data_6IEH
# 
_entry.id   6IEH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.309 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6IEH         
WWPDB D_1300009058 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6IEH 
_pdbx_database_status.recvd_initial_deposition_date   2018-09-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chen, J.Y.' 1 0000-0002-9423-0258 
'Yun, C.H.'  2 0000-0002-5880-8307 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_id_ASTM           GEDEEP 
_citation.journal_id_CSD            2056 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            33 
_citation.language                  ? 
_citation.page_first                536 
_citation.page_last                 549 
_citation.title                     
'NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1101/gad.322602.118 
_citation.pdbx_database_id_PubMed   30842217 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, J.'     1  ? 
primary 'Chen, J.'     2  ? 
primary 'Wu, G.'       3  ? 
primary 'Zhang, H.'    4  ? 
primary 'Du, X.'       5  ? 
primary 'Chen, S.'     6  ? 
primary 'Zhang, L.'    7  ? 
primary 'Wang, K.'     8  ? 
primary 'Fan, J.'      9  ? 
primary 'Gao, S.'      10 ? 
primary 'Wu, X.'       11 ? 
primary 'Zhang, S.'    12 ? 
primary 'Kuai, B.'     13 ? 
primary 'Zhao, P.'     14 ? 
primary 'Chi, B.'      15 ? 
primary 'Wang, L.'     16 ? 
primary 'Li, G.'       17 ? 
primary 'Wong, C.C.L.' 18 ? 
primary 'Zhou, Y.'     19 ? 
primary 'Li, J.'       20 ? 
primary 'Yun, C.'      21 ? 
primary 'Cheng, H.'    22 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   96.49 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6IEH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     148.305 
_cell.length_a_esd                 ? 
_cell.length_b                     113.728 
_cell.length_b_esd                 ? 
_cell.length_c                     80.717 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6IEH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Exosome RNA helicase MTR4' 111188.406 1  3.6.4.13 ? ? ? 
2 polymer     man 'Protein NRDE2 homolog'     11886.500  1  ?        ? ? ? 
3 non-polymer syn 'CHLORIDE ION'              35.453     1  ?        ? ? ? 
4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181    1  ?        ? ? ? 
5 water       nat water                       18.015     32 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ATP-dependent RNA helicase DOB1,ATP-dependent RNA helicase SKIV2L2,Superkiller viralicidic activity 2-like 2,TRAMP-like complex helicase
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMDPEFTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAF
QREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTAS
CLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQP
CHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIME
RNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPIL
KETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKM
SPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEESV
VIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCS
KESLKNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPIDDM
GIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGF
ATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIA
KVSAEAKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKF
AEGITKIKRDIVFAASLYL
;
;GAMDPEFTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAF
QREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTAS
CLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQP
CHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIME
RNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPIL
KETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKM
SPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEESV
VIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCS
KESLKNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPIDDM
GIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGF
ATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIA
KVSAEAKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKF
AEGITKIKRDIVFAASLYL
;
B ? 
2 'polypeptide(L)' no no 
;SFRTDKKPDPANWEYKSLYRGDIARYKRKGDSCLGINPKKQCISWEGTSTEKKHSRKQVERYFTKKSVGLMNIDGVAISS
KTEPPSSEPISFIPVKDLEDAAPVT
;
;SFRTDKKPDPANWEYKSLYRGDIARYKRKGDSCLGINPKKQCISWEGTSTEKKHSRKQVERYFTKKSVGLMNIDGVAISS
KTEPPSSEPISFIPVKDLEDAAPVT
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   PRO n 
1 6   GLU n 
1 7   PHE n 
1 8   THR n 
1 9   ASP n 
1 10  GLU n 
1 11  PRO n 
1 12  ILE n 
1 13  PHE n 
1 14  GLY n 
1 15  LYS n 
1 16  LYS n 
1 17  PRO n 
1 18  ARG n 
1 19  ILE n 
1 20  GLU n 
1 21  GLU n 
1 22  SER n 
1 23  ILE n 
1 24  THR n 
1 25  GLU n 
1 26  ASP n 
1 27  LEU n 
1 28  SER n 
1 29  LEU n 
1 30  ALA n 
1 31  ASP n 
1 32  LEU n 
1 33  MET n 
1 34  PRO n 
1 35  ARG n 
1 36  VAL n 
1 37  LYS n 
1 38  VAL n 
1 39  GLN n 
1 40  SER n 
1 41  VAL n 
1 42  GLU n 
1 43  THR n 
1 44  VAL n 
1 45  GLU n 
1 46  GLY n 
1 47  CYS n 
1 48  THR n 
1 49  HIS n 
1 50  GLU n 
1 51  VAL n 
1 52  ALA n 
1 53  LEU n 
1 54  PRO n 
1 55  ALA n 
1 56  GLU n 
1 57  GLU n 
1 58  ASP n 
1 59  TYR n 
1 60  LEU n 
1 61  PRO n 
1 62  LEU n 
1 63  LYS n 
1 64  PRO n 
1 65  ARG n 
1 66  VAL n 
1 67  GLY n 
1 68  LYS n 
1 69  ALA n 
1 70  ALA n 
1 71  LYS n 
1 72  GLU n 
1 73  TYR n 
1 74  PRO n 
1 75  PHE n 
1 76  ILE n 
1 77  LEU n 
1 78  ASP n 
1 79  ALA n 
1 80  PHE n 
1 81  GLN n 
1 82  ARG n 
1 83  GLU n 
1 84  ALA n 
1 85  ILE n 
1 86  GLN n 
1 87  CYS n 
1 88  VAL n 
1 89  ASP n 
1 90  ASN n 
1 91  ASN n 
1 92  GLN n 
1 93  SER n 
1 94  VAL n 
1 95  LEU n 
1 96  VAL n 
1 97  SER n 
1 98  ALA n 
1 99  HIS n 
1 100 THR n 
1 101 SER n 
1 102 ALA n 
1 103 GLY n 
1 104 LYS n 
1 105 THR n 
1 106 VAL n 
1 107 CYS n 
1 108 ALA n 
1 109 GLU n 
1 110 TYR n 
1 111 ALA n 
1 112 ILE n 
1 113 ALA n 
1 114 LEU n 
1 115 ALA n 
1 116 LEU n 
1 117 ARG n 
1 118 GLU n 
1 119 LYS n 
1 120 GLN n 
1 121 ARG n 
1 122 VAL n 
1 123 ILE n 
1 124 PHE n 
1 125 THR n 
1 126 SER n 
1 127 PRO n 
1 128 ILE n 
1 129 LYS n 
1 130 ALA n 
1 131 LEU n 
1 132 SER n 
1 133 ASN n 
1 134 GLN n 
1 135 LYS n 
1 136 TYR n 
1 137 ARG n 
1 138 GLU n 
1 139 MET n 
1 140 TYR n 
1 141 GLU n 
1 142 GLU n 
1 143 PHE n 
1 144 GLN n 
1 145 ASP n 
1 146 VAL n 
1 147 GLY n 
1 148 LEU n 
1 149 MET n 
1 150 THR n 
1 151 GLY n 
1 152 ASP n 
1 153 VAL n 
1 154 THR n 
1 155 ILE n 
1 156 ASN n 
1 157 PRO n 
1 158 THR n 
1 159 ALA n 
1 160 SER n 
1 161 CYS n 
1 162 LEU n 
1 163 VAL n 
1 164 MET n 
1 165 THR n 
1 166 THR n 
1 167 GLU n 
1 168 ILE n 
1 169 LEU n 
1 170 ARG n 
1 171 SER n 
1 172 MET n 
1 173 LEU n 
1 174 TYR n 
1 175 ARG n 
1 176 GLY n 
1 177 SER n 
1 178 GLU n 
1 179 VAL n 
1 180 MET n 
1 181 ARG n 
1 182 GLU n 
1 183 VAL n 
1 184 ALA n 
1 185 TRP n 
1 186 VAL n 
1 187 ILE n 
1 188 PHE n 
1 189 ASP n 
1 190 GLU n 
1 191 ILE n 
1 192 HIS n 
1 193 TYR n 
1 194 MET n 
1 195 ARG n 
1 196 ASP n 
1 197 SER n 
1 198 GLU n 
1 199 ARG n 
1 200 GLY n 
1 201 VAL n 
1 202 VAL n 
1 203 TRP n 
1 204 GLU n 
1 205 GLU n 
1 206 THR n 
1 207 ILE n 
1 208 ILE n 
1 209 LEU n 
1 210 LEU n 
1 211 PRO n 
1 212 ASP n 
1 213 ASN n 
1 214 VAL n 
1 215 HIS n 
1 216 TYR n 
1 217 VAL n 
1 218 PHE n 
1 219 LEU n 
1 220 SER n 
1 221 ALA n 
1 222 THR n 
1 223 ILE n 
1 224 PRO n 
1 225 ASN n 
1 226 ALA n 
1 227 ARG n 
1 228 GLN n 
1 229 PHE n 
1 230 ALA n 
1 231 GLU n 
1 232 TRP n 
1 233 ILE n 
1 234 CYS n 
1 235 HIS n 
1 236 LEU n 
1 237 HIS n 
1 238 LYS n 
1 239 GLN n 
1 240 PRO n 
1 241 CYS n 
1 242 HIS n 
1 243 VAL n 
1 244 ILE n 
1 245 TYR n 
1 246 THR n 
1 247 ASP n 
1 248 TYR n 
1 249 ARG n 
1 250 PRO n 
1 251 THR n 
1 252 PRO n 
1 253 LEU n 
1 254 GLN n 
1 255 HIS n 
1 256 TYR n 
1 257 ILE n 
1 258 PHE n 
1 259 PRO n 
1 260 ALA n 
1 261 GLY n 
1 262 GLY n 
1 263 ASP n 
1 264 GLY n 
1 265 LEU n 
1 266 HIS n 
1 267 LEU n 
1 268 VAL n 
1 269 VAL n 
1 270 ASP n 
1 271 GLU n 
1 272 ASN n 
1 273 GLY n 
1 274 ASP n 
1 275 PHE n 
1 276 ARG n 
1 277 GLU n 
1 278 ASP n 
1 279 ASN n 
1 280 PHE n 
1 281 ASN n 
1 282 THR n 
1 283 ALA n 
1 284 MET n 
1 285 GLN n 
1 286 VAL n 
1 287 LEU n 
1 288 ARG n 
1 289 ASP n 
1 290 ALA n 
1 291 GLY n 
1 292 ASP n 
1 293 LEU n 
1 294 ALA n 
1 295 LYS n 
1 296 GLY n 
1 297 ASP n 
1 298 GLN n 
1 299 LYS n 
1 300 GLY n 
1 301 ARG n 
1 302 LYS n 
1 303 GLY n 
1 304 GLY n 
1 305 THR n 
1 306 LYS n 
1 307 GLY n 
1 308 PRO n 
1 309 SER n 
1 310 ASN n 
1 311 VAL n 
1 312 PHE n 
1 313 LYS n 
1 314 ILE n 
1 315 VAL n 
1 316 LYS n 
1 317 MET n 
1 318 ILE n 
1 319 MET n 
1 320 GLU n 
1 321 ARG n 
1 322 ASN n 
1 323 PHE n 
1 324 GLN n 
1 325 PRO n 
1 326 VAL n 
1 327 ILE n 
1 328 ILE n 
1 329 PHE n 
1 330 SER n 
1 331 PHE n 
1 332 SER n 
1 333 LYS n 
1 334 LYS n 
1 335 ASP n 
1 336 CYS n 
1 337 GLU n 
1 338 ALA n 
1 339 TYR n 
1 340 ALA n 
1 341 LEU n 
1 342 GLN n 
1 343 MET n 
1 344 THR n 
1 345 LYS n 
1 346 LEU n 
1 347 ASP n 
1 348 PHE n 
1 349 ASN n 
1 350 THR n 
1 351 ASP n 
1 352 GLU n 
1 353 GLU n 
1 354 LYS n 
1 355 LYS n 
1 356 MET n 
1 357 VAL n 
1 358 GLU n 
1 359 GLU n 
1 360 VAL n 
1 361 PHE n 
1 362 SER n 
1 363 ASN n 
1 364 ALA n 
1 365 ILE n 
1 366 ASP n 
1 367 CYS n 
1 368 LEU n 
1 369 SER n 
1 370 ASP n 
1 371 GLU n 
1 372 ASP n 
1 373 LYS n 
1 374 LYS n 
1 375 LEU n 
1 376 PRO n 
1 377 GLN n 
1 378 VAL n 
1 379 GLU n 
1 380 HIS n 
1 381 VAL n 
1 382 LEU n 
1 383 PRO n 
1 384 LEU n 
1 385 LEU n 
1 386 LYS n 
1 387 ARG n 
1 388 GLY n 
1 389 ILE n 
1 390 GLY n 
1 391 ILE n 
1 392 HIS n 
1 393 HIS n 
1 394 GLY n 
1 395 GLY n 
1 396 LEU n 
1 397 LEU n 
1 398 PRO n 
1 399 ILE n 
1 400 LEU n 
1 401 LYS n 
1 402 GLU n 
1 403 THR n 
1 404 ILE n 
1 405 GLU n 
1 406 ILE n 
1 407 LEU n 
1 408 PHE n 
1 409 SER n 
1 410 GLU n 
1 411 GLY n 
1 412 LEU n 
1 413 ILE n 
1 414 LYS n 
1 415 ALA n 
1 416 LEU n 
1 417 PHE n 
1 418 ALA n 
1 419 THR n 
1 420 GLU n 
1 421 THR n 
1 422 PHE n 
1 423 ALA n 
1 424 MET n 
1 425 GLY n 
1 426 ILE n 
1 427 ASN n 
1 428 MET n 
1 429 PRO n 
1 430 ALA n 
1 431 ARG n 
1 432 THR n 
1 433 VAL n 
1 434 LEU n 
1 435 PHE n 
1 436 THR n 
1 437 ASN n 
1 438 ALA n 
1 439 ARG n 
1 440 LYS n 
1 441 PHE n 
1 442 ASP n 
1 443 GLY n 
1 444 LYS n 
1 445 ASP n 
1 446 PHE n 
1 447 ARG n 
1 448 TRP n 
1 449 ILE n 
1 450 SER n 
1 451 SER n 
1 452 GLY n 
1 453 GLU n 
1 454 TYR n 
1 455 ILE n 
1 456 GLN n 
1 457 MET n 
1 458 SER n 
1 459 GLY n 
1 460 ARG n 
1 461 ALA n 
1 462 GLY n 
1 463 ARG n 
1 464 ARG n 
1 465 GLY n 
1 466 MET n 
1 467 ASP n 
1 468 ASP n 
1 469 ARG n 
1 470 GLY n 
1 471 ILE n 
1 472 VAL n 
1 473 ILE n 
1 474 LEU n 
1 475 MET n 
1 476 VAL n 
1 477 ASP n 
1 478 GLU n 
1 479 LYS n 
1 480 MET n 
1 481 SER n 
1 482 PRO n 
1 483 THR n 
1 484 ILE n 
1 485 GLY n 
1 486 LYS n 
1 487 GLN n 
1 488 LEU n 
1 489 LEU n 
1 490 LYS n 
1 491 GLY n 
1 492 SER n 
1 493 ALA n 
1 494 ASP n 
1 495 PRO n 
1 496 LEU n 
1 497 ASN n 
1 498 SER n 
1 499 ALA n 
1 500 PHE n 
1 501 HIS n 
1 502 LEU n 
1 503 THR n 
1 504 TYR n 
1 505 ASN n 
1 506 MET n 
1 507 VAL n 
1 508 LEU n 
1 509 ASN n 
1 510 LEU n 
1 511 LEU n 
1 512 ARG n 
1 513 VAL n 
1 514 GLU n 
1 515 GLU n 
1 516 ILE n 
1 517 ASN n 
1 518 PRO n 
1 519 GLU n 
1 520 TYR n 
1 521 MET n 
1 522 LEU n 
1 523 GLU n 
1 524 LYS n 
1 525 SER n 
1 526 PHE n 
1 527 TYR n 
1 528 GLN n 
1 529 PHE n 
1 530 GLN n 
1 531 HIS n 
1 532 TYR n 
1 533 ARG n 
1 534 ALA n 
1 535 ILE n 
1 536 PRO n 
1 537 GLY n 
1 538 VAL n 
1 539 VAL n 
1 540 GLU n 
1 541 LYS n 
1 542 VAL n 
1 543 LYS n 
1 544 ASN n 
1 545 SER n 
1 546 GLU n 
1 547 GLU n 
1 548 GLN n 
1 549 TYR n 
1 550 ASN n 
1 551 LYS n 
1 552 ILE n 
1 553 VAL n 
1 554 ILE n 
1 555 PRO n 
1 556 ASN n 
1 557 GLU n 
1 558 GLU n 
1 559 SER n 
1 560 VAL n 
1 561 VAL n 
1 562 ILE n 
1 563 TYR n 
1 564 TYR n 
1 565 LYS n 
1 566 ILE n 
1 567 ARG n 
1 568 GLN n 
1 569 GLN n 
1 570 LEU n 
1 571 ALA n 
1 572 LYS n 
1 573 LEU n 
1 574 GLY n 
1 575 LYS n 
1 576 GLU n 
1 577 ILE n 
1 578 GLU n 
1 579 GLU n 
1 580 TYR n 
1 581 ILE n 
1 582 HIS n 
1 583 LYS n 
1 584 PRO n 
1 585 LYS n 
1 586 TYR n 
1 587 CYS n 
1 588 LEU n 
1 589 PRO n 
1 590 PHE n 
1 591 LEU n 
1 592 GLN n 
1 593 PRO n 
1 594 GLY n 
1 595 ARG n 
1 596 LEU n 
1 597 VAL n 
1 598 LYS n 
1 599 VAL n 
1 600 LYS n 
1 601 ASN n 
1 602 GLU n 
1 603 GLY n 
1 604 ASP n 
1 605 ASP n 
1 606 PHE n 
1 607 GLY n 
1 608 TRP n 
1 609 GLY n 
1 610 VAL n 
1 611 VAL n 
1 612 VAL n 
1 613 ASN n 
1 614 PHE n 
1 615 SER n 
1 616 LYS n 
1 617 LYS n 
1 618 SER n 
1 619 ASN n 
1 620 VAL n 
1 621 LYS n 
1 622 PRO n 
1 623 ASN n 
1 624 SER n 
1 625 GLY n 
1 626 GLU n 
1 627 LEU n 
1 628 ASP n 
1 629 PRO n 
1 630 LEU n 
1 631 TYR n 
1 632 VAL n 
1 633 VAL n 
1 634 GLU n 
1 635 VAL n 
1 636 LEU n 
1 637 LEU n 
1 638 ARG n 
1 639 CYS n 
1 640 SER n 
1 641 LYS n 
1 642 GLU n 
1 643 SER n 
1 644 LEU n 
1 645 LYS n 
1 646 ASN n 
1 647 SER n 
1 648 ALA n 
1 649 THR n 
1 650 GLU n 
1 651 ALA n 
1 652 ALA n 
1 653 LYS n 
1 654 PRO n 
1 655 ALA n 
1 656 LYS n 
1 657 PRO n 
1 658 ASP n 
1 659 GLU n 
1 660 LYS n 
1 661 GLY n 
1 662 GLU n 
1 663 MET n 
1 664 GLN n 
1 665 VAL n 
1 666 VAL n 
1 667 PRO n 
1 668 VAL n 
1 669 LEU n 
1 670 VAL n 
1 671 HIS n 
1 672 LEU n 
1 673 LEU n 
1 674 SER n 
1 675 ALA n 
1 676 ILE n 
1 677 SER n 
1 678 SER n 
1 679 VAL n 
1 680 ARG n 
1 681 LEU n 
1 682 TYR n 
1 683 ILE n 
1 684 PRO n 
1 685 LYS n 
1 686 ASP n 
1 687 LEU n 
1 688 ARG n 
1 689 PRO n 
1 690 VAL n 
1 691 ASP n 
1 692 ASN n 
1 693 ARG n 
1 694 GLN n 
1 695 SER n 
1 696 VAL n 
1 697 LEU n 
1 698 LYS n 
1 699 SER n 
1 700 ILE n 
1 701 GLN n 
1 702 GLU n 
1 703 VAL n 
1 704 GLN n 
1 705 LYS n 
1 706 ARG n 
1 707 PHE n 
1 708 PRO n 
1 709 ASP n 
1 710 GLY n 
1 711 ILE n 
1 712 PRO n 
1 713 LEU n 
1 714 LEU n 
1 715 ASP n 
1 716 PRO n 
1 717 ILE n 
1 718 ASP n 
1 719 ASP n 
1 720 MET n 
1 721 GLY n 
1 722 ILE n 
1 723 GLN n 
1 724 ASP n 
1 725 GLN n 
1 726 GLY n 
1 727 LEU n 
1 728 LYS n 
1 729 LYS n 
1 730 VAL n 
1 731 ILE n 
1 732 GLN n 
1 733 LYS n 
1 734 VAL n 
1 735 GLU n 
1 736 ALA n 
1 737 PHE n 
1 738 GLU n 
1 739 HIS n 
1 740 ARG n 
1 741 MET n 
1 742 TYR n 
1 743 SER n 
1 744 HIS n 
1 745 PRO n 
1 746 LEU n 
1 747 HIS n 
1 748 ASN n 
1 749 ASP n 
1 750 PRO n 
1 751 ASN n 
1 752 LEU n 
1 753 GLU n 
1 754 THR n 
1 755 VAL n 
1 756 TYR n 
1 757 THR n 
1 758 LEU n 
1 759 CYS n 
1 760 GLU n 
1 761 LYS n 
1 762 LYS n 
1 763 ALA n 
1 764 GLN n 
1 765 ILE n 
1 766 ALA n 
1 767 ILE n 
1 768 ASP n 
1 769 ILE n 
1 770 LYS n 
1 771 SER n 
1 772 ALA n 
1 773 LYS n 
1 774 ARG n 
1 775 GLU n 
1 776 LEU n 
1 777 LYS n 
1 778 LYS n 
1 779 ALA n 
1 780 ARG n 
1 781 THR n 
1 782 VAL n 
1 783 LEU n 
1 784 GLN n 
1 785 MET n 
1 786 ASP n 
1 787 GLU n 
1 788 LEU n 
1 789 LYS n 
1 790 CYS n 
1 791 ARG n 
1 792 LYS n 
1 793 ARG n 
1 794 VAL n 
1 795 LEU n 
1 796 ARG n 
1 797 ARG n 
1 798 LEU n 
1 799 GLY n 
1 800 PHE n 
1 801 ALA n 
1 802 THR n 
1 803 SER n 
1 804 SER n 
1 805 ASP n 
1 806 VAL n 
1 807 ILE n 
1 808 GLU n 
1 809 MET n 
1 810 LYS n 
1 811 GLY n 
1 812 ARG n 
1 813 VAL n 
1 814 ALA n 
1 815 CYS n 
1 816 GLU n 
1 817 ILE n 
1 818 SER n 
1 819 SER n 
1 820 ALA n 
1 821 ASP n 
1 822 GLU n 
1 823 LEU n 
1 824 LEU n 
1 825 LEU n 
1 826 THR n 
1 827 GLU n 
1 828 MET n 
1 829 MET n 
1 830 PHE n 
1 831 ASN n 
1 832 GLY n 
1 833 LEU n 
1 834 PHE n 
1 835 ASN n 
1 836 ASP n 
1 837 LEU n 
1 838 SER n 
1 839 ALA n 
1 840 GLU n 
1 841 GLN n 
1 842 ALA n 
1 843 THR n 
1 844 ALA n 
1 845 LEU n 
1 846 LEU n 
1 847 SER n 
1 848 CYS n 
1 849 PHE n 
1 850 VAL n 
1 851 PHE n 
1 852 GLN n 
1 853 GLU n 
1 854 ASN n 
1 855 SER n 
1 856 SER n 
1 857 GLU n 
1 858 MET n 
1 859 PRO n 
1 860 LYS n 
1 861 LEU n 
1 862 THR n 
1 863 GLU n 
1 864 GLN n 
1 865 LEU n 
1 866 ALA n 
1 867 GLY n 
1 868 PRO n 
1 869 LEU n 
1 870 ARG n 
1 871 GLN n 
1 872 MET n 
1 873 GLN n 
1 874 GLU n 
1 875 CYS n 
1 876 ALA n 
1 877 LYS n 
1 878 ARG n 
1 879 ILE n 
1 880 ALA n 
1 881 LYS n 
1 882 VAL n 
1 883 SER n 
1 884 ALA n 
1 885 GLU n 
1 886 ALA n 
1 887 LYS n 
1 888 LEU n 
1 889 GLU n 
1 890 ILE n 
1 891 ASP n 
1 892 GLU n 
1 893 GLU n 
1 894 THR n 
1 895 TYR n 
1 896 LEU n 
1 897 SER n 
1 898 SER n 
1 899 PHE n 
1 900 LYS n 
1 901 PRO n 
1 902 HIS n 
1 903 LEU n 
1 904 MET n 
1 905 ASP n 
1 906 VAL n 
1 907 VAL n 
1 908 TYR n 
1 909 THR n 
1 910 TRP n 
1 911 ALA n 
1 912 THR n 
1 913 GLY n 
1 914 ALA n 
1 915 THR n 
1 916 PHE n 
1 917 ALA n 
1 918 HIS n 
1 919 ILE n 
1 920 CYS n 
1 921 LYS n 
1 922 MET n 
1 923 THR n 
1 924 ASP n 
1 925 VAL n 
1 926 PHE n 
1 927 GLU n 
1 928 GLY n 
1 929 SER n 
1 930 ILE n 
1 931 ILE n 
1 932 ARG n 
1 933 CYS n 
1 934 MET n 
1 935 ARG n 
1 936 ARG n 
1 937 LEU n 
1 938 GLU n 
1 939 GLU n 
1 940 LEU n 
1 941 LEU n 
1 942 ARG n 
1 943 GLN n 
1 944 MET n 
1 945 CYS n 
1 946 GLN n 
1 947 ALA n 
1 948 ALA n 
1 949 LYS n 
1 950 ALA n 
1 951 ILE n 
1 952 GLY n 
1 953 ASN n 
1 954 THR n 
1 955 GLU n 
1 956 LEU n 
1 957 GLU n 
1 958 ASN n 
1 959 LYS n 
1 960 PHE n 
1 961 ALA n 
1 962 GLU n 
1 963 GLY n 
1 964 ILE n 
1 965 THR n 
1 966 LYS n 
1 967 ILE n 
1 968 LYS n 
1 969 ARG n 
1 970 ASP n 
1 971 ILE n 
1 972 VAL n 
1 973 PHE n 
1 974 ALA n 
1 975 ALA n 
1 976 SER n 
1 977 LEU n 
1 978 TYR n 
1 979 LEU n 
2 1   SER n 
2 2   PHE n 
2 3   ARG n 
2 4   THR n 
2 5   ASP n 
2 6   LYS n 
2 7   LYS n 
2 8   PRO n 
2 9   ASP n 
2 10  PRO n 
2 11  ALA n 
2 12  ASN n 
2 13  TRP n 
2 14  GLU n 
2 15  TYR n 
2 16  LYS n 
2 17  SER n 
2 18  LEU n 
2 19  TYR n 
2 20  ARG n 
2 21  GLY n 
2 22  ASP n 
2 23  ILE n 
2 24  ALA n 
2 25  ARG n 
2 26  TYR n 
2 27  LYS n 
2 28  ARG n 
2 29  LYS n 
2 30  GLY n 
2 31  ASP n 
2 32  SER n 
2 33  CYS n 
2 34  LEU n 
2 35  GLY n 
2 36  ILE n 
2 37  ASN n 
2 38  PRO n 
2 39  LYS n 
2 40  LYS n 
2 41  GLN n 
2 42  CYS n 
2 43  ILE n 
2 44  SER n 
2 45  TRP n 
2 46  GLU n 
2 47  GLY n 
2 48  THR n 
2 49  SER n 
2 50  THR n 
2 51  GLU n 
2 52  LYS n 
2 53  LYS n 
2 54  HIS n 
2 55  SER n 
2 56  ARG n 
2 57  LYS n 
2 58  GLN n 
2 59  VAL n 
2 60  GLU n 
2 61  ARG n 
2 62  TYR n 
2 63  PHE n 
2 64  THR n 
2 65  LYS n 
2 66  LYS n 
2 67  SER n 
2 68  VAL n 
2 69  GLY n 
2 70  LEU n 
2 71  MET n 
2 72  ASN n 
2 73  ILE n 
2 74  ASP n 
2 75  GLY n 
2 76  VAL n 
2 77  ALA n 
2 78  ILE n 
2 79  SER n 
2 80  SER n 
2 81  LYS n 
2 82  THR n 
2 83  GLU n 
2 84  PRO n 
2 85  PRO n 
2 86  SER n 
2 87  SER n 
2 88  GLU n 
2 89  PRO n 
2 90  ILE n 
2 91  SER n 
2 92  PHE n 
2 93  ILE n 
2 94  PRO n 
2 95  VAL n 
2 96  LYS n 
2 97  ASP n 
2 98  LEU n 
2 99  GLU n 
2 100 ASP n 
2 101 ALA n 
2 102 ALA n 
2 103 PRO n 
2 104 VAL n 
2 105 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 979 Human ? 'MTREX, DOB1, KIAA0052, MTR4, SKIV2L2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 105 Human ? 'NRDE2, C14orf102'                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli'      562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MTREX_HUMAN P42285 ? 1 
;TDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAFQREAIQC
VDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTE
ILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTD
YRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVI
IFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEIL
FSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQ
LLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEESVVIYYKIR
QQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESLKNS
ATEAAKPAKPDEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPIDDMGIQDQGL
KKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVI
EMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAK
LEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKI
KRDIVFAASLYL
;
71  
2 UNP NRDE2_HUMAN Q9H7Z3 ? 2 
;FRTDKKPDPANWEYKSLYRGDIARYKRKGDSCLGINPKKQCISWEGTSTEKKHSRKQVERYFTKKSVGLMNIDGVAISSK
TEPPSSEPISFIPVKDLEDAAPVT
;
163 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6IEH B 8 ? 979 ? P42285 71  ? 1042 ? 71  1042 
2 2 6IEH A 2 ? 105 ? Q9H7Z3 163 ? 266  ? 163 266  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6IEH GLY B 1 ? UNP P42285 ? ? 'expression tag' 64  1 
1 6IEH ALA B 2 ? UNP P42285 ? ? 'expression tag' 65  2 
1 6IEH MET B 3 ? UNP P42285 ? ? 'expression tag' 66  3 
1 6IEH ASP B 4 ? UNP P42285 ? ? 'expression tag' 67  4 
1 6IEH PRO B 5 ? UNP P42285 ? ? 'expression tag' 68  5 
1 6IEH GLU B 6 ? UNP P42285 ? ? 'expression tag' 69  6 
1 6IEH PHE B 7 ? UNP P42285 ? ? 'expression tag' 70  7 
2 6IEH SER A 1 ? UNP Q9H7Z3 ? ? 'expression tag' 162 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CL  non-polymer         . 'CHLORIDE ION'              ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6IEH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.79 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.91 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM Glycine pH 9.0, 100 mM NaCl, 33% (w/v) polyethylene glycol 300 (PEG 300)' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 300K' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-03-21 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97893 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97893 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6IEH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.88 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       29469 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.077 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.9 
_reflns_shell.d_res_low                   3.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4141 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.369 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6IEH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.892 
_refine.ls_d_res_low                             40.100 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     29379 
_refine.ls_number_reflns_R_free                  1496 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.44 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2364 
_refine.ls_R_factor_R_free                       0.2522 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2355 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4U4C 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.35 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.38 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7583 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               7647 
_refine_hist.d_res_high                       2.892 
_refine_hist.d_res_low                        40.100 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.036  ? 7763  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 2.382  ? 10549 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 24.464 ? 2771  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.202  ? 1228  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.014  ? 1356  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8917 2.9850  . . 125 2518 98.00 . . . 0.3568 . 0.3428 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9850 3.0917  . . 141 2520 98.00 . . . 0.3655 . 0.3369 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0917 3.2154  . . 148 2515 99.00 . . . 0.3217 . 0.3163 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2154 3.3617  . . 138 2506 99.00 . . . 0.2926 . 0.2732 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3617 3.5388  . . 141 2521 99.00 . . . 0.2741 . 0.2459 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5388 3.7604  . . 128 2545 99.00 . . . 0.2669 . 0.2472 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7604 4.0505  . . 130 2564 99.00 . . . 0.2377 . 0.2199 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0505 4.4576  . . 140 2546 99.00 . . . 0.2165 . 0.1945 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4576 5.1015  . . 132 2552 99.00 . . . 0.2005 . 0.1920 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1015 6.4231  . . 134 2571 99.00 . . . 0.2593 . 0.2323 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.4231 40.1035 . . 139 2525 96.00 . . . 0.2016 . 0.2066 . . . . . . . . . . 
# 
_struct.entry_id                     6IEH 
_struct.title                        'Crystal structures of the hMTR4-NRDE2 complex' 
_struct.pdbx_descriptor              'Exosome RNA helicase MTR4 (E.C.3.6.4.13), Protein NRDE2 homolog' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6IEH 
_struct_keywords.text            'RNA helicase, MTR4, NRDE2, Complex, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 78  ? ASN A 90  ? ASP B 141  ASN B 153  1 ? 13 
HELX_P HELX_P2  AA2 LYS A 104 ? GLU A 118 ? LYS B 167  GLU B 181  1 ? 15 
HELX_P HELX_P3  AA3 ILE A 128 ? PHE A 143 ? ILE B 191  PHE B 206  1 ? 16 
HELX_P HELX_P4  AA4 THR A 166 ? GLY A 176 ? THR B 229  GLY B 239  1 ? 11 
HELX_P HELX_P5  AA5 SER A 177 ? ARG A 181 ? SER B 240  ARG B 244  5 ? 5  
HELX_P HELX_P6  AA6 GLU A 190 ? ASP A 196 ? GLU B 253  ASP B 259  5 ? 7  
HELX_P HELX_P7  AA7 ARG A 199 ? LEU A 210 ? ARG B 262  LEU B 273  1 ? 12 
HELX_P HELX_P8  AA8 ASN A 225 ? LYS A 238 ? ASN B 288  LYS B 301  1 ? 14 
HELX_P HELX_P9  AA9 ARG A 276 ? ASP A 289 ? ARG B 339  ASP B 352  1 ? 14 
HELX_P HELX_P10 AB1 ASN A 310 ? ARG A 321 ? ASN B 373  ARG B 384  1 ? 12 
HELX_P HELX_P11 AB2 SER A 332 ? MET A 343 ? SER B 395  MET B 406  1 ? 12 
HELX_P HELX_P12 AB3 THR A 344 ? LEU A 346 ? THR B 407  LEU B 409  5 ? 3  
HELX_P HELX_P13 AB4 THR A 350 ? ASP A 366 ? THR B 413  ASP B 429  1 ? 17 
HELX_P HELX_P14 AB5 SER A 369 ? LYS A 374 ? SER B 432  LYS B 437  1 ? 6  
HELX_P HELX_P15 AB6 LEU A 375 ? HIS A 380 ? LEU B 438  HIS B 443  1 ? 6  
HELX_P HELX_P16 AB7 VAL A 381 ? ARG A 387 ? VAL B 444  ARG B 450  1 ? 7  
HELX_P HELX_P17 AB8 LEU A 397 ? GLY A 411 ? LEU B 460  GLY B 474  1 ? 15 
HELX_P HELX_P18 AB9 THR A 421 ? ALA A 423 ? THR B 484  ALA B 486  5 ? 3  
HELX_P HELX_P19 AC1 SER A 450 ? GLY A 459 ? SER B 513  GLY B 522  1 ? 10 
HELX_P HELX_P20 AC2 SER A 481 ? GLY A 491 ? SER B 544  GLY B 554  1 ? 11 
HELX_P HELX_P21 AC3 THR A 503 ? VAL A 513 ? THR B 566  VAL B 576  1 ? 11 
HELX_P HELX_P22 AC4 ASN A 517 ? LYS A 524 ? ASN B 580  LYS B 587  1 ? 8  
HELX_P HELX_P23 AC5 SER A 525 ? ALA A 534 ? SER B 588  ALA B 597  1 ? 10 
HELX_P HELX_P24 AC6 ALA A 534 ? ILE A 552 ? ALA B 597  ILE B 615  1 ? 19 
HELX_P HELX_P25 AC7 SER A 559 ? HIS A 582 ? SER B 622  HIS B 645  1 ? 24 
HELX_P HELX_P26 AC8 LYS A 583 ? LEU A 588 ? LYS B 646  LEU B 651  1 ? 6  
HELX_P HELX_P27 AC9 PRO A 589 ? LEU A 591 ? PRO B 652  LEU B 654  5 ? 3  
HELX_P HELX_P28 AD1 SER A 640 ? LYS A 645 ? SER B 703  LYS B 708  1 ? 6  
HELX_P HELX_P29 AD2 PRO A 689 ? PHE A 707 ? PRO B 752  PHE B 770  1 ? 19 
HELX_P HELX_P30 AD3 ASP A 724 ? HIS A 744 ? ASP B 787  HIS B 807  1 ? 21 
HELX_P HELX_P31 AD4 HIS A 744 ? ASP A 749 ? HIS B 807  ASP B 812  1 ? 6  
HELX_P HELX_P32 AD5 ASN A 751 ? LYS A 778 ? ASN B 814  LYS B 841  1 ? 28 
HELX_P HELX_P33 AD6 GLN A 784 ? LEU A 798 ? GLN B 847  LEU B 861  1 ? 15 
HELX_P HELX_P34 AD7 GLU A 808 ? ILE A 817 ? GLU B 871  ILE B 880  1 ? 10 
HELX_P HELX_P35 AD8 ASP A 821 ? ASN A 831 ? ASP B 884  ASN B 894  1 ? 11 
HELX_P HELX_P36 AD9 GLY A 832 ? LEU A 837 ? GLY B 895  LEU B 900  5 ? 6  
HELX_P HELX_P37 AE1 SER A 838 ? PHE A 851 ? SER B 901  PHE B 914  1 ? 14 
HELX_P HELX_P38 AE2 THR A 862 ? ALA A 886 ? THR B 925  ALA B 949  1 ? 25 
HELX_P HELX_P39 AE3 ASP A 891 ? SER A 897 ? ASP B 954  SER B 960  1 ? 7  
HELX_P HELX_P40 AE4 LEU A 903 ? THR A 912 ? LEU B 966  THR B 975  1 ? 10 
HELX_P HELX_P41 AE5 THR A 915 ? THR A 923 ? THR B 978  THR B 986  1 ? 9  
HELX_P HELX_P42 AE6 PHE A 926 ? ILE A 951 ? PHE B 989  ILE B 1014 1 ? 26 
HELX_P HELX_P43 AE7 ASN A 953 ? LYS A 968 ? ASN B 1016 LYS B 1031 1 ? 16 
HELX_P HELX_P44 AE8 ARG A 969 ? ALA A 974 ? ARG B 1032 ALA B 1037 5 ? 6  
HELX_P HELX_P45 AE9 PRO B 10  ? LYS B 16  ? PRO A 171  LYS A 177  1 ? 7  
HELX_P HELX_P46 AF1 ARG B 56  ? LYS B 65  ? ARG A 217  LYS A 226  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           ASP 
_struct_conn.ptnr1_label_seq_id            604 
_struct_conn.ptnr1_label_atom_id           OD2 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           LYS 
_struct_conn.ptnr2_label_seq_id            653 
_struct_conn.ptnr2_label_atom_id           NZ 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            ASP 
_struct_conn.ptnr1_auth_seq_id             667 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            LYS 
_struct_conn.ptnr2_auth_seq_id             716 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.265 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 8  ? 
AA3 ? 2  ? 
AA4 ? 6  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA1 3 4  ? parallel      
AA1 4 5  ? parallel      
AA1 5 6  ? parallel      
AA1 6 7  ? parallel      
AA1 7 8  ? parallel      
AA1 8 9  ? parallel      
AA1 9 10 ? anti-parallel 
AA2 1 2  ? parallel      
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? parallel      
AA2 5 6  ? parallel      
AA2 6 7  ? anti-parallel 
AA2 7 8  ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA4 2 3  ? anti-parallel 
AA4 3 4  ? anti-parallel 
AA4 4 5  ? anti-parallel 
AA4 5 6  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 36  ? VAL A 41  ? VAL B 99  VAL B 104 
AA1 2  CYS A 47  ? PRO A 54  ? CYS B 110 PRO B 117 
AA1 3  CYS A 241 ? THR A 246 ? CYS B 304 THR B 309 
AA1 4  SER A 93  ? SER A 97  ? SER B 156 SER B 160 
AA1 5  HIS A 215 ? SER A 220 ? HIS B 278 SER B 283 
AA1 6  VAL A 183 ? PHE A 188 ? VAL B 246 PHE B 251 
AA1 7  ARG A 121 ? SER A 126 ? ARG B 184 SER B 189 
AA1 8  CYS A 161 ? THR A 165 ? CYS B 224 THR B 228 
AA1 9  VAL A 146 ? MET A 149 ? VAL B 209 MET B 212 
AA1 10 THR A 154 ? ILE A 155 ? THR B 217 ILE B 218 
AA2 1  ILE A 389 ? HIS A 392 ? ILE B 452 HIS B 455 
AA2 2  ALA A 415 ? THR A 419 ? ALA B 478 THR B 482 
AA2 3  VAL A 326 ? SER A 330 ? VAL B 389 SER B 393 
AA2 4  THR A 432 ? PHE A 435 ? THR B 495 PHE B 498 
AA2 5  GLY A 470 ? VAL A 476 ? GLY B 533 VAL B 539 
AA2 6  LEU A 253 ? PRO A 259 ? LEU B 316 PRO B 322 
AA2 7  GLY A 264 ? VAL A 269 ? GLY B 327 VAL B 332 
AA2 8  PHE B 92  ? PRO B 94  ? PHE A 253 PRO A 255 
AA3 1  ARG A 439 ? PHE A 441 ? ARG B 502 PHE B 504 
AA3 2  PHE A 446 ? TRP A 448 ? PHE B 509 TRP B 511 
AA4 1  GLU A 662 ? LEU A 669 ? GLU B 725 LEU B 732 
AA4 2  LEU A 630 ? CYS A 639 ? LEU B 693 CYS B 702 
AA4 3  ASP A 604 ? LYS A 617 ? ASP B 667 LYS B 680 
AA4 4  ARG A 595 ? ASN A 601 ? ARG B 658 ASN B 664 
AA4 5  LEU A 673 ? ARG A 680 ? LEU B 736 ARG B 743 
AA4 6  ARG B 3   ? THR B 4   ? ARG A 164 THR A 165 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  N VAL A 41  ? N VAL B 104 O HIS A 49  ? O HIS B 112 
AA1 2 3  N THR A 48  ? N THR B 111 O TYR A 245 ? O TYR B 308 
AA1 3 4  O HIS A 242 ? O HIS B 305 N LEU A 95  ? N LEU B 158 
AA1 4 5  N VAL A 96  ? N VAL B 159 O PHE A 218 ? O PHE B 281 
AA1 5 6  O LEU A 219 ? O LEU B 282 N PHE A 188 ? N PHE B 251 
AA1 6 7  O ILE A 187 ? O ILE B 250 N ILE A 123 ? N ILE B 186 
AA1 7 8  N PHE A 124 ? N PHE B 187 O MET A 164 ? O MET B 227 
AA1 8 9  O VAL A 163 ? O VAL B 226 N GLY A 147 ? N GLY B 210 
AA1 9 10 N LEU A 148 ? N LEU B 211 O ILE A 155 ? O ILE B 218 
AA2 1 2  N GLY A 390 ? N GLY B 453 O PHE A 417 ? O PHE B 480 
AA2 2 3  O LEU A 416 ? O LEU B 479 N ILE A 328 ? N ILE B 391 
AA2 3 4  N PHE A 329 ? N PHE B 392 O LEU A 434 ? O LEU B 497 
AA2 4 5  N VAL A 433 ? N VAL B 496 O ILE A 473 ? O ILE B 536 
AA2 5 6  O VAL A 472 ? O VAL B 535 N TYR A 256 ? N TYR B 319 
AA2 6 7  N ILE A 257 ? N ILE B 320 O HIS A 266 ? O HIS B 329 
AA2 7 8  N LEU A 265 ? N LEU B 328 O ILE B 93  ? O ILE A 254 
AA3 1 2  N LYS A 440 ? N LYS B 503 O ARG A 447 ? O ARG B 510 
AA4 1 2  O VAL A 668 ? O VAL B 731 N VAL A 633 ? N VAL B 696 
AA4 2 3  O GLU A 634 ? O GLU B 697 N VAL A 612 ? N VAL B 675 
AA4 3 4  O GLY A 609 ? O GLY B 672 N VAL A 597 ? N VAL B 660 
AA4 4 5  N LYS A 598 ? N LYS B 661 O ALA A 675 ? O ALA B 738 
AA4 5 6  N ARG A 680 ? N ARG B 743 O ARG B 3   ? O ARG A 164 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B CL  1101 ? 3  'binding site for residue CL B 1101'  
AC2 Software B ATP 1102 ? 12 'binding site for residue ATP B 1102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  MET A 663 ? MET B 726 . ? 1_555 ? 
