.0209  99  GLY D CA  
2201 C C   . GLY B 99  ? 1.0284 0.8392 0.8932 0.0001  -0.0285 0.0037  99  GLY D C   
2202 O O   . GLY B 99  ? 0.9921 0.8241 0.8825 -0.0129 -0.0307 -0.0047 99  GLY D O   
2203 N N   . GLY B 100 ? 1.0046 0.8186 0.8680 0.0101  -0.0486 -0.0027 100 GLY D N   
2204 C CA  . GLY B 100 ? 0.9856 0.8274 0.8820 0.0064  -0.0718 -0.0213 100 GLY D CA  
2205 C C   . GLY B 100 ? 1.0342 0.9015 0.9795 -0.0171 -0.0671 -0.0255 100 GLY D C   
2206 O O   . GLY B 100 ? 1.0281 0.9144 1.0003 -0.0219 -0.0781 -0.0398 100 GLY D O   
2207 N N   . GLY B 101 ? 0.9865 0.8510 0.9430 -0.0295 -0.0499 -0.0146 101 GLY D N   
2208 C CA  . GLY B 101 ? 0.9606 0.8415 0.9523 -0.0465 -0.0460 -0.0181 101 GLY D CA  
2209 C C   . GLY B 101 ? 1.0016 0.8881 1.0134 -0.0503 -0.0491 -0.0187 101 GLY D C   
2210 O O   . GLY B 101 ? 1.0071 0.8930 1.0164 -0.0422 -0.0607 -0.0230 101 GLY D O   
2211 N N   . THR B 102 ? 0.9259 0.8174 0.9587 -0.0609 -0.0409 -0.0170 102 THR D N   
2212 C CA  . THR B 102 ? 0.9014 0.7993 0.9547 -0.0651 -0.0422 -0.0182 102 THR D CA  
2213 C C   . THR B 102 ? 0.9077 0.8117 0.9749 -0.0731 -0.0408 -0.0248 102 THR D C   
2214 O O   . THR B 102 ? 0.8989 0.7997 0.9686 -0.0749 -0.0359 -0.0245 102 THR D O   
2215 C CB  . THR B 102 ? 0.9430 0.8354 1.0039 -0.0635 -0.0337 -0.0099 102 THR D CB  
2216 O OG1 . THR B 102 ? 0.9574 0.8349 0.9965 -0.0542 -0.0298 -0.0012 102 THR D OG1 
2217 C CG2 . THR B 102 ? 0.8494 0.7507 0.9316 -0.0660 -0.0380 -0.0121 102 THR D CG2 
2218 N N   . LYS B 103 ? 0.8327 0.7415 0.9094 -0.0758 -0.0441 -0.0320 103 LYS D N   
2219 C CA  . LYS B 103 ? 0.8260 0.7314 0.9071 -0.0808 -0.0377 -0.0360 103 LYS D CA  
2220 C C   . LYS B 103 ? 0.8633 0.7677 0.9513 -0.0807 -0.0354 -0.0347 103 LYS D C   
2221 O O   . LYS B 103 ? 0.8627 0.7723 0.9647 -0.0823 -0.0365 -0.0375 103 LYS D O   
2222 C CB  . LYS B 103 ? 0.8611 0.7675 0.9541 -0.0843 -0.0350 -0.0452 103 LYS D CB  
2223 C CG  . LYS B 103 ? 1.1429 1.0360 1.2291 -0.0877 -0.0223 -0.0462 103 LYS D CG  
2224 C CD  . LYS B 103 ? 1.3270 1.2195 1.4224 -0.0903 -0.0176 -0.0531 103 LYS D CD  
2225 C CE  . LYS B 103 ? 1.4722 1.3613 1.5949 -0.0947 -0.0051 -0.0633 103 LYS D CE  
2226 N NZ  . LYS B 103 ? 1.5955 1.4601 1.7037 -0.0967 0.0159  -0.0593 103 LYS D NZ  
2227 N N   . VAL B 104 ? 0.8107 0.7089 0.8919 -0.0774 -0.0342 -0.0333 104 VAL D N   
2228 C CA  . VAL B 104 ? 0.8021 0.6991 0.8894 -0.0730 -0.0349 -0.0351 104 VAL D CA  
2229 C C   . VAL B 104 ? 0.8625 0.7440 0.9323 -0.0714 -0.0282 -0.0384 104 VAL D C   
2230 O O   . VAL B 104 ? 0.8653 0.7317 0.9144 -0.0683 -0.0257 -0.0395 104 VAL D O   
2231 C CB  . VAL B 104 ? 0.8365 0.7333 0.9317 -0.0663 -0.0392 -0.0375 104 VAL D CB  
2232 C CG1 . VAL B 104 ? 0.8297 0.7255 0.9328 -0.0576 -0.0438 -0.0441 104 VAL D CG1 
2233 C CG2 . VAL B 104 ? 0.8226 0.7283 0.9352 -0.0683 -0.0375 -0.0321 104 VAL D CG2 
2234 N N   . GLU B 105 ? 0.8222 0.7044 0.8995 -0.0736 -0.0232 -0.0399 105 GLU D N   
2235 C CA  . GLU B 105 ? 0.8396 0.7019 0.9004 -0.0725 -0.0095 -0.0418 105 GLU D CA  
2236 C C   . GLU B 105 ? 0.8923 0.7481 0.9456 -0.0636 -0.0100 -0.0438 105 GLU D C   
2237 O O   . GLU B 105 ? 0.8995 0.7737 0.9733 -0.0616 -0.0219 -0.0451 105 GLU D O   
2238 C CB  . GLU B 105 ? 0.8555 0.7217 0.9374 -0.0835 0.0011  -0.0457 105 GLU D CB  
2239 C CG  . GLU B 105 ? 1.1013 0.9598 1.1784 -0.0867 0.0079  -0.0464 105 GLU D CG  
2240 C CD  . GLU B 105 ? 1.5201 1.3902 1.6303 -0.0949 0.0104  -0.0554 105 GLU D CD  
2241 O OE1 . GLU B 105 ? 1.2242 1.0810 1.3404 -0.0983 0.0271  -0.0599 105 GLU D OE1 
2242 O OE2 . GLU B 105 ? 1.5458 1.4357 1.6768 -0.0957 -0.0045 -0.0595 105 GLU D OE2 
2243 N N   . ILE B 106 ? 0.8534 0.6803 0.8750 -0.0559 0.0034  -0.0441 106 ILE D N   
2244 C CA  . ILE B 106 ? 0.8616 0.6776 0.8678 -0.0433 0.0031  -0.0472 106 ILE D CA  
2245 C C   . ILE B 106 ? 0.9164 0.7423 0.9480 -0.0536 0.0140  -0.0492 106 ILE D C   
2246 O O   . ILE B 106 ? 0.9120 0.7290 0.9514 -0.0647 0.0335  -0.0496 106 ILE D O   
2247 C CB  . ILE B 106 ? 0.9239 0.6958 0.8724 -0.0248 0.0124  -0.0465 106 ILE D CB  
2248 C CG1 . ILE B 106 ? 0.9432 0.7037 0.8696 -0.0161 0.0010  -0.0471 106 ILE D CG1 
2249 C CG2 . ILE B 106 ? 0.9154 0.6751 0.8421 -0.0054 0.0062  -0.0521 106 ILE D CG2 
2250 C CD1 . ILE B 106 ? 1.1151 0.8296 0.9785 0.0107  -0.0012 -0.0501 106 ILE D CD1 
2251 N N   . LYS B 107 ? 0.8740 0.7181 0.9242 -0.0497 0.0020  -0.0532 107 LYS D N   
2252 C CA  . LYS B 107 ? 0.8690 0.7224 0.9442 -0.0589 0.0105  -0.0572 107 LYS D CA  
2253 C C   . LYS B 107 ? 0.9617 0.7826 1.0001 -0.0478 0.0288  -0.0584 107 LYS D C   
2254 O O   . LYS B 107 ? 0.9715 0.7758 0.9738 -0.0270 0.0211  -0.0594 107 LYS D O   
2255 C CB  . LYS B 107 ? 0.8634 0.7517 0.9786 -0.0607 -0.0095 -0.0608 107 LYS D CB  
2256 C CG  . LYS B 107 ? 1.0027 0.9063 1.1543 -0.0753 -0.0046 -0.0663 107 LYS D CG  
2257 C CD  . LYS B 107 ? 1.1563 1.0876 1.3405 -0.0742 -0.0213 -0.0701 107 LYS D CD  
2258 C CE  . LYS B 107 ? 1.2912 1.2422 1.5168 -0.0896 -0.0254 -0.0753 107 LYS D CE  
2259 N NZ  . LYS B 107 ? 1.3689 1.3416 1.6253 -0.0900 -0.0359 -0.0809 107 LYS D NZ  
2260 N N   . ARG B 108 ? 0.9317 0.7418 0.9812 -0.0599 0.0529  -0.0609 108 ARG D N   
2261 C CA  . ARG B 108 ? 0.9543 0.7277 0.9687 -0.0512 0.0787  -0.0611 108 ARG D CA  
2262 C C   . ARG B 108 ? 0.9640 0.7501 1.0219 -0.0670 0.0921  -0.0701 108 ARG D C   
2263 O O   . ARG B 108 ? 0.9200 0.7442 1.0326 -0.0818 0.0757  -0.0769 108 ARG D O   
2264 C CB  . ARG B 108 ? 1.0235 0.7501 0.9943 -0.0473 0.1080  -0.0541 108 ARG D CB  
2265 C CG  . ARG B 108 ? 1.3871 1.0642 1.2846 -0.0216 0.1216  -0.0492 108 ARG D CG  
2266 C CD  . ARG B 108 ? 1.6044 1.2252 1.4568 -0.0181 0.1613  -0.0411 108 ARG D CD  
2267 N NE  . ARG B 108 ? 1.5321 1.1605 1.4407 -0.0446 0.1897  -0.0457 108 ARG D NE  
2268 C CZ  . ARG B 108 ? 1.6366 1.2476 1.5611 -0.0531 0.2232  -0.0509 108 ARG D CZ  
2269 N NH1 . ARG B 108 ? 1.2742 0.8544 1.1521 -0.0368 0.2362  -0.0486 108 ARG D NH1 
2270 N NH2 . ARG B 108 ? 1.6051 1.2279 1.5945 -0.0766 0.2441  -0.0611 108 ARG D NH2 
2271 N N   . THR B 109 ? 0.9517 0.7032 0.9831 -0.0619 0.1214  -0.0711 109 THR D N   
2272 C CA  . THR B 109 ? 0.9410 0.7010 1.0163 -0.0775 0.1381  -0.0823 109 THR D CA  
2273 C C   . THR B 109 ? 1.0047 0.7550 1.1185 -0.0971 0.1658  -0.0895 109 THR D C   
2274 O O   . THR B 109 ? 1.0313 0.7489 1.1166 -0.0940 0.1876  -0.0824 109 THR D O   
2275 C CB  . THR B 109 ? 1.0285 0.7510 1.0586 -0.0632 0.1627  -0.0814 109 THR D CB  
2276 O OG1 . THR B 109 ? 1.1193 0.7826 1.0860 -0.0509 0.1970  -0.0709 109 THR D OG1 
2277 C CG2 . THR B 109 ? 0.9205 0.6593 0.9272 -0.0423 0.1312  -0.0812 109 THR D CG2 
2278 N N   . VAL B 110 ? 0.9310 0.7078 1.1124 -0.1158 0.1654  -0.1061 110 VAL D N   
2279 C CA  . VAL B 110 ? 0.9081 0.6799 1.1421 -0.1332 0.1883  -0.1206 110 VAL D CA  
2280 C C   . VAL B 110 ? 0.9720 0.6891 1.1816 -0.1325 0.2425  -0.1191 110 VAL D C   
2281 O O   . VAL B 110 ? 1.0030 0.6978 1.1943 -0.1292 0.2651  -0.1195 110 VAL D O   
2282 C CB  . VAL B 110 ? 0.9228 0.7319 1.2371 -0.1503 0.1729  -0.1441 110 VAL D CB  
2283 C CG1 . VAL B 110 ? 0.8953 0.7009 1.2728 -0.1649 0.1914  -0.1654 110 VAL D CG1 
2284 C CG2 . VAL B 110 ? 0.9073 0.7618 1.2343 -0.1477 0.1225  -0.1421 110 VAL D CG2 
2285 N N   . ALA B 111 ? 0.7637 0.8249 0.9584 0.0976  -0.0805 0.0517  111 ALA D N   
2286 C CA  . ALA B 111 ? 0.7014 0.7932 0.9672 0.1022  -0.0503 0.0454  111 ALA D CA  
2287 C C   . ALA B 111 ? 0.7972 0.8552 1.0403 0.0609  -0.0695 0.0254  111 ALA D C   
2288 O O   . ALA B 111 ? 0.8587 0.8516 1.0204 0.0338  -0.0625 0.0165  111 ALA D O   
2289 C CB  . ALA B 111 ? 0.7122 0.7774 0.9634 0.1211  0.0193  0.0462  111 ALA D CB  
2290 N N   . ALA B 112 ? 0.7202 0.8280 1.0383 0.0547  -0.0954 0.0141  112 ALA D N   
2291 C CA  . ALA B 112 ? 0.7239 0.8076 1.0322 0.0204  -0.1123 -0.0093 112 ALA D CA  
2292 C C   . ALA B 112 ? 0.8134 0.8589 1.0953 0.0090  -0.0539 -0.0128 112 ALA D C   
2293 O O   . ALA B 112 ? 0.7980 0.8545 1.1017 0.0278  -0.0087 -0.0025 112 ALA D O   
2294 C CB  . ALA B 112 ? 0.6718 0.8280 1.0742 0.0183  -0.1500 -0.0305 112 ALA D CB  
2295 N N   . PRO B 113 ? 0.7982 0.7952 1.0331 -0.0210 -0.0564 -0.0277 113 PRO D N   
2296 C CA  . PRO B 113 ? 0.7947 0.7610 1.0119 -0.0312 -0.0094 -0.0321 113 PRO D CA  