2  AC1 3  LEU A 687 ? LEU B 750 . ? 1_555 ? 
3  AC1 3  ARG A 693 ? ARG B 756 . ? 1_555 ? 
4  AC2 12 PHE A 75  ? PHE B 138 . ? 1_555 ? 
5  AC2 12 ILE A 76  ? ILE B 139 . ? 1_555 ? 
6  AC2 12 GLN A 81  ? GLN B 144 . ? 1_555 ? 
7  AC2 12 THR A 100 ? THR B 163 . ? 1_555 ? 
8  AC2 12 SER A 101 ? SER B 164 . ? 1_555 ? 
9  AC2 12 GLY A 103 ? GLY B 166 . ? 1_555 ? 
10 AC2 12 LYS A 104 ? LYS B 167 . ? 1_555 ? 
11 AC2 12 THR A 105 ? THR B 168 . ? 1_555 ? 
12 AC2 12 LYS A 135 ? LYS B 198 . ? 1_555 ? 
13 AC2 12 ASP A 189 ? ASP B 252 . ? 1_555 ? 
14 AC2 12 GLU A 190 ? GLU B 253 . ? 1_555 ? 
15 AC2 12 ARG A 464 ? ARG B 527 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6IEH 
_atom_sites.fract_transf_matrix[1][1]   0.006743 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000767 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008793 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012469 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 35  ? -40.016 -10.628 -15.053 1.00 39.79  ? 98   ARG B N     1 
ATOM   2    C  CA    . ARG A 1 35  ? -39.206 -10.274 -16.179 1.00 31.58  ? 98   ARG B CA    1 
ATOM   3    C  C     . ARG A 1 35  ? -38.159 -11.282 -16.419 1.00 35.97  ? 98   ARG B C     1 
ATOM   4    O  O     . ARG A 1 35  ? -37.178 -10.973 -17.017 1.00 30.06  ? 98   ARG B O     1 
ATOM   5    C  CB    . ARG A 1 35  ? -38.521 -8.965  -15.896 1.00 30.98  ? 98   ARG B CB    1 
ATOM   6    N  N     . VAL A 1 36  ? -38.373 -12.490 -15.927 1.00 36.40  ? 99   VAL B N     1 
ATOM   7    C  CA    . VAL A 1 36  ? -37.441 -13.581 -15.998 1.00 32.54  ? 99   VAL B CA    1 
ATOM   8    C  C     . VAL A 1 36  ? -38.218 -14.819 -16.361 1.00 31.90  ? 99   VAL B C     1 
ATOM   9    O  O     . VAL A 1 36  ? -39.324 -14.955 -15.968 1.00 36.23  ? 99   VAL B O     1 
ATOM   10   C  CB    . VAL A 1 36  ? -36.758 -13.708 -14.620 1.00 36.46  ? 99   VAL B CB    1 
ATOM   11   C  CG1   . VAL A 1 36  ? -36.103 -15.033 -14.366 1.00 35.59  ? 99   VAL B CG1   1 
ATOM   12   C  CG2   . VAL A 1 36  ? -35.793 -12.591 -14.378 1.00 28.92  ? 99   VAL B CG2   1 
ATOM   13   N  N     . LYS A 1 37  ? -37.622 -15.695 -17.149 1.00 33.79  ? 100  LYS B N     1 
ATOM   14   C  CA    . LYS A 1 37  ? -38.182 -16.962 -17.567 1.00 31.88  ? 100  LYS B CA    1 
ATOM   15   C  C     . LYS A 1 37  ? -37.228 -18.042 -17.210 1.00 34.19  ? 100  LYS B C     1 
ATOM   16   O  O     . LYS A 1 37  ? -36.067 -17.826 -17.045 1.00 38.54  ? 100  LYS B O     1 
ATOM   17   C  CB    . LYS A 1 37  ? -38.384 -17.021 -19.056 1.00 31.09  ? 100  LYS B CB    1 
ATOM   18   C  CG    . LYS A 1 37  ? -37.134 -16.916 -19.875 1.00 27.45  ? 100  LYS B CG    1 
ATOM   19   C  CD    . LYS A 1 37  ? -37.433 -16.914 -21.341 1.00 23.84  ? 100  LYS B CD    1 
ATOM   20   C  CE    . LYS A 1 37  ? -36.397 -16.184 -22.149 1.00 29.20  ? 100  LYS B CE    1 
ATOM   21   N  NZ    . LYS A 1 37  ? -36.462 -16.774 -23.496 1.00 34.45  ? 100  LYS B NZ    1 
ATOM   22   N  N     . VAL A 1 38  ? -37.740 -19.231 -17.045 1.00 32.68  ? 101  VAL B N     1 
ATOM   23   C  CA    . VAL A 1 38  ? -36.905 -20.339 -16.722 1.00 33.43  ? 101  VAL B CA    1 
ATOM   24   C  C     . VAL A 1 38  ? -37.027 -21.369 -17.804 1.00 35.63  ? 101  VAL B C     1 
ATOM   25   O  O     . VAL A 1 38  ? -38.068 -21.545 -18.348 1.00 38.97  ? 101  VAL B O     1 
ATOM   26   C  CB    . VAL A 1 38  ? -37.292 -20.926 -15.379 1.00 29.73  ? 101  VAL B CB    1 
ATOM   27   C  CG1   . VAL A 1 38  ? -36.337 -22.003 -14.962 1.00 30.11  ? 101  VAL B CG1   1 
ATOM   28   C  CG2   . VAL A 1 38  ? -37.282 -19.853 -14.348 1.00 26.58  ? 101  VAL B CG2   1 
ATOM   29   N  N     . GLN A 1 39  ? -35.922 -21.978 -18.163 1.00 31.31  ? 102  GLN B N     1 
ATOM   30   C  CA    . GLN A 1 39  ? -35.854 -23.028 -19.125 1.00 26.28  ? 102  GLN B CA    1 
ATOM   31   C  C     . GLN A 1 39  ? -35.339 -24.226 -18.445 1.00 32.63  ? 102  GLN B C     1 
ATOM   32   O  O     . GLN A 1 39  ? -34.504 -24.122 -17.633 1.00 37.23  ? 102  GLN B O     1 
ATOM   33   C  CB    . GLN A 1 39  ? -34.849 -22.672 -20.173 1.00 27.34  ? 102  GLN B CB    1 
ATOM   34   C  CG    . GLN A 1 39  ? -34.721 -23.675 -21.280 1.00 30.28  ? 102  GLN B CG    1 
ATOM   35   C  CD    . GLN A 1 39  ? -35.903 -23.690 -22.173 1.00 37.08  ? 102  GLN B CD    1 
ATOM   36   O  OE1   . GLN A 1 39  ? -36.483 -22.684 -22.428 1.00 35.57  ? 102  GLN B OE1   1 
ATOM   37   N  NE2   . GLN A 1 39  ? -36.276 -24.830 -22.617 1.00 34.52  ? 102  GLN B NE2   1 
ATOM   38   N  N     . SER A 1 40  ? -35.834 -25.392 -18.762 1.00 34.36  ? 103  SER B N     1 
ATOM   39   C  CA    . SER A 1 40  ? -35.331 -26.564 -18.120 1.00 30.99  ? 103  SER B CA    1 
ATOM   40   C  C     . SER A 1 40  ? -34.453 -27.297 -19.022 1.00 31.45  ? 103  SER B C     1 
ATOM   41   O  O     . SER A 1 40  ? -34.802 -27.495 -20.090 1.00 32.46  ? 103  SER B O     1 
ATOM   42   C  CB    . SER A 1 40  ? -36.454 -27.456 -17.669 1.00 31.40  ? 103  SER B CB    1 
ATOM   43   O  OG    . SER A 1 40  ? -36.790 -28.408 -18.626 1.00 38.51  ? 103  SER B OG    1 
ATOM   44   N  N     . VAL A 1 41  ? -33.302 -27.724 -18.570 1.00 33.52  ? 104  VAL B N     1 
ATOM   45   C  CA    . VAL A 1 41  ? -32.405 -28.456 -19.428 1.00 31.93  ? 104  VAL B CA    1 
ATOM   46   C  C     . VAL A 1 41  ? -32.146 -29.914 -19.054 1.00 37.99  ? 104  VAL B C     1 
ATOM   47   O  O     . VAL A 1 41  ? -31.925 -30.235 -17.944 1.00 40.65  ? 104  VAL B O     1 
ATOM   48   C  CB    . VAL A 1 41  ? -31.137 -27.678 -19.684 1.00 32.70  ? 104  VAL B CB    1 
ATOM   49   C  CG1   . VAL A 1 41  ? -31.040 -26.430 -18.851 1.00 33.18  ? 104  VAL B CG1   1 
ATOM   50   C  CG2   . VAL A 1 41  ? -29.945 -28.561 -19.579 1.00 41.77  ? 104  VAL B CG2   1 
ATOM   51   N  N     . GLU A 1 42  ? -32.236 -30.824 -20.006 1.00 47.44  ? 105  GLU B N     1 
ATOM   52   C  CA    . GLU A 1 42  ? -32.059 -32.236 -19.713 1.00 44.23  ? 105  GLU B CA    1 
ATOM   53   C  C     . GLU A 1 42  ? -30.674 -32.714 -19.404 1.00 49.57  ? 105  GLU B C     1 
ATOM   54   O  O     . GLU A 1 42  ? -29.712 -32.360 -20.022 1.00 53.80  ? 105  GLU B O     1 
ATOM   55   C  CB    . GLU A 1 42  ? -32.690 -33.104 -20.775 1.00 41.71  ? 105  GLU B CB    1 
ATOM   56   N  N     . THR A 1 43  ? -30.611 -33.554 -18.404 1.00 47.21  ? 106  THR B N     1 
ATOM   57   C  CA    . THR A 1 43  ? -29.394 -34.144 -17.893 1.00 53.20  ? 106  THR B CA    1 
ATOM   58   C  C     . THR A 1 43  ? -29.667 -35.600 -17.577 1.00 59.97  ? 106  THR B C     1 
ATOM   59   O  O     . THR A 1 43  ? -30.765 -36.090 -17.771 1.00 60.59  ? 106  THR B O     1 
ATOM   60   C  CB    . THR A 1 43  ? -28.864 -33.426 -16.656 1.00 52.82  ? 106  THR B CB    1 
ATOM   61   O  OG1   . THR A 1 43  ? -29.925 -33.210 -15.762 1.00 50.89  ? 106  THR B OG1   1 
ATOM   62   C  CG2   . THR A 1 43  ? -28.359 -32.128 -16.994 1.00 45.37  ? 106  THR B CG2   1 
ATOM   63   N  N     . VAL A 1 44  ? -28.678 -36.312 -17.081 1.00 57.51  ? 107  VAL B N     1 
ATOM   64   C  CA    . VAL A 1 44  ? -28.892 -37.722 -16.927 1.00 60.40  ? 107  VAL B CA    1 
ATOM   65   C  C     . VAL A 1 44  ? -29.151 -38.429 -15.631 1.00 68.32  ? 107  VAL B C     1 
ATOM   66   O  O     . VAL A 1 44  ? -30.272 -38.817 -15.318 1.00 66.89  ? 107  VAL B O     1 
ATOM   67   C  CB    . VAL A 1 44  ? -27.747 -38.464 -17.593 1.00 67.41  ? 107  VAL B CB    1 
ATOM   68   C  CG1   . VAL A 1 44  ? -28.085 -38.769 -19.046 1.00 66.49  ? 107  VAL B CG1   1 
ATOM   69   C  CG2   . VAL A 1 44  ? -26.464 -37.683 -17.485 1.00 59.14  ? 107  VAL B CG2   1 
ATOM   70   N  N     . GLU A 1 45  ? -28.122 -38.545 -14.839 1.00 64.30  ? 108  GLU B N     1 
ATOM   71   C  CA    . GLU A 1 45  ? -28.238 -39.348 -13.669 1.00 69.47  ? 108  GLU B CA    1 
ATOM   72   C  C     . GLU A 1 45  ? -28.900 -38.718 -12.489 1.00 68.90  ? 108  GLU B C     1 
ATOM   73   O  O     . GLU A 1 45  ? -28.240 -38.383 -11.538 1.00 64.19  ? 108  GLU B O     1 
ATOM   74   C  CB    . GLU A 1 45  ? -26.833 -39.790 -13.283 1.00 71.28  ? 108  GLU B CB    1 
ATOM   75   N  N     . GLY A 1 46  ? -30.213 -38.542 -12.573 1.00 65.79  ? 109  GLY B N     1 
ATOM   76   C  CA    . GLY A 1 46  ? -30.999 -37.982 -11.478 1.00 66.09  ? 109  GLY B CA    1 
ATOM   77   C  C     . GLY A 1 46  ? -30.512 -36.669 -10.921 1.00 67.50  ? 109  GLY B C     1 
ATOM   78   O  O     . GLY A 1 46  ? -30.398 -36.493 -9.721  1.00 62.22  ? 109  GLY B O     1 
ATOM   79   N  N     . CYS A 1 47  ? -30.204 -35.782 -11.843 1.00 65.04  ? 110  CYS B N     1 
ATOM   80   C  CA    . CYS A 1 47  ? -29.670 -34.470 -11.633 1.00 44.29  ? 110  CYS B CA    1 
ATOM   81   C  C     . CYS A 1 47  ? -30.502 -33.538 -12.476 1.00 46.23  ? 110  CYS B C     1 
ATOM   82   O  O     . CYS A 1 47  ? -30.941 -33.908 -13.532 1.00 43.24  ? 110  CYS B O     1 
ATOM   83   C  CB    . CYS A 1 47  ? -28.226 -34.551 -12.070 1.00 45.02  ? 110  CYS B CB    1 
ATOM   84   S  SG    . CYS A 1 47  ? -27.376 -33.128 -12.658 1.00 50.83  ? 110  CYS B SG    1 
ATOM   85   N  N     . THR A 1 48  ? -30.739 -32.332 -11.995 1.00 42.34  ? 111  THR B N     1 
ATOM   86   C  CA    . THR A 1 48  ? -31.559 -31.373 -12.669 1.00 30.98  ? 111  THR B CA    1 
ATOM   87   C  C     . THR A 1 48  ? -30.786 -30.164 -13.028 1.00 33.70  ? 111  THR B C     1 
ATOM   88   O  O     . THR A 1 48  ? -29.976 -29.767 -12.280 1.00 33.61  ? 111  THR B O     1 
ATOM   89   C  CB    . THR A 1 48  ? -32.600 -30.884 -11.711 1.00 25.96  ? 111  THR B CB    1 
ATOM   90   O  OG1   . THR A 1 48  ? -33.219 -31.991 -11.125 1.00 36.32  ? 111  THR B OG1   1 
ATOM   91   C  CG2   . THR A 1 48  ? -33.599 -30.194 -12.390 1.00 31.81  ? 111  THR B CG2   1 
ATOM   92   N  N     . HIS A 1 49  ? -30.983 -29.626 -14.220 1.00 31.16  ? 112  HIS B N     1 
ATOM   93   C  CA    . HIS A 1 49  ? -30.365 -28.414 -14.659 1.00 28.02  ? 112  HIS B CA    1 
ATOM   94   C  C     . HIS A 1 49  ? -31.426 -27.532 -15.227 1.00 30.47  ? 112  HIS B C     1 
ATOM   95   O  O     . HIS A 1 49  ? -32.085 -27.904 -16.135 1.00 30.96  ? 112  HIS B O     1 
ATOM   96   C  CB    . HIS A 1 49  ? -29.379 -28.775 -15.716 1.00 27.73  ? 112  HIS B CB    1 
ATOM   97   C  CG    . HIS A 1 49  ? -28.623 -27.633 -16.304 1.00 26.99  ? 112  HIS B CG    1 
ATOM   98   N  ND1   . HIS A 1 49  ? -27.467 -27.818 -17.000 1.00 37.80  ? 112  HIS B ND1   1 
ATOM   99   C  CD2   . HIS A 1 49  ? -28.858 -26.316 -16.341 1.00 28.16  ? 112  HIS B CD2   1 
ATOM   100  C  CE1   . HIS A 1 49  ? -27.018 -26.667 -17.434 1.00 33.22  ? 112  HIS B CE1   1 
ATOM   101  N  NE2   . HIS A 1 49  ? -27.851 -25.739 -17.050 1.00 29.34  ? 112  HIS B NE2   1 
ATOM   102  N  N     . GLU A 1 50  ? -31.602 -26.356 -14.660 1.00 32.27  ? 113  GLU B N     1 
ATOM   103  C  CA    . GLU A 1 50  ? -32.518 -25.358 -15.125 1.00 29.41  ? 113  GLU B CA    1 
ATOM   104  C  C     . GLU A 1 50  ? -31.766 -24.068 -15.168 1.00 27.59  ? 113  GLU B C     1 
ATOM   105  O  O     . GLU A 1 50  ? -30.904 -23.835 -14.402 1.00 25.59  ? 113  GLU B O     1 
ATOM   106  C  CB    . GLU A 1 50  ? -33.633 -25.195 -14.138 1.00 23.89  ? 113  GLU B CB    1 
ATOM   107  C  CG    . GLU A 1 50  ? -34.289 -26.458 -13.750 1.00 27.18  ? 113  GLU B CG    1 
ATOM   108  C  CD    . GLU A 1 50  ? -35.491 -26.212 -12.991 1.00 30.81  ? 113  GLU B CD    1 
ATOM   109  O  OE1   . GLU A 1 50  ? -35.437 -25.328 -12.209 1.00 30.63  ? 113  GLU B OE1   1 
ATOM   110  O  OE2   . GLU A 1 50  ? -36.466 -26.903 -13.167 1.00 43.96  ? 113  GLU B OE2   1 
ATOM   111  N  N     . VAL A 1 51  ? -32.099 -23.228 -16.100 1.00 26.70  ? 114  VAL B N     1 
ATOM   112  C  CA    . VAL A 1 51  ? -31.462 -21.946 -16.158 1.00 27.37  ? 114  VAL B CA    1 
ATOM   113  C  C     . VAL A 1 51  ? -32.451 -20.817 -16.168 1.00 29.86  ? 114  VAL B C     1 
ATOM   114  O  O     . VAL A 1 51  ? -33.340 -20.823 -16.911 1.00 36.51  ? 114  VAL B O     1 
ATOM   115  C  CB    . VAL A 1 51  ? -30.553 -21.826 -17.373 1.00 31.16  ? 114  VAL B CB    1 
ATOM   116  C  CG1   . VAL A 1 51  ? -31.335 -21.923 -18.626 1.00 31.54  ? 114  VAL B CG1   1 
ATOM   117  C  CG2   . VAL A 1 51  ? -29.832 -20.526 -17.371 1.00 24.75  ? 114  VAL B CG2   1 
ATOM   118  N  N     . ALA A 1 52  ? -32.272 -19.821 -15.346 1.00 34.73  ? 115  ALA B N     1 
ATOM   119  C  CA    . ALA A 1 52  ? -33.137 -18.711 -15.342 1.00 31.24  ? 115  ALA B CA    1 
ATOM   120  C  C     . ALA A 1 52  ? -32.459 -17.692 -16.133 1.00 33.54  ? 115  ALA B C     1 
ATOM   121  O  O     . ALA A 1 52  ? -31.359 -17.412 -15.912 1.00 27.68  ? 115  ALA B O     1 
ATOM   122  C  CB    . ALA A 1 52  ? -33.276 -18.212 -13.956 1.00 27.65  ? 115  ALA B CB    1 
ATOM   123  N  N     . LEU A 1 53  ? -33.136 -17.111 -17.085 1.00 37.43  ? 116  LEU B N     1 
ATOM   124  C  CA    . LEU A 1 53  ? -32.520 -16.094 -17.882 1.00 37.44  ? 116  LEU B CA    1 
ATOM   125  C  C     . LEU A 1 53  ? -33.396 -14.908 -17.976 1.00 40.80  ? 116  LEU B C     1 
ATOM   126  O  O     . LEU A 1 53  ? -34.548 -15.008 -17.794 1.00 37.90  ? 116  LEU B O     1 
ATOM   127  C  CB    . LEU A 1 53  ? -32.304 -16.554 -19.293 1.00 30.60  ? 116  LEU B CB    1 
ATOM   128  C  CG    . LEU A 1 53  ? -32.241 -17.984 -19.651 1.00 40.19  ? 116  LEU B CG    1 
ATOM   129  C  CD1   . LEU A 1 53  ? -33.424 -18.279 -20.500 1.00 30.20  ? 116  LEU B CD1   1 
ATOM   130  C  CD2   . LEU A 1 53  ? -31.005 -18.077 -20.486 1.00 39.16  ? 116  LEU B CD2   1 
ATOM   131  N  N     . PRO A 1 54  ? -32.828 -13.764 -18.324 1.00 38.31  ? 117  PRO B N     1 
ATOM   132  C  CA    . PRO A 1 54  ? -33.567 -12.552 -18.501 1.00 34.53  ? 117  PRO B CA    1 
ATOM   133  C  C     . PRO A 1 54  ? -34.437 -12.811 -19.629 1.00 36.24  ? 117  PRO B C     1 
ATOM   134  O  O     . PRO A 1 54  ? -33.968 -13.230 -20.631 1.00 39.94  ? 117  PRO B O     1 
ATOM   135  C  CB    . PRO A 1 54  ? -32.511 -11.588 -18.931 1.00 40.87  ? 117  PRO B CB    1 
ATOM   136  C  CG    . PRO A 1 54  ? -31.258 -12.151 -18.505 1.00 37.12  ? 117  PRO B CG    1 
ATOM   137  C  CD    . PRO A 1 54  ? -31.443 -13.575 -18.717 1.00 41.56  ? 117  PRO B CD    1 
ATOM   138  N  N     . ALA A 1 55  ? -35.661 -12.354 -19.549 1.00 41.75  ? 118  ALA B N     1 
ATOM   139  C  CA    . ALA A 1 55  ? -36.690 -12.633 -20.529 1.00 33.52  ? 118  ALA B CA    1 
ATOM   140  C  C     . ALA A 1 55  ? -36.518 -12.183 -21.895 1.00 39.63  ? 118  ALA B C     1 
ATOM   141  O  O     . ALA A 1 55  ? -37.144 -12.693 -22.766 1.00 43.73  ? 118  ALA B O     1 
ATOM   142  C  CB    . ALA A 1 55  ? -38.005 -12.167 -20.048 1.00 27.54  ? 118  ALA B CB    1 
ATOM   143  N  N     . GLU A 1 56  ? -35.718 -11.182 -22.111 1.00 40.53  ? 119  GLU B N     1 
ATOM   144  C  CA    . GLU A 1 56  ? -35.540 -10.711 -23.422 1.00 40.72  ? 119  GLU B CA    1 
ATOM   145  C  C     . GLU A 1 56  ? -34.402 -11.351 -24.160 1.00 40.69  ? 119  GLU B C     1 
ATOM   146  O  O     . GLU A 1 56  ? -34.076 -10.955 -25.221 1.00 46.33  ? 119  GLU B O     1 
ATOM   147  C  CB    . GLU A 1 56  ? -35.435 -9.223  -23.391 1.00 39.05  ? 119  GLU B CB    1 
ATOM   148  C  CG    . GLU A 1 56  ? -34.306 -8.730  -22.557 1.00 52.55  ? 119  GLU B CG    1 
ATOM   149  C  CD    . GLU A 1 56  ? -34.649 -8.674  -21.127 1.00 53.12  ? 119  GLU B CD    1 
ATOM   150  O  OE1   . GLU A 1 56  ? -33.748 -8.496  -20.337 1.00 50.39  ? 119  GLU B OE1   1 
ATOM   151  O  OE2   . GLU A 1 56  ? -35.815 -8.787  -20.817 1.00 54.19  ? 119  GLU B OE2   1 
ATOM   152  N  N     . GLU A 1 57  ? -33.787 -12.357 -23.602 1.00 38.25  ? 120  GLU B N     1 
ATOM   153  C  CA    . GLU A 1 57  ? -32.712 -12.999 -24.257 1.00 43.40  ? 120  GLU B CA    1 
ATOM   154  C  C     . GLU A 1 57  ? -33.114 -14.379 -24.542 1.00 36.24  ? 120  GLU B C     1 
ATOM   155  O  O     . GLU A 1 57  ? -33.748 -14.989 -23.778 1.00 33.85  ? 120  GLU B O     1 
ATOM   156  C  CB    . GLU A 1 57  ? -31.473 -12.987 -23.377 1.00 42.55  ? 120  GLU B CB    1 
ATOM   157  N  N     . ASP A 1 58  ? -32.761 -14.835 -25.711 1.00 34.59  ? 121  ASP B N     1 
ATOM   158  C  CA    . ASP A 1 58  ? -33.038 -16.151 -26.153 1.00 39.85  ? 121  ASP B CA    1 
ATOM   159  C  C     . ASP A 1 58  ? -32.226 -17.185 -25.447 1.00 37.45  ? 121  ASP B C     1 
ATOM   160  O  O     . ASP A 1 58  ? -31.065 -17.007 -25.217 1.00 38.96  ? 121  ASP B O     1 
ATOM   161  C  CB    . ASP A 1 58  ? -32.726 -16.205 -27.606 1.00 39.25  ? 121  ASP B CB    1 
ATOM   162  C  CG    . ASP A 1 58  ? -33.408 -15.170 -28.346 1.00 41.41  ? 121  ASP B CG    1 
ATOM   163  O  OD1   . ASP A 1 58  ? -34.605 -15.142 -28.322 1.00 42.02  ? 121  ASP B OD1   1 
ATOM   164  O  OD2   . ASP A 1 58  ? -32.756 -14.377 -28.976 1.00 52.62  ? 121  ASP B OD2   1 
ATOM   165  N  N     . TYR A 1 59  ? -32.857 -18.289 -25.089 1.00 30.49  ? 122  TYR B N     1 
ATOM   166  C  CA    . TYR A 1 59  ? -32.133 -19.345 -24.436 1.00 32.81  ? 122  TYR B CA    1 
ATOM   167  C  C     . TYR A 1 59  ? -31.297 -20.044 -25.456 1.00 36.28  ? 122  TYR B C     1 
ATOM   168  O  O     . TYR A 1 59  ? -31.802 -20.487 -26.466 1.00 41.14  ? 122  TYR B O     1 
ATOM   169  C  CB    . TYR A 1 59  ? -33.097 -20.349 -23.848 1.00 34.51  ? 122  TYR B CB    1 
ATOM   170  C  CG    . TYR A 1 59  ? -32.473 -21.684 -23.554 1.00 37.62  ? 122  TYR B CG    1 
ATOM   171  C  CD1   . TYR A 1 59  ? -31.762 -21.892 -22.397 1.00 41.11  ? 122  TYR B CD1   1 
ATOM   172  C  CD2   . TYR A 1 59  ? -32.602 -22.737 -24.426 1.00 35.51  ? 122  TYR B CD2   1 
ATOM   173  C  CE1   . TYR A 1 59  ? -31.195 -23.112 -22.116 1.00 36.15  ? 122  TYR B CE1   1 
ATOM   174  C  CE2   . TYR A 1 59  ? -32.038 -23.961 -24.150 1.00 37.39  ? 122  TYR B CE2   1 
ATOM   175  C  CZ    . TYR A 1 59  ? -31.332 -24.137 -22.990 1.00 35.89  ? 122  TYR B CZ    1 
ATOM   176  O  OH    . TYR A 1 59  ? -30.754 -25.339 -22.689 1.00 34.67  ? 122  TYR B OH    1 
ATOM   177  N  N     . LEU A 1 60  ? -30.016 -20.181 -25.167 1.00 34.70  ? 123  LEU B N     1 
ATOM   178  C  CA    . LEU A 1 60  ? -29.124 -20.910 -26.031 1.00 32.97  ? 123  LEU B CA    1 
ATOM   179  C  C     . LEU A 1 60  ? -28.481 -21.985 -25.200 1.00 38.56  ? 123  LEU B C     1 
ATOM   180  O  O     . LEU A 1 60  ? -28.104 -21.751 -24.061 1.00 37.91  ? 123  LEU B O     1 
ATOM   181  C  CB    . LEU A 1 60  ? -28.055 -20.000 -26.607 1.00 29.23  ? 123  LEU B CB    1 
ATOM   182  C  CG    . LEU A 1 60  ? -28.494 -18.905 -27.560 1.00 33.30  ? 123  LEU B CG    1 
ATOM   183  C  CD1   . LEU A 1 60  ? -27.308 -18.092 -28.026 1.00 26.56  ? 123  LEU B CD1   1 
ATOM   184  C  CD2   . LEU A 1 60  ? -29.208 -19.519 -28.739 1.00 39.09  ? 123  LEU B CD2   1 
ATOM   185  N  N     . PRO A 1 61  ? -28.363 -23.170 -25.771 1.00 34.29  ? 124  PRO B N     1 
ATOM   186  C  CA    . PRO A 1 61  ? -27.787 -24.299 -25.064 1.00 31.24  ? 124  PRO B CA    1 
ATOM   187  C  C     . PRO A 1 61  ? -26.347 -24.032 -24.762 1.00 30.54  ? 124  PRO B C     1 
ATOM   188  O  O     . PRO A 1 61  ? -25.677 -23.326 -25.482 1.00 30.54  ? 124  PRO B O     1 
ATOM   189  C  CB    . PRO A 1 61  ? -27.903 -25.414 -26.076 1.00 35.70  ? 124  PRO B CB    1 
ATOM   190  C  CG    . PRO A 1 61  ? -29.146 -25.087 -26.807 1.00 36.76  ? 124  PRO B CG    1 
ATOM   191  C  CD    . PRO A 1 61  ? -29.149 -23.601 -26.932 1.00 34.46  ? 124  PRO B CD    1 
ATOM   192  N  N     . LEU A 1 62  ? -25.887 -24.572 -23.657 1.00 30.93  ? 125  LEU B N     1 
ATOM   193  C  CA    . LEU A 1 62  ? -24.537 -24.364 -23.244 1.00 28.98  ? 125  LEU B CA    1 
ATOM   194  C  C     . LEU A 1 62  ? -23.598 -24.967 -24.208 1.00 31.77  ? 125  LEU B C     1 
ATOM   195  O  O     . LEU A 1 62  ? -23.885 -25.955 -24.825 1.00 31.19  ? 125  LEU B O     1 
ATOM   196  C  CB    . LEU A 1 62  ? -24.313 -24.887 -21.846 1.00 34.13  ? 125  LEU B CB    1 
ATOM   197  C  CG    . LEU A 1 62  ? -23.777 -23.924 -20.827 1.00 32.76  ? 125  LEU B CG    1 
ATOM   198  C  CD1   . LEU A 1 62  ? -24.596 -22.687 -21.020 1.00 30.72  ? 125  LEU B CD1   1 
ATOM   199  C  CD2   . LEU A 1 62  ? -24.079 -24.513 -19.491 1.00 28.90  ? 125  LEU B CD2   1 
ATOM   200  N  N     . LYS A 1 63  ? -22.418 -24.397 -24.276 1.00 33.09  ? 126  LYS B N     1 
ATOM   201  C  CA    . LYS A 1 63  ? -21.454 -24.786 -25.247 1.00 33.66  ? 126  LYS B CA    1 
ATOM   202  C  C     . LYS A 1 63  ? -20.327 -25.601 -24.764 1.00 33.77  ? 126  LYS B C     1 
ATOM   203  O  O     . LYS A 1 63  ? -19.715 -25.316 -23.819 1.00 28.23  ? 126  LYS B O     1 
ATOM   204  C  CB    . LYS A 1 63  ? -20.961 -23.556 -25.969 1.00 25.71  ? 126  LYS B CB    1 
ATOM   205  N  N     . PRO A 1 64  ? -20.003 -26.623 -25.490 1.00 38.77  ? 127  PRO B N     1 
ATOM   206  C  CA    . PRO A 1 64  ? -18.954 -27.526 -25.108 1.00 41.29  ? 127  PRO B CA    1 
ATOM   207  C  C     . PRO A 1 64  ? -17.632 -26.876 -25.051 1.00 39.13  ? 127  PRO B C     1 
ATOM   208  O  O     . PRO A 1 64  ? -17.332 -26.020 -25.808 1.00 46.27  ? 127  PRO B O     1 
ATOM   209  C  CB    . PRO A 1 64  ? -18.982 -28.529 -26.216 1.00 40.29  ? 127  PRO B CB    1 
ATOM   210  C  CG    . PRO A 1 64  ? -20.389 -28.551 -26.587 1.00 39.80  ? 127  PRO B CG    1 
ATOM   211  C  CD    . PRO A 1 64  ? -20.744 -27.140 -26.627 1.00 31.90  ? 127  PRO B CD    1 
ATOM   212  N  N     . ARG A 1 65  ? -16.806 -27.364 -24.167 1.00 39.71  ? 128  ARG B N     1 
ATOM   213  C  CA    . ARG A 1 65  ? -15.540 -26.761 -23.937 1.00 47.41  ? 128  ARG B CA    1 
ATOM   214  C  C     . ARG A 1 65  ? -14.604 -26.738 -25.089 1.00 47.73  ? 128  ARG B C     1 
ATOM   215  O  O     . ARG A 1 65  ? -14.394 -27.720 -25.759 1.00 46.99  ? 128  ARG B O     1 
ATOM   216  C  CB    . ARG A 1 65  ? -14.880 -27.481 -22.783 1.00 46.69  ? 128  ARG B CB    1 
ATOM   217  C  CG    . ARG A 1 65  ? -13.522 -26.972 -22.397 1.00 46.46  ? 128  ARG B CG    1 
ATOM   218  C  CD    . ARG A 1 65  ? -13.255 -27.300 -20.987 1.00 47.40  ? 128  ARG B CD    1 
ATOM   219  N  NE    . ARG A 1 65  ? -13.346 -28.703 -20.776 1.00 49.93  ? 128  ARG B NE    1 
ATOM   220  C  CZ    . ARG A 1 65  ? -13.589 -29.219 -19.614 1.00 44.49  ? 128  ARG B CZ    1 
ATOM   221  N  NH1   . ARG A 1 65  ? -13.793 -28.426 -18.631 1.00 41.68  ? 128  ARG B NH1   1 
ATOM   222  N  NH2   . ARG A 1 65  ? -13.647 -30.498 -19.456 1.00 49.16  ? 128  ARG B NH2   1 
ATOM   223  N  N     . VAL A 1 66  ? -14.007 -25.577 -25.268 1.00 44.41  ? 129  VAL B N     1 
ATOM   224  C  CA    . VAL A 1 66  ? -13.031 -25.352 -26.252 1.00 46.09  ? 129  VAL B CA    1 
ATOM   225  C  C     . VAL A 1 66  ? -11.769 -25.348 -25.440 1.00 46.47  ? 129  VAL B C     1 
ATOM   226  O  O     . VAL A 1 66  ? -11.680 -24.662 -24.470 1.00 57.91  ? 129  VAL B O     1 
ATOM   227  C  CB    . VAL A 1 66  ? -13.252 -23.999 -26.952 1.00 50.74  ? 129  VAL B CB    1 
ATOM   228  C  CG1   . VAL A 1 66  ? -14.716 -23.719 -27.195 1.00 43.80  ? 129  VAL B CG1   1 
ATOM   229  C  CG2   . VAL A 1 66  ? -12.641 -22.849 -26.201 1.00 50.68  ? 129  VAL B CG2   1 
ATOM   230  N  N     . GLY A 1 67  ? -10.786 -26.134 -25.810 1.00 39.65  ? 130  GLY B N     1 
ATOM   231  C  CA    . GLY A 1 67  ? -9.554  -26.172 -25.055 1.00 44.82  ? 130  GLY B CA    1 
ATOM   232  C  C     . GLY A 1 67  ? -9.562  -27.169 -23.935 1.00 45.71  ? 130  GLY B C     1 
ATOM   233  O  O     . GLY A 1 67  ? -10.440 -27.965 -23.876 1.00 45.23  ? 130  GLY B O     1 
ATOM   234  N  N     . LYS A 1 68  ? -8.536  -27.172 -23.103 1.00 44.34  ? 131  LYS B N     1 
ATOM   235  C  CA    . LYS A 1 68  ? -8.440  -28.053 -21.967 1.00 39.32  ? 131  LYS B CA    1 
ATOM   236  C  C     . LYS A 1 68  ? -9.144  -27.555 -20.732 1.00 41.17  ? 131  LYS B C     1 
ATOM   237  O  O     . LYS A 1 68  ? -9.478  -26.424 -20.615 1.00 45.70  ? 131  LYS B O     1 
ATOM   238  C  CB    . LYS A 1 68  ? -6.994  -28.331 -21.634 1.00 35.96  ? 131  LYS B CB    1 
ATOM   239  N  N     . ALA A 1 69  ? -9.397  -28.443 -19.811 1.00 41.02  ? 132  ALA B N     1 
ATOM   240  C  CA    . ALA A 1 69  ? -10.004 -28.065 -18.590 1.00 40.63  ? 132  ALA B CA    1 
ATOM   241  C  C     . ALA A 1 69  ? -9.065  -27.264 -17.789 1.00 34.08  ? 132  ALA B C     1 
ATOM   242  O  O     . ALA A 1 69  ? -7.938  -27.532 -17.748 1.00 38.09  ? 132  ALA B O     1 
ATOM   243  C  CB    . ALA A 1 69  ? -10.350 -29.300 -17.819 1.00 47.97  ? 132  ALA B CB    1 
ATOM   244  N  N     . ALA A 1 70  ? -9.570  -26.278 -17.111 1.00 36.98  ? 133  ALA B N     1 
ATOM   245  C  CA    . ALA A 1 70  ? -8.815  -25.421 -16.257 1.00 39.41  ? 133  ALA B CA    1 
ATOM   246  C  C     . ALA A 1 70  ? -8.244  -26.113 -15.067 1.00 38.70  ? 133  ALA B C     1 
ATOM   247  O  O     . ALA A 1 70  ? -7.194  -25.766 -14.618 1.00 38.53  ? 133  ALA B O     1 
ATOM   248  C  CB    . ALA A 1 70  ? -9.672  -24.281 -15.842 1.00 35.65  ? 133  ALA B CB    1 
ATOM   249  N  N     . LYS A 1 71  ? -8.988  -27.053 -14.526 1.00 37.99  ? 134  LYS B N     1 
ATOM   250  C  CA    . LYS A 1 71  ? -8.626  -27.857 -13.383 1.00 38.92  ? 134  LYS B CA    1 
ATOM   251  C  C     . LYS A 1 71  ? -8.948  -29.300 -13.709 1.00 44.65  ? 134  LYS B C     1 
ATOM   252  O  O     . LYS A 1 71  ? -9.819  -29.554 -14.458 1.00 40.95  ? 134  LYS B O     1 
ATOM   253  C  CB    . LYS A 1 71  ? -9.384  -27.368 -12.156 1.00 34.48  ? 134  LYS B CB    1 
ATOM   254  C  CG    . LYS A 1 71  ? -9.206  -28.205 -10.926 1.00 35.48  ? 134  LYS B CG    1 
ATOM   255  C  CD    . LYS A 1 71  ? -8.699  -27.459 -9.747  1.00 40.26  ? 134  LYS B CD    1 
ATOM   256  C  CE    . LYS A 1 71  ? -7.999  -28.395 -8.794  1.00 41.64  ? 134  LYS B CE    1 
ATOM   257  N  NZ    . LYS A 1 71  ? -6.526  -28.362 -8.850  1.00 45.72  ? 134  LYS B NZ    1 
ATOM   258  N  N     . GLU A 1 72  ? -8.173  -30.240 -13.203 1.00 40.69  ? 135  GLU B N     1 
ATOM   259  C  CA    . GLU A 1 72  ? -8.385  -31.661 -13.391 1.00 44.96  ? 135  GLU B CA    1 
ATOM   260  C  C     . GLU A 1 72  ? -8.416  -32.270 -12.015 1.00 41.47  ? 135  GLU B C     1 
ATOM   261  O  O     . GLU A 1 72  ? -7.754  -31.837 -11.162 1.00 52.14  ? 135  GLU B O     1 
ATOM   262  C  CB    . GLU A 1 72  ? -7.274  -32.255 -14.231 1.00 50.86  ? 135  GLU B CB    1 
ATOM   263  C  CG    . GLU A 1 72  ? -7.723  -33.310 -15.225 1.00 53.54  ? 135  GLU B CG    1 
ATOM   264  C  CD    . GLU A 1 72  ? -7.204  -33.062 -16.624 1.00 62.43  ? 135  GLU B CD    1 
ATOM   265  O  OE1   . GLU A 1 72  ? -6.047  -32.685 -16.810 1.00 54.86  ? 135  GLU B OE1   1 
ATOM   266  O  OE2   . GLU A 1 72  ? -7.962  -33.236 -17.560 1.00 70.91  ? 135  GLU B OE2   1 
ATOM   267  N  N     . TYR A 1 73  ? -9.205  -33.285 -11.780 1.00 46.08  ? 136  TYR B N     1 
ATOM   268  C  CA    . TYR A 1 73  ? -9.317  -33.836 -10.448 1.00 43.20  ? 136  TYR B CA    1 
ATOM   269  C  C     . TYR A 1 73  ? -8.878  -35.261 -10.437 1.00 46.53  ? 136  TYR B C     1 
ATOM   270  O  O     . TYR A 1 73  ? -8.766  -35.863 -11.452 1.00 48.81  ? 136  TYR B O     1 
ATOM   271  C  CB    . TYR A 1 73  ? -10.755 -33.718 -9.942  1.00 44.50  ? 136  TYR B CB    1 
ATOM   272  C  CG    . TYR A 1 73  ? -11.340 -32.353 -10.087 1.00 41.48  ? 136  TYR B CG    1 
ATOM   273  C  CD1   . TYR A 1 73  ? -11.706 -31.890 -11.288 1.00 35.23  ? 136  TYR B CD1   1 
ATOM   274  C  CD2   . TYR A 1 73  ? -11.505 -31.530 -9.015  1.00 42.23  ? 136  TYR B CD2   1 
ATOM   275  C  CE1   . TYR A 1 73  ? -12.211 -30.645 -11.429 1.00 41.36  ? 136  TYR B CE1   1 
ATOM   276  C  CE2   . TYR A 1 73  ? -11.999 -30.275 -9.171  1.00 34.41  ? 136  TYR B CE2   1 
ATOM   277  C  CZ    . TYR A 1 73  ? -12.349 -29.858 -10.390 1.00 37.10  ? 136  TYR B CZ    1 
ATOM   278  O  OH    . TYR A 1 73  ? -12.850 -28.652 -10.580 1.00 28.31  ? 136  TYR B OH    1 
ATOM   279  N  N     . PRO A 1 74  ? -8.538  -35.780 -9.277  1.00 49.78  ? 137  PRO B N     1 
ATOM   280  C  CA    . PRO A 1 74  ? -8.105  -37.136 -9.030  1.00 50.12  ? 137  PRO B CA    1 
ATOM   281  C  C     . PRO A 1 74  ? -9.141  -38.128 -9.334  1.00 50.70  ? 137  PRO B C     1 
ATOM   282  O  O     . PRO A 1 74  ? -8.884  -39.190 -9.800  1.00 58.74  ? 137  PRO B O     1 
ATOM   283  C  CB    . PRO A 1 74  ? -7.928  -37.151 -7.548  1.00 46.85  ? 137  PRO B CB    1 
ATOM   284  C  CG    . PRO A 1 74  ? -7.482  -35.799 -7.263  1.00 45.29  ? 137  PRO B CG    1 
ATOM   285  C  CD    . PRO A 1 74  ? -8.360  -34.955 -8.096  1.00 45.16  ? 137  PRO B CD    1 
ATOM   286  N  N     . PHE A 1 75  ? -10.343 -37.776 -9.015  1.00 50.48  ? 138  PHE B N     1 
ATOM   287  C  CA    . PHE A 1 75  ? -11.470 -38.618 -9.180  1.00 51.76  ? 138  PHE B CA    1 
ATOM   288  C  C     . PHE A 1 75  ? -12.314 -38.312 -10.374 1.00 50.43  ? 138  PHE B C     1 
ATOM   289  O  O     . PHE A 1 75  ? -12.204 -37.295 -10.981 1.00 46.09  ? 138  PHE B O     1 
ATOM   290  C  CB    . PHE A 1 75  ? -12.289 -38.471 -7.942  1.00 51.32  ? 138  PHE B CB    1 
ATOM   291  C  CG    . PHE A 1 75  ? -12.260 -37.097 -7.378  1.00 48.33  ? 138  PHE B CG    1 
ATOM   292  C  CD1   . PHE A 1 75  ? -13.103 -36.144 -7.847  1.00 46.78  ? 138  PHE B CD1   1 
ATOM   293  C  CD2   . PHE A 1 75  ? -11.369 -36.777 -6.430  1.00 47.47  ? 138  PHE B CD2   1 
ATOM   294  C  CE1   . PHE A 1 75  ? -13.091 -34.899 -7.348  1.00 48.25  ? 138  PHE B CE1   1 
ATOM   295  C  CE2   . PHE A 1 75  ? -11.341 -35.531 -5.920  1.00 53.35  ? 138  PHE B CE2   1 
ATOM   296  C  CZ    . PHE A 1 75  ? -12.202 -34.587 -6.381  1.00 51.98  ? 138  PHE B CZ    1 
ATOM   297  N  N     . ILE A 1 76  ? -13.144 -39.257 -10.723 1.00 47.48  ? 139  ILE B N     1 
ATOM   298  C  CA    . ILE A 1 76  ? -14.029 -39.067 -11.814 1.00 52.27  ? 139  ILE B CA    1 
ATOM   299  C  C     . ILE A 1 76  ? -15.128 -38.269 -11.232 1.00 47.84  ? 139  ILE B C     1 
ATOM   300  O  O     . ILE A 1 76  ? -15.662 -38.624 -10.244 1.00 47.59  ? 139  ILE B O     1 
ATOM   301  C  CB    . ILE A 1 76  ? -14.579 -40.397 -12.287 1.00 51.40  ? 139  ILE B CB    1 
ATOM   302  C  CG1   . ILE A 1 76  ? -13.521 -41.461 -12.121 1.00 52.80  ? 139  ILE B CG1   1 
ATOM   303  C  CG2   . ILE A 1 76  ? -15.040 -40.320 -13.713 1.00 47.29  ? 139  ILE B CG2   1 
ATOM   304  C  CD1   . ILE A 1 76  ? -13.419 -41.971 -10.707 1.00 52.09  ? 139  ILE B CD1   1 
ATOM   305  N  N     . LEU A 1 77  ? -15.459 -37.182 -11.875 1.00 48.10  ? 140  LEU B N     1 
ATOM   306  C  CA    . LEU A 1 77  ? -16.477 -36.292 -11.433 1.00 42.57  ? 140  LEU B CA    1 
ATOM   307  C  C     . LEU A 1 77  ? -17.828 -36.858 -11.581 1.00 43.53  ? 140  LEU B C     1 
ATOM   308  O  O     . LEU A 1 77  ? -18.061 -37.674 -12.413 1.00 50.67  ? 140  LEU B O     1 
ATOM   309  C  CB    . LEU A 1 77  ? -16.444 -35.058 -12.275 1.00 41.01  ? 140  LEU B CB    1 
ATOM   310  C  CG    . LEU A 1 77  ? -15.225 -34.213 -12.332 1.00 40.40  ? 140  LEU B CG    1 
ATOM   311  C  CD1   . LEU A 1 77  ? -15.626 -33.073 -13.200 1.00 43.33  ? 140  LEU B CD1   1 
ATOM   312  C  CD2   . LEU A 1 77  ? -14.916 -33.719 -10.962 1.00 39.76  ? 140  LEU B CD2   1 
ATOM   313  N  N     . ASP A 1 78  ? -18.726 -36.411 -10.738 1.00 42.81  ? 141  ASP B N     1 
ATOM   314  C  CA    . ASP A 1 78  ? -20.095 -36.810 -10.798 1.00 39.35  ? 141  ASP B CA    1 
ATOM   315  C  C     . ASP A 1 78  ? -20.801 -35.981 -11.844 1.00 43.63  ? 141  ASP B C     1 
ATOM   316  O  O     . ASP A 1 78  ? -20.331 -34.960 -12.262 1.00 42.37  ? 141  ASP B O     1 
ATOM   317  C  CB    . ASP A 1 78  ? -20.745 -36.692 -9.451  1.00 34.57  ? 141  ASP B CB    1 
ATOM   318  C  CG    . ASP A 1 78  ? -20.309 -37.758 -8.524  1.00 43.56  ? 141  ASP B CG    1 
ATOM   319  O  OD1   . ASP A 1 78  ? -19.902 -38.799 -9.006  1.00 45.53  ? 141  ASP B OD1   1 
ATOM   320  O  OD2   . ASP A 1 78  ? -20.367 -37.572 -7.317  1.00 47.55  ? 141  ASP B OD2   1 
ATOM   321  N  N     . ALA A 1 79  ? -21.966 -36.425 -12.259 1.00 43.93  ? 142  ALA B N     1 
ATOM   322  C  CA    . ALA A 1 79  ? -22.730 -35.774 -13.284 1.00 36.88  ? 142  ALA B CA    1 
ATOM   323  C  C     . ALA A 1 79  ? -23.117 -34.416 -12.890 1.00 41.08  ? 142  ALA B C     1 
ATOM   324  O  O     . ALA A 1 79  ? -23.138 -33.563 -13.696 1.00 40.09  ? 142  ALA B O     1 
ATOM   325  C  CB    . ALA A 1 79  ? -23.952 -36.566 -13.593 1.00 33.61  ? 142  ALA B CB    1 
ATOM   326  N  N     . PHE A 1 80  ? -23.498 -34.212 -11.658 1.00 35.52  ? 143  PHE B N     1 
ATOM   327  C  CA    . PHE A 1 80  ? -23.810 -32.913 -11.233 1.00 32.42  ? 143  PHE B CA    1 
ATOM   328  C  C     . PHE A 1 80  ? -22.609 -32.014 -11.285 1.00 35.51  ? 143  PHE B C     1 
ATOM   329  O  O     . PHE A 1 80  ? -22.736 -30.909 -11.641 1.00 36.71  ? 143  PHE B O     1 
ATOM   330  C  CB    . PHE A 1 80  ? -24.564 -32.939 -9.910  1.00 33.87  ? 143  PHE B CB    1 
ATOM   331  C  CG    . PHE A 1 80  ? -23.715 -32.977 -8.698  1.00 36.19  ? 143  PHE B CG    1 
ATOM   332  C  CD1   . PHE A 1 80  ? -23.299 -34.141 -8.175  1.00 36.50  ? 143  PHE B CD1   1 
ATOM   333  C  CD2   . PHE A 1 80  ? -23.351 -31.831 -8.087  1.00 34.09  ? 143  PHE B CD2   1 
ATOM   334  C  CE1   . PHE A 1 80  ? -22.526 -34.157 -7.080  1.00 37.81  ? 143  PHE B CE1   1 
ATOM   335  C  CE2   . PHE A 1 80  ? -22.572 -31.849 -6.996  1.00 33.35  ? 143  PHE B CE2   1 
ATOM   336  C  CZ    . PHE A 1 80  ? -22.173 -33.013 -6.492  1.00 31.98  ? 143  PHE B CZ    1 
ATOM   337  N  N     . GLN A 1 81  ? -21.429 -32.468 -10.928 1.00 36.30  ? 144  GLN B N     1 
ATOM   338  C  CA    . GLN A 1 81  ? -20.287 -31.629 -10.975 1.00 34.30  ? 144  GLN B CA    1 
ATOM   339  C  C     . GLN A 1 81  ? -19.990 -31.237 -12.381 1.00 36.89  ? 144  GLN B C     1 
ATOM   340  O  O     . GLN A 1 81  ? -19.758 -30.132 -12.658 1.00 35.84  ? 144  GLN B O     1 
ATOM   341  C  CB    . GLN A 1 81  ? -19.118 -32.315 -10.330 1.00 33.40  ? 144  GLN B CB    1 
ATOM   342  C  CG    . GLN A 1 81  ? -19.475 -32.977 -9.026  1.00 37.50  ? 144  GLN B CG    1 
ATOM   343  C  CD    . GLN A 1 81  ? -18.318 -33.244 -8.116  1.00 38.06  ? 144  GLN B CD    1 
ATOM   344  O  OE1   . GLN A 1 81  ? -17.688 -34.242 -8.226  1.00 40.99  ? 144  GLN B OE1   1 
ATOM   345  N  NE2   . GLN A 1 81  ? -18.072 -32.363 -7.185  1.00 33.79  ? 144  GLN B NE2   1 
ATOM   346  N  N     . ARG A 1 82  ? -20.076 -32.146 -13.304 1.00 38.59  ? 145  ARG B N     1 
ATOM   347  C  CA    . ARG A 1 82  ? -19.795 -31.815 -14.671 1.00 39.69  ? 145  ARG B CA    1 
ATOM   348  C  C     . ARG A 1 82  ? -20.693 -30.807 -15.253 1.00 36.26  ? 145  ARG B C     1 
ATOM   349  O  O     . ARG A 1 82  ? -20.298 -30.097 -16.089 1.00 35.07  ? 145  ARG B O     1 
ATOM   350  C  CB    . ARG A 1 82  ? -19.922 -33.035 -15.520 1.00 45.22  ? 145  ARG B CB    1 
ATOM   351  C  CG    . ARG A 1 82  ? -18.624 -33.591 -15.990 1.00 50.07  ? 145  ARG B CG    1 
ATOM   352  C  CD    . ARG A 1 82  ? -18.805 -35.027 -16.322 1.00 49.66  ? 145  ARG B CD    1 
ATOM   353  N  NE    . ARG A 1 82  ? -17.534 -35.632 -16.113 1.00 65.63  ? 145  ARG B NE    1 
ATOM   354  C  CZ    . ARG A 1 82  ? -17.348 -36.729 -15.431 1.00 64.61  ? 145  ARG B CZ    1 
ATOM   355  N  NH1   . ARG A 1 82  ? -18.378 -37.366 -14.941 1.00 56.99  ? 145  ARG B NH1   1 
ATOM   356  N  NH2   . ARG A 1 82  ? -16.132 -37.187 -15.275 1.00 62.73  ? 145  ARG B NH2   1 
ATOM   357  N  N     . GLU A 1 83  ? -21.954 -30.836 -14.935 1.00 34.76  ? 146  GLU B N     1 
ATOM   358  C  CA    . GLU A 1 83  ? -22.855 -29.882 -15.484 1.00 34.54  ? 146  GLU B CA    1 
ATOM   359  C  C     . GLU A 1 83  ? -22.551 -28.527 -15.042 1.00 39.80  ? 146  GLU B C     1 
ATOM   360  O  O     . GLU A 1 83  ? -22.635 -27.626 -15.787 1.00 42.92  ? 146  GLU B O     1 
ATOM   361  C  CB    . GLU A 1 83  ? -24.273 -30.202 -15.103 1.00 36.54  ? 146  GLU B CB    1 
ATOM   362  C  CG    . GLU A 1 83  ? -24.886 -31.365 -15.842 1.00 43.45  ? 146  GLU B CG    1 
ATOM   363  C  CD    . GLU A 1 83  ? -24.986 -31.182 -17.319 1.00 40.71  ? 146  GLU B CD    1 
ATOM   364  O  OE1   . GLU A 1 83  ? -25.630 -30.267 -17.755 1.00 38.36  ? 146  GLU B OE1   1 
ATOM   365  O  OE2   . GLU A 1 83  ? -24.445 -31.983 -18.044 1.00 39.69  ? 146  GLU B OE2   1 
ATOM   366  N  N     . ALA A 1 84  ? -22.260 -28.385 -13.782 1.00 35.77  ? 147  ALA B N     1 
ATOM   367  C  CA    . ALA A 1 84  ? -21.931 -27.131 -13.174 1.00 37.07  ? 147  ALA B CA    1 
ATOM   368  C  C     . ALA A 1 84  ? -20.665 -26.538 -13.678 1.00 37.15  ? 147  ALA B C     1 
ATOM   369  O  O     . ALA A 1 84  ? -20.527 -25.368 -13.771 1.00 38.82  ? 147  ALA B O     1 
ATOM   370  C  CB    . ALA A 1 84  ? -21.861 -27.308 -11.701 1.00 38.85  ? 147  ALA B CB    1 
ATOM   371  N  N     . ILE A 1 85  ? -19.708 -27.392 -13.942 1.00 37.19  ? 148  ILE B N     1 
ATOM   372  C  CA    . ILE A 1 85  ? -18.410 -27.039 -14.457 1.00 36.22  ? 148  ILE B CA    1 
ATOM   373  C  C     . ILE A 1 85  ? -18.505 -26.451 -15.816 1.00 40.17  ? 148  ILE B C     1 
ATOM   374  O  O     . ILE A 1 85  ? -17.793 -25.538 -16.146 1.00 40.79  ? 148  ILE B O     1 
ATOM   375  C  CB    . ILE A 1 85  ? -17.507 -28.246 -14.456 1.00 35.27  ? 148  ILE B CB    1 
ATOM   376  C  CG1   . ILE A 1 85  ? -16.852 -28.347 -13.119 1.00 36.76  ? 148  ILE B CG1   1 
ATOM   377  C  CG2   . ILE A 1 85  ? -16.439 -28.103 -15.469 1.00 30.37  ? 148  ILE B CG2   1 
ATOM   378  C  CD1   . ILE A 1 85  ? -15.884 -29.461 -13.045 1.00 37.34  ? 148  ILE B CD1   1 
ATOM   379  N  N     . GLN A 1 86  ? -19.399 -27.004 -16.615 1.00 37.98  ? 149  GLN B N     1 
ATOM   380  C  CA    . GLN A 1 86  ? -19.706 -26.551 -17.943 1.00 31.21  ? 149  GLN B CA    1 
ATOM   381  C  C     . GLN A 1 86  ? -20.334 -25.213 -17.899 1.00 36.50  ? 149  GLN B C     1 
ATOM   382  O  O     . GLN A 1 86  ? -20.227 -24.521 -18.836 1.00 39.28  ? 149  GLN B O     1 
ATOM   383  C  CB    . GLN A 1 86  ? -20.561 -27.534 -18.671 1.00 31.84  ? 149  GLN B CB    1 
ATOM   384  C  CG    . GLN A 1 86  ? -20.751 -27.269 -20.136 1.00 36.13  ? 149  GLN B CG    1 
ATOM   385  C  CD    . GLN A 1 86  ? -21.815 -28.117 -20.724 1.00 29.93  ? 149  GLN B CD    1 
ATOM   386  O  OE1   . GLN A 1 86  ? -22.763 -28.455 -20.093 1.00 29.98  ? 149  GLN B OE1   1 
ATOM   387  N  NE2   . GLN A 1 86  ? -21.666 -28.430 -21.944 1.00 36.49  ? 149  GLN B NE2   1 
ATOM   388  N  N     . CYS A 1 87  ? -21.122 -24.901 -16.882 1.00 41.08  ? 150  CYS B N     1 
ATOM   389  C  CA    . CYS A 1 87  ? -21.668 -23.582 -16.708 1.00 33.56  ? 150  CYS B CA    1 
ATOM   390  C  C     . CYS A 1 87  ? -20.535 -22.618 -16.490 1.00 38.28  ? 150  CYS B C     1 
ATOM   391  O  O     . CYS A 1 87  ? -20.521 -21.594 -17.041 1.00 34.87  ? 150  CYS B O     1 
ATOM   392  C  CB    . CYS A 1 87  ? -22.538 -23.513 -15.456 1.00 32.42  ? 150  CYS B CB    1 
ATOM   393  S  SG    . CYS A 1 87  ? -24.107 -24.348 -15.340 1.00 33.48  ? 150  CYS B SG    1 
ATOM   394  N  N     . VAL A 1 88  ? -19.570 -22.943 -15.669 1.00 36.06  ? 151  VAL B N     1 
ATOM   395  C  CA    . VAL A 1 88  ? -18.455 -22.056 -15.426 1.00 38.19  ? 151  VAL B CA    1 
ATOM   396  C  C     . VAL A 1 88  ? -17.585 -21.841 -16.622 1.00 40.45  ? 151  VAL B C     1 
ATOM   397  O  O     . VAL A 1 88  ? -17.035 -20.793 -16.810 1.00 43.26  ? 151  VAL B O     1 
ATOM   398  C  CB    . VAL A 1 88  ? -17.561 -22.532 -14.317 1.00 42.84  ? 151  VAL B CB    1 
ATOM   399  C  CG1   . VAL A 1 88  ? -16.515 -21.498 -14.058 1.00 37.98  ? 151  VAL B CG1   1 
ATOM   400  C  CG2   . VAL A 1 88  ? -18.336 -22.749 -13.079 1.00 37.08  ? 151  VAL B CG2   1 
ATOM   401  N  N     . ASP A 1 89  ? -17.415 -22.878 -17.426 1.00 36.79  ? 152  ASP B N     1 
ATOM   402  C  CA    . ASP A 1 89  ? -16.640 -22.820 -18.660 1.00 34.08  ? 152  ASP B CA    1 
ATOM   403  C  C     . ASP A 1 89  ? -17.253 -21.869 -19.639 1.00 33.60  ? 152  ASP B C     1 
ATOM   404  O  O     . ASP A 1 89  ? -16.592 -21.178 -20.338 1.00 35.42  ? 152  ASP B O     1 
ATOM   405  C  CB    . ASP A 1 89  ? -16.636 -24.150 -19.345 1.00 30.54  ? 152  ASP B CB    1 
ATOM   406  C  CG    . ASP A 1 89  ? -15.533 -25.005 -18.943 1.00 35.35  ? 152  ASP B CG    1 
ATOM   407  O  OD1   . ASP A 1 89  ? -14.412 -24.570 -18.885 1.00 33.65  ? 152  ASP B OD1   1 
ATOM   408  O  OD2   . ASP A 1 89  ? -15.776 -26.165 -18.733 1.00 43.10  ? 152  ASP B OD2   1 
ATOM   409  N  N     . ASN A 1 90  ? -18.561 -21.846 -19.671 1.00 33.67  ? 153  ASN B N     1 
ATOM   410  C  CA    . ASN A 1 90  ? -19.371 -21.037 -20.515 1.00 28.56  ? 153  ASN B CA    1 
ATOM   411  C  C     . ASN A 1 90  ? -19.651 -19.681 -20.012 1.00 29.81  ? 153  ASN B C     1 
ATOM   412  O  O     . ASN A 1 90  ? -20.418 -19.014 -20.615 1.00 31.84  ? 153  ASN B O     1 
ATOM   413  C  CB    . ASN A 1 90  ? -20.696 -21.702 -20.692 1.00 31.88  ? 153  ASN B CB    1 
ATOM   414  C  CG    . ASN A 1 90  ? -20.827 -22.373 -21.978 1.00 30.55  ? 153  ASN B CG    1 
ATOM   415  O  OD1   . ASN A 1 90  ? -21.750 -23.069 -22.201 1.00 37.42  ? 153  ASN B OD1   1 
ATOM   416  N  ND2   . ASN A 1 90  ? -19.925 -22.135 -22.840 1.00 30.47  ? 153  ASN B ND2   1 
ATOM   417  N  N     . ASN A 1 91  ? -19.055 -19.303 -18.903 1.00 35.44  ? 154  ASN B N     1 
ATOM   418  C  CA    . ASN A 1 91  ? -19.167 -18.004 -18.251 1.00 40.40  ? 154  ASN B CA    1 
ATOM   419  C  C     . ASN A 1 91  ? -20.499 -17.593 -17.766 1.00 40.10  ? 154  ASN B C     1 
ATOM   420  O  O     . ASN A 1 91  ? -20.887 -16.491 -17.904 1.00 45.73  ? 154  ASN B O     1 
ATOM   421  C  CB    . ASN A 1 91  ? -18.595 -16.893 -19.109 1.00 40.70  ? 154  ASN B CB    1 
ATOM   422  C  CG    . ASN A 1 91  ? -17.388 -16.352 -18.566 1.00 47.29  ? 154  ASN B CG    1 
ATOM   423  O  OD1   . ASN A 1 91  ? -16.683 -17.035 -17.883 1.00 57.01  ? 154  ASN B OD1   1 
ATOM   424  N  ND2   . ASN A 1 91  ? -17.137 -15.108 -18.838 1.00 47.40  ? 154  ASN B ND2   1 
ATOM   425  N  N     . GLN A 1 92  ? -21.227 -18.503 -17.201 1.00 33.62  ? 155  GLN B N     1 
ATOM   426  C  CA    . GLN A 1 92  ? -22.501 -18.169 -16.669 1.00 35.32  ? 155  GLN B CA    1 
ATOM   427  C  C     . GLN A 1 92  ? -22.521 -18.605 -15.231 1.00 36.43  ? 155  GLN B C     1 
ATOM   428  O  O     . GLN A 1 92  ? -21.779 -19.443 -14.821 1.00 32.69  ? 155  GLN B O     1 
ATOM   429  C  CB    . GLN A 1 92  ? -23.625 -18.830 -17.457 1.00 31.44  ? 155  GLN B CB    1 
ATOM   430  C  CG    . GLN A 1 92  ? -23.376 -18.965 -18.936 1.00 25.23  ? 155  GLN B CG    1 
ATOM   431  C  CD    . GLN A 1 92  ? -24.539 -18.662 -19.779 1.00 28.52  ? 155  GLN B CD    1 
ATOM   432  O  OE1   . GLN A 1 92  ? -24.422 -17.989 -20.729 1.00 30.01  ? 155  GLN B OE1   1 
ATOM   433  N  NE2   . GLN A 1 92  ? -25.646 -19.151 -19.437 1.00 30.97  ? 155  GLN B NE2   1 
ATOM   434  N  N     . SER A 1 93  ? -23.334 -17.951 -14.435 1.00 32.58  ? 156  SER B N     1 
ATOM   435  C  CA    . SER A 1 93  ? -23.455 -18.300 -13.059 1.00 28.54  ? 156  SER B CA    1 
ATOM   436  C  C     . SER A 1 93  ? -24.242 -19.559 -12.829 1.00 32.64  ? 156  SER B C     1 
ATOM   437  O  O     . SER A 1 93  ? -25.057 -19.932 -13.591 1.00 32.17  ? 156  SER B O     1 
ATOM   438  C  CB    . SER A 1 93  ? -24.067 -17.175 -12.305 1.00 24.04  ? 156  SER B CB    1 
ATOM   439  O  OG    . SER A 1 93  ? -23.500 -15.991 -12.680 1.00 23.71  ? 156  SER B OG    1 
ATOM   440  N  N     . VAL A 1 94  ? -23.943 -20.213 -11.736 1.00 30.99  ? 157  VAL B N     1 
ATOM   441  C  CA    . VAL A 1 94  ? -24.604 -21.412 -11.360 1.00 28.36  ? 157  VAL B CA    1 
ATOM   442  C  C     . VAL A 1 94  ? -24.764 -21.418 -9.872  1.00 31.88  ? 157  VAL B C     1 
ATOM   443  O  O     . VAL A 1 94  ? -23.993 -20.834 -9.182  1.00 26.75  ? 157  VAL B O     1 
ATOM   444  C  CB    . VAL A 1 94  ? -23.767 -22.618 -11.800 1.00 27.53  ? 157  VAL B CB    1 
ATOM   445  C  CG1   . VAL A 1 94  ? -22.485 -22.671 -11.099 1.00 25.82  ? 157  VAL B CG1   1 
ATOM   446  C  CG2   . VAL A 1 94  ? -24.462 -23.930 -11.645 1.00 29.42  ? 157  VAL B CG2   1 
ATOM   447  N  N     . LEU A 1 95  ? -25.841 -22.046 -9.419  1.00 36.14  ? 158  LEU B N     1 
ATOM   448  C  CA    . LEU A 1 95  ? -26.127 -22.332 -8.038  1.00 33.40  ? 158  LEU B CA    1 
ATOM   449  C  C     . LEU A 1 95  ? -26.133 -23.824 -8.020  1.00 33.43  ? 158  LEU B C     1 
ATOM   450  O  O     . LEU A 1 95  ? -26.783 -24.425 -8.793  1.00 35.10  ? 158  LEU B O     1 