2297 C C   . PRO B 113 ? 0.7946 0.7985 1.0727 -0.0380 0.0004  -0.0430 113 PRO D C   
2298 O O   . PRO B 113 ? 0.7328 0.7812 1.0600 -0.0453 -0.0325 -0.0592 113 PRO D O   
2299 C CB  . PRO B 113 ? 0.8509 0.7647 1.0058 -0.0601 -0.0206 -0.0438 113 PRO D CB  
2300 C CG  . PRO B 113 ? 0.9111 0.8332 1.0721 -0.0703 -0.0764 -0.0527 113 PRO D CG  
2301 C CD  . PRO B 113 ? 0.8383 0.8054 1.0382 -0.0463 -0.1048 -0.0420 113 PRO D CD  
2302 N N   . SER B 114 ? 0.7843 0.7677 1.0562 -0.0386 0.0429  -0.0390 114 SER D N   
2303 C CA  . SER B 114 ? 0.7648 0.7655 1.0699 -0.0557 0.0577  -0.0491 114 SER D CA  
2304 C C   . SER B 114 ? 0.8323 0.7900 1.0951 -0.0807 0.0570  -0.0636 114 SER D C   
2305 O O   . SER B 114 ? 0.8277 0.7352 1.0412 -0.0812 0.0724  -0.0595 114 SER D O   
2306 C CB  . SER B 114 ? 0.8193 0.7984 1.1212 -0.0457 0.0965  -0.0357 114 SER D CB  
2307 O OG  . SER B 114 ? 0.8643 0.8659 1.1899 -0.0131 0.1044  -0.0185 114 SER D OG  
2308 N N   . VAL B 115 ? 0.7958 0.7780 1.0821 -0.1000 0.0358  -0.0858 115 VAL D N   
2309 C CA  . VAL B 115 ? 0.8239 0.7716 1.0779 -0.1198 0.0356  -0.1002 115 VAL D CA  
2310 C C   . VAL B 115 ? 0.9143 0.8550 1.1690 -0.1389 0.0632  -0.1073 115 VAL D C   
2311 O O   . VAL B 115 ? 0.8920 0.8702 1.1828 -0.1492 0.0680  -0.1163 115 VAL D O   
2312 C CB  . VAL B 115 ? 0.8628 0.8264 1.1322 -0.1273 -0.0042 -0.1255 115 VAL D CB  
2313 C CG1 . VAL B 115 ? 0.8861 0.8078 1.1179 -0.1413 -0.0019 -0.1352 115 VAL D CG1 
2314 C CG2 . VAL B 115 ? 0.8575 0.8271 1.1263 -0.1121 -0.0425 -0.1183 115 VAL D CG2 
2315 N N   . PHE B 116 ? 0.9305 0.8253 1.1451 -0.1470 0.0788  -0.1042 116 PHE D N   
2316 C CA  . PHE B 116 ? 0.9480 0.8235 1.1506 -0.1671 0.0987  -0.1089 116 PHE D CA  
2317 C C   . PHE B 116 ? 1.0663 0.9202 1.2477 -0.1769 0.0973  -0.1192 116 PHE D C   
2318 O O   . PHE B 116 ? 1.0842 0.9197 1.2471 -0.1683 0.0913  -0.1141 116 PHE D O   
2319 C CB  . PHE B 116 ? 0.9841 0.8189 1.1627 -0.1614 0.1167  -0.0914 116 PHE D CB  
2320 C CG  . PHE B 116 ? 0.9875 0.8350 1.1848 -0.1454 0.1232  -0.0778 116 PHE D CG  
2321 C CD1 . PHE B 116 ? 1.0091 0.8911 1.2371 -0.1595 0.1277  -0.0802 116 PHE D CD1 
2322 C CD2 . PHE B 116 ? 1.0321 0.8596 1.2169 -0.1184 0.1272  -0.0663 116 PHE D CD2 
2323 C CE1 . PHE B 116 ? 1.0186 0.9167 1.2707 -0.1436 0.1358  -0.0658 116 PHE D CE1 
2324 C CE2 . PHE B 116 ? 1.0742 0.9122 1.2786 -0.0986 0.1370  -0.0535 116 PHE D CE2 
2325 C CZ  . PHE B 116 ? 1.0358 0.9100 1.2768 -0.1097 0.1412  -0.0506 116 PHE D CZ  
2326 N N   . ILE B 117 ? 1.0521 0.9115 1.2363 -0.1973 0.1040  -0.1358 117 ILE D N   
2327 C CA  . ILE B 117 ? 1.0754 0.9202 1.2466 -0.2029 0.1054  -0.1453 117 ILE D CA  
2328 C C   . ILE B 117 ? 1.1602 0.9761 1.3080 -0.2187 0.1205  -0.1400 117 ILE D C   
2329 O O   . ILE B 117 ? 1.1556 0.9666 1.2955 -0.2363 0.1283  -0.1398 117 ILE D O   
2330 C CB  . ILE B 117 ? 1.1060 0.9790 1.2997 -0.2073 0.0943  -0.1760 117 ILE D CB  
2331 C CG1 . ILE B 117 ? 1.1364 0.9933 1.3209 -0.2038 0.0944  -0.1820 117 ILE D CG1 
2332 C CG2 . ILE B 117 ? 1.0939 0.9947 1.3024 -0.2302 0.1028  -0.2033 117 ILE D CG2 
2333 C CD1 . ILE B 117 ? 1.2834 1.1502 1.4848 -0.1963 0.0720  -0.2077 117 ILE D CD1 
2334 N N   . PHE B 118 ? 1.1349 0.9307 1.2714 -0.2146 0.1202  -0.1354 118 PHE D N   
2335 C CA  . PHE B 118 ? 1.1426 0.9098 1.2602 -0.2271 0.1236  -0.1319 118 PHE D CA  
2336 C C   . PHE B 118 ? 1.2104 0.9900 1.3359 -0.2301 0.1265  -0.1426 118 PHE D C   
2337 O O   . PHE B 118 ? 1.1997 0.9913 1.3405 -0.2174 0.1222  -0.1432 118 PHE D O   
2338 C CB  . PHE B 118 ? 1.1655 0.9027 1.2738 -0.2171 0.1144  -0.1223 118 PHE D CB  
2339 C CG  . PHE B 118 ? 1.1773 0.8950 1.2767 -0.2088 0.1144  -0.1136 118 PHE D CG  
2340 C CD1 . PHE B 118 ? 1.2246 0.9036 1.3026 -0.2206 0.1128  -0.1085 118 PHE D CD1 
2341 C CD2 . PHE B 118 ? 1.1616 0.8944 1.2699 -0.1898 0.1145  -0.1106 118 PHE D CD2 
2342 C CE1 . PHE B 118 ? 1.2223 0.8810 1.2956 -0.2088 0.1148  -0.1010 118 PHE D CE1 
2343 C CE2 . PHE B 118 ? 1.1917 0.9083 1.2948 -0.1770 0.1177  -0.1033 118 PHE D CE2 
2344 C CZ  . PHE B 118 ? 1.1791 0.8608 1.2688 -0.1842 0.1195  -0.0986 118 PHE D CZ  
2345 N N   . PRO B 119 ? 1.1825 0.9600 1.2960 -0.2492 0.1350  -0.1525 119 PRO D N   
2346 C CA  . PRO B 119 ? 1.1761 0.9673 1.2993 -0.2479 0.1413  -0.1635 119 PRO D CA  
2347 C C   . PRO B 119 ? 1.2441 1.0212 1.3693 -0.2439 0.1308  -0.1509 119 PRO D C   
2348 O O   . PRO B 119 ? 1.2575 1.0043 1.3675 -0.2484 0.1165  -0.1402 119 PRO D O   
2349 C CB  . PRO B 119 ? 1.2046 0.9953 1.3053 -0.2747 0.1541  -0.1815 119 PRO D CB  
2350 C CG  . PRO B 119 ? 1.2631 1.0527 1.3530 -0.2910 0.1538  -0.1836 119 PRO D CG  
2351 C CD  . PRO B 119 ? 1.2143 0.9782 1.3019 -0.2768 0.1406  -0.1563 119 PRO D CD  
2352 N N   . PRO B 120 ? 1.1961 0.9958 1.3449 -0.2346 0.1346  -0.1559 120 PRO D N   
2353 C CA  . PRO B 120 ? 1.1957 0.9953 1.3598 -0.2320 0.1190  -0.1487 120 PRO D CA  
2354 C C   . PRO B 120 ? 1.3143 1.0758 1.4453 -0.2520 0.1048  -0.1440 120 PRO D C   
2355 O O   . PRO B 120 ? 1.3405 1.0905 1.4413 -0.2698 0.1161  -0.1485 120 PRO D O   
2356 C CB  . PRO B 120 ? 1.1862 1.0236 1.3840 -0.2197 0.1313  -0.1558 120 PRO D CB  
2357 C CG  . PRO B 120 ? 1.2332 1.0828 1.4354 -0.2105 0.1469  -0.1667 120 PRO D CG  
2358 C CD  . PRO B 120 ? 1.1958 1.0235 1.3644 -0.2246 0.1503  -0.1724 120 PRO D CD  
2359 N N   . SER B 121 ? 1.3022 1.0398 1.4343 -0.2526 0.0766  -0.1404 121 SER D N   
2360 C CA  . SER B 121 ? 1.3381 1.0245 1.4359 -0.2718 0.0484  -0.1376 121 SER D CA  
2361 C C   . SER B 121 ? 1.3585 1.0570 1.4616 -0.2782 0.0410  -0.1380 121 SER D C   
2362 O O   . SER B 121 ? 1.3157 1.0682 1.4687 -0.2597 0.0496  -0.1418 121 SER D O   
2363 C CB  . SER B 121 ? 1.4203 1.0845 1.5330 -0.2639 0.0140  -0.1457 121 SER D CB  
2364 O OG  . SER B 121 ? 1.6401 1.2515 1.7278 -0.2796 -0.0265 -0.1488 121 SER D OG  
2365 N N   . ASP B 122 ? 1.3441 0.9917 1.3936 -0.3061 0.0244  -0.1337 122 ASP D N   
2366 C CA  . ASP B 122 ? 1.3365 0.9909 1.3827 -0.3141 0.0144  -0.1332 122 ASP D CA  
2367 C C   . ASP B 122 ? 1.3248 1.0006 1.4258 -0.2966 -0.0263 -0.1370 122 ASP D C   
2368 O O   . ASP B 122 ? 1.3107 1.0302 1.4468 -0.2863 -0.0250 -0.1371 122 ASP D O   
2369 C CB  . ASP B 122 ? 1.4269 1.0128 1.3892 -0.3570 0.0008  -0.1286 122 ASP D CB  
2370 C CG  . ASP B 122 ? 1.7114 1.3040 1.6321 -0.3801 0.0460  -0.1360 122 ASP D CG  
2371 O OD1 . ASP B 122 ? 1.7123 1.3473 1.6446 -0.3751 0.0751  -0.1469 122 ASP D OD1 
2372 O OD2 . ASP B 122 ? 1.8647 1.4236 1.7454 -0.4034 0.0515  -0.1359 122 ASP D OD2 
2373 N N   . GLU B 123 ? 1.2576 0.9095 1.3731 -0.2919 -0.0619 -0.1457 123 GLU D N   
2374 C CA  . GLU B 123 ? 1.2170 0.8950 1.3945 -0.2785 -0.1082 -0.1633 123 GLU D CA  
2375 C C   . GLU B 123 ? 1.1879 0.9616 1.4470 -0.2530 -0.0813 -0.1704 123 GLU D C   
2376 O O   . GLU B 123 ? 1.1336 0.9616 1.4524 -0.2438 -0.0995 -0.1772 123 GLU D O   
2377 C CB  . GLU B 123 ? 1.2541 0.8818 1.4247 -0.2797 -0.1465 -0.1831 123 GLU D CB  
2378 C CG  . GLU B 123 ? 1.4700 0.9934 1.5669 -0.3051 -0.1901 -0.1812 123 GLU D CG  
2379 C CD  . GLU B 123 ? 1.8758 1.3421 1.8873 -0.3311 -0.1583 -0.1562 123 GLU D CD  
2380 O OE1 . GLU B 123 ? 2.0418 1.4498 1.9920 -0.3619 -0.1827 -0.1463 123 GLU D OE1 
2381 O OE2 . GLU B 123 ? 1.6400 1.1235 1.6464 -0.3243 -0.1118 -0.1489 123 GLU D OE2 
2382 N N   . GLN B 124 ? 1.1286 0.9224 1.3894 -0.2439 -0.0405 -0.1682 124 GLN D N   
2383 C CA  . GLN B 124 ? 1.0631 0.9332 1.3851 -0.2271 -0.0152 -0.1733 124 GLN D CA  
2384 C C   . GLN B 124 ? 1.0754 0.9843 1.4148 -0.2177 0.0133  -0.1612 124 GLN D C   
2385 O O   . GLN B 124 ? 1.0238 0.9980 1.4292 -0.2053 0.0131  -0.1664 124 GLN D O   
2386 C CB  . GLN B 124 ? 1.0775 0.9430 1.3806 -0.2240 0.0142  -0.1720 124 GLN D CB  
2387 C CG  . GLN B 124 ? 1.1865 1.1179 1.5449 -0.2164 0.0253  -0.1825 124 GLN D CG  
2388 C CD  . GLN B 124 ? 1.4657 1.3912 1.7985 -0.2149 0.0536  -0.1768 124 GLN D CD  
2389 O OE1 . GLN B 124 ? 1.4642 1.3478 1.7485 -0.2148 0.0688  -0.1650 124 GLN D OE1 
2390 N NE2 . GLN B 124 ? 1.2116 1.1819 1.5781 -0.2176 0.0573  -0.1874 124 GLN D NE2 
2391 N N   . LEU B 125 ? 1.0520 0.9240 1.3348 -0.2251 0.0382  -0.1497 125 LEU D N   
2392 C CA  . LEU B 125 ? 1.0357 0.9371 1.3272 -0.2156 0.0685  -0.1467 125 LEU D CA  
2393 C C   . LEU B 125 ? 1.0994 1.0293 1.4282 -0.2110 0.0431  -0.1450 125 LEU D C   