ATOM   451  C  CB    . LEU A 1 95  ? -27.483 -21.813 -7.625  1.00 27.93  ? 158  LEU B CB    1 
ATOM   452  C  CG    . LEU A 1 95  ? -28.213 -22.581 -6.561  1.00 28.93  ? 158  LEU B CG    1 
ATOM   453  C  CD1   . LEU A 1 95  ? -27.458 -22.588 -5.275  1.00 31.03  ? 158  LEU B CD1   1 
ATOM   454  C  CD2   . LEU A 1 95  ? -29.508 -21.916 -6.310  1.00 27.88  ? 158  LEU B CD2   1 
ATOM   455  N  N     . VAL A 1 96  ? -25.366 -24.430 -7.163  1.00 30.44  ? 159  VAL B N     1 
ATOM   456  C  CA    . VAL A 1 96  ? -25.369 -25.841 -7.107  1.00 28.15  ? 159  VAL B CA    1 
ATOM   457  C  C     . VAL A 1 96  ? -25.978 -26.151 -5.787  1.00 35.54  ? 159  VAL B C     1 
ATOM   458  O  O     . VAL A 1 96  ? -25.562 -25.618 -4.812  1.00 34.78  ? 159  VAL B O     1 
ATOM   459  C  CB    . VAL A 1 96  ? -23.959 -26.367 -7.086  1.00 29.54  ? 159  VAL B CB    1 
ATOM   460  C  CG1   . VAL A 1 96  ? -23.974 -27.856 -7.075  1.00 29.17  ? 159  VAL B CG1   1 
ATOM   461  C  CG2   . VAL A 1 96  ? -23.202 -25.863 -8.267  1.00 27.35  ? 159  VAL B CG2   1 
ATOM   462  N  N     . SER A 1 97  ? -27.013 -26.964 -5.757  1.00 32.95  ? 160  SER B N     1 
ATOM   463  C  CA    . SER A 1 97  ? -27.605 -27.322 -4.504  1.00 30.67  ? 160  SER B CA    1 
ATOM   464  C  C     . SER A 1 97  ? -27.533 -28.786 -4.351  1.00 33.64  ? 160  SER B C     1 
ATOM   465  O  O     . SER A 1 97  ? -28.214 -29.486 -4.957  1.00 34.12  ? 160  SER B O     1 
ATOM   466  C  CB    . SER A 1 97  ? -29.028 -26.887 -4.472  1.00 28.01  ? 160  SER B CB    1 
ATOM   467  O  OG    . SER A 1 97  ? -29.513 -27.094 -3.199  1.00 34.04  ? 160  SER B OG    1 
ATOM   468  N  N     . ALA A 1 98  ? -26.732 -29.242 -3.445  1.00 34.03  ? 161  ALA B N     1 
ATOM   469  C  CA    . ALA A 1 98  ? -26.568 -30.643 -3.242  1.00 31.87  ? 161  ALA B CA    1 
ATOM   470  C  C     . ALA A 1 98  ? -26.334 -30.923 -1.805  1.00 33.60  ? 161  ALA B C     1 
ATOM   471  O  O     . ALA A 1 98  ? -26.001 -30.071 -1.076  1.00 35.72  ? 161  ALA B O     1 
ATOM   472  C  CB    . ALA A 1 98  ? -25.423 -31.149 -4.068  1.00 27.44  ? 161  ALA B CB    1 
ATOM   473  N  N     . HIS A 1 99  ? -26.390 -32.149 -1.376  1.00 32.75  ? 162  HIS B N     1 
ATOM   474  C  CA    . HIS A 1 99  ? -26.174 -32.427 0.032   1.00 35.95  ? 162  HIS B CA    1 
ATOM   475  C  C     . HIS A 1 99  ? -24.805 -32.172 0.558   1.00 33.47  ? 162  HIS B C     1 
ATOM   476  O  O     . HIS A 1 99  ? -23.887 -32.107 -0.152  1.00 38.08  ? 162  HIS B O     1 
ATOM   477  C  CB    . HIS A 1 99  ? -26.460 -33.858 0.279   1.00 41.10  ? 162  HIS B CB    1 
ATOM   478  C  CG    . HIS A 1 99  ? -27.902 -34.170 0.332   1.00 45.06  ? 162  HIS B CG    1 
ATOM   479  N  ND1   . HIS A 1 99  ? -28.765 -33.510 1.157   1.00 44.24  ? 162  HIS B ND1   1 
ATOM   480  C  CD2   . HIS A 1 99  ? -28.625 -35.097 -0.310  1.00 42.10  ? 162  HIS B CD2   1 
ATOM   481  C  CE1   . HIS A 1 99  ? -29.966 -34.010 1.010   1.00 37.41  ? 162  HIS B CE1   1 
ATOM   482  N  NE2   . HIS A 1 99  ? -29.905 -34.976 0.127   1.00 43.66  ? 162  HIS B NE2   1 
ATOM   483  N  N     . THR A 1 100 ? -24.664 -32.026 1.846   1.00 31.20  ? 163  THR B N     1 
ATOM   484  C  CA    . THR A 1 100 ? -23.366 -31.809 2.405   1.00 35.93  ? 163  THR B CA    1 
ATOM   485  C  C     . THR A 1 100 ? -22.572 -33.046 2.159   1.00 33.39  ? 163  THR B C     1 
ATOM   486  O  O     . THR A 1 100 ? -23.030 -34.120 2.380   1.00 33.79  ? 163  THR B O     1 
ATOM   487  C  CB    . THR A 1 100 ? -23.470 -31.455 3.887   1.00 35.92  ? 163  THR B CB    1 
ATOM   488  O  OG1   . THR A 1 100 ? -24.167 -30.230 4.026   1.00 46.36  ? 163  THR B OG1   1 
ATOM   489  C  CG2   . THR A 1 100 ? -22.176 -31.249 4.447   1.00 32.61  ? 163  THR B CG2   1 
ATOM   490  N  N     . SER A 1 101 ? -21.363 -32.852 1.695   1.00 31.06  ? 164  SER B N     1 
ATOM   491  C  CA    . SER A 1 101 ? -20.387 -33.874 1.315   1.00 35.33  ? 164  SER B CA    1 
ATOM   492  C  C     . SER A 1 101 ? -20.568 -34.517 -0.020  1.00 35.06  ? 164  SER B C     1 
ATOM   493  O  O     . SER A 1 101 ? -19.915 -35.409 -0.346  1.00 34.56  ? 164  SER B O     1 
ATOM   494  C  CB    . SER A 1 101 ? -19.918 -34.823 2.413   1.00 37.57  ? 164  SER B CB    1 
ATOM   495  O  OG    . SER A 1 101 ? -20.897 -35.724 2.744   1.00 31.94  ? 164  SER B OG    1 
ATOM   496  N  N     . ALA A 1 102 ? -21.488 -34.016 -0.790  1.00 36.24  ? 165  ALA B N     1 
ATOM   497  C  CA    . ALA A 1 102 ? -21.708 -34.465 -2.123  1.00 35.27  ? 165  ALA B CA    1 
ATOM   498  C  C     . ALA A 1 102 ? -20.597 -34.127 -3.022  1.00 36.43  ? 165  ALA B C     1 
ATOM   499  O  O     . ALA A 1 102 ? -20.308 -34.822 -3.922  1.00 44.03  ? 165  ALA B O     1 
ATOM   500  C  CB    . ALA A 1 102 ? -22.951 -33.869 -2.660  1.00 38.08  ? 165  ALA B CB    1 
ATOM   501  N  N     . GLY A 1 103 ? -20.054 -32.967 -2.851  1.00 32.73  ? 166  GLY B N     1 
ATOM   502  C  CA    . GLY A 1 103 ? -18.963 -32.574 -3.667  1.00 36.26  ? 166  GLY B CA    1 
ATOM   503  C  C     . GLY A 1 103 ? -19.215 -31.293 -4.353  1.00 39.52  ? 166  GLY B C     1 
ATOM   504  O  O     . GLY A 1 103 ? -18.821 -31.099 -5.453  1.00 38.99  ? 166  GLY B O     1 
ATOM   505  N  N     . LYS A 1 104 ? -19.865 -30.379 -3.665  1.00 36.45  ? 167  LYS B N     1 
ATOM   506  C  CA    . LYS A 1 104 ? -20.151 -29.053 -4.179  1.00 36.62  ? 167  LYS B CA    1 
ATOM   507  C  C     . LYS A 1 104 ? -18.930 -28.204 -4.317  1.00 35.06  ? 167  LYS B C     1 
ATOM   508  O  O     . LYS A 1 104 ? -18.864 -27.284 -5.037  1.00 31.90  ? 167  LYS B O     1 
ATOM   509  C  CB    . LYS A 1 104 ? -21.060 -28.325 -3.218  1.00 37.03  ? 167  LYS B CB    1 
ATOM   510  C  CG    . LYS A 1 104 ? -22.541 -28.493 -3.330  1.00 36.60  ? 167  LYS B CG    1 
ATOM   511  C  CD    . LYS A 1 104 ? -23.110 -27.954 -2.066  1.00 32.19  ? 167  LYS B CD    1 
ATOM   512  C  CE    . LYS A 1 104 ? -23.006 -28.929 -0.932  1.00 30.49  ? 167  LYS B CE    1 
ATOM   513  N  NZ    . LYS A 1 104 ? -23.233 -28.314 0.398   1.00 44.48  ? 167  LYS B NZ    1 
ATOM   514  N  N     . THR A 1 105 ? -17.969 -28.472 -3.504  1.00 38.09  ? 168  THR B N     1 
ATOM   515  C  CA    . THR A 1 105 ? -16.794 -27.726 -3.464  1.00 37.28  ? 168  THR B CA    1 
ATOM   516  C  C     . THR A 1 105 ? -15.922 -27.736 -4.682  1.00 33.94  ? 168  THR B C     1 
ATOM   517  O  O     . THR A 1 105 ? -15.172 -26.866 -4.841  1.00 42.36  ? 168  THR B O     1 
ATOM   518  C  CB    . THR A 1 105 ? -16.110 -27.930 -2.124  1.00 41.62  ? 168  THR B CB    1 
ATOM   519  O  OG1   . THR A 1 105 ? -15.605 -26.682 -1.690  1.00 26.88  ? 168  THR B OG1   1 
ATOM   520  C  CG2   . THR A 1 105 ? -15.068 -29.145 -2.144  1.00 48.35  ? 168  THR B CG2   1 
ATOM   521  N  N     . VAL A 1 106 ? -15.967 -28.755 -5.499  1.00 35.28  ? 169  VAL B N     1 
ATOM   522  C  CA    . VAL A 1 106 ? -15.192 -28.814 -6.703  1.00 33.16  ? 169  VAL B CA    1 
ATOM   523  C  C     . VAL A 1 106 ? -15.559 -27.796 -7.706  1.00 30.59  ? 169  VAL B C     1 
ATOM   524  O  O     . VAL A 1 106 ? -14.736 -27.359 -8.385  1.00 34.12  ? 169  VAL B O     1 
ATOM   525  C  CB    . VAL A 1 106 ? -15.141 -30.199 -7.339  1.00 35.78  ? 169  VAL B CB    1 
ATOM   526  C  CG1   . VAL A 1 106 ? -15.813 -31.243 -6.523  1.00 35.89  ? 169  VAL B CG1   1 
ATOM   527  C  CG2   . VAL A 1 106 ? -15.628 -30.223 -8.758  1.00 34.51  ? 169  VAL B CG2   1 
ATOM   528  N  N     . CYS A 1 107 ? -16.810 -27.393 -7.788  1.00 32.58  ? 170  CYS B N     1 
ATOM   529  C  CA    . CYS A 1 107 ? -17.259 -26.422 -8.736  1.00 29.98  ? 170  CYS B CA    1 
ATOM   530  C  C     . CYS A 1 107 ? -16.654 -25.133 -8.519  1.00 30.68  ? 170  CYS B C     1 
ATOM   531  O  O     . CYS A 1 107 ? -16.435 -24.432 -9.420  1.00 32.17  ? 170  CYS B O     1 
ATOM   532  C  CB    . CYS A 1 107 ? -18.727 -26.245 -8.587  1.00 34.10  ? 170  CYS B CB    1 
ATOM   533  S  SG    . CYS A 1 107 ? -19.502 -27.798 -8.773  1.00 48.25  ? 170  CYS B SG    1 
ATOM   534  N  N     . ALA A 1 108 ? -16.526 -24.762 -7.278  1.00 29.86  ? 171  ALA B N     1 
ATOM   535  C  CA    . ALA A 1 108 ? -15.889 -23.566 -6.890  1.00 33.32  ? 171  ALA B CA    1 
ATOM   536  C  C     . ALA A 1 108 ? -14.459 -23.609 -7.228  1.00 37.17  ? 171  ALA B C     1 
ATOM   537  O  O     . ALA A 1 108 ? -13.936 -22.640 -7.598  1.00 41.86  ? 171  ALA B O     1 
ATOM   538  C  CB    . ALA A 1 108 ? -16.052 -23.376 -5.425  1.00 37.89  ? 171  ALA B CB    1 
ATOM   539  N  N     . GLU A 1 109 ? -13.807 -24.731 -7.049  1.00 29.07  ? 172  GLU B N     1 
ATOM   540  C  CA    . GLU A 1 109 ? -12.424 -24.849 -7.356  1.00 34.12  ? 172  GLU B CA    1 
ATOM   541  C  C     . GLU A 1 109 ? -12.146 -24.667 -8.800  1.00 35.56  ? 172  GLU B C     1 
ATOM   542  O  O     . GLU A 1 109 ? -11.176 -24.138 -9.163  1.00 39.49  ? 172  GLU B O     1 
ATOM   543  C  CB    . GLU A 1 109 ? -11.931 -26.200 -6.951  1.00 33.36  ? 172  GLU B CB    1 
ATOM   544  C  CG    . GLU A 1 109 ? -11.512 -26.347 -5.521  1.00 28.99  ? 172  GLU B CG    1 
ATOM   545  C  CD    . GLU A 1 109 ? -11.385 -27.753 -5.149  1.00 28.16  ? 172  GLU B CD    1 
ATOM   546  O  OE1   . GLU A 1 109 ? -11.227 -28.550 -6.008  1.00 30.85  ? 172  GLU B OE1   1 
ATOM   547  O  OE2   . GLU A 1 109 ? -11.449 -28.082 -4.011  1.00 28.77  ? 172  GLU B OE2   1 
ATOM   548  N  N     . TYR A 1 110 ? -12.973 -25.195 -9.641  1.00 32.81  ? 173  TYR B N     1 
ATOM   549  C  CA    . TYR A 1 110 ? -12.821 -25.053 -11.054 1.00 33.38  ? 173  TYR B CA    1 
ATOM   550  C  C     . TYR A 1 110 ? -12.988 -23.644 -11.505 1.00 34.32  ? 173  TYR B C     1 
ATOM   551  O  O     . TYR A 1 110 ? -12.415 -23.245 -12.440 1.00 40.43  ? 173  TYR B O     1 
ATOM   552  C  CB    . TYR A 1 110 ? -13.754 -25.996 -11.789 1.00 32.47  ? 173  TYR B CB    1 
ATOM   553  C  CG    . TYR A 1 110 ? -13.551 -25.986 -13.248 1.00 36.04  ? 173  TYR B CG    1 
ATOM   554  C  CD1   . TYR A 1 110 ? -14.046 -24.987 -13.997 1.00 38.17  ? 173  TYR B CD1   1 
ATOM   555  C  CD2   . TYR A 1 110 ? -12.877 -26.954 -13.871 1.00 35.28  ? 173  TYR B CD2   1 
ATOM   556  C  CE1   . TYR A 1 110 ? -13.851 -24.941 -15.333 1.00 34.94  ? 173  TYR B CE1   1 
ATOM   557  C  CE2   . TYR A 1 110 ? -12.696 -26.910 -15.211 1.00 38.71  ? 173  TYR B CE2   1 
ATOM   558  C  CZ    . TYR A 1 110 ? -13.167 -25.884 -15.924 1.00 35.08  ? 173  TYR B CZ    1 
ATOM   559  O  OH    . TYR A 1 110 ? -12.988 -25.810 -17.256 1.00 32.64  ? 173  TYR B OH    1 
ATOM   560  N  N     . ALA A 1 111 ? -13.879 -22.914 -10.910 1.00 35.43  ? 174  ALA B N     1 
ATOM   561  C  CA    . ALA A 1 111 ? -14.055 -21.532 -11.234 1.00 37.53  ? 174  ALA B CA    1 
ATOM   562  C  C     . ALA A 1 111 ? -12.865 -20.700 -10.841 1.00 42.59  ? 174  ALA B C     1 
ATOM   563  O  O     . ALA A 1 111 ? -12.576 -19.744 -11.462 1.00 48.54  ? 174  ALA B O     1 
ATOM   564  C  CB    . ALA A 1 111 ? -15.308 -21.002 -10.618 1.00 37.91  ? 174  ALA B CB    1 
ATOM   565  N  N     . ILE A 1 112 ? -12.224 -20.997 -9.737  1.00 38.51  ? 175  ILE B N     1 
ATOM   566  C  CA    . ILE A 1 112 ? -11.032 -20.294 -9.358  1.00 40.97  ? 175  ILE B CA    1 
ATOM   567  C  C     . ILE A 1 112 ? -9.933  -20.536 -10.309 1.00 41.22  ? 175  ILE B C     1 
ATOM   568  O  O     . ILE A 1 112 ? -9.196  -19.676 -10.623 1.00 39.61  ? 175  ILE B O     1 
ATOM   569  C  CB    . ILE A 1 112 ? -10.429 -20.849 -8.117  1.00 40.31  ? 175  ILE B CB    1 
ATOM   570  C  CG1   . ILE A 1 112 ? -11.382 -20.730 -6.977  1.00 41.57  ? 175  ILE B CG1   1 
ATOM   571  C  CG2   . ILE A 1 112 ? -9.198  -20.054 -7.826  1.00 42.96  ? 175  ILE B CG2   1 
ATOM   572  C  CD1   . ILE A 1 112 ? -10.742 -20.923 -5.656  1.00 42.08  ? 175  ILE B CD1   1 
ATOM   573  N  N     . ALA A 1 113 ? -9.820  -21.768 -10.746 1.00 41.11  ? 176  ALA B N     1 
ATOM   574  C  CA    . ALA A 1 113 ? -8.838  -22.208 -11.673 1.00 36.11  ? 176  ALA B CA    1 
ATOM   575  C  C     . ALA A 1 113 ? -8.982  -21.504 -12.980 1.00 42.16  ? 176  ALA B C     1 
ATOM   576  O  O     . ALA A 1 113 ? -8.025  -21.256 -13.625 1.00 41.76  ? 176  ALA B O     1 
ATOM   577  C  CB    . ALA A 1 113 ? -8.989  -23.675 -11.849 1.00 30.28  ? 176  ALA B CB    1 
ATOM   578  N  N     . LEU A 1 114 ? -10.202 -21.298 -13.428 1.00 40.74  ? 177  LEU B N     1 
ATOM   579  C  CA    . LEU A 1 114 ? -10.527 -20.555 -14.618 1.00 41.97  ? 177  LEU B CA    1 
ATOM   580  C  C     . LEU A 1 114 ? -10.220 -19.107 -14.450 1.00 46.11  ? 177  LEU B C     1 
ATOM   581  O  O     . LEU A 1 114 ? -9.774  -18.468 -15.343 1.00 48.45  ? 177  LEU B O     1 
ATOM   582  C  CB    . LEU A 1 114 ? -12.011 -20.695 -14.891 1.00 42.88  ? 177  LEU B CB    1 
ATOM   583  C  CG    . LEU A 1 114 ? -12.705 -20.367 -16.203 1.00 38.05  ? 177  LEU B CG    1 
ATOM   584  C  CD1   . LEU A 1 114 ? -12.893 -18.909 -16.511 1.00 37.57  ? 177  LEU B CD1   1 
ATOM   585  C  CD2   . LEU A 1 114 ? -11.978 -21.031 -17.310 1.00 42.09  ? 177  LEU B CD2   1 
ATOM   586  N  N     . ALA A 1 115 ? -10.547 -18.566 -13.302 1.00 46.42  ? 178  ALA B N     1 
ATOM   587  C  CA    . ALA A 1 115 ? -10.306 -17.175 -13.015 1.00 49.61  ? 178  ALA B CA    1 
ATOM   588  C  C     . ALA A 1 115 ? -8.866  -16.902 -12.954 1.00 45.68  ? 178  ALA B C     1 
ATOM   589  O  O     . ALA A 1 115 ? -8.395  -15.946 -13.450 1.00 45.36  ? 178  ALA B O     1 
ATOM   590  C  CB    . ALA A 1 115 ? -10.927 -16.825 -11.696 1.00 49.55  ? 178  ALA B CB    1 
ATOM   591  N  N     . LEU A 1 116 ? -8.141  -17.766 -12.305 1.00 45.53  ? 179  LEU B N     1 
ATOM   592  C  CA    . LEU A 1 116 ? -6.725  -17.585 -12.234 1.00 48.51  ? 179  LEU B CA    1 
ATOM   593  C  C     . LEU A 1 116 ? -6.132  -17.725 -13.583 1.00 53.55  ? 179  LEU B C     1 
ATOM   594  O  O     . LEU A 1 116 ? -5.389  -16.912 -13.969 1.00 56.73  ? 179  LEU B O     1 
ATOM   595  C  CB    . LEU A 1 116 ? -6.101  -18.550 -11.269 1.00 42.54  ? 179  LEU B CB    1 
ATOM   596  C  CG    . LEU A 1 116 ? -5.787  -17.939 -9.943  1.00 38.56  ? 179  LEU B CG    1 
ATOM   597  C  CD1   . LEU A 1 116 ? -6.750  -16.849 -9.648  1.00 41.61  ? 179  LEU B CD1   1 
ATOM   598  C  CD2   . LEU A 1 116 ? -5.764  -18.951 -8.849  1.00 39.40  ? 179  LEU B CD2   1 
ATOM   599  N  N     . ARG A 1 117 ? -6.574  -18.673 -14.379 1.00 47.16  ? 180  ARG B N     1 
ATOM   600  C  CA    . ARG A 1 117 ? -6.017  -18.899 -15.692 1.00 45.59  ? 180  ARG B CA    1 
ATOM   601  C  C     . ARG A 1 117 ? -6.106  -17.730 -16.609 1.00 49.42  ? 180  ARG B C     1 
ATOM   602  O  O     . ARG A 1 117 ? -5.237  -17.516 -17.362 1.00 52.35  ? 180  ARG B O     1 
ATOM   603  C  CB    . ARG A 1 117 ? -6.641  -20.120 -16.320 1.00 49.44  ? 180  ARG B CB    1 
ATOM   604  C  CG    . ARG A 1 117 ? -6.959  -19.995 -17.782 1.00 46.26  ? 180  ARG B CG    1 
ATOM   605  C  CD    . ARG A 1 117 ? -6.545  -21.225 -18.538 1.00 41.44  ? 180  ARG B CD    1 
ATOM   606  N  NE    . ARG A 1 117 ? -7.642  -22.122 -18.823 1.00 52.66  ? 180  ARG B NE    1 
ATOM   607  C  CZ    . ARG A 1 117 ? -8.737  -21.763 -19.458 1.00 49.09  ? 180  ARG B CZ    1 
ATOM   608  N  NH1   . ARG A 1 117 ? -8.874  -20.528 -19.800 1.00 48.27  ? 180  ARG B NH1   1 
ATOM   609  N  NH2   . ARG A 1 117 ? -9.696  -22.618 -19.706 1.00 47.54  ? 180  ARG B NH2   1 
ATOM   610  N  N     . GLU A 1 118 ? -7.161  -16.951 -16.544 1.00 48.63  ? 181  GLU B N     1 
ATOM   611  C  CA    . GLU A 1 118 ? -7.354  -15.776 -17.358 1.00 49.70  ? 181  GLU B CA    1 
ATOM   612  C  C     . GLU A 1 118 ? -6.750  -14.547 -16.756 1.00 48.52  ? 181  GLU B C     1 
ATOM   613  O  O     . GLU A 1 118 ? -6.898  -13.500 -17.285 1.00 56.22  ? 181  GLU B O     1 
ATOM   614  C  CB    . GLU A 1 118 ? -8.835  -15.505 -17.531 1.00 51.73  ? 181  GLU B CB    1 
ATOM   615  C  CG    . GLU A 1 118 ? -9.534  -16.341 -18.544 1.00 49.58  ? 181  GLU B CG    1 
ATOM   616  C  CD    . GLU A 1 118 ? -8.710  -16.497 -19.756 1.00 59.88  ? 181  GLU B CD    1 
ATOM   617  O  OE1   . GLU A 1 118 ? -8.965  -15.851 -20.752 1.00 64.00  ? 181  GLU B OE1   1 
ATOM   618  O  OE2   . GLU A 1 118 ? -7.761  -17.243 -19.700 1.00 60.03  ? 181  GLU B OE2   1 
ATOM   619  N  N     . LYS A 1 119 ? -6.203  -14.689 -15.580 1.00 47.10  ? 182  LYS B N     1 
ATOM   620  C  CA    . LYS A 1 119 ? -5.502  -13.697 -14.807 1.00 53.49  ? 182  LYS B CA    1 
ATOM   621  C  C     . LYS A 1 119 ? -6.299  -12.707 -14.021 1.00 54.85  ? 182  LYS B C     1 
ATOM   622  O  O     . LYS A 1 119 ? -5.752  -11.830 -13.424 1.00 57.82  ? 182  LYS B O     1 
ATOM   623  C  CB    . LYS A 1 119 ? -4.278  -13.111 -15.505 1.00 51.59  ? 182  LYS B CB    1 
ATOM   624  C  CG    . LYS A 1 119 ? -3.118  -14.074 -15.543 1.00 50.62  ? 182  LYS B CG    1 
ATOM   625  C  CD    . LYS A 1 119 ? -3.011  -14.773 -14.217 1.00 52.88  ? 182  LYS B CD    1 
ATOM   626  C  CE    . LYS A 1 119 ? -1.919  -14.183 -13.392 1.00 57.92  ? 182  LYS B CE    1 
ATOM   627  N  NZ    . LYS A 1 119 ? -0.784  -14.045 -14.312 1.00 57.79  ? 182  LYS B NZ    1 
ATOM   628  N  N     . GLN A 1 120 ? -7.599  -12.895 -13.984 1.00 51.60  ? 183  GLN B N     1 
ATOM   629  C  CA    . GLN A 1 120 ? -8.508  -12.081 -13.202 1.00 49.24  ? 183  GLN B CA    1 
ATOM   630  C  C     . GLN A 1 120 ? -8.573  -12.611 -11.769 1.00 52.37  ? 183  GLN B C     1 
ATOM   631  O  O     . GLN A 1 120 ? -8.042  -13.649 -11.498 1.00 51.54  ? 183  GLN B O     1 
ATOM   632  C  CB    . GLN A 1 120 ? -9.846  -12.079 -13.880 1.00 37.93  ? 183  GLN B CB    1 
ATOM   633  C  CG    . GLN A 1 120 ? -10.135 -13.381 -14.518 1.00 43.47  ? 183  GLN B CG    1 
ATOM   634  C  CD    . GLN A 1 120 ? -11.280 -13.321 -15.431 1.00 51.81  ? 183  GLN B CD    1 
ATOM   635  O  OE1   . GLN A 1 120 ? -12.389 -13.519 -15.049 1.00 54.06  ? 183  GLN B OE1   1 
ATOM   636  N  NE2   . GLN A 1 120 ? -11.015 -13.082 -16.652 1.00 58.46  ? 183  GLN B NE2   1 
ATOM   637  N  N     . ARG A 1 121 ? -9.180  -11.923 -10.831 1.00 50.98  ? 184  ARG B N     1 
ATOM   638  C  CA    . ARG A 1 121 ? -9.205  -12.457 -9.484  1.00 46.09  ? 184  ARG B CA    1 
ATOM   639  C  C     . ARG A 1 121 ? -10.487 -13.147 -9.115  1.00 51.27  ? 184  ARG B C     1 
ATOM   640  O  O     . ARG A 1 121 ? -11.373 -13.216 -9.888  1.00 44.85  ? 184  ARG B O     1 
ATOM   641  C  CB    . ARG A 1 121 ? -8.868  -11.399 -8.467  1.00 47.36  ? 184  ARG B CB    1 
ATOM   642  N  N     . VAL A 1 122 ? -10.531 -13.749 -7.949  1.00 51.34  ? 185  VAL B N     1 
ATOM   643  C  CA    . VAL A 1 122 ? -11.718 -14.413 -7.476  1.00 45.96  ? 185  VAL B CA    1 
ATOM   644  C  C     . VAL A 1 122 ? -11.763 -14.264 -5.970  1.00 44.72  ? 185  VAL B C     1 
ATOM   645  O  O     . VAL A 1 122 ? -10.755 -14.177 -5.353  1.00 41.07  ? 185  VAL B O     1 
ATOM   646  C  CB    . VAL A 1 122 ? -11.678 -15.887 -7.923  1.00 46.03  ? 185  VAL B CB    1 
ATOM   647  C  CG1   . VAL A 1 122 ? -10.265 -16.399 -7.902  1.00 50.90  ? 185  VAL B CG1   1 
ATOM   648  C  CG2   . VAL A 1 122 ? -12.590 -16.807 -7.134  1.00 42.94  ? 185  VAL B CG2   1 
ATOM   649  N  N     . ILE A 1 123 ? -12.929 -14.111 -5.380  1.00 44.21  ? 186  ILE B N     1 
ATOM   650  C  CA    . ILE A 1 123 ? -13.021 -14.095 -3.944  1.00 43.04  ? 186  ILE B CA    1 
ATOM   651  C  C     . ILE A 1 123 ? -14.011 -15.162 -3.515  1.00 39.12  ? 186  ILE B C     1 
ATOM   652  O  O     . ILE A 1 123 ? -15.079 -15.242 -4.001  1.00 41.06  ? 186  ILE B O     1 
ATOM   653  C  CB    . ILE A 1 123 ? -13.408 -12.753 -3.376  1.00 40.95  ? 186  ILE B CB    1 
ATOM   654  C  CG1   . ILE A 1 123 ? -14.868 -12.620 -3.386  1.00 41.91  ? 186  ILE B CG1   1 
ATOM   655  C  CG2   . ILE A 1 123 ? -12.811 -11.614 -4.140  1.00 40.70  ? 186  ILE B CG2   1 
ATOM   656  C  CD1   . ILE A 1 123 ? -15.279 -11.198 -3.319  1.00 51.13  ? 186  ILE B CD1   1 
ATOM   657  N  N     . PHE A 1 124 ? -13.620 -15.988 -2.583  1.00 35.63  ? 187  PHE B N     1 
ATOM   658  C  CA    . PHE A 1 124 ? -14.428 -17.067 -2.130  1.00 33.86  ? 187  PHE B CA    1 
ATOM   659  C  C     . PHE A 1 124 ? -14.798 -16.652 -0.759  1.00 37.12  ? 187  PHE B C     1 
ATOM   660  O  O     . PHE A 1 124 ? -13.956 -16.354 0.005   1.00 41.72  ? 187  PHE B O     1 
ATOM   661  C  CB    . PHE A 1 124 ? -13.533 -18.295 -2.130  1.00 34.29  ? 187  PHE B CB    1 
ATOM   662  C  CG    . PHE A 1 124 ? -14.183 -19.514 -1.671  1.00 29.37  ? 187  PHE B CG    1 
ATOM   663  C  CD1   . PHE A 1 124 ? -14.888 -20.254 -2.498  1.00 33.70  ? 187  PHE B CD1   1 
ATOM   664  C  CD2   . PHE A 1 124 ? -14.080 -19.897 -0.411  1.00 36.61  ? 187  PHE B CD2   1 
ATOM   665  C  CE1   . PHE A 1 124 ? -15.514 -21.378 -2.060  1.00 39.75  ? 187  PHE B CE1   1 
ATOM   666  C  CE2   . PHE A 1 124 ? -14.694 -21.018 0.043   1.00 39.09  ? 187  PHE B CE2   1 
ATOM   667  C  CZ    . PHE A 1 124 ? -15.404 -21.769 -0.787  1.00 32.41  ? 187  PHE B CZ    1 
ATOM   668  N  N     . THR A 1 125 ? -16.074 -16.610 -0.438  1.00 31.91  ? 188  THR B N     1 
ATOM   669  C  CA    . THR A 1 125 ? -16.512 -16.170 0.867   1.00 34.95  ? 188  THR B CA    1 
ATOM   670  C  C     . THR A 1 125 ? -17.211 -17.226 1.622   1.00 37.79  ? 188  THR B C     1 
ATOM   671  O  O     . THR A 1 125 ? -17.872 -18.022 1.061   1.00 33.22  ? 188  THR B O     1 
ATOM   672  C  CB    . THR A 1 125 ? -17.458 -14.986 0.806   1.00 31.53  ? 188  THR B CB    1 
ATOM   673  O  OG1   . THR A 1 125 ? -18.545 -15.288 -0.017  1.00 37.12  ? 188  THR B OG1   1 
ATOM   674  C  CG2   . THR A 1 125 ? -16.815 -13.903 0.205   1.00 34.33  ? 188  THR B CG2   1 
ATOM   675  N  N     . SER A 1 126 ? -16.985 -17.237 2.919   1.00 42.28  ? 189  SER B N     1 
ATOM   676  C  CA    . SER A 1 126 ? -17.615 -18.153 3.825   1.00 38.69  ? 189  SER B CA    1 
ATOM   677  C  C     . SER A 1 126 ? -18.233 -17.363 4.941   1.00 38.76  ? 189  SER B C     1 
ATOM   678  O  O     . SER A 1 126 ? -17.786 -16.330 5.281   1.00 43.79  ? 189  SER B O     1 
ATOM   679  C  CB    . SER A 1 126 ? -16.655 -19.204 4.314   1.00 38.61  ? 189  SER B CB    1 
ATOM   680  O  OG    . SER A 1 126 ? -17.016 -20.462 3.813   1.00 46.32  ? 189  SER B OG    1 
ATOM   681  N  N     . PRO A 1 127 ? -19.310 -17.853 5.473   1.00 35.81  ? 190  PRO B N     1 
ATOM   682  C  CA    . PRO A 1 127 ? -20.154 -17.309 6.503   1.00 40.49  ? 190  PRO B CA    1 
ATOM   683  C  C     . PRO A 1 127 ? -19.556 -17.117 7.840   1.00 42.40  ? 190  PRO B C     1 
ATOM   684  O  O     . PRO A 1 127 ? -19.742 -16.096 8.385   1.00 51.92  ? 190  PRO B O     1 
ATOM   685  C  CB    . PRO A 1 127 ? -21.198 -18.383 6.653   1.00 40.29  ? 190  PRO B CB    1 
ATOM   686  C  CG    . PRO A 1 127 ? -21.161 -19.136 5.412   1.00 45.15  ? 190  PRO B CG    1 
ATOM   687  C  CD    . PRO A 1 127 ? -19.761 -19.158 5.046   1.00 39.43  ? 190  PRO B CD    1 
ATOM   688  N  N     . ILE A 1 128 ? -18.808 -18.062 8.334   1.00 40.76  ? 191  ILE B N     1 
ATOM   689  C  CA    . ILE A 1 128 ? -18.256 -18.013 9.650   1.00 41.64  ? 191  ILE B CA    1 
ATOM   690  C  C     . ILE A 1 128 ? -16.753 -17.924 9.559   1.00 43.81  ? 191  ILE B C     1 
ATOM   691  O  O     . ILE A 1 128 ? -16.189 -18.134 8.562   1.00 44.78  ? 191  ILE B O     1 
ATOM   692  C  CB    . ILE A 1 128 ? -18.653 -19.310 10.372  1.00 43.01  ? 191  ILE B CB    1 
ATOM   693  C  CG1   . ILE A 1 128 ? -20.118 -19.559 10.217  1.00 54.33  ? 191  ILE B CG1   1 
ATOM   694  C  CG2   . ILE A 1 128 ? -18.453 -19.290 11.862  1.00 47.09  ? 191  ILE B CG2   1 
ATOM   695  C  CD1   . ILE A 1 128 ? -20.978 -18.891 11.257  1.00 43.61  ? 191  ILE B CD1   1 
ATOM   696  N  N     . LYS A 1 129 ? -16.096 -17.487 10.595  1.00 44.82  ? 192  LYS B N     1 
ATOM   697  C  CA    . LYS A 1 129 ? -14.682 -17.441 10.621  1.00 44.71  ? 192  LYS B CA    1 
ATOM   698  C  C     . LYS A 1 129 ? -14.088 -18.825 10.572  1.00 42.56  ? 192  LYS B C     1 
ATOM   699  O  O     . LYS A 1 129 ? -13.090 -19.043 9.984   1.00 42.95  ? 192  LYS B O     1 
ATOM   700  C  CB    . LYS A 1 129 ? -14.276 -16.755 11.892  1.00 43.61  ? 192  LYS B CB    1 
ATOM   701  C  CG    . LYS A 1 129 ? -13.123 -15.825 11.727  1.00 42.21  ? 192  LYS B CG    1 
ATOM   702  C  CD    . LYS A 1 129 ? -12.083 -16.134 12.752  1.00 54.90  ? 192  LYS B CD    1 
ATOM   703  C  CE    . LYS A 1 129 ? -10.695 -16.115 12.151  1.00 56.24  ? 192  LYS B CE    1 
ATOM   704  N  NZ    . LYS A 1 129 ? -9.696  -16.590 13.134  1.00 54.20  ? 192  LYS B NZ    1 
ATOM   705  N  N     . ALA A 1 130 ? -14.700 -19.743 11.271  1.00 39.05  ? 193  ALA B N     1 
ATOM   706  C  CA    . ALA A 1 130 ? -14.298 -21.105 11.328  1.00 36.37  ? 193  ALA B CA    1 
ATOM   707  C  C     . ALA A 1 130 ? -14.405 -21.787 10.011  1.00 42.61  ? 193  ALA B C     1 
ATOM   708  O  O     . ALA A 1 130 ? -13.687 -22.677 9.710   1.00 47.05  ? 193  ALA B O     1 
ATOM   709  C  CB    . ALA A 1 130 ? -15.183 -21.807 12.299  1.00 37.05  ? 193  ALA B CB    1 
ATOM   710  N  N     . LEU A 1 131 ? -15.444 -21.486 9.296   1.00 46.06  ? 194  LEU B N     1 
ATOM   711  C  CA    . LEU A 1 131 ? -15.651 -22.014 8.001   1.00 41.56  ? 194  LEU B CA    1 
ATOM   712  C  C     . LEU A 1 131 ? -14.672 -21.501 7.042   1.00 43.80  ? 194  LEU B C     1 
ATOM   713  O  O     . LEU A 1 131 ? -14.328 -22.161 6.140   1.00 52.52  ? 194  LEU B O     1 
ATOM   714  C  CB    . LEU A 1 131 ? -17.020 -21.699 7.515   1.00 37.38  ? 194  LEU B CB    1 
ATOM   715  C  CG    . LEU A 1 131 ? -17.778 -22.957 7.642   1.00 37.67  ? 194  LEU B CG    1 
ATOM   716  C  CD1   . LEU A 1 131 ? -17.877 -23.204 9.100   1.00 39.36  ? 194  LEU B CD1   1 
ATOM   717  C  CD2   . LEU A 1 131 ? -19.112 -22.714 7.058   1.00 41.19  ? 194  LEU B CD2   1 
ATOM   718  N  N     . SER A 1 132 ? -14.342 -20.247 7.158   1.00 40.42  ? 195  SER B N     1 
ATOM   719  C  CA    . SER A 1 132 ? -13.389 -19.602 6.284   1.00 40.17  ? 195  SER B CA    1 
ATOM   720  C  C     . SER A 1 132 ? -11.977 -20.050 6.401   1.00 43.98  ? 195  SER B C     1 
ATOM   721  O  O     . SER A 1 132 ? -11.246 -19.969 5.482   1.00 44.95  ? 195  SER B O     1 
ATOM   722  C  CB    . SER A 1 132 ? -13.453 -18.124 6.434   1.00 43.20  ? 195  SER B CB    1 
ATOM   723  O  OG    . SER A 1 132 ? -14.778 -17.749 6.486   1.00 46.10  ? 195  SER B OG    1 
ATOM   724  N  N     . ASN A 1 133 ? -11.548 -20.357 7.593   1.00 43.27  ? 196  ASN B N     1 
ATOM   725  C  CA    . ASN A 1 133 ? -10.220 -20.824 7.810   1.00 42.87  ? 196  ASN B CA    1 
ATOM   726  C  C     . ASN A 1 133 ? -10.025 -22.138 7.200   1.00 45.78  ? 196  ASN B C     1 
ATOM   727  O  O     . ASN A 1 133 ? -8.979  -22.407 6.714   1.00 53.86  ? 196  ASN B O     1 
ATOM   728  C  CB    . ASN A 1 133 ? -9.977  -21.003 9.265   1.00 50.35  ? 196  ASN B CB    1 
ATOM   729  C  CG    . ASN A 1 133 ? -9.750  -19.723 9.961   1.00 51.31  ? 196  ASN B CG    1 
ATOM   730  O  OD1   . ASN A 1 133 ? -9.390  -18.746 9.382   1.00 48.18  ? 196  ASN B OD1   1 
ATOM   731  N  ND2   . ASN A 1 133 ? -9.987  -19.730 11.219  1.00 52.95  ? 196  ASN B ND2   1 
ATOM   732  N  N     . GLN A 1 134 ? -11.015 -23.007 7.325   1.00 44.42  ? 197  GLN B N     1 
ATOM   733  C  CA    . GLN A 1 134 ? -10.954 -24.326 6.760   1.00 43.84  ? 197  GLN B CA    1 
ATOM   734  C  C     . GLN A 1 134 ? -10.905 -24.211 5.309   1.00 43.93  ? 197  GLN B C     1 
ATOM   735  O  O     . GLN A 1 134 ? -10.168 -24.852 4.713   1.00 45.71  ? 197  GLN B O     1 
ATOM   736  C  CB    . GLN A 1 134 ? -12.152 -25.119 7.144   1.00 40.75  ? 197  GLN B CB    1 
ATOM   737  N  N     . LYS A 1 135 ? -11.704 -23.366 4.719   1.00 42.30  ? 198  LYS B N     1 
ATOM   738  C  CA    . LYS A 1 135 ? -11.651 -23.148 3.296   1.00 47.78  ? 198  LYS B CA    1 
ATOM   739  C  C     . LYS A 1 135 ? -10.396 -22.492 2.842   1.00 47.83  ? 198  LYS B C     1 
ATOM   740  O  O     . LYS A 1 135 ? -10.042 -22.633 1.716   1.00 55.35  ? 198  LYS B O     1 
ATOM   741  C  CB    . LYS A 1 135 ? -12.837 -22.385 2.751   1.00 41.55  ? 198  LYS B CB    1 
ATOM   742  C  CG    . LYS A 1 135 ? -14.144 -23.123 2.800   1.00 43.59  ? 198  LYS B CG    1 
ATOM   743  C  CD    . LYS A 1 135 ? -14.211 -24.250 1.827   1.00 38.51  ? 198  LYS B CD    1 
ATOM   744  C  CE    . LYS A 1 135 ? -15.147 -25.257 2.408   1.00 41.31  ? 198  LYS B CE    1 
ATOM   745  N  NZ    . LYS A 1 135 ? -15.349 -26.454 1.589   1.00 43.13  ? 198  LYS B NZ    1 
ATOM   746  N  N     . TYR A 1 136 ? -9.776  -21.667 3.666   1.00 47.22  ? 199  TYR B N     1 
ATOM   747  C  CA    . TYR A 1 136 ? -8.540  -21.009 3.304   1.00 47.58  ? 199  TYR B CA    1 
ATOM   748  C  C     . TYR A 1 136 ? -7.501  -22.002 3.102   1.00 46.62  ? 199  TYR B C     1 
ATOM   749  O  O     . TYR A 1 136 ? -6.759  -21.941 2.198   1.00 42.46  ? 199  TYR B O     1 
ATOM   750  C  CB    . TYR A 1 136 ? -8.069  -20.167 4.460   1.00 51.50  ? 199  TYR B CB    1 
ATOM   751  C  CG    . TYR A 1 136 ? -6.647  -19.777 4.379   1.00 46.76  ? 199  TYR B CG    1 
ATOM   752  C  CD1   . TYR A 1 136 ? -6.209  -18.951 3.410   1.00 46.77  ? 199  TYR B CD1   1 
ATOM   753  C  CD2   . TYR A 1 136 ? -5.750  -20.209 5.296   1.00 48.52  ? 199  TYR B CD2   1 
ATOM   754  C  CE1   . TYR A 1 136 ? -4.898  -18.596 3.344   1.00 51.26  ? 199  TYR B CE1   1 
ATOM   755  C  CE2   . TYR A 1 136 ? -4.447  -19.867 5.225   1.00 47.34  ? 199  TYR B CE2   1 
ATOM   756  C  CZ    . TYR A 1 136 ? -4.040  -19.058 4.240   1.00 52.22  ? 199  TYR B CZ    1 
ATOM   757  O  OH    . TYR A 1 136 ? -2.753  -18.703 4.150   1.00 57.48  ? 199  TYR B OH    1 
ATOM   758  N  N     . ARG A 1 137 ? -7.411  -22.922 4.010   1.00 50.17  ? 200  ARG B N     1 
ATOM   759  C  CA    . ARG A 1 137 ? -6.443  -23.930 3.895   1.00 53.64  ? 200  ARG B CA    1 
ATOM   760  C  C     . ARG A 1 137 ? -6.722  -24.825 2.759   1.00 54.23  ? 200  ARG B C     1 
ATOM   761  O  O     . ARG A 1 137 ? -5.849  -25.110 2.009   1.00 60.49  ? 200  ARG B O     1 
ATOM   762  C  CB    . ARG A 1 137 ? -6.343  -24.691 5.188   1.00 56.92  ? 200  ARG B CB    1 
ATOM   763  C  CG    . ARG A 1 137 ? -5.323  -24.070 6.111   1.00 71.06  ? 200  ARG B CG    1 
ATOM   764  C  CD    . ARG A 1 137 ? -4.965  -25.028 7.210   1.00 80.69  ? 200  ARG B CD    1 
ATOM   765  N  NE    . ARG A 1 137 ? -6.163  -25.573 7.825   1.00 77.29  ? 200  ARG B NE    1 
ATOM   766  C  CZ    . ARG A 1 137 ? -6.734  -26.710 7.477   1.00 74.33  ? 200  ARG B CZ    1 
ATOM   767  N  NH1   . ARG A 1 137 ? -6.225  -27.447 6.507   1.00 76.93  ? 200  ARG B NH1   1 
ATOM   768  N  NH2   . ARG A 1 137 ? -7.816  -27.109 8.110   1.00 74.35  ? 200  ARG B NH2   1 
ATOM   769  N  N     . GLU A 1 138 ? -7.971  -25.212 2.578   1.00 55.42  ? 201  GLU B N     1 
ATOM   770  C  CA    . GLU A 1 138 ? -8.369  -26.110 1.511   1.00 47.29  ? 201  GLU B CA    1 
ATOM   771  C  C     . GLU A 1 138 ? -8.084  -25.500 0.203   1.00 47.77  ? 201  GLU B C     1 
ATOM   772  O  O     . GLU A 1 138 ? -7.584  -26.116 -0.679  1.00 54.58  ? 201  GLU B O     1 
ATOM   773  C  CB    . GLU A 1 138 ? -9.843  -26.405 1.601   1.00 41.17  ? 201  GLU B CB    1 
ATOM   774  C  CG    . GLU A 1 138 ? -10.186 -27.352 2.708   1.00 45.14  ? 201  GLU B CG    1 
ATOM   775  C  CD    . GLU A 1 138 ? -11.593 -27.761 2.671   1.00 44.21  ? 201  GLU B CD    1 
ATOM   776  O  OE1   . GLU A 1 138 ? -12.270 -27.413 1.736   1.00 45.17  ? 201  GLU B OE1   1 
ATOM   777  O  OE2   . GLU A 1 138 ? -11.998 -28.471 3.562   1.00 44.23  ? 201  GLU B OE2   1 
ATOM   778  N  N     . MET A 1 139 ? -8.401  -24.250 0.059   1.00 48.14  ? 202  MET B N     1 
ATOM   779  C  CA    . MET A 1 139 ? -8.047  -23.563 -1.140  1.00 50.50  ? 202  MET B CA    1 
ATOM   780  C  C     . MET A 1 139 ? -6.543  -23.404 -1.266  1.00 52.16  ? 202  MET B C     1 
ATOM   781  O  O     . MET A 1 139 ? -6.044  -23.403 -2.316  1.00 48.14  ? 202  MET B O     1 
ATOM   782  C  CB    . MET A 1 139 ? -8.784  -22.248 -1.279  1.00 47.88  ? 202  MET B CB    1 
ATOM   783  C  CG    . MET A 1 139 ? -10.262 -22.383 -1.592  1.00 48.60  ? 202  MET B CG    1 
ATOM   784  S  SD    . MET A 1 139 ? -10.787 -23.523 -2.848  1.00 42.40  ? 202  MET B SD    1 
ATOM   785  C  CE    . MET A 1 139 ? -10.664 -25.003 -1.952  1.00 45.83  ? 202  MET B CE    1 
ATOM   786  N  N     . TYR A 1 140 ? -5.817  -23.235 -0.185  1.00 53.49  ? 203  TYR B N     1 
ATOM   787  C  CA    . TYR A 1 140 ? -4.399  -23.049 -0.267  1.00 53.17  ? 203  TYR B CA    1 
ATOM   788  C  C     . TYR A 1 140 ? -3.667  -24.203 -0.881  1.00 53.55  ? 203  TYR B C     1 
ATOM   789  O  O     . TYR A 1 140 ? -2.705  -24.025 -1.564  1.00 50.29  ? 203  TYR B O     1 
ATOM   790  C  CB    . TYR A 1 140 ? -3.846  -22.766 1.106   1.00 51.42  ? 203  TYR B CB    1 
ATOM   791  N  N     . GLU A 1 141 ? -4.077  -25.405 -0.589  1.00 52.97  ? 204  GLU B N     1 
ATOM   792  C  CA    . GLU A 1 141 ? -3.422  -26.533 -1.163  1.00 57.16  ? 204  GLU B CA    1 
ATOM   793  C  C     . GLU A 1 141 ? -3.525  -26.565 -2.661  1.00 60.27  ? 204  GLU B C     1 
ATOM   794  O  O     . GLU A 1 141 ? -2.549  -26.777 -3.331  1.00 63.64  ? 204  GLU B O     1 
ATOM   795  C  CB    . GLU A 1 141 ? -4.118  -27.805 -0.706  1.00 61.70  ? 204  GLU B CB    1 
ATOM   796  C  CG    . GLU A 1 141 ? -4.421  -27.950 0.768   1.00 60.62  ? 204  GLU B CG    1 
ATOM   797  C  CD    . GLU A 1 141 ? -4.654  -29.388 1.165   1.00 70.09  ? 204  GLU B CD    1 
ATOM   798  O  OE1   . GLU A 1 141 ? -4.387  -30.278 0.357   1.00 68.00  ? 204  GLU B OE1   1 
ATOM   799  O  OE2   . GLU A 1 141 ? -5.078  -29.648 2.296   1.00 75.18  ? 204  GLU B OE2   1 
ATOM   800  N  N     . GLU A 1 142 ? -4.706  -26.391 -3.206  1.00 51.92  ? 205  GLU B N     1 
ATOM   801  C  CA    . GLU A 1 142 ? -4.855  -26.419 -4.644  1.00 53.82  ? 205  GLU B CA    1 
ATOM   802  C  C     . GLU A 1 142 ? -4.303  -25.262 -5.410  1.00 47.95  ? 205  GLU B C     1 
ATOM   803  O  O     . GLU A 1 142 ? -3.701  -25.450 -6.414  1.00 49.95  ? 205  GLU B O     1 
ATOM   804  C  CB    . GLU A 1 142 ? -6.305  -26.634 -5.066  1.00 49.35  ? 205  GLU B CB    1 
ATOM   805  C  CG    . GLU A 1 142 ? -7.124  -27.447 -4.123  1.00 49.96  ? 205  GLU B CG    1 
ATOM   806  C  CD    . GLU A 1 142 ? -7.086  -28.904 -4.398  1.00 58.05  ? 205  GLU B CD    1 
ATOM   807  O  OE1   . GLU A 1 142 ? -7.294  -29.301 -5.521  1.00 49.83  ? 205  GLU B OE1   1 
ATOM   808  O  OE2   . GLU A 1 142 ? -6.904  -29.663 -3.467  1.00 63.99  ? 205  GLU B OE2   1 
ATOM   809  N  N     . PHE A 1 143 ? -4.525  -24.056 -4.941  1.00 44.61  ? 206  PHE B N     1 
ATOM   810  C  CA    . PHE A 1 143 ? -4.096  -22.881 -5.650  1.00 47.85  ? 206  PHE B CA    1 
ATOM   811  C  C     . PHE A 1 143 ? -3.142  -22.147 -4.808  1.00 55.64  ? 206  PHE B C     1 
ATOM   812  O  O     . PHE A 1 143 ? -3.377  -21.954 -3.667  1.00 60.87  ? 206  PHE B O     1 
ATOM   813  C  CB    . PHE A 1 143 ? -5.272  -21.997 -5.931  1.00 46.33  ? 206  PHE B CB    1 
ATOM   814  C  CG    . PHE A 1 143 ? -6.402  -22.714 -6.529  1.00 46.27  ? 206  PHE B CG    1 
ATOM   815  C  CD1   . PHE A 1 143 ? -6.359  -23.102 -7.814  1.00 50.83  ? 206  PHE B CD1   1 
ATOM   816  C  CD2   . PHE A 1 143 ? -7.486  -23.010 -5.806  1.00 51.71  ? 206  PHE B CD2   1 
ATOM   817  C  CE1   . PHE A 1 143 ? -7.374  -23.792 -8.373  1.00 48.45  ? 206  PHE B CE1   1 
ATOM   818  C  CE2   . PHE A 1 143 ? -8.517  -23.714 -6.361  1.00 56.39  ? 206  PHE B CE2   1 
ATOM   819  C  CZ    . PHE A 1 143 ? -8.462  -24.098 -7.653  1.00 47.04  ? 206  PHE B CZ    1 
ATOM   820  N  N     . GLN A 1 144 ? -2.019  -21.795 -5.358  1.00 48.48  ? 207  GLN B N     1 
ATOM   821  C  CA    . GLN A 1 144 ? -1.044  -21.167 -4.558  1.00 44.39  ? 207  GLN B CA    1 
ATOM   822  C  C     . GLN A 1 144 ? -1.298  -19.795 -4.064  1.00 45.50  ? 207  GLN B C     1 
ATOM   823  O  O     . GLN A 1 144 ? -1.144  -19.548 -2.930  1.00 51.95  ? 207  GLN B O     1 
ATOM   824  C  CB    . GLN A 1 144 ? 0.285   -21.311 -5.238  1.00 52.60  ? 207  GLN B CB    1 
ATOM   825  C  CG    . GLN A 1 144 ? 0.683   -22.741 -5.460  1.00 51.57  ? 207  GLN B CG    1 
ATOM   826  C  CD    . GLN A 1 144 ? 1.874   -22.840 -6.345  1.00 58.23  ? 207  GLN B CD    1 
ATOM   827  O  OE1   . GLN A 1 144 ? 2.098   -21.978 -7.159  1.00 46.99  ? 207  GLN B OE1   1 
ATOM   828  N  NE2   . GLN A 1 144 ? 2.650   -23.893 -6.189  1.00 61.54  ? 207  GLN B NE2   1 
ATOM   829  N  N     . ASP A 1 145 ? -1.783  -18.911 -4.884  1.00 48.04  ? 208  ASP B N     1 
ATOM   830  C  CA    . ASP A 1 145 ? -1.950  -17.527 -4.476  1.00 49.80  ? 208  ASP B CA    1 
ATOM   831  C  C     . ASP A 1 145 ? -3.237  -17.300 -3.768  1.00 50.98  ? 208  ASP B C     1 
ATOM   832  O  O     . ASP A 1 145 ? -4.166  -16.899 -4.375  1.00 50.17  ? 208  ASP B O     1 
ATOM   833  C  CB    . ASP A 1 145 ? -1.923  -16.655 -5.744  1.00 51.38  ? 208  ASP B CB    1 
ATOM   834  C  CG    . ASP A 1 145 ? -1.392  -15.268 -5.536  1.00 50.88  ? 208  ASP B CG    1 
ATOM   835  O  OD1   . ASP A 1 145 ? -1.246  -14.822 -4.426  1.00 54.52  ? 208  ASP B OD1   1 
ATOM   836  O  OD2   . ASP A 1 145 ? -1.159  -14.594 -6.511  1.00 39.67  ? 208  ASP B OD2   1 
ATOM   837  N  N     . VAL A 1 146 ? -3.279  -17.593 -2.484  1.00 44.14  ? 209  VAL B N     1 
ATOM   838  C  CA    . VAL A 1 146 ? -4.483  -17.384 -1.728  1.00 46.82  ? 209  VAL B CA    1 
ATOM   839  C  C     . VAL A 1 146 ? -4.366  -16.496 -0.507  1.00 53.11  ? 209  VAL B C     1 
ATOM   840  O  O     . VAL A 1 146 ? -3.312  -16.373 0.063   1.00 55.00  ? 209  VAL B O     1 
ATOM   841  C  CB    . VAL A 1 146 ? -5.266  -18.654 -1.383  1.00 45.73  ? 209  VAL B CB    1 
ATOM   842  C  CG1   . VAL A 1 146 ? -4.927  -19.779 -2.303  1.00 51.20  ? 209  VAL B CG1   1 
ATOM   843  C  CG2   . VAL A 1 146 ? -5.072  -19.040 0.047   1.00 50.43  ? 209  VAL B CG2   1 
ATOM   844  N  N     . GLY A 1 147 ? -5.464  -15.835 -0.158  1.00 53.11  ? 210  GLY B N     1 
ATOM   845  C  CA    . GLY A 1 147 ? -5.518  -14.959 0.982   1.00 50.08  ? 210  GLY B CA    1 
ATOM   846  C  C     . GLY A 1 147 ? -6.661  -15.206 1.925   1.00 48.42  ? 210  GLY B C     1 
ATOM   847  O  O     . GLY A 1 147 ? -7.578  -15.891 1.589   1.00 49.03  ? 210  GLY B O     1 
ATOM   848  N  N     . LEU A 1 148 ? -6.554  -14.742 3.151   1.00 42.12  ? 211  LEU B N     1 
ATOM   849  C  CA    . LEU A 1 148 ? -7.638  -14.901 4.067   1.00 42.18  ? 211  LEU B CA    1 
ATOM   850  C  C     . LEU A 1 148 ? -7.925  -13.590 4.686   1.00 42.63  ? 211  LEU B C     1 
ATOM   851  O  O     . LEU A 1 148 ? -7.049  -12.979 5.170   1.00 39.52  ? 211  LEU B O     1 
ATOM   852  C  CB    . LEU A 1 148 ? -7.301  -15.898 5.139   1.00 45.66  ? 211  LEU B CB    1 
ATOM   853  C  CG    . LEU A 1 148 ? -8.364  -15.990 6.202   1.00 46.91  ? 211  LEU B CG    1 
ATOM   854  C  CD1   . LEU A 1 148 ? -9.696  -16.220 5.561   1.00 43.23  ? 211  LEU B CD1   1 
ATOM   855  C  CD2   . LEU A 1 148 ? -8.098  -17.037 7.238   1.00 43.81  ? 211  LEU B CD2   1 
ATOM   856  N  N     . MET A 1 149 ? -9.165  -13.157 4.647   1.00 46.31  ? 212  MET B N     1 
ATOM   857  C  CA    . MET A 1 149 ? -9.568  -11.935 5.268   1.00 42.63  ? 212  MET B CA    1 
ATOM   858  C  C     . MET A 1 149 ? -10.738 -12.224 6.175   1.00 45.33  ? 212  MET B C     1 
ATOM   859  O  O     . MET A 1 149 ? -11.770 -12.592 5.769   1.00 48.16  ? 212  MET B O     1 
ATOM   860  C  CB    . MET A 1 149 ? -9.961  -10.963 4.212   1.00 43.20  ? 212  MET B CB    1 
ATOM   861  C  CG    . MET A 1 149 ? -9.304  -9.624  4.299   1.00 45.24  ? 212  MET B CG    1 
ATOM   862  S  SD    . MET A 1 149 ? -8.768  -9.177  2.681   1.00 52.15  ? 212  MET B SD    1 
ATOM   863  C  CE    . MET A 1 149 ? -8.570  -7.446  2.857   1.00 55.53  ? 212  MET B CE    1 
ATOM   864  N  N     . THR A 1 150 ? -10.507 -11.969 7.432   1.00 50.13  ? 213  THR B N     1 
ATOM   865  C  CA    . THR A 1 150 ? -11.348 -12.138 8.591   1.00 49.92  ? 213  THR B CA    1 
ATOM   866  C  C     . THR A 1 150 ? -11.224 -10.835 9.412   1.00 51.41  ? 213  THR B C     1 
ATOM   867  O  O     . THR A 1 150 ? -10.425 -9.960  9.068   1.00 52.86  ? 213  THR B O     1 
ATOM   868  C  CB    . THR A 1 150 ? -10.767 -13.342 9.313   1.00 47.41  ? 213  THR B CB    1 
ATOM   869  O  OG1   . THR A 1 150 ? -10.944 -14.448 8.470   1.00 44.92  ? 213  THR B OG1   1 
ATOM   870  C  CG2   . THR A 1 150 ? -11.443 -13.713 10.503  1.00 50.40  ? 213  THR B CG2   1 
ATOM   871  N  N     . GLY A 1 151 ? -12.084 -10.582 10.384  1.00 42.91  ? 214  GLY B N     1 
ATOM   872  C  CA    . GLY A 1 151 ? -11.840 -9.414  11.205  1.00 67.83  ? 214  GLY B CA    1 
ATOM   873  C  C     . GLY A 1 151 ? -10.523 -9.571  11.963  1.00 67.49  ? 214  GLY B C     1 
ATOM   874  O  O     . GLY A 1 151 ? -9.691  -8.680  12.035  1.00 60.12  ? 214  GLY B O     1 
ATOM   875  N  N     . ASP A 1 152 ? -10.361 -10.751 12.538  1.00 62.85  ? 215  ASP B N     1 
ATOM   876  C  CA    . ASP A 1 152 ? -9.180  -11.132 13.264  1.00 53.59  ? 215  ASP B CA    1 
ATOM   877  C  C     . ASP A 1 152 ? -7.896  -11.311 12.515  1.00 57.19  ? 215  ASP B C     1 
ATOM   878  O  O     . ASP A 1 152 ? -6.900  -10.832 12.950  1.00 67.24  ? 215  ASP B O     1 
ATOM   879  C  CB    . ASP A 1 152 ? -9.466  -12.421 13.963  1.00 55.07  ? 215  ASP B CB    1 
ATOM   880  C  CG    . ASP A 1 152 ? -10.801 -12.421 14.582  1.00 69.66  ? 215  ASP B CG    1 
ATOM   881  O  OD1   . ASP A 1 152 ? -11.646 -11.649 14.130  1.00 65.97  ? 215  ASP B OD1   1 
ATOM   882  O  OD2   . ASP A 1 152 ? -11.012 -13.184 15.526  1.00 78.36  ? 215  ASP B OD2   1 
ATOM   883  N  N     . VAL A 1 153 ? -7.896  -11.968 11.373  1.00 56.84  ? 216  VAL B N     1 
ATOM   884  C  CA    . VAL A 1 153 ? -6.648  -12.215 10.672  1.00 54.70  ? 216  VAL B CA    1 
ATOM   885  C  C     . VAL A 1 153 ? -6.660  -11.622 9.302   1.00 54.58  ? 216  VAL B C     1 
ATOM   886  O  O     . VAL A 1 153 ? -7.683  -11.364 8.806   1.00 53.59  ? 216  VAL B O     1 
ATOM   887  C  CB    . VAL A 1 153 ? -6.437  -13.706 10.482  1.00 44.41  ? 216  VAL B CB    1 
ATOM   888  C  CG1   . VAL A 1 153 ? -4.983  -14.019 10.423  1.00 46.84  ? 216  VAL B CG1   1 
ATOM   889  C  CG2   . VAL A 1 153 ? -6.993  -14.457 11.633  1.00 46.37  ? 216  VAL B CG2   1 
ATOM   890  N  N     . THR A 1 154 ? -5.535  -11.234 8.743   1.00 52.92  ? 217  THR B N     1 
ATOM   891  C  CA    . THR A 1 154 ? -5.541  -10.775 7.372   1.00 46.54  ? 217  THR B CA    1 
ATOM   892  C  C     . THR A 1 154 ? -4.319  -11.372 6.777   1.00 47.74  ? 217  THR B C     1 
ATOM   893  O  O     . THR A 1 154 ? -3.278  -11.077 7.229   1.00 52.17  ? 217  THR B O     1 
ATOM   894  C  CB    . THR A 1 154 ? -5.450  -9.282  7.286   1.00 43.83  ? 217  THR B CB    1 
ATOM   895  O  OG1   . THR A 1 154 ? -6.588  -8.735  7.905   1.00 46.00  ? 217  THR B OG1   1 
ATOM   896  C  CG2   . THR A 1 154 ? -5.501  -8.873  5.926   1.00 34.36  ? 217  THR B CG2   1 
ATOM   897  N  N     . ILE A 1 155 ? -4.427  -12.200 5.763   1.00 46.05  ? 218  ILE B N     1 
ATOM   898  C  CA    . ILE A 1 155 ? -3.261  -12.818 5.190   1.00 43.86  ? 218  ILE B CA    1 
ATOM   899  C  C     . ILE A 1 155 ? -3.310  -12.669 3.707   1.00 45.43  ? 218  ILE B C     1 
ATOM   900  O  O     . ILE A 1 155 ? -4.331  -12.918 3.164   1.00 46.23  ? 218  ILE B O     1 
ATOM   901  C  CB    . ILE A 1 155 ? -3.325  -14.326 5.421   1.00 44.48  ? 218  ILE B CB    1 
ATOM   902  C  CG1   . ILE A 1 155 ? -3.172  -14.695 6.871   1.00 44.44  ? 218  ILE B CG1   1 
ATOM   903  C  CG2   . ILE A 1 155 ? -2.263  -15.051 4.669   1.00 42.13  ? 218  ILE B CG2   1 
ATOM   904  C  CD1   . ILE A 1 155 ? -3.695  -16.054 7.195   1.00 41.44  ? 218  ILE B CD1   1 
ATOM   905  N  N     . ASN A 1 156 ? -2.232  -12.237 3.067   1.00 43.65  ? 219  ASN B N     1 
ATOM   906  C  CA    . ASN A 1 156 ? -2.136  -12.139 1.632   1.00 44.34  ? 219  ASN B CA    1 
ATOM   907  C  C     . ASN A 1 156 ? -3.271  -11.399 1.035   1.00 49.85  ? 219  ASN B C     1 
ATOM   908  O  O     . ASN A 1 156 ? -3.856  -11.844 0.133   1.00 46.23  ? 219  ASN B O     1 
ATOM   909  C  CB    . ASN A 1 156 ? -2.005  -13.528 1.042   1.00 43.21  ? 219  ASN B CB    1 