2394 O O   . LEU B 125 ? 1.0723 1.0584 1.4507 -0.1907 0.0633  -0.1450 125 LEU D O   
2395 C CB  . LEU B 125 ? 1.0725 0.9278 1.2923 -0.2334 0.0926  -0.1469 125 LEU D CB  
2396 C CG  . LEU B 125 ? 1.1476 0.9959 1.3486 -0.2324 0.1213  -0.1538 125 LEU D CG  
2397 C CD1 . LEU B 125 ? 1.1833 0.9860 1.3153 -0.2616 0.1312  -0.1596 125 LEU D CD1 
2398 C CD2 . LEU B 125 ? 1.1755 1.0693 1.4176 -0.2074 0.1520  -0.1645 125 LEU D CD2 
2399 N N   . LYS B 126 ? 1.0784 0.9696 1.3889 -0.2278 -0.0064 -0.1456 126 LYS D N   
2400 C CA  . LYS B 126 ? 1.0540 0.9646 1.3993 -0.2268 -0.0489 -0.1468 126 LYS D CA  
2401 C C   . LYS B 126 ? 1.0450 1.0432 1.4970 -0.2055 -0.0656 -0.1604 126 LYS D C   
2402 O O   . LYS B 126 ? 1.0280 1.0758 1.5366 -0.1956 -0.0887 -0.1618 126 LYS D O   
2403 C CB  . LYS B 126 ? 1.1272 0.9569 1.4165 -0.2537 -0.1072 -0.1493 126 LYS D CB  
2404 C CG  . LYS B 126 ? 1.4202 1.1745 1.6090 -0.2841 -0.1024 -0.1354 126 LYS D CG  
2405 C CD  . LYS B 126 ? 1.6094 1.3820 1.8000 -0.2856 -0.1146 -0.1283 126 LYS D CD  
2406 C CE  . LYS B 126 ? 1.6882 1.4256 1.8785 -0.2990 -0.1952 -0.1313 126 LYS D CE  
2407 N NZ  . LYS B 126 ? 1.7878 1.4085 1.8611 -0.3449 -0.2285 -0.1249 126 LYS D NZ  
2408 N N   . SER B 127 ? 0.9645 0.9876 1.4448 -0.2013 -0.0526 -0.1718 127 SER D N   
2409 C CA  . SER B 127 ? 0.8908 1.0010 1.4666 -0.1917 -0.0637 -0.1904 127 SER D CA  
2410 C C   . SER B 127 ? 0.9182 1.0877 1.5307 -0.1759 -0.0107 -0.1818 127 SER D C   
2411 O O   . SER B 127 ? 0.8793 1.1145 1.5572 -0.1767 -0.0126 -0.1972 127 SER D O   
2412 C CB  . SER B 127 ? 0.9182 1.0152 1.4983 -0.2054 -0.0932 -0.2177 127 SER D CB  
2413 O OG  . SER B 127 ? 0.9972 1.0592 1.5254 -0.2091 -0.0559 -0.2111 127 SER D OG  
2414 N N   . GLY B 128 ? 0.8923 1.0352 1.4603 -0.1654 0.0324  -0.1634 128 GLY D N   
2415 C CA  . GLY B 128 ? 0.8675 1.0477 1.4611 -0.1469 0.0781  -0.1584 128 GLY D CA  
2416 C C   . GLY B 128 ? 0.9340 1.1012 1.5084 -0.1518 0.0998  -0.1619 128 GLY D C   
2417 O O   . GLY B 128 ? 0.9183 1.1056 1.5101 -0.1388 0.1296  -0.1606 128 GLY D O   
2418 N N   . THR B 129 ? 0.9088 1.0413 1.4492 -0.1707 0.0799  -0.1683 129 THR D N   
2419 C CA  . THR B 129 ? 0.9234 1.0354 1.4342 -0.1792 0.0930  -0.1710 129 THR D CA  
2420 C C   . THR B 129 ? 1.0198 1.0582 1.4520 -0.1828 0.1023  -0.1638 129 THR D C   
2421 O O   . THR B 129 ? 1.0281 1.0325 1.4295 -0.1871 0.0923  -0.1598 129 THR D O   
2422 C CB  . THR B 129 ? 1.0028 1.1490 1.5465 -0.1979 0.0685  -0.1896 129 THR D CB  
2423 O OG1 . THR B 129 ? 1.0320 1.1548 1.5374 -0.2082 0.0828  -0.1896 129 THR D OG1 
2424 C CG2 . THR B 129 ? 0.9925 1.1153 1.5269 -0.2084 0.0314  -0.2045 129 THR D CG2 
2425 N N   . ALA B 130 ? 0.9983 1.0136 1.3989 -0.1839 0.1183  -0.1631 130 ALA D N   
2426 C CA  . ALA B 130 ? 1.0292 0.9897 1.3691 -0.1874 0.1255  -0.1600 130 ALA D CA  
2427 C C   . ALA B 130 ? 1.0730 1.0176 1.3907 -0.1939 0.1227  -0.1609 130 ALA D C   
2428 O O   . ALA B 130 ? 1.0694 1.0268 1.3973 -0.1923 0.1277  -0.1635 130 ALA D O   
2429 C CB  . ALA B 130 ? 1.0502 1.0000 1.3753 -0.1768 0.1498  -0.1644 130 ALA D CB  
2430 N N   . SER B 131 ? 1.0280 0.9400 1.3114 -0.2019 0.1127  -0.1586 131 SER D N   
2431 C CA  . SER B 131 ? 1.0218 0.9175 1.2798 -0.2065 0.1095  -0.1583 131 SER D CA  
2432 C C   . SER B 131 ? 1.0400 0.8989 1.2594 -0.2051 0.1126  -0.1528 131 SER D C   
2433 O O   . SER B 131 ? 1.0167 0.8541 1.2213 -0.2090 0.1085  -0.1496 131 SER D O   
2434 C CB  . SER B 131 ? 1.0525 0.9619 1.3199 -0.2181 0.0946  -0.1676 131 SER D CB  
2435 O OG  . SER B 131 ? 1.1945 1.1014 1.4736 -0.2208 0.0788  -0.1768 131 SER D OG  
2436 N N   . VAL B 132 ? 0.9957 0.8475 1.2017 -0.2012 0.1158  -0.1542 132 VAL D N   
2437 C CA  . VAL B 132 ? 1.0045 0.8371 1.1875 -0.2004 0.1157  -0.1536 132 VAL D CA  
2438 C C   . VAL B 132 ? 1.0548 0.8774 1.2211 -0.2008 0.1045  -0.1462 132 VAL D C   
2439 O O   . VAL B 132 ? 1.0658 0.8926 1.2290 -0.2040 0.0961  -0.1473 132 VAL D O   
2440 C CB  . VAL B 132 ? 1.0533 0.8894 1.2404 -0.1954 0.1176  -0.1694 132 VAL D CB  
2441 C CG1 . VAL B 132 ? 1.0531 0.8856 1.2304 -0.1993 0.1167  -0.1763 132 VAL D CG1 
2442 C CG2 . VAL B 132 ? 1.0459 0.8941 1.2500 -0.1922 0.1323  -0.1821 132 VAL D CG2 
2443 N N   . VAL B 133 ? 0.9936 0.8011 1.1458 -0.1998 0.1050  -0.1395 133 VAL D N   
2444 C CA  . VAL B 133 ? 0.9979 0.7962 1.1342 -0.1962 0.0985  -0.1342 133 VAL D CA  
2445 C C   . VAL B 133 ? 1.1249 0.9238 1.2564 -0.1888 0.0948  -0.1291 133 VAL D C   
2446 O O   . VAL B 133 ? 1.1349 0.9353 1.2727 -0.1894 0.1012  -0.1285 133 VAL D O   
2447 C CB  . VAL B 133 ? 1.0296 0.8105 1.1599 -0.1959 0.0990  -0.1359 133 VAL D CB  
2448 C CG1 . VAL B 133 ? 1.0289 0.7991 1.1412 -0.1882 0.0978  -0.1349 133 VAL D CG1 
2449 C CG2 . VAL B 133 ? 1.0120 0.8053 1.1585 -0.2045 0.0932  -0.1497 133 VAL D CG2 
2450 N N   . CYS B 134 ? 1.1126 0.9125 1.2329 -0.1860 0.0813  -0.1271 134 CYS D N   
2451 C CA  . CYS B 134 ? 1.1241 0.9309 1.2463 -0.1771 0.0689  -0.1234 134 CYS D CA  
2452 C C   . CYS B 134 ? 1.1591 0.9569 1.2623 -0.1695 0.0710  -0.1125 134 CYS D C   
2453 O O   . CYS B 134 ? 1.1911 0.9788 1.2678 -0.1761 0.0639  -0.1135 134 CYS D O   
2454 C CB  . CYS B 134 ? 1.1467 0.9538 1.2668 -0.1798 0.0427  -0.1323 134 CYS D CB  
2455 S SG  . CYS B 134 ? 1.2020 1.0247 1.3364 -0.1687 0.0129  -0.1349 134 CYS D SG  
2456 N N   . LEU B 135 ? 1.0572 0.8574 1.1710 -0.1580 0.0822  -0.1051 135 LEU D N   
2457 C CA  . LEU B 135 ? 1.0299 0.8203 1.1298 -0.1444 0.0885  -0.0978 135 LEU D CA  
2458 C C   . LEU B 135 ? 1.0545 0.8681 1.1688 -0.1296 0.0769  -0.0872 135 LEU D C   
2459 O O   . LEU B 135 ? 1.0298 0.8688 1.1780 -0.1263 0.0757  -0.0855 135 LEU D O   
2460 C CB  . LEU B 135 ? 1.0249 0.7944 1.1275 -0.1392 0.1068  -0.0981 135 LEU D CB  
2461 C CG  . LEU B 135 ? 1.0842 0.8405 1.1805 -0.1190 0.1168  -0.0939 135 LEU D CG  
2462 C CD1 . LEU B 135 ? 1.1052 0.8446 1.1726 -0.1180 0.1183  -0.1105 135 LEU D CD1 
2463 C CD2 . LEU B 135 ? 1.0851 0.8154 1.1877 -0.1153 0.1278  -0.0919 135 LEU D CD2 
2464 N N   . LEU B 136 ? 1.0106 0.8195 1.0997 -0.1242 0.0664  -0.0833 136 LEU D N   
2465 C CA  . LEU B 136 ? 0.9959 0.8262 1.0952 -0.1076 0.0504  -0.0720 136 LEU D CA  
2466 C C   . LEU B 136 ? 1.0454 0.8637 1.1320 -0.0888 0.0758  -0.0670 136 LEU D C   
2467 O O   . LEU B 136 ? 1.0649 0.8568 1.1106 -0.0955 0.0850  -0.0779 136 LEU D O   
2468 C CB  . LEU B 136 ? 1.0154 0.8346 1.0787 -0.1200 0.0178  -0.0732 136 LEU D CB  
2469 C CG  . LEU B 136 ? 1.0711 0.8930 1.1452 -0.1341 -0.0175 -0.0827 136 LEU D CG  
2470 C CD1 . LEU B 136 ? 1.0856 0.8931 1.1576 -0.1516 -0.0041 -0.0953 136 LEU D CD1 
2471 C CD2 . LEU B 136 ? 1.1142 0.9115 1.1426 -0.1472 -0.0568 -0.0811 136 LEU D CD2 
2472 N N   . ASN B 137 ? 0.9856 0.8231 1.1087 -0.0677 0.0889  -0.0567 137 ASN D N   
2473 C CA  . ASN B 137 ? 0.9979 0.8141 1.1111 -0.0464 0.1159  -0.0564 137 ASN D CA  
2474 C C   . ASN B 137 ? 1.0058 0.8490 1.1368 -0.0159 0.1176  -0.0413 137 ASN D C   
2475 O O   . ASN B 137 ? 0.9976 0.8873 1.1766 -0.0071 0.1044  -0.0276 137 ASN D O   
2476 C CB  . ASN B 137 ? 1.0094 0.8062 1.1400 -0.0483 0.1343  -0.0589 137 ASN D CB  
2477 C CG  . ASN B 137 ? 1.2757 1.0356 1.3964 -0.0263 0.1570  -0.0647 137 ASN D CG  
2478 O OD1 . ASN B 137 ? 1.1382 0.8631 1.2252 -0.0237 0.1634  -0.0868 137 ASN D OD1 
2479 N ND2 . ASN B 137 ? 1.2225 0.9893 1.3740 -0.0125 0.1680  -0.0510 137 ASN D ND2 
2480 N N   . ASN B 138 ? 0.9310 0.7491 1.0254 -0.0010 0.1335  -0.0495 138 ASN D N   
2481 C CA  . ASN B 138 ? 0.9088 0.7414 1.0063 0.0316  0.1432  -0.0401 138 ASN D CA  
2482 C C   . ASN B 138 ? 0.9287 0.8054 1.0399 0.0338  0.1095  -0.0211 138 ASN D C   
2483 O O   . ASN B 138 ? 0.8866 0.8134 1.0588 0.0527  0.0994  -0.0032 138 ASN D O   
2484 C CB  . ASN B 138 ? 0.8543 0.6907 0.9957 0.0638  0.1706  -0.0316 138 ASN D CB  
2485 C CG  . ASN B 138 ? 1.4683 1.2459 1.5855 0.0691  0.1967  -0.0557 138 ASN D CG  
2486 O OD1 . ASN B 138 ? 1.5954 1.3362 1.6651 0.0641  0.2038  -0.0858 138 ASN D OD1 
2487 N ND2 . ASN B 138 ? 1.3900 1.1572 1.5397 0.0756  0.2072  -0.0481 138 ASN D ND2 
2488 N N   . PHE B 139 ? 0.8898 0.7474 0.9441 0.0105  0.0873  -0.0285 139 PHE D N   
2489 C CA  . PHE B 139 ? 0.8673 0.7485 0.9181 0.0063  0.0429  -0.0145 139 PHE D CA  
2490 C C   . PHE B 139 ? 0.9153 0.7698 0.8923 -0.0007 0.0383  -0.0186 139 PHE D C   
2491 O O   . PHE B 139 ? 0.9300 0.7476 0.8520 -0.0141 0.0673  -0.0411 139 PHE D O   
2492 C CB  . PHE B 139 ? 0.8977 0.7736 0.9465 -0.0278 0.0027  -0.0199 139 PHE D CB  
2493 C CG  . PHE B 139 ? 0.9539 0.7805 0.9365 -0.0661 0.0053  -0.0378 139 PHE D CG  
2494 C CD1 . PHE B 139 ? 1.0009 0.7961 0.9112 -0.0941 -0.0206 -0.0417 139 PHE D CD1 
2495 C CD2 . PHE B 139 ? 0.9885 0.8026 0.9817 -0.0776 0.0305  -0.0511 139 PHE D CD2 
2496 C CE1 . PHE B 139 ? 1.0346 0.7934 0.8903 -0.1339 -0.0172 -0.0600 139 PHE D CE1 
2497 C CE2 . PHE B 139 ? 1.0501 0.8318 0.9951 -0.1118 0.0318  -0.0687 139 PHE D CE2 
2498 C CZ  . PHE B 139 ? 1.0421 0.7998 0.9216 -0.1404 0.0097  -0.0737 139 PHE D CZ  
2499 N N   . TYR B 140 ? 0.8635 0.7363 0.8364 0.0019  -0.0046 -0.0025 140 TYR D N   
2500 C CA  . TYR B 140 ? 0.8927 0.7393 0.7872 -0.0109 -0.0198 -0.0029 140 TYR D CA  
2501 C C   . TYR B 140 ? 0.9287 0.7858 0.8230 -0.0206 -0.0909 0.0139  140 TYR D C   
2502 O O   . TYR B 140 ? 0.8644 0.7764 0.8430 0.0095  -0.1145 0.0280  140 TYR D O   
2503 C CB  . TYR B 140 ? 0.9087 0.7712 0.8072 0.0303  0.0209  -0.0002 140 TYR D CB  
2504 C CG  . TYR B 140 ? 0.9765 0.8094 0.7823 0.0127  0.0112  -0.0063 140 TYR D CG  
2505 C CD1 . TYR B 140 ? 1.0522 0.8381 0.7720 -0.0222 0.0409  -0.0409 140 TYR D CD1 
2506 C CD2 . TYR B 140 ? 0.9657 0.8189 0.7672 0.0238  -0.0335 0.0178  140 TYR D CD2 
2507 C CE1 . TYR B 140 ? 1.1214 0.8794 0.7454 -0.0490 0.0325  -0.0521 140 TYR D CE1 
2508 C CE2 . TYR B 140 ? 1.0182 0.8371 0.7209 -0.0002 -0.0467 0.0125  140 TYR D CE2 
2509 C CZ  . TYR B 140 ? 1.2015 0.9721 0.8119 -0.0383 -0.0104 -0.0228 140 TYR D CZ  
2510 O OH  . TYR B 140 ? 1.3185 1.0572 0.8249 -0.0681 -0.0205 -0.0326 140 TYR D OH  
2511 N N   . PRO B 141 ? 0.8416 0.6013 1.0263 0.0965  -0.1508 0.1321  141 PRO D N   
2512 C CA  . PRO B 141 ? 0.8209 0.6224 1.0240 0.0692  -0.1334 0.1331  141 PRO D CA  
2513 C C   . PRO B 141 ? 0.8575 0.7111 1.0697 0.0485  -0.0934 0.0972  141 PRO D C   
2514 O O   . PRO B 141 ? 0.8452 0.7091 1.0487 0.0526  -0.0811 0.0748  141 PRO D O   
2515 C CB  . PRO B 141 ? 0.8285 0.6705 1.0231 0.0655  -0.1640 0.1578  141 PRO D CB  
2516 C CG  . PRO B 141 ? 0.8835 0.7343 1.0579 0.0828  -0.1817 0.1482  141 PRO D CG  
2517 C CD  . PRO B 141 ? 0.8519 0.6391 1.0197 0.1092  -0.1851 0.1442  141 PRO D CD  
2518 N N   . ARG B 142 ? 0.8013 0.6901 1.0311 0.0274  -0.0762 0.0929  142 ARG D N   
2519 C CA  . ARG B 142 ? 0.7868 0.7247 1.0274 0.0095  -0.0446 0.0615  142 ARG D CA  
2520 C C   . ARG B 142 ? 0.8830 0.8759 1.1123 0.0064  -0.0377 0.0490  142 ARG D C   
2521 O O   . ARG B 142 ? 0.8925 0.9038 1.1234 0.0016  -0.0173 0.0222  142 ARG D O   
2522 C CB  . ARG B 142 ? 0.7477 0.7205 1.0071 -0.0075 -0.0364 0.0651  142 ARG D CB  
2523 C CG  . ARG B 142 ? 0.8661 0.8894 1.1385 -0.0224 -0.0098 0.0332  142 ARG D CG  
2524 C CD  . ARG B 142 ? 1.0845 1.1634 1.3694 -0.0368 -0.0060 0.0430  142 ARG D CD  
2525 N NE  . ARG B 142 ? 1.2528 1.3785 1.5530 -0.0470 0.0153  0.0121  142 ARG D NE  
2526 C CZ  . ARG B 142 ? 1.5442 1.6886 1.8650 -0.0549 0.0208  0.0062  142 ARG D CZ  
2527 N NH1 . ARG B 142 ? 1.3664 1.4861 1.6959 -0.0560 0.0089  0.0322  142 ARG D NH1 
2528 N NH2 . ARG B 142 ? 1.5095 1.6996 1.8434 -0.0606 0.0355  -0.0259 142 ARG D NH2 
2529 N N   . GLU B 143 ? 0.8356 0.8495 1.0527 0.0086  -0.0590 0.0686  143 GLU D N   
2530 C CA  . GLU B 143 ? 0.8223 0.8793 1.0284 0.0055  -0.0581 0.0580  143 GLU D CA  
2531 C C   . GLU B 143 ? 0.9197 0.9633 1.1180 0.0193  -0.0517 0.0381  143 GLU D C   
2532 O O   . GLU B 143 ? 0.9306 0.9348 1.1193 0.0379  -0.0695 0.0450  143 GLU D O   
2533 C CB  . GLU B 143 ? 0.8417 0.9077 1.0338 0.0050  -0.0927 0.0823  143 GLU D CB  
2534 C CG  . GLU B 143 ? 1.0188 1.1155 1.2162 -0.0160 -0.0970 0.1020  143 GLU D CG  
2535 C CD  . GLU B 143 ? 1.3926 1.4608 1.6011 -0.0159 -0.1065 0.1266  143 GLU D CD  
2536 O OE1 . GLU B 143 ? 1.3471 1.3624 1.5495 0.0021  -0.1345 0.1463  143 GLU D OE1 
2537 O OE2 . GLU B 143 ? 1.4002 1.4989 1.6242 -0.0324 -0.0866 0.1255  143 GLU D OE2 
2538 N N   . ALA B 144 ? 0.8963 0.9759 1.0987 0.0104  -0.0273 0.0140  144 ALA D N   
2539 C CA  . ALA B 144 ? 0.9028 0.9859 1.1004 0.0170  -0.0163 -0.0064 144 ALA D CA  
2540 C C   . ALA B 144 ? 0.9742 1.1051 1.1751 0.0063  0.0001  -0.0227 144 ALA D C   
2541 O O   . ALA B 144 ? 0.9725 1.1268 1.1830 -0.0063 0.0128  -0.0268 144 ALA D O   
2542 C CB  . ALA B 144 ? 0.9214 0.9721 1.1242 0.0164  -0.0028 -0.0176 144 ALA D CB  
2543 N N   . LYS B 145 ? 0.9543 1.0990 1.1481 0.0132  -0.0011 -0.0332 145 LYS D N   
2544 C CA  . LYS B 145 ? 0.9484 1.1292 1.1455 0.0060  0.0123  -0.0474 145 LYS D CA  
2545 C C   . LYS B 145 ? 1.0099 1.1938 1.2091 0.0083  0.0261  -0.0628 145 LYS D C   
2546 O O   . LYS B 145 ? 1.0223 1.1986 1.2147 0.0192  0.0205  -0.0663 145 LYS D O   
2547 C CB  . LYS B 145 ? 0.9910 1.1853 1.1791 0.0087  -0.0040 -0.0470 145 LYS D CB  
2548 C CG  . LYS B 145 ? 1.3229 1.5207 1.5059 -0.0013 -0.0202 -0.0312 145 LYS D CG  
2549 C CD  . LYS B 145 ? 1.4362 1.6346 1.6060 -0.0002 -0.0477 -0.0321 145 LYS D CD  
2550 C CE  . LYS B 145 ? 1.5504 1.7584 1.7128 -0.0184 -0.0612 -0.0194 145 LYS D CE  
2551 N NZ  . LYS B 145 ? 1.6723 1.8745 1.8199 -0.0214 -0.0925 -0.0246 145 LYS D NZ  
2552 N N   . VAL B 146 ? 0.9521 1.1488 1.1599 -0.0022 0.0406  -0.0718 146 VAL D N   
2553 C CA  . VAL B 146 ? 0.9405 1.1436 1.1496 -0.0056 0.0493  -0.0838 146 VAL D CA  
2554 C C   . VAL B 146 ? 1.0056 1.2411 1.2195 -0.0084 0.0550  -0.0902 146 VAL D C   
2555 O O   . VAL B 146 ? 0.9982 1.2456 1.2177 -0.0129 0.0569  -0.0906 146 VAL D O   
2556 C CB  . VAL B 146 ? 0.9823 1.1622 1.1943 -0.0154 0.0510  -0.0891 146 VAL D CB  
2557 C CG1 . VAL B 146 ? 0.9765 1.1573 1.1982 -0.0223 0.0505  -0.0907 146 VAL D CG1 
2558 C CG2 . VAL B 146 ? 0.9722 1.1631 1.1829 -0.0244 0.0538  -0.0996 146 VAL D CG2 
2559 N N   . GLN B 147 ? 0.9813 1.2309 1.1932 -0.0041 0.0568  -0.0954 147 GLN D N   
2560 C CA  . GLN B 147 ? 0.9763 1.2492 1.1935 -0.0050 0.0606  -0.0999 147 GLN D CA  
2561 C C   . GLN B 147 ? 1.0181 1.3014 1.2380 -0.0121 0.0635  -0.1038 147 GLN D C   
2562 O O   . GLN B 147 ? 1.0137 1.2910 1.2286 -0.0155 0.0642  -0.1052 147 GLN D O   
2563 C CB  . GLN B 147 ? 0.9964 1.2770 1.2115 0.0039  0.0568  -0.1034 147 GLN D CB  
2564 C CG  . GLN B 147 ? 1.3534 1.6254 1.5643 0.0046  0.0482  -0.0991 147 GLN D CG  
2565 C CD  . GLN B 147 ? 1.5904 1.8616 1.7973 0.0104  0.0367  -0.1060 147 GLN D CD  
2566 O OE1 . GLN B 147 ? 1.4946 1.7708 1.7010 0.0190  0.0316  -0.1153 147 GLN D OE1 
2567 N NE2 . GLN B 147 ? 1.4764 1.7413 1.6795 0.0050  0.0302  -0.1038 147 GLN D NE2 
2568 N N   . TRP B 148 ? 0.9652 1.2621 1.1912 -0.0146 0.0620  -0.1040 148 TRP D N   
2569 C CA  . TRP B 148 ? 0.9603 1.2685 1.1881 -0.0235 0.0570  -0.1042 148 TRP D CA  
2570 C C   . TRP B 148 ? 1.0289 1.3564 1.2619 -0.0183 0.0590  -0.1023 148 TRP D C   
2571 O O   . TRP B 148 ? 1.0369 1.3630 1.2740 -0.0095 0.0590  -0.1014 148 TRP D O   
2572 C CB  . TRP B 148 ? 0.9398 1.2450 1.1707 -0.0284 0.0448  -0.1052 148 TRP D CB  
2573 C CG  . TRP B 148 ? 0.9519 1.2380 1.1794 -0.0390 0.0376  -0.1110 148 TRP D CG  
2574 C CD1 . TRP B 148 ? 0.9915 1.2653 1.2217 -0.0375 0.0364  -0.1157 148 TRP D CD1 
2575 C CD2 . TRP B 148 ? 0.9504 1.2250 1.1712 -0.0547 0.0289  -0.1140 148 TRP D CD2 
2576 N NE1 . TRP B 148 ? 0.9886 1.2391 1.2159 -0.0495 0.0270  -0.1231 148 TRP D NE1 
2577 C CE2 . TRP B 148 ? 1.0101 1.2574 1.2299 -0.0612 0.0213  -0.1223 148 TRP D CE2 
2578 C CE3 . TRP B 148 ? 0.9594 1.2442 1.1741 -0.0659 0.0260  -0.1105 148 TRP D CE3 
2579 C CZ2 . TRP B 148 ? 1.0139 1.2352 1.2254 -0.0788 0.0092  -0.1287 148 TRP D CZ2 
2580 C CZ3 . TRP B 148 ? 0.9848 1.2505 1.1897 -0.0850 0.0149  -0.1147 148 TRP D CZ3 
2581 C CH2 . TRP B 148 ? 1.0085 1.2384 1.2110 -0.0915 0.0057  -0.1244 148 TRP D CH2 
2582 N N   . LYS B 149 ? 0.9997 1.3439 1.2322 -0.0246 0.0603  -0.1018 149 LYS D N   
2583 C CA  . LYS B 149 ? 1.0086 1.3738 1.2489 -0.0203 0.0623  -0.1001 149 LYS D CA  
2584 C C   . LYS B 149 ? 1.0814 1.4646 1.3227 -0.0345 0.0524  -0.0912 149 LYS D C   
2585 O O   . LYS B 149 ? 1.0787 1.4705 1.3123 -0.0486 0.0523  -0.0915 149 LYS D O   