ATOM   910  C  CG    . ASN A 1 156 ? -1.784  -13.528 -0.427  1.00 47.54  ? 219  ASN B CG    1 
ATOM   911  O  OD1   . ASN A 1 156 ? -1.704  -12.518 -1.043  1.00 48.61  ? 219  ASN B OD1   1 
ATOM   912  N  ND2   . ASN A 1 156 ? -1.692  -14.681 -0.985  1.00 44.49  ? 219  ASN B ND2   1 
ATOM   913  N  N     . PRO A 1 157 ? -3.542  -10.207 1.481   1.00 45.57  ? 220  PRO B N     1 
ATOM   914  C  CA    . PRO A 1 157 ? -4.710  -9.501  0.996   1.00 49.84  ? 220  PRO B CA    1 
ATOM   915  C  C     . PRO A 1 157 ? -4.844  -9.265  -0.486  1.00 52.61  ? 220  PRO B C     1 
ATOM   916  O  O     . PRO A 1 157 ? -5.937  -9.150  -0.928  1.00 53.47  ? 220  PRO B O     1 
ATOM   917  C  CB    . PRO A 1 157 ? -4.592  -8.179  1.692   1.00 45.14  ? 220  PRO B CB    1 
ATOM   918  C  CG    . PRO A 1 157 ? -3.949  -8.513  2.931   1.00 44.02  ? 220  PRO B CG    1 
ATOM   919  C  CD    . PRO A 1 157 ? -2.915  -9.494  2.577   1.00 43.14  ? 220  PRO B CD    1 
ATOM   920  N  N     . THR A 1 158 ? -3.780  -9.149  -1.238  1.00 53.67  ? 221  THR B N     1 
ATOM   921  C  CA    . THR A 1 158 ? -3.875  -8.930  -2.668  1.00 50.24  ? 221  THR B CA    1 
ATOM   922  C  C     . THR A 1 158 ? -3.664  -10.211 -3.441  1.00 49.69  ? 221  THR B C     1 
ATOM   923  O  O     . THR A 1 158 ? -3.021  -10.198 -4.447  1.00 49.19  ? 221  THR B O     1 
ATOM   924  C  CB    . THR A 1 158 ? -2.946  -7.817  -3.157  1.00 45.05  ? 221  THR B CB    1 
ATOM   925  O  OG1   . THR A 1 158 ? -2.310  -8.193  -4.371  1.00 52.61  ? 221  THR B OG1   1 
ATOM   926  C  CG2   . THR A 1 158 ? -1.895  -7.585  -2.196  1.00 50.54  ? 221  THR B CG2   1 
ATOM   927  N  N     . ALA A 1 159 ? -4.132  -11.307 -2.886  1.00 44.96  ? 222  ALA B N     1 
ATOM   928  C  CA    . ALA A 1 159 ? -4.064  -12.597 -3.466  1.00 45.26  ? 222  ALA B CA    1 
ATOM   929  C  C     . ALA A 1 159 ? -4.968  -12.712 -4.590  1.00 50.11  ? 222  ALA B C     1 
ATOM   930  O  O     . ALA A 1 159 ? -5.980  -12.102 -4.626  1.00 56.83  ? 222  ALA B O     1 
ATOM   931  C  CB    . ALA A 1 159 ? -4.495  -13.602 -2.471  1.00 45.19  ? 222  ALA B CB    1 
ATOM   932  N  N     . SER A 1 160 ? -4.601  -13.579 -5.497  1.00 48.64  ? 223  SER B N     1 
ATOM   933  C  CA    . SER A 1 160 ? -5.349  -13.875 -6.658  1.00 44.88  ? 223  SER B CA    1 
ATOM   934  C  C     . SER A 1 160 ? -6.639  -14.499 -6.281  1.00 50.45  ? 223  SER B C     1 
ATOM   935  O  O     . SER A 1 160 ? -7.625  -14.226 -6.876  1.00 52.84  ? 223  SER B O     1 
ATOM   936  C  CB    . SER A 1 160 ? -4.562  -14.806 -7.517  1.00 43.68  ? 223  SER B CB    1 
ATOM   937  N  N     . CYS A 1 161 ? -6.631  -15.383 -5.315  1.00 48.09  ? 224  CYS B N     1 
ATOM   938  C  CA    . CYS A 1 161 ? -7.841  -15.976 -4.846  1.00 47.55  ? 224  CYS B CA    1 
ATOM   939  C  C     . CYS A 1 161 ? -7.945  -15.544 -3.426  1.00 52.25  ? 224  CYS B C     1 
ATOM   940  O  O     . CYS A 1 161 ? -7.114  -15.869 -2.688  1.00 56.34  ? 224  CYS B O     1 
ATOM   941  C  CB    . CYS A 1 161 ? -7.644  -17.421 -4.825  1.00 41.57  ? 224  CYS B CB    1 
ATOM   942  S  SG    . CYS A 1 161 ? -9.034  -18.204 -4.151  1.00 48.35  ? 224  CYS B SG    1 
ATOM   943  N  N     . LEU A 1 162 ? -8.982  -14.859 -3.004  1.00 46.31  ? 225  LEU B N     1 
ATOM   944  C  CA    . LEU A 1 162 ? -9.028  -14.398 -1.654  1.00 40.47  ? 225  LEU B CA    1 
ATOM   945  C  C     . LEU A 1 162 ? -10.178 -15.011 -1.010  1.00 44.23  ? 225  LEU B C     1 
ATOM   946  O  O     . LEU A 1 162 ? -11.217 -14.947 -1.547  1.00 44.42  ? 225  LEU B O     1 
ATOM   947  C  CB    . LEU A 1 162 ? -9.220  -12.930 -1.695  1.00 44.16  ? 225  LEU B CB    1 
ATOM   948  C  CG    . LEU A 1 162 ? -9.315  -12.233 -0.390  1.00 47.22  ? 225  LEU B CG    1 
ATOM   949  C  CD1   . LEU A 1 162 ? -7.945  -12.176 0.172   1.00 46.48  ? 225  LEU B CD1   1 
ATOM   950  C  CD2   . LEU A 1 162 ? -9.736  -10.853 -0.750  1.00 43.34  ? 225  LEU B CD2   1 
ATOM   951  N  N     . VAL A 1 163 ? -9.999  -15.592 0.155   1.00 42.85  ? 226  VAL B N     1 
ATOM   952  C  CA    . VAL A 1 163 ? -11.056 -16.260 0.859   1.00 37.12  ? 226  VAL B CA    1 
ATOM   953  C  C     . VAL A 1 163 ? -11.436 -15.353 1.931   1.00 43.19  ? 226  VAL B C     1 
ATOM   954  O  O     . VAL A 1 163 ? -10.639 -15.050 2.720   1.00 41.58  ? 226  VAL B O     1 
ATOM   955  C  CB    . VAL A 1 163 ? -10.508 -17.442 1.617   1.00 36.65  ? 226  VAL B CB    1 
ATOM   956  C  CG1   . VAL A 1 163 ? -11.445 -17.866 2.687   1.00 36.95  ? 226  VAL B CG1   1 
ATOM   957  C  CG2   . VAL A 1 163 ? -10.259 -18.584 0.709   1.00 40.98  ? 226  VAL B CG2   1 
ATOM   958  N  N     . MET A 1 164 ? -12.673 -14.936 1.996   1.00 45.25  ? 227  MET B N     1 
ATOM   959  C  CA    . MET A 1 164 ? -13.055 -14.072 3.072   1.00 42.46  ? 227  MET B CA    1 
ATOM   960  C  C     . MET A 1 164 ? -14.384 -14.368 3.575   1.00 38.50  ? 227  MET B C     1 
ATOM   961  O  O     . MET A 1 164 ? -15.155 -15.035 2.982   1.00 38.15  ? 227  MET B O     1 
ATOM   962  C  CB    . MET A 1 164 ? -12.929 -12.590 2.767   1.00 35.78  ? 227  MET B CB    1 
ATOM   963  C  CG    . MET A 1 164 ? -13.286 -12.159 1.397   1.00 39.05  ? 227  MET B CG    1 
ATOM   964  S  SD    . MET A 1 164 ? -13.158 -10.419 1.381   1.00 42.83  ? 227  MET B SD    1 
ATOM   965  C  CE    . MET A 1 164 ? -13.024 -10.116 -0.316  1.00 36.31  ? 227  MET B CE    1 
ATOM   966  N  N     . THR A 1 165 ? -14.601 -13.903 4.759   1.00 35.25  ? 228  THR B N     1 
ATOM   967  C  CA    . THR A 1 165 ? -15.854 -14.038 5.375   1.00 38.57  ? 228  THR B CA    1 
ATOM   968  C  C     . THR A 1 165 ? -16.738 -13.101 4.672   1.00 39.70  ? 228  THR B C     1 
ATOM   969  O  O     . THR A 1 165 ? -16.385 -12.017 4.411   1.00 45.39  ? 228  THR B O     1 
ATOM   970  C  CB    . THR A 1 165 ? -15.781 -13.604 6.807   1.00 42.52  ? 228  THR B CB    1 
ATOM   971  O  OG1   . THR A 1 165 ? -14.697 -14.255 7.424   1.00 54.86  ? 228  THR B OG1   1 
ATOM   972  C  CG2   . THR A 1 165 ? -16.907 -14.094 7.476   1.00 48.34  ? 228  THR B CG2   1 
ATOM   973  N  N     . THR A 1 166 ? -17.971 -13.466 4.475   1.00 39.54  ? 229  THR B N     1 
ATOM   974  C  CA    . THR A 1 166 ? -18.873 -12.607 3.773   1.00 40.26  ? 229  THR B CA    1 
ATOM   975  C  C     . THR A 1 166 ? -19.123 -11.290 4.453   1.00 41.72  ? 229  THR B C     1 
ATOM   976  O  O     . THR A 1 166 ? -19.252 -10.308 3.819   1.00 48.37  ? 229  THR B O     1 
ATOM   977  C  CB    . THR A 1 166 ? -20.094 -13.326 3.222   1.00 41.15  ? 229  THR B CB    1 
ATOM   978  O  OG1   . THR A 1 166 ? -21.256 -12.630 3.584   1.00 38.92  ? 229  THR B OG1   1 
ATOM   979  C  CG2   . THR A 1 166 ? -20.191 -14.661 3.718   1.00 42.29  ? 229  THR B CG2   1 
ATOM   980  N  N     . GLU A 1 167 ? -19.161 -11.250 5.758   1.00 49.57  ? 230  GLU B N     1 
ATOM   981  C  CA    . GLU A 1 167 ? -19.325 -10.010 6.471   1.00 46.71  ? 230  GLU B CA    1 
ATOM   982  C  C     . GLU A 1 167 ? -18.178 -9.048  6.219   1.00 40.40  ? 230  GLU B C     1 
ATOM   983  O  O     . GLU A 1 167 ? -18.350 -7.881  6.217   1.00 42.60  ? 230  GLU B O     1 
ATOM   984  C  CB    . GLU A 1 167 ? -19.501 -10.278 7.941   1.00 44.25  ? 230  GLU B CB    1 
ATOM   985  C  CG    . GLU A 1 167 ? -18.548 -11.296 8.449   1.00 50.97  ? 230  GLU B CG    1 
ATOM   986  C  CD    . GLU A 1 167 ? -18.232 -11.097 9.874   1.00 60.60  ? 230  GLU B CD    1 
ATOM   987  O  OE1   . GLU A 1 167 ? -17.087 -11.327 10.272  1.00 59.65  ? 230  GLU B OE1   1 
ATOM   988  O  OE2   . GLU A 1 167 ? -19.140 -10.694 10.582  1.00 64.82  ? 230  GLU B OE2   1 
ATOM   989  N  N     . ILE A 1 168 ? -16.969 -9.528  6.090   1.00 39.03  ? 231  ILE B N     1 
ATOM   990  C  CA    . ILE A 1 168 ? -15.853 -8.687  5.741   1.00 39.38  ? 231  ILE B CA    1 
ATOM   991  C  C     . ILE A 1 168 ? -16.005 -8.144  4.355   1.00 37.83  ? 231  ILE B C     1 
ATOM   992  O  O     . ILE A 1 168 ? -15.599 -7.072  4.080   1.00 41.92  ? 231  ILE B O     1 
ATOM   993  C  CB    . ILE A 1 168 ? -14.521 -9.409  5.795   1.00 39.50  ? 231  ILE B CB    1 
ATOM   994  C  CG1   . ILE A 1 168 ? -14.079 -9.591  7.197   1.00 34.37  ? 231  ILE B CG1   1 
ATOM   995  C  CG2   . ILE A 1 168 ? -13.468 -8.527  5.214   1.00 40.15  ? 231  ILE B CG2   1 
ATOM   996  C  CD1   . ILE A 1 168 ? -13.745 -8.289  7.814   1.00 38.60  ? 231  ILE B CD1   1 
ATOM   997  N  N     . LEU A 1 169 ? -16.534 -8.938  3.457   1.00 37.99  ? 232  LEU B N     1 
ATOM   998  C  CA    . LEU A 1 169 ? -16.789 -8.552  2.104   1.00 41.10  ? 232  LEU B CA    1 
ATOM   999  C  C     . LEU A 1 169 ? -17.768 -7.434  2.041   1.00 41.96  ? 232  LEU B C     1 
ATOM   1000 O  O     . LEU A 1 169 ? -17.633 -6.573  1.246   1.00 38.97  ? 232  LEU B O     1 
ATOM   1001 C  CB    . LEU A 1 169 ? -17.309 -9.726  1.321   1.00 31.27  ? 232  LEU B CB    1 
ATOM   1002 C  CG    . LEU A 1 169 ? -17.641 -9.333  -0.079  1.00 32.49  ? 232  LEU B CG    1 
ATOM   1003 C  CD1   . LEU A 1 169 ? -16.456 -8.673  -0.668  1.00 28.91  ? 232  LEU B CD1   1 
ATOM   1004 C  CD2   . LEU A 1 169 ? -18.090 -10.462 -0.941  1.00 30.31  ? 232  LEU B CD2   1 
ATOM   1005 N  N     . ARG A 1 170 ? -18.782 -7.435  2.871   1.00 40.28  ? 233  ARG B N     1 
ATOM   1006 C  CA    . ARG A 1 170 ? -19.714 -6.352  2.849   1.00 40.28  ? 233  ARG B CA    1 
ATOM   1007 C  C     . ARG A 1 170 ? -19.057 -5.042  3.199   1.00 41.23  ? 233  ARG B C     1 
ATOM   1008 O  O     . ARG A 1 170 ? -19.378 -4.075  2.605   1.00 45.10  ? 233  ARG B O     1 
ATOM   1009 C  CB    . ARG A 1 170 ? -20.968 -6.645  3.669   1.00 43.07  ? 233  ARG B CB    1 
ATOM   1010 C  CG    . ARG A 1 170 ? -21.027 -6.118  5.079   1.00 45.47  ? 233  ARG B CG    1 
ATOM   1011 C  CD    . ARG A 1 170 ? -22.393 -5.602  5.444   1.00 42.06  ? 233  ARG B CD    1 
ATOM   1012 N  NE    . ARG A 1 170 ? -22.317 -4.439  6.292   1.00 42.77  ? 233  ARG B NE    1 
ATOM   1013 C  CZ    . ARG A 1 170 ? -23.318 -3.621  6.513   1.00 39.04  ? 233  ARG B CZ    1 
ATOM   1014 N  NH1   . ARG A 1 170 ? -24.474 -3.827  5.954   1.00 39.69  ? 233  ARG B NH1   1 
ATOM   1015 N  NH2   . ARG A 1 170 ? -23.157 -2.594  7.284   1.00 42.23  ? 233  ARG B NH2   1 
ATOM   1016 N  N     . SER A 1 171 ? -18.172 -5.014  4.175   1.00 42.99  ? 234  SER B N     1 
ATOM   1017 C  CA    . SER A 1 171 ? -17.462 -3.813  4.576   1.00 41.04  ? 234  SER B CA    1 
ATOM   1018 C  C     . SER A 1 171 ? -16.585 -3.344  3.486   1.00 39.14  ? 234  SER B C     1 
ATOM   1019 O  O     . SER A 1 171 ? -16.372 -2.211  3.350   1.00 40.57  ? 234  SER B O     1 
ATOM   1020 C  CB    . SER A 1 171 ? -16.643 -4.070  5.789   1.00 44.34  ? 234  SER B CB    1 
ATOM   1021 O  OG    . SER A 1 171 ? -15.634 -4.955  5.436   1.00 52.76  ? 234  SER B OG    1 
ATOM   1022 N  N     . MET A 1 172 ? -16.001 -4.260  2.758   1.00 39.50  ? 235  MET B N     1 
ATOM   1023 C  CA    . MET A 1 172 ? -15.159 -3.953  1.631   1.00 42.16  ? 235  MET B CA    1 
ATOM   1024 C  C     . MET A 1 172 ? -15.913 -3.288  0.550   1.00 43.29  ? 235  MET B C     1 
ATOM   1025 O  O     . MET A 1 172 ? -15.348 -2.569  -0.175  1.00 44.87  ? 235  MET B O     1 
ATOM   1026 C  CB    . MET A 1 172 ? -14.599 -5.196  1.009   1.00 45.84  ? 235  MET B CB    1 
ATOM   1027 C  CG    . MET A 1 172 ? -13.482 -5.863  1.741   1.00 49.13  ? 235  MET B CG    1 
ATOM   1028 S  SD    . MET A 1 172 ? -12.227 -4.755  2.274   1.00 68.98  ? 235  MET B SD    1 
ATOM   1029 C  CE    . MET A 1 172 ? -11.465 -5.773  3.512   1.00 63.33  ? 235  MET B CE    1 
ATOM   1030 N  N     . LEU A 1 173 ? -17.137 -3.703  0.310   1.00 41.75  ? 236  LEU B N     1 
ATOM   1031 C  CA    . LEU A 1 173 ? -17.988 -3.076  -0.662  1.00 36.28  ? 236  LEU B CA    1 
ATOM   1032 C  C     . LEU A 1 173 ? -18.327 -1.692  -0.238  1.00 40.07  ? 236  LEU B C     1 
ATOM   1033 O  O     . LEU A 1 173 ? -18.428 -0.839  -1.048  1.00 43.01  ? 236  LEU B O     1 
ATOM   1034 C  CB    . LEU A 1 173 ? -19.244 -3.857  -0.866  1.00 41.67  ? 236  LEU B CB    1 
ATOM   1035 C  CG    . LEU A 1 173 ? -19.281 -4.847  -1.996  1.00 38.31  ? 236  LEU B CG    1 
ATOM   1036 C  CD1   . LEU A 1 173 ? -18.091 -4.736  -2.867  1.00 28.04  ? 236  LEU B CD1   1 
ATOM   1037 C  CD2   . LEU A 1 173 ? -19.331 -6.208  -1.426  1.00 35.94  ? 236  LEU B CD2   1 
ATOM   1038 N  N     . TYR A 1 174 ? -18.567 -1.481  1.037   1.00 42.16  ? 237  TYR B N     1 
ATOM   1039 C  CA    . TYR A 1 174 ? -18.854 -0.153  1.588   1.00 40.91  ? 237  TYR B CA    1 
ATOM   1040 C  C     . TYR A 1 174 ? -17.741 0.861   1.546   1.00 42.80  ? 237  TYR B C     1 
ATOM   1041 O  O     . TYR A 1 174 ? -17.975 2.027   1.419   1.00 46.77  ? 237  TYR B O     1 
ATOM   1042 C  CB    . TYR A 1 174 ? -19.425 -0.244  2.968   1.00 35.64  ? 237  TYR B CB    1 
ATOM   1043 C  CG    . TYR A 1 174 ? -20.842 -0.581  2.909   1.00 33.86  ? 237  TYR B CG    1 
ATOM   1044 C  CD1   . TYR A 1 174 ? -21.686 0.132   2.154   1.00 34.64  ? 237  TYR B CD1   1 
ATOM   1045 C  CD2   . TYR A 1 174 ? -21.317 -1.623  3.581   1.00 39.42  ? 237  TYR B CD2   1 
ATOM   1046 C  CE1   . TYR A 1 174 ? -22.989 -0.194  2.078   1.00 35.56  ? 237  TYR B CE1   1 
ATOM   1047 C  CE2   . TYR A 1 174 ? -22.620 -1.956  3.508   1.00 41.75  ? 237  TYR B CE2   1 
ATOM   1048 C  CZ    . TYR A 1 174 ? -23.438 -1.233  2.757   1.00 37.14  ? 237  TYR B CZ    1 
ATOM   1049 O  OH    . TYR A 1 174 ? -24.707 -1.625  2.737   1.00 34.92  ? 237  TYR B OH    1 
ATOM   1050 N  N     . ARG A 1 175 ? -16.532 0.392   1.770   1.00 45.63  ? 238  ARG B N     1 
ATOM   1051 C  CA    . ARG A 1 175 ? -15.332 1.160   1.697   1.00 46.07  ? 238  ARG B CA    1 
ATOM   1052 C  C     . ARG A 1 175 ? -15.076 1.572   0.278   1.00 50.80  ? 238  ARG B C     1 
ATOM   1053 O  O     . ARG A 1 175 ? -14.648 2.648   0.016   1.00 59.22  ? 238  ARG B O     1 
ATOM   1054 C  CB    . ARG A 1 175 ? -14.179 0.367   2.245   1.00 43.21  ? 238  ARG B CB    1 
ATOM   1055 C  CG    . ARG A 1 175 ? -14.229 0.158   3.726   1.00 44.73  ? 238  ARG B CG    1 
ATOM   1056 C  CD    . ARG A 1 175 ? -13.383 1.171   4.457   1.00 57.37  ? 238  ARG B CD    1 
ATOM   1057 N  N     . GLY A 1 176 ? -15.387 0.708   -0.655  1.00 49.25  ? 239  GLY B N     1 
ATOM   1058 C  CA    . GLY A 1 176 ? -15.147 0.973   -2.048  1.00 61.65  ? 239  GLY B CA    1 
ATOM   1059 C  C     . GLY A 1 176 ? -13.789 0.527   -2.466  1.00 61.09  ? 239  GLY B C     1 
ATOM   1060 O  O     . GLY A 1 176 ? -13.295 0.930   -3.477  1.00 70.69  ? 239  GLY B O     1 
ATOM   1061 N  N     . SER A 1 177 ? -13.264 -0.417  -1.725  1.00 57.85  ? 240  SER B N     1 
ATOM   1062 C  CA    . SER A 1 177 ? -11.910 -0.900  -1.861  1.00 70.21  ? 240  SER B CA    1 
ATOM   1063 C  C     . SER A 1 177 ? -11.424 -1.529  -3.160  1.00 69.87  ? 240  SER B C     1 
ATOM   1064 O  O     . SER A 1 177 ? -12.164 -1.987  -4.002  1.00 61.52  ? 240  SER B O     1 
ATOM   1065 C  CB    . SER A 1 177 ? -11.607 -1.858  -0.709  1.00 53.13  ? 240  SER B CB    1 
ATOM   1066 N  N     . GLU A 1 178 ? -10.112 -1.453  -3.290  1.00 67.52  ? 241  GLU B N     1 
ATOM   1067 C  CA    . GLU A 1 178 ? -9.343  -1.947  -4.395  1.00 74.59  ? 241  GLU B CA    1 
ATOM   1068 C  C     . GLU A 1 178 ? -9.378  -3.435  -4.560  1.00 77.85  ? 241  GLU B C     1 
ATOM   1069 O  O     . GLU A 1 178 ? -9.214  -3.923  -5.650  1.00 76.98  ? 241  GLU B O     1 
ATOM   1070 C  CB    . GLU A 1 178 ? -7.897  -1.481  -4.296  1.00 70.24  ? 241  GLU B CB    1 
ATOM   1071 C  CG    . GLU A 1 178 ? -7.618  -0.172  -5.010  1.00 73.06  ? 241  GLU B CG    1 
ATOM   1072 C  CD    . GLU A 1 178 ? -8.159  -0.141  -6.402  1.00 61.65  ? 241  GLU B CD    1 
ATOM   1073 O  OE1   . GLU A 1 178 ? -8.661  0.889   -6.801  1.00 65.12  ? 241  GLU B OE1   1 
ATOM   1074 O  OE2   . GLU A 1 178 ? -8.092  -1.139  -7.101  1.00 69.36  ? 241  GLU B OE2   1 
ATOM   1075 N  N     . VAL A 1 179 ? -9.625  -4.183  -3.502  1.00 77.47  ? 242  VAL B N     1 
ATOM   1076 C  CA    . VAL A 1 179 ? -9.645  -5.619  -3.630  1.00 76.57  ? 242  VAL B CA    1 
ATOM   1077 C  C     . VAL A 1 179 ? -10.679 -6.112  -4.593  1.00 70.53  ? 242  VAL B C     1 
ATOM   1078 O  O     . VAL A 1 179 ? -10.429 -7.042  -5.274  1.00 79.77  ? 242  VAL B O     1 
ATOM   1079 C  CB    . VAL A 1 179 ? -9.657  -6.386  -2.322  1.00 71.90  ? 242  VAL B CB    1 
ATOM   1080 C  CG1   . VAL A 1 179 ? -9.815  -7.854  -2.632  1.00 63.54  ? 242  VAL B CG1   1 
ATOM   1081 C  CG2   . VAL A 1 179 ? -8.338  -6.169  -1.608  1.00 66.63  ? 242  VAL B CG2   1 
ATOM   1082 N  N     . MET A 1 180 ? -11.831 -5.504  -4.700  1.00 61.27  ? 243  MET B N     1 
ATOM   1083 C  CA    . MET A 1 180 ? -12.769 -5.913  -5.697  1.00 62.97  ? 243  MET B CA    1 
ATOM   1084 C  C     . MET A 1 180 ? -12.420 -5.571  -7.136  1.00 69.60  ? 243  MET B C     1 
ATOM   1085 O  O     . MET A 1 180 ? -13.006 -6.111  -8.041  1.00 71.85  ? 243  MET B O     1 
ATOM   1086 C  CB    . MET A 1 180 ? -14.087 -5.283  -5.402  1.00 67.59  ? 243  MET B CB    1 
ATOM   1087 C  CG    . MET A 1 180 ? -15.103 -5.465  -6.483  1.00 56.27  ? 243  MET B CG    1 
ATOM   1088 S  SD    . MET A 1 180 ? -16.038 -6.934  -6.261  1.00 58.92  ? 243  MET B SD    1 
ATOM   1089 C  CE    . MET A 1 180 ? -14.864 -7.915  -5.418  1.00 59.05  ? 243  MET B CE    1 
ATOM   1090 N  N     . ARG A 1 181 ? -11.440 -4.727  -7.385  1.00 79.57  ? 244  ARG B N     1 
ATOM   1091 C  CA    . ARG A 1 181 ? -11.147 -4.270  -8.738  1.00 80.51  ? 244  ARG B CA    1 
ATOM   1092 C  C     . ARG A 1 181 ? -10.831 -5.262  -9.860  1.00 74.48  ? 244  ARG B C     1 
ATOM   1093 O  O     . ARG A 1 181 ? -11.249 -5.031  -10.982 1.00 75.86  ? 244  ARG B O     1 
ATOM   1094 C  CB    . ARG A 1 181 ? -10.057 -3.194  -8.668  1.00 74.87  ? 244  ARG B CB    1 
ATOM   1095 N  N     . GLU A 1 182 ? -10.082 -6.314  -9.621  1.00 67.55  ? 245  GLU B N     1 
ATOM   1096 C  CA    . GLU A 1 182 ? -9.846  -7.245  -10.719 1.00 69.26  ? 245  GLU B CA    1 
ATOM   1097 C  C     . GLU A 1 182 ? -10.676 -8.519  -10.584 1.00 60.72  ? 245  GLU B C     1 
ATOM   1098 O  O     . GLU A 1 182 ? -10.423 -9.515  -11.196 1.00 50.66  ? 245  GLU B O     1 
ATOM   1099 C  CB    . GLU A 1 182 ? -8.354  -7.516  -10.936 1.00 53.70  ? 245  GLU B CB    1 
ATOM   1100 N  N     . VAL A 1 183 ? -11.670 -8.480  -9.739  1.00 57.72  ? 246  VAL B N     1 
ATOM   1101 C  CA    . VAL A 1 183 ? -12.457 -9.647  -9.523  1.00 49.41  ? 246  VAL B CA    1 
ATOM   1102 C  C     . VAL A 1 183 ? -13.492 -9.915  -10.560 1.00 47.73  ? 246  VAL B C     1 
ATOM   1103 O  O     . VAL A 1 183 ? -14.278 -9.075  -10.877 1.00 45.76  ? 246  VAL B O     1 
ATOM   1104 C  CB    . VAL A 1 183 ? -13.109 -9.540  -8.161  1.00 47.29  ? 246  VAL B CB    1 
ATOM   1105 C  CG1   . VAL A 1 183 ? -14.170 -10.574 -7.961  1.00 44.15  ? 246  VAL B CG1   1 
ATOM   1106 C  CG2   . VAL A 1 183 ? -12.062 -9.705  -7.112  1.00 56.01  ? 246  VAL B CG2   1 
ATOM   1107 N  N     . ALA A 1 184 ? -13.467 -11.127 -11.075 1.00 44.30  ? 247  ALA B N     1 
ATOM   1108 C  CA    . ALA A 1 184 ? -14.416 -11.582 -12.036 1.00 34.99  ? 247  ALA B CA    1 
ATOM   1109 C  C     . ALA A 1 184 ? -15.442 -12.545 -11.490 1.00 39.15  ? 247  ALA B C     1 
ATOM   1110 O  O     . ALA A 1 184 ? -16.505 -12.594 -12.001 1.00 42.31  ? 247  ALA B O     1 
ATOM   1111 C  CB    . ALA A 1 184 ? -13.688 -12.233 -13.169 1.00 31.51  ? 247  ALA B CB    1 
ATOM   1112 N  N     . TRP A 1 185 ? -15.104 -13.319 -10.472 1.00 35.16  ? 248  TRP B N     1 
ATOM   1113 C  CA    . TRP A 1 185 ? -15.975 -14.303 -9.873  1.00 31.10  ? 248  TRP B CA    1 
ATOM   1114 C  C     . TRP A 1 185 ? -15.973 -14.261 -8.379  1.00 40.02  ? 248  TRP B C     1 
ATOM   1115 O  O     . TRP A 1 185 ? -14.964 -14.113 -7.803  1.00 46.00  ? 248  TRP B O     1 
ATOM   1116 C  CB    . TRP A 1 185 ? -15.509 -15.695 -10.233 1.00 33.96  ? 248  TRP B CB    1 
ATOM   1117 C  CG    . TRP A 1 185 ? -15.735 -16.093 -11.594 1.00 36.39  ? 248  TRP B CG    1 
ATOM   1118 C  CD1   . TRP A 1 185 ? -15.023 -15.768 -12.616 1.00 37.72  ? 248  TRP B CD1   1 
ATOM   1119 C  CD2   . TRP A 1 185 ? -16.746 -16.932 -12.072 1.00 34.14  ? 248  TRP B CD2   1 
ATOM   1120 N  NE1   . TRP A 1 185 ? -15.508 -16.288 -13.729 1.00 39.85  ? 248  TRP B NE1   1 
ATOM   1121 C  CE2   . TRP A 1 185 ? -16.586 -17.034 -13.407 1.00 35.70  ? 248  TRP B CE2   1 
ATOM   1122 C  CE3   . TRP A 1 185 ? -17.805 -17.574 -11.493 1.00 38.20  ? 248  TRP B CE3   1 
ATOM   1123 C  CZ2   . TRP A 1 185 ? -17.424 -17.757 -14.179 1.00 39.96  ? 248  TRP B CZ2   1 
ATOM   1124 C  CZ3   . TRP A 1 185 ? -18.614 -18.262 -12.250 1.00 39.61  ? 248  TRP B CZ3   1 
ATOM   1125 C  CH2   . TRP A 1 185 ? -18.435 -18.361 -13.567 1.00 37.65  ? 248  TRP B CH2   1 
ATOM   1126 N  N     . VAL A 1 186 ? -17.115 -14.449 -7.751  1.00 38.74  ? 249  VAL B N     1 
ATOM   1127 C  CA    . VAL A 1 186 ? -17.252 -14.488 -6.315  1.00 33.79  ? 249  VAL B CA    1 
ATOM   1128 C  C     . VAL A 1 186 ? -17.941 -15.782 -6.001  1.00 30.76  ? 249  VAL B C     1 
ATOM   1129 O  O     . VAL A 1 186 ? -18.814 -16.149 -6.672  1.00 30.07  ? 249  VAL B O     1 
ATOM   1130 C  CB    . VAL A 1 186 ? -18.101 -13.335 -5.833  1.00 30.00  ? 249  VAL B CB    1 
ATOM   1131 C  CG1   . VAL A 1 186 ? -18.192 -13.296 -4.343  1.00 27.28  ? 249  VAL B CG1   1 
ATOM   1132 C  CG2   . VAL A 1 186 ? -17.488 -12.070 -6.269  1.00 30.19  ? 249  VAL B CG2   1 
ATOM   1133 N  N     . ILE A 1 187 ? -17.542 -16.479 -4.971  1.00 25.17  ? 250  ILE B N     1 
ATOM   1134 C  CA    . ILE A 1 187 ? -18.146 -17.736 -4.651  1.00 26.28  ? 250  ILE B CA    1 
ATOM   1135 C  C     . ILE A 1 187 ? -18.798 -17.589 -3.324  1.00 28.45  ? 250  ILE B C     1 
ATOM   1136 O  O     . ILE A 1 187 ? -18.261 -16.994 -2.488  1.00 32.39  ? 250  ILE B O     1 
ATOM   1137 C  CB    . ILE A 1 187 ? -17.099 -18.864 -4.666  1.00 29.30  ? 250  ILE B CB    1 
ATOM   1138 C  CG1   . ILE A 1 187 ? -16.650 -19.106 -6.069  1.00 31.26  ? 250  ILE B CG1   1 
ATOM   1139 C  CG2   . ILE A 1 187 ? -17.691 -20.194 -4.316  1.00 23.16  ? 250  ILE B CG2   1 
ATOM   1140 C  CD1   . ILE A 1 187 ? -15.185 -19.070 -6.261  1.00 32.51  ? 250  ILE B CD1   1 
ATOM   1141 N  N     . PHE A 1 188 ? -20.025 -18.032 -3.174  1.00 28.68  ? 251  PHE B N     1 
ATOM   1142 C  CA    . PHE A 1 188 ? -20.680 -17.979 -1.906  1.00 28.48  ? 251  PHE B CA    1 
ATOM   1143 C  C     . PHE A 1 188 ? -20.891 -19.385 -1.497  1.00 30.79  ? 251  PHE B C     1 
ATOM   1144 O  O     . PHE A 1 188 ? -21.697 -20.034 -2.011  1.00 26.84  ? 251  PHE B O     1 
ATOM   1145 C  CB    . PHE A 1 188 ? -22.027 -17.358 -2.032  1.00 22.89  ? 251  PHE B CB    1 
ATOM   1146 C  CG    . PHE A 1 188 ? -22.002 -15.901 -2.161  1.00 24.33  ? 251  PHE B CG    1 
ATOM   1147 C  CD1   . PHE A 1 188 ? -21.845 -15.335 -3.351  1.00 28.11  ? 251  PHE B CD1   1 
ATOM   1148 C  CD2   . PHE A 1 188 ? -22.167 -15.121 -1.094  1.00 25.42  ? 251  PHE B CD2   1 
ATOM   1149 C  CE1   . PHE A 1 188 ? -21.832 -14.001 -3.486  1.00 28.07  ? 251  PHE B CE1   1 
ATOM   1150 C  CE2   . PHE A 1 188 ? -22.150 -13.781 -1.205  1.00 22.76  ? 251  PHE B CE2   1 
ATOM   1151 C  CZ    . PHE A 1 188 ? -21.983 -13.221 -2.406  1.00 27.44  ? 251  PHE B CZ    1 
ATOM   1152 N  N     . ASP A 1 189 ? -20.206 -19.814 -0.475  1.00 37.77  ? 252  ASP B N     1 
ATOM   1153 C  CA    . ASP A 1 189 ? -20.321 -21.157 -0.013  1.00 34.22  ? 252  ASP B CA    1 
ATOM   1154 C  C     . ASP A 1 189 ? -21.259 -21.160 1.118   1.00 37.70  ? 252  ASP B C     1 
ATOM   1155 O  O     . ASP A 1 189 ? -21.274 -20.262 1.891   1.00 37.43  ? 252  ASP B O     1 
ATOM   1156 C  CB    . ASP A 1 189 ? -18.989 -21.709 0.440   1.00 34.28  ? 252  ASP B CB    1 
ATOM   1157 C  CG    . ASP A 1 189 ? -18.995 -23.198 0.578   1.00 46.53  ? 252  ASP B CG    1 
ATOM   1158 O  OD1   . ASP A 1 189 ? -19.375 -23.871 -0.356  1.00 46.09  ? 252  ASP B OD1   1 
ATOM   1159 O  OD2   . ASP A 1 189 ? -18.638 -23.724 1.617   1.00 48.30  ? 252  ASP B OD2   1 
ATOM   1160 N  N     . GLU A 1 190 ? -22.030 -22.222 1.188   1.00 31.68  ? 253  GLU B N     1 
ATOM   1161 C  CA    . GLU A 1 190 ? -23.046 -22.459 2.157   1.00 36.62  ? 253  GLU B CA    1 
ATOM   1162 C  C     . GLU A 1 190 ? -23.985 -21.323 2.164   1.00 39.14  ? 253  GLU B C     1 
ATOM   1163 O  O     . GLU A 1 190 ? -24.378 -20.838 3.170   1.00 42.67  ? 253  GLU B O     1 
ATOM   1164 C  CB    . GLU A 1 190 ? -22.481 -22.764 3.517   1.00 39.67  ? 253  GLU B CB    1 
ATOM   1165 C  CG    . GLU A 1 190 ? -21.609 -23.980 3.550   1.00 33.22  ? 253  GLU B CG    1 
ATOM   1166 C  CD    . GLU A 1 190 ? -22.358 -25.252 3.631   1.00 39.67  ? 253  GLU B CD    1 
ATOM   1167 O  OE1   . GLU A 1 190 ? -22.530 -25.911 2.619   1.00 52.11  ? 253  GLU B OE1   1 
ATOM   1168 O  OE2   . GLU A 1 190 ? -22.726 -25.631 4.710   1.00 38.54  ? 253  GLU B OE2   1 
ATOM   1169 N  N     . ILE A 1 191 ? -24.498 -20.999 1.000   1.00 34.44  ? 254  ILE B N     1 
ATOM   1170 C  CA    . ILE A 1 191 ? -25.393 -19.896 0.775   1.00 32.81  ? 254  ILE B CA    1 
ATOM   1171 C  C     . ILE A 1 191 ? -26.722 -19.939 1.444   1.00 37.93  ? 254  ILE B C     1 
ATOM   1172 O  O     . ILE A 1 191 ? -27.307 -18.941 1.651   1.00 41.26  ? 254  ILE B O     1 
ATOM   1173 C  CB    . ILE A 1 191 ? -25.614 -19.699 -0.683  1.00 32.40  ? 254  ILE B CB    1 
ATOM   1174 C  CG1   . ILE A 1 191 ? -26.426 -18.469 -0.861  1.00 35.14  ? 254  ILE B CG1   1 
ATOM   1175 C  CG2   . ILE A 1 191 ? -26.326 -20.871 -1.262  1.00 29.81  ? 254  ILE B CG2   1 
ATOM   1176 C  CD1   . ILE A 1 191 ? -25.856 -17.307 -0.143  1.00 38.00  ? 254  ILE B CD1   1 
ATOM   1177 N  N     . HIS A 1 192 ? -27.149 -21.108 1.871   1.00 37.83  ? 255  HIS B N     1 
ATOM   1178 C  CA    . HIS A 1 192 ? -28.376 -21.421 2.555   1.00 42.02  ? 255  HIS B CA    1 
ATOM   1179 C  C     . HIS A 1 192 ? -28.458 -21.020 3.993   1.00 48.09  ? 255  HIS B C     1 
ATOM   1180 O  O     . HIS A 1 192 ? -29.427 -21.276 4.619   1.00 50.19  ? 255  HIS B O     1 
ATOM   1181 C  CB    . HIS A 1 192 ? -28.658 -22.883 2.481   1.00 33.24  ? 255  HIS B CB    1 
ATOM   1182 C  CG    . HIS A 1 192 ? -27.588 -23.718 3.055   1.00 39.35  ? 255  HIS B CG    1 
ATOM   1183 N  ND1   . HIS A 1 192 ? -27.681 -24.291 4.290   1.00 47.84  ? 255  HIS B ND1   1 
ATOM   1184 C  CD2   . HIS A 1 192 ? -26.401 -24.095 2.559   1.00 42.12  ? 255  HIS B CD2   1 
ATOM   1185 C  CE1   . HIS A 1 192 ? -26.589 -24.970 4.541   1.00 40.99  ? 255  HIS B CE1   1 
ATOM   1186 N  NE2   . HIS A 1 192 ? -25.806 -24.881 3.497   1.00 38.83  ? 255  HIS B NE2   1 
ATOM   1187 N  N     . TYR A 1 193 ? -27.422 -20.395 4.534   1.00 48.55  ? 256  TYR B N     1 
ATOM   1188 C  CA    . TYR A 1 193 ? -27.431 -19.806 5.842   1.00 55.31  ? 256  TYR B CA    1 
ATOM   1189 C  C     . TYR A 1 193 ? -27.938 -18.378 5.735   1.00 55.92  ? 256  TYR B C     1 
ATOM   1190 O  O     . TYR A 1 193 ? -27.942 -17.704 6.700   1.00 62.41  ? 256  TYR B O     1 
ATOM   1191 C  CB    . TYR A 1 193 ? -26.060 -19.629 6.416   1.00 53.89  ? 256  TYR B CB    1 
ATOM   1192 C  CG    . TYR A 1 193 ? -25.367 -20.800 7.004   1.00 52.29  ? 256  TYR B CG    1 
ATOM   1193 C  CD1   . TYR A 1 193 ? -25.340 -21.962 6.362   1.00 49.26  ? 256  TYR B CD1   1 
ATOM   1194 C  CD2   . TYR A 1 193 ? -24.633 -20.682 8.154   1.00 52.37  ? 256  TYR B CD2   1 
ATOM   1195 C  CE1   . TYR A 1 193 ? -24.664 -23.013 6.868   1.00 52.07  ? 256  TYR B CE1   1 
ATOM   1196 C  CE2   . TYR A 1 193 ? -23.942 -21.732 8.662   1.00 48.36  ? 256  TYR B CE2   1 
ATOM   1197 C  CZ    . TYR A 1 193 ? -23.966 -22.897 7.986   1.00 57.57  ? 256  TYR B CZ    1 
ATOM   1198 O  OH    . TYR A 1 193 ? -23.300 -24.009 8.394   1.00 65.20  ? 256  TYR B OH    1 
ATOM   1199 N  N     . MET A 1 194 ? -28.327 -17.901 4.562   1.00 48.31  ? 257  MET B N     1 
ATOM   1200 C  CA    . MET A 1 194 ? -28.892 -16.613 4.258   1.00 52.66  ? 257  MET B CA    1 
ATOM   1201 C  C     . MET A 1 194 ? -30.230 -16.436 4.911   1.00 58.65  ? 257  MET B C     1 
ATOM   1202 O  O     . MET A 1 194 ? -30.638 -15.331 5.064   1.00 63.65  ? 257  MET B O     1 
ATOM   1203 C  CB    . MET A 1 194 ? -29.040 -16.461 2.749   1.00 46.62  ? 257  MET B CB    1 
ATOM   1204 C  CG    . MET A 1 194 ? -28.920 -15.084 2.163   1.00 39.53  ? 257  MET B CG    1 
ATOM   1205 S  SD    . MET A 1 194 ? -29.680 -15.031 0.577   1.00 49.66  ? 257  MET B SD    1 
ATOM   1206 C  CE    . MET A 1 194 ? -28.513 -14.100 -0.278  1.00 33.37  ? 257  MET B CE    1 
ATOM   1207 N  N     . ARG A 1 195 ? -30.965 -17.506 5.203   1.00 49.00  ? 258  ARG B N     1 
ATOM   1208 C  CA    . ARG A 1 195 ? -32.235 -17.436 5.889   1.00 50.77  ? 258  ARG B CA    1 
ATOM   1209 C  C     . ARG A 1 195 ? -32.122 -17.198 7.377   1.00 60.07  ? 258  ARG B C     1 
ATOM   1210 O  O     . ARG A 1 195 ? -33.114 -16.919 8.002   1.00 64.19  ? 258  ARG B O     1 
ATOM   1211 C  CB    . ARG A 1 195 ? -33.078 -18.649 5.622   1.00 48.51  ? 258  ARG B CB    1 
ATOM   1212 C  CG    . ARG A 1 195 ? -32.507 -19.899 6.197   1.00 49.46  ? 258  ARG B CG    1 
ATOM   1213 C  CD    . ARG A 1 195 ? -33.026 -21.087 5.431   1.00 48.88  ? 258  ARG B CD    1 
ATOM   1214 N  NE    . ARG A 1 195 ? -31.956 -22.045 5.217   1.00 55.11  ? 258  ARG B NE    1 
ATOM   1215 C  CZ    . ARG A 1 195 ? -32.037 -23.184 4.556   1.00 48.68  ? 258  ARG B CZ    1 
ATOM   1216 N  NH1   . ARG A 1 195 ? -33.135 -23.600 4.009   1.00 43.48  ? 258  ARG B NH1   1 
ATOM   1217 N  NH2   . ARG A 1 195 ? -30.993 -23.935 4.467   1.00 49.94  ? 258  ARG B NH2   1 
ATOM   1218 N  N     . ASP A 1 196 ? -30.911 -17.274 7.918   1.00 62.86  ? 259  ASP B N     1 
ATOM   1219 C  CA    . ASP A 1 196 ? -30.642 -17.047 9.331   1.00 59.38  ? 259  ASP B CA    1 
ATOM   1220 C  C     . ASP A 1 196 ? -31.064 -15.659 9.589   1.00 63.05  ? 259  ASP B C     1 
ATOM   1221 O  O     . ASP A 1 196 ? -30.762 -14.810 8.828   1.00 68.25  ? 259  ASP B O     1 
ATOM   1222 C  CB    . ASP A 1 196 ? -29.150 -17.122 9.570   1.00 56.21  ? 259  ASP B CB    1 
ATOM   1223 C  CG    . ASP A 1 196 ? -28.740 -16.692 10.970  1.00 69.58  ? 259  ASP B CG    1 
ATOM   1224 O  OD1   . ASP A 1 196 ? -29.205 -15.701 11.509  1.00 66.54  ? 259  ASP B OD1   1 
ATOM   1225 O  OD2   . ASP A 1 196 ? -27.887 -17.336 11.559  1.00 79.39  ? 259  ASP B OD2   1 
ATOM   1226 N  N     . SER A 1 197 ? -31.708 -15.400 10.703  1.00 57.70  ? 260  SER B N     1 
ATOM   1227 C  CA    . SER A 1 197 ? -32.191 -14.068 10.985  1.00 64.81  ? 260  SER B CA    1 
ATOM   1228 C  C     . SER A 1 197 ? -31.243 -12.891 11.193  1.00 69.20  ? 260  SER B C     1 
ATOM   1229 O  O     . SER A 1 197 ? -31.414 -11.842 10.613  1.00 59.81  ? 260  SER B O     1 
ATOM   1230 C  CB    . SER A 1 197 ? -33.010 -14.193 12.242  1.00 63.86  ? 260  SER B CB    1 
ATOM   1231 O  OG    . SER A 1 197 ? -32.225 -14.819 13.223  1.00 70.85  ? 260  SER B OG    1 
ATOM   1232 N  N     . GLU A 1 198 ? -30.251 -13.061 12.040  1.00 72.51  ? 261  GLU B N     1 
ATOM   1233 C  CA    . GLU A 1 198 ? -29.293 -11.998 12.294  1.00 67.62  ? 261  GLU B CA    1 
ATOM   1234 C  C     . GLU A 1 198 ? -28.292 -11.652 11.212  1.00 65.75  ? 261  GLU B C     1 
ATOM   1235 O  O     . GLU A 1 198 ? -28.118 -10.509 10.884  1.00 62.99  ? 261  GLU B O     1 
ATOM   1236 C  CB    . GLU A 1 198 ? -28.529 -12.304 13.573  1.00 67.95  ? 261  GLU B CB    1 
ATOM   1237 N  N     . ARG A 1 199 ? -27.660 -12.660 10.639  1.00 65.42  ? 262  ARG B N     1 
ATOM   1238 C  CA    . ARG A 1 199 ? -26.626 -12.420 9.657   1.00 65.60  ? 262  ARG B CA    1 
ATOM   1239 C  C     . ARG A 1 199 ? -27.025 -12.675 8.258   1.00 58.15  ? 262  ARG B C     1 
ATOM   1240 O  O     . ARG A 1 199 ? -26.271 -12.514 7.352   1.00 57.92  ? 262  ARG B O     1 
ATOM   1241 C  CB    . ARG A 1 199 ? -25.395 -13.248 9.984   1.00 70.24  ? 262  ARG B CB    1 
ATOM   1242 C  CG    . ARG A 1 199 ? -24.106 -12.453 9.976   1.00 63.83  ? 262  ARG B CG    1 
ATOM   1243 C  CD    . ARG A 1 199 ? -22.913 -13.360 9.828   1.00 72.27  ? 262  ARG B CD    1 
ATOM   1244 N  NE    . ARG A 1 199 ? -22.496 -13.489 8.444   1.00 68.76  ? 262  ARG B NE    1 
ATOM   1245 N  N     . GLY A 1 200 ? -28.257 -13.044 8.084   1.00 52.88  ? 263  GLY B N     1 
ATOM   1246 C  CA    . GLY A 1 200 ? -28.769 -13.332 6.782   1.00 56.18  ? 263  GLY B CA    1 
ATOM   1247 C  C     . GLY A 1 200 ? -28.780 -12.179 5.845   1.00 52.06  ? 263  GLY B C     1 
ATOM   1248 O  O     . GLY A 1 200 ? -28.616 -12.331 4.686   1.00 48.86  ? 263  GLY B O     1 
ATOM   1249 N  N     . VAL A 1 201 ? -29.052 -11.013 6.368   1.00 53.00  ? 264  VAL B N     1 
ATOM   1250 C  CA    . VAL A 1 201 ? -29.123 -9.806  5.604   1.00 43.52  ? 264  VAL B CA    1 
ATOM   1251 C  C     . VAL A 1 201 ? -27.862 -9.434  4.947   1.00 47.42  ? 264  VAL B C     1 
ATOM   1252 O  O     . VAL A 1 201 ? -27.914 -8.820  3.948   1.00 47.93  ? 264  VAL B O     1 
ATOM   1253 C  CB    . VAL A 1 201 ? -29.611 -8.631  6.419   1.00 44.39  ? 264  VAL B CB    1 
ATOM   1254 C  CG1   . VAL A 1 201 ? -28.825 -8.469  7.670   1.00 51.46  ? 264  VAL B CG1   1 
ATOM   1255 C  CG2   . VAL A 1 201 ? -29.467 -7.390  5.629   1.00 52.90  ? 264  VAL B CG2   1 
ATOM   1256 N  N     . VAL A 1 202 ? -26.725 -9.705  5.546   1.00 48.67  ? 265  VAL B N     1 
ATOM   1257 C  CA    . VAL A 1 202 ? -25.449 -9.401  4.958   1.00 49.51  ? 265  VAL B CA    1 
ATOM   1258 C  C     . VAL A 1 202 ? -25.152 -10.146 3.709   1.00 42.19  ? 265  VAL B C     1 
ATOM   1259 O  O     . VAL A 1 202 ? -24.402 -9.689  2.923   1.00 41.58  ? 265  VAL B O     1 
ATOM   1260 C  CB    . VAL A 1 202 ? -24.298 -9.419  5.947   1.00 45.49  ? 265  VAL B CB    1 
ATOM   1261 C  CG1   . VAL A 1 202 ? -24.788 -9.661  7.334   1.00 53.13  ? 265  VAL B CG1   1 
ATOM   1262 C  CG2   . VAL A 1 202 ? -23.235 -10.380 5.541   1.00 44.70  ? 265  VAL B CG2   1 
ATOM   1263 N  N     . TRP A 1 203 ? -25.626 -11.349 3.577   1.00 40.85  ? 266  TRP B N     1 
ATOM   1264 C  CA    . TRP A 1 203 ? -25.438 -12.045 2.358   1.00 40.93  ? 266  TRP B CA    1 
ATOM   1265 C  C     . TRP A 1 203 ? -26.152 -11.355 1.243   1.00 41.43  ? 266  TRP B C     1 
ATOM   1266 O  O     . TRP A 1 203 ? -25.634 -11.241 0.185   1.00 39.10  ? 266  TRP B O     1 
ATOM   1267 C  CB    . TRP A 1 203 ? -26.052 -13.395 2.510   1.00 44.08  ? 266  TRP B CB    1 
ATOM   1268 C  CG    . TRP A 1 203 ? -25.343 -14.221 3.419   1.00 54.83  ? 266  TRP B CG    1 
ATOM   1269 C  CD1   . TRP A 1 203 ? -25.431 -14.232 4.766   1.00 60.56  ? 266  TRP B CD1   1 
ATOM   1270 C  CD2   . TRP A 1 203 ? -24.408 -15.201 3.069   1.00 53.74  ? 266  TRP B CD2   1 
ATOM   1271 N  NE1   . TRP A 1 203 ? -24.592 -15.171 5.285   1.00 60.88  ? 266  TRP B NE1   1 
ATOM   1272 C  CE2   . TRP A 1 203 ? -23.951 -15.779 4.245   1.00 56.26  ? 266  TRP B CE2   1 
ATOM   1273 C  CE3   . TRP A 1 203 ? -23.905 -15.646 1.869   1.00 46.08  ? 266  TRP B CE3   1 
ATOM   1274 C  CZ2   . TRP A 1 203 ? -23.034 -16.759 4.246   1.00 48.83  ? 266  TRP B CZ2   1 
ATOM   1275 C  CZ3   . TRP A 1 203 ? -22.990 -16.620 1.880   1.00 50.11  ? 266  TRP B CZ3   1 
ATOM   1276 C  CH2   . TRP A 1 203 ? -22.561 -17.169 3.043   1.00 51.33  ? 266  TRP B CH2   1 
ATOM   1277 N  N     . GLU A 1 204 ? -27.382 -10.939 1.487   1.00 35.88  ? 267  GLU B N     1 
ATOM   1278 C  CA    . GLU A 1 204 ? -28.195 -10.265 0.527   1.00 29.49  ? 267  GLU B CA    1 
ATOM   1279 C  C     . GLU A 1 204 ? -27.653 -8.937  0.176   1.00 40.32  ? 267  GLU B C     1 
ATOM   1280 O  O     . GLU A 1 204 ? -27.615 -8.541  -0.936  1.00 39.21  ? 267  GLU B O     1 
ATOM   1281 C  CB    . GLU A 1 204 ? -29.548 -10.059 1.090   1.00 23.36  ? 267  GLU B CB    1 
ATOM   1282 C  CG    . GLU A 1 204 ? -30.504 -11.160 0.870   1.00 29.55  ? 267  GLU B CG    1 
ATOM   1283 C  CD    . GLU A 1 204 ? -31.909 -10.721 1.003   1.00 32.73  ? 267  GLU B CD    1 
ATOM   1284 O  OE1   . GLU A 1 204 ? -32.654 -11.397 1.694   1.00 36.49  ? 267  GLU B OE1   1 
ATOM   1285 O  OE2   . GLU A 1 204 ? -32.270 -9.713  0.438   1.00 25.65  ? 267  GLU B OE2   1 
ATOM   1286 N  N     . GLU A 1 205 ? -27.217 -8.232  1.172   1.00 41.47  ? 268  GLU B N     1 
ATOM   1287 C  CA    . GLU A 1 205 ? -26.656 -6.951  0.984   1.00 34.40  ? 268  GLU B CA    1 
ATOM   1288 C  C     . GLU A 1 205 ? -25.405 -7.017  0.185   1.00 37.99  ? 268  GLU B C     1 
ATOM   1289 O  O     . GLU A 1 205 ? -25.186 -6.220  -0.613  1.00 38.64  ? 268  GLU B O     1 
ATOM   1290 C  CB    . GLU A 1 205 ? -26.431 -6.343  2.335   1.00 32.05  ? 268  GLU B CB    1 
ATOM   1291 C  CG    . GLU A 1 205 ? -25.465 -5.219  2.353   1.00 37.15  ? 268  GLU B CG    1 
ATOM   1292 C  CD    . GLU A 1 205 ? -25.513 -4.505  3.633   1.00 46.70  ? 268  GLU B CD    1 
ATOM   1293 O  OE1   . GLU A 1 205 ? -25.242 -3.311  3.661   1.00 50.80  ? 268  GLU B OE1   1 
ATOM   1294 O  OE2   . GLU A 1 205 ? -25.821 -5.145  4.602   1.00 45.47  ? 268  GLU B OE2   1 
ATOM   1295 N  N     . THR A 1 206 ? -24.564 -7.986  0.411   1.00 39.45  ? 269  THR B N     1 
ATOM   1296 C  CA    . THR A 1 206 ? -23.363 -8.125  -0.361  1.00 40.67  ? 269  THR B CA    1 
ATOM   1297 C  C     . THR A 1 206 ? -23.627 -8.393  -1.792  1.00 42.94  ? 269  THR B C     1 
ATOM   1298 O  O     . THR A 1 206 ? -22.939 -7.911  -2.632  1.00 42.04  ? 269  THR B O     1 
ATOM   1299 C  CB    . THR A 1 206 ? -22.534 -9.281  0.110   1.00 38.55  ? 269  THR B CB    1 
ATOM   1300 O  OG1   . THR A 1 206 ? -22.383 -9.170  1.494   1.00 45.92  ? 269  THR B OG1   1 
ATOM   1301 C  CG2   . THR A 1 206 ? -21.236 -9.187  -0.462  1.00 33.66  ? 269  THR B CG2   1 
ATOM   1302 N  N     . ILE A 1 207 ? -24.610 -9.214  -2.074  1.00 40.32  ? 270  ILE B N     1 
ATOM   1303 C  CA    . ILE A 1 207 ? -24.963 -9.554  -3.427  1.00 35.79  ? 270  ILE B CA    1 
ATOM   1304 C  C     . ILE A 1 207 ? -25.448 -8.362  -4.208  1.00 37.69  ? 270  ILE B C     1 
ATOM   1305 O  O     . ILE A 1 207 ? -25.271 -8.310  -5.372  1.00 38.98  ? 270  ILE B O     1 
ATOM   1306 C  CB    . ILE A 1 207 ? -26.013 -10.646 -3.429  1.00 39.50  ? 270  ILE B CB    1 
ATOM   1307 C  CG1   . ILE A 1 207 ? -25.423 -11.940 -2.946  1.00 33.11  ? 270  ILE B CG1   1 
ATOM   1308 C  CG2   . ILE A 1 207 ? -26.530 -10.880 -4.809  1.00 33.45  ? 270  ILE B CG2   1 
ATOM   1309 C  CD1   . ILE A 1 207 ? -26.454 -12.964 -2.593  1.00 30.47  ? 270  ILE B CD1   1 
ATOM   1310 N  N     . ILE A 1 208 ? -26.190 -7.485  -3.557  1.00 38.17  ? 271  ILE B N     1 
ATOM   1311 C  CA    . ILE A 1 208 ? -26.719 -6.258  -4.123  1.00 37.95  ? 271  ILE B CA    1 
ATOM   1312 C  C     . ILE A 1 208 ? -25.685 -5.207  -4.473  1.00 39.06  ? 271  ILE B C     1 
ATOM   1313 O  O     . ILE A 1 208 ? -25.836 -4.501  -5.430  1.00 38.22  ? 271  ILE B O     1 
ATOM   1314 C  CB    . ILE A 1 208 ? -27.854 -5.708  -3.264  1.00 35.72  ? 271  ILE B CB    1 
ATOM   1315 C  CG1   . ILE A 1 208 ? -29.056 -6.584  -3.377  1.00 35.24  ? 271  ILE B CG1   1 
ATOM   1316 C  CG2   . ILE A 1 208 ? -28.307 -4.370  -3.733  1.00 27.94  ? 271  ILE B CG2   1 
ATOM   1317 C  CD1   . ILE A 1 208 ? -29.876 -6.585  -2.125  1.00 32.79  ? 271  ILE B CD1   1 
ATOM   1318 N  N     . LEU A 1 209 ? -24.688 -5.092  -3.626  1.00 37.80  ? 272  LEU B N     1 
ATOM   1319 C  CA    . LEU A 1 209 ? -23.552 -4.224  -3.773  1.00 38.83  ? 272  LEU B CA    1 
ATOM   1320 C  C     . LEU A 1 209 ? -22.621 -4.557  -4.907  1.00 40.48  ? 272  LEU B C     1 
ATOM   1321 O  O     . LEU A 1 209 ? -21.986 -3.683  -5.431  1.00 34.24  ? 272  LEU B O     1 
ATOM   1322 C  CB    . LEU A 1 209 ? -22.772 -4.185  -2.495  1.00 43.84  ? 272  LEU B CB    1 
ATOM   1323 C  CG    . LEU A 1 209 ? -23.194 -3.257  -1.381  1.00 43.48  ? 272  LEU B CG    1 
ATOM   1324 C  CD1   . LEU A 1 209 ? -22.184 -3.401  -0.308  1.00 38.37  ? 272  LEU B CD1   1 
ATOM   1325 C  CD2   . LEU A 1 209 ? -23.193 -1.850  -1.885  1.00 44.42  ? 272  LEU B CD2   1 
ATOM   1326 N  N     . LEU A 1 210 ? -22.451 -5.838  -5.190  1.00 40.91  ? 273  LEU B N     1 
ATOM   1327 C  CA    . LEU A 1 210 ? -21.607 -6.340  -6.267  1.00 36.56  ? 273  LEU B CA    1 
ATOM   1328 C  C     . LEU A 1 210 ? -22.139 -5.999  -7.643  1.00 34.96  ? 273  LEU B C     1 
ATOM   1329 O  O     . LEU A 1 210 ? -23.299 -5.978  -7.839  1.00 38.21  ? 273  LEU B O     1 
ATOM   1330 C  CB    . LEU A 1 210 ? -21.455 -7.834  -6.132  1.00 36.41  ? 273  LEU B CB    1 
ATOM   1331 C  CG    . LEU A 1 210 ? -20.455 -8.342  -5.117  1.00 30.13  ? 273  LEU B CG    1 
ATOM   1332 C  CD1   . LEU A 1 210 ? -20.823 -9.678  -4.586  1.00 28.78  ? 273  LEU B CD1   1 
ATOM   1333 C  CD2   . LEU A 1 210 ? -19.069 -8.388  -5.644  1.00 27.85  ? 273  LEU B CD2   1 
ATOM   1334 N  N     . PRO A 1 211 ? -21.262 -5.737  -8.614  1.00 36.27  ? 274  PRO B N     1 
ATOM   1335 C  CA    . PRO A 1 211 ? -21.587 -5.347  -9.967  1.00 34.65  ? 274  PRO B CA    1 
ATOM   1336 C  C     . PRO A 1 211 ? -22.094 -6.416  -10.877 1.00 40.21  ? 274  PRO B C     1 
ATOM   1337 O  O     . PRO A 1 211 ? -21.885 -7.571  -10.688 1.00 37.29  ? 274  PRO B O     1 
ATOM   1338 C  CB    . PRO A 1 211 ? -20.272 -4.834  -10.494 1.00 34.85  ? 274  PRO B CB    1 
ATOM   1339 C  CG    . PRO A 1 211 ? -19.400 -4.717  -9.343  1.00 34.68  ? 274  PRO B CG    1 
ATOM   1340 C  CD    . PRO A 1 211 ? -19.824 -5.815  -8.479  1.00 40.09  ? 274  PRO B CD    1 
ATOM   1341 N  N     . ASP A 1 212 ? -22.756 -5.980  -11.928 1.00 37.89  ? 275  ASP B N     1 
ATOM   1342 C  CA    . ASP A 1 212 ? -23.337 -6.831  -12.933 1.00 33.61  ? 275  ASP B CA    1 
ATOM   1343 C  C     . ASP A 1 212 ? -22.373 -7.604  -13.791 1.00 36.86  ? 275  ASP B C     1 
ATOM   1344 O  O     . ASP A 1 212 ? -22.704 -8.586  -14.370 1.00 38.79  ? 275  ASP B O     1 
ATOM   1345 C  CB    . ASP A 1 212 ? -24.314 -6.048  -13.740 1.00 30.25  ? 275  ASP B CB    1 
ATOM   1346 C  CG    . ASP A 1 212 ? -25.482 -5.658  -12.960 1.00 34.11  ? 275  ASP B CG    1 
ATOM   1347 O  OD1   . ASP A 1 212 ? -25.455 -5.693  -11.766 1.00 38.41  ? 275  ASP B OD1   1 
ATOM   1348 O  OD2   . ASP A 1 212 ? -26.462 -5.303  -13.529 1.00 42.28  ? 275  ASP B OD2   1 
ATOM   1349 N  N     . ASN A 1 213 ? -21.178 -7.090  -13.889 1.00 40.06  ? 276  ASN B N     1 
ATOM   1350 C  CA    . ASN A 1 213 ? -20.056 -7.627  -14.578 1.00 41.61  ? 276  ASN B CA    1 
ATOM   1351 C  C     . ASN A 1 213 ? -19.545 -8.924  -14.015 1.00 47.21  ? 276  ASN B C     1 
ATOM   1352 O  O     . ASN A 1 213 ? -18.907 -9.652  -14.698 1.00 51.88  ? 276  ASN B O     1 
ATOM   1353 C  CB    . ASN A 1 213 ? -19.021 -6.515  -14.649 1.00 40.39  ? 276  ASN B CB    1 
ATOM   1354 C  CG    . ASN A 1 213 ? -17.697 -6.870  -14.066 1.00 52.05  ? 276  ASN B CG    1 
ATOM   1355 O  OD1   . ASN A 1 213 ? -17.111 -7.864  -14.391 1.00 61.47  ? 276  ASN B OD1   1 
ATOM   1356 N  ND2   . ASN A 1 213 ? -17.181 -5.996  -13.253 1.00 49.20  ? 276  ASN B ND2   1 
ATOM   1357 N  N     . VAL A 1 214 ? -19.715 -9.120  -12.727 1.00 45.88  ? 277  VAL B N     1 
ATOM   1358 C  CA    . VAL A 1 214 ? -19.300 -10.279 -11.960 1.00 39.40  ? 277  VAL B CA    1 
ATOM   1359 C  C     . VAL A 1 214 ? -20.213 -11.453 -12.095 1.00 33.88  ? 277  VAL B C     1 
ATOM   1360 O  O     . VAL A 1 214 ? -21.356 -11.307 -12.281 1.00 36.52  ? 277  VAL B O     1 
ATOM   1361 C  CB    . VAL A 1 214 ? -19.260 -9.894  -10.487 1.00 43.33  ? 277  VAL B CB    1 
ATOM   1362 C  CG1   . VAL A 1 214 ? -18.327 -10.743 -9.682  1.00 35.52  ? 277  VAL B CG1   1 
ATOM   1363 C  CG2   . VAL A 1 214 ? -18.818 -8.474  -10.341 1.00 45.31  ? 277  VAL B CG2   1 
ATOM   1364 N  N     . HIS A 1 215 ? -19.656 -12.632 -11.955 1.00 33.91  ? 278  HIS B N     1 
ATOM   1365 C  CA    . HIS A 1 215 ? -20.320 -13.901 -12.058 1.00 32.75  ? 278  HIS B CA    1 
ATOM   1366 C  C     . HIS A 1 215 ? -20.161 -14.630 -10.797 1.00 30.79  ? 278  HIS B C     1 
ATOM   1367 O  O     . HIS A 1 215 ? -19.209 -14.466 -10.138 1.00 34.82  ? 278  HIS B O     1 
ATOM   1368 C  CB    . HIS A 1 215 ? -19.713 -14.719 -13.152 1.00 32.80  ? 278  HIS B CB    1 