2586 C CB  . LYS B 149 ? 1.0430 1.4229 1.2831 -0.0134 0.0725  -0.1094 149 LYS D CB  
2587 C CG  . LYS B 149 ? 1.2880 1.6530 1.5282 0.0011  0.0729  -0.1181 149 LYS D CG  
2588 C CD  . LYS B 149 ? 1.4117 1.7957 1.6571 0.0106  0.0746  -0.1308 149 LYS D CD  
2589 C CE  . LYS B 149 ? 1.5059 1.8926 1.7429 0.0190  0.0724  -0.1410 149 LYS D CE  
2590 N NZ  . LYS B 149 ? 1.4804 1.9047 1.7197 0.0205  0.0787  -0.1495 149 LYS D NZ  
2591 N N   . VAL B 150 ? 1.0447 1.4304 1.2934 -0.0316 0.0410  -0.0823 150 VAL D N   
2592 C CA  . VAL B 150 ? 1.0422 1.4459 1.2909 -0.0468 0.0239  -0.0698 150 VAL D CA  
2593 C C   . VAL B 150 ? 1.0952 1.5263 1.3539 -0.0448 0.0320  -0.0651 150 VAL D C   
2594 O O   . VAL B 150 ? 1.0857 1.5080 1.3548 -0.0289 0.0349  -0.0648 150 VAL D O   
2595 C CB  . VAL B 150 ? 1.0964 1.4859 1.3462 -0.0442 -0.0027 -0.0603 150 VAL D CB  
2596 C CG1 . VAL B 150 ? 1.0930 1.4769 1.3539 -0.0260 -0.0055 -0.0519 150 VAL D CG1 
2597 C CG2 . VAL B 150 ? 1.0937 1.4942 1.3367 -0.0657 -0.0306 -0.0499 150 VAL D CG2 
2598 N N   . ASP B 151 ? 1.0594 1.5216 1.3144 -0.0607 0.0370  -0.0640 151 ASP D N   
2599 C CA  . ASP B 151 ? 1.0561 1.5556 1.3222 -0.0608 0.0461  -0.0617 151 ASP D CA  
2600 C C   . ASP B 151 ? 1.0983 1.5920 1.3750 -0.0380 0.0633  -0.0787 151 ASP D C   
2601 O O   . ASP B 151 ? 1.0916 1.5873 1.3827 -0.0288 0.0620  -0.0761 151 ASP D O   
2602 C CB  . ASP B 151 ? 1.0839 1.5918 1.3584 -0.0669 0.0250  -0.0399 151 ASP D CB  
2603 C CG  . ASP B 151 ? 1.2658 1.7862 1.5277 -0.0944 0.0005  -0.0238 151 ASP D CG  
2604 O OD1 . ASP B 151 ? 1.2901 1.8165 1.5375 -0.1112 0.0052  -0.0314 151 ASP D OD1 
2605 O OD2 . ASP B 151 ? 1.3017 1.8212 1.5671 -0.0991 -0.0272 -0.0035 151 ASP D OD2 
2606 N N   . ASN B 152 ? 1.0522 1.5321 1.3212 -0.0295 0.0737  -0.0948 152 ASN D N   
2607 C CA  . ASN B 152 ? 1.0563 1.5260 1.3304 -0.0102 0.0814  -0.1136 152 ASN D CA  
2608 C C   . ASN B 152 ? 1.1137 1.5424 1.3914 0.0013  0.0744  -0.1128 152 ASN D C   
2609 O O   . ASN B 152 ? 1.1142 1.5293 1.3944 0.0133  0.0751  -0.1281 152 ASN D O   
2610 C CB  . ASN B 152 ? 1.0839 1.5920 1.3693 -0.0045 0.0893  -0.1271 152 ASN D CB  
2611 C CG  . ASN B 152 ? 1.5912 2.0949 1.8746 0.0123  0.0905  -0.1514 152 ASN D CG  
2612 O OD1 . ASN B 152 ? 1.5790 2.0460 1.8536 0.0190  0.0841  -0.1545 152 ASN D OD1 
2613 N ND2 . ASN B 152 ? 1.5108 2.0545 1.8019 0.0191  0.0951  -0.1689 152 ASN D ND2 
2614 N N   . ALA B 153 ? 1.0607 1.4698 1.3368 -0.0024 0.0647  -0.0974 153 ALA D N   
2615 C CA  . ALA B 153 ? 1.0609 1.4333 1.3382 0.0091  0.0590  -0.0966 153 ALA D CA  
2616 C C   . ALA B 153 ? 1.1520 1.5068 1.4173 0.0080  0.0591  -0.0988 153 ALA D C   
2617 O O   . ALA B 153 ? 1.1593 1.5181 1.4195 -0.0003 0.0535  -0.0912 153 ALA D O   
2618 C CB  . ALA B 153 ? 1.0651 1.4292 1.3481 0.0105  0.0452  -0.0790 153 ALA D CB  
2619 N N   . LEU B 154 ? 1.1223 1.4581 1.3831 0.0146  0.0619  -0.1091 154 LEU D N   
2620 C CA  . LEU B 154 ? 1.1238 1.4464 1.3742 0.0123  0.0617  -0.1088 154 LEU D CA  
2621 C C   . LEU B 154 ? 1.1726 1.4853 1.4225 0.0131  0.0558  -0.0993 154 LEU D C   
2622 O O   . LEU B 154 ? 1.1602 1.4610 1.4144 0.0204  0.0509  -0.0954 154 LEU D O   
2623 C CB  . LEU B 154 ? 1.1331 1.4377 1.3778 0.0168  0.0594  -0.1188 154 LEU D CB  
2624 C CG  . LEU B 154 ? 1.1966 1.5049 1.4334 0.0157  0.0581  -0.1239 154 LEU D CG  
2625 C CD1 . LEU B 154 ? 1.2009 1.5033 1.4357 0.0224  0.0480  -0.1386 154 LEU D CD1 
2626 C CD2 . LEU B 154 ? 1.2253 1.5211 1.4538 0.0110  0.0563  -0.1161 154 LEU D CD2 
2627 N N   . GLN B 155 ? 1.1445 1.4598 1.3894 0.0077  0.0546  -0.0975 155 GLN D N   
2628 C CA  . GLN B 155 ? 1.1555 1.4685 1.4005 0.0108  0.0457  -0.0931 155 GLN D CA  
2629 C C   . GLN B 155 ? 1.2458 1.5527 1.4850 0.0115  0.0506  -0.0961 155 GLN D C   
2630 O O   . GLN B 155 ? 1.2484 1.5521 1.4831 0.0065  0.0571  -0.0988 155 GLN D O   
2631 C CB  . GLN B 155 ? 1.1659 1.4894 1.4112 0.0024  0.0352  -0.0923 155 GLN D CB  
2632 C CG  . GLN B 155 ? 1.2440 1.5780 1.4926 -0.0036 0.0270  -0.0861 155 GLN D CG  
2633 C CD  . GLN B 155 ? 1.4238 1.7556 1.6779 0.0066  0.0128  -0.0763 155 GLN D CD  
2634 O OE1 . GLN B 155 ? 1.3450 1.6719 1.5987 0.0147  -0.0032 -0.0743 155 GLN D OE1 
2635 N NE2 . GLN B 155 ? 1.3237 1.6587 1.5838 0.0085  0.0167  -0.0708 155 GLN D NE2 
2636 N N   . SER B 156 ? 1.4874 1.3670 1.3417 -0.2881 0.0673  -0.0752 156 SER D N   
2637 C CA  . SER B 156 ? 1.4962 1.3712 1.3443 -0.2931 0.0649  -0.0872 156 SER D CA  
2638 C C   . SER B 156 ? 1.5454 1.4150 1.3815 -0.2995 0.0590  -0.0935 156 SER D C   
2639 O O   . SER B 156 ? 1.5167 1.3832 1.3491 -0.3055 0.0533  -0.0857 156 SER D O   
2640 C CB  . SER B 156 ? 1.5305 1.4085 1.3910 -0.3002 0.0635  -0.0817 156 SER D CB  
2641 O OG  . SER B 156 ? 1.5858 1.4637 1.4426 -0.2992 0.0621  -0.0934 156 SER D OG  
2642 N N   . GLY B 157 ? 1.5163 1.3827 1.3457 -0.2973 0.0603  -0.1057 157 GLY D N   
2643 C CA  . GLY B 157 ? 1.5169 1.3775 1.3368 -0.3005 0.0587  -0.1125 157 GLY D CA  
2644 C C   . GLY B 157 ? 1.5354 1.3944 1.3524 -0.2980 0.0577  -0.1156 157 GLY D C   
2645 O O   . GLY B 157 ? 1.5400 1.3951 1.3551 -0.2974 0.0592  -0.1225 157 GLY D O   
2646 N N   . ASN B 158 ? 1.4472 1.3113 1.2673 -0.2970 0.0542  -0.1084 158 ASN D N   
2647 C CA  . ASN B 158 ? 1.4271 1.2943 1.2476 -0.2966 0.0494  -0.1102 158 ASN D CA  
2648 C C   . ASN B 158 ? 1.4334 1.3010 1.2584 -0.2943 0.0526  -0.1182 158 ASN D C   
2649 O O   . ASN B 158 ? 1.4282 1.2998 1.2575 -0.2969 0.0475  -0.1207 158 ASN D O   
2650 C CB  . ASN B 158 ? 1.4096 1.2856 1.2344 -0.2959 0.0428  -0.0972 158 ASN D CB  
2651 C CG  . ASN B 158 ? 1.5273 1.4104 1.3607 -0.2895 0.0495  -0.0902 158 ASN D CG  
2652 O OD1 . ASN B 158 ? 1.4306 1.3093 1.2643 -0.2863 0.0581  -0.0943 158 ASN D OD1 
2653 N ND2 . ASN B 158 ? 1.3112 1.2051 1.1513 -0.2867 0.0452  -0.0783 158 ASN D ND2 
2654 N N   . SER B 159 ? 1.3520 1.2138 1.1757 -0.2914 0.0586  -0.1207 159 SER D N   
2655 C CA  . SER B 159 ? 1.3350 1.1887 1.1580 -0.2920 0.0597  -0.1247 159 SER D CA  
2656 C C   . SER B 159 ? 1.3316 1.1758 1.1532 -0.2929 0.0607  -0.1261 159 SER D C   
2657 O O   . SER B 159 ? 1.3166 1.1622 1.1363 -0.2906 0.0619  -0.1252 159 SER D O   
2658 C CB  . SER B 159 ? 1.3810 1.2303 1.1982 -0.2876 0.0632  -0.1224 159 SER D CB  
2659 O OG  . SER B 159 ? 1.4537 1.3004 1.2668 -0.2818 0.0674  -0.1197 159 SER D OG  
2660 N N   . GLN B 160 ? 1.2606 1.0960 1.0855 -0.2976 0.0589  -0.1261 160 GLN D N   
2661 C CA  . GLN B 160 ? 1.2499 1.0752 1.0769 -0.2992 0.0582  -0.1218 160 GLN D CA  
2662 C C   . GLN B 160 ? 1.2645 1.0707 1.0846 -0.3036 0.0538  -0.1160 160 GLN D C   
2663 O O   . GLN B 160 ? 1.2598 1.0606 1.0811 -0.3107 0.0519  -0.1168 160 GLN D O   
2664 C CB  . GLN B 160 ? 1.2657 1.0940 1.1063 -0.3031 0.0599  -0.1221 160 GLN D CB  
2665 C CG  . GLN B 160 ? 1.5469 1.3851 1.3862 -0.3000 0.0636  -0.1278 160 GLN D CG  
2666 C CD  . GLN B 160 ? 1.8423 1.6789 1.6823 -0.2969 0.0696  -0.1263 160 GLN D CD  
2667 O OE1 . GLN B 160 ? 1.7950 1.6266 1.6441 -0.2968 0.0717  -0.1194 160 GLN D OE1 
2668 N NE2 . GLN B 160 ? 1.7494 1.5883 1.5789 -0.2951 0.0723  -0.1305 160 GLN D NE2 
2669 N N   . GLU B 161 ? 1.1967 0.9909 1.0079 -0.3008 0.0502  -0.1089 161 GLU D N   
2670 C CA  . GLU B 161 ? 1.1896 0.9570 0.9866 -0.3058 0.0431  -0.1000 161 GLU D CA  
2671 C C   . GLU B 161 ? 1.1683 0.9248 0.9771 -0.3140 0.0374  -0.0864 161 GLU D C   
2672 O O   . GLU B 161 ? 1.1374 0.9085 0.9630 -0.3111 0.0404  -0.0838 161 GLU D O   
2673 C CB  . GLU B 161 ? 1.2234 0.9807 1.0016 -0.2980 0.0386  -0.0970 161 GLU D CB  
2674 C CG  . GLU B 161 ? 1.4419 1.1952 1.2037 -0.2919 0.0439  -0.1050 161 GLU D CG  
2675 C CD  . GLU B 161 ? 1.9712 1.7153 1.7170 -0.2836 0.0396  -0.1030 161 GLU D CD  
2676 O OE1 . GLU B 161 ? 2.0225 1.7491 1.7576 -0.2849 0.0276  -0.0928 161 GLU D OE1 
2677 O OE2 . GLU B 161 ? 1.9757 1.7301 1.7214 -0.2761 0.0470  -0.1096 161 GLU D OE2 
2678 N N   . SER B 162 ? 1.1140 0.8424 0.9134 -0.3248 0.0295  -0.0757 162 SER D N   
2679 C CA  . SER B 162 ? 1.1008 0.8122 0.9118 -0.3356 0.0215  -0.0561 162 SER D CA  
2680 C C   . SER B 162 ? 1.1797 0.8503 0.9639 -0.3456 0.0088  -0.0422 162 SER D C   
2681 O O   . SER B 162 ? 1.2050 0.8590 0.9721 -0.3531 0.0091  -0.0492 162 SER D O   
2682 C CB  . SER B 162 ? 1.1162 0.8361 0.9552 -0.3470 0.0257  -0.0564 162 SER D CB  
2683 O OG  . SER B 162 ? 1.1844 0.9014 1.0452 -0.3504 0.0236  -0.0373 162 SER D OG  
2684 N N   . VAL B 163 ? 0.9605 0.7923 1.0407 -0.0394 0.0966  -0.1222 163 VAL D N   
2685 C CA  . VAL B 163 ? 0.9521 0.7875 1.0425 -0.0289 0.0892  -0.1140 163 VAL D CA  
2686 C C   . VAL B 163 ? 1.0126 0.8283 1.1213 -0.0228 0.0912  -0.1107 163 VAL D C   
2687 O O   . VAL B 163 ? 1.0083 0.8116 1.1262 -0.0238 0.1012  -0.1156 163 VAL D O   
2688 C CB  . VAL B 163 ? 0.9971 0.8496 1.0834 -0.0226 0.0836  -0.1117 163 VAL D CB  
2689 C CG1 . VAL B 163 ? 1.0062 0.8491 1.0890 -0.0192 0.0899  -0.1148 163 VAL D CG1 
2690 C CG2 . VAL B 163 ? 0.9925 0.8512 1.0858 -0.0148 0.0773  -0.1036 163 VAL D CG2 
2691 N N   . THR B 164 ? 0.9694 0.7777 1.0837 -0.0182 0.0816  -0.1030 164 THR D N   
2692 C CA  . THR B 164 ? 0.9492 0.7375 1.0856 -0.0117 0.0758  -0.0982 164 THR D CA  
2693 C C   . THR B 164 ? 0.9735 0.7664 1.1260 -0.0011 0.0737  -0.0964 164 THR D C   
2694 O O   . THR B 164 ? 0.9588 0.7690 1.0990 0.0020  0.0732  -0.0953 164 THR D O   
2695 C CB  . THR B 164 ? 0.9181 0.6906 1.0445 -0.0120 0.0617  -0.0894 164 THR D CB  
2696 O OG1 . THR B 164 ? 0.9504 0.7347 1.0570 -0.0118 0.0584  -0.0860 164 THR D OG1 
2697 C CG2 . THR B 164 ? 0.8604 0.6177 0.9742 -0.0211 0.0638  -0.0909 164 THR D CG2 
2698 N N   . GLU B 165 ? 0.9227 0.6995 1.1077 0.0046  0.0723  -0.0962 165 GLU D N   
2699 C CA  . GLU B 165 ? 0.9124 0.6906 1.1194 0.0151  0.0706  -0.0958 165 GLU D CA  
2700 C C   . GLU B 165 ? 0.9925 0.7703 1.1900 0.0196  0.0511  -0.0850 165 GLU D C   
2701 O O   . GLU B 165 ? 1.0065 0.7698 1.1903 0.0148  0.0386  -0.0785 165 GLU D O   
2702 C CB  . GLU B 165 ? 0.9152 0.6745 1.1695 0.0190  0.0752  -0.1005 165 GLU D CB  
2703 C CG  . GLU B 165 ? 1.1030 0.8555 1.3631 0.0120  0.1004  -0.1127 165 GLU D CG  
2704 C CD  . GLU B 165 ? 1.5281 1.2753 1.8014 0.0151  0.1200  -0.1228 165 GLU D CD  
2705 O OE1 . GLU B 165 ? 1.5244 1.2833 1.7886 0.0230  0.1165  -0.1211 165 GLU D OE1 
2706 O OE2 . GLU B 165 ? 1.5297 1.2576 1.8187 0.0082  0.1418  -0.1333 165 GLU D OE2 
2707 N N   . GLN B 166 ? 0.9511 0.7412 1.1490 0.0271  0.0503  -0.0835 166 GLN D N   
2708 C CA  . GLN B 166 ? 0.9445 0.7331 1.1291 0.0298  0.0351  -0.0738 166 GLN D CA  
2709 C C   . GLN B 166 ? 1.0303 0.7896 1.2259 0.0299  0.0132  -0.0659 166 GLN D C   
2710 O O   . GLN B 166 ? 1.0187 0.7657 1.2549 0.0358  0.0070  -0.0678 166 GLN D O   
2711 C CB  . GLN B 166 ? 0.9364 0.7405 1.1306 0.0392  0.0398  -0.0750 166 GLN D CB  
2712 C CG  . GLN B 166 ? 0.8831 0.6910 1.0543 0.0390  0.0311  -0.0662 166 GLN D CG  
2713 C CD  . GLN B 166 ? 1.0901 0.9174 1.2681 0.0478  0.0397  -0.0681 166 GLN D CD  
2714 O OE1 . GLN B 166 ? 0.9731 0.8011 1.1799 0.0564  0.0456  -0.0744 166 GLN D OE1 
2715 N NE2 . GLN B 166 ? 1.0737 0.9151 1.2272 0.0451  0.0431  -0.0636 166 GLN D NE2 
2716 N N   . ASP B 167 ? 1.0274 0.7712 1.1868 0.0222  0.0019  -0.0578 167 ASP D N   
2717 C CA  . ASP B 167 ? 1.0612 0.7682 1.2145 0.0195  -0.0223 -0.0486 167 ASP D CA  
2718 C C   . ASP B 167 ? 1.1243 0.8223 1.3000 0.0281  -0.0408 -0.0433 167 ASP D C   
2719 O O   . ASP B 167 ? 1.1345 0.8467 1.3001 0.0308  -0.0368 -0.0421 167 ASP D O   
2720 C CB  . ASP B 167 ? 1.1306 0.8170 1.2277 0.0068  -0.0249 -0.0426 167 ASP D CB  
2721 C CG  . ASP B 167 ? 1.3996 1.0368 1.4724 -0.0003 -0.0484 -0.0335 167 ASP D CG  
2722 O OD1 . ASP B 167 ? 1.4314 1.0498 1.5325 0.0061  -0.0713 -0.0284 167 ASP D OD1 
2723 O OD2 . ASP B 167 ? 1.5212 1.1356 1.5474 -0.0127 -0.0439 -0.0320 167 ASP D OD2 
2724 N N   . SER B 168 ? 1.0911 0.7641 1.2985 0.0317  -0.0626 -0.0397 168 SER D N   
2725 C CA  . SER B 168 ? 1.0909 0.7500 1.3261 0.0393  -0.0866 -0.0344 168 SER D CA  
2726 C C   . SER B 168 ? 1.1694 0.7989 1.3481 0.0308  -0.1072 -0.0221 168 SER D C   
2727 O O   . SER B 168 ? 1.1786 0.8101 1.3606 0.0350  -0.1156 -0.0192 168 SER D O   
2728 C CB  . SER B 168 ? 1.1437 0.7789 1.4312 0.0438  -0.1087 -0.0331 168 SER D CB  
2729 O OG  . SER B 168 ? 1.2707 0.8703 1.5272 0.0346  -0.1268 -0.0246 168 SER D OG  
2730 N N   . LYS B 169 ? 1.1358 0.7345 1.2601 0.0175  -0.1122 -0.0159 169 LYS D N   
2731 C CA  . LYS B 169 ? 1.1663 0.7215 1.2245 0.0045  -0.1285 -0.0050 169 LYS D CA  
2732 C C   . LYS B 169 ? 1.2309 0.8023 1.2531 -0.0008 -0.1085 -0.0056 169 LYS D C   
2733 O O   . LYS B 169 ? 1.2245 0.7753 1.2271 -0.0034 -0.1240 0.0017  169 LYS D O   
2734 C CB  . LYS B 169 ? 1.2086 0.7242 1.2171 -0.0094 -0.1305 -0.0018 169 LYS D CB  
2735 C CG  . LYS B 169 ? 1.4679 0.9548 1.5045 -0.0059 -0.1575 0.0025  169 LYS D CG  
2736 C CD  . LYS B 169 ? 1.5833 1.0485 1.5881 -0.0159 -0.1479 0.0008  169 LYS D CD  
2737 C CE  . LYS B 169 ? 1.4329 0.8878 1.4840 -0.0097 -0.1640 0.0017  169 LYS D CE  
2738 N NZ  . LYS B 169 ? 1.3211 0.8248 1.4202 -0.0034 -0.1326 -0.0113 169 LYS D NZ  
2739 N N   . ASP B 170 ? 1.1907 0.7971 1.2067 -0.0030 -0.0757 -0.0140 170 ASP D N   
2740 C CA  . ASP B 170 ? 1.1863 0.8092 1.1745 -0.0090 -0.0539 -0.0153 170 ASP D CA  
2741 C C   . ASP B 170 ? 1.1613 0.8425 1.1873 0.0018  -0.0290 -0.0248 170 ASP D C   
2742 O O   . ASP B 170 ? 1.1794 0.8778 1.1885 -0.0036 -0.0087 -0.0270 170 ASP D O   
2743 C CB  . ASP B 170 ? 1.2472 0.8417 1.1805 -0.0272 -0.0399 -0.0155 170 ASP D CB  
2744 C CG  . ASP B 170 ? 1.4905 1.1020 1.4344 -0.0286 -0.0236 -0.0244 170 ASP D CG  
2745 O OD1 . ASP B 170 ? 1.5062 1.1426 1.4931 -0.0172 -0.0267 -0.0288 170 ASP D OD1 
2746 O OD2 . ASP B 170 ? 1.5930 1.1904 1.5031 -0.0422 -0.0062 -0.0280 170 ASP D OD2 
2747 N N   . SER B 171 ? 1.0299 0.7363 1.1056 0.0155  -0.0298 -0.0306 171 SER D N   
2748 C CA  . SER B 171 ? 0.9776 0.7288 1.0832 0.0252  -0.0087 -0.0397 171 SER D CA  
2749 C C   . SER B 171 ? 0.9582 0.7325 1.0480 0.0189  0.0129  -0.0454 171 SER D C   
2750 O O   . SER B 171 ? 0.9363 0.7410 1.0325 0.0231  0.0275  -0.0492 171 SER D O   
2751 C CB  . SER B 171 ? 1.0132 0.7802 1.1279 0.0329  -0.0062 -0.0383 171 SER D CB  
2752 O OG  . SER B 171 ? 1.1550 0.8993 1.2859 0.0376  -0.0287 -0.0333 171 SER D OG  
2753 N N   . THR B 172 ? 0.8773 0.6361 0.9496 0.0091  0.0135  -0.0466 172 THR D N   
2754 C CA  . THR B 172 ? 0.8658 0.6450 0.9299 0.0028  0.0312  -0.0531 172 THR D CA  
2755 C C   . THR B 172 ? 0.9294 0.7192 1.0115 0.0042  0.0360  -0.0610 172 THR D C   
2756 O O   . THR B 172 ? 0.9207 0.6978 1.0207 0.0083  0.0281  -0.0615 172 THR D O   
2757 C CB  . THR B 172 ? 0.9927 0.7473 1.0200 -0.0123 0.0357  -0.0509 172 THR D CB  
2758 O OG1 . THR B 172 ? 1.0526 0.7659 1.0598 -0.0184 0.0222  -0.0468 172 THR D OG1 
2759 C CG2 . THR B 172 ? 1.0453 0.7928 1.0531 -0.0170 0.0398  -0.0455 172 THR D CG2 
2760 N N   . TYR B 173 ? 0.8796 0.6911 0.9591 -0.0004 0.0489  -0.0674 173 TYR D N   
2761 C CA  . TYR B 173 ? 0.8743 0.6934 0.9623 -0.0026 0.0546  -0.0752 173 TYR D CA  
2762 C C   . TYR B 173 ? 0.9428 0.7526 1.0128 -0.0150 0.0597  -0.0782 173 TYR D C   
2763 O O   . TYR B 173 ? 0.9480 0.7533 1.0032 -0.0215 0.0638  -0.0765 173 TYR D O   
2764 C CB  . TYR B 173 ? 0.8822 0.7309 0.9799 0.0013  0.0623  -0.0808 173 TYR D CB  
2765 C CG  . TYR B 173 ? 0.9014 0.7571 1.0126 0.0126  0.0623  -0.0800 173 TYR D CG  
2766 C CD1 . TYR B 173 ? 0.9190 0.7664 1.0451 0.0169  0.0658  -0.0850 173 TYR D CD1 
2767 C CD2 . TYR B 173 ? 0.9068 0.7761 1.0172 0.0180  0.0628  -0.0759 173 TYR D CD2 
2768 C CE1 . TYR B 173 ? 0.9182 0.7680 1.0576 0.0264  0.0700  -0.0869 173 TYR D CE1 
2769 C CE2 . TYR B 173 ? 0.9141 0.7887 1.0362 0.0285  0.0652  -0.0765 173 TYR D CE2 
2770 C CZ  . TYR B 173 ? 1.0234 0.8871 1.1596 0.0327  0.0691  -0.0826 173 TYR D CZ  
2771 O OH  . TYR B 173 ? 1.0642 0.9292 1.2126 0.0422  0.0753  -0.0855 173 TYR D OH  
2772 N N   . SER B 174 ? 0.8965 0.7005 0.9687 -0.0192 0.0623  -0.0835 174 SER D N   
2773 C CA  . SER B 174 ? 0.9100 0.7075 0.9692 -0.0304 0.0700  -0.0892 174 SER D CA  
2774 C C   . SER B 174 ? 0.9930 0.8119 1.0648 -0.0321 0.0764  -0.0982 174 SER D C   
2775 O O   . SER B 174 ? 0.9901 0.8123 1.0731 -0.0271 0.0756  -0.0993 174 SER D O   
2776 C CB  . SER B 174 ? 0.9756 0.7356 1.0176 -0.0356 0.0655  -0.0859 174 SER D CB  
2777 O OG  . SER B 174 ? 1.1307 0.8632 1.1498 -0.0378 0.0584  -0.0778 174 SER D OG  
2778 N N   . LEU B 175 ? 0.9550 0.7860 1.0259 -0.0402 0.0833  -0.1054 175 LEU D N   