ATOM   1369 C  CG    . HIS A 1 215 ? -20.009 -14.223 -14.522 1.00 36.19  ? 278  HIS B CG    1 
ATOM   1370 N  ND1   . HIS A 1 215 ? -21.118 -13.488 -14.819 1.00 35.36  ? 278  HIS B ND1   1 
ATOM   1371 C  CD2   . HIS A 1 215 ? -19.352 -14.376 -15.676 1.00 34.71  ? 278  HIS B CD2   1 
ATOM   1372 C  CE1   . HIS A 1 215 ? -21.127 -13.190 -16.092 1.00 37.41  ? 278  HIS B CE1   1 
ATOM   1373 N  NE2   . HIS A 1 215 ? -20.064 -13.723 -16.636 1.00 38.66  ? 278  HIS B NE2   1 
ATOM   1374 N  N     . TYR A 1 216 ? -21.140 -15.435 -10.454 1.00 27.52  ? 279  TYR B N     1 
ATOM   1375 C  CA    . TYR A 1 216 ? -21.158 -16.151 -9.210  1.00 25.86  ? 279  TYR B CA    1 
ATOM   1376 C  C     . TYR A 1 216 ? -21.317 -17.620 -9.255  1.00 26.52  ? 279  TYR B C     1 
ATOM   1377 O  O     . TYR A 1 216 ? -21.901 -18.138 -10.104 1.00 33.87  ? 279  TYR B O     1 
ATOM   1378 C  CB    . TYR A 1 216 ? -22.345 -15.681 -8.416  1.00 25.42  ? 279  TYR B CB    1 
ATOM   1379 C  CG    . TYR A 1 216 ? -22.487 -14.211 -8.375  1.00 33.21  ? 279  TYR B CG    1 
ATOM   1380 C  CD1   . TYR A 1 216 ? -21.665 -13.457 -7.622  1.00 38.34  ? 279  TYR B CD1   1 
ATOM   1381 C  CD2   . TYR A 1 216 ? -23.405 -13.580 -9.122  1.00 31.04  ? 279  TYR B CD2   1 
ATOM   1382 C  CE1   . TYR A 1 216 ? -21.765 -12.114 -7.625  1.00 38.10  ? 279  TYR B CE1   1 
ATOM   1383 C  CE2   . TYR A 1 216 ? -23.498 -12.252 -9.114  1.00 33.23  ? 279  TYR B CE2   1 
ATOM   1384 C  CZ    . TYR A 1 216 ? -22.680 -11.543 -8.355  1.00 36.76  ? 279  TYR B CZ    1 
ATOM   1385 O  OH    . TYR A 1 216 ? -22.782 -10.226 -8.349  1.00 38.16  ? 279  TYR B OH    1 
ATOM   1386 N  N     . VAL A 1 217 ? -20.767 -18.290 -8.288  1.00 25.37  ? 280  VAL B N     1 
ATOM   1387 C  CA    . VAL A 1 217 ? -20.960 -19.689 -8.118  1.00 25.59  ? 280  VAL B CA    1 
ATOM   1388 C  C     . VAL A 1 217 ? -21.578 -19.771 -6.752  1.00 28.46  ? 280  VAL B C     1 
ATOM   1389 O  O     . VAL A 1 217 ? -21.062 -19.219 -5.852  1.00 31.59  ? 280  VAL B O     1 
ATOM   1390 C  CB    . VAL A 1 217 ? -19.642 -20.416 -8.106  1.00 30.04  ? 280  VAL B CB    1 
ATOM   1391 C  CG1   . VAL A 1 217 ? -19.757 -21.666 -7.307  1.00 25.70  ? 280  VAL B CG1   1 
ATOM   1392 C  CG2   . VAL A 1 217 ? -19.225 -20.766 -9.497  1.00 34.23  ? 280  VAL B CG2   1 
ATOM   1393 N  N     . PHE A 1 218 ? -22.707 -20.434 -6.592  1.00 30.15  ? 281  PHE B N     1 
ATOM   1394 C  CA    . PHE A 1 218 ? -23.350 -20.548 -5.291  1.00 29.21  ? 281  PHE B CA    1 
ATOM   1395 C  C     . PHE A 1 218 ? -23.333 -21.935 -4.771  1.00 30.24  ? 281  PHE B C     1 
ATOM   1396 O  O     . PHE A 1 218 ? -23.752 -22.799 -5.413  1.00 30.90  ? 281  PHE B O     1 
ATOM   1397 C  CB    . PHE A 1 218 ? -24.788 -20.115 -5.349  1.00 28.72  ? 281  PHE B CB    1 
ATOM   1398 C  CG    . PHE A 1 218 ? -24.968 -18.677 -5.596  1.00 30.51  ? 281  PHE B CG    1 
ATOM   1399 C  CD1   . PHE A 1 218 ? -25.008 -17.813 -4.580  1.00 26.72  ? 281  PHE B CD1   1 
ATOM   1400 C  CD2   . PHE A 1 218 ? -25.111 -18.215 -6.859  1.00 30.25  ? 281  PHE B CD2   1 
ATOM   1401 C  CE1   . PHE A 1 218 ? -25.167 -16.499 -4.814  1.00 28.25  ? 281  PHE B CE1   1 
ATOM   1402 C  CE2   . PHE A 1 218 ? -25.237 -16.901 -7.109  1.00 26.01  ? 281  PHE B CE2   1 
ATOM   1403 C  CZ    . PHE A 1 218 ? -25.270 -16.036 -6.080  1.00 24.99  ? 281  PHE B CZ    1 
ATOM   1404 N  N     . LEU A 1 219 ? -22.832 -22.145 -3.582  1.00 26.04  ? 282  LEU B N     1 
ATOM   1405 C  CA    . LEU A 1 219 ? -22.803 -23.459 -3.049  1.00 26.85  ? 282  LEU B CA    1 
ATOM   1406 C  C     . LEU A 1 219 ? -23.799 -23.492 -1.966  1.00 28.71  ? 282  LEU B C     1 
ATOM   1407 O  O     . LEU A 1 219 ? -23.889 -22.635 -1.218  1.00 34.56  ? 282  LEU B O     1 
ATOM   1408 C  CB    . LEU A 1 219 ? -21.445 -23.791 -2.548  1.00 28.62  ? 282  LEU B CB    1 
ATOM   1409 C  CG    . LEU A 1 219 ? -20.401 -23.747 -3.602  1.00 29.04  ? 282  LEU B CG    1 
ATOM   1410 C  CD1   . LEU A 1 219 ? -19.351 -24.651 -3.080  1.00 33.88  ? 282  LEU B CD1   1 
ATOM   1411 C  CD2   . LEU A 1 219 ? -20.927 -24.326 -4.860  1.00 26.77  ? 282  LEU B CD2   1 
ATOM   1412 N  N     . SER A 1 220 ? -24.617 -24.484 -1.958  1.00 28.75  ? 283  SER B N     1 
ATOM   1413 C  CA    . SER A 1 220 ? -25.665 -24.590 -1.022  1.00 29.11  ? 283  SER B CA    1 
ATOM   1414 C  C     . SER A 1 220 ? -26.087 -25.967 -0.919  1.00 31.19  ? 283  SER B C     1 
ATOM   1415 O  O     . SER A 1 220 ? -25.842 -26.767 -1.752  1.00 30.93  ? 283  SER B O     1 
ATOM   1416 C  CB    . SER A 1 220 ? -26.859 -23.825 -1.565  1.00 31.72  ? 283  SER B CB    1 
ATOM   1417 O  OG    . SER A 1 220 ? -28.085 -24.290 -1.072  1.00 25.60  ? 283  SER B OG    1 
ATOM   1418 N  N     . ALA A 1 221 ? -26.820 -26.200 0.128   1.00 30.15  ? 284  ALA B N     1 
ATOM   1419 C  CA    . ALA A 1 221 ? -27.445 -27.449 0.402   1.00 31.46  ? 284  ALA B CA    1 
ATOM   1420 C  C     . ALA A 1 221 ? -28.732 -27.516 -0.338  1.00 29.74  ? 284  ALA B C     1 
ATOM   1421 O  O     . ALA A 1 221 ? -29.144 -26.610 -0.989  1.00 30.47  ? 284  ALA B O     1 
ATOM   1422 C  CB    . ALA A 1 221 ? -27.679 -27.619 1.866   1.00 29.98  ? 284  ALA B CB    1 
ATOM   1423 N  N     . THR A 1 222 ? -29.376 -28.639 -0.255  1.00 31.33  ? 285  THR B N     1 
ATOM   1424 C  CA    . THR A 1 222 ? -30.572 -28.823 -0.998  1.00 31.60  ? 285  THR B CA    1 
ATOM   1425 C  C     . THR A 1 222 ? -31.688 -28.056 -0.475  1.00 31.85  ? 285  THR B C     1 
ATOM   1426 O  O     . THR A 1 222 ? -32.135 -28.308 0.568   1.00 38.43  ? 285  THR B O     1 
ATOM   1427 C  CB    . THR A 1 222 ? -31.050 -30.246 -0.856  1.00 26.57  ? 285  THR B CB    1 
ATOM   1428 O  OG1   . THR A 1 222 ? -30.882 -30.655 0.486   1.00 33.01  ? 285  THR B OG1   1 
ATOM   1429 C  CG2   . THR A 1 222 ? -30.300 -31.142 -1.712  1.00 25.93  ? 285  THR B CG2   1 
ATOM   1430 N  N     . ILE A 1 223 ? -32.226 -27.185 -1.283  1.00 29.20  ? 286  ILE B N     1 
ATOM   1431 C  CA    . ILE A 1 223 ? -33.327 -26.362 -0.934  1.00 28.22  ? 286  ILE B CA    1 
ATOM   1432 C  C     . ILE A 1 223 ? -34.351 -26.497 -2.015  1.00 30.07  ? 286  ILE B C     1 
ATOM   1433 O  O     . ILE A 1 223 ? -34.022 -26.626 -3.128  1.00 31.93  ? 286  ILE B O     1 
ATOM   1434 C  CB    . ILE A 1 223 ? -32.891 -24.930 -0.908  1.00 28.72  ? 286  ILE B CB    1 
ATOM   1435 C  CG1   . ILE A 1 223 ? -32.280 -24.608 -2.200  1.00 24.47  ? 286  ILE B CG1   1 
ATOM   1436 C  CG2   . ILE A 1 223 ? -31.843 -24.721 0.120   1.00 30.35  ? 286  ILE B CG2   1 
ATOM   1437 C  CD1   . ILE A 1 223 ? -31.326 -23.478 -2.136  1.00 27.25  ? 286  ILE B CD1   1 
ATOM   1438 N  N     . PRO A 1 224 ? -35.619 -26.489 -1.664  1.00 28.16  ? 287  PRO B N     1 
ATOM   1439 C  CA    . PRO A 1 224 ? -36.834 -26.583 -2.445  1.00 24.79  ? 287  PRO B CA    1 
ATOM   1440 C  C     . PRO A 1 224 ? -37.070 -25.467 -3.385  1.00 25.40  ? 287  PRO B C     1 
ATOM   1441 O  O     . PRO A 1 224 ? -37.629 -25.629 -4.409  1.00 30.27  ? 287  PRO B O     1 
ATOM   1442 C  CB    . PRO A 1 224 ? -37.907 -26.556 -1.398  1.00 27.14  ? 287  PRO B CB    1 
ATOM   1443 C  CG    . PRO A 1 224 ? -37.278 -26.105 -0.185  1.00 30.17  ? 287  PRO B CG    1 
ATOM   1444 C  CD    . PRO A 1 224 ? -35.920 -26.615 -0.253  1.00 36.67  ? 287  PRO B CD    1 
ATOM   1445 N  N     . ASN A 1 225 ? -36.659 -24.299 -2.985  1.00 31.40  ? 288  ASN B N     1 
ATOM   1446 C  CA    . ASN A 1 225 ? -36.840 -23.119 -3.749  1.00 26.29  ? 288  ASN B CA    1 
ATOM   1447 C  C     . ASN A 1 225 ? -35.595 -22.668 -4.410  1.00 28.41  ? 288  ASN B C     1 
ATOM   1448 O  O     . ASN A 1 225 ? -35.401 -21.537 -4.549  1.00 34.09  ? 288  ASN B O     1 
ATOM   1449 C  CB    . ASN A 1 225 ? -37.375 -22.028 -2.872  1.00 21.01  ? 288  ASN B CB    1 
ATOM   1450 C  CG    . ASN A 1 225 ? -36.382 -21.547 -1.925  1.00 29.40  ? 288  ASN B CG    1 
ATOM   1451 O  OD1   . ASN A 1 225 ? -35.702 -22.305 -1.329  1.00 33.28  ? 288  ASN B OD1   1 
ATOM   1452 N  ND2   . ASN A 1 225 ? -36.299 -20.282 -1.777  1.00 28.32  ? 288  ASN B ND2   1 
ATOM   1453 N  N     . ALA A 1 226 ? -34.745 -23.557 -4.841  1.00 27.49  ? 289  ALA B N     1 
ATOM   1454 C  CA    . ALA A 1 226 ? -33.502 -23.179 -5.482  1.00 29.65  ? 289  ALA B CA    1 
ATOM   1455 C  C     . ALA A 1 226 ? -33.662 -22.400 -6.753  1.00 33.08  ? 289  ALA B C     1 
ATOM   1456 O  O     . ALA A 1 226 ? -32.852 -21.602 -7.085  1.00 32.17  ? 289  ALA B O     1 
ATOM   1457 C  CB    . ALA A 1 226 ? -32.617 -24.376 -5.696  1.00 29.97  ? 289  ALA B CB    1 
ATOM   1458 N  N     . ARG A 1 227 ? -34.683 -22.692 -7.511  1.00 31.24  ? 290  ARG B N     1 
ATOM   1459 C  CA    . ARG A 1 227 ? -34.961 -21.952 -8.678  1.00 25.36  ? 290  ARG B CA    1 
ATOM   1460 C  C     . ARG A 1 227 ? -35.274 -20.537 -8.365  1.00 26.72  ? 290  ARG B C     1 
ATOM   1461 O  O     . ARG A 1 227 ? -34.866 -19.724 -9.054  1.00 32.08  ? 290  ARG B O     1 
ATOM   1462 C  CB    . ARG A 1 227 ? -36.137 -22.570 -9.391  1.00 30.94  ? 290  ARG B CB    1 
ATOM   1463 C  CG    . ARG A 1 227 ? -36.509 -21.896 -10.679 1.00 30.26  ? 290  ARG B CG    1 
ATOM   1464 C  CD    . ARG A 1 227 ? -37.091 -22.890 -11.604 1.00 35.51  ? 290  ARG B CD    1 
ATOM   1465 N  NE    . ARG A 1 227 ? -38.462 -23.083 -11.262 1.00 42.75  ? 290  ARG B NE    1 
ATOM   1466 C  CZ    . ARG A 1 227 ? -39.221 -24.071 -11.685 1.00 46.66  ? 290  ARG B CZ    1 
ATOM   1467 N  NH1   . ARG A 1 227 ? -38.746 -24.970 -12.489 1.00 36.08  ? 290  ARG B NH1   1 
ATOM   1468 N  NH2   . ARG A 1 227 ? -40.460 -24.153 -11.300 1.00 54.46  ? 290  ARG B NH2   1 
ATOM   1469 N  N     . GLN A 1 228 ? -35.999 -20.240 -7.314  1.00 26.78  ? 291  GLN B N     1 
ATOM   1470 C  CA    . GLN A 1 228 ? -36.381 -18.909 -6.966  1.00 26.81  ? 291  GLN B CA    1 
ATOM   1471 C  C     . GLN A 1 228 ? -35.218 -18.005 -6.708  1.00 28.73  ? 291  GLN B C     1 
ATOM   1472 O  O     . GLN A 1 228 ? -35.245 -16.869 -7.032  1.00 29.18  ? 291  GLN B O     1 
ATOM   1473 C  CB    . GLN A 1 228 ? -37.222 -18.983 -5.713  1.00 22.43  ? 291  GLN B CB    1 
ATOM   1474 C  CG    . GLN A 1 228 ? -38.349 -18.003 -5.706  1.00 27.84  ? 291  GLN B CG    1 
ATOM   1475 C  CD    . GLN A 1 228 ? -38.950 -17.769 -4.391  1.00 25.54  ? 291  GLN B CD    1 
ATOM   1476 O  OE1   . GLN A 1 228 ? -38.463 -18.180 -3.411  1.00 23.05  ? 291  GLN B OE1   1 
ATOM   1477 N  NE2   . GLN A 1 228 ? -40.020 -17.064 -4.383  1.00 24.99  ? 291  GLN B NE2   1 
ATOM   1478 N  N     . PHE A 1 229 ? -34.207 -18.519 -6.055  1.00 29.78  ? 292  PHE B N     1 
ATOM   1479 C  CA    . PHE A 1 229 ? -32.999 -17.808 -5.765  1.00 26.34  ? 292  PHE B CA    1 
ATOM   1480 C  C     . PHE A 1 229 ? -32.268 -17.483 -7.015  1.00 27.23  ? 292  PHE B C     1 
ATOM   1481 O  O     . PHE A 1 229 ? -31.657 -16.490 -7.125  1.00 24.50  ? 292  PHE B O     1 
ATOM   1482 C  CB    . PHE A 1 229 ? -32.132 -18.625 -4.829  1.00 26.48  ? 292  PHE B CB    1 
ATOM   1483 C  CG    . PHE A 1 229 ? -30.875 -17.944 -4.420  1.00 27.18  ? 292  PHE B CG    1 
ATOM   1484 C  CD1   . PHE A 1 229 ? -30.899 -16.925 -3.559  1.00 30.75  ? 292  PHE B CD1   1 
ATOM   1485 C  CD2   . PHE A 1 229 ? -29.691 -18.344 -4.891  1.00 27.46  ? 292  PHE B CD2   1 
ATOM   1486 C  CE1   . PHE A 1 229 ? -29.766 -16.296 -3.199  1.00 28.60  ? 292  PHE B CE1   1 
ATOM   1487 C  CE2   . PHE A 1 229 ? -28.568 -17.731 -4.537  1.00 28.18  ? 292  PHE B CE2   1 
ATOM   1488 C  CZ    . PHE A 1 229 ? -28.597 -16.709 -3.680  1.00 26.88  ? 292  PHE B CZ    1 
ATOM   1489 N  N     . ALA A 1 230 ? -32.252 -18.405 -7.934  1.00 30.12  ? 293  ALA B N     1 
ATOM   1490 C  CA    . ALA A 1 230 ? -31.626 -18.192 -9.190  1.00 27.18  ? 293  ALA B CA    1 
ATOM   1491 C  C     . ALA A 1 230 ? -32.328 -17.167 -10.012 1.00 27.44  ? 293  ALA B C     1 
ATOM   1492 O  O     . ALA A 1 230 ? -31.725 -16.580 -10.809 1.00 24.87  ? 293  ALA B O     1 
ATOM   1493 C  CB    . ALA A 1 230 ? -31.412 -19.467 -9.919  1.00 22.07  ? 293  ALA B CB    1 
ATOM   1494 N  N     . GLU A 1 231 ? -33.630 -17.057 -9.942  1.00 29.76  ? 294  GLU B N     1 
ATOM   1495 C  CA    . GLU A 1 231 ? -34.342 -16.020 -10.669 1.00 29.76  ? 294  GLU B CA    1 
ATOM   1496 C  C     . GLU A 1 231 ? -34.002 -14.647 -10.143 1.00 34.18  ? 294  GLU B C     1 
ATOM   1497 O  O     . GLU A 1 231 ? -34.034 -13.707 -10.856 1.00 34.95  ? 294  GLU B O     1 
ATOM   1498 C  CB    . GLU A 1 231 ? -35.846 -16.230 -10.671 1.00 28.69  ? 294  GLU B CB    1 
ATOM   1499 C  CG    . GLU A 1 231 ? -36.294 -17.622 -11.016 1.00 33.88  ? 294  GLU B CG    1 
ATOM   1500 C  CD    . GLU A 1 231 ? -37.731 -17.745 -11.398 1.00 33.73  ? 294  GLU B CD    1 
ATOM   1501 O  OE1   . GLU A 1 231 ? -38.276 -18.834 -11.346 1.00 30.25  ? 294  GLU B OE1   1 
ATOM   1502 O  OE2   . GLU A 1 231 ? -38.334 -16.758 -11.748 1.00 34.48  ? 294  GLU B OE2   1 
ATOM   1503 N  N     . TRP A 1 232 ? -33.804 -14.516 -8.849  1.00 26.77  ? 295  TRP B N     1 
ATOM   1504 C  CA    . TRP A 1 232 ? -33.431 -13.267 -8.266  1.00 30.21  ? 295  TRP B CA    1 
ATOM   1505 C  C     . TRP A 1 232 ? -32.098 -12.832 -8.720  1.00 31.92  ? 295  TRP B C     1 
ATOM   1506 O  O     . TRP A 1 232 ? -31.908 -11.693 -8.924  1.00 34.99  ? 295  TRP B O     1 
ATOM   1507 C  CB    . TRP A 1 232 ? -33.483 -13.322 -6.760  1.00 34.36  ? 295  TRP B CB    1 
ATOM   1508 C  CG    . TRP A 1 232 ? -33.016 -12.098 -6.090  1.00 28.20  ? 295  TRP B CG    1 
ATOM   1509 C  CD1   . TRP A 1 232 ? -33.487 -10.906 -6.256  1.00 28.37  ? 295  TRP B CD1   1 
ATOM   1510 C  CD2   . TRP A 1 232 ? -31.964 -11.987 -5.150  1.00 27.96  ? 295  TRP B CD2   1 
ATOM   1511 N  NE1   . TRP A 1 232 ? -32.834 -10.043 -5.492  1.00 29.14  ? 295  TRP B NE1   1 
ATOM   1512 C  CE2   . TRP A 1 232 ? -31.872 -10.696 -4.810  1.00 31.04  ? 295  TRP B CE2   1 
ATOM   1513 C  CE3   . TRP A 1 232 ? -31.101 -12.877 -4.559  1.00 26.17  ? 295  TRP B CE3   1 
ATOM   1514 C  CZ2   . TRP A 1 232 ? -30.984 -10.256 -3.915  1.00 32.22  ? 295  TRP B CZ2   1 
ATOM   1515 C  CZ3   . TRP A 1 232 ? -30.236 -12.439 -3.693  1.00 26.51  ? 295  TRP B CZ3   1 
ATOM   1516 C  CH2   . TRP A 1 232 ? -30.166 -11.161 -3.373  1.00 26.68  ? 295  TRP B CH2   1 
ATOM   1517 N  N     . ILE A 1 233 ? -31.139 -13.719 -8.839  1.00 24.98  ? 296  ILE B N     1 
ATOM   1518 C  CA    . ILE A 1 233 ? -29.833 -13.336 -9.301  1.00 26.75  ? 296  ILE B CA    1 
ATOM   1519 C  C     . ILE A 1 233 ? -29.910 -12.868 -10.735 1.00 35.06  ? 296  ILE B C     1 
ATOM   1520 O  O     . ILE A 1 233 ? -29.265 -11.949 -11.148 1.00 38.66  ? 296  ILE B O     1 
ATOM   1521 C  CB    . ILE A 1 233 ? -28.861 -14.492 -9.194  1.00 27.02  ? 296  ILE B CB    1 
ATOM   1522 C  CG1   . ILE A 1 233 ? -28.801 -15.007 -7.781  1.00 34.08  ? 296  ILE B CG1   1 
ATOM   1523 C  CG2   . ILE A 1 233 ? -27.494 -14.089 -9.636  1.00 17.98  ? 296  ILE B CG2   1 
ATOM   1524 C  CD1   . ILE A 1 233 ? -27.938 -14.209 -6.860  1.00 24.12  ? 296  ILE B CD1   1 
ATOM   1525 N  N     . CYS A 1 234 ? -30.668 -13.552 -11.537 1.00 33.87  ? 297  CYS B N     1 
ATOM   1526 C  CA    . CYS A 1 234 ? -30.841 -13.143 -12.884 1.00 31.54  ? 297  CYS B CA    1 
ATOM   1527 C  C     . CYS A 1 234 ? -31.545 -11.824 -12.937 1.00 32.46  ? 297  CYS B C     1 
ATOM   1528 O  O     . CYS A 1 234 ? -31.193 -10.980 -13.684 1.00 30.58  ? 297  CYS B O     1 
ATOM   1529 C  CB    . CYS A 1 234 ? -31.631 -14.180 -13.601 1.00 27.12  ? 297  CYS B CB    1 
ATOM   1530 S  SG    . CYS A 1 234 ? -32.345 -13.552 -15.053 1.00 38.81  ? 297  CYS B SG    1 
ATOM   1531 N  N     . HIS A 1 235 ? -32.571 -11.643 -12.141 1.00 31.97  ? 298  HIS B N     1 
ATOM   1532 C  CA    . HIS A 1 235 ? -33.290 -10.409 -12.167 1.00 34.87  ? 298  HIS B CA    1 
ATOM   1533 C  C     . HIS A 1 235 ? -32.461 -9.298  -11.684 1.00 34.19  ? 298  HIS B C     1 
ATOM   1534 O  O     . HIS A 1 235 ? -32.517 -8.225  -12.196 1.00 33.44  ? 298  HIS B O     1 
ATOM   1535 C  CB    . HIS A 1 235 ? -34.557 -10.545 -11.381 1.00 36.60  ? 298  HIS B CB    1 
ATOM   1536 C  CG    . HIS A 1 235 ? -35.388 -9.306  -11.340 1.00 46.50  ? 298  HIS B CG    1 
ATOM   1537 N  ND1   . HIS A 1 235 ? -35.821 -8.656  -12.464 1.00 51.24  ? 298  HIS B ND1   1 
ATOM   1538 C  CD2   . HIS A 1 235 ? -35.881 -8.614  -10.295 1.00 47.78  ? 298  HIS B CD2   1 
ATOM   1539 C  CE1   . HIS A 1 235 ? -36.534 -7.607  -12.111 1.00 51.29  ? 298  HIS B CE1   1 
ATOM   1540 N  NE2   . HIS A 1 235 ? -36.578 -7.555  -10.799 1.00 44.58  ? 298  HIS B NE2   1 
ATOM   1541 N  N     . LEU A 1 236 ? -31.740 -9.527  -10.627 1.00 31.61  ? 299  LEU B N     1 
ATOM   1542 C  CA    . LEU A 1 236 ? -30.837 -8.518  -10.164 1.00 31.99  ? 299  LEU B CA    1 
ATOM   1543 C  C     . LEU A 1 236 ? -29.654 -8.273  -11.034 1.00 34.96  ? 299  LEU B C     1 
ATOM   1544 O  O     . LEU A 1 236 ? -29.342 -7.184  -11.317 1.00 40.00  ? 299  LEU B O     1 
ATOM   1545 C  CB    . LEU A 1 236 ? -30.331 -8.891  -8.828  1.00 29.78  ? 299  LEU B CB    1 
ATOM   1546 C  CG    . LEU A 1 236 ? -29.639 -7.817  -8.094  1.00 25.76  ? 299  LEU B CG    1 
ATOM   1547 C  CD1   . LEU A 1 236 ? -30.707 -6.826  -7.856  1.00 22.73  ? 299  LEU B CD1   1 
ATOM   1548 C  CD2   . LEU A 1 236 ? -29.289 -8.495  -6.830  1.00 26.07  ? 299  LEU B CD2   1 
ATOM   1549 N  N     . HIS A 1 237 ? -29.025 -9.312  -11.513 1.00 34.04  ? 300  HIS B N     1 
ATOM   1550 C  CA    . HIS A 1 237 ? -27.836 -9.107  -12.293 1.00 33.76  ? 300  HIS B CA    1 
ATOM   1551 C  C     . HIS A 1 237 ? -27.927 -9.149  -13.757 1.00 37.62  ? 300  HIS B C     1 
ATOM   1552 O  O     . HIS A 1 237 ? -26.938 -9.120  -14.391 1.00 42.92  ? 300  HIS B O     1 
ATOM   1553 C  CB    . HIS A 1 237 ? -26.666 -9.911  -11.774 1.00 36.02  ? 300  HIS B CB    1 
ATOM   1554 C  CG    . HIS A 1 237 ? -26.212 -9.481  -10.421 1.00 31.62  ? 300  HIS B CG    1 
ATOM   1555 N  ND1   . HIS A 1 237 ? -26.405 -10.234 -9.302  1.00 33.50  ? 300  HIS B ND1   1 
ATOM   1556 C  CD2   . HIS A 1 237 ? -25.632 -8.348  -10.011 1.00 31.82  ? 300  HIS B CD2   1 
ATOM   1557 C  CE1   . HIS A 1 237 ? -25.925 -9.597  -8.265  1.00 29.78  ? 300  HIS B CE1   1 
ATOM   1558 N  NE2   . HIS A 1 237 ? -25.474 -8.440  -8.668  1.00 31.30  ? 300  HIS B NE2   1 
ATOM   1559 N  N     . LYS A 1 238 ? -29.116 -9.299  -14.284 1.00 38.20  ? 301  LYS B N     1 
ATOM   1560 C  CA    . LYS A 1 238 ? -29.368 -9.265  -15.689 1.00 32.75  ? 301  LYS B CA    1 
ATOM   1561 C  C     . LYS A 1 238 ? -28.537 -10.182 -16.477 1.00 33.08  ? 301  LYS B C     1 
ATOM   1562 O  O     . LYS A 1 238 ? -27.989 -9.802  -17.446 1.00 40.11  ? 301  LYS B O     1 
ATOM   1563 C  CB    . LYS A 1 238 ? -29.260 -7.861  -16.197 1.00 31.52  ? 301  LYS B CB    1 
ATOM   1564 C  CG    . LYS A 1 238 ? -30.530 -7.081  -16.092 1.00 44.91  ? 301  LYS B CG    1 
ATOM   1565 C  CD    . LYS A 1 238 ? -30.443 -5.946  -15.104 1.00 42.59  ? 301  LYS B CD    1 
ATOM   1566 C  CE    . LYS A 1 238 ? -31.831 -5.454  -14.765 1.00 43.98  ? 301  LYS B CE    1 
ATOM   1567 N  NZ    . LYS A 1 238 ? -32.664 -6.525  -14.160 1.00 41.21  ? 301  LYS B NZ    1 
ATOM   1568 N  N     . GLN A 1 239 ? -28.423 -11.405 -16.019 1.00 35.82  ? 302  GLN B N     1 
ATOM   1569 C  CA    . GLN A 1 239 ? -27.639 -12.420 -16.648 1.00 32.77  ? 302  GLN B CA    1 
ATOM   1570 C  C     . GLN A 1 239 ? -28.135 -13.775 -16.218 1.00 36.20  ? 302  GLN B C     1 
ATOM   1571 O  O     . GLN A 1 239 ? -28.875 -13.889 -15.308 1.00 36.74  ? 302  GLN B O     1 
ATOM   1572 C  CB    . GLN A 1 239 ? -26.229 -12.242 -16.215 1.00 34.67  ? 302  GLN B CB    1 
ATOM   1573 C  CG    . GLN A 1 239 ? -26.081 -12.402 -14.748 1.00 38.39  ? 302  GLN B CG    1 
ATOM   1574 C  CD    . GLN A 1 239 ? -24.715 -12.090 -14.280 1.00 43.04  ? 302  GLN B CD    1 
ATOM   1575 O  OE1   . GLN A 1 239 ? -23.949 -11.500 -14.981 1.00 51.15  ? 302  GLN B OE1   1 
ATOM   1576 N  NE2   . GLN A 1 239 ? -24.426 -12.436 -13.086 1.00 35.36  ? 302  GLN B NE2   1 
ATOM   1577 N  N     . PRO A 1 240 ? -27.766 -14.828 -16.918 1.00 31.57  ? 303  PRO B N     1 
ATOM   1578 C  CA    . PRO A 1 240 ? -28.215 -16.147 -16.544 1.00 24.04  ? 303  PRO B CA    1 
ATOM   1579 C  C     . PRO A 1 240 ? -27.632 -16.736 -15.315 1.00 23.76  ? 303  PRO B C     1 
ATOM   1580 O  O     . PRO A 1 240 ? -26.518 -16.520 -15.079 1.00 27.46  ? 303  PRO B O     1 
ATOM   1581 C  CB    . PRO A 1 240 ? -27.717 -16.964 -17.672 1.00 26.42  ? 303  PRO B CB    1 
ATOM   1582 C  CG    . PRO A 1 240 ? -27.732 -16.079 -18.800 1.00 22.82  ? 303  PRO B CG    1 
ATOM   1583 C  CD    . PRO A 1 240 ? -27.241 -14.823 -18.270 1.00 28.53  ? 303  PRO B CD    1 
ATOM   1584 N  N     . CYS A 1 241 ? -28.412 -17.457 -14.548 1.00 25.35  ? 304  CYS B N     1 
ATOM   1585 C  CA    . CYS A 1 241 ? -27.961 -18.154 -13.389 1.00 25.98  ? 304  CYS B CA    1 
ATOM   1586 C  C     . CYS A 1 241 ? -28.527 -19.514 -13.489 1.00 24.83  ? 304  CYS B C     1 
ATOM   1587 O  O     . CYS A 1 241 ? -29.674 -19.666 -13.628 1.00 24.97  ? 304  CYS B O     1 
ATOM   1588 C  CB    . CYS A 1 241 ? -28.475 -17.512 -12.153 1.00 22.04  ? 304  CYS B CB    1 
ATOM   1589 S  SG    . CYS A 1 241 ? -27.651 -18.003 -10.697 1.00 27.49  ? 304  CYS B SG    1 
ATOM   1590 N  N     . HIS A 1 242 ? -27.709 -20.521 -13.357 1.00 21.18  ? 305  HIS B N     1 
ATOM   1591 C  CA    . HIS A 1 242 ? -28.188 -21.836 -13.442 1.00 23.08  ? 305  HIS B CA    1 
ATOM   1592 C  C     . HIS A 1 242 ? -28.291 -22.496 -12.120 1.00 27.95  ? 305  HIS B C     1 
ATOM   1593 O  O     . HIS A 1 242 ? -27.463 -22.324 -11.306 1.00 29.84  ? 305  HIS B O     1 
ATOM   1594 C  CB    . HIS A 1 242 ? -27.261 -22.663 -14.263 1.00 28.77  ? 305  HIS B CB    1 
ATOM   1595 C  CG    . HIS A 1 242 ? -26.849 -22.053 -15.551 1.00 29.13  ? 305  HIS B CG    1 
ATOM   1596 N  ND1   . HIS A 1 242 ? -27.487 -22.297 -16.731 1.00 21.82  ? 305  HIS B ND1   1 
ATOM   1597 C  CD2   . HIS A 1 242 ? -25.784 -21.305 -15.856 1.00 32.75  ? 305  HIS B CD2   1 
ATOM   1598 C  CE1   . HIS A 1 242 ? -26.857 -21.688 -17.699 1.00 23.97  ? 305  HIS B CE1   1 
ATOM   1599 N  NE2   . HIS A 1 242 ? -25.825 -21.070 -17.191 1.00 25.91  ? 305  HIS B NE2   1 
ATOM   1600 N  N     . VAL A 1 243 ? -29.342 -23.267 -11.938 1.00 26.19  ? 306  VAL B N     1 
ATOM   1601 C  CA    . VAL A 1 243 ? -29.563 -24.018 -10.754 1.00 28.82  ? 306  VAL B CA    1 
ATOM   1602 C  C     . VAL A 1 243 ? -29.294 -25.395 -11.155 1.00 30.30  ? 306  VAL B C     1 
ATOM   1603 O  O     . VAL A 1 243 ? -29.877 -25.849 -12.045 1.00 30.63  ? 306  VAL B O     1 
ATOM   1604 C  CB    . VAL A 1 243 ? -31.008 -24.099 -10.431 1.00 21.69  ? 306  VAL B CB    1 
ATOM   1605 C  CG1   . VAL A 1 243 ? -31.195 -24.602 -9.057  1.00 24.91  ? 306  VAL B CG1   1 
ATOM   1606 C  CG2   . VAL A 1 243 ? -31.640 -22.784 -10.576 1.00 24.09  ? 306  VAL B CG2   1 
ATOM   1607 N  N     . ILE A 1 244 ? -28.389 -26.059 -10.484 1.00 32.35  ? 307  ILE B N     1 
ATOM   1608 C  CA    . ILE A 1 244 ? -28.084 -27.422 -10.760 1.00 31.71  ? 307  ILE B CA    1 
ATOM   1609 C  C     . ILE A 1 244 ? -28.445 -28.107 -9.483  1.00 35.50  ? 307  ILE B C     1 
ATOM   1610 O  O     . ILE A 1 244 ? -27.865 -27.826 -8.494  1.00 34.78  ? 307  ILE B O     1 
ATOM   1611 C  CB    . ILE A 1 244 ? -26.604 -27.587 -11.006 1.00 30.40  ? 307  ILE B CB    1 
ATOM   1612 C  CG1   . ILE A 1 244 ? -26.314 -27.654 -12.475 1.00 30.36  ? 307  ILE B CG1   1 
ATOM   1613 C  CG2   . ILE A 1 244 ? -26.154 -28.902 -10.499 1.00 26.30  ? 307  ILE B CG2   1 
ATOM   1614 C  CD1   . ILE A 1 244 ? -26.875 -26.532 -13.243 1.00 30.98  ? 307  ILE B CD1   1 
ATOM   1615 N  N     . TYR A 1 245 ? -29.366 -29.049 -9.512  1.00 35.45  ? 308  TYR B N     1 
ATOM   1616 C  CA    . TYR A 1 245 ? -29.801 -29.695 -8.293  1.00 32.89  ? 308  TYR B CA    1 
ATOM   1617 C  C     . TYR A 1 245 ? -29.687 -31.197 -8.318  1.00 39.71  ? 308  TYR B C     1 
ATOM   1618 O  O     . TYR A 1 245 ? -29.955 -31.809 -9.285  1.00 41.02  ? 308  TYR B O     1 
ATOM   1619 C  CB    . TYR A 1 245 ? -31.225 -29.257 -8.001  1.00 27.93  ? 308  TYR B CB    1 
ATOM   1620 C  CG    . TYR A 1 245 ? -31.797 -29.727 -6.711  1.00 35.93  ? 308  TYR B CG    1 
ATOM   1621 C  CD1   . TYR A 1 245 ? -32.392 -30.944 -6.613  1.00 38.27  ? 308  TYR B CD1   1 
ATOM   1622 C  CD2   . TYR A 1 245 ? -31.785 -28.961 -5.610  1.00 36.42  ? 308  TYR B CD2   1 
ATOM   1623 C  CE1   . TYR A 1 245 ? -32.902 -31.393 -5.447  1.00 32.91  ? 308  TYR B CE1   1 
ATOM   1624 C  CE2   . TYR A 1 245 ? -32.312 -29.412 -4.455  1.00 28.14  ? 308  TYR B CE2   1 
ATOM   1625 C  CZ    . TYR A 1 245 ? -32.866 -30.624 -4.411  1.00 26.85  ? 308  TYR B CZ    1 
ATOM   1626 O  OH    . TYR A 1 245 ? -33.396 -31.101 -3.309  1.00 31.53  ? 308  TYR B OH    1 
ATOM   1627 N  N     . THR A 1 246 ? -29.234 -31.795 -7.253  1.00 38.36  ? 309  THR B N     1 
ATOM   1628 C  CA    . THR A 1 246 ? -29.148 -33.213 -7.238  1.00 38.32  ? 309  THR B CA    1 
ATOM   1629 C  C     . THR A 1 246 ? -29.360 -33.682 -5.853  1.00 43.55  ? 309  THR B C     1 
ATOM   1630 O  O     . THR A 1 246 ? -29.034 -33.032 -4.940  1.00 41.33  ? 309  THR B O     1 
ATOM   1631 C  CB    . THR A 1 246 ? -27.786 -33.676 -7.702  1.00 40.66  ? 309  THR B CB    1 
ATOM   1632 O  OG1   . THR A 1 246 ? -27.835 -35.037 -8.054  1.00 51.64  ? 309  THR B OG1   1 
ATOM   1633 C  CG2   . THR A 1 246 ? -26.857 -33.565 -6.647  1.00 37.56  ? 309  THR B CG2   1 
ATOM   1634 N  N     . ASP A 1 247 ? -29.926 -34.848 -5.714  1.00 52.80  ? 310  ASP B N     1 
ATOM   1635 C  CA    . ASP A 1 247 ? -30.142 -35.460 -4.426  1.00 43.36  ? 310  ASP B CA    1 
ATOM   1636 C  C     . ASP A 1 247 ? -29.124 -36.498 -4.147  1.00 46.38  ? 310  ASP B C     1 
ATOM   1637 O  O     . ASP A 1 247 ? -29.248 -37.250 -3.234  1.00 49.71  ? 310  ASP B O     1 
ATOM   1638 C  CB    . ASP A 1 247 ? -31.482 -36.127 -4.387  1.00 51.41  ? 310  ASP B CB    1 
ATOM   1639 C  CG    . ASP A 1 247 ? -32.497 -35.262 -3.841  1.00 63.35  ? 310  ASP B CG    1 
ATOM   1640 O  OD1   . ASP A 1 247 ? -32.255 -34.717 -2.769  1.00 58.86  ? 310  ASP B OD1   1 
ATOM   1641 O  OD2   . ASP A 1 247 ? -33.536 -35.119 -4.477  1.00 65.03  ? 310  ASP B OD2   1 
ATOM   1642 N  N     . TYR A 1 248 ? -28.098 -36.543 -4.936  1.00 43.63  ? 311  TYR B N     1 
ATOM   1643 C  CA    . TYR A 1 248 ? -27.122 -37.528 -4.792  1.00 47.49  ? 311  TYR B CA    1 
ATOM   1644 C  C     . TYR A 1 248 ? -26.402 -37.449 -3.502  1.00 49.52  ? 311  TYR B C     1 
ATOM   1645 O  O     . TYR A 1 248 ? -26.112 -36.398 -3.034  1.00 52.06  ? 311  TYR B O     1 
ATOM   1646 C  CB    . TYR A 1 248 ? -26.161 -37.345 -5.930  1.00 44.15  ? 311  TYR B CB    1 
ATOM   1647 C  CG    . TYR A 1 248 ? -25.120 -38.375 -5.967  1.00 52.57  ? 311  TYR B CG    1 
ATOM   1648 C  CD1   . TYR A 1 248 ? -25.423 -39.683 -5.866  1.00 50.48  ? 311  TYR B CD1   1 
ATOM   1649 C  CD2   . TYR A 1 248 ? -23.838 -38.032 -6.096  1.00 55.42  ? 311  TYR B CD2   1 
ATOM   1650 C  CE1   . TYR A 1 248 ? -24.447 -40.622 -5.881  1.00 57.27  ? 311  TYR B CE1   1 
ATOM   1651 C  CE2   . TYR A 1 248 ? -22.861 -38.960 -6.115  1.00 56.98  ? 311  TYR B CE2   1 
ATOM   1652 C  CZ    . TYR A 1 248 ? -23.170 -40.251 -6.013  1.00 59.33  ? 311  TYR B CZ    1 
ATOM   1653 O  OH    . TYR A 1 248 ? -22.161 -41.159 -6.042  1.00 57.29  ? 311  TYR B OH    1 
ATOM   1654 N  N     . ARG A 1 249 ? -26.168 -38.597 -2.900  1.00 49.89  ? 312  ARG B N     1 
ATOM   1655 C  CA    . ARG A 1 249 ? -25.365 -38.709 -1.732  1.00 48.78  ? 312  ARG B CA    1 
ATOM   1656 C  C     . ARG A 1 249 ? -24.344 -39.736 -2.105  1.00 53.07  ? 312  ARG B C     1 
ATOM   1657 O  O     . ARG A 1 249 ? -24.683 -40.829 -2.459  1.00 55.04  ? 312  ARG B O     1 
ATOM   1658 C  CB    . ARG A 1 249 ? -26.146 -39.243 -0.579  1.00 48.60  ? 312  ARG B CB    1 
ATOM   1659 C  CG    . ARG A 1 249 ? -27.284 -38.382 -0.146  1.00 53.95  ? 312  ARG B CG    1 
ATOM   1660 C  CD    . ARG A 1 249 ? -27.575 -38.575 1.315   1.00 44.88  ? 312  ARG B CD    1 
ATOM   1661 N  NE    . ARG A 1 249 ? -26.474 -38.056 2.080   1.00 49.46  ? 312  ARG B NE    1 
ATOM   1662 C  CZ    . ARG A 1 249 ? -26.626 -37.140 2.990   1.00 56.59  ? 312  ARG B CZ    1 
ATOM   1663 N  NH1   . ARG A 1 249 ? -27.838 -36.702 3.227   1.00 59.59  ? 312  ARG B NH1   1 
ATOM   1664 N  NH2   . ARG A 1 249 ? -25.597 -36.694 3.647   1.00 48.53  ? 312  ARG B NH2   1 
ATOM   1665 N  N     . PRO A 1 250 ? -23.075 -39.375 -2.067  1.00 55.87  ? 313  PRO B N     1 
ATOM   1666 C  CA    . PRO A 1 250 ? -21.990 -40.274 -2.375  1.00 50.26  ? 313  PRO B CA    1 
ATOM   1667 C  C     . PRO A 1 250 ? -21.887 -41.421 -1.471  1.00 44.08  ? 313  PRO B C     1 
ATOM   1668 O  O     . PRO A 1 250 ? -21.458 -42.447 -1.877  1.00 46.91  ? 313  PRO B O     1 
ATOM   1669 C  CB    . PRO A 1 250 ? -20.813 -39.382 -2.216  1.00 45.98  ? 313  PRO B CB    1 
ATOM   1670 C  CG    . PRO A 1 250 ? -21.285 -38.159 -2.864  1.00 50.71  ? 313  PRO B CG    1 
ATOM   1671 C  CD    . PRO A 1 250 ? -22.715 -38.021 -2.497  1.00 52.44  ? 313  PRO B CD    1 
ATOM   1672 N  N     . THR A 1 251 ? -22.152 -41.215 -0.216  1.00 38.62  ? 314  THR B N     1 
ATOM   1673 C  CA    . THR A 1 251 ? -22.106 -42.276 0.725   1.00 35.95  ? 314  THR B CA    1 
ATOM   1674 C  C     . THR A 1 251 ? -23.496 -42.325 1.226   1.00 42.86  ? 314  THR B C     1 
ATOM   1675 O  O     . THR A 1 251 ? -23.909 -41.413 1.840   1.00 48.88  ? 314  THR B O     1 
ATOM   1676 C  CB    . THR A 1 251 ? -21.259 -41.837 1.893   1.00 36.51  ? 314  THR B CB    1 
ATOM   1677 O  OG1   . THR A 1 251 ? -19.922 -41.725 1.493   1.00 36.32  ? 314  THR B OG1   1 
ATOM   1678 C  CG2   . THR A 1 251 ? -21.309 -42.802 2.939   1.00 40.81  ? 314  THR B CG2   1 
ATOM   1679 N  N     . PRO A 1 252 ? -24.216 -43.409 1.011   1.00 44.51  ? 315  PRO B N     1 
ATOM   1680 C  CA    . PRO A 1 252 ? -25.593 -43.547 1.450   1.00 38.31  ? 315  PRO B CA    1 
ATOM   1681 C  C     . PRO A 1 252 ? -25.787 -43.755 2.924   1.00 37.86  ? 315  PRO B C     1 
ATOM   1682 O  O     . PRO A 1 252 ? -24.929 -44.238 3.584   1.00 40.17  ? 315  PRO B O     1 
ATOM   1683 C  CB    . PRO A 1 252 ? -26.044 -44.767 0.706   1.00 38.81  ? 315  PRO B CB    1 
ATOM   1684 C  CG    . PRO A 1 252 ? -25.218 -44.776 -0.481  1.00 36.70  ? 315  PRO B CG    1 
ATOM   1685 C  CD    . PRO A 1 252 ? -23.894 -44.442 0.038   1.00 44.56  ? 315  PRO B CD    1 
ATOM   1686 N  N     . LEU A 1 253 ? -26.967 -43.437 3.405   1.00 32.35  ? 316  LEU B N     1 
ATOM   1687 C  CA    . LEU A 1 253 ? -27.304 -43.525 4.799   1.00 33.74  ? 316  LEU B CA    1 
ATOM   1688 C  C     . LEU A 1 253 ? -28.445 -44.431 5.098   1.00 34.15  ? 316  LEU B C     1 
ATOM   1689 O  O     . LEU A 1 253 ? -29.324 -44.515 4.348   1.00 30.87  ? 316  LEU B O     1 
ATOM   1690 C  CB    . LEU A 1 253 ? -27.776 -42.175 5.243   1.00 32.23  ? 316  LEU B CB    1 
ATOM   1691 C  CG    . LEU A 1 253 ? -26.991 -41.032 5.805   1.00 37.13  ? 316  LEU B CG    1 
ATOM   1692 C  CD1   . LEU A 1 253 ? -25.610 -40.838 5.261   1.00 40.78  ? 316  LEU B CD1   1 
ATOM   1693 C  CD2   . LEU A 1 253 ? -27.832 -39.851 5.449   1.00 48.07  ? 316  LEU B CD2   1 
ATOM   1694 N  N     . GLN A 1 254 ? -28.408 -45.131 6.205   1.00 34.04  ? 317  GLN B N     1 
ATOM   1695 C  CA    . GLN A 1 254 ? -29.509 -45.939 6.612   1.00 33.40  ? 317  GLN B CA    1 
ATOM   1696 C  C     . GLN A 1 254 ? -29.881 -45.407 7.944   1.00 39.77  ? 317  GLN B C     1 
ATOM   1697 O  O     . GLN A 1 254 ? -29.119 -45.475 8.813   1.00 42.71  ? 317  GLN B O     1 
ATOM   1698 C  CB    . GLN A 1 254 ? -29.063 -47.374 6.736   1.00 38.10  ? 317  GLN B CB    1 
ATOM   1699 C  CG    . GLN A 1 254 ? -27.603 -47.527 7.106   1.00 47.28  ? 317  GLN B CG    1 
ATOM   1700 C  CD    . GLN A 1 254 ? -27.058 -48.921 6.902   1.00 60.70  ? 317  GLN B CD    1 
ATOM   1701 O  OE1   . GLN A 1 254 ? -26.144 -49.356 7.563   1.00 55.34  ? 317  GLN B OE1   1 
ATOM   1702 N  NE2   . GLN A 1 254 ? -27.616 -49.608 5.969   1.00 62.43  ? 317  GLN B NE2   1 
ATOM   1703 N  N     . HIS A 1 255 ? -31.101 -44.946 8.111   1.00 36.00  ? 318  HIS B N     1 
ATOM   1704 C  CA    . HIS A 1 255 ? -31.597 -44.343 9.330   1.00 28.69  ? 318  HIS B CA    1 
ATOM   1705 C  C     . HIS A 1 255 ? -32.325 -45.217 10.231  1.00 31.33  ? 318  HIS B C     1 
ATOM   1706 O  O     . HIS A 1 255 ? -33.144 -45.913 9.826   1.00 37.27  ? 318  HIS B O     1 
ATOM   1707 C  CB    . HIS A 1 255 ? -32.600 -43.304 8.986   1.00 33.74  ? 318  HIS B CB    1 
ATOM   1708 C  CG    . HIS A 1 255 ? -32.122 -42.338 7.978   1.00 29.82  ? 318  HIS B CG    1 
ATOM   1709 N  ND1   . HIS A 1 255 ? -32.301 -42.527 6.648   1.00 31.12  ? 318  HIS B ND1   1 
ATOM   1710 C  CD2   . HIS A 1 255 ? -31.450 -41.189 8.106   1.00 33.15  ? 318  HIS B CD2   1 
ATOM   1711 C  CE1   . HIS A 1 255 ? -31.762 -41.534 5.994   1.00 33.97  ? 318  HIS B CE1   1 
ATOM   1712 N  NE2   . HIS A 1 255 ? -31.244 -40.705 6.859   1.00 28.06  ? 318  HIS B NE2   1 
ATOM   1713 N  N     . TYR A 1 256 ? -32.067 -45.095 11.507  1.00 33.54  ? 319  TYR B N     1 
ATOM   1714 C  CA    . TYR A 1 256 ? -32.708 -45.928 12.473  1.00 30.98  ? 319  TYR B CA    1 
ATOM   1715 C  C     . TYR A 1 256 ? -33.382 -45.210 13.572  1.00 35.58  ? 319  TYR B C     1 
ATOM   1716 O  O     . TYR A 1 256 ? -33.042 -44.149 13.872  1.00 35.57  ? 319  TYR B O     1 
ATOM   1717 C  CB    . TYR A 1 256 ? -31.688 -46.824 13.132  1.00 33.70  ? 319  TYR B CB    1 
ATOM   1718 C  CG    . TYR A 1 256 ? -31.100 -47.848 12.266  1.00 32.10  ? 319  TYR B CG    1 
ATOM   1719 C  CD1   . TYR A 1 256 ? -30.083 -47.557 11.481  1.00 32.85  ? 319  TYR B CD1   1 
ATOM   1720 C  CD2   . TYR A 1 256 ? -31.560 -49.091 12.259  1.00 31.86  ? 319  TYR B CD2   1 
ATOM   1721 C  CE1   . TYR A 1 256 ? -29.546 -48.479 10.668  1.00 38.30  ? 319  TYR B CE1   1 
ATOM   1722 C  CE2   . TYR A 1 256 ? -31.024 -50.024 11.465  1.00 36.82  ? 319  TYR B CE2   1 
ATOM   1723 C  CZ    . TYR A 1 256 ? -30.008 -49.699 10.667  1.00 40.98  ? 319  TYR B CZ    1 
ATOM   1724 O  OH    . TYR A 1 256 ? -29.440 -50.613 9.847   1.00 45.97  ? 319  TYR B OH    1 
ATOM   1725 N  N     . ILE A 1 257 ? -34.389 -45.816 14.151  1.00 36.07  ? 320  ILE B N     1 
ATOM   1726 C  CA    . ILE A 1 257 ? -35.084 -45.272 15.291  1.00 38.40  ? 320  ILE B CA    1 
ATOM   1727 C  C     . ILE A 1 257 ? -35.019 -46.288 16.384  1.00 39.02  ? 320  ILE B C     1 
ATOM   1728 O  O     . ILE A 1 257 ? -35.281 -47.413 16.178  1.00 41.10  ? 320  ILE B O     1 
ATOM   1729 C  CB    . ILE A 1 257 ? -36.566 -44.962 15.020  1.00 40.93  ? 320  ILE B CB    1 
ATOM   1730 C  CG1   . ILE A 1 257 ? -36.733 -43.715 14.185  1.00 36.96  ? 320  ILE B CG1   1 
ATOM   1731 C  CG2   . ILE A 1 257 ? -37.320 -44.637 16.293  1.00 38.21  ? 320  ILE B CG2   1 
ATOM   1732 C  CD1   . ILE A 1 257 ? -38.106 -43.147 14.229  1.00 28.58  ? 320  ILE B CD1   1 
ATOM   1733 N  N     . PHE A 1 258 ? -34.616 -45.872 17.558  1.00 43.53  ? 321  PHE B N     1 
ATOM   1734 C  CA    . PHE A 1 258 ? -34.579 -46.726 18.691  1.00 47.11  ? 321  PHE B CA    1 
ATOM   1735 C  C     . PHE A 1 258 ? -35.663 -46.252 19.567  1.00 44.57  ? 321  PHE B C     1 
ATOM   1736 O  O     . PHE A 1 258 ? -35.649 -45.137 19.942  1.00 43.86  ? 321  PHE B O     1 
ATOM   1737 C  CB    . PHE A 1 258 ? -33.331 -46.487 19.467  1.00 45.19  ? 321  PHE B CB    1 
ATOM   1738 C  CG    . PHE A 1 258 ? -33.272 -47.265 20.702  1.00 53.39  ? 321  PHE B CG    1 
ATOM   1739 C  CD1   . PHE A 1 258 ? -32.938 -48.586 20.673  1.00 56.50  ? 321  PHE B CD1   1 
ATOM   1740 C  CD2   . PHE A 1 258 ? -33.590 -46.695 21.884  1.00 52.96  ? 321  PHE B CD2   1 
ATOM   1741 C  CE1   . PHE A 1 258 ? -32.907 -49.324 21.810  1.00 50.02  ? 321  PHE B CE1   1 
ATOM   1742 C  CE2   . PHE A 1 258 ? -33.571 -47.432 23.033  1.00 54.10  ? 321  PHE B CE2   1 
ATOM   1743 C  CZ    . PHE A 1 258 ? -33.225 -48.746 22.994  1.00 49.69  ? 321  PHE B CZ    1 
ATOM   1744 N  N     . PRO A 1 259 ? -36.598 -47.105 19.921  1.00 45.04  ? 322  PRO B N     1 
ATOM   1745 C  CA    . PRO A 1 259 ? -37.651 -46.639 20.773  1.00 43.56  ? 322  PRO B CA    1 
ATOM   1746 C  C     . PRO A 1 259 ? -37.241 -46.866 22.163  1.00 55.67  ? 322  PRO B C     1 
ATOM   1747 O  O     . PRO A 1 259 ? -36.700 -47.893 22.430  1.00 54.64  ? 322  PRO B O     1 
ATOM   1748 C  CB    . PRO A 1 259 ? -38.754 -47.590 20.490  1.00 40.46  ? 322  PRO B CB    1 
ATOM   1749 C  CG    . PRO A 1 259 ? -38.295 -48.441 19.422  1.00 46.64  ? 322  PRO B CG    1 
ATOM   1750 C  CD    . PRO A 1 259 ? -36.851 -48.463 19.521  1.00 47.32  ? 322  PRO B CD    1 
ATOM   1751 N  N     . ALA A 1 260 ? -37.507 -45.946 23.058  1.00 58.81  ? 323  ALA B N     1 
ATOM   1752 C  CA    . ALA A 1 260 ? -37.088 -46.128 24.408  1.00 51.83  ? 323  ALA B CA    1 
ATOM   1753 C  C     . ALA A 1 260 ? -37.755 -47.324 25.001  1.00 57.02  ? 323  ALA B C     1 
ATOM   1754 O  O     . ALA A 1 260 ? -38.946 -47.530 24.872  1.00 51.21  ? 323  ALA B O     1 
ATOM   1755 C  CB    . ALA A 1 260 ? -37.407 -44.901 25.203  1.00 53.03  ? 323  ALA B CB    1 
ATOM   1756 N  N     . GLY A 1 261 ? -36.952 -48.106 25.700  1.00 58.03  ? 324  GLY B N     1 
ATOM   1757 C  CA    . GLY A 1 261 ? -37.387 -49.330 26.303  1.00 49.31  ? 324  GLY B CA    1 
ATOM   1758 C  C     . GLY A 1 261 ? -37.490 -50.425 25.294  1.00 54.41  ? 324  GLY B C     1 
ATOM   1759 O  O     . GLY A 1 261 ? -38.182 -51.379 25.500  1.00 57.05  ? 324  GLY B O     1 
ATOM   1760 N  N     . GLY A 1 262 ? -36.799 -50.292 24.191  1.00 50.83  ? 325  GLY B N     1 
ATOM   1761 C  CA    . GLY A 1 262 ? -36.888 -51.261 23.153  1.00 45.97  ? 325  GLY B CA    1 
ATOM   1762 C  C     . GLY A 1 262 ? -35.687 -52.109 23.140  1.00 52.80  ? 325  GLY B C     1 
ATOM   1763 O  O     . GLY A 1 262 ? -34.678 -51.738 23.632  1.00 56.14  ? 325  GLY B O     1 
ATOM   1764 N  N     . ASP A 1 263 ? -35.831 -53.310 22.644  1.00 60.15  ? 326  ASP B N     1 
ATOM   1765 C  CA    . ASP A 1 263 ? -34.719 -54.208 22.569  1.00 56.62  ? 326  ASP B CA    1 
ATOM   1766 C  C     . ASP A 1 263 ? -33.741 -53.832 21.521  1.00 60.90  ? 326  ASP B C     1 
ATOM   1767 O  O     . ASP A 1 263 ? -32.628 -54.179 21.633  1.00 68.34  ? 326  ASP B O     1 
ATOM   1768 C  CB    . ASP A 1 263 ? -35.158 -55.660 22.462  1.00 57.14  ? 326  ASP B CB    1 
ATOM   1769 C  CG    . ASP A 1 263 ? -35.398 -56.313 23.824  1.00 68.77  ? 326  ASP B CG    1 
ATOM   1770 O  OD1   . ASP A 1 263 ? -35.904 -55.671 24.746  1.00 65.35  ? 326  ASP B OD1   1 
ATOM   1771 O  OD2   . ASP A 1 263 ? -35.105 -57.497 23.972  1.00 62.90  ? 326  ASP B OD2   1 
ATOM   1772 N  N     . GLY A 1 264 ? -34.139 -53.137 20.479  1.00 58.18  ? 327  GLY B N     1 
ATOM   1773 C  CA    . GLY A 1 264 ? -33.203 -52.783 19.421  1.00 57.36  ? 327  GLY B CA    1 
ATOM   1774 C  C     . GLY A 1 264 ? -33.557 -51.657 18.482  1.00 52.53  ? 327  GLY B C     1 
ATOM   1775 O  O     . GLY A 1 264 ? -34.608 -51.092 18.613  1.00 52.88  ? 327  GLY B O     1 
ATOM   1776 N  N     . LEU A 1 265 ? -32.637 -51.311 17.585  1.00 49.99  ? 328  LEU B N     1 
ATOM   1777 C  CA    . LEU A 1 265 ? -32.806 -50.276 16.563  1.00 47.33  ? 328  LEU B CA    1 
ATOM   1778 C  C     . LEU A 1 265 ? -33.558 -50.750 15.370  1.00 42.48  ? 328  LEU B C     1 
ATOM   1779 O  O     . LEU A 1 265 ? -33.330 -51.804 14.932  1.00 46.53  ? 328  LEU B O     1 
ATOM   1780 C  CB    . LEU A 1 265 ? -31.471 -49.877 16.036  1.00 36.73  ? 328  LEU B CB    1 
ATOM   1781 C  CG    . LEU A 1 265 ? -30.634 -48.774 16.565  1.00 35.42  ? 328  LEU B CG    1 
ATOM   1782 C  CD1   . LEU A 1 265 ? -30.332 -49.003 17.982  1.00 45.08  ? 328  LEU B CD1   1 
ATOM   1783 C  CD2   . LEU A 1 265 ? -29.372 -48.904 15.803  1.00 33.45  ? 328  LEU B CD2   1 
ATOM   1784 N  N     . HIS A 1 266 ? -34.419 -49.930 14.818  1.00 33.96  ? 329  HIS B N     1 
ATOM   1785 C  CA    . HIS A 1 266 ? -35.211 -50.276 13.659  1.00 35.82  ? 329  HIS B CA    1 
ATOM   1786 C  C     . HIS A 1 266 ? -34.940 -49.391 12.465  1.00 40.05  ? 329  HIS B C     1 
ATOM   1787 O  O     . HIS A 1 266 ? -34.912 -48.233 12.595  1.00 34.55  ? 329  HIS B O     1 
ATOM   1788 C  CB    . HIS A 1 266 ? -36.671 -50.131 13.964  1.00 36.22  ? 329  HIS B CB    1 
ATOM   1789 C  CG    . HIS A 1 266 ? -37.170 -51.043 15.014  1.00 37.88  ? 329  HIS B CG    1 
ATOM   1790 N  ND1   . HIS A 1 266 ? -36.943 -50.823 16.340  1.00 46.51  ? 329  HIS B ND1   1 
ATOM   1791 C  CD2   . HIS A 1 266 ? -37.945 -52.134 14.943  1.00 39.98  ? 329  HIS B CD2   1 
ATOM   1792 C  CE1   . HIS A 1 266 ? -37.524 -51.761 17.048  1.00 46.03  ? 329  HIS B CE1   1 
ATOM   1793 N  NE2   . HIS A 1 266 ? -38.137 -52.569 16.219  1.00 48.95  ? 329  HIS B NE2   1 
ATOM   1794 N  N     . LEU A 1 267 ? -34.852 -49.957 11.281  1.00 35.22  ? 330  LEU B N     1 
ATOM   1795 C  CA    . LEU A 1 267 ? -34.541 -49.211 10.097  1.00 33.40  ? 330  LEU B CA    1 
ATOM   1796 C  C     . LEU A 1 267 ? -35.704 -48.544 9.425   1.00 34.88  ? 330  LEU B C     1 
ATOM   1797 O  O     . LEU A 1 267 ? -36.298 -49.114 8.599   1.00 40.32  ? 330  LEU B O     1 
ATOM   1798 C  CB    . LEU A 1 267 ? -33.942 -50.178 9.126   1.00 31.73  ? 330  LEU B CB    1 
ATOM   1799 C  CG    . LEU A 1 267 ? -33.522 -49.542 7.854   1.00 32.40  ? 330  LEU B CG    1 
ATOM   1800 C  CD1   . LEU A 1 267 ? -32.234 -48.862 8.094   1.00 39.09  ? 330  LEU B CD1   1 
ATOM   1801 C  CD2   . LEU A 1 267 ? -33.294 -50.568 6.814   1.00 35.08  ? 330  LEU B CD2   1 
ATOM   1802 N  N     . VAL A 1 268 ? -36.018 -47.326 9.815   1.00 32.30  ? 331  VAL B N     1 
ATOM   1803 C  CA    . VAL A 1 268 ? -37.097 -46.504 9.284   1.00 30.53  ? 331  VAL B CA    1 
ATOM   1804 C  C     . VAL A 1 268 ? -36.978 -45.930 7.866   1.00 34.32  ? 331  VAL B C     1 
ATOM   1805 O  O     . VAL A 1 268 ? -37.948 -45.651 7.230   1.00 33.76  ? 331  VAL B O     1 
ATOM   1806 C  CB    . VAL A 1 268 ? -37.564 -45.472 10.319  1.00 29.85  ? 331  VAL B CB    1 
ATOM   1807 C  CG1   . VAL A 1 268 ? -38.010 -46.180 11.559  1.00 34.26  ? 331  VAL B CG1   1 
ATOM   1808 C  CG2   . VAL A 1 268 ? -36.471 -44.515 10.658  1.00 29.02  ? 331  VAL B CG2   1 
ATOM   1809 N  N     . VAL A 1 269 ? -35.783 -45.623 7.430   1.00 32.39  ? 332  VAL B N     1 
ATOM   1810 C  CA    . VAL A 1 269 ? -35.561 -45.145 6.102   1.00 31.24  ? 332  VAL B CA    1 
ATOM   1811 C  C     . VAL A 1 269 ? -34.425 -45.968 5.508   1.00 35.88  ? 332  VAL B C     1 
ATOM   1812 O  O     . VAL A 1 269 ? -33.528 -46.270 6.191   1.00 32.50  ? 332  VAL B O     1 
ATOM   1813 C  CB    . VAL A 1 269 ? -35.292 -43.656 6.094   1.00 30.68  ? 332  VAL B CB    1 
ATOM   1814 C  CG1   . VAL A 1 269 ? -34.849 -43.199 4.748   1.00 29.05  ? 332  VAL B CG1   1 
ATOM   1815 C  CG2   . VAL A 1 269 ? -36.517 -42.888 6.428   1.00 29.07  ? 332  VAL B CG2   1 
ATOM   1816 N  N     . ASP A 1 270 ? -34.502 -46.403 4.267   1.00 32.88  ? 333  ASP B N     1 
ATOM   1817 C  CA    . ASP A 1 270 ? -33.399 -47.178 3.726   1.00 33.20  ? 333  ASP B CA    1 
ATOM   1818 C  C     . ASP A 1 270 ? -32.326 -46.455 3.029   1.00 39.07  ? 333  ASP B C     1 
ATOM   1819 O  O     . ASP A 1 270 ? -32.304 -45.270 2.898   1.00 40.94  ? 333  ASP B O     1 
ATOM   1820 C  CB    . ASP A 1 270 ? -33.767 -48.409 2.893   1.00 37.41  ? 333  ASP B CB    1 
ATOM   1821 C  CG    . ASP A 1 270 ? -34.802 -48.178 1.947   1.00 30.51  ? 333  ASP B CG    1 
ATOM   1822 O  OD1   . ASP A 1 270 ? -34.936 -47.107 1.523   1.00 35.15  ? 333  ASP B OD1   1 
ATOM   1823 O  OD2   . ASP A 1 270 ? -35.517 -49.068 1.631   1.00 31.36  ? 333  ASP B OD2   1 
ATOM   1824 N  N     . GLU A 1 271 ? -31.417 -47.242 2.516   1.00 34.60  ? 334  GLU B N     1 
ATOM   1825 C  CA    . GLU A 1 271 ? -30.306 -46.730 1.786   1.00 35.78  ? 334  GLU B CA    1 
ATOM   1826 C  C     . GLU A 1 271 ? -30.753 -46.088 0.516   1.00 33.23  ? 334  GLU B C     1 
ATOM   1827 O  O     . GLU A 1 271 ? -30.062 -45.339 -0.061  1.00 26.55  ? 334  GLU B O     1 
ATOM   1828 C  CB    . GLU A 1 271 ? -29.309 -47.829 1.512   1.00 38.37  ? 334  GLU B CB    1 
ATOM   1829 C  CG    . GLU A 1 271 ? -28.350 -48.118 2.629   1.00 47.68  ? 334  GLU B CG    1 
ATOM   1830 C  CD    . GLU A 1 271 ? -27.180 -48.926 2.173   1.00 62.42  ? 334  GLU B CD    1 
ATOM   1831 O  OE1   . GLU A 1 271 ? -27.289 -49.622 1.171   1.00 65.33  ? 334  GLU B OE1   1 
ATOM   1832 O  OE2   . GLU A 1 271 ? -26.133 -48.856 2.800   1.00 56.89  ? 334  GLU B OE2   1 
ATOM   1833 N  N     . ASN A 1 272 ? -31.910 -46.452 0.054   1.00 35.10  ? 335  ASN B N     1 
ATOM   1834 C  CA    . ASN A 1 272 ? -32.448 -45.911 -1.144  1.00 29.52  ? 335  ASN B CA    1 
ATOM   1835 C  C     . ASN A 1 272 ? -33.343 -44.750 -0.935  1.00 35.93  ? 335  ASN B C     1 
ATOM   1836 O  O     . ASN A 1 272 ? -33.943 -44.293 -1.850  1.00 38.57  ? 335  ASN B O     1 
ATOM   1837 C  CB    . ASN A 1 272 ? -33.252 -46.946 -1.838  1.00 35.25  ? 335  ASN B CB    1 
ATOM   1838 C  CG    . ASN A 1 272 ? -33.581 -46.570 -3.250  1.00 45.40  ? 335  ASN B CG    1 
ATOM   1839 O  OD1   . ASN A 1 272 ? -34.714 -46.368 -3.591  1.00 43.91  ? 335  ASN B OD1   1 
ATOM   1840 N  ND2   . ASN A 1 272 ? -32.584 -46.496 -4.079  1.00 41.73  ? 335  ASN B ND2   1 
ATOM   1841 N  N     . GLY A 1 273 ? -33.430 -44.260 0.291   1.00 40.29  ? 336  GLY B N     1 
ATOM   1842 C  CA    . GLY A 1 273 ? -34.254 -43.110 0.601   1.00 22.83  ? 336  GLY B CA    1 
ATOM   1843 C  C     . GLY A 1 273 ? -35.709 -43.413 0.859   1.00 30.36  ? 336  GLY B C     1 
ATOM   1844 O  O     . GLY A 1 273 ? -36.499 -42.509 1.038   1.00 27.72  ? 336  GLY B O     1 
ATOM   1845 N  N     . ASP A 1 274 ? -36.058 -44.690 0.858   1.00 36.19  ? 337  ASP B N     1 
ATOM   1846 C  CA    . ASP A 1 274 ? -37.416 -45.139 1.137   1.00 28.53  ? 337  ASP B CA    1 
ATOM   1847 C  C     . ASP A 1 274 ? -37.752 -45.280 2.614   1.00 35.59  ? 337  ASP B C     1 
ATOM   1848 O  O     . ASP A 1 274 ? -36.892 -45.528 3.433   1.00 37.28  ? 337  ASP B O     1 
ATOM   1849 C  CB    . ASP A 1 274 ? -37.706 -46.434 0.400   1.00 35.82  ? 337  ASP B CB    1 
ATOM   1850 C  CG    . ASP A 1 274 ? -37.778 -46.242 -1.083  1.00 44.19  ? 337  ASP B CG    1 
ATOM   1851 O  OD1   . ASP A 1 274 ? -37.938 -45.106 -1.530  1.00 44.32  ? 337  ASP B OD1   1 
ATOM   1852 O  OD2   . ASP A 1 274 ? -37.666 -47.227 -1.812  1.00 52.19  ? 337  ASP B OD2   1 
ATOM   1853 N  N     . PHE A 1 275 ? -39.028 -45.147 2.931   1.00 32.25  ? 338  PHE B N     1 
ATOM   1854 C  CA    . PHE A 1 275 ? -39.507 -45.127 4.291   1.00 24.60  ? 338  PHE B CA    1 
ATOM   1855 C  C     . PHE A 1 275 ? -40.178 -46.443 4.576   1.00 25.15  ? 338  PHE B C     1 
ATOM   1856 O  O     . PHE A 1 275 ? -41.051 -46.870 3.849   1.00 32.24  ? 338  PHE B O     1 
ATOM   1857 C  CB    . PHE A 1 275 ? -40.499 -43.979 4.430   1.00 23.76  ? 338  PHE B CB    1 
ATOM   1858 C  CG    . PHE A 1 275 ? -41.278 -43.971 5.710   1.00 25.21  ? 338  PHE B CG    1 
ATOM   1859 C  CD1   . PHE A 1 275 ? -40.736 -43.466 6.860   1.00 27.19  ? 338  PHE B CD1   1 
ATOM   1860 C  CD2   . PHE A 1 275 ? -42.573 -44.430 5.744   1.00 28.27  ? 338  PHE B CD2   1 
ATOM   1861 C  CE1   . PHE A 1 275 ? -41.455 -43.443 8.027   1.00 27.23  ? 338  PHE B CE1   1 
ATOM   1862 C  CE2   . PHE A 1 275 ? -43.299 -44.408 6.909   1.00 27.79  ? 338  PHE B CE2   1 
ATOM   1863 C  CZ    . PHE A 1 275 ? -42.738 -43.906 8.050   1.00 28.24  ? 338  PHE B CZ    1 
ATOM   1864 N  N     . ARG A 1 276 ? -39.746 -47.103 5.636   1.00 26.59  ? 339  ARG B N     1 
ATOM   1865 C  CA    . ARG A 1 276 ? -40.288 -48.369 5.978   1.00 31.44  ? 339  ARG B CA    1 
ATOM   1866 C  C     . ARG A 1 276 ? -41.160 -48.151 7.100   1.00 32.36  ? 339  ARG B C     1 
ATOM   1867 O  O     . ARG A 1 276 ? -40.719 -48.008 8.157   1.00 33.48  ? 339  ARG B O     1 
ATOM   1868 C  CB    . ARG A 1 276 ? -39.198 -49.297 6.410   1.00 27.44  ? 339  ARG B CB    1 
ATOM   1869 C  CG    . ARG A 1 276 ? -38.216 -49.621 5.333   1.00 29.14  ? 339  ARG B CG    1 
ATOM   1870 C  CD    . ARG A 1 276 ? -38.680 -50.720 4.439   1.00 24.49  ? 339  ARG B CD    1 
ATOM   1871 N  NE    . ARG A 1 276 ? -39.114 -51.875 5.168   1.00 29.70  ? 339  ARG B NE    1 
ATOM   1872 C  CZ    . ARG A 1 276 ? -38.414 -52.975 5.300   1.00 32.35  ? 339  ARG B CZ    1 
ATOM   1873 N  NH1   . ARG A 1 276 ? -37.254 -53.050 4.794   1.00 32.35  ? 339  ARG B NH1   1 
ATOM   1874 N  NH2   . ARG A 1 276 ? -38.865 -53.988 5.939   1.00 33.20  ? 339  ARG B NH2   1 
ATOM   1875 N  N     . GLU A 1 277 ? -42.435 -48.125 6.822   1.00 30.59  ? 340  GLU B N     1 
ATOM   1876 C  CA    . GLU A 1 277 ? -43.456 -47.903 7.786   1.00 29.44  ? 340  GLU B CA    1 
ATOM   1877 C  C     . GLU A 1 277 ? -43.645 -49.013 8.751   1.00 33.48  ? 340  GLU B C     1 
ATOM   1878 O  O     . GLU A 1 277 ? -43.902 -48.811 9.884   1.00 36.87  ? 340  GLU B O     1 
ATOM   1879 C  CB    . GLU A 1 277 ? -44.737 -47.482 7.138   1.00 30.64  ? 340  GLU B CB    1 
ATOM   1880 C  CG    . GLU A 1 277 ? -45.566 -46.640 8.070   1.00 40.40  ? 340  GLU B CG    1 
ATOM   1881 C  CD    . GLU A 1 277 ? -46.965 -46.469 7.613   1.00 54.85  ? 340  GLU B CD    1 
ATOM   1882 O  OE1   . GLU A 1 277 ? -47.152 -46.081 6.474   1.00 62.22  ? 340  GLU B OE1   1 
ATOM   1883 O  OE2   . GLU A 1 277 ? -47.872 -46.713 8.394   1.00 49.04  ? 340  GLU B OE2   1 
ATOM   1884 N  N     . ASP A 1 278 ? -43.458 -50.222 8.302   1.00 36.74  ? 341  ASP B N     1 
ATOM   1885 C  CA    . ASP A 1 278 ? -43.615 -51.346 9.149   1.00 33.19  ? 341  ASP B CA    1 
ATOM   1886 C  C     . ASP A 1 278 ? -42.685 -51.325 10.299  1.00 35.67  ? 341  ASP B C     1 
ATOM   1887 O  O     . ASP A 1 278 ? -43.028 -51.789 11.311  1.00 43.46  ? 341  ASP B O     1 
ATOM   1888 C  CB    . ASP A 1 278 ? -43.362 -52.598 8.365   1.00 34.04  ? 341  ASP B CB    1 
ATOM   1889 C  CG    . ASP A 1 278 ? -42.320 -52.431 7.360   1.00 37.78  ? 341  ASP B CG    1 
ATOM   1890 O  OD1   . ASP A 1 278 ? -42.339 -51.413 6.723   1.00 38.75  ? 341  ASP B OD1   1 
ATOM   1891 O  OD2   . ASP A 1 278 ? -41.498 -53.307 7.190   1.00 34.65  ? 341  ASP B OD2   1 
ATOM   1892 N  N     . ASN A 1 279 ? -41.450 -50.935 10.105  1.00 32.90  ? 342  ASN B N     1 
ATOM   1893 C  CA    . ASN A 1 279 ? -40.490 -50.765 11.131  1.00 32.02  ? 342  ASN B CA    1 
ATOM   1894 C  C     . ASN A 1 279 ? -40.865 -49.620 11.977  1.00 36.50  ? 342  ASN B C     1 
ATOM   1895 O  O     . ASN A 1 279 ? -40.571 -49.603 13.106  1.00 41.38  ? 342  ASN B O     1 
ATOM   1896 C  CB    . ASN A 1 279 ? -39.168 -50.448 10.532  1.00 34.56  ? 342  ASN B CB    1 
ATOM   1897 C  CG    . ASN A 1 279 ? -38.589 -51.579 9.799   1.00 38.35  ? 342  ASN B CG    1 
ATOM   1898 O  OD1   . ASN A 1 279 ? -39.063 -52.642 9.873   1.00 39.70  ? 342  ASN B OD1   1 
ATOM   1899 N  ND2   . ASN A 1 279 ? -37.572 -51.335 9.080   1.00 35.49  ? 342  ASN B ND2   1 
ATOM   1900 N  N     . PHE A 1 280 ? -41.386 -48.572 11.393  1.00 38.95  ? 343  PHE B N     1 
ATOM   1901 C  CA    . PHE A 1 280 ? -41.775 -47.411 12.149  1.00 37.16  ? 343  PHE B CA    1 
ATOM   1902 C  C     . PHE A 1 280 ? -42.881 -47.773 13.040  1.00 36.98  ? 343  PHE B C     1 
ATOM   1903 O  O     . PHE A 1 280 ? -42.852 -47.507 14.190  1.00 39.90  ? 343  PHE B O     1 
ATOM   1904 C  CB    . PHE A 1 280 ? -42.187 -46.280 11.213  1.00 33.94  ? 343  PHE B CB    1 
ATOM   1905 C  CG    . PHE A 1 280 ? -42.310 -44.957 11.880  1.00 32.61  ? 343  PHE B CG    1 
ATOM   1906 C  CD1   . PHE A 1 280 ? -41.238 -44.156 12.041  1.00 34.00  ? 343  PHE B CD1   1 
ATOM   1907 C  CD2   . PHE A 1 280 ? -43.492 -44.551 12.356  1.00 32.15  ? 343  PHE B CD2   1 
ATOM   1908 C  CE1   . PHE A 1 280 ? -41.339 -42.986 12.682  1.00 37.50  ? 343  PHE B CE1   1 
ATOM   1909 C  CE2   . PHE A 1 280 ? -43.605 -43.382 12.995  1.00 36.01  ? 343  PHE B CE2   1 
ATOM   1910 C  CZ    . PHE A 1 280 ? -42.530 -42.597 13.164  1.00 37.17  ? 343  PHE B CZ    1 
ATOM   1911 N  N     . ASN A 1 281 ? -43.852 -48.457 12.508  1.00 37.73  ? 344  ASN B N     1 
ATOM   1912 C  CA    . ASN A 1 281 ? -44.958 -48.839 13.323  1.00 39.12  ? 344  ASN B CA    1 
ATOM   1913 C  C     . ASN A 1 281 ? -44.510 -49.799 14.368  1.00 43.83  ? 344  ASN B C     1 
ATOM   1914 O  O     . ASN A 1 281 ? -44.800 -49.624 15.497  1.00 44.86  ? 344  ASN B O     1 
ATOM   1915 C  CB    . ASN A 1 281 ? -46.073 -49.396 12.473  1.00 41.20  ? 344  ASN B CB    1 
ATOM   1916 C  CG    . ASN A 1 281 ? -46.832 -48.331 11.751  1.00 45.19  ? 344  ASN B CG    1 
ATOM   1917 O  OD1   . ASN A 1 281 ? -47.459 -48.575 10.751  1.00 44.67  ? 344  ASN B OD1   1 
ATOM   1918 N  ND2   . ASN A 1 281 ? -46.792 -47.156 12.268  1.00 44.46  ? 344  ASN B ND2   1 
ATOM   1919 N  N     . THR A 1 282 ? -43.700 -50.761 14.007  1.00 44.30  ? 345  THR B N     1 
ATOM   1920 C  CA    . THR A 1 282 ? -43.221 -51.723 14.957  1.00 45.17  ? 345  THR B CA    1 
ATOM   1921 C  C     . THR A 1 282 ? -42.421 -51.071 16.041  1.00 46.75  ? 345  THR B C     1 
ATOM   1922 O  O     . THR A 1 282 ? -42.567 -51.421 17.164  1.00 52.16  ? 345  THR B O     1 
ATOM   1923 C  CB    . THR A 1 282 ? -42.425 -52.838 14.289  1.00 43.28  ? 345  THR B CB    1 
ATOM   1924 O  OG1   . THR A 1 282 ? -43.286 -53.942 14.092  1.00 48.80  ? 345  THR B OG1   1 
ATOM   1925 C  CG2   . THR A 1 282 ? -41.341 -53.295 15.147  1.00 36.76  ? 345  THR B CG2   1 
ATOM   1926 N  N     . ALA A 1 283 ? -41.580 -50.106 15.721  1.00 42.11  ? 346  ALA B N     1 
ATOM   1927 C  CA    . ALA A 1 283 ? -40.816 -49.390 16.710  1.00 42.88  ? 346  ALA B CA    1 
ATOM   1928 C  C     . ALA A 1 283 ? -41.699 -48.602 17.585  1.00 43.55  ? 346  ALA B C     1 
ATOM   1929 O  O     . ALA A 1 283 ? -41.408 -48.429 18.723  1.00 43.41  ? 346  ALA B O     1 
ATOM   1930 C  CB    . ALA A 1 283 ? -39.830 -48.473 16.059  1.00 43.86  ? 346  ALA B CB    1 
ATOM   1931 N  N     . MET A 1 284 ? -42.717 -48.013 17.005  1.00 42.51  ? 347  MET B N     1 
ATOM   1932 C  CA    . MET A 1 284 ? -43.661 -47.229 17.732  1.00 43.16  ? 347  MET B CA    1 
ATOM   1933 C  C     . MET A 1 284 ? -44.471 -47.998 18.710  1.00 46.70  ? 347  MET B C     1 
ATOM   1934 O  O     . MET A 1 284 ? -44.730 -47.513 19.751  1.00 47.81  ? 347  MET B O     1 
ATOM   1935 C  CB    . MET A 1 284 ? -44.567 -46.496 16.789  1.00 39.68  ? 347  MET B CB    1 
ATOM   1936 C  CG    . MET A 1 284 ? -44.432 -45.017 16.889  1.00 33.85  ? 347  MET B CG    1 
ATOM   1937 S  SD    . MET A 1 284 ? -42.732 -44.582 17.018  1.00 39.63  ? 347  MET B SD    1 
ATOM   1938 C  CE    . MET A 1 284 ? -42.903 -43.126 17.933  1.00 44.19  ? 347  MET B CE    1 
ATOM   1939 N  N     . GLN A 1 285 ? -44.877 -49.199 18.370  1.00 45.79  ? 348  GLN B N     1 
ATOM   1940 C  CA    . GLN A 1 285 ? -45.690 -50.001 19.259  1.00 51.42  ? 348  GLN B CA    1 
ATOM   1941 C  C     . GLN A 1 285 ? -44.930 -50.287 20.490  1.00 52.94  ? 348  GLN B C     1 
ATOM   1942 O  O     . GLN A 1 285 ? -45.488 -50.318 21.541  1.00 53.20  ? 348  GLN B O     1 
ATOM   1943 C  CB    . GLN A 1 285 ? -46.133 -51.281 18.614  1.00 54.26  ? 348  GLN B CB    1 
ATOM   1944 C  CG    . GLN A 1 285 ? -47.617 -51.472 18.702  1.00 54.75  ? 348  GLN B CG    1 
ATOM   1945 C  CD    . GLN A 1 285 ? -48.366 -50.194 18.458  1.00 57.92  ? 348  GLN B CD    1 
ATOM   1946 O  OE1   . GLN A 1 285 ? -47.956 -49.354 17.690  1.00 51.02  ? 348  GLN B OE1   1 
ATOM   1947 N  NE2   . GLN A 1 285 ? -49.485 -50.052 19.112  1.00 60.20  ? 348  GLN B NE2   1 
ATOM   1948 N  N     . VAL A 1 286 ? -43.655 -50.547 20.362  1.00 48.34  ? 349  VAL B N     1 
ATOM   1949 C  CA    . VAL A 1 286 ? -42.846 -50.740 21.526  1.00 48.61  ? 349  VAL B CA    1 
ATOM   1950 C  C     . VAL A 1 286 ? -42.993 -49.556 22.466  1.00 49.29  ? 349  VAL B C     1 
ATOM   1951 O  O     . VAL A 1 286 ? -42.952 -49.729 23.634  1.00 51.18  ? 349  VAL B O     1 
ATOM   1952 C  CB    . VAL A 1 286 ? -41.398 -50.895 21.143  1.00 45.70  ? 349  VAL B CB    1 
ATOM   1953 C  CG1   . VAL A 1 286 ? -40.510 -50.371 22.220  1.00 43.92  ? 349  VAL B CG1   1 
ATOM   1954 C  CG2   . VAL A 1 286 ? -41.093 -52.342 20.931  1.00 48.62  ? 349  VAL B CG2   1 
ATOM   1955 N  N     . LEU A 1 287 ? -43.065 -48.346 21.970  1.00 48.52  ? 350  LEU B N     1 
ATOM   1956 C  CA    . LEU A 1 287 ? -43.303 -47.255 22.822  1.00 50.33  ? 350  LEU B CA    1 
ATOM   1957 C  C     . LEU A 1 287 ? -44.656 -47.468 23.432  1.00 57.56  ? 350  LEU B C     1 
ATOM   1958 O  O     . LEU A 1 287 ? -44.796 -47.249 24.590  1.00 63.07  ? 350  LEU B O     1 
ATOM   1959 C  CB    . LEU A 1 287 ? -43.267 -45.966 22.045  1.00 46.39  ? 350  LEU B CB    1 
ATOM   1960 C  CG    . LEU A 1 287 ? -41.938 -45.263 22.102  1.00 46.33  ? 350  LEU B CG    1 
ATOM   1961 C  CD1   . LEU A 1 287 ? -42.040 -43.997 21.335  1.00 41.62  ? 350  LEU B CD1   1 
ATOM   1962 C  CD2   . LEU A 1 287 ? -41.516 -44.972 23.502  1.00 42.94  ? 350  LEU B CD2   1 
ATOM   1963 N  N     . ARG A 1 288 ? -45.659 -47.921 22.684  1.00 56.35  ? 351  ARG B N     1 
ATOM   1964 C  CA    . ARG A 1 288 ? -46.964 -48.122 23.289  1.00 55.56  ? 351  ARG B CA    1 
ATOM   1965 C  C     . ARG A 1 288 ? -46.806 -49.126 24.403  1.00 69.20  ? 351  ARG B C     1 
ATOM   1966 O  O     . ARG A 1 288 ? -47.623 -49.209 25.305  1.00 71.55  ? 351  ARG B O     1 
ATOM   1967 C  CB    . ARG A 1 288 ? -47.974 -48.614 22.270  1.00 52.42  ? 351  ARG B CB    1 
ATOM   1968 N  N     . ASP A 1 289 ? -45.738 -49.903 24.317  1.00 71.02  ? 352  ASP B N     1 
ATOM   1969 C  CA    . ASP A 1 289 ? -45.464 -50.938 25.291  1.00 61.71  ? 352  ASP B CA    1 
ATOM   1970 C  C     . ASP A 1 289 ? -46.279 -52.162 24.929  1.00 64.75  ? 352  ASP B C     1 
ATOM   1971 O  O     . ASP A 1 289 ? -46.445 -53.073 25.725  1.00 76.78  ? 352  ASP B O     1 
ATOM   1972 C  CB    . ASP A 1 289 ? -45.787 -50.440 26.696  1.00 68.53  ? 352  ASP B CB    1 
ATOM   1973 C  CG    . ASP A 1 289 ? -44.704 -49.534 27.259  1.00 79.25  ? 352  ASP B CG    1 
ATOM   1974 O  OD1   . ASP A 1 289 ? -43.570 -50.010 27.455  1.00 73.30  ? 352  ASP B OD1   1 
ATOM   1975 O  OD2   . ASP A 1 289 ? -44.988 -48.348 27.517  1.00 78.87  ? 352  ASP B OD2   1 
ATOM   1976 N  N     . ALA A 1 290 ? -46.784 -52.162 23.704  1.00 67.45  ? 353  ALA B N     1 
ATOM   1977 C  CA    . ALA A 1 290 ? -47.593 -53.253 23.178  1.00 74.88  ? 353  ALA B CA    1 
ATOM   1978 C  C     . ALA A 1 290 ? -46.769 -54.226 22.337  1.00 80.39  ? 353  ALA B C     1 
ATOM   1979 O  O     . ALA A 1 290 ? -47.319 -55.058 21.617  1.00 79.54  ? 353  ALA B O     1 
ATOM   1980 C  CB    . ALA A 1 290 ? -48.760 -52.708 22.377  1.00 65.11  ? 353  ALA B CB    1 
ATOM   1981 N  N     . GLY A 1 291 ? -45.449 -54.086 22.408  1.00 79.44  ? 354  GLY B N     1 
ATOM   1982 C  CA    . GLY A 1 291 ? -44.524 -54.906 21.644  1.00 87.41  ? 354  GLY B CA    1 
ATOM   1983 C  C     . GLY A 1 291 ? -44.514 -56.400 21.917  1.00 103.22 ? 354  GLY B C     1 
ATOM   1984 O  O     . GLY A 1 291 ? -44.376 -57.200 20.995  1.00 100.49 ? 354  GLY B O     1 
ATOM   1985 N  N     . ASP A 1 292 ? -44.632 -56.790 23.179  1.00 104.29 ? 355  ASP B N     1 
ATOM   1986 C  CA    . ASP A 1 292 ? -44.634 -58.209 23.507  1.00 98.14  ? 355  ASP B CA    1 
ATOM   1987 C  C     . ASP A 1 292 ? -43.329 -58.843 23.086  1.00 93.64  ? 355  ASP B C     1 
ATOM   1988 O  O     . ASP A 1 292 ? -42.858 -58.611 21.979  1.00 101.34 ? 355  ASP B O     1 
ATOM   1989 C  CB    . ASP A 1 292 ? -45.796 -58.919 22.820  1.00 96.43  ? 355  ASP B CB    1 
ATOM   1990 N  N     . SER A 1 309 ? -33.623 -47.171 27.792  1.00 57.51  ? 372  SER B N     1 
ATOM   1991 C  CA    . SER A 1 309 ? -33.158 -46.733 26.510  1.00 55.87  ? 372  SER B CA    1 
ATOM   1992 C  C     . SER A 1 309 ? -31.972 -45.888 26.729  1.00 53.29  ? 372  SER B C     1 
ATOM   1993 O  O     . SER A 1 309 ? -32.028 -44.710 26.503  1.00 67.67  ? 372  SER B O     1 
ATOM   1994 C  CB    . SER A 1 309 ? -34.252 -45.918 25.819  1.00 65.75  ? 372  SER B CB    1 
ATOM   1995 O  OG    . SER A 1 309 ? -34.109 -44.530 26.028  1.00 59.44  ? 372  SER B OG    1 
ATOM   1996 N  N     . ASN A 1 310 ? -30.904 -46.449 27.214  1.00 42.60  ? 373  ASN B N     1 
ATOM   1997 C  CA    . ASN A 1 310 ? -29.761 -45.626 27.439  1.00 44.73  ? 373  ASN B CA    1 
ATOM   1998 C  C     . ASN A 1 310 ? -29.029 -45.234 26.210  1.00 44.25  ? 373  ASN B C     1 
ATOM   1999 O  O     . ASN A 1 310 ? -29.044 -45.906 25.282  1.00 48.46  ? 373  ASN B O     1 
ATOM   2000 C  CB    . ASN A 1 310 ? -28.831 -46.363 28.333  1.00 46.54  ? 373  ASN B CB    1 
ATOM   2001 C  CG    . ASN A 1 310 ? -28.737 -45.728 29.654  1.00 52.76  ? 373  ASN B CG    1 
ATOM   2002 O  OD1   . ASN A 1 310 ? -28.422 -44.554 29.745  1.00 49.27  ? 373  ASN B OD1   1 
ATOM   2003 N  ND2   . ASN A 1 310 ? -29.052 -46.473 30.688  1.00 47.52  ? 373  ASN B ND2   1 
ATOM   2004 N  N     . VAL A 1 311 ? -28.350 -44.107 26.210  1.00 44.36  ? 374  VAL B N     1 
ATOM   2005 C  CA    . VAL A 1 311 ? -27.474 -43.763 25.095  1.00 39.95  ? 374  VAL B CA    1 
ATOM   2006 C  C     . VAL A 1 311 ? -26.132 -44.386 25.345  1.00 39.88  ? 374  VAL B C     1 
ATOM   2007 O  O     . VAL A 1 311 ? -25.326 -44.383 24.504  1.00 39.22  ? 374  VAL B O     1 
ATOM   2008 C  CB    . VAL A 1 311 ? -27.292 -42.262 24.781  1.00 32.09  ? 374  VAL B CB    1 
ATOM   2009 C  CG1   . VAL A 1 311 ? -28.259 -41.407 25.505  1.00 32.06  ? 374  VAL B CG1   1 
ATOM   2010 C  CG2   . VAL A 1 311 ? -25.900 -41.790 25.014  1.00 30.27  ? 374  VAL B CG2   1 
ATOM   2011 N  N     . PHE A 1 312 ? -25.956 -44.867 26.544  1.00 40.38  ? 375  PHE B N     1 
ATOM   2012 C  CA    . PHE A 1 312 ? -24.772 -45.551 26.878  1.00 42.51  ? 375  PHE B CA    1 
ATOM   2013 C  C     . PHE A 1 312 ? -24.766 -46.800 26.087  1.00 43.76  ? 375  PHE B C     1 
ATOM   2014 O  O     . PHE A 1 312 ? -23.766 -47.207 25.596  1.00 42.91  ? 375  PHE B O     1 
ATOM   2015 C  CB    . PHE A 1 312 ? -24.782 -45.894 28.352  1.00 50.29  ? 375  PHE B CB    1 
ATOM   2016 C  CG    . PHE A 1 312 ? -23.472 -46.408 28.864  1.00 49.08  ? 375  PHE B CG    1 
ATOM   2017 C  CD1   . PHE A 1 312 ? -23.143 -47.729 28.760  1.00 42.99  ? 375  PHE B CD1   1 
ATOM   2018 C  CD2   . PHE A 1 312 ? -22.594 -45.568 29.437  1.00 48.02  ? 375  PHE B CD2   1 
ATOM   2019 C  CE1   . PHE A 1 312 ? -21.959 -48.193 29.209  1.00 43.10  ? 375  PHE B CE1   1 
ATOM   2020 C  CE2   . PHE A 1 312 ? -21.408 -46.028 29.893  1.00 52.17  ? 375  PHE B CE2   1 
ATOM   2021 C  CZ    . PHE A 1 312 ? -21.081 -47.338 29.768  1.00 44.44  ? 375  PHE B CZ    1 
ATOM   2022 N  N     . LYS A 1 313 ? -25.910 -47.442 26.018  1.00 39.94  ? 376  LYS B N     1 
ATOM   2023 C  CA    . LYS A 1 313 ? -26.067 -48.680 25.308  1.00 40.33  ? 376  LYS B CA    1 
ATOM   2024 C  C     . LYS A 1 313 ? -25.919 -48.595 23.862  1.00 39.31  ? 376  LYS B C     1 
ATOM   2025 O  O     . LYS A 1 313 ? -25.593 -49.530 23.259  1.00 41.43  ? 376  LYS B O     1 
ATOM   2026 C  CB    . LYS A 1 313 ? -27.393 -49.280 25.598  1.00 49.79  ? 376  LYS B CB    1 
ATOM   2027 C  CG    . LYS A 1 313 ? -27.617 -49.542 27.044  1.00 44.38  ? 376  LYS B CG    1 
ATOM   2028 C  CD    . LYS A 1 313 ? -28.638 -50.641 27.170  1.00 50.18  ? 376  LYS B CD    1 
ATOM   2029 C  CE    . LYS A 1 313 ? -29.966 -50.271 26.571  1.00 52.56  ? 376  LYS B CE    1 
ATOM   2030 N  NZ    . LYS A 1 313 ? -30.995 -51.271 26.911  1.00 55.42  ? 376  LYS B NZ    1 
ATOM   2031 N  N     . ILE A 1 314 ? -26.389 -47.532 23.284  1.00 40.74  ? 377  ILE B N     1 
ATOM   2032 C  CA    . ILE A 1 314 ? -26.249 -47.322 21.885  1.00 34.00  ? 377  ILE B CA    1 
ATOM   2033 C  C     . ILE A 1 314 ? -24.809 -47.134 21.555  1.00 32.37  ? 377  ILE B C     1 
ATOM   2034 O  O     . ILE A 1 314 ? -24.336 -47.637 20.617  1.00 32.49  ? 377  ILE B O     1 
ATOM   2035 C  CB    . ILE A 1 314 ? -26.998 -46.060 21.495  1.00 37.20  ? 377  ILE B CB    1 
ATOM   2036 C  CG1   . ILE A 1 314 ? -28.475 -46.274 21.549  1.00 33.34  ? 377  ILE B CG1   1 
ATOM   2037 C  CG2   . ILE A 1 314 ? -26.583 -45.579 20.138  1.00 35.26  ? 377  ILE B CG2   1 
ATOM   2038 C  CD1   . ILE A 1 314 ? -28.873 -47.656 21.210  1.00 38.18  ? 377  ILE B CD1   1 
ATOM   2039 N  N     . VAL A 1 315 ? -24.120 -46.359 22.348  1.00 33.15  ? 378  VAL B N     1 
ATOM   2040 C  CA    . VAL A 1 315 ? -22.727 -46.113 22.127  1.00 37.38  ? 378  VAL B CA    1 
ATOM   2041 C  C     . VAL A 1 315 ? -21.896 -47.341 22.301  1.00 38.16  ? 378  VAL B C     1 
ATOM   2042 O  O     . VAL A 1 315 ? -20.917 -47.476 21.680  1.00 35.89  ? 378  VAL B O     1 
ATOM   2043 C  CB    . VAL A 1 315 ? -22.177 -44.959 22.936  1.00 35.38  ? 378  VAL B CB    1 
ATOM   2044 C  CG1   . VAL A 1 315 ? -20.795 -44.627 22.452  1.00 32.47  ? 378  VAL B CG1   1 
ATOM   2045 C  CG2   . VAL A 1 315 ? -23.056 -43.766 22.777  1.00 29.28  ? 378  VAL B CG2   1 
ATOM   2046 N  N     . LYS A 1 316 ? -22.233 -48.186 23.235  1.00 33.54  ? 379  LYS B N     1 
ATOM   2047 C  CA    . LYS A 1 316 ? -21.501 -49.390 23.397  1.00 35.06  ? 379  LYS B CA    1 
ATOM   2048 C  C     . LYS A 1 316 ? -21.617 -50.265 22.185  1.00 44.12  ? 379  LYS B C     1 
ATOM   2049 O  O     . LYS A 1 316 ? -20.658 -50.847 21.792  1.00 46.16  ? 379  LYS B O     1 
ATOM   2050 C  CB    . LYS A 1 316 ? -22.066 -50.147 24.561  1.00 41.53  ? 379  LYS B CB    1 
ATOM   2051 C  CG    . LYS A 1 316 ? -21.117 -51.126 25.199  1.00 48.48  ? 379  LYS B CG    1 
ATOM   2052 C  CD    . LYS A 1 316 ? -21.865 -52.109 26.057  1.00 56.19  ? 379  LYS B CD    1 
ATOM   2053 C  CE    . LYS A 1 316 ? -20.943 -53.066 26.766  1.00 58.42  ? 379  LYS B CE    1 
ATOM   2054 N  NZ    . LYS A 1 316 ? -20.308 -53.959 25.780  1.00 55.85  ? 379  LYS B NZ    1 
ATOM   2055 N  N     . MET A 1 317 ? -22.783 -50.413 21.583  1.00 40.28  ? 380  MET B N     1 
ATOM   2056 C  CA    . MET A 1 317 ? -22.869 -51.269 20.428  1.00 36.00  ? 380  MET B CA    1 
ATOM   2057 C  C     . MET A 1 317 ? -22.086 -50.764 19.273  1.00 41.70  ? 380  MET B C     1 
ATOM   2058 O  O     . MET A 1 317 ? -21.472 -51.510 18.608  1.00 44.62  ? 380  MET B O     1 
ATOM   2059 C  CB    . MET A 1 317 ? -24.289 -51.712 20.061  1.00 35.23  ? 380  MET B CB    1 
ATOM   2060 C  CG    . MET A 1 317 ? -25.290 -50.675 19.626  1.00 44.28  ? 380  MET B CG    1 
ATOM   2061 S  SD    . MET A 1 317 ? -25.660 -50.528 17.901  1.00 42.49  ? 380  MET B SD    1 
ATOM   2062 C  CE    . MET A 1 317 ? -26.155 -52.170 17.615  1.00 51.77  ? 380  MET B CE    1 
ATOM   2063 N  N     . ILE A 1 318 ? -22.071 -49.468 19.072  1.00 40.87  ? 381  ILE B N     1 
ATOM   2064 C  CA    . ILE A 1 318 ? -21.389 -48.855 17.964  1.00 42.97  ? 381  ILE B CA    1 
ATOM   2065 C  C     . ILE A 1 318 ? -19.933 -49.140 17.990  1.00 40.25  ? 381  ILE B C     1 
ATOM   2066 O  O     . ILE A 1 318 ? -19.348 -49.299 16.992  1.00 43.20  ? 381  ILE B O     1 
ATOM   2067 C  CB    . ILE A 1 318 ? -21.579 -47.344 17.991  1.00 41.62  ? 381  ILE B CB    1 
ATOM   2068 C  CG1   . ILE A 1 318 ? -22.871 -46.921 17.357  1.00 33.68  ? 381  ILE B CG1   1 
ATOM   2069 C  CG2   . ILE A 1 318 ? -20.486 -46.668 17.247  1.00 38.57  ? 381  ILE B CG2   1 
ATOM   2070 C  CD1   . ILE A 1 318 ? -23.306 -45.551 17.778  1.00 32.71  ? 381  ILE B CD1   1 
ATOM   2071 N  N     . MET A 1 319 ? -19.315 -49.092 19.131  1.00 43.16  ? 382  MET B N     1 
ATOM   2072 C  CA    . MET A 1 319 ? -17.924 -49.432 19.214  1.00 47.00  ? 382  MET B CA    1 
ATOM   2073 C  C     . MET A 1 319 ? -17.739 -50.900 18.974  1.00 46.76  ? 382  MET B C     1 
ATOM   2074 O  O     . MET A 1 319 ? -16.755 -51.293 18.426  1.00 48.50  ? 382  MET B O     1 
ATOM   2075 C  CB    . MET A 1 319 ? -17.302 -49.068 20.540  1.00 46.09  ? 382  MET B CB    1 
ATOM   2076 C  CG    . MET A 1 319 ? -17.764 -47.809 21.181  1.00 43.91  ? 382  MET B CG    1 
ATOM   2077 S  SD    . MET A 1 319 ? -17.158 -46.358 20.432  1.00 45.37  ? 382  MET B SD    1 
ATOM   2078 C  CE    . MET A 1 319 ? -15.858 -47.082 19.572  1.00 48.58  ? 382  MET B CE    1 
ATOM   2079 N  N     . GLU A 1 320 ? -18.642 -51.703 19.505  1.00 39.91  ? 383  GLU B N     1 
ATOM   2080 C  CA    . GLU A 1 320 ? -18.644 -53.130 19.329  1.00 45.71  ? 383  GLU B CA    1 
ATOM   2081 C  C     . GLU A 1 320 ? -18.885 -53.590 17.923  1.00 46.41  ? 383  GLU B C     1 
ATOM   2082 O  O     . GLU A 1 320 ? -18.325 -54.525 17.486  1.00 48.85  ? 383  GLU B O     1 
ATOM   2083 C  CB    . GLU A 1 320 ? -19.699 -53.770 20.215  1.00 52.55  ? 383  GLU B CB    1 
ATOM   2084 C  CG    . GLU A 1 320 ? -19.380 -53.799 21.695  1.00 51.10  ? 383  GLU B CG    1 
ATOM   2085 C  CD    . GLU A 1 320 ? -20.335 -54.645 22.509  1.00 59.85  ? 383  GLU B CD    1 
ATOM   2086 O  OE1   . GLU A 1 320 ? -21.512 -54.792 22.145  1.00 49.56  ? 383  GLU B OE1   1 
ATOM   2087 O  OE2   . GLU A 1 320 ? -19.893 -55.151 23.550  1.00 69.09  ? 383  GLU B OE2   1 
ATOM   2088 N  N     . ARG A 1 321 ? -19.761 -52.939 17.210  1.00 41.97  ? 384  ARG B N     1 
ATOM   2089 C  CA    . ARG A 1 321 ? -20.075 -53.315 15.859  1.00 39.29  ? 384  ARG B CA    1 
ATOM   2090 C  C     . ARG A 1 321 ? -19.316 -52.569 14.827  1.00 44.02  ? 384  ARG B C     1 
ATOM   2091 O  O     . ARG A 1 321 ? -19.713 -52.549 13.720  1.00 46.47  ? 384  ARG B O     1 
ATOM   2092 C  CB    . ARG A 1 321 ? -21.525 -53.078 15.600  1.00 47.36  ? 384  ARG B CB    1 
ATOM   2093 C  CG    . ARG A 1 321 ? -22.405 -54.249 15.906  1.00 52.15  ? 384  ARG B CG    1 
ATOM   2094 C  CD    . ARG A 1 321 ? -23.820 -53.927 15.536  1.00 58.00  ? 384  ARG B CD    1 
ATOM   2095 N  NE    . ARG A 1 321 ? -24.543 -55.079 15.048  1.00 70.00  ? 384  ARG B NE    1 
ATOM   2096 C  CZ    . ARG A 1 321 ? -25.227 -55.927 15.797  1.00 67.32  ? 384  ARG B CZ    1 
ATOM   2097 N  NH1   . ARG A 1 321 ? -25.309 -55.800 17.102  1.00 52.92  ? 384  ARG B NH1   1 
ATOM   2098 N  NH2   . ARG A 1 321 ? -25.835 -56.921 15.213  1.00 71.11  ? 384  ARG B NH2   1 
ATOM   2099 N  N     . ASN A 1 322 ? -18.264 -51.895 15.231  1.00 47.64  ? 385  ASN B N     1 
ATOM   2100 C  CA    . ASN A 1 322 ? -17.390 -51.092 14.400  1.00 47.91  ? 385  ASN B CA    1 
ATOM   2101 C  C     . ASN A 1 322 ? -18.118 -50.028 13.667  1.00 47.41  ? 385  ASN B C     1 
ATOM   2102 O  O     . ASN A 1 322 ? -17.944 -49.863 12.498  1.00 51.87  ? 385  ASN B O     1 
ATOM   2103 C  CB    . ASN A 1 322 ? -16.570 -51.934 13.467  1.00 46.81  ? 385  ASN B CB    1 
ATOM   2104 C  CG    . ASN A 1 322 ? -15.308 -51.261 13.043  1.00 54.57  ? 385  ASN B CG    1 
ATOM   2105 O  OD1   . ASN A 1 322 ? -14.583 -50.722 13.827  1.00 53.32  ? 385  ASN B OD1   1 
ATOM   2106 N  ND2   . ASN A 1 322 ? -15.025 -51.340 11.792  1.00 60.87  ? 385  ASN B ND2   1 
ATOM   2107 N  N     . PHE A 1 323 ? -19.062 -49.412 14.351  1.00 42.63  ? 386  PHE B N     1 
ATOM   2108 C  CA    . PHE A 1 323 ? -19.649 -48.182 13.884  1.00 41.98  ? 386  PHE B CA    1 
ATOM   2109 C  C     . PHE A 1 323 ? -18.778 -47.011 14.350  1.00 49.14  ? 386  PHE B C     1 
ATOM   2110 O  O     . PHE A 1 323 ? -18.921 -45.885 13.892  1.00 45.00  ? 386  PHE B O     1 
ATOM   2111 C  CB    . PHE A 1 323 ? -21.090 -48.083 14.348  1.00 41.62  ? 386  PHE B CB    1 
ATOM   2112 C  CG    . PHE A 1 323 ? -21.995 -49.102 13.717  1.00 47.91  ? 386  PHE B CG    1 
ATOM   2113 C  CD1   . PHE A 1 323 ? -21.642 -49.725 12.543  1.00 53.97  ? 386  PHE B CD1   1 
ATOM   2114 C  CD2   . PHE A 1 323 ? -23.196 -49.427 14.291  1.00 50.27  ? 386  PHE B CD2   1 
ATOM   2115 C  CE1   . PHE A 1 323 ? -22.469 -50.655 11.958  1.00 53.73  ? 386  PHE B CE1   1 
ATOM   2116 C  CE2   . PHE A 1 323 ? -24.030 -50.356 13.709  1.00 53.28  ? 386  PHE B CE2   1 
ATOM   2117 C  CZ    . PHE A 1 323 ? -23.666 -50.975 12.542  1.00 47.31  ? 386  PHE B CZ    1 
ATOM   2118 N  N     . GLN A 1 324 ? -17.882 -47.299 15.289  1.00 48.90  ? 387  GLN B N     1 
ATOM   2119 C  CA    . GLN A 1 324 ? -16.685 -46.532 15.514  1.00 39.31  ? 387  GLN B CA    1 
ATOM   2120 C  C     . GLN A 1 324 ? -16.991 -45.093 15.686  1.00 40.11  ? 387  GLN B C     1 
ATOM   2121 O  O     . GLN A 1 324 ? -17.720 -44.770 16.615  1.00 38.49  ? 387  GLN B O     1 
ATOM   2122 C  CB    . GLN A 1 324 ? -15.597 -46.815 14.497  1.00 37.06  ? 387  GLN B CB    1 
ATOM   2123 C  CG    . GLN A 1 324 ? -14.311 -47.357 15.123  1.00 45.01  ? 387  GLN B CG    1 
ATOM   2124 C  CD    . GLN A 1 324 ? -14.533 -48.196 16.372  1.00 58.51  ? 387  GLN B CD    1 
ATOM   2125 O  OE1   . GLN A 1 324 ? -13.689 -48.232 17.261  1.00 65.71  ? 387  GLN B OE1   1 
ATOM   2126 N  NE2   . GLN A 1 324 ? -15.657 -48.882 16.437  1.00 54.66  ? 387  GLN B NE2   1 
ATOM   2127 N  N     . PRO A 1 325 ? -16.384 -44.194 14.787  1.00 40.13  ? 388  PRO B N     1 
ATOM   2128 C  CA    . PRO A 1 325 ? -16.558 -42.791 15.205  1.00 38.94  ? 388  PRO B CA    1 
ATOM   2129 C  C     . PRO A 1 325 ? -18.011 -42.399 15.133  1.00 39.73  ? 388  PRO B C     1 
ATOM   2130 O  O     . PRO A 1 325 ? -18.674 -42.666 14.156  1.00 45.67  ? 388  PRO B O     1 
ATOM   2131 C  CB    . PRO A 1 325 ? -15.708 -41.999 14.223  1.00 36.00  ? 388  PRO B CB    1 
ATOM   2132 C  CG    . PRO A 1 325 ? -15.786 -42.760 12.985  1.00 35.78  ? 388  PRO B CG    1 
ATOM   2133 C  CD    . PRO A 1 325 ? -15.672 -44.175 13.420  1.00 38.02  ? 388  PRO B CD    1 
ATOM   2134 N  N     . VAL A 1 326 ? -18.507 -41.778 16.184  1.00 39.16  ? 389  VAL B N     1 
ATOM   2135 C  CA    . VAL A 1 326 ? -19.903 -41.434 16.241  1.00 37.63  ? 389  VAL B CA    1 
ATOM   2136 C  C     . VAL A 1 326 ? -20.058 -40.086 16.895  1.00 38.99  ? 389  VAL B C     1 
ATOM   2137 O  O     . VAL A 1 326 ? -19.293 -39.725 17.762  1.00 37.76  ? 389  VAL B O     1 
ATOM   2138 C  CB    . VAL A 1 326 ? -20.694 -42.482 17.022  1.00 39.04  ? 389  VAL B CB    1 
ATOM   2139 C  CG1   . VAL A 1 326 ? -20.298 -42.451 18.478  1.00 43.11  ? 389  VAL B CG1   1 
ATOM   2140 C  CG2   . VAL A 1 326 ? -22.182 -42.258 16.869  1.00 34.18  ? 389  VAL B CG2   1 
ATOM   2141 N  N     . ILE A 1 327 ? -21.069 -39.358 16.463  1.00 37.46  ? 390  ILE B N     1 
ATOM   2142 C  CA    . ILE A 1 327 ? -21.337 -38.052 16.930  1.00 33.28  ? 390  ILE B CA    1 
ATOM   2143 C  C     . ILE A 1 327 ? -22.648 -38.190 17.571  1.00 35.80  ? 390  ILE B C     1 
ATOM   2144 O  O     . ILE A 1 327 ? -23.544 -38.634 16.988  1.00 34.38  ? 390  ILE B O     1 
ATOM   2145 C  CB    . ILE A 1 327 ? -21.489 -37.110 15.774  1.00 28.07  ? 390  ILE B CB    1 
ATOM   2146 C  CG1   . ILE A 1 327 ? -20.177 -36.511 15.396  1.00 31.89  ? 390  ILE B CG1   1 
ATOM   2147 C  CG2   . ILE A 1 327 ? -22.252 -35.934 16.194  1.00 30.41  ? 390  ILE B CG2   1 
ATOM   2148 C  CD1   . ILE A 1 327 ? -20.214 -35.823 14.084  1.00 23.82  ? 390  ILE B CD1   1 
ATOM   2149 N  N     . ILE A 1 328 ? -22.745 -37.796 18.812  1.00 37.73  ? 391  ILE B N     1 
ATOM   2150 C  CA    . ILE A 1 328 ? -23.959 -37.903 19.550  1.00 35.90  ? 391  ILE B CA    1 
ATOM   2151 C  C     . ILE A 1 328 ? -24.494 -36.535 19.724  1.00 38.20  ? 391  ILE B C     1 
ATOM   2152 O  O     . ILE A 1 328 ? -23.816 -35.713 20.212  1.00 41.42  ? 391  ILE B O     1 
ATOM   2153 C  CB    . ILE A 1 328 ? -23.649 -38.399 20.925  1.00 33.49  ? 391  ILE B CB    1 
ATOM   2154 C  CG1   . ILE A 1 328 ? -22.605 -39.468 20.847  1.00 32.57  ? 391  ILE B CG1   1 
ATOM   2155 C  CG2   . ILE A 1 328 ? -24.890 -38.897 21.589  1.00 30.72  ? 391  ILE B CG2   1 
ATOM   2156 C  CD1   . ILE A 1 328 ? -23.156 -40.818 21.091  1.00 35.74  ? 391  ILE B CD1   1 
ATOM   2157 N  N     . PHE A 1 329 ? -25.746 -36.321 19.389  1.00 33.46  ? 392  PHE B N     1 
ATOM   2158 C  CA    . PHE A 1 329 ? -26.327 -35.020 19.440  1.00 30.67  ? 392  PHE B CA    1 
ATOM   2159 C  C     . PHE A 1 329 ? -27.311 -34.915 20.518  1.00 39.66  ? 392  PHE B C     1 
ATOM   2160 O  O     . PHE A 1 329 ? -28.147 -35.742 20.646  1.00 37.56  ? 392  PHE B O     1 
ATOM   2161 C  CB    . PHE A 1 329 ? -27.044 -34.726 18.149  1.00 35.94  ? 392  PHE B CB    1 
ATOM   2162 C  CG    . PHE A 1 329 ? -26.163 -34.228 17.070  1.00 36.65  ? 392  PHE B CG    1 
ATOM   2163 C  CD1   . PHE A 1 329 ? -25.640 -32.989 17.129  1.00 36.12  ? 392  PHE B CD1   1 
ATOM   2164 C  CD2   . PHE A 1 329 ? -25.902 -34.992 15.986  1.00 31.89  ? 392  PHE B CD2   1 
ATOM   2165 C  CE1   . PHE A 1 329 ? -24.853 -32.520 16.136  1.00 36.69  ? 392  PHE B CE1   1 
ATOM   2166 C  CE2   . PHE A 1 329 ? -25.102 -34.527 15.000  1.00 31.31  ? 392  PHE B CE2   1 
ATOM   2167 C  CZ    . PHE A 1 329 ? -24.586 -33.291 15.073  1.00 33.19  ? 392  PHE B CZ    1 
ATOM   2168 N  N     . SER A 1 330 ? -27.169 -33.834 21.264  1.00 41.24  ? 393  SER B N     1 
ATOM   2169 C  CA    . SER A 1 330 ? -27.970 -33.454 22.395  1.00 39.86  ? 393  SER B CA    1 
ATOM   2170 C  C     . SER A 1 330 ? -28.279 -31.993 22.250  1.00 47.41  ? 393  SER B C     1 
ATOM   2171 O  O     . SER A 1 330 ? -27.471 -31.267 21.770  1.00 47.41  ? 393  SER B O     1 
ATOM   2172 C  CB    . SER A 1 330 ? -27.178 -33.634 23.668  1.00 42.30  ? 393  SER B CB    1 
ATOM   2173 O  OG    . SER A 1 330 ? -26.133 -34.572 23.553  1.00 47.20  ? 393  SER B OG    1 
ATOM   2174 N  N     . PHE A 1 331 ? -29.433 -31.532 22.668  1.00 48.44  ? 394  PHE B N     1 
ATOM   2175 C  CA    . PHE A 1 331 ? -29.714 -30.116 22.541  1.00 52.03  ? 394  PHE B CA    1 
ATOM   2176 C  C     . PHE A 1 331 ? -29.374 -29.283 23.742  1.00 58.98  ? 394  PHE B C     1 
ATOM   2177 O  O     . PHE A 1 331 ? -29.621 -28.115 23.764  1.00 66.66  ? 394  PHE B O     1 
ATOM   2178 C  CB    . PHE A 1 331 ? -31.159 -29.870 22.205  1.00 53.67  ? 394  PHE B CB    1 
ATOM   2179 C  CG    . PHE A 1 331 ? -31.626 -30.678 21.086  1.00 56.16  ? 394  PHE B CG    1 
ATOM   2180 C  CD1   . PHE A 1 331 ? -31.412 -30.268 19.812  1.00 51.59  ? 394  PHE B CD1   1 
ATOM   2181 C  CD2   . PHE A 1 331 ? -32.199 -31.879 21.325  1.00 51.89  ? 394  PHE B CD2   1 
ATOM   2182 C  CE1   . PHE A 1 331 ? -31.790 -31.028 18.786  1.00 43.81  ? 394  PHE B CE1   1 
ATOM   2183 C  CE2   . PHE A 1 331 ? -32.593 -32.644 20.307  1.00 49.16  ? 394  PHE B CE2   1 
ATOM   2184 C  CZ    . PHE A 1 331 ? -32.371 -32.224 19.035  1.00 48.59  ? 394  PHE B CZ    1 
ATOM   2185 N  N     . SER A 1 332 ? -28.838 -29.875 24.772  1.00 58.97  ? 395  SER B N     1 
ATOM   2186 C  CA    . SER A 1 332 ? -28.483 -29.123 25.922  1.00 47.07  ? 395  SER B CA    1 
ATOM   2187 C  C     . SER A 1 332 ? -27.030 -29.209 26.050  1.00 47.81  ? 395  SER B C     1 
ATOM   2188 O  O     . SER A 1 332 ? -26.438 -30.204 25.803  1.00 49.15  ? 395  SER B O     1 
ATOM   2189 C  CB    . SER A 1 332 ? -29.087 -29.743 27.130  1.00 47.40  ? 395  SER B CB    1 
ATOM   2190 O  OG    . SER A 1 332 ? -29.012 -28.921 28.235  1.00 46.05  ? 395  SER B OG    1 
ATOM   2191 N  N     . LYS A 1 333 ? -26.410 -28.130 26.439  1.00 50.35  ? 396  LYS B N     1 
ATOM   2192 C  CA    . LYS A 1 333 ? -25.006 -28.158 26.658  1.00 48.58  ? 396  LYS B CA    1 
ATOM   2193 C  C     . LYS A 1 333 ? -24.721 -29.071 27.796  1.00 48.15  ? 396  LYS B C     1 
ATOM   2194 O  O     . LYS A 1 333 ? -23.835 -29.841 27.743  1.00 50.78  ? 396  LYS B O     1 
ATOM   2195 C  CB    . LYS A 1 333 ? -24.536 -26.767 27.033  1.00 57.90  ? 396  LYS B CB    1 
ATOM   2196 C  CG    . LYS A 1 333 ? -23.686 -26.018 26.029  1.00 61.33  ? 396  LYS B CG    1 
ATOM   2197 C  CD    . LYS A 1 333 ? -23.482 -24.604 26.499  1.00 45.37  ? 396  LYS B CD    1 
ATOM   2198 C  CE    . LYS A 1 333 ? -24.734 -23.769 26.329  1.00 56.41  ? 396  LYS B CE    1 
ATOM   2199 N  NZ    . LYS A 1 333 ? -24.784 -22.895 25.129  1.00 41.87  ? 396  LYS B NZ    1 
ATOM   2200 N  N     . LYS A 1 334 ? -25.494 -28.966 28.850  1.00 50.51  ? 397  LYS B N     1 
ATOM   2201 C  CA    . LYS A 1 334 ? -25.344 -29.803 29.985  1.00 46.56  ? 397  LYS B CA    1 
ATOM   2202 C  C     . LYS A 1 334 ? -25.579 -31.230 29.646  1.00 47.38  ? 397  LYS B C     1 
ATOM   2203 O  O     . LYS A 1 334 ? -24.919 -32.048 30.171  1.00 47.61  ? 397  LYS B O     1 
ATOM   2204 C  CB    . LYS A 1 334 ? -26.303 -29.379 31.074  1.00 43.35  ? 397  LYS B CB    1 
ATOM   2205 N  N     . ASP A 1 335 ? -26.540 -31.562 28.817  1.00 46.97  ? 398  ASP B N     1 
ATOM   2206 C  CA    . ASP A 1 335 ? -26.749 -32.951 28.476  1.00 42.85  ? 398  ASP B CA    1 
ATOM   2207 C  C     . ASP A 1 335 ? -25.602 -33.538 27.753  1.00 43.36  ? 398  ASP B C     1 
ATOM   2208 O  O     . ASP A 1 335 ? -25.260 -34.602 27.972  1.00 40.49  ? 398  ASP B O     1 
ATOM   2209 C  CB    . ASP A 1 335 ? -27.950 -33.157 27.599  1.00 45.51  ? 398  ASP B CB    1 
ATOM   2210 C  CG    . ASP A 1 335 ? -29.196 -32.934 28.290  1.00 51.92  ? 398  ASP B CG    1 
ATOM   2211 O  OD1   . ASP A 1 335 ? -29.220 -32.176 29.234  1.00 49.89  ? 398  ASP B OD1   1 
ATOM   2212 O  OD2   . ASP A 1 335 ? -30.186 -33.456 27.841  1.00 53.44  ? 398  ASP B OD2   1 
ATOM   2213 N  N     . CYS A 1 336 ? -24.975 -32.810 26.881  1.00 48.28  ? 399  CYS B N     1 
ATOM   2214 C  CA    . CYS A 1 336 ? -23.851 -33.298 26.117  1.00 43.02  ? 399  CYS B CA    1 
ATOM   2215 C  C     . CYS A 1 336 ? -22.738 -33.722 27.015  1.00 41.17  ? 399  CYS B C     1 
ATOM   2216 O  O     . CYS A 1 336 ? -22.131 -34.703 26.779  1.00 42.79  ? 399  CYS B O     1 
ATOM   2217 C  CB    . CYS A 1 336 ? -23.394 -32.137 25.268  1.00 47.54  ? 399  CYS B CB    1 
ATOM   2218 S  SG    . CYS A 1 336 ? -22.085 -32.394 24.129  1.00 54.41  ? 399  CYS B SG    1 
ATOM   2219 N  N     . GLU A 1 337 ? -22.472 -32.930 28.029  1.00 50.32  ? 400  GLU B N     1 
ATOM   2220 C  CA    . GLU A 1 337 ? -21.485 -33.211 29.058  1.00 49.67  ? 400  GLU B CA    1 
ATOM   2221 C  C     . GLU A 1 337 ? -21.825 -34.338 30.009  1.00 41.17  ? 400  GLU B C     1 
ATOM   2222 O  O     . GLU A 1 337 ? -20.992 -35.074 30.443  1.00 37.21  ? 400  GLU B O     1 
ATOM   2223 C  CB    . GLU A 1 337 ? -21.149 -31.944 29.813  1.00 45.76  ? 400  GLU B CB    1 
ATOM   2224 C  CG    . GLU A 1 337 ? -20.064 -31.138 29.163  1.00 43.53  ? 400  GLU B CG    1 
ATOM   2225 C  CD    . GLU A 1 337 ? -19.757 -29.917 29.903  1.00 48.32  ? 400  GLU B CD    1 
ATOM   2226 O  OE1   . GLU A 1 337 ? -20.318 -29.722 30.951  1.00 50.85  ? 400  GLU B OE1   1 
ATOM   2227 O  OE2   . GLU A 1 337 ? -18.947 -29.157 29.438  1.00 49.26  ? 400  GLU B OE2   1 
ATOM   2228 N  N     . ALA A 1 338 ? -23.082 -34.433 30.343  1.00 41.07  ? 401  ALA B N     1 
ATOM   2229 C  CA    . ALA A 1 338 ? -23.564 -35.435 31.244  1.00 39.50  ? 401  ALA B CA    1 
ATOM   2230 C  C     . ALA A 1 338 ? -23.367 -36.792 30.701  1.00 46.96  ? 401  ALA B C     1 
ATOM   2231 O  O     . ALA A 1 338 ? -23.018 -37.693 31.408  1.00 51.35  ? 401  ALA B O     1 
ATOM   2232 C  CB    . ALA A 1 338 ? -25.033 -35.213 31.464  1.00 38.52  ? 401  ALA B CB    1 
ATOM   2233 N  N     . TYR A 1 339 ? -23.676 -36.931 29.430  1.00 43.90  ? 402  TYR B N     1 
ATOM   2234 C  CA    . TYR A 1 339 ? -23.533 -38.142 28.667  1.00 42.17  ? 402  TYR B CA    1 
ATOM   2235 C  C     . TYR A 1 339 ? -22.109 -38.576 28.470  1.00 43.94  ? 402  TYR B C     1 
ATOM   2236 O  O     . TYR A 1 339 ? -21.797 -39.714 28.490  1.00 45.20  ? 402  TYR B O     1 
ATOM   2237 C  CB    . TYR A 1 339 ? -24.160 -37.935 27.331  1.00 33.43  ? 402  TYR B CB    1 
ATOM   2238 C  CG    . TYR A 1 339 ? -25.620 -37.976 27.341  1.00 36.18  ? 402  TYR B CG    1 
ATOM   2239 C  CD1   . TYR A 1 339 ? -26.252 -39.019 27.843  1.00 35.63  ? 402  TYR B CD1   1 
ATOM   2240 C  CD2   . TYR A 1 339 ? -26.364 -36.986 26.788  1.00 44.01  ? 402  TYR B CD2   1 
ATOM   2241 C  CE1   . TYR A 1 339 ? -27.595 -39.087 27.847  1.00 35.16  ? 402  TYR B CE1   1 
ATOM   2242 C  CE2   . TYR A 1 339 ? -27.716 -37.055 26.783  1.00 36.83  ? 402  TYR B CE2   1 
ATOM   2243 C  CZ    . TYR A 1 339 ? -28.301 -38.124 27.340  1.00 36.25  ? 402  TYR B CZ    1 
ATOM   2244 O  OH    . TYR A 1 339 ? -29.618 -38.261 27.381  1.00 41.26  ? 402  TYR B OH    1 
ATOM   2245 N  N     . ALA A 1 340 ? -21.238 -37.625 28.276  1.00 38.80  ? 403  ALA B N     1 
ATOM   2246 C  CA    . ALA A 1 340 ? -19.857 -37.869 28.019  1.00 37.85  ? 403  ALA B CA    1 
ATOM   2247 C  C     . ALA A 1 340 ? -19.173 -38.538 29.115  1.00 46.88  ? 403  ALA B C     1 
ATOM   2248 O  O     . ALA A 1 340 ? -18.297 -39.301 28.869  1.00 51.11  ? 403  ALA B O     1 
ATOM   2249 C  CB    . ALA A 1 340 ? -19.155 -36.583 27.718  1.00 39.44  ? 403  ALA B CB    1 
ATOM   2250 N  N     . LEU A 1 341 ? -19.510 -38.160 30.339  1.00 50.19  ? 404  LEU B N     1 
ATOM   2251 C  CA    . LEU A 1 341 ? -18.998 -38.730 31.567  1.00 48.57  ? 404  LEU B CA    1 
ATOM   2252 C  C     . LEU A 1 341 ? -19.387 -40.131 31.709  1.00 44.99  ? 404  LEU B C     1 
ATOM   2253 O  O     . LEU A 1 341 ? -18.650 -40.921 32.138  1.00 47.54  ? 404  LEU B O     1 
ATOM   2254 C  CB    . LEU A 1 341 ? -19.525 -37.997 32.756  1.00 46.58  ? 404  LEU B CB    1 
ATOM   2255 C  CG    . LEU A 1 341 ? -18.779 -36.733 33.004  1.00 47.81  ? 404  LEU B CG    1 
ATOM   2256 C  CD1   . LEU A 1 341 ? -19.264 -36.234 34.316  1.00 50.66  ? 404  LEU B CD1   1 
ATOM   2257 C  CD2   . LEU A 1 341 ? -17.324 -37.019 33.073  1.00 47.63  ? 404  LEU B CD2   1 
ATOM   2258 N  N     . GLN A 1 342 ? -20.583 -40.431 31.308  1.00 47.05  ? 405  GLN B N     1 
ATOM   2259 C  CA    . GLN A 1 342 ? -21.099 -41.747 31.399  1.00 45.14  ? 405  GLN B CA    1 
ATOM   2260 C  C     . GLN A 1 342 ? -20.312 -42.643 30.563  1.00 44.56  ? 405  GLN B C     1 
ATOM   2261 O  O     . GLN A 1 342 ? -20.238 -43.775 30.813  1.00 49.89  ? 405  GLN B O     1 
ATOM   2262 C  CB    . GLN A 1 342 ? -22.494 -41.781 30.900  1.00 46.93  ? 405  GLN B CB    1 
ATOM   2263 C  CG    . GLN A 1 342 ? -23.445 -40.937 31.654  1.00 50.71  ? 405  GLN B CG    1 
ATOM   2264 C  CD    . GLN A 1 342 ? -24.821 -41.450 31.465  1.00 62.46  ? 405  GLN B CD    1 
ATOM   2265 O  OE1   . GLN A 1 342 ? -25.776 -40.718 31.556  1.00 63.71  ? 405  GLN B OE1   1 
ATOM   2266 N  NE2   . GLN A 1 342 ? -24.932 -42.716 31.219  1.00 60.93  ? 405  GLN B NE2   1 
ATOM   2267 N  N     . MET A 1 343 ? -19.766 -42.156 29.487  1.00 43.52  ? 406  MET B N     1 
ATOM   2268 C  CA    . MET A 1 343 ? -18.962 -42.975 28.610  1.00 45.72  ? 406  MET B CA    1 
ATOM   2269 C  C     . MET A 1 343 ? -17.599 -43.309 29.133  1.00 52.89  ? 406  MET B C     1 
ATOM   2270 O  O     . MET A 1 343 ? -17.000 -44.199 28.654  1.00 55.44  ? 406  MET B O     1 
ATOM   2271 C  CB    . MET A 1 343 ? -18.826 -42.367 27.228  1.00 47.24  ? 406  MET B CB    1 
ATOM   2272 C  CG    . MET A 1 343 ? -19.707 -42.959 26.163  1.00 39.32  ? 406  MET B CG    1 
ATOM   2273 S  SD    . MET A 1 343 ? -21.225 -43.676 26.733  1.00 45.85  ? 406  MET B SD    1 
ATOM   2274 C  CE    . MET A 1 343 ? -20.866 -45.345 26.397  1.00 47.22  ? 406  MET B CE    1 
ATOM   2275 N  N     . THR A 1 344 ? -17.136 -42.624 30.163  1.00 53.29  ? 407  THR B N     1 
ATOM   2276 C  CA    . THR A 1 344 ? -15.855 -42.782 30.793  1.00 56.28  ? 407  THR B CA    1 
ATOM   2277 C  C     . THR A 1 344 ? -15.572 -44.100 31.458  1.00 59.52  ? 407  THR B C     1 
ATOM   2278 O  O     . THR A 1 344 ? -14.432 -44.400 31.758  1.00 67.54  ? 407  THR B O     1 
ATOM   2279 C  CB    . THR A 1 344 ? -15.665 -41.732 31.819  1.00 56.90  ? 407  THR B CB    1 
ATOM   2280 O  OG1   . THR A 1 344 ? -16.033 -40.497 31.251  1.00 52.22  ? 407  THR B OG1   1 
ATOM   2281 C  CG2   . THR A 1 344 ? -14.256 -41.681 32.151  1.00 66.60  ? 407  THR B CG2   1 
ATOM   2282 N  N     . LYS A 1 345 ? -16.614 -44.854 31.766  1.00 52.92  ? 408  LYS B N     1 
ATOM   2283 C  CA    . LYS A 1 345 ? -16.530 -46.178 32.291  1.00 58.23  ? 408  LYS B CA    1 
ATOM   2284 C  C     . LYS A 1 345 ? -15.863 -47.117 31.290  1.00 61.52  ? 408  LYS B C     1 
ATOM   2285 O  O     . LYS A 1 345 ? -15.220 -48.063 31.664  1.00 68.99  ? 408  LYS B O     1 
ATOM   2286 C  CB    . LYS A 1 345 ? -17.895 -46.654 32.652  1.00 53.71  ? 408  LYS B CB    1 
ATOM   2287 C  CG    . LYS A 1 345 ? -18.794 -45.544 33.068  1.00 49.78  ? 408  LYS B CG    1 