2779 C CA  . LEU B 175 ? 0.9516 0.8011 1.0309 -0.0432 0.0855  -0.1135 175 LEU D CA  
2780 C C   . LEU B 175 ? 1.0049 0.8499 1.0814 -0.0542 0.0934  -0.1221 175 LEU D C   
2781 O O   . LEU B 175 ? 1.0178 0.8566 1.0920 -0.0600 0.0994  -0.1246 175 LEU D O   
2782 C CB  . LEU B 175 ? 0.9451 0.8212 1.0348 -0.0400 0.0807  -0.1140 175 LEU D CB  
2783 C CG  . LEU B 175 ? 1.0183 0.9107 1.1121 -0.0442 0.0768  -0.1212 175 LEU D CG  
2784 C CD1 . LEU B 175 ? 1.0238 0.9246 1.1146 -0.0370 0.0694  -0.1178 175 LEU D CD1 
2785 C CD2 . LEU B 175 ? 1.0515 0.9603 1.1622 -0.0510 0.0756  -0.1273 175 LEU D CD2 
2786 N N   . SER B 176 ? 0.9370 0.7820 1.0130 -0.0582 0.0963  -0.1278 176 SER D N   
2787 C CA  . SER B 176 ? 0.9114 0.7541 0.9859 -0.0687 0.1048  -0.1373 176 SER D CA  
2788 C C   . SER B 176 ? 0.9874 0.8521 1.0698 -0.0735 0.1007  -0.1450 176 SER D C   
2789 O O   . SER B 176 ? 0.9872 0.8554 1.0645 -0.0712 0.0952  -0.1433 176 SER D O   
2790 C CB  . SER B 176 ? 0.9016 0.7225 0.9676 -0.0712 0.1116  -0.1374 176 SER D CB  
2791 O OG  . SER B 176 ? 1.0193 0.8453 1.0872 -0.0733 0.1135  -0.1408 176 SER D OG  
2792 N N   . SER B 177 ? 0.9558 0.8305 1.0494 -0.0813 0.1035  -0.1541 177 SER D N   
2793 C CA  . SER B 177 ? 0.9536 0.8460 1.0563 -0.0875 0.0955  -0.1620 177 SER D CA  
2794 C C   . SER B 177 ? 1.0523 0.9394 1.1562 -0.0982 0.1068  -0.1732 177 SER D C   
2795 O O   . SER B 177 ? 1.0568 0.9405 1.1721 -0.1018 0.1174  -0.1794 177 SER D O   
2796 C CB  . SER B 177 ? 0.9547 0.8689 1.0831 -0.0858 0.0843  -0.1632 177 SER D CB  
2797 O OG  . SER B 177 ? 1.0399 0.9664 1.1708 -0.0894 0.0677  -0.1664 177 SER D OG  
2798 N N   . THR B 178 ? 1.0281 0.9094 1.1173 -0.1043 0.1083  -0.1765 178 THR D N   
2799 C CA  . THR B 178 ? 1.0342 0.9104 1.1226 -0.1148 0.1206  -0.1872 178 THR D CA  
2800 C C   . THR B 178 ? 1.1293 1.0208 1.2262 -0.1242 0.1095  -0.1969 178 THR D C   
2801 O O   . THR B 178 ? 1.1344 1.0232 1.2138 -0.1278 0.0990  -0.1949 178 THR D O   
2802 C CB  . THR B 178 ? 1.0891 0.9435 1.1575 -0.1165 0.1342  -0.1844 178 THR D CB  
2803 O OG1 . THR B 178 ? 1.0619 0.9004 1.1275 -0.1080 0.1393  -0.1756 178 THR D OG1 
2804 C CG2 . THR B 178 ? 1.1339 0.9829 1.2003 -0.1271 0.1487  -0.1949 178 THR D CG2 
2805 N N   . LEU B 179 ? 1.1186 1.0215 1.2414 -0.1295 0.1123  -0.2081 179 LEU D N   
2806 C CA  . LEU B 179 ? 1.1262 1.0439 1.2664 -0.1391 0.1001  -0.2194 179 LEU D CA  
2807 C C   . LEU B 179 ? 1.1966 1.1033 1.3217 -0.1499 0.1166  -0.2286 179 LEU D C   
2808 O O   . LEU B 179 ? 1.1957 1.0950 1.3268 -0.1515 0.1379  -0.2353 179 LEU D O   
2809 C CB  . LEU B 179 ? 1.1133 1.0480 1.3005 -0.1388 0.0990  -0.2286 179 LEU D CB  
2810 C CG  . LEU B 179 ? 1.1678 1.1191 1.3906 -0.1483 0.0880  -0.2435 179 LEU D CG  
2811 C CD1 . LEU B 179 ? 1.1797 1.1444 1.4110 -0.1484 0.0531  -0.2390 179 LEU D CD1 
2812 C CD2 . LEU B 179 ? 1.1699 1.1296 1.4417 -0.1486 0.1004  -0.2550 179 LEU D CD2 
2813 N N   . THR B 180 ? 1.1800 1.0803 1.2805 -0.1585 0.1089  -0.2288 180 THR D N   
2814 C CA  . THR B 180 ? 1.2018 1.0907 1.2860 -0.1702 0.1262  -0.2372 180 THR D CA  
2815 C C   . THR B 180 ? 1.2691 1.1701 1.3681 -0.1828 0.1138  -0.2508 180 THR D C   
2816 O O   . THR B 180 ? 1.2682 1.1701 1.3578 -0.1886 0.0883  -0.2497 180 THR D O   
2817 C CB  . THR B 180 ? 1.3364 1.2016 1.3813 -0.1735 0.1356  -0.2291 180 THR D CB  
2818 O OG1 . THR B 180 ? 1.3910 1.2459 1.4183 -0.1891 0.1466  -0.2379 180 THR D OG1 
2819 C CG2 . THR B 180 ? 1.2944 1.1525 1.3194 -0.1702 0.1168  -0.2187 180 THR D CG2 
2820 N N   . LEU B 181 ? 1.2271 1.1332 1.3470 -0.1873 0.1318  -0.2640 181 LEU D N   
2821 C CA  . LEU B 181 ? 1.2139 1.1318 1.3553 -0.1992 0.1252  -0.2798 181 LEU D CA  
2822 C C   . LEU B 181 ? 1.2276 1.1340 1.3532 -0.2089 0.1543  -0.2893 181 LEU D C   
2823 O O   . LEU B 181 ? 1.2283 1.1200 1.3375 -0.2043 0.1796  -0.2847 181 LEU D O   
2824 C CB  . LEU B 181 ? 1.1919 1.1296 1.3901 -0.1950 0.1234  -0.2912 181 LEU D CB  
2825 C CG  . LEU B 181 ? 1.2318 1.1861 1.4630 -0.1880 0.0951  -0.2867 181 LEU D CG  
2826 C CD1 . LEU B 181 ? 1.2344 1.1850 1.4710 -0.1751 0.1097  -0.2783 181 LEU D CD1 
2827 C CD2 . LEU B 181 ? 1.2426 1.2170 1.5337 -0.1935 0.0832  -0.3037 181 LEU D CD2 
2828 N N   . SER B 182 ? 1.1483 1.0609 1.2816 -0.2222 0.1493  -0.3027 182 SER D N   
2829 C CA  . SER B 182 ? 1.1449 1.0493 1.2678 -0.2320 0.1783  -0.3137 182 SER D CA  
2830 C C   . SER B 182 ? 1.1989 1.1127 1.3630 -0.2280 0.1980  -0.3285 182 SER D C   
2831 O O   . SER B 182 ? 1.1695 1.0988 1.3758 -0.2226 0.1844  -0.3337 182 SER D O   
2832 C CB  . SER B 182 ? 1.1682 1.0737 1.2817 -0.2493 0.1646  -0.3231 182 SER D CB  
2833 O OG  . SER B 182 ? 1.2033 1.1306 1.3643 -0.2509 0.1399  -0.3351 182 SER D OG  
2834 N N   . LYS B 183 ? 1.1823 1.0834 1.3349 -0.2320 0.2317  -0.3364 183 LYS D N   
2835 C CA  . LYS B 183 ? 1.1711 1.0709 1.3521 -0.2312 0.2573  -0.3529 183 LYS D CA  
2836 C C   . LYS B 183 ? 1.2277 1.1512 1.4623 -0.2373 0.2423  -0.3716 183 LYS D C   
2837 O O   . LYS B 183 ? 1.2080 1.1367 1.4838 -0.2322 0.2454  -0.3802 183 LYS D O   
2838 C CB  . LYS B 183 ? 1.2067 1.0892 1.3620 -0.2384 0.2913  -0.3599 183 LYS D CB  
2839 C CG  . LYS B 183 ? 1.3671 1.2319 1.5299 -0.2356 0.3241  -0.3717 183 LYS D CG  
2840 C CD  . LYS B 183 ? 1.4355 1.2895 1.5835 -0.2455 0.3551  -0.3844 183 LYS D CD  
2841 C CE  . LYS B 183 ? 1.5540 1.3883 1.7110 -0.2458 0.3880  -0.4015 183 LYS D CE  
2842 N NZ  . LYS B 183 ? 1.7149 1.5126 1.8355 -0.2370 0.4030  -0.3887 183 LYS D NZ  
2843 N N   . ALA B 184 ? 1.2133 1.1481 1.4476 -0.2491 0.2237  -0.3769 184 ALA D N   
2844 C CA  . ALA B 184 ? 1.1983 1.1550 1.4833 -0.2567 0.2007  -0.3933 184 ALA D CA  
2845 C C   . ALA B 184 ? 1.2386 1.2120 1.5682 -0.2482 0.1667  -0.3888 184 ALA D C   
2846 O O   . ALA B 184 ? 1.1956 1.1847 1.5905 -0.2481 0.1635  -0.4054 184 ALA D O   
2847 C CB  . ALA B 184 ? 1.2183 1.1737 1.4733 -0.2717 0.1809  -0.3928 184 ALA D CB  
2848 N N   . ASP B 185 ? 1.2250 1.1937 1.5225 -0.2414 0.1437  -0.3673 185 ASP D N   
2849 C CA  . ASP B 185 ? 1.2107 1.1931 1.5419 -0.2326 0.1113  -0.3596 185 ASP D CA  
2850 C C   . ASP B 185 ? 1.2321 1.2158 1.5969 -0.2210 0.1337  -0.3617 185 ASP D C   
2851 O O   . ASP B 185 ? 1.2034 1.2027 1.6250 -0.2167 0.1185  -0.3663 185 ASP D O   
2852 C CB  . ASP B 185 ? 1.2628 1.2332 1.5394 -0.2286 0.0890  -0.3362 185 ASP D CB  
2853 C CG  . ASP B 185 ? 1.4496 1.4110 1.6899 -0.2414 0.0579  -0.3319 185 ASP D CG  
2854 O OD1 . ASP B 185 ? 1.4637 1.4343 1.7322 -0.2522 0.0385  -0.3453 185 ASP D OD1 
2855 O OD2 . ASP B 185 ? 1.4982 1.4395 1.6810 -0.2416 0.0531  -0.3158 185 ASP D OD2 
2856 N N   . TYR B 186 ? 1.1848 1.1479 1.5117 -0.2169 0.1689  -0.3571 186 TYR D N   
2857 C CA  . TYR B 186 ? 1.1625 1.1148 1.5028 -0.2086 0.1926  -0.3577 186 TYR D CA  
2858 C C   . TYR B 186 ? 1.1933 1.1455 1.5855 -0.2146 0.2180  -0.3829 186 TYR D C   
2859 O O   . TYR B 186 ? 1.1717 1.1296 1.6146 -0.2120 0.2189  -0.3901 186 TYR D O   
2860 C CB  . TYR B 186 ? 1.1883 1.1128 1.4671 -0.2031 0.2151  -0.3431 186 TYR D CB  
2861 C CG  . TYR B 186 ? 1.1918 1.0946 1.4708 -0.1975 0.2396  -0.3434 186 TYR D CG  
2862 C CD1 . TYR B 186 ? 1.1981 1.1043 1.4934 -0.1896 0.2278  -0.3343 186 TYR D CD1 
2863 C CD2 . TYR B 186 ? 1.2156 1.0893 1.4733 -0.2015 0.2754  -0.3528 186 TYR D CD2 
2864 C CE1 . TYR B 186 ? 1.2045 1.0842 1.4943 -0.1875 0.2518  -0.3354 186 TYR D CE1 
2865 C CE2 . TYR B 186 ? 1.2361 1.0791 1.4830 -0.1992 0.2976  -0.3533 186 TYR D CE2 
2866 C CZ  . TYR B 186 ? 1.3089 1.1544 1.5716 -0.1930 0.2861  -0.3449 186 TYR D CZ  
2867 O OH  . TYR B 186 ? 1.3618 1.1709 1.6074 -0.1936 0.3092  -0.3456 186 TYR D OH  
2868 N N   . GLU B 187 ? 1.1240 1.2101 1.4552 -0.2412 0.2144  -0.1921 187 GLU D N   
2869 C CA  . GLU B 187 ? 1.1097 1.2251 1.4636 -0.2369 0.1955  -0.1853 187 GLU D CA  
2870 C C   . GLU B 187 ? 1.1985 1.3123 1.5131 -0.2392 0.1717  -0.1786 187 GLU D C   
2871 O O   . GLU B 187 ? 1.1774 1.3187 1.5092 -0.2303 0.1519  -0.1647 187 GLU D O   
2872 C CB  . GLU B 187 ? 1.1138 1.2279 1.4953 -0.2445 0.2080  -0.1917 187 GLU D CB  
2873 C CG  . GLU B 187 ? 1.1708 1.3069 1.6154 -0.2405 0.2289  -0.1863 187 GLU D CG  
2874 C CD  . GLU B 187 ? 1.4128 1.5427 1.8898 -0.2489 0.2503  -0.1925 187 GLU D CD  