ATOM   2288 C  CD    . LYS A 1 345 ? -18.152 -44.669 34.106  1.00 63.92  ? 408  LYS B CD    1 
ATOM   2289 C  CE    . LYS A 1 345 ? -18.919 -44.728 35.423  1.00 75.85  ? 408  LYS B CE    1 
ATOM   2290 N  NZ    . LYS A 1 345 ? -18.566 -43.685 36.417  1.00 71.43  ? 408  LYS B NZ    1 
ATOM   2291 N  N     . LEU A 1 346 ? -16.083 -46.931 30.016  1.00 56.16  ? 409  LEU B N     1 
ATOM   2292 C  CA    . LEU A 1 346 ? -15.446 -47.770 29.051  1.00 61.50  ? 409  LEU B CA    1 
ATOM   2293 C  C     . LEU A 1 346 ? -14.360 -46.980 28.403  1.00 56.92  ? 409  LEU B C     1 
ATOM   2294 O  O     . LEU A 1 346 ? -14.482 -45.828 28.239  1.00 59.28  ? 409  LEU B O     1 
ATOM   2295 C  CB    . LEU A 1 346 ? -16.464 -48.185 28.021  1.00 64.13  ? 409  LEU B CB    1 
ATOM   2296 C  CG    . LEU A 1 346 ? -17.894 -47.729 28.279  1.00 60.14  ? 409  LEU B CG    1 
ATOM   2297 C  CD1   . LEU A 1 346 ? -18.722 -48.090 27.073  1.00 59.70  ? 409  LEU B CD1   1 
ATOM   2298 C  CD2   . LEU A 1 346 ? -18.471 -48.364 29.514  1.00 56.11  ? 409  LEU B CD2   1 
ATOM   2299 N  N     . ASP A 1 347 ? -13.277 -47.597 28.024  1.00 55.91  ? 410  ASP B N     1 
ATOM   2300 C  CA    . ASP A 1 347 ? -12.198 -46.857 27.427  1.00 55.40  ? 410  ASP B CA    1 
ATOM   2301 C  C     . ASP A 1 347 ? -12.138 -47.308 25.992  1.00 56.30  ? 410  ASP B C     1 
ATOM   2302 O  O     . ASP A 1 347 ? -12.177 -48.459 25.740  1.00 58.24  ? 410  ASP B O     1 
ATOM   2303 C  CB    . ASP A 1 347 ? -10.928 -47.151 28.223  1.00 56.01  ? 410  ASP B CB    1 
ATOM   2304 C  CG    . ASP A 1 347 ? -9.746  -46.393 27.762  1.00 56.49  ? 410  ASP B CG    1 
ATOM   2305 O  OD1   . ASP A 1 347 ? -9.694  -46.003 26.615  1.00 58.03  ? 410  ASP B OD1   1 
ATOM   2306 O  OD2   . ASP A 1 347 ? -8.828  -46.218 28.551  1.00 55.96  ? 410  ASP B OD2   1 
ATOM   2307 N  N     . PHE A 1 348 ? -12.105 -46.390 25.050  1.00 50.57  ? 411  PHE B N     1 
ATOM   2308 C  CA    . PHE A 1 348 ? -12.090 -46.741 23.648  1.00 55.25  ? 411  PHE B CA    1 
ATOM   2309 C  C     . PHE A 1 348 ? -10.765 -46.573 22.960  1.00 63.94  ? 411  PHE B C     1 
ATOM   2310 O  O     . PHE A 1 348 ? -10.700 -46.566 21.758  1.00 70.14  ? 411  PHE B O     1 
ATOM   2311 C  CB    . PHE A 1 348 ? -13.060 -45.895 22.845  1.00 53.06  ? 411  PHE B CB    1 
ATOM   2312 C  CG    . PHE A 1 348 ? -14.425 -45.829 23.393  1.00 47.99  ? 411  PHE B CG    1 
ATOM   2313 C  CD1   . PHE A 1 348 ? -15.105 -46.946 23.720  1.00 46.34  ? 411  PHE B CD1   1 
ATOM   2314 C  CD2   . PHE A 1 348 ? -15.030 -44.640 23.528  1.00 45.78  ? 411  PHE B CD2   1 
ATOM   2315 C  CE1   . PHE A 1 348 ? -16.363 -46.871 24.203  1.00 43.74  ? 411  PHE B CE1   1 
ATOM   2316 C  CE2   . PHE A 1 348 ? -16.278 -44.559 24.025  1.00 44.29  ? 411  PHE B CE2   1 
ATOM   2317 C  CZ    . PHE A 1 348 ? -16.949 -45.676 24.355  1.00 40.49  ? 411  PHE B CZ    1 
ATOM   2318 N  N     . ASN A 1 349 ? -9.702  -46.401 23.698  1.00 60.29  ? 412  ASN B N     1 
ATOM   2319 C  CA    . ASN A 1 349 ? -8.451  -46.172 23.034  1.00 61.00  ? 412  ASN B CA    1 
ATOM   2320 C  C     . ASN A 1 349 ? -7.322  -47.095 23.370  1.00 67.26  ? 412  ASN B C     1 
ATOM   2321 O  O     . ASN A 1 349 ? -7.197  -47.551 24.473  1.00 72.03  ? 412  ASN B O     1 
ATOM   2322 C  CB    . ASN A 1 349 ? -8.006  -44.792 23.373  1.00 61.04  ? 412  ASN B CB    1 
ATOM   2323 C  CG    . ASN A 1 349 ? -8.524  -43.795 22.429  1.00 66.28  ? 412  ASN B CG    1 
ATOM   2324 O  OD1   . ASN A 1 349 ? -8.110  -43.753 21.307  1.00 67.84  ? 412  ASN B OD1   1 
ATOM   2325 N  ND2   . ASN A 1 349 ? -9.441  -42.977 22.879  1.00 66.51  ? 412  ASN B ND2   1 
ATOM   2326 N  N     . THR A 1 350 ? -6.474  -47.375 22.396  1.00 66.24  ? 413  THR B N     1 
ATOM   2327 C  CA    . THR A 1 350 ? -5.311  -48.172 22.675  1.00 61.77  ? 413  THR B CA    1 
ATOM   2328 C  C     . THR A 1 350 ? -4.334  -47.291 23.356  1.00 63.72  ? 413  THR B C     1 
ATOM   2329 O  O     . THR A 1 350 ? -4.293  -46.103 23.137  1.00 62.55  ? 413  THR B O     1 
ATOM   2330 C  CB    . THR A 1 350 ? -4.528  -48.556 21.438  1.00 50.58  ? 413  THR B CB    1 
ATOM   2331 O  OG1   . THR A 1 350 ? -4.159  -47.385 20.736  1.00 53.49  ? 413  THR B OG1   1 
ATOM   2332 C  CG2   . THR A 1 350 ? -5.313  -49.376 20.582  1.00 51.43  ? 413  THR B CG2   1 
ATOM   2333 N  N     . ASP A 1 351 ? -3.400  -47.885 24.057  1.00 58.50  ? 414  ASP B N     1 
ATOM   2334 C  CA    . ASP A 1 351 ? -2.381  -47.108 24.682  1.00 58.16  ? 414  ASP B CA    1 
ATOM   2335 C  C     . ASP A 1 351 ? -1.522  -46.343 23.675  1.00 61.69  ? 414  ASP B C     1 
ATOM   2336 O  O     . ASP A 1 351 ? -1.031  -45.310 23.992  1.00 64.25  ? 414  ASP B O     1 
ATOM   2337 C  CB    . ASP A 1 351 ? -1.596  -47.915 25.673  1.00 59.08  ? 414  ASP B CB    1 
ATOM   2338 C  CG    . ASP A 1 351 ? -2.161  -47.827 27.046  1.00 60.08  ? 414  ASP B CG    1 
ATOM   2339 O  OD1   . ASP A 1 351 ? -3.178  -48.454 27.338  1.00 61.74  ? 414  ASP B OD1   1 
ATOM   2340 O  OD2   . ASP A 1 351 ? -1.576  -47.117 27.846  1.00 61.94  ? 414  ASP B OD2   1 
ATOM   2341 N  N     . GLU A 1 352 ? -1.279  -46.839 22.471  1.00 57.97  ? 415  GLU B N     1 
ATOM   2342 C  CA    . GLU A 1 352 ? -0.545  -46.055 21.508  1.00 61.80  ? 415  GLU B CA    1 
ATOM   2343 C  C     . GLU A 1 352 ? -1.336  -44.844 21.187  1.00 64.73  ? 415  GLU B C     1 
ATOM   2344 O  O     . GLU A 1 352 ? -0.789  -43.806 21.092  1.00 68.53  ? 415  GLU B O     1 
ATOM   2345 C  CB    . GLU A 1 352 ? -0.287  -46.801 20.211  1.00 64.85  ? 415  GLU B CB    1 
ATOM   2346 C  CG    . GLU A 1 352 ? 0.710   -46.091 19.303  1.00 68.55  ? 415  GLU B CG    1 
ATOM   2347 C  CD    . GLU A 1 352 ? 0.819   -46.685 17.919  1.00 78.17  ? 415  GLU B CD    1 
ATOM   2348 O  OE1   . GLU A 1 352 ? 1.861   -47.242 17.582  1.00 77.11  ? 415  GLU B OE1   1 
ATOM   2349 O  OE2   . GLU A 1 352 ? -0.129  -46.590 17.150  1.00 80.17  ? 415  GLU B OE2   1 
ATOM   2350 N  N     . GLU A 1 353 ? -2.631  -44.965 20.987  1.00 66.22  ? 416  GLU B N     1 
ATOM   2351 C  CA    . GLU A 1 353 ? -3.481  -43.815 20.740  1.00 66.43  ? 416  GLU B CA    1 
ATOM   2352 C  C     . GLU A 1 353 ? -3.548  -42.883 21.927  1.00 57.35  ? 416  GLU B C     1 
ATOM   2353 O  O     . GLU A 1 353 ? -3.568  -41.701 21.788  1.00 53.34  ? 416  GLU B O     1 
ATOM   2354 C  CB    . GLU A 1 353 ? -4.844  -44.269 20.320  1.00 62.49  ? 416  GLU B CB    1 
ATOM   2355 C  CG    . GLU A 1 353 ? -4.858  -44.817 18.926  1.00 66.24  ? 416  GLU B CG    1 
ATOM   2356 C  CD    . GLU A 1 353 ? -6.017  -45.700 18.738  1.00 63.83  ? 416  GLU B CD    1 
ATOM   2357 O  OE1   . GLU A 1 353 ? -6.271  -46.441 19.681  1.00 59.25  ? 416  GLU B OE1   1 
ATOM   2358 O  OE2   . GLU A 1 353 ? -6.652  -45.645 17.692  1.00 59.36  ? 416  GLU B OE2   1 
ATOM   2359 N  N     . LYS A 1 354 ? -3.519  -43.433 23.122  1.00 54.16  ? 417  LYS B N     1 
ATOM   2360 C  CA    . LYS A 1 354 ? -3.565  -42.638 24.313  1.00 50.28  ? 417  LYS B CA    1 
ATOM   2361 C  C     . LYS A 1 354 ? -2.406  -41.670 24.378  1.00 53.53  ? 417  LYS B C     1 
ATOM   2362 O  O     . LYS A 1 354 ? -2.544  -40.588 24.839  1.00 49.53  ? 417  LYS B O     1 
ATOM   2363 C  CB    . LYS A 1 354 ? -3.512  -43.538 25.513  1.00 44.70  ? 417  LYS B CB    1 
ATOM   2364 C  CG    . LYS A 1 354 ? -4.810  -44.182 25.903  1.00 50.95  ? 417  LYS B CG    1 
ATOM   2365 C  CD    . LYS A 1 354 ? -4.980  -44.120 27.389  1.00 43.30  ? 417  LYS B CD    1 
ATOM   2366 C  CE    . LYS A 1 354 ? -5.832  -45.248 27.869  1.00 51.55  ? 417  LYS B CE    1 
ATOM   2367 N  NZ    . LYS A 1 354 ? -6.802  -45.652 26.851  1.00 52.07  ? 417  LYS B NZ    1 
ATOM   2368 N  N     . LYS A 1 355 ? -1.227  -42.091 23.999  1.00 52.55  ? 418  LYS B N     1 
ATOM   2369 C  CA    . LYS A 1 355 ? -0.091  -41.242 23.920  1.00 53.70  ? 418  LYS B CA    1 
ATOM   2370 C  C     . LYS A 1 355 ? -0.296  -40.271 22.831  1.00 54.46  ? 418  LYS B C     1 
ATOM   2371 O  O     . LYS A 1 355 ? 0.082   -39.152 22.978  1.00 60.63  ? 418  LYS B O     1 
ATOM   2372 C  CB    . LYS A 1 355 ? 1.151   -42.041 23.611  1.00 55.45  ? 418  LYS B CB    1 
ATOM   2373 N  N     . MET A 1 356 ? -0.875  -40.695 21.711  1.00 56.19  ? 419  MET B N     1 
ATOM   2374 C  CA    . MET A 1 356 ? -1.130  -39.805 20.576  1.00 55.20  ? 419  MET B CA    1 
ATOM   2375 C  C     . MET A 1 356 ? -2.063  -38.687 20.977  1.00 54.07  ? 419  MET B C     1 
ATOM   2376 O  O     . MET A 1 356 ? -1.872  -37.572 20.580  1.00 49.90  ? 419  MET B O     1 
ATOM   2377 C  CB    . MET A 1 356 ? -1.772  -40.537 19.407  1.00 56.20  ? 419  MET B CB    1 
ATOM   2378 C  CG    . MET A 1 356 ? -0.894  -41.119 18.343  1.00 61.29  ? 419  MET B CG    1 
ATOM   2379 S  SD    . MET A 1 356 ? -1.765  -42.516 17.663  1.00 73.13  ? 419  MET B SD    1 
ATOM   2380 C  CE    . MET A 1 356 ? -1.332  -42.442 15.951  1.00 52.06  ? 419  MET B CE    1 
ATOM   2381 N  N     . VAL A 1 357 ? -3.073  -38.979 21.770  1.00 49.29  ? 420  VAL B N     1 
ATOM   2382 C  CA    . VAL A 1 357 ? -3.963  -37.951 22.192  1.00 47.64  ? 420  VAL B CA    1 
ATOM   2383 C  C     . VAL A 1 357 ? -3.228  -36.928 22.972  1.00 51.09  ? 420  VAL B C     1 
ATOM   2384 O  O     . VAL A 1 357 ? -3.369  -35.798 22.698  1.00 52.09  ? 420  VAL B O     1 
ATOM   2385 C  CB    . VAL A 1 357 ? -5.023  -38.498 23.120  1.00 44.41  ? 420  VAL B CB    1 
ATOM   2386 N  N     . GLU A 1 358 ? -2.390  -37.351 23.900  1.00 58.60  ? 421  GLU B N     1 
ATOM   2387 C  CA    . GLU A 1 358 ? -1.558  -36.489 24.726  1.00 56.61  ? 421  GLU B CA    1 
ATOM   2388 C  C     . GLU A 1 358 ? -0.486  -35.708 24.014  1.00 54.06  ? 421  GLU B C     1 
ATOM   2389 O  O     . GLU A 1 358 ? -0.155  -34.671 24.459  1.00 54.35  ? 421  GLU B O     1 
ATOM   2390 C  CB    . GLU A 1 358 ? -0.953  -37.252 25.871  1.00 52.30  ? 421  GLU B CB    1 
ATOM   2391 C  CG    . GLU A 1 358 ? -1.967  -37.942 26.739  1.00 60.10  ? 421  GLU B CG    1 
ATOM   2392 C  CD    . GLU A 1 358 ? -1.324  -38.894 27.701  1.00 70.71  ? 421  GLU B CD    1 
ATOM   2393 O  OE1   . GLU A 1 358 ? -0.100  -38.927 27.721  1.00 73.43  ? 421  GLU B OE1   1 
ATOM   2394 O  OE2   . GLU A 1 358 ? -2.028  -39.610 28.429  1.00 70.43  ? 421  GLU B OE2   1 
ATOM   2395 N  N     . GLU A 1 359 ? 0.166   -36.249 23.011  1.00 49.96  ? 422  GLU B N     1 
ATOM   2396 C  CA    . GLU A 1 359 ? 1.141   -35.440 22.317  1.00 51.39  ? 422  GLU B CA    1 
ATOM   2397 C  C     . GLU A 1 359 ? 0.479   -34.317 21.603  1.00 55.21  ? 422  GLU B C     1 
ATOM   2398 O  O     . GLU A 1 359 ? 0.934   -33.245 21.688  1.00 60.89  ? 422  GLU B O     1 
ATOM   2399 C  CB    . GLU A 1 359 ? 1.974   -36.239 21.334  1.00 52.64  ? 422  GLU B CB    1 
ATOM   2400 N  N     . VAL A 1 360 ? -0.602  -34.553 20.899  1.00 56.24  ? 423  VAL B N     1 
ATOM   2401 C  CA    . VAL A 1 360 ? -1.287  -33.492 20.181  1.00 59.95  ? 423  VAL B CA    1 
ATOM   2402 C  C     . VAL A 1 360 ? -1.966  -32.464 21.046  1.00 54.85  ? 423  VAL B C     1 
ATOM   2403 O  O     . VAL A 1 360 ? -2.085  -31.326 20.682  1.00 52.03  ? 423  VAL B O     1 
ATOM   2404 C  CB    . VAL A 1 360 ? -2.265  -34.037 19.137  1.00 52.05  ? 423  VAL B CB    1 
ATOM   2405 N  N     . PHE A 1 361 ? -2.521  -32.925 22.141  1.00 49.96  ? 424  PHE B N     1 
ATOM   2406 C  CA    . PHE A 1 361 ? -3.217  -32.090 23.074  1.00 50.58  ? 424  PHE B CA    1 
ATOM   2407 C  C     . PHE A 1 361 ? -2.294  -31.124 23.676  1.00 53.54  ? 424  PHE B C     1 
ATOM   2408 O  O     . PHE A 1 361 ? -2.578  -29.972 23.760  1.00 56.48  ? 424  PHE B O     1 
ATOM   2409 C  CB    . PHE A 1 361 ? -3.705  -32.979 24.177  1.00 47.11  ? 424  PHE B CB    1 
ATOM   2410 C  CG    . PHE A 1 361 ? -4.348  -32.276 25.276  1.00 46.55  ? 424  PHE B CG    1 
ATOM   2411 C  CD1   . PHE A 1 361 ? -3.629  -31.863 26.329  1.00 53.88  ? 424  PHE B CD1   1 
ATOM   2412 C  CD2   . PHE A 1 361 ? -5.687  -32.075 25.269  1.00 51.86  ? 424  PHE B CD2   1 
ATOM   2413 C  CE1   . PHE A 1 361 ? -4.233  -31.218 27.356  1.00 58.40  ? 424  PHE B CE1   1 
ATOM   2414 C  CE2   . PHE A 1 361 ? -6.307  -31.423 26.286  1.00 54.30  ? 424  PHE B CE2   1 
ATOM   2415 C  CZ    . PHE A 1 361 ? -5.576  -31.000 27.333  1.00 55.24  ? 424  PHE B CZ    1 
ATOM   2416 N  N     . SER A 1 362 ? -1.215  -31.668 24.173  1.00 52.65  ? 425  SER B N     1 
ATOM   2417 C  CA    . SER A 1 362 ? -0.160  -30.959 24.808  1.00 52.49  ? 425  SER B CA    1 
ATOM   2418 C  C     . SER A 1 362 ? 0.471   -30.072 23.832  1.00 53.16  ? 425  SER B C     1 
ATOM   2419 O  O     . SER A 1 362 ? 0.909   -29.021 24.140  1.00 55.14  ? 425  SER B O     1 
ATOM   2420 C  CB    . SER A 1 362 ? 0.868   -31.951 25.293  1.00 55.17  ? 425  SER B CB    1 
ATOM   2421 O  OG    . SER A 1 362 ? 0.533   -32.420 26.577  1.00 61.22  ? 425  SER B OG    1 
ATOM   2422 N  N     . ASN A 1 363 ? 0.620   -30.556 22.645  1.00 51.77  ? 426  ASN B N     1 
ATOM   2423 C  CA    . ASN A 1 363 ? 1.195   -29.763 21.627  1.00 51.72  ? 426  ASN B CA    1 
ATOM   2424 C  C     . ASN A 1 363 ? 0.362   -28.582 21.240  1.00 63.79  ? 426  ASN B C     1 
ATOM   2425 O  O     . ASN A 1 363 ? 0.864   -27.564 20.875  1.00 72.48  ? 426  ASN B O     1 
ATOM   2426 C  CB    . ASN A 1 363 ? 1.445   -30.581 20.443  1.00 53.97  ? 426  ASN B CB    1 
ATOM   2427 C  CG    . ASN A 1 363 ? 2.211   -29.840 19.459  1.00 62.88  ? 426  ASN B CG    1 
ATOM   2428 O  OD1   . ASN A 1 363 ? 1.714   -28.897 18.888  1.00 70.13  ? 426  ASN B OD1   1 
ATOM   2429 N  ND2   . ASN A 1 363 ? 3.452   -30.211 19.281  1.00 68.65  ? 426  ASN B ND2   1 
ATOM   2430 N  N     . ALA A 1 364 ? -0.936  -28.727 21.212  1.00 63.85  ? 427  ALA B N     1 
ATOM   2431 C  CA    . ALA A 1 364 ? -1.769  -27.607 20.911  1.00 59.36  ? 427  ALA B CA    1 
ATOM   2432 C  C     . ALA A 1 364 ? -1.661  -26.581 21.984  1.00 59.87  ? 427  ALA B C     1 
ATOM   2433 O  O     . ALA A 1 364 ? -1.477  -25.435 21.721  1.00 64.28  ? 427  ALA B O     1 
ATOM   2434 C  CB    . ALA A 1 364 ? -3.184  -28.084 20.837  1.00 58.73  ? 427  ALA B CB    1 
ATOM   2435 N  N     . ILE A 1 365 ? -1.700  -27.058 23.210  1.00 56.82  ? 428  ILE B N     1 
ATOM   2436 C  CA    . ILE A 1 365 ? -1.653  -26.328 24.455  1.00 57.63  ? 428  ILE B CA    1 
ATOM   2437 C  C     . ILE A 1 365 ? -0.335  -25.641 24.754  1.00 61.57  ? 428  ILE B C     1 
ATOM   2438 O  O     . ILE A 1 365 ? -0.289  -24.834 25.616  1.00 58.74  ? 428  ILE B O     1 
ATOM   2439 C  CB    . ILE A 1 365 ? -1.972  -27.302 25.600  1.00 57.13  ? 428  ILE B CB    1 
ATOM   2440 C  CG1   . ILE A 1 365 ? -3.266  -26.971 26.274  1.00 52.29  ? 428  ILE B CG1   1 
ATOM   2441 C  CG2   . ILE A 1 365 ? -0.929  -27.302 26.689  1.00 55.41  ? 428  ILE B CG2   1 
ATOM   2442 C  CD1   . ILE A 1 365 ? -3.369  -27.623 27.618  1.00 45.27  ? 428  ILE B CD1   1 
ATOM   2443 N  N     . ASP A 1 366 ? 0.748   -25.923 24.053  1.00 60.36  ? 429  ASP B N     1 
ATOM   2444 C  CA    . ASP A 1 366 ? 2.031   -25.325 24.416  1.00 66.78  ? 429  ASP B CA    1 
ATOM   2445 C  C     . ASP A 1 366 ? 2.083   -23.827 24.398  1.00 70.35  ? 429  ASP B C     1 
ATOM   2446 O  O     . ASP A 1 366 ? 2.789   -23.227 25.147  1.00 71.23  ? 429  ASP B O     1 
ATOM   2447 C  CB    . ASP A 1 366 ? 3.212   -25.895 23.635  1.00 65.45  ? 429  ASP B CB    1 
ATOM   2448 C  CG    . ASP A 1 366 ? 4.471   -25.956 24.473  1.00 71.39  ? 429  ASP B CG    1 
ATOM   2449 O  OD1   . ASP A 1 366 ? 4.407   -26.448 25.612  1.00 56.08  ? 429  ASP B OD1   1 
ATOM   2450 O  OD2   . ASP A 1 366 ? 5.513   -25.505 24.005  1.00 72.13  ? 429  ASP B OD2   1 
ATOM   2451 N  N     . CYS A 1 367 ? 1.375   -23.220 23.484  1.00 77.85  ? 430  CYS B N     1 
ATOM   2452 C  CA    . CYS A 1 367 ? 1.276   -21.798 23.382  1.00 77.24  ? 430  CYS B CA    1 
ATOM   2453 C  C     . CYS A 1 367 ? 0.657   -21.167 24.585  1.00 67.49  ? 430  CYS B C     1 
ATOM   2454 O  O     . CYS A 1 367 ? 1.079   -20.143 25.022  1.00 63.73  ? 430  CYS B O     1 
ATOM   2455 C  CB    . CYS A 1 367 ? 0.430   -21.505 22.181  1.00 68.05  ? 430  CYS B CB    1 
ATOM   2456 S  SG    . CYS A 1 367 ? 1.318   -22.155 20.788  1.00 96.06  ? 430  CYS B SG    1 
ATOM   2457 N  N     . LEU A 1 368 ? -0.333  -21.817 25.147  1.00 67.77  ? 431  LEU B N     1 
ATOM   2458 C  CA    . LEU A 1 368 ? -1.055  -21.313 26.268  1.00 66.29  ? 431  LEU B CA    1 
ATOM   2459 C  C     . LEU A 1 368 ? -0.140  -21.089 27.419  1.00 65.31  ? 431  LEU B C     1 
ATOM   2460 O  O     . LEU A 1 368 ? 0.719   -21.883 27.707  1.00 69.32  ? 431  LEU B O     1 
ATOM   2461 C  CB    . LEU A 1 368 ? -2.057  -22.369 26.669  1.00 67.95  ? 431  LEU B CB    1 
ATOM   2462 C  CG    . LEU A 1 368 ? -3.532  -22.101 26.817  1.00 62.06  ? 431  LEU B CG    1 
ATOM   2463 C  CD1   . LEU A 1 368 ? -4.008  -21.385 25.586  1.00 51.27  ? 431  LEU B CD1   1 
ATOM   2464 C  CD2   . LEU A 1 368 ? -4.263  -23.402 27.082  1.00 53.78  ? 431  LEU B CD2   1 
ATOM   2465 N  N     . SER A 1 369 ? -0.382  -20.006 28.127  1.00 67.44  ? 432  SER B N     1 
ATOM   2466 C  CA    . SER A 1 369 ? 0.402   -19.647 29.284  1.00 68.23  ? 432  SER B CA    1 
ATOM   2467 C  C     . SER A 1 369 ? 0.225   -20.713 30.285  1.00 66.98  ? 432  SER B C     1 
ATOM   2468 O  O     . SER A 1 369 ? -0.853  -21.109 30.548  1.00 62.42  ? 432  SER B O     1 
ATOM   2469 C  CB    . SER A 1 369 ? -0.142  -18.375 29.916  1.00 62.42  ? 432  SER B CB    1 
ATOM   2470 N  N     . ASP A 1 370 ? 1.256   -21.012 31.043  1.00 69.96  ? 433  ASP B N     1 
ATOM   2471 C  CA    . ASP A 1 370 ? 1.220   -22.066 32.040  1.00 68.37  ? 433  ASP B CA    1 
ATOM   2472 C  C     . ASP A 1 370 ? 0.142   -21.847 33.091  1.00 65.03  ? 433  ASP B C     1 
ATOM   2473 O  O     . ASP A 1 370 ? -0.402  -22.766 33.636  1.00 66.38  ? 433  ASP B O     1 
ATOM   2474 C  CB    . ASP A 1 370 ? 2.597   -22.224 32.657  1.00 69.42  ? 433  ASP B CB    1 
ATOM   2475 C  CG    . ASP A 1 370 ? 3.118   -20.950 33.225  1.00 76.10  ? 433  ASP B CG    1 
ATOM   2476 O  OD1   . ASP A 1 370 ? 2.581   -19.890 32.897  1.00 75.16  ? 433  ASP B OD1   1 
ATOM   2477 O  OD2   . ASP A 1 370 ? 4.045   -21.010 34.026  1.00 75.42  ? 433  ASP B OD2   1 
ATOM   2478 N  N     . GLU A 1 371 ? -0.101  -20.617 33.455  1.00 63.24  ? 434  GLU B N     1 
ATOM   2479 C  CA    . GLU A 1 371 ? -1.176  -20.335 34.307  1.00 68.09  ? 434  GLU B CA    1 
ATOM   2480 C  C     . GLU A 1 371 ? -2.471  -20.710 33.590  1.00 69.67  ? 434  GLU B C     1 
ATOM   2481 O  O     . GLU A 1 371 ? -3.352  -21.250 34.210  1.00 70.60  ? 434  GLU B O     1 
ATOM   2482 C  CB    . GLU A 1 371 ? -1.139  -18.865 34.660  1.00 63.53  ? 434  GLU B CB    1 
ATOM   2483 C  CG    . GLU A 1 371 ? -1.812  -18.599 35.956  1.00 62.34  ? 434  GLU B CG    1 
ATOM   2484 C  CD    . GLU A 1 371 ? -3.168  -19.191 35.938  1.00 74.08  ? 434  GLU B CD    1 
ATOM   2485 O  OE1   . GLU A 1 371 ? -3.515  -20.002 36.795  1.00 72.04  ? 434  GLU B OE1   1 
ATOM   2486 O  OE2   . GLU A 1 371 ? -3.872  -18.879 34.989  1.00 79.86  ? 434  GLU B OE2   1 
ATOM   2487 N  N     . ASP A 1 372 ? -2.632  -20.401 32.308  1.00 65.76  ? 435  ASP B N     1 
ATOM   2488 C  CA    . ASP A 1 372 ? -3.861  -20.774 31.586  1.00 68.44  ? 435  ASP B CA    1 
ATOM   2489 C  C     . ASP A 1 372 ? -3.936  -22.271 31.430  1.00 65.37  ? 435  ASP B C     1 
ATOM   2490 O  O     . ASP A 1 372 ? -4.983  -22.841 31.505  1.00 60.54  ? 435  ASP B O     1 
ATOM   2491 C  CB    . ASP A 1 372 ? -3.994  -20.097 30.224  1.00 66.15  ? 435  ASP B CB    1 
ATOM   2492 C  CG    . ASP A 1 372 ? -4.331  -18.652 30.312  1.00 63.21  ? 435  ASP B CG    1 
ATOM   2493 O  OD1   . ASP A 1 372 ? -4.735  -18.171 31.358  1.00 73.00  ? 435  ASP B OD1   1 
ATOM   2494 O  OD2   . ASP A 1 372 ? -4.183  -17.979 29.313  1.00 54.48  ? 435  ASP B OD2   1 
ATOM   2495 N  N     . LYS A 1 373 ? -2.792  -22.915 31.232  1.00 61.97  ? 436  LYS B N     1 
ATOM   2496 C  CA    . LYS A 1 373 ? -2.662  -24.358 31.079  1.00 54.67  ? 436  LYS B CA    1 
ATOM   2497 C  C     . LYS A 1 373 ? -3.029  -25.152 32.309  1.00 50.58  ? 436  LYS B C     1 
ATOM   2498 O  O     . LYS A 1 373 ? -3.346  -26.290 32.236  1.00 56.39  ? 436  LYS B O     1 
ATOM   2499 C  CB    . LYS A 1 373 ? -1.273  -24.732 30.608  1.00 46.04  ? 436  LYS B CB    1 
ATOM   2500 N  N     . LYS A 1 374 ? -2.994  -24.554 33.468  1.00 51.19  ? 437  LYS B N     1 
ATOM   2501 C  CA    . LYS A 1 374 ? -3.349  -25.211 34.680  1.00 58.09  ? 437  LYS B CA    1 
ATOM   2502 C  C     . LYS A 1 374 ? -4.795  -25.111 35.024  1.00 55.96  ? 437  LYS B C     1 
ATOM   2503 O  O     . LYS A 1 374 ? -5.180  -25.516 36.087  1.00 55.01  ? 437  LYS B O     1 
ATOM   2504 C  CB    . LYS A 1 374 ? -2.563  -24.593 35.821  1.00 61.40  ? 437  LYS B CB    1 
ATOM   2505 N  N     . LEU A 1 375 ? -5.591  -24.534 34.151  1.00 49.44  ? 438  LEU B N     1 
ATOM   2506 C  CA    . LEU A 1 375 ? -6.986  -24.343 34.394  1.00 51.35  ? 438  LEU B CA    1 
ATOM   2507 C  C     . LEU A 1 375 ? -7.737  -25.613 34.502  1.00 48.81  ? 438  LEU B C     1 
ATOM   2508 O  O     . LEU A 1 375 ? -7.439  -26.559 33.855  1.00 55.32  ? 438  LEU B O     1 
ATOM   2509 C  CB    . LEU A 1 375 ? -7.574  -23.497 33.288  1.00 54.78  ? 438  LEU B CB    1 
ATOM   2510 N  N     . PRO A 1 376 ? -8.776  -25.618 35.299  1.00 41.69  ? 439  PRO B N     1 
ATOM   2511 C  CA    . PRO A 1 376 ? -9.650  -26.744 35.540  1.00 49.78  ? 439  PRO B CA    1 
ATOM   2512 C  C     . PRO A 1 376 ? -10.362 -27.167 34.289  1.00 57.78  ? 439  PRO B C     1 
ATOM   2513 O  O     . PRO A 1 376 ? -10.666 -28.313 34.083  1.00 59.49  ? 439  PRO B O     1 
ATOM   2514 C  CB    . PRO A 1 376 ? -10.651 -26.194 36.514  1.00 39.44  ? 439  PRO B CB    1 
ATOM   2515 C  CG    . PRO A 1 376 ? -9.988  -25.062 37.124  1.00 42.01  ? 439  PRO B CG    1 
ATOM   2516 C  CD    . PRO A 1 376 ? -9.181  -24.456 36.066  1.00 39.40  ? 439  PRO B CD    1 
ATOM   2517 N  N     . GLN A 1 377 ? -10.674 -26.198 33.469  1.00 54.93  ? 440  GLN B N     1 
ATOM   2518 C  CA    . GLN A 1 377 ? -11.331 -26.419 32.217  1.00 56.21  ? 440  GLN B CA    1 
ATOM   2519 C  C     . GLN A 1 377 ? -10.438 -27.147 31.284  1.00 58.23  ? 440  GLN B C     1 
ATOM   2520 O  O     . GLN A 1 377 ? -10.879 -27.946 30.507  1.00 61.70  ? 440  GLN B O     1 
ATOM   2521 C  CB    . GLN A 1 377 ? -11.817 -25.115 31.649  1.00 51.52  ? 440  GLN B CB    1 
ATOM   2522 C  CG    . GLN A 1 377 ? -13.225 -24.829 32.076  1.00 54.99  ? 440  GLN B CG    1 
ATOM   2523 C  CD    . GLN A 1 377 ? -13.406 -24.691 33.564  1.00 63.52  ? 440  GLN B CD    1 
ATOM   2524 O  OE1   . GLN A 1 377 ? -12.960 -23.726 34.148  1.00 56.22  ? 440  GLN B OE1   1 
ATOM   2525 N  NE2   . GLN A 1 377 ? -14.106 -25.635 34.170  1.00 58.03  ? 440  GLN B NE2   1 
ATOM   2526 N  N     . VAL A 1 378 ? -9.179  -26.790 31.291  1.00 50.59  ? 441  VAL B N     1 
ATOM   2527 C  CA    . VAL A 1 378 ? -8.224  -27.520 30.522  1.00 44.50  ? 441  VAL B CA    1 
ATOM   2528 C  C     . VAL A 1 378 ? -7.889  -28.846 31.116  1.00 53.51  ? 441  VAL B C     1 
ATOM   2529 O  O     . VAL A 1 378 ? -7.800  -29.789 30.425  1.00 53.77  ? 441  VAL B O     1 
ATOM   2530 C  CB    . VAL A 1 378 ? -6.935  -26.773 30.373  1.00 40.65  ? 441  VAL B CB    1 
ATOM   2531 C  CG1   . VAL A 1 378 ? -5.844  -27.703 29.945  1.00 39.14  ? 441  VAL B CG1   1 
ATOM   2532 C  CG2   . VAL A 1 378 ? -7.090  -25.704 29.348  1.00 49.14  ? 441  VAL B CG2   1 
ATOM   2533 N  N     . GLU A 1 379 ? -7.670  -28.903 32.424  1.00 60.77  ? 442  GLU B N     1 
ATOM   2534 C  CA    . GLU A 1 379 ? -7.218  -30.144 33.065  1.00 63.71  ? 442  GLU B CA    1 
ATOM   2535 C  C     . GLU A 1 379 ? -8.153  -31.336 33.029  1.00 58.54  ? 442  GLU B C     1 
ATOM   2536 O  O     . GLU A 1 379 ? -7.716  -32.439 32.762  1.00 55.22  ? 442  GLU B O     1 
ATOM   2537 C  CB    . GLU A 1 379 ? -6.849  -29.900 34.530  1.00 68.20  ? 442  GLU B CB    1 
ATOM   2538 C  CG    . GLU A 1 379 ? -6.746  -31.186 35.344  1.00 74.73  ? 442  GLU B CG    1 
ATOM   2539 C  CD    . GLU A 1 379 ? -7.330  -31.071 36.743  1.00 84.79  ? 442  GLU B CD    1 
ATOM   2540 O  OE1   . GLU A 1 379 ? -8.494  -31.477 36.932  1.00 77.84  ? 442  GLU B OE1   1 
ATOM   2541 O  OE2   . GLU A 1 379 ? -6.621  -30.588 37.656  1.00 82.36  ? 442  GLU B OE2   1 
ATOM   2542 N  N     . HIS A 1 380 ? -9.430  -31.117 33.303  1.00 59.56  ? 443  HIS B N     1 
ATOM   2543 C  CA    . HIS A 1 380 ? -10.372 -32.189 33.379  1.00 63.84  ? 443  HIS B CA    1 
ATOM   2544 C  C     . HIS A 1 380 ? -10.776 -32.787 32.061  1.00 60.28  ? 443  HIS B C     1 
ATOM   2545 O  O     . HIS A 1 380 ? -11.330 -33.848 32.036  1.00 62.73  ? 443  HIS B O     1 
ATOM   2546 C  CB    . HIS A 1 380 ? -11.571 -31.758 34.178  1.00 63.77  ? 443  HIS B CB    1 
ATOM   2547 N  N     . VAL A 1 381 ? -10.610 -32.047 30.989  1.00 51.93  ? 444  VAL B N     1 
ATOM   2548 C  CA    . VAL A 1 381 ? -10.905 -32.516 29.668  1.00 57.09  ? 444  VAL B CA    1 
ATOM   2549 C  C     . VAL A 1 381 ? -10.005 -33.609 29.176  1.00 57.51  ? 444  VAL B C     1 
ATOM   2550 O  O     . VAL A 1 381 ? -10.427 -34.465 28.466  1.00 57.87  ? 444  VAL B O     1 
ATOM   2551 C  CB    . VAL A 1 381 ? -10.856 -31.385 28.639  1.00 61.45  ? 444  VAL B CB    1 
ATOM   2552 N  N     . LEU A 1 382 ? -8.752  -33.561 29.550  1.00 54.54  ? 445  LEU B N     1 
ATOM   2553 C  CA    . LEU A 1 382 ? -7.789  -34.500 29.035  1.00 52.16  ? 445  LEU B CA    1 
ATOM   2554 C  C     . LEU A 1 382 ? -8.020  -35.930 29.274  1.00 56.18  ? 445  LEU B C     1 
ATOM   2555 O  O     . LEU A 1 382 ? -7.714  -36.708 28.444  1.00 56.12  ? 445  LEU B O     1 
ATOM   2556 C  CB    . LEU A 1 382 ? -6.407  -34.173 29.489  1.00 53.24  ? 445  LEU B CB    1 
ATOM   2557 C  CG    . LEU A 1 382 ? -5.421  -35.034 28.769  1.00 46.65  ? 445  LEU B CG    1 
ATOM   2558 C  CD1   . LEU A 1 382 ? -5.855  -35.084 27.348  1.00 45.54  ? 445  LEU B CD1   1 
ATOM   2559 C  CD2   . LEU A 1 382 ? -4.098  -34.349 28.872  1.00 42.68  ? 445  LEU B CD2   1 
ATOM   2560 N  N     . PRO A 1 383 ? -8.516  -36.306 30.424  1.00 54.06  ? 446  PRO B N     1 
ATOM   2561 C  CA    . PRO A 1 383 ? -8.823  -37.694 30.626  1.00 54.35  ? 446  PRO B CA    1 
ATOM   2562 C  C     . PRO A 1 383 ? -9.878  -38.193 29.679  1.00 60.03  ? 446  PRO B C     1 
ATOM   2563 O  O     . PRO A 1 383 ? -9.802  -39.309 29.291  1.00 59.58  ? 446  PRO B O     1 
ATOM   2564 C  CB    . PRO A 1 383 ? -9.358  -37.685 32.020  1.00 54.18  ? 446  PRO B CB    1 
ATOM   2565 C  CG    . PRO A 1 383 ? -8.467  -36.764 32.680  1.00 54.91  ? 446  PRO B CG    1 
ATOM   2566 C  CD    . PRO A 1 383 ? -8.320  -35.650 31.704  1.00 55.61  ? 446  PRO B CD    1 
ATOM   2567 N  N     . LEU A 1 384 ? -10.883 -37.405 29.353  1.00 57.59  ? 447  LEU B N     1 
ATOM   2568 C  CA    . LEU A 1 384 ? -11.899 -37.814 28.449  1.00 48.47  ? 447  LEU B CA    1 
ATOM   2569 C  C     . LEU A 1 384 ? -11.358 -38.073 27.130  1.00 49.28  ? 447  LEU B C     1 
ATOM   2570 O  O     . LEU A 1 384 ? -11.635 -39.047 26.554  1.00 48.67  ? 447  LEU B O     1 
ATOM   2571 C  CB    . LEU A 1 384 ? -12.823 -36.682 28.284  1.00 49.39  ? 447  LEU B CB    1 
ATOM   2572 C  CG    . LEU A 1 384 ? -13.914 -36.667 29.287  1.00 51.27  ? 447  LEU B CG    1 
ATOM   2573 C  CD1   . LEU A 1 384 ? -15.049 -35.987 28.595  1.00 48.38  ? 447  LEU B CD1   1 
ATOM   2574 C  CD2   . LEU A 1 384 ? -14.299 -38.090 29.498  1.00 60.65  ? 447  LEU B CD2   1 
ATOM   2575 N  N     . LEU A 1 385 ? -10.492 -37.216 26.657  1.00 49.91  ? 448  LEU B N     1 
ATOM   2576 C  CA    . LEU A 1 385 ? -9.896  -37.386 25.365  1.00 48.32  ? 448  LEU B CA    1 
ATOM   2577 C  C     . LEU A 1 385 ? -9.074  -38.598 25.328  1.00 52.00  ? 448  LEU B C     1 
ATOM   2578 O  O     . LEU A 1 385 ? -9.165  -39.374 24.432  1.00 58.75  ? 448  LEU B O     1 
ATOM   2579 C  CB    . LEU A 1 385 ? -9.049  -36.205 25.006  1.00 45.98  ? 448  LEU B CB    1 
ATOM   2580 C  CG    . LEU A 1 385 ? -9.803  -35.183 24.220  1.00 50.35  ? 448  LEU B CG    1 
ATOM   2581 C  CD1   . LEU A 1 385 ? -10.925 -34.699 25.064  1.00 49.41  ? 448  LEU B CD1   1 
ATOM   2582 C  CD2   . LEU A 1 385 ? -8.911  -34.039 23.880  1.00 56.01  ? 448  LEU B CD2   1 
ATOM   2583 N  N     . LYS A 1 386 ? -8.338  -38.851 26.381  1.00 52.47  ? 449  LYS B N     1 
ATOM   2584 C  CA    . LYS A 1 386 ? -7.503  -40.006 26.468  1.00 52.94  ? 449  LYS B CA    1 
ATOM   2585 C  C     . LYS A 1 386 ? -8.295  -41.271 26.356  1.00 52.95  ? 449  LYS B C     1 
ATOM   2586 O  O     . LYS A 1 386 ? -7.852  -42.146 25.702  1.00 60.05  ? 449  LYS B O     1 
ATOM   2587 C  CB    . LYS A 1 386 ? -6.690  -39.985 27.752  1.00 59.53  ? 449  LYS B CB    1 
ATOM   2588 N  N     . ARG A 1 387 ? -9.521  -41.265 26.818  1.00 54.09  ? 450  ARG B N     1 
ATOM   2589 C  CA    . ARG A 1 387 ? -10.380 -42.424 26.803  1.00 55.24  ? 450  ARG B CA    1 
ATOM   2590 C  C     . ARG A 1 387 ? -11.253 -42.473 25.593  1.00 49.23  ? 450  ARG B C     1 
ATOM   2591 O  O     . ARG A 1 387 ? -12.169 -43.216 25.559  1.00 48.95  ? 450  ARG B O     1 
ATOM   2592 C  CB    . ARG A 1 387 ? -11.236 -42.416 28.043  1.00 53.80  ? 450  ARG B CB    1 
ATOM   2593 C  CG    . ARG A 1 387 ? -11.644 -43.748 28.582  1.00 56.34  ? 450  ARG B CG    1 
ATOM   2594 C  CD    . ARG A 1 387 ? -11.901 -43.619 30.055  1.00 56.55  ? 450  ARG B CD    1 
ATOM   2595 N  NE    . ARG A 1 387 ? -10.649 -43.418 30.738  1.00 65.37  ? 450  ARG B NE    1 
ATOM   2596 C  CZ    . ARG A 1 387 ? -10.085 -42.237 30.885  1.00 70.08  ? 450  ARG B CZ    1 
ATOM   2597 N  NH1   . ARG A 1 387 ? -10.685 -41.169 30.404  1.00 67.90  ? 450  ARG B NH1   1 
ATOM   2598 N  NH2   . ARG A 1 387 ? -8.930  -42.111 31.499  1.00 60.42  ? 450  ARG B NH2   1 
ATOM   2599 N  N     . GLY A 1 388 ? -11.000 -41.631 24.619  1.00 48.98  ? 451  GLY B N     1 
ATOM   2600 C  CA    . GLY A 1 388 ? -11.761 -41.628 23.385  1.00 52.49  ? 451  GLY B CA    1 
ATOM   2601 C  C     . GLY A 1 388 ? -13.050 -40.850 23.297  1.00 48.26  ? 451  GLY B C     1 
ATOM   2602 O  O     . GLY A 1 388 ? -13.747 -40.920 22.340  1.00 45.12  ? 451  GLY B O     1 
ATOM   2603 N  N     . ILE A 1 389 ? -13.332 -40.081 24.313  1.00 47.95  ? 452  ILE B N     1 
ATOM   2604 C  CA    . ILE A 1 389 ? -14.521 -39.312 24.407  1.00 40.60  ? 452  ILE B CA    1 
ATOM   2605 C  C     . ILE A 1 389 ? -14.261 -37.860 24.189  1.00 45.10  ? 452  ILE B C     1 
ATOM   2606 O  O     . ILE A 1 389 ? -13.281 -37.362 24.603  1.00 52.11  ? 452  ILE B O     1 
ATOM   2607 C  CB    . ILE A 1 389 ? -15.010 -39.461 25.810  1.00 40.35  ? 452  ILE B CB    1 
ATOM   2608 C  CG1   . ILE A 1 389 ? -15.044 -40.911 26.141  1.00 44.90  ? 452  ILE B CG1   1 
ATOM   2609 C  CG2   . ILE A 1 389 ? -16.354 -38.837 25.986  1.00 42.92  ? 452  ILE B CG2   1 
ATOM   2610 C  CD1   . ILE A 1 389 ? -16.315 -41.331 26.789  1.00 50.47  ? 452  ILE B CD1   1 
ATOM   2611 N  N     . GLY A 1 390 ? -15.133 -37.185 23.483  1.00 43.37  ? 453  GLY B N     1 
ATOM   2612 C  CA    . GLY A 1 390 ? -15.004 -35.778 23.248  1.00 36.29  ? 453  GLY B CA    1 
ATOM   2613 C  C     . GLY A 1 390 ? -16.326 -35.105 23.420  1.00 37.63  ? 453  GLY B C     1 
ATOM   2614 O  O     . GLY A 1 390 ? -17.327 -35.735 23.408  1.00 40.33  ? 453  GLY B O     1 
ATOM   2615 N  N     . ILE A 1 391 ? -16.302 -33.824 23.690  1.00 35.31  ? 454  ILE B N     1 
ATOM   2616 C  CA    . ILE A 1 391 ? -17.486 -33.018 23.796  1.00 34.36  ? 454  ILE B CA    1 
ATOM   2617 C  C     . ILE A 1 391 ? -17.240 -31.793 22.963  1.00 40.63  ? 454  ILE B C     1 
ATOM   2618 O  O     . ILE A 1 391 ? -16.133 -31.348 22.843  1.00 41.92  ? 454  ILE B O     1 
ATOM   2619 C  CB    . ILE A 1 391 ? -17.699 -32.542 25.192  1.00 34.12  ? 454  ILE B CB    1 
ATOM   2620 C  CG1   . ILE A 1 391 ? -16.384 -32.155 25.766  1.00 36.21  ? 454  ILE B CG1   1 
ATOM   2621 C  CG2   . ILE A 1 391 ? -18.201 -33.647 26.042  1.00 36.26  ? 454  ILE B CG2   1 
ATOM   2622 C  CD1   . ILE A 1 391 ? -16.382 -32.101 27.258  1.00 43.23  ? 454  ILE B CD1   1 
ATOM   2623 N  N     . HIS A 1 392 ? -18.250 -31.278 22.308  1.00 36.15  ? 455  HIS B N     1 
ATOM   2624 C  CA    . HIS A 1 392 ? -18.052 -30.090 21.564  1.00 33.44  ? 455  HIS B CA    1 
ATOM   2625 C  C     . HIS A 1 392 ? -19.252 -29.295 21.678  1.00 43.50  ? 455  HIS B C     1 
ATOM   2626 O  O     . HIS A 1 392 ? -20.227 -29.658 21.118  1.00 41.04  ? 455  HIS B O     1 
ATOM   2627 C  CB    . HIS A 1 392 ? -17.892 -30.441 20.144  1.00 28.62  ? 455  HIS B CB    1 
ATOM   2628 C  CG    . HIS A 1 392 ? -17.253 -29.381 19.341  1.00 31.47  ? 455  HIS B CG    1 
ATOM   2629 N  ND1   . HIS A 1 392 ? -17.833 -28.165 19.140  1.00 31.27  ? 455  HIS B ND1   1 
ATOM   2630 C  CD2   . HIS A 1 392 ? -16.104 -29.364 18.657  1.00 33.55  ? 455  HIS B CD2   1 
ATOM   2631 C  CE1   . HIS A 1 392 ? -17.055 -27.426 18.393  1.00 32.58  ? 455  HIS B CE1   1 
ATOM   2632 N  NE2   . HIS A 1 392 ? -16.000 -28.134 18.080  1.00 33.17  ? 455  HIS B NE2   1 
ATOM   2633 N  N     . HIS A 1 393 ? -19.188 -28.172 22.363  1.00 44.37  ? 456  HIS B N     1 
ATOM   2634 C  CA    . HIS A 1 393 ? -20.348 -27.325 22.478  1.00 43.71  ? 456  HIS B CA    1 
ATOM   2635 C  C     . HIS A 1 393 ? -20.058 -25.894 22.509  1.00 45.58  ? 456  HIS B C     1 
ATOM   2636 O  O     . HIS A 1 393 ? -18.938 -25.547 22.454  1.00 45.40  ? 456  HIS B O     1 
ATOM   2637 C  CB    . HIS A 1 393 ? -21.403 -27.791 23.448  1.00 41.52  ? 456  HIS B CB    1 
ATOM   2638 C  CG    . HIS A 1 393 ? -21.156 -27.476 24.868  1.00 50.76  ? 456  HIS B CG    1 
ATOM   2639 N  ND1   . HIS A 1 393 ? -22.096 -26.846 25.639  1.00 63.64  ? 456  HIS B ND1   1 
ATOM   2640 C  CD2   . HIS A 1 393 ? -20.146 -27.791 25.691  1.00 53.99  ? 456  HIS B CD2   1 
ATOM   2641 C  CE1   . HIS A 1 393 ? -21.655 -26.744 26.869  1.00 60.98  ? 456  HIS B CE1   1 
ATOM   2642 N  NE2   . HIS A 1 393 ? -20.482 -27.328 26.930  1.00 52.38  ? 456  HIS B NE2   1 
ATOM   2643 N  N     . GLY A 1 394 ? -21.074 -25.060 22.471  1.00 46.23  ? 457  GLY B N     1 
ATOM   2644 C  CA    . GLY A 1 394 ? -20.862 -23.638 22.443  1.00 43.67  ? 457  GLY B CA    1 
ATOM   2645 C  C     . GLY A 1 394 ? -20.132 -23.079 23.632  1.00 48.75  ? 457  GLY B C     1 
ATOM   2646 O  O     . GLY A 1 394 ? -19.365 -22.179 23.516  1.00 44.30  ? 457  GLY B O     1 
ATOM   2647 N  N     . GLY A 1 395 ? -20.410 -23.609 24.792  1.00 49.59  ? 458  GLY B N     1 
ATOM   2648 C  CA    . GLY A 1 395 ? -19.793 -23.179 26.023  1.00 59.41  ? 458  GLY B CA    1 
ATOM   2649 C  C     . GLY A 1 395 ? -18.315 -23.337 26.300  1.00 53.55  ? 458  GLY B C     1 
ATOM   2650 O  O     . GLY A 1 395 ? -17.746 -22.589 27.039  1.00 48.90  ? 458  GLY B O     1 
ATOM   2651 N  N     . LEU A 1 396 ? -17.724 -24.372 25.746  1.00 52.99  ? 459  LEU B N     1 
ATOM   2652 C  CA    . LEU A 1 396 ? -16.336 -24.690 25.923  1.00 48.28  ? 459  LEU B CA    1 
ATOM   2653 C  C     . LEU A 1 396 ? -15.413 -23.763 25.270  1.00 44.76  ? 459  LEU B C     1 
ATOM   2654 O  O     . LEU A 1 396 ? -15.746 -23.065 24.392  1.00 49.85  ? 459  LEU B O     1 
ATOM   2655 C  CB    . LEU A 1 396 ? -16.043 -26.056 25.362  1.00 52.29  ? 459  LEU B CB    1 
ATOM   2656 C  CG    . LEU A 1 396 ? -16.331 -27.224 26.272  1.00 54.64  ? 459  LEU B CG    1 
ATOM   2657 C  CD1   . LEU A 1 396 ? -17.329 -26.729 27.264  1.00 57.54  ? 459  LEU B CD1   1 
ATOM   2658 C  CD2   . LEU A 1 396 ? -16.807 -28.465 25.565  1.00 45.31  ? 459  LEU B CD2   1 
ATOM   2659 N  N     . LEU A 1 397 ? -14.210 -23.769 25.759  1.00 47.96  ? 460  LEU B N     1 
ATOM   2660 C  CA    . LEU A 1 397 ? -13.171 -22.929 25.265  1.00 50.03  ? 460  LEU B CA    1 
ATOM   2661 C  C     . LEU A 1 397 ? -12.732 -23.336 23.905  1.00 42.52  ? 460  LEU B C     1 
ATOM   2662 O  O     . LEU A 1 397 ? -12.620 -24.472 23.624  1.00 46.16  ? 460  LEU B O     1 
ATOM   2663 C  CB    . LEU A 1 397 ? -11.985 -23.015 26.213  1.00 49.20  ? 460  LEU B CB    1 
ATOM   2664 C  CG    . LEU A 1 397 ? -12.164 -23.232 27.705  1.00 46.43  ? 460  LEU B CG    1 
ATOM   2665 C  CD1   . LEU A 1 397 ? -12.630 -21.996 28.422  1.00 38.40  ? 460  LEU B CD1   1 
ATOM   2666 C  CD2   . LEU A 1 397 ? -12.966 -24.466 28.060  1.00 47.51  ? 460  LEU B CD2   1 
ATOM   2667 N  N     . PRO A 1 398 ? -12.429 -22.375 23.074  1.00 38.99  ? 461  PRO B N     1 
ATOM   2668 C  CA    . PRO A 1 398 ? -11.980 -22.458 21.703  1.00 42.52  ? 461  PRO B CA    1 
ATOM   2669 C  C     . PRO A 1 398 ? -10.679 -23.156 21.492  1.00 46.42  ? 461  PRO B C     1 
ATOM   2670 O  O     . PRO A 1 398 ? -10.571 -23.823 20.525  1.00 53.03  ? 461  PRO B O     1 
ATOM   2671 C  CB    . PRO A 1 398 ? -11.867 -21.024 21.318  1.00 37.13  ? 461  PRO B CB    1 
ATOM   2672 C  CG    . PRO A 1 398 ? -12.944 -20.417 22.063  1.00 36.03  ? 461  PRO B CG    1 
ATOM   2673 C  CD    . PRO A 1 398 ? -12.874 -21.032 23.387  1.00 39.71  ? 461  PRO B CD    1 
ATOM   2674 N  N     . ILE A 1 399 ? -9.695  -23.010 22.357  1.00 50.02  ? 462  ILE B N     1 
ATOM   2675 C  CA    . ILE A 1 399 ? -8.455  -23.715 22.180  1.00 45.50  ? 462  ILE B CA    1 
ATOM   2676 C  C     . ILE A 1 399 ? -8.710  -25.188 22.256  1.00 45.82  ? 462  ILE B C     1 
ATOM   2677 O  O     . ILE A 1 399 ? -8.143  -25.910 21.524  1.00 46.65  ? 462  ILE B O     1 
ATOM   2678 C  CB    . ILE A 1 399 ? -7.354  -23.218 23.146  1.00 50.83  ? 462  ILE B CB    1 
ATOM   2679 C  CG1   . ILE A 1 399 ? -6.007  -23.843 22.848  1.00 52.57  ? 462  ILE B CG1   1 
ATOM   2680 C  CG2   . ILE A 1 399 ? -7.695  -23.381 24.605  1.00 44.00  ? 462  ILE B CG2   1 
ATOM   2681 C  CD1   . ILE A 1 399 ? -5.089  -22.925 22.106  1.00 43.59  ? 462  ILE B CD1   1 
ATOM   2682 N  N     . LEU A 1 400 ? -9.519  -25.626 23.194  1.00 48.54  ? 463  LEU B N     1 
ATOM   2683 C  CA    . LEU A 1 400 ? -9.934  -26.978 23.337  1.00 46.94  ? 463  LEU B CA    1 
ATOM   2684 C  C     . LEU A 1 400 ? -10.872 -27.399 22.271  1.00 48.28  ? 463  LEU B C     1 
ATOM   2685 O  O     . LEU A 1 400 ? -10.914 -28.530 21.952  1.00 49.47  ? 463  LEU B O     1 
ATOM   2686 C  CB    . LEU A 1 400 ? -10.606 -27.197 24.667  1.00 40.11  ? 463  LEU B CB    1 
ATOM   2687 C  CG    . LEU A 1 400 ? -9.833  -26.840 25.914  1.00 47.87  ? 463  LEU B CG    1 
ATOM   2688 C  CD1   . LEU A 1 400 ? -10.635 -27.303 27.097  1.00 51.23  ? 463  LEU B CD1   1 
ATOM   2689 C  CD2   . LEU A 1 400 ? -8.493  -27.520 25.947  1.00 44.29  ? 463  LEU B CD2   1 
ATOM   2690 N  N     . LYS A 1 401 ? -11.710 -26.508 21.785  1.00 47.65  ? 464  LYS B N     1 
ATOM   2691 C  CA    . LYS A 1 401 ? -12.702 -26.912 20.801  1.00 46.08  ? 464  LYS B CA    1 
ATOM   2692 C  C     . LYS A 1 401 ? -12.066 -27.407 19.554  1.00 44.05  ? 464  LYS B C     1 
ATOM   2693 O  O     . LYS A 1 401 ? -12.410 -28.413 19.011  1.00 39.51  ? 464  LYS B O     1 
ATOM   2694 C  CB    . LYS A 1 401 ? -13.647 -25.751 20.473  1.00 41.03  ? 464  LYS B CB    1 
ATOM   2695 C  CG    . LYS A 1 401 ? -14.964 -25.707 21.220  1.00 35.69  ? 464  LYS B CG    1 
ATOM   2696 C  CD    . LYS A 1 401 ? -15.957 -24.891 20.441  1.00 40.38  ? 464  LYS B CD    1 
ATOM   2697 C  CE    . LYS A 1 401 ? -16.001 -23.464 20.897  1.00 46.09  ? 464  LYS B CE    1 
ATOM   2698 N  NZ    . LYS A 1 401 ? -16.235 -22.500 19.807  1.00 48.57  ? 464  LYS B NZ    1 
ATOM   2699 N  N     . GLU A 1 402 ? -11.093 -26.668 19.115  1.00 46.82  ? 465  GLU B N     1 
ATOM   2700 C  CA    . GLU A 1 402 ? -10.339 -26.979 17.951  1.00 46.55  ? 465  GLU B CA    1 
ATOM   2701 C  C     . GLU A 1 402 ? -9.527  -28.205 18.129  1.00 45.13  ? 465  GLU B C     1 
ATOM   2702 O  O     . GLU A 1 402 ? -9.321  -28.928 17.229  1.00 43.24  ? 465  GLU B O     1 
ATOM   2703 C  CB    . GLU A 1 402 ? -9.442  -25.825 17.637  1.00 52.44  ? 465  GLU B CB    1 
ATOM   2704 C  CG    . GLU A 1 402 ? -10.149 -24.633 17.039  1.00 55.58  ? 465  GLU B CG    1 
ATOM   2705 C  CD    . GLU A 1 402 ? -9.226  -23.461 16.947  1.00 62.89  ? 465  GLU B CD    1 
ATOM   2706 O  OE1   . GLU A 1 402 ? -8.490  -23.274 17.889  1.00 64.40  ? 465  GLU B OE1   1 
ATOM   2707 O  OE2   . GLU A 1 402 ? -9.195  -22.741 15.950  1.00 69.08  ? 465  GLU B OE2   1 
ATOM   2708 N  N     . THR A 1 403 ? -8.998  -28.400 19.307  1.00 50.02  ? 466  THR B N     1 
ATOM   2709 C  CA    . THR A 1 403 ? -8.173  -29.534 19.595  1.00 49.47  ? 466  THR B CA    1 
ATOM   2710 C  C     . THR A 1 403 ? -8.932  -30.807 19.438  1.00 46.79  ? 466  THR B C     1 
ATOM   2711 O  O     . THR A 1 403 ? -8.463  -31.723 18.845  1.00 45.07  ? 466  THR B O     1 
ATOM   2712 C  CB    . THR A 1 403 ? -7.519  -29.360 20.965  1.00 48.30  ? 466  THR B CB    1 
ATOM   2713 O  OG1   . THR A 1 403 ? -6.186  -28.899 20.780  1.00 45.14  ? 466  THR B OG1   1 
ATOM   2714 C  CG2   . THR A 1 403 ? -7.447  -30.604 21.683  1.00 44.56  ? 466  THR B CG2   1 
ATOM   2715 N  N     . ILE A 1 404 ? -10.153 -30.846 19.905  1.00 46.96  ? 467  ILE B N     1 
ATOM   2716 C  CA    . ILE A 1 404 ? -11.007 -32.007 19.772  1.00 48.88  ? 467  ILE B CA    1 
ATOM   2717 C  C     . ILE A 1 404 ? -11.333 -32.271 18.311  1.00 45.65  ? 467  ILE B C     1 
ATOM   2718 O  O     . ILE A 1 404 ? -11.435 -33.373 17.890  1.00 42.18  ? 467  ILE B O     1 
ATOM   2719 C  CB    . ILE A 1 404 ? -12.222 -31.839 20.662  1.00 44.02  ? 467  ILE B CB    1 
ATOM   2720 C  CG1   . ILE A 1 404 ? -11.748 -31.635 22.086  1.00 41.15  ? 467  ILE B CG1   1 
ATOM   2721 C  CG2   . ILE A 1 404 ? -13.118 -33.030 20.554  1.00 37.04  ? 467  ILE B CG2   1 
ATOM   2722 C  CD1   . ILE A 1 404 ? -12.736 -30.970 22.987  1.00 29.86  ? 467  ILE B CD1   1 
ATOM   2723 N  N     . GLU A 1 405 ? -11.525 -31.222 17.538  1.00 44.86  ? 468  GLU B N     1 
ATOM   2724 C  CA    . GLU A 1 405 ? -11.774 -31.332 16.132  1.00 40.20  ? 468  GLU B CA    1 
ATOM   2725 C  C     . GLU A 1 405 ? -10.584 -31.881 15.464  1.00 42.04  ? 468  GLU B C     1 
ATOM   2726 O  O     . GLU A 1 405 ? -10.709 -32.573 14.529  1.00 52.41  ? 468  GLU B O     1 
ATOM   2727 C  CB    . GLU A 1 405 ? -12.055 -29.983 15.532  1.00 39.99  ? 468  GLU B CB    1 
ATOM   2728 C  CG    . GLU A 1 405 ? -13.411 -29.457 15.839  1.00 38.84  ? 468  GLU B CG    1 
ATOM   2729 C  CD    . GLU A 1 405 ? -13.457 -27.991 15.726  1.00 41.12  ? 468  GLU B CD    1 
ATOM   2730 O  OE1   . GLU A 1 405 ? -12.644 -27.466 15.018  1.00 45.36  ? 468  GLU B OE1   1 
ATOM   2731 O  OE2   . GLU A 1 405 ? -14.272 -27.355 16.351  1.00 37.83  ? 468  GLU B OE2   1 
ATOM   2732 N  N     . ILE A 1 406 ? -9.404  -31.464 15.850  1.00 44.61  ? 469  ILE B N     1 
ATOM   2733 C  CA    . ILE A 1 406 ? -8.237  -32.036 15.254  1.00 47.52  ? 469  ILE B CA    1 
ATOM   2734 C  C     . ILE A 1 406 ? -8.178  -33.487 15.623  1.00 53.28  ? 469  ILE B C     1 
ATOM   2735 O  O     . ILE A 1 406 ? -8.057  -34.308 14.777  1.00 52.97  ? 469  ILE B O     1 
ATOM   2736 C  CB    . ILE A 1 406 ? -6.955  -31.390 15.776  1.00 44.99  ? 469  ILE B CB    1 
ATOM   2737 C  CG1   . ILE A 1 406 ? -6.875  -29.927 15.375  1.00 42.28  ? 469  ILE B CG1   1 
ATOM   2738 C  CG2   . ILE A 1 406 ? -5.740  -32.102 15.233  1.00 39.40  ? 469  ILE B CG2   1 
ATOM   2739 C  CD1   . ILE A 1 406 ? -5.942  -29.649 14.241  1.00 40.07  ? 469  ILE B CD1   1 
ATOM   2740 N  N     . LEU A 1 407 ? -8.402  -33.809 16.881  1.00 51.54  ? 470  LEU B N     1 
ATOM   2741 C  CA    . LEU A 1 407 ? -8.312  -35.155 17.331  1.00 43.91  ? 470  LEU B CA    1 
ATOM   2742 C  C     . LEU A 1 407 ? -9.274  -36.061 16.644  1.00 49.28  ? 470  LEU B C     1 
ATOM   2743 O  O     . LEU A 1 407 ? -8.905  -37.098 16.238  1.00 52.12  ? 470  LEU B O     1 
ATOM   2744 C  CB    . LEU A 1 407 ? -8.576  -35.187 18.801  1.00 41.83  ? 470  LEU B CB    1 
ATOM   2745 C  CG    . LEU A 1 407 ? -7.428  -34.818 19.697  1.00 52.11  ? 470  LEU B CG    1 
ATOM   2746 C  CD1   . LEU A 1 407 ? -7.857  -34.756 21.129  1.00 51.33  ? 470  LEU B CD1   1 