2875 O OE1 . GLU B 187 ? 1.5445 1.7171 2.0930 -0.2451 0.2556  -0.1814 187 GLU D OE1 
2876 O OE2 . GLU B 187 ? 1.1648 1.2488 1.5978 -0.2613 0.2630  -0.2079 187 GLU D OE2 
2877 N N   . LYS B 188 ? 1.1989 1.2854 1.4657 -0.2517 0.1737  -0.1836 188 LYS D N   
2878 C CA  . LYS B 188 ? 1.2148 1.3019 1.4473 -0.2605 0.1551  -0.1707 188 LYS D CA  
2879 C C   . LYS B 188 ? 1.2670 1.3775 1.5083 -0.2433 0.1422  -0.1525 188 LYS D C   
2880 O O   . LYS B 188 ? 1.2524 1.3757 1.4869 -0.2430 0.1257  -0.1308 188 LYS D O   
2881 C CB  . LYS B 188 ? 1.2761 1.3335 1.4633 -0.2840 0.1642  -0.1815 188 LYS D CB  
2882 C CG  . LYS B 188 ? 1.5618 1.6189 1.7130 -0.3064 0.1479  -0.1654 188 LYS D CG  
2883 C CD  . LYS B 188 ? 1.7816 1.8151 1.8922 -0.3335 0.1583  -0.1779 188 LYS D CD  
2884 C CE  . LYS B 188 ? 1.9905 2.0407 2.0793 -0.3551 0.1416  -0.1528 188 LYS D CE  
2885 N NZ  . LYS B 188 ? 2.1398 2.1975 2.2213 -0.3645 0.1470  -0.1567 188 LYS D NZ  
2886 N N   . HIS B 189 ? 1.2430 1.3561 1.4984 -0.2298 0.1510  -0.1580 189 HIS D N   
2887 C CA  . HIS B 189 ? 1.2503 1.3752 1.5084 -0.2146 0.1448  -0.1456 189 HIS D CA  
2888 C C   . HIS B 189 ? 1.2466 1.3872 1.5353 -0.1976 0.1459  -0.1443 189 HIS D C   
2889 O O   . HIS B 189 ? 1.2207 1.3663 1.5342 -0.1994 0.1538  -0.1525 189 HIS D O   
2890 C CB  . HIS B 189 ? 1.2894 1.4005 1.5267 -0.2189 0.1513  -0.1510 189 HIS D CB  
2891 C CG  . HIS B 189 ? 1.3560 1.4583 1.5674 -0.2398 0.1508  -0.1528 189 HIS D CG  
2892 N ND1 . HIS B 189 ? 1.3859 1.4994 1.5858 -0.2500 0.1405  -0.1330 189 HIS D ND1 
2893 C CD2 . HIS B 189 ? 1.3928 1.4768 1.5883 -0.2548 0.1607  -0.1691 189 HIS D CD2 
2894 C CE1 . HIS B 189 ? 1.3885 1.4933 1.5652 -0.2745 0.1424  -0.1391 189 HIS D CE1 
2895 N NE2 . HIS B 189 ? 1.4018 1.4865 1.5726 -0.2769 0.1550  -0.1631 189 HIS D NE2 
2896 N N   . LYS B 190 ? 1.1912 1.3390 1.4788 -0.1837 0.1408  -0.1322 190 LYS D N   
2897 C CA  . LYS B 190 ? 1.1783 1.3409 1.4893 -0.1718 0.1412  -0.1305 190 LYS D CA  
2898 C C   . LYS B 190 ? 1.2410 1.3881 1.5384 -0.1699 0.1496  -0.1351 190 LYS D C   
2899 O O   . LYS B 190 ? 1.2236 1.3783 1.5387 -0.1738 0.1539  -0.1383 190 LYS D O   
2900 C CB  . LYS B 190 ? 1.2017 1.3843 1.5237 -0.1562 0.1297  -0.1122 190 LYS D CB  
2901 C CG  . LYS B 190 ? 1.3382 1.5474 1.6934 -0.1474 0.1271  -0.1111 190 LYS D CG  
2902 C CD  . LYS B 190 ? 1.4779 1.7033 1.8390 -0.1277 0.1172  -0.0910 190 LYS D CD  
2903 C CE  . LYS B 190 ? 1.5949 1.7952 1.9261 -0.1175 0.1280  -0.0859 190 LYS D CE  
2904 N NZ  . LYS B 190 ? 1.6625 1.8764 2.0015 -0.0961 0.1228  -0.0643 190 LYS D NZ  
2905 N N   . VAL B 191 ? 1.2202 1.3489 1.4899 -0.1657 0.1518  -0.1316 191 VAL D N   
2906 C CA  . VAL B 191 ? 1.2252 1.3354 1.4780 -0.1644 0.1582  -0.1356 191 VAL D CA  
2907 C C   . VAL B 191 ? 1.2779 1.3721 1.5169 -0.1746 0.1609  -0.1438 191 VAL D C   
2908 O O   . VAL B 191 ? 1.2765 1.3694 1.5087 -0.1783 0.1595  -0.1451 191 VAL D O   
2909 C CB  . VAL B 191 ? 1.2761 1.3741 1.5115 -0.1513 0.1622  -0.1264 191 VAL D CB  
2910 C CG1 . VAL B 191 ? 1.2602 1.3658 1.4976 -0.1458 0.1605  -0.1107 191 VAL D CG1 
2911 C CG2 . VAL B 191 ? 1.2944 1.3649 1.5034 -0.1528 0.1689  -0.1318 191 VAL D CG2 
2912 N N   . TYR B 192 ? 1.2333 1.3194 1.4712 -0.1812 0.1638  -0.1451 192 TYR D N   
2913 C CA  . TYR B 192 ? 1.2420 1.3142 1.4696 -0.1887 0.1650  -0.1457 192 TYR D CA  
2914 C C   . TYR B 192 ? 1.2676 1.3204 1.4716 -0.1902 0.1631  -0.1400 192 TYR D C   
2915 O O   . TYR B 192 ? 1.2723 1.3251 1.4782 -0.1975 0.1648  -0.1337 192 TYR D O   
2916 C CB  . TYR B 192 ? 1.2601 1.3413 1.5132 -0.1984 0.1718  -0.1426 192 TYR D CB  
2917 C CG  . TYR B 192 ? 1.2887 1.3786 1.5558 -0.1995 0.1753  -0.1508 192 TYR D CG  
2918 C CD1 . TYR B 192 ? 1.2979 1.4074 1.5857 -0.1972 0.1730  -0.1524 192 TYR D CD1 
2919 C CD2 . TYR B 192 ? 1.3135 1.3907 1.5702 -0.2038 0.1801  -0.1559 192 TYR D CD2 
2920 C CE1 . TYR B 192 ? 1.3080 1.4202 1.6009 -0.2013 0.1743  -0.1588 192 TYR D CE1 
2921 C CE2 . TYR B 192 ? 1.3240 1.4018 1.5840 -0.2095 0.1849  -0.1650 192 TYR D CE2 
2922 C CZ  . TYR B 192 ? 1.3986 1.4920 1.6740 -0.2093 0.1813  -0.1663 192 TYR D CZ  
2923 O OH  . TYR B 192 ? 1.4032 1.4927 1.6748 -0.2179 0.1840  -0.1739 192 TYR D OH  
2924 N N   . ALA B 193 ? 1.1889 1.2272 1.3715 -0.1858 0.1587  -0.1410 193 ALA D N   
2925 C CA  . ALA B 193 ? 1.1749 1.1894 1.3292 -0.1875 0.1552  -0.1358 193 ALA D CA  
2926 C C   . ALA B 193 ? 1.1867 1.1921 1.3291 -0.1884 0.1457  -0.1297 193 ALA D C   
2927 O O   . ALA B 193 ? 1.1518 1.1705 1.3056 -0.1833 0.1423  -0.1334 193 ALA D O   
2928 C CB  . ALA B 193 ? 1.1861 1.1895 1.3259 -0.1776 0.1599  -0.1406 193 ALA D CB  
2929 N N   . CYS B 194 ? 1.1446 1.1286 1.2627 -0.1965 0.1398  -0.1176 194 CYS D N   
2930 C CA  . CYS B 194 ? 1.1426 1.1174 1.2470 -0.1952 0.1264  -0.1066 194 CYS D CA  
2931 C C   . CYS B 194 ? 1.2124 1.1611 1.2836 -0.1948 0.1211  -0.1072 194 CYS D C   
2932 O O   . CYS B 194 ? 1.2220 1.1475 1.2672 -0.2060 0.1257  -0.1049 194 CYS D O   
2933 C CB  . CYS B 194 ? 1.1389 1.1105 1.2441 -0.2060 0.1218  -0.0827 194 CYS D CB  
2934 S SG  . CYS B 194 ? 1.1948 1.1468 1.2778 -0.2305 0.1230  -0.0605 194 CYS D SG  
2935 N N   . GLU B 195 ? 1.1642 1.1187 1.2393 -0.1831 0.1139  -0.1117 195 GLU D N   
2936 C CA  . GLU B 195 ? 1.1748 1.1067 1.2261 -0.1798 0.1114  -0.1139 195 GLU D CA  
2937 C C   . GLU B 195 ? 1.2111 1.1320 1.2436 -0.1825 0.0893  -0.0964 195 GLU D C   
2938 O O   . GLU B 195 ? 1.1913 1.1390 1.2477 -0.1740 0.0752  -0.0897 195 GLU D O   
2939 C CB  . GLU B 195 ? 1.1794 1.1354 1.2612 -0.1660 0.1186  -0.1248 195 GLU D CB  
2940 C CG  . GLU B 195 ? 1.3796 1.3107 1.4458 -0.1611 0.1306  -0.1298 195 GLU D CG  
2941 C CD  . GLU B 195 ? 1.7730 1.7357 1.8813 -0.1504 0.1433  -0.1323 195 GLU D CD  
2942 O OE1 . GLU B 195 ? 1.6151 1.6153 1.7578 -0.1474 0.1317  -0.1278 195 GLU D OE1 
2943 O OE2 . GLU B 195 ? 1.8510 1.8047 1.9605 -0.1464 0.1645  -0.1346 195 GLU D OE2 
2944 N N   . VAL B 196 ? 1.1726 1.0538 1.1599 -0.1957 0.0850  -0.0871 196 VAL D N   
2945 C CA  . VAL B 196 ? 1.1736 1.0369 1.1328 -0.2026 0.0611  -0.0632 196 VAL D CA  
2946 C C   . VAL B 196 ? 1.2109 1.0513 1.1470 -0.1975 0.0535  -0.0680 196 VAL D C   
2947 O O   . VAL B 196 ? 1.2104 1.0167 1.1172 -0.2030 0.0700  -0.0825 196 VAL D O   
2948 C CB  . VAL B 196 ? 1.2442 1.0799 1.1667 -0.2292 0.0591  -0.0402 196 VAL D CB  
2949 C CG1 . VAL B 196 ? 1.2650 1.0720 1.1449 -0.2423 0.0335  -0.0089 196 VAL D CG1 
2950 C CG2 . VAL B 196 ? 1.2180 1.0830 1.1755 -0.2325 0.0650  -0.0279 196 VAL D CG2 
2951 N N   . THR B 197 ? 1.1598 1.0178 1.1088 -0.1873 0.0284  -0.0534 197 THR D N   
2952 C CA  . THR B 197 ? 1.1628 1.0064 1.0977 -0.1817 0.0144  -0.0520 197 THR D CA  
2953 C C   . THR B 197 ? 1.1878 1.0128 1.0871 -0.1912 -0.0191 -0.0169 197 THR D C   
2954 O O   . THR B 197 ? 1.1387 0.9925 1.0593 -0.1855 -0.0378 0.0068  197 THR D O   
2955 C CB  . THR B 197 ? 1.3019 1.1964 1.2982 -0.1594 0.0133  -0.0645 197 THR D CB  
2956 O OG1 . THR B 197 ? 1.3098 1.2563 1.3532 -0.1502 0.0064  -0.0606 197 THR D OG1 
2957 C CG2 . THR B 197 ? 1.2986 1.1905 1.3119 -0.1544 0.0449  -0.0891 197 THR D CG2 
2958 N N   . HIS B 198 ? 1.1864 0.9586 1.0269 -0.2074 -0.0248 -0.0108 198 HIS D N   
2959 C CA  . HIS B 198 ? 1.1972 0.9414 0.9907 -0.2225 -0.0580 0.0280  198 HIS D CA  
2960 C C   . HIS B 198 ? 1.2393 0.9346 0.9834 -0.2305 -0.0632 0.0212  198 HIS D C   
2961 O O   . HIS B 198 ? 1.2370 0.9020 0.9645 -0.2338 -0.0329 -0.0109 198 HIS D O   
2962 C CB  . HIS B 198 ? 1.2285 0.9458 0.9814 -0.2534 -0.0549 0.0541  198 HIS D CB  
2963 C CG  . HIS B 198 ? 1.2929 0.9838 0.9983 -0.2742 -0.0886 0.1053  198 HIS D CG  
2964 N ND1 . HIS B 198 ? 1.3639 0.9932 0.9916 -0.3065 -0.0953 0.1168  198 HIS D ND1 
2965 C CD2 . HIS B 198 ? 1.3012 1.0174 1.0243 -0.2681 -0.1161 0.1508  198 HIS D CD2 
2966 C CE1 . HIS B 198 ? 1.3655 0.9869 0.9666 -0.3210 -0.1293 0.1719  198 HIS D CE1 
2967 N NE2 . HIS B 198 ? 1.3346 1.0078 0.9934 -0.2968 -0.1423 0.1959  198 HIS D NE2 
2968 N N   . GLN B 199 ? 0.9088 0.7878 1.3295 0.1110  0.0169  0.0169  199 GLN D N   
2969 C CA  . GLN B 199 ? 0.8967 0.7745 1.3455 0.1137  0.0157  0.0116  199 GLN D CA  
2970 C C   . GLN B 199 ? 0.9973 0.8407 1.4008 0.0855  0.0208  -0.0106 199 GLN D C   
2971 O O   . GLN B 199 ? 0.9971 0.8445 1.4116 0.0823  0.0366  -0.0295