ATOM   2747 C  CD2   . LEU A 1 407 ? -6.307  -35.801 19.591  1.00 50.05  ? 470  LEU B CD2   1 
ATOM   2748 N  N     . PHE A 1 408 ? -10.495 -35.647 16.417  1.00 47.17  ? 471  PHE B N     1 
ATOM   2749 C  CA    . PHE A 1 408 ? -11.474 -36.465 15.769  1.00 41.89  ? 471  PHE B CA    1 
ATOM   2750 C  C     . PHE A 1 408 ? -11.041 -36.809 14.397  1.00 43.33  ? 471  PHE B C     1 
ATOM   2751 O  O     . PHE A 1 408 ? -11.062 -37.929 14.023  1.00 47.25  ? 471  PHE B O     1 
ATOM   2752 C  CB    . PHE A 1 408 ? -12.736 -35.671 15.698  1.00 41.77  ? 471  PHE B CB    1 
ATOM   2753 C  CG    . PHE A 1 408 ? -13.939 -36.437 15.284  1.00 45.81  ? 471  PHE B CG    1 
ATOM   2754 C  CD1   . PHE A 1 408 ? -14.635 -37.164 16.172  1.00 39.70  ? 471  PHE B CD1   1 
ATOM   2755 C  CD2   . PHE A 1 408 ? -14.411 -36.334 14.027  1.00 40.82  ? 471  PHE B CD2   1 
ATOM   2756 C  CE1   . PHE A 1 408 ? -15.745 -37.831 15.789  1.00 42.85  ? 471  PHE B CE1   1 
ATOM   2757 C  CE2   . PHE A 1 408 ? -15.505 -36.988 13.636  1.00 31.44  ? 471  PHE B CE2   1 
ATOM   2758 C  CZ    . PHE A 1 408 ? -16.175 -37.738 14.515  1.00 34.69  ? 471  PHE B CZ    1 
ATOM   2759 N  N     . SER A 1 409 ? -10.510 -35.864 13.669  1.00 42.62  ? 472  SER B N     1 
ATOM   2760 C  CA    . SER A 1 409 ? -10.043 -36.123 12.329  1.00 49.74  ? 472  SER B CA    1 
ATOM   2761 C  C     . SER A 1 409 ? -8.940  -37.142 12.283  1.00 46.80  ? 472  SER B C     1 
ATOM   2762 O  O     . SER A 1 409 ? -8.856  -37.889 11.360  1.00 52.12  ? 472  SER B O     1 
ATOM   2763 C  CB    . SER A 1 409 ? -9.623  -34.855 11.625  1.00 47.93  ? 472  SER B CB    1 
ATOM   2764 O  OG    . SER A 1 409 ? -8.564  -34.247 12.296  1.00 54.68  ? 472  SER B OG    1 
ATOM   2765 N  N     . GLU A 1 410 ? -8.048  -37.176 13.256  1.00 44.67  ? 473  GLU B N     1 
ATOM   2766 C  CA    . GLU A 1 410 ? -6.987  -38.156 13.309  1.00 51.82  ? 473  GLU B CA    1 
ATOM   2767 C  C     . GLU A 1 410 ? -7.456  -39.549 13.634  1.00 55.62  ? 473  GLU B C     1 
ATOM   2768 O  O     . GLU A 1 410 ? -6.755  -40.495 13.386  1.00 63.25  ? 473  GLU B O     1 
ATOM   2769 C  CB    . GLU A 1 410 ? -5.923  -37.755 14.301  1.00 61.28  ? 473  GLU B CB    1 
ATOM   2770 C  CG    . GLU A 1 410 ? -5.163  -36.498 13.947  1.00 61.92  ? 473  GLU B CG    1 
ATOM   2771 C  CD    . GLU A 1 410 ? -4.484  -36.573 12.622  1.00 70.89  ? 473  GLU B CD    1 
ATOM   2772 O  OE1   . GLU A 1 410 ? -4.179  -37.675 12.184  1.00 76.42  ? 473  GLU B OE1   1 
ATOM   2773 O  OE2   . GLU A 1 410 ? -4.254  -35.539 12.010  1.00 70.83  ? 473  GLU B OE2   1 
ATOM   2774 N  N     . GLY A 1 411 ? -8.630  -39.674 14.213  1.00 48.24  ? 474  GLY B N     1 
ATOM   2775 C  CA    . GLY A 1 411 ? -9.191  -40.936 14.563  1.00 43.69  ? 474  GLY B CA    1 
ATOM   2776 C  C     . GLY A 1 411 ? -9.070  -41.223 15.998  1.00 44.99  ? 474  GLY B C     1 
ATOM   2777 O  O     . GLY A 1 411 ? -9.441  -42.249 16.421  1.00 47.38  ? 474  GLY B O     1 
ATOM   2778 N  N     . LEU A 1 412 ? -8.499  -40.304 16.721  1.00 46.46  ? 475  LEU B N     1 
ATOM   2779 C  CA    . LEU A 1 412 ? -8.346  -40.479 18.128  1.00 50.25  ? 475  LEU B CA    1 
ATOM   2780 C  C     . LEU A 1 412 ? -9.611  -40.380 18.867  1.00 52.46  ? 475  LEU B C     1 
ATOM   2781 O  O     . LEU A 1 412 ? -9.666  -40.837 19.947  1.00 54.28  ? 475  LEU B O     1 
ATOM   2782 C  CB    . LEU A 1 412 ? -7.327  -39.548 18.708  1.00 49.68  ? 475  LEU B CB    1 
ATOM   2783 C  CG    . LEU A 1 412 ? -6.065  -39.538 17.888  1.00 58.35  ? 475  LEU B CG    1 
ATOM   2784 C  CD1   . LEU A 1 412 ? -5.073  -38.637 18.559  1.00 59.97  ? 475  LEU B CD1   1 
ATOM   2785 C  CD2   . LEU A 1 412 ? -5.527  -40.930 17.783  1.00 57.75  ? 475  LEU B CD2   1 
ATOM   2786 N  N     . ILE A 1 413 ? -10.606 -39.706 18.337  1.00 50.24  ? 476  ILE B N     1 
ATOM   2787 C  CA    . ILE A 1 413 ? -11.865 -39.626 19.035  1.00 47.71  ? 476  ILE B CA    1 
ATOM   2788 C  C     . ILE A 1 413 ? -12.993 -40.444 18.444  1.00 41.97  ? 476  ILE B C     1 
ATOM   2789 O  O     . ILE A 1 413 ? -13.488 -40.171 17.395  1.00 42.33  ? 476  ILE B O     1 
ATOM   2790 C  CB    . ILE A 1 413 ? -12.242 -38.189 19.253  1.00 36.55  ? 476  ILE B CB    1 
ATOM   2791 C  CG1   . ILE A 1 413 ? -11.508 -37.716 20.440  1.00 41.58  ? 476  ILE B CG1   1 
ATOM   2792 C  CG2   . ILE A 1 413 ? -13.683 -38.073 19.600  1.00 34.54  ? 476  ILE B CG2   1 
ATOM   2793 C  CD1   . ILE A 1 413 ? -11.341 -36.255 20.423  1.00 47.57  ? 476  ILE B CD1   1 
ATOM   2794 N  N     . LYS A 1 414 ? -13.292 -41.522 19.138  1.00 37.76  ? 477  LYS B N     1 
ATOM   2795 C  CA    . LYS A 1 414 ? -14.325 -42.486 18.829  1.00 45.47  ? 477  LYS B CA    1 
ATOM   2796 C  C     . LYS A 1 414 ? -15.771 -42.065 19.029  1.00 43.11  ? 477  LYS B C     1 
ATOM   2797 O  O     . LYS A 1 414 ? -16.641 -42.518 18.357  1.00 42.43  ? 477  LYS B O     1 
ATOM   2798 C  CB    . LYS A 1 414 ? -14.005 -43.815 19.479  1.00 43.98  ? 477  LYS B CB    1 
ATOM   2799 C  CG    . LYS A 1 414 ? -12.780 -44.507 18.915  1.00 42.59  ? 477  LYS B CG    1 
ATOM   2800 C  CD    . LYS A 1 414 ? -12.525 -45.874 19.504  1.00 55.98  ? 477  LYS B CD    1 
ATOM   2801 C  CE    . LYS A 1 414 ? -11.367 -46.611 18.849  1.00 66.56  ? 477  LYS B CE    1 
ATOM   2802 N  NZ    . LYS A 1 414 ? -9.975  -46.093 19.126  1.00 70.75  ? 477  LYS B NZ    1 
ATOM   2803 N  N     . ALA A 1 415 ? -16.013 -41.274 20.045  1.00 37.05  ? 478  ALA B N     1 
ATOM   2804 C  CA    . ALA A 1 415 ? -17.320 -40.767 20.344  1.00 37.80  ? 478  ALA B CA    1 
ATOM   2805 C  C     . ALA A 1 415 ? -17.273 -39.280 20.550  1.00 42.51  ? 478  ALA B C     1 
ATOM   2806 O  O     . ALA A 1 415 ? -16.387 -38.818 21.166  1.00 48.04  ? 478  ALA B O     1 
ATOM   2807 C  CB    . ALA A 1 415 ? -17.794 -41.414 21.593  1.00 30.12  ? 478  ALA B CB    1 
ATOM   2808 N  N     . LEU A 1 416 ? -18.195 -38.511 20.006  1.00 38.99  ? 479  LEU B N     1 
ATOM   2809 C  CA    . LEU A 1 416 ? -18.197 -37.086 20.251  1.00 33.30  ? 479  LEU B CA    1 
ATOM   2810 C  C     . LEU A 1 416 ? -19.543 -36.710 20.665  1.00 33.51  ? 479  LEU B C     1 
ATOM   2811 O  O     . LEU A 1 416 ? -20.428 -36.961 19.970  1.00 38.31  ? 479  LEU B O     1 
ATOM   2812 C  CB    . LEU A 1 416 ? -17.933 -36.340 18.982  1.00 34.20  ? 479  LEU B CB    1 
ATOM   2813 C  CG    . LEU A 1 416 ? -17.072 -35.115 19.038  1.00 40.51  ? 479  LEU B CG    1 
ATOM   2814 C  CD1   . LEU A 1 416 ? -17.683 -34.077 18.163  1.00 26.78  ? 479  LEU B CD1   1 
ATOM   2815 C  CD2   . LEU A 1 416 ? -17.097 -34.672 20.447  1.00 35.27  ? 479  LEU B CD2   1 
ATOM   2816 N  N     . PHE A 1 417 ? -19.699 -36.063 21.792  1.00 31.38  ? 480  PHE B N     1 
ATOM   2817 C  CA    . PHE A 1 417 ? -20.980 -35.628 22.200  1.00 33.41  ? 480  PHE B CA    1 
ATOM   2818 C  C     . PHE A 1 417 ? -20.915 -34.165 22.005  1.00 41.60  ? 480  PHE B C     1 
ATOM   2819 O  O     . PHE A 1 417 ? -20.275 -33.492 22.735  1.00 44.80  ? 480  PHE B O     1 
ATOM   2820 C  CB    . PHE A 1 417 ? -21.160 -35.903 23.644  1.00 32.17  ? 480  PHE B CB    1 
ATOM   2821 C  CG    . PHE A 1 417 ? -21.166 -37.323 23.976  1.00 35.98  ? 480  PHE B CG    1 
ATOM   2822 C  CD1   . PHE A 1 417 ? -20.013 -38.017 24.029  1.00 39.46  ? 480  PHE B CD1   1 
ATOM   2823 C  CD2   . PHE A 1 417 ? -22.319 -37.961 24.231  1.00 37.23  ? 480  PHE B CD2   1 
ATOM   2824 C  CE1   . PHE A 1 417 ? -20.009 -39.335 24.340  1.00 37.58  ? 480  PHE B CE1   1 
ATOM   2825 C  CE2   . PHE A 1 417 ? -22.330 -39.284 24.554  1.00 34.86  ? 480  PHE B CE2   1 
ATOM   2826 C  CZ    . PHE A 1 417 ? -21.172 -39.967 24.611  1.00 33.94  ? 480  PHE B CZ    1 
ATOM   2827 N  N     . ALA A 1 418 ? -21.684 -33.667 21.068  1.00 44.07  ? 481  ALA B N     1 
ATOM   2828 C  CA    . ALA A 1 418 ? -21.663 -32.301 20.698  1.00 37.23  ? 481  ALA B CA    1 
ATOM   2829 C  C     . ALA A 1 418 ? -23.012 -31.741 20.731  1.00 47.20  ? 481  ALA B C     1 
ATOM   2830 O  O     . ALA A 1 418 ? -23.966 -32.399 20.611  1.00 45.87  ? 481  ALA B O     1 
ATOM   2831 C  CB    . ALA A 1 418 ? -21.140 -32.196 19.320  1.00 32.21  ? 481  ALA B CB    1 
ATOM   2832 N  N     . THR A 1 419 ? -23.041 -30.445 20.890  1.00 57.14  ? 482  THR B N     1 
ATOM   2833 C  CA    . THR A 1 419 ? -24.215 -29.612 20.944  1.00 51.31  ? 482  THR B CA    1 
ATOM   2834 C  C     . THR A 1 419 ? -24.730 -29.440 19.553  1.00 44.15  ? 482  THR B C     1 
ATOM   2835 O  O     . THR A 1 419 ? -24.027 -29.567 18.618  1.00 39.86  ? 482  THR B O     1 
ATOM   2836 C  CB    . THR A 1 419 ? -23.791 -28.272 21.526  1.00 45.66  ? 482  THR B CB    1 
ATOM   2837 O  OG1   . THR A 1 419 ? -24.878 -27.612 22.134  1.00 57.71  ? 482  THR B OG1   1 
ATOM   2838 C  CG2   . THR A 1 419 ? -23.297 -27.434 20.493  1.00 43.37  ? 482  THR B CG2   1 
ATOM   2839 N  N     . GLU A 1 420 ? -25.931 -28.968 19.384  1.00 42.47  ? 483  GLU B N     1 
ATOM   2840 C  CA    . GLU A 1 420 ? -26.491 -28.861 18.048  1.00 44.20  ? 483  GLU B CA    1 
ATOM   2841 C  C     . GLU A 1 420 ? -25.788 -28.029 17.013  1.00 44.04  ? 483  GLU B C     1 
ATOM   2842 O  O     . GLU A 1 420 ? -25.971 -28.248 15.870  1.00 43.08  ? 483  GLU B O     1 
ATOM   2843 C  CB    . GLU A 1 420 ? -27.915 -28.429 18.111  1.00 44.16  ? 483  GLU B CB    1 
ATOM   2844 C  CG    . GLU A 1 420 ? -28.563 -28.466 16.776  1.00 39.89  ? 483  GLU B CG    1 
ATOM   2845 C  CD    . GLU A 1 420 ? -29.857 -27.756 16.788  1.00 54.71  ? 483  GLU B CD    1 
ATOM   2846 O  OE1   . GLU A 1 420 ? -30.367 -27.481 15.720  1.00 58.10  ? 483  GLU B OE1   1 
ATOM   2847 O  OE2   . GLU A 1 420 ? -30.353 -27.452 17.859  1.00 55.88  ? 483  GLU B OE2   1 
ATOM   2848 N  N     . THR A 1 421 ? -24.986 -27.063 17.398  1.00 42.19  ? 484  THR B N     1 
ATOM   2849 C  CA    . THR A 1 421 ? -24.261 -26.233 16.478  1.00 44.02  ? 484  THR B CA    1 
ATOM   2850 C  C     . THR A 1 421 ? -23.005 -26.849 15.893  1.00 47.88  ? 484  THR B C     1 
ATOM   2851 O  O     . THR A 1 421 ? -22.335 -26.233 15.131  1.00 50.43  ? 484  THR B O     1 
ATOM   2852 C  CB    . THR A 1 421 ? -23.963 -24.869 17.057  1.00 44.99  ? 484  THR B CB    1 
ATOM   2853 O  OG1   . THR A 1 421 ? -23.687 -25.013 18.424  1.00 49.13  ? 484  THR B OG1   1 
ATOM   2854 C  CG2   . THR A 1 421 ? -25.134 -24.014 16.951  1.00 38.10  ? 484  THR B CG2   1 
ATOM   2855 N  N     . PHE A 1 422 ? -22.649 -28.058 16.269  1.00 47.28  ? 485  PHE B N     1 
ATOM   2856 C  CA    . PHE A 1 422 ? -21.535 -28.755 15.668  1.00 46.46  ? 485  PHE B CA    1 
ATOM   2857 C  C     . PHE A 1 422 ? -21.812 -29.024 14.195  1.00 48.97  ? 485  PHE B C     1 
ATOM   2858 O  O     . PHE A 1 422 ? -20.914 -28.984 13.415  1.00 48.92  ? 485  PHE B O     1 
ATOM   2859 C  CB    . PHE A 1 422 ? -21.136 -30.025 16.414  1.00 38.85  ? 485  PHE B CB    1 
ATOM   2860 C  CG    . PHE A 1 422 ? -19.848 -30.607 15.937  1.00 34.73  ? 485  PHE B CG    1 
ATOM   2861 C  CD1   . PHE A 1 422 ? -18.747 -29.860 15.912  1.00 37.89  ? 485  PHE B CD1   1 
ATOM   2862 C  CD2   . PHE A 1 422 ? -19.773 -31.865 15.490  1.00 36.31  ? 485  PHE B CD2   1 
ATOM   2863 C  CE1   . PHE A 1 422 ? -17.582 -30.340 15.455  1.00 36.08  ? 485  PHE B CE1   1 
ATOM   2864 C  CE2   . PHE A 1 422 ? -18.612 -32.366 15.053  1.00 36.37  ? 485  PHE B CE2   1 
ATOM   2865 C  CZ    . PHE A 1 422 ? -17.514 -31.597 15.029  1.00 30.65  ? 485  PHE B CZ    1 
ATOM   2866 N  N     . ALA A 1 423 ? -23.053 -29.299 13.817  1.00 46.34  ? 486  ALA B N     1 
ATOM   2867 C  CA    . ALA A 1 423 ? -23.472 -29.491 12.450  1.00 44.80  ? 486  ALA B CA    1 
ATOM   2868 C  C     . ALA A 1 423 ? -23.214 -28.255 11.642  1.00 51.48  ? 486  ALA B C     1 
ATOM   2869 O  O     . ALA A 1 423 ? -22.827 -28.343 10.528  1.00 49.66  ? 486  ALA B O     1 
ATOM   2870 C  CB    . ALA A 1 423 ? -24.918 -29.810 12.427  1.00 42.96  ? 486  ALA B CB    1 
ATOM   2871 N  N     . MET A 1 424 ? -23.443 -27.080 12.211  1.00 58.17  ? 487  MET B N     1 
ATOM   2872 C  CA    . MET A 1 424 ? -23.125 -25.766 11.647  1.00 56.01  ? 487  MET B CA    1 
ATOM   2873 C  C     . MET A 1 424 ? -21.675 -25.461 11.995  1.00 53.59  ? 487  MET B C     1 
ATOM   2874 O  O     . MET A 1 424 ? -21.368 -24.565 12.729  1.00 59.72  ? 487  MET B O     1 
ATOM   2875 C  CB    . MET A 1 424 ? -23.959 -24.712 12.367  1.00 50.39  ? 487  MET B CB    1 
ATOM   2876 C  CG    . MET A 1 424 ? -25.034 -24.075 11.567  1.00 51.65  ? 487  MET B CG    1 
ATOM   2877 S  SD    . MET A 1 424 ? -26.225 -25.322 11.350  1.00 72.81  ? 487  MET B SD    1 
ATOM   2878 C  CE    . MET A 1 424 ? -27.427 -24.413 10.445  1.00 63.69  ? 487  MET B CE    1 
ATOM   2879 N  N     . GLY A 1 425 ? -20.763 -26.184 11.439  1.00 46.37  ? 488  GLY B N     1 
ATOM   2880 C  CA    . GLY A 1 425 ? -19.384 -26.034 11.764  1.00 41.86  ? 488  GLY B CA    1 
ATOM   2881 C  C     . GLY A 1 425 ? -18.559 -26.587 10.657  1.00 53.36  ? 488  GLY B C     1 
ATOM   2882 O  O     . GLY A 1 425 ? -19.093 -27.000 9.631   1.00 63.78  ? 488  GLY B O     1 
ATOM   2883 N  N     . ILE A 1 426 ? -17.243 -26.544 10.802  1.00 48.40  ? 489  ILE B N     1 
ATOM   2884 C  CA    . ILE A 1 426 ? -16.432 -27.090 9.754   1.00 41.85  ? 489  ILE B CA    1 
ATOM   2885 C  C     . ILE A 1 426 ? -16.756 -28.525 9.782   1.00 49.05  ? 489  ILE B C     1 
ATOM   2886 O  O     . ILE A 1 426 ? -16.707 -29.194 10.773  1.00 53.20  ? 489  ILE B O     1 
ATOM   2887 C  CB    . ILE A 1 426 ? -14.961 -26.832 9.902   1.00 41.37  ? 489  ILE B CB    1 
ATOM   2888 C  CG1   . ILE A 1 426 ? -14.343 -27.094 8.568   1.00 51.14  ? 489  ILE B CG1   1 
ATOM   2889 C  CG2   . ILE A 1 426 ? -14.334 -27.764 10.898  1.00 38.82  ? 489  ILE B CG2   1 
ATOM   2890 C  CD1   . ILE A 1 426 ? -15.213 -26.633 7.428   1.00 54.07  ? 489  ILE B CD1   1 
ATOM   2891 N  N     . ASN A 1 427 ? -17.106 -28.985 8.630   1.00 46.72  ? 490  ASN B N     1 
ATOM   2892 C  CA    . ASN A 1 427 ? -17.619 -30.280 8.558   1.00 49.54  ? 490  ASN B CA    1 
ATOM   2893 C  C     . ASN A 1 427 ? -16.594 -31.274 8.789   1.00 52.52  ? 490  ASN B C     1 
ATOM   2894 O  O     . ASN A 1 427 ? -15.611 -31.333 8.103   1.00 49.28  ? 490  ASN B O     1 
ATOM   2895 C  CB    . ASN A 1 427 ? -18.156 -30.481 7.186   1.00 50.94  ? 490  ASN B CB    1 
ATOM   2896 C  CG    . ASN A 1 427 ? -17.162 -30.144 6.173   1.00 52.94  ? 490  ASN B CG    1 
ATOM   2897 O  OD1   . ASN A 1 427 ? -17.298 -29.192 5.459   1.00 52.20  ? 490  ASN B OD1   1 
ATOM   2898 N  ND2   . ASN A 1 427 ? -16.117 -30.892 6.140   1.00 60.12  ? 490  ASN B ND2   1 
ATOM   2899 N  N     . MET A 1 428 ? -16.888 -32.085 9.776   1.00 51.39  ? 491  MET B N     1 
ATOM   2900 C  CA    . MET A 1 428 ? -16.122 -33.223 10.121  1.00 45.17  ? 491  MET B CA    1 
ATOM   2901 C  C     . MET A 1 428 ? -17.187 -34.232 10.131  1.00 41.54  ? 491  MET B C     1 
ATOM   2902 O  O     . MET A 1 428 ? -18.090 -34.136 10.890  1.00 40.24  ? 491  MET B O     1 
ATOM   2903 C  CB    . MET A 1 428 ? -15.620 -33.115 11.523  1.00 44.40  ? 491  MET B CB    1 
ATOM   2904 C  CG    . MET A 1 428 ? -14.154 -32.890 11.640  1.00 44.93  ? 491  MET B CG    1 
ATOM   2905 S  SD    . MET A 1 428 ? -13.994 -32.348 13.292  1.00 55.63  ? 491  MET B SD    1 
ATOM   2906 C  CE    . MET A 1 428 ? -12.236 -32.250 13.439  1.00 56.46  ? 491  MET B CE    1 
ATOM   2907 N  N     . PRO A 1 429 ? -17.092 -35.204 9.269   1.00 37.14  ? 492  PRO B N     1 
ATOM   2908 C  CA    . PRO A 1 429 ? -18.073 -36.254 9.242   1.00 40.59  ? 492  PRO B CA    1 
ATOM   2909 C  C     . PRO A 1 429 ? -17.807 -37.373 10.184  1.00 39.41  ? 492  PRO B C     1 
ATOM   2910 O  O     . PRO A 1 429 ? -16.751 -37.549 10.662  1.00 35.44  ? 492  PRO B O     1 
ATOM   2911 C  CB    . PRO A 1 429 ? -17.961 -36.772 7.834   1.00 30.63  ? 492  PRO B CB    1 
ATOM   2912 C  CG    . PRO A 1 429 ? -17.391 -35.683 7.079   1.00 34.11  ? 492  PRO B CG    1 
ATOM   2913 C  CD    . PRO A 1 429 ? -16.420 -35.082 7.990   1.00 34.99  ? 492  PRO B CD    1 
ATOM   2914 N  N     . ALA A 1 430 ? -18.811 -38.161 10.435  1.00 33.76  ? 493  ALA B N     1 
ATOM   2915 C  CA    . ALA A 1 430 ? -18.635 -39.320 11.246  1.00 34.16  ? 493  ALA B CA    1 
ATOM   2916 C  C     . ALA A 1 430 ? -19.295 -40.513 10.605  1.00 40.17  ? 493  ALA B C     1 
ATOM   2917 O  O     . ALA A 1 430 ? -20.014 -40.371 9.692   1.00 41.06  ? 493  ALA B O     1 
ATOM   2918 C  CB    . ALA A 1 430 ? -19.194 -39.077 12.598  1.00 33.59  ? 493  ALA B CB    1 
ATOM   2919 N  N     . ARG A 1 431 ? -18.944 -41.712 10.972  1.00 34.64  ? 494  ARG B N     1 
ATOM   2920 C  CA    . ARG A 1 431 ? -19.648 -42.856 10.458  1.00 35.41  ? 494  ARG B CA    1 
ATOM   2921 C  C     . ARG A 1 431 ? -21.099 -43.022 10.909  1.00 37.44  ? 494  ARG B C     1 
ATOM   2922 O  O     . ARG A 1 431 ? -21.894 -43.544 10.191  1.00 41.83  ? 494  ARG B O     1 
ATOM   2923 C  CB    . ARG A 1 431 ? -18.876 -44.114 10.693  1.00 43.41  ? 494  ARG B CB    1 
ATOM   2924 C  CG    . ARG A 1 431 ? -19.703 -45.334 10.491  1.00 45.41  ? 494  ARG B CG    1 
ATOM   2925 C  CD    . ARG A 1 431 ? -18.850 -46.522 10.695  1.00 43.82  ? 494  ARG B CD    1 
ATOM   2926 N  NE    . ARG A 1 431 ? -17.750 -46.507 9.782   1.00 43.28  ? 494  ARG B NE    1 
ATOM   2927 C  CZ    . ARG A 1 431 ? -16.841 -47.451 9.732   1.00 51.30  ? 494  ARG B CZ    1 
ATOM   2928 N  NH1   . ARG A 1 431 ? -16.917 -48.461 10.539  1.00 48.08  ? 494  ARG B NH1   1 
ATOM   2929 N  NH2   . ARG A 1 431 ? -15.865 -47.382 8.876   1.00 48.52  ? 494  ARG B NH2   1 
ATOM   2930 N  N     . THR A 1 432 ? -21.397 -42.670 12.143  1.00 32.15  ? 495  THR B N     1 
ATOM   2931 C  CA    . THR A 1 432 ? -22.715 -42.798 12.713  1.00 31.37  ? 495  THR B CA    1 
ATOM   2932 C  C     . THR A 1 432 ? -23.088 -41.498 13.388  1.00 31.26  ? 495  THR B C     1 
ATOM   2933 O  O     . THR A 1 432 ? -22.260 -40.771 13.752  1.00 32.82  ? 495  THR B O     1 
ATOM   2934 C  CB    . THR A 1 432 ? -22.672 -43.901 13.764  1.00 33.03  ? 495  THR B CB    1 
ATOM   2935 O  OG1   . THR A 1 432 ? -22.076 -45.045 13.210  1.00 35.05  ? 495  THR B OG1   1 
ATOM   2936 C  CG2   . THR A 1 432 ? -23.962 -44.285 14.259  1.00 25.76  ? 495  THR B CG2   1 
ATOM   2937 N  N     . VAL A 1 433 ? -24.359 -41.173 13.458  1.00 28.89  ? 496  VAL B N     1 
ATOM   2938 C  CA    . VAL A 1 433 ? -24.838 -40.006 14.138  1.00 27.14  ? 496  VAL B CA    1 
ATOM   2939 C  C     . VAL A 1 433 ? -25.929 -40.423 15.096  1.00 32.25  ? 496  VAL B C     1 
ATOM   2940 O  O     . VAL A 1 433 ? -26.816 -41.100 14.723  1.00 32.59  ? 496  VAL B O     1 
ATOM   2941 C  CB    . VAL A 1 433 ? -25.385 -39.027 13.140  1.00 28.43  ? 496  VAL B CB    1 
ATOM   2942 C  CG1   . VAL A 1 433 ? -26.244 -38.003 13.793  1.00 30.47  ? 496  VAL B CG1   1 
ATOM   2943 C  CG2   . VAL A 1 433 ? -24.263 -38.361 12.452  1.00 27.43  ? 496  VAL B CG2   1 
ATOM   2944 N  N     . LEU A 1 434 ? -25.882 -39.992 16.337  1.00 34.92  ? 497  LEU B N     1 
ATOM   2945 C  CA    . LEU A 1 434 ? -26.884 -40.381 17.295  1.00 35.54  ? 497  LEU B CA    1 
ATOM   2946 C  C     . LEU A 1 434 ? -27.607 -39.190 17.743  1.00 36.34  ? 497  LEU B C     1 
ATOM   2947 O  O     . LEU A 1 434 ? -27.011 -38.251 18.035  1.00 37.38  ? 497  LEU B O     1 
ATOM   2948 C  CB    . LEU A 1 434 ? -26.217 -40.983 18.486  1.00 34.68  ? 497  LEU B CB    1 
ATOM   2949 C  CG    . LEU A 1 434 ? -27.183 -41.513 19.491  1.00 37.40  ? 497  LEU B CG    1 
ATOM   2950 C  CD1   . LEU A 1 434 ? -28.086 -42.484 18.805  1.00 39.68  ? 497  LEU B CD1   1 
ATOM   2951 C  CD2   . LEU A 1 434 ? -26.440 -42.197 20.591  1.00 32.32  ? 497  LEU B CD2   1 
ATOM   2952 N  N     . PHE A 1 435 ? -28.915 -39.235 17.758  1.00 33.61  ? 498  PHE B N     1 
ATOM   2953 C  CA    . PHE A 1 435 ? -29.716 -38.137 18.193  1.00 37.56  ? 498  PHE B CA    1 
ATOM   2954 C  C     . PHE A 1 435 ? -30.232 -38.608 19.535  1.00 43.74  ? 498  PHE B C     1 
ATOM   2955 O  O     . PHE A 1 435 ? -30.864 -39.614 19.600  1.00 45.43  ? 498  PHE B O     1 
ATOM   2956 C  CB    . PHE A 1 435 ? -30.931 -37.975 17.268  1.00 32.24  ? 498  PHE B CB    1 
ATOM   2957 C  CG    . PHE A 1 435 ? -30.711 -37.176 16.012  1.00 30.56  ? 498  PHE B CG    1 
ATOM   2958 C  CD1   . PHE A 1 435 ? -30.265 -37.766 14.887  1.00 33.77  ? 498  PHE B CD1   1 
ATOM   2959 C  CD2   . PHE A 1 435 ? -31.076 -35.869 15.933  1.00 34.31  ? 498  PHE B CD2   1 
ATOM   2960 C  CE1   . PHE A 1 435 ? -30.097 -37.055 13.731  1.00 35.44  ? 498  PHE B CE1   1 
ATOM   2961 C  CE2   . PHE A 1 435 ? -30.926 -35.153 14.772  1.00 34.73  ? 498  PHE B CE2   1 
ATOM   2962 C  CZ    . PHE A 1 435 ? -30.423 -35.748 13.677  1.00 30.83  ? 498  PHE B CZ    1 
ATOM   2963 N  N     . THR A 1 436 ? -29.958 -37.913 20.625  1.00 40.73  ? 499  THR B N     1 
ATOM   2964 C  CA    . THR A 1 436 ? -30.500 -38.351 21.901  1.00 44.77  ? 499  THR B CA    1 
ATOM   2965 C  C     . THR A 1 436 ? -31.960 -38.101 22.044  1.00 46.05  ? 499  THR B C     1 
ATOM   2966 O  O     . THR A 1 436 ? -32.597 -38.725 22.834  1.00 49.97  ? 499  THR B O     1 
ATOM   2967 C  CB    . THR A 1 436 ? -29.757 -37.878 23.136  1.00 41.12  ? 499  THR B CB    1 
ATOM   2968 O  OG1   . THR A 1 436 ? -29.941 -36.492 23.295  1.00 46.19  ? 499  THR B OG1   1 
ATOM   2969 C  CG2   . THR A 1 436 ? -28.376 -38.138 22.990  1.00 35.34  ? 499  THR B CG2   1 
ATOM   2970 N  N     . ASN A 1 437 ? -32.469 -37.150 21.299  1.00 44.52  ? 500  ASN B N     1 
ATOM   2971 C  CA    . ASN A 1 437 ? -33.857 -36.853 21.354  1.00 47.22  ? 500  ASN B CA    1 
ATOM   2972 C  C     . ASN A 1 437 ? -34.372 -36.406 20.053  1.00 43.32  ? 500  ASN B C     1 
ATOM   2973 O  O     . ASN A 1 437 ? -33.717 -35.760 19.332  1.00 42.06  ? 500  ASN B O     1 
ATOM   2974 C  CB    . ASN A 1 437 ? -34.102 -35.758 22.332  1.00 49.72  ? 500  ASN B CB    1 
ATOM   2975 C  CG    . ASN A 1 437 ? -34.389 -36.269 23.684  1.00 58.07  ? 500  ASN B CG    1 
ATOM   2976 O  OD1   . ASN A 1 437 ? -35.144 -37.201 23.855  1.00 59.89  ? 500  ASN B OD1   1 
ATOM   2977 N  ND2   . ASN A 1 437 ? -33.805 -35.656 24.661  1.00 68.55  ? 500  ASN B ND2   1 
ATOM   2978 N  N     . ALA A 1 438 ? -35.601 -36.783 19.804  1.00 42.01  ? 501  ALA B N     1 
ATOM   2979 C  CA    . ALA A 1 438 ? -36.320 -36.438 18.634  1.00 36.11  ? 501  ALA B CA    1 
ATOM   2980 C  C     . ALA A 1 438 ? -37.055 -35.174 18.797  1.00 37.32  ? 501  ALA B C     1 
ATOM   2981 O  O     . ALA A 1 438 ? -37.408 -34.598 17.855  1.00 38.75  ? 501  ALA B O     1 
ATOM   2982 C  CB    . ALA A 1 438 ? -37.298 -37.527 18.349  1.00 29.84  ? 501  ALA B CB    1 
ATOM   2983 N  N     . ARG A 1 439 ? -37.201 -34.711 20.015  1.00 41.86  ? 502  ARG B N     1 
ATOM   2984 C  CA    . ARG A 1 439 ? -37.934 -33.525 20.346  1.00 41.56  ? 502  ARG B CA    1 
ATOM   2985 C  C     . ARG A 1 439 ? -37.099 -32.398 20.881  1.00 39.84  ? 502  ARG B C     1 
ATOM   2986 O  O     . ARG A 1 439 ? -36.132 -32.632 21.497  1.00 41.41  ? 502  ARG B O     1 
ATOM   2987 C  CB    . ARG A 1 439 ? -39.040 -33.891 21.293  1.00 39.73  ? 502  ARG B CB    1 
ATOM   2988 C  CG    . ARG A 1 439 ? -40.041 -34.754 20.605  1.00 38.16  ? 502  ARG B CG    1 
ATOM   2989 C  CD    . ARG A 1 439 ? -41.345 -34.885 21.320  1.00 39.01  ? 502  ARG B CD    1 
ATOM   2990 N  NE    . ARG A 1 439 ? -41.975 -33.630 21.579  1.00 43.67  ? 502  ARG B NE    1 
ATOM   2991 C  CZ    . ARG A 1 439 ? -43.177 -33.321 21.195  1.00 46.67  ? 502  ARG B CZ    1 
ATOM   2992 N  NH1   . ARG A 1 439 ? -43.867 -34.169 20.521  1.00 44.06  ? 502  ARG B NH1   1 
ATOM   2993 N  NH2   . ARG A 1 439 ? -43.680 -32.171 21.497  1.00 48.33  ? 502  ARG B NH2   1 
ATOM   2994 N  N     . LYS A 1 440 ? -37.502 -31.169 20.658  1.00 37.32  ? 503  LYS B N     1 
ATOM   2995 C  CA    . LYS A 1 440 ? -36.718 -30.036 21.045  1.00 30.94  ? 503  LYS B CA    1 
ATOM   2996 C  C     . LYS A 1 440 ? -37.496 -29.022 21.805  1.00 38.21  ? 503  LYS B C     1 
ATOM   2997 O  O     . LYS A 1 440 ? -38.663 -28.956 21.682  1.00 42.78  ? 503  LYS B O     1 
ATOM   2998 C  CB    . LYS A 1 440 ? -36.272 -29.381 19.758  1.00 40.28  ? 503  LYS B CB    1 
ATOM   2999 C  CG    . LYS A 1 440 ? -35.103 -28.436 19.851  1.00 44.52  ? 503  LYS B CG    1 
ATOM   3000 C  CD    . LYS A 1 440 ? -34.108 -28.670 18.748  1.00 42.23  ? 503  LYS B CD    1 
ATOM   3001 C  CE    . LYS A 1 440 ? -34.121 -27.571 17.736  1.00 38.43  ? 503  LYS B CE    1 
ATOM   3002 N  NZ    . LYS A 1 440 ? -33.565 -26.335 18.286  1.00 50.33  ? 503  LYS B NZ    1 
ATOM   3003 N  N     . PHE A 1 441 ? -36.844 -28.202 22.600  1.00 42.10  ? 504  PHE B N     1 
ATOM   3004 C  CA    . PHE A 1 441 ? -37.567 -27.174 23.291  1.00 35.84  ? 504  PHE B CA    1 
ATOM   3005 C  C     . PHE A 1 441 ? -37.222 -25.860 22.657  1.00 35.91  ? 504  PHE B C     1 
ATOM   3006 O  O     . PHE A 1 441 ? -36.120 -25.436 22.686  1.00 37.68  ? 504  PHE B O     1 
ATOM   3007 C  CB    . PHE A 1 441 ? -37.208 -27.160 24.764  1.00 44.21  ? 504  PHE B CB    1 
ATOM   3008 C  CG    . PHE A 1 441 ? -38.051 -26.231 25.566  1.00 46.78  ? 504  PHE B CG    1 
ATOM   3009 C  CD1   . PHE A 1 441 ? -39.387 -26.405 25.646  1.00 49.18  ? 504  PHE B CD1   1 
ATOM   3010 C  CD2   . PHE A 1 441 ? -37.515 -25.178 26.187  1.00 43.54  ? 504  PHE B CD2   1 
ATOM   3011 C  CE1   . PHE A 1 441 ? -40.180 -25.553 26.330  1.00 43.98  ? 504  PHE B CE1   1 
ATOM   3012 C  CE2   . PHE A 1 441 ? -38.305 -24.313 26.866  1.00 43.48  ? 504  PHE B CE2   1 
ATOM   3013 C  CZ    . PHE A 1 441 ? -39.640 -24.501 26.934  1.00 41.23  ? 504  PHE B CZ    1 
ATOM   3014 N  N     . ASP A 1 442 ? -38.233 -25.206 22.119  1.00 43.95  ? 505  ASP B N     1 
ATOM   3015 C  CA    . ASP A 1 442 ? -38.188 -23.914 21.412  1.00 41.71  ? 505  ASP B CA    1 
ATOM   3016 C  C     . ASP A 1 442 ? -37.835 -22.749 22.228  1.00 43.88  ? 505  ASP B C     1 
ATOM   3017 O  O     . ASP A 1 442 ? -37.459 -21.745 21.733  1.00 52.13  ? 505  ASP B O     1 
ATOM   3018 C  CB    . ASP A 1 442 ? -39.601 -23.484 21.077  1.00 39.87  ? 505  ASP B CB    1 
ATOM   3019 C  CG    . ASP A 1 442 ? -39.955 -23.634 19.694  1.00 48.76  ? 505  ASP B CG    1 
ATOM   3020 O  OD1   . ASP A 1 442 ? -39.062 -23.649 18.884  1.00 62.60  ? 505  ASP B OD1   1 
ATOM   3021 O  OD2   . ASP A 1 442 ? -41.143 -23.669 19.410  1.00 43.00  ? 505  ASP B OD2   1 
ATOM   3022 N  N     . GLY A 1 443 ? -38.103 -22.866 23.491  1.00 47.33  ? 506  GLY B N     1 
ATOM   3023 C  CA    . GLY A 1 443 ? -38.055 -21.785 24.425  1.00 44.77  ? 506  GLY B CA    1 
ATOM   3024 C  C     . GLY A 1 443 ? -39.497 -21.412 24.737  1.00 47.84  ? 506  GLY B C     1 
ATOM   3025 O  O     . GLY A 1 443 ? -39.742 -20.725 25.678  1.00 53.93  ? 506  GLY B O     1 
ATOM   3026 N  N     . LYS A 1 444 ? -40.457 -21.846 23.940  1.00 46.42  ? 507  LYS B N     1 
ATOM   3027 C  CA    . LYS A 1 444 ? -41.824 -21.608 24.238  1.00 44.79  ? 507  LYS B CA    1 
ATOM   3028 C  C     . LYS A 1 444 ? -42.513 -22.921 24.356  1.00 50.35  ? 507  LYS B C     1 
ATOM   3029 O  O     . LYS A 1 444 ? -43.023 -23.254 25.373  1.00 53.48  ? 507  LYS B O     1 
ATOM   3030 C  CB    . LYS A 1 444 ? -42.510 -20.821 23.160  1.00 52.25  ? 507  LYS B CB    1 
ATOM   3031 C  CG    . LYS A 1 444 ? -43.634 -19.968 23.691  1.00 55.73  ? 507  LYS B CG    1 
ATOM   3032 C  CD    . LYS A 1 444 ? -44.788 -19.912 22.735  1.00 58.73  ? 507  LYS B CD    1 
ATOM   3033 C  CE    . LYS A 1 444 ? -46.017 -19.410 23.441  1.00 64.40  ? 507  LYS B CE    1 
ATOM   3034 N  NZ    . LYS A 1 444 ? -47.270 -19.623 22.690  1.00 41.93  ? 507  LYS B NZ    1 
ATOM   3035 N  N     . ASP A 1 445 ? -42.469 -23.713 23.312  1.00 50.82  ? 508  ASP B N     1 
ATOM   3036 C  CA    . ASP A 1 445 ? -43.158 -24.975 23.296  1.00 48.47  ? 508  ASP B CA    1 
ATOM   3037 C  C     . ASP A 1 445 ? -42.258 -26.070 22.916  1.00 46.96  ? 508  ASP B C     1 
ATOM   3038 O  O     . ASP A 1 445 ? -41.210 -25.874 22.452  1.00 48.64  ? 508  ASP B O     1 
ATOM   3039 C  CB    . ASP A 1 445 ? -44.264 -24.958 22.272  1.00 43.74  ? 508  ASP B CB    1 
ATOM   3040 C  CG    . ASP A 1 445 ? -45.149 -23.816 22.426  1.00 56.81  ? 508  ASP B CG    1 
ATOM   3041 O  OD1   . ASP A 1 445 ? -45.792 -23.745 23.454  1.00 60.19  ? 508  ASP B OD1   1 
ATOM   3042 O  OD2   . ASP A 1 445 ? -45.187 -22.963 21.551  1.00 57.78  ? 508  ASP B OD2   1 
ATOM   3043 N  N     . PHE A 1 446 ? -42.655 -27.266 23.206  1.00 46.91  ? 509  PHE B N     1 
ATOM   3044 C  CA    . PHE A 1 446 ? -41.895 -28.398 22.807  1.00 45.46  ? 509  PHE B CA    1 
ATOM   3045 C  C     . PHE A 1 446 ? -42.283 -28.815 21.416  1.00 42.93  ? 509  PHE B C     1 
ATOM   3046 O  O     . PHE A 1 446 ? -43.409 -28.755 21.038  1.00 36.58  ? 509  PHE B O     1 
ATOM   3047 C  CB    . PHE A 1 446 ? -42.262 -29.518 23.702  1.00 45.02  ? 509  PHE B CB    1 
ATOM   3048 C  CG    . PHE A 1 446 ? -41.381 -29.688 24.850  1.00 42.83  ? 509  PHE B CG    1 
ATOM   3049 C  CD1   . PHE A 1 446 ? -40.224 -30.381 24.724  1.00 45.85  ? 509  PHE B CD1   1 
ATOM   3050 C  CD2   . PHE A 1 446 ? -41.749 -29.246 26.051  1.00 46.42  ? 509  PHE B CD2   1 
ATOM   3051 C  CE1   . PHE A 1 446 ? -39.397 -30.560 25.776  1.00 47.37  ? 509  PHE B CE1   1 
ATOM   3052 C  CE2   . PHE A 1 446 ? -40.936 -29.420 27.122  1.00 50.02  ? 509  PHE B CE2   1 
ATOM   3053 C  CZ    . PHE A 1 446 ? -39.757 -30.083 26.982  1.00 45.45  ? 509  PHE B CZ    1 
ATOM   3054 N  N     . ARG A 1 447 ? -41.337 -29.266 20.649  1.00 39.67  ? 510  ARG B N     1 
ATOM   3055 C  CA    . ARG A 1 447 ? -41.640 -29.712 19.336  1.00 36.84  ? 510  ARG B CA    1 
ATOM   3056 C  C     . ARG A 1 447 ? -40.696 -30.748 18.881  1.00 35.70  ? 510  ARG B C     1 
ATOM   3057 O  O     . ARG A 1 447 ? -39.775 -31.038 19.506  1.00 36.73  ? 510  ARG B O     1 
ATOM   3058 C  CB    . ARG A 1 447 ? -41.606 -28.574 18.363  1.00 35.01  ? 510  ARG B CB    1 
ATOM   3059 C  CG    . ARG A 1 447 ? -40.336 -27.789 18.331  1.00 42.25  ? 510  ARG B CG    1 
ATOM   3060 C  CD    . ARG A 1 447 ? -40.038 -27.359 16.930  1.00 36.92  ? 510  ARG B CD    1 
ATOM   3061 N  NE    . ARG A 1 447 ? -39.086 -26.289 16.918  1.00 29.89  ? 510  ARG B NE    1 
ATOM   3062 C  CZ    . ARG A 1 447 ? -37.916 -26.338 16.332  1.00 35.95  ? 510  ARG B CZ    1 
ATOM   3063 N  NH1   . ARG A 1 447 ? -37.533 -27.403 15.701  1.00 31.76  ? 510  ARG B NH1   1 
ATOM   3064 N  NH2   . ARG A 1 447 ? -37.125 -25.310 16.393  1.00 39.35  ? 510  ARG B NH2   1 
ATOM   3065 N  N     . TRP A 1 448 ? -40.990 -31.382 17.787  1.00 32.90  ? 511  TRP B N     1 
ATOM   3066 C  CA    . TRP A 1 448 ? -40.075 -32.310 17.220  1.00 32.55  ? 511  TRP B CA    1 
ATOM   3067 C  C     . TRP A 1 448 ? -39.101 -31.559 16.389  1.00 31.99  ? 511  TRP B C     1 
ATOM   3068 O  O     . TRP A 1 448 ? -39.290 -30.433 16.036  1.00 37.62  ? 511  TRP B O     1 
ATOM   3069 C  CB    . TRP A 1 448 ? -40.763 -33.266 16.283  1.00 28.82  ? 511  TRP B CB    1 
ATOM   3070 C  CG    . TRP A 1 448 ? -41.883 -34.015 16.771  1.00 28.80  ? 511  TRP B CG    1 
ATOM   3071 C  CD1   . TRP A 1 448 ? -43.140 -33.677 16.680  1.00 29.32  ? 511  TRP B CD1   1 
ATOM   3072 C  CD2   . TRP A 1 448 ? -41.857 -35.292 17.343  1.00 32.54  ? 511  TRP B CD2   1 
ATOM   3073 N  NE1   . TRP A 1 448 ? -43.923 -34.624 17.179  1.00 29.37  ? 511  TRP B NE1   1 
ATOM   3074 C  CE2   . TRP A 1 448 ? -43.146 -35.638 17.611  1.00 29.89  ? 511  TRP B CE2   1 
ATOM   3075 C  CE3   . TRP A 1 448 ? -40.857 -36.175 17.658  1.00 31.31  ? 511  TRP B CE3   1 
ATOM   3076 C  CZ2   . TRP A 1 448 ? -43.471 -36.795 18.168  1.00 32.32  ? 511  TRP B CZ2   1 
ATOM   3077 C  CZ3   . TRP A 1 448 ? -41.166 -37.283 18.229  1.00 33.82  ? 511  TRP B CZ3   1 
ATOM   3078 C  CH2   . TRP A 1 448 ? -42.461 -37.610 18.487  1.00 39.86  ? 511  TRP B CH2   1 
ATOM   3079 N  N     . ILE A 1 449 ? -38.053 -32.222 15.994  1.00 29.59  ? 512  ILE B N     1 
ATOM   3080 C  CA    . ILE A 1 449 ? -37.125 -31.594 15.128  1.00 28.68  ? 512  ILE B CA    1 
ATOM   3081 C  C     . ILE A 1 449 ? -37.725 -31.508 13.765  1.00 27.94  ? 512  ILE B C     1 
ATOM   3082 O  O     . ILE A 1 449 ? -38.443 -32.353 13.358  1.00 29.40  ? 512  ILE B O     1 
ATOM   3083 C  CB    . ILE A 1 449 ? -35.823 -32.334 15.094  1.00 31.74  ? 512  ILE B CB    1 
ATOM   3084 C  CG1   . ILE A 1 449 ? -36.021 -33.688 14.520  1.00 29.83  ? 512  ILE B CG1   1 
ATOM   3085 C  CG2   . ILE A 1 449 ? -35.275 -32.456 16.477  1.00 28.31  ? 512  ILE B CG2   1 
ATOM   3086 C  CD1   . ILE A 1 449 ? -34.873 -34.573 14.821  1.00 30.32  ? 512  ILE B CD1   1 
ATOM   3087 N  N     . SER A 1 450 ? -37.392 -30.462 13.051  1.00 26.48  ? 513  SER B N     1 
ATOM   3088 C  CA    . SER A 1 450 ? -37.862 -30.199 11.731  1.00 25.35  ? 513  SER B CA    1 
ATOM   3089 C  C     . SER A 1 450 ? -37.164 -30.993 10.704  1.00 28.39  ? 513  SER B C     1 
ATOM   3090 O  O     . SER A 1 450 ? -36.173 -31.505 10.959  1.00 36.22  ? 513  SER B O     1 
ATOM   3091 C  CB    . SER A 1 450 ? -37.694 -28.734 11.433  1.00 25.84  ? 513  SER B CB    1 
ATOM   3092 O  OG    . SER A 1 450 ? -36.464 -28.452 10.852  1.00 32.38  ? 513  SER B OG    1 
ATOM   3093 N  N     . SER A 1 451 ? -37.665 -31.073 9.502   1.00 24.27  ? 514  SER B N     1 
ATOM   3094 C  CA    . SER A 1 451 ? -36.990 -31.776 8.466   1.00 25.50  ? 514  SER B CA    1 
ATOM   3095 C  C     . SER A 1 451 ? -35.632 -31.164 8.209   1.00 31.50  ? 514  SER B C     1 
ATOM   3096 O  O     . SER A 1 451 ? -34.703 -31.854 8.079   1.00 30.67  ? 514  SER B O     1 
ATOM   3097 C  CB    . SER A 1 451 ? -37.803 -31.671 7.208   1.00 31.02  ? 514  SER B CB    1 
ATOM   3098 O  OG    . SER A 1 451 ? -38.865 -32.563 7.215   1.00 37.73  ? 514  SER B OG    1 
ATOM   3099 N  N     . GLY A 1 452 ? -35.510 -29.860 8.168   1.00 31.65  ? 515  GLY B N     1 
ATOM   3100 C  CA    . GLY A 1 452 ? -34.250 -29.210 7.994   1.00 31.22  ? 515  GLY B CA    1 
ATOM   3101 C  C     . GLY A 1 452 ? -33.317 -29.468 9.126   1.00 34.73  ? 515  GLY B C     1 
ATOM   3102 O  O     . GLY A 1 452 ? -32.153 -29.508 8.940   1.00 36.39  ? 515  GLY B O     1 
ATOM   3103 N  N     . GLU A 1 453 ? -33.820 -29.512 10.333  1.00 31.24  ? 516  GLU B N     1 
ATOM   3104 C  CA    . GLU A 1 453 ? -33.017 -29.845 11.479  1.00 28.58  ? 516  GLU B CA    1 
ATOM   3105 C  C     . GLU A 1 453 ? -32.499 -31.240 11.417  1.00 29.37  ? 516  GLU B C     1 
ATOM   3106 O  O     . GLU A 1 453 ? -31.408 -31.464 11.753  1.00 29.17  ? 516  GLU B O     1 
ATOM   3107 C  CB    . GLU A 1 453 ? -33.820 -29.650 12.729  1.00 27.00  ? 516  GLU B CB    1 
ATOM   3108 C  CG    . GLU A 1 453 ? -33.667 -28.282 13.273  1.00 24.41  ? 516  GLU B CG    1 
ATOM   3109 C  CD    . GLU A 1 453 ? -34.678 -27.956 14.268  1.00 29.42  ? 516  GLU B CD    1 
ATOM   3110 O  OE1   . GLU A 1 453 ? -34.745 -26.831 14.668  1.00 31.38  ? 516  GLU B OE1   1 
ATOM   3111 O  OE2   . GLU A 1 453 ? -35.428 -28.798 14.640  1.00 28.36  ? 516  GLU B OE2   1 
ATOM   3112 N  N     . TYR A 1 454 ? -33.309 -32.189 11.016  1.00 25.42  ? 517  TYR B N     1 
ATOM   3113 C  CA    . TYR A 1 454 ? -32.858 -33.543 10.842  1.00 25.36  ? 517  TYR B CA    1 
ATOM   3114 C  C     . TYR A 1 454 ? -31.905 -33.650 9.726   1.00 33.86  ? 517  TYR B C     1 
ATOM   3115 O  O     . TYR A 1 454 ? -30.909 -34.244 9.850   1.00 34.30  ? 517  TYR B O     1 
ATOM   3116 C  CB    . TYR A 1 454 ? -34.012 -34.455 10.568  1.00 20.14  ? 517  TYR B CB    1 
ATOM   3117 C  CG    . TYR A 1 454 ? -33.681 -35.894 10.558  1.00 29.09  ? 517  TYR B CG    1 
ATOM   3118 C  CD1   . TYR A 1 454 ? -33.399 -36.553 11.695  1.00 26.56  ? 517  TYR B CD1   1 
ATOM   3119 C  CD2   . TYR A 1 454 ? -33.693 -36.611 9.410   1.00 30.68  ? 517  TYR B CD2   1 
ATOM   3120 C  CE1   . TYR A 1 454 ? -33.079 -37.877 11.676  1.00 25.23  ? 517  TYR B CE1   1 
ATOM   3121 C  CE2   . TYR A 1 454 ? -33.417 -37.943 9.397   1.00 27.34  ? 517  TYR B CE2   1 
ATOM   3122 C  CZ    . TYR A 1 454 ? -33.103 -38.554 10.532  1.00 29.02  ? 517  TYR B CZ    1 
ATOM   3123 O  OH    . TYR A 1 454 ? -32.813 -39.837 10.543  1.00 25.43  ? 517  TYR B OH    1 
ATOM   3124 N  N     . ILE A 1 455 ? -32.183 -32.990 8.632   1.00 34.61  ? 518  ILE B N     1 
ATOM   3125 C  CA    . ILE A 1 455 ? -31.351 -33.060 7.474   1.00 26.93  ? 518  ILE B CA    1 
ATOM   3126 C  C     . ILE A 1 455 ? -29.985 -32.577 7.749   1.00 27.42  ? 518  ILE B C     1 
ATOM   3127 O  O     . ILE A 1 455 ? -29.108 -33.123 7.240   1.00 29.61  ? 518  ILE B O     1 
ATOM   3128 C  CB    . ILE A 1 455 ? -31.908 -32.213 6.368   1.00 31.16  ? 518  ILE B CB    1 
ATOM   3129 C  CG1   . ILE A 1 455 ? -32.976 -32.940 5.592   1.00 32.95  ? 518  ILE B CG1   1 
ATOM   3130 C  CG2   . ILE A 1 455 ? -30.854 -31.954 5.355   1.00 27.46  ? 518  ILE B CG2   1 
ATOM   3131 C  CD1   . ILE A 1 455 ? -33.496 -34.180 6.231   1.00 31.38  ? 518  ILE B CD1   1 
ATOM   3132 N  N     . GLN A 1 456 ? -29.787 -31.508 8.466   1.00 33.36  ? 519  GLN B N     1 
ATOM   3133 C  CA    . GLN A 1 456 ? -28.436 -31.085 8.776   1.00 33.35  ? 519  GLN B CA    1 
ATOM   3134 C  C     . GLN A 1 456 ? -27.648 -31.986 9.689   1.00 33.87  ? 519  GLN B C     1 
ATOM   3135 O  O     . GLN A 1 456 ? -26.537 -32.239 9.467   1.00 35.84  ? 519  GLN B O     1 
ATOM   3136 C  CB    . GLN A 1 456 ? -28.438 -29.715 9.389   1.00 24.01  ? 519  GLN B CB    1 
ATOM   3137 C  CG    . GLN A 1 456 ? -27.104 -29.035 9.387   1.00 28.35  ? 519  GLN B CG    1 
ATOM   3138 C  CD    . GLN A 1 456 ? -26.981 -28.079 8.269   1.00 41.13  ? 519  GLN B CD    1 
ATOM   3139 O  OE1   . GLN A 1 456 ? -27.954 -27.562 7.821   1.00 53.56  ? 519  GLN B OE1   1 
ATOM   3140 N  NE2   . GLN A 1 456 ? -25.801 -27.830 7.818   1.00 47.08  ? 519  GLN B NE2   1 
ATOM   3141 N  N     . MET A 1 457 ? -28.225 -32.437 10.760  1.00 30.04  ? 520  MET B N     1 
ATOM   3142 C  CA    . MET A 1 457 ? -27.534 -33.274 11.680  1.00 33.71  ? 520  MET B CA    1 
ATOM   3143 C  C     . MET A 1 457 ? -27.227 -34.649 11.221  1.00 39.50  ? 520  MET B C     1 
ATOM   3144 O  O     . MET A 1 457 ? -26.241 -35.207 11.577  1.00 38.90  ? 520  MET B O     1 
ATOM   3145 C  CB    . MET A 1 457 ? -28.271 -33.318 12.970  1.00 37.85  ? 520  MET B CB    1 
ATOM   3146 C  CG    . MET A 1 457 ? -28.347 -31.986 13.596  1.00 36.13  ? 520  MET B CG    1 
ATOM   3147 S  SD    . MET A 1 457 ? -28.737 -32.190 15.261  1.00 41.02  ? 520  MET B SD    1 
ATOM   3148 C  CE    . MET A 1 457 ? -30.098 -31.117 15.313  1.00 29.05  ? 520  MET B CE    1 
ATOM   3149 N  N     . SER A 1 458 ? -28.139 -35.219 10.460  1.00 40.30  ? 521  SER B N     1 
ATOM   3150 C  CA    . SER A 1 458 ? -28.038 -36.551 9.906   1.00 31.70  ? 521  SER B CA    1 
ATOM   3151 C  C     . SER A 1 458 ? -27.176 -36.639 8.673   1.00 37.83  ? 521  SER B C     1 
ATOM   3152 O  O     . SER A 1 458 ? -26.849 -37.686 8.238   1.00 35.53  ? 521  SER B O     1 
ATOM   3153 C  CB    . SER A 1 458 ? -29.412 -37.078 9.637   1.00 33.31  ? 521  SER B CB    1 
ATOM   3154 O  OG    . SER A 1 458 ? -29.838 -36.775 8.360   1.00 39.12  ? 521  SER B OG    1 
ATOM   3155 N  N     . GLY A 1 459 ? -26.805 -35.477 8.150   1.00 40.79  ? 522  GLY B N     1 
ATOM   3156 C  CA    . GLY A 1 459 ? -25.940 -35.209 7.031   1.00 37.61  ? 522  GLY B CA    1 
ATOM   3157 C  C     . GLY A 1 459 ? -24.493 -35.124 7.443   1.00 32.94  ? 522  GLY B C     1 
ATOM   3158 O  O     . GLY A 1 459 ? -23.661 -34.820 6.688   1.00 32.74  ? 522  GLY B O     1 
ATOM   3159 N  N     . ARG A 1 460 ? -24.235 -35.338 8.701   1.00 33.29  ? 523  ARG B N     1 
ATOM   3160 C  CA    . ARG A 1 460 ? -22.940 -35.441 9.251   1.00 34.94  ? 523  ARG B CA    1 
ATOM   3161 C  C     . ARG A 1 460 ? -22.478 -36.885 9.220   1.00 37.54  ? 523  ARG B C     1 
ATOM   3162 O  O     . ARG A 1 460 ? -21.370 -37.162 9.555   1.00 37.08  ? 523  ARG B O     1 
ATOM   3163 C  CB    . ARG A 1 460 ? -23.002 -35.090 10.705  1.00 33.69  ? 523  ARG B CB    1 
ATOM   3164 C  CG    . ARG A 1 460 ? -23.422 -33.705 11.016  1.00 41.36  ? 523  ARG B CG    1 
ATOM   3165 C  CD    . ARG A 1 460 ? -22.541 -32.712 10.331  1.00 42.36  ? 523  ARG B CD    1 
ATOM   3166 N  NE    . ARG A 1 460 ? -21.332 -32.471 11.055  1.00 49.80  ? 523  ARG B NE    1 
ATOM   3167 C  CZ    . ARG A 1 460 ? -20.517 -31.479 10.791  1.00 56.74  ? 523  ARG B CZ    1 
ATOM   3168 N  NH1   . ARG A 1 460 ? -20.796 -30.637 9.826   1.00 58.14  ? 523  ARG B NH1   1 
ATOM   3169 N  NH2   . ARG A 1 460 ? -19.440 -31.330 11.496  1.00 53.05  ? 523  ARG B NH2   1 
ATOM   3170 N  N     . ALA A 1 461 ? -23.343 -37.799 8.841   1.00 32.97  ? 524  ALA B N     1 
ATOM   3171 C  CA    . ALA A 1 461 ? -23.049 -39.188 8.796   1.00 32.31  ? 524  ALA B CA    1 
ATOM   3172 C  C     . ALA A 1 461 ? -22.691 -39.688 7.413   1.00 39.08  ? 524  ALA B C     1 
ATOM   3173 O  O     . ALA A 1 461 ? -23.343 -39.395 6.451   1.00 41.69  ? 524  ALA B O     1 
ATOM   3174 C  CB    . ALA A 1 461 ? -24.210 -39.957 9.357   1.00 28.99  ? 524  ALA B CB    1 
ATOM   3175 N  N     . GLY A 1 462 ? -21.615 -40.457 7.364   1.00 35.04  ? 525  GLY B N     1 
ATOM   3176 C  CA    . GLY A 1 462 ? -21.059 -41.024 6.178   1.00 34.23  ? 525  GLY B CA    1 
ATOM   3177 C  C     . GLY A 1 462 ? -19.861 -40.251 5.757   1.00 36.60  ? 525  GLY B C     1 
ATOM   3178 O  O     . GLY A 1 462 ? -19.940 -39.089 5.558   1.00 40.14  ? 525  GLY B O     1 
ATOM   3179 N  N     . ARG A 1 463 ? -18.748 -40.937 5.575   1.00 38.08  ? 526  ARG B N     1 
ATOM   3180 C  CA    . ARG A 1 463 ? -17.484 -40.340 5.186   1.00 42.26  ? 526  ARG B CA    1 
ATOM   3181 C  C     . ARG A 1 463 ? -17.138 -40.810 3.835   1.00 43.71  ? 526  ARG B C     1 
ATOM   3182 O  O     . ARG A 1 463 ? -16.992 -41.957 3.651   1.00 45.44  ? 526  ARG B O     1 
ATOM   3183 C  CB    . ARG A 1 463 ? -16.423 -40.768 6.148   1.00 43.70  ? 526  ARG B CB    1 
ATOM   3184 C  CG    . ARG A 1 463 ? -16.703 -40.260 7.506   1.00 37.48  ? 526  ARG B CG    1 
ATOM   3185 C  CD    . ARG A 1 463 ? -15.661 -40.649 8.480   1.00 42.89  ? 526  ARG B CD    1 
ATOM   3186 N  NE    . ARG A 1 463 ? -15.539 -42.072 8.632   1.00 47.67  ? 526  ARG B NE    1 
ATOM   3187 C  CZ    . ARG A 1 463 ? -14.965 -42.632 9.668   1.00 47.55  ? 526  ARG B CZ    1 
ATOM   3188 N  NH1   . ARG A 1 463 ? -14.511 -41.895 10.627  1.00 44.71  ? 526  ARG B NH1   1 
ATOM   3189 N  NH2   . ARG A 1 463 ? -14.870 -43.916 9.746   1.00 48.23  ? 526  ARG B NH2   1 
ATOM   3190 N  N     . ARG A 1 464 ? -16.867 -39.918 2.911   1.00 44.15  ? 527  ARG B N     1 
ATOM   3191 C  CA    . ARG A 1 464 ? -16.727 -40.357 1.554   1.00 45.78  ? 527  ARG B CA    1 
ATOM   3192 C  C     . ARG A 1 464 ? -15.692 -41.340 1.216   1.00 50.49  ? 527  ARG B C     1 
ATOM   3193 O  O     . ARG A 1 464 ? -15.965 -42.279 0.499   1.00 54.21  ? 527  ARG B O     1 
ATOM   3194 C  CB    . ARG A 1 464 ? -16.567 -39.183 0.654   1.00 39.45  ? 527  ARG B CB    1 
ATOM   3195 C  CG    . ARG A 1 464 ? -17.730 -39.048 -0.250  1.00 41.44  ? 527  ARG B CG    1 
ATOM   3196 C  CD    . ARG A 1 464 ? -17.468 -39.746 -1.536  1.00 47.76  ? 527  ARG B CD    1 
ATOM   3197 N  NE    . ARG A 1 464 ? -17.290 -38.751 -2.558  1.00 49.90  ? 527  ARG B NE    1 
ATOM   3198 C  CZ    . ARG A 1 464 ? -18.290 -38.117 -3.132  1.00 52.32  ? 527  ARG B CZ    1 
ATOM   3199 N  NH1   . ARG A 1 464 ? -19.530 -38.401 -2.800  1.00 59.55  ? 527  ARG B NH1   1 
ATOM   3200 N  NH2   . ARG A 1 464 ? -18.060 -37.223 -4.041  1.00 47.68  ? 527  ARG B NH2   1 
ATOM   3201 N  N     . GLY A 1 465 ? -14.498 -41.148 1.687   1.00 49.08  ? 528  GLY B N     1 
ATOM   3202 C  CA    . GLY A 1 465 ? -13.513 -42.142 1.395   1.00 51.61  ? 528  GLY B CA    1 
ATOM   3203 C  C     . GLY A 1 465 ? -13.779 -43.405 2.146   1.00 50.75  ? 528  GLY B C     1 
ATOM   3204 O  O     . GLY A 1 465 ? -13.758 -44.495 1.646   1.00 58.04  ? 528  GLY B O     1 
ATOM   3205 N  N     . MET A 1 466 ? -14.127 -43.190 3.379   1.00 46.04  ? 529  MET B N     1 
ATOM   3206 C  CA    . MET A 1 466 ? -14.179 -44.223 4.333   1.00 43.62  ? 529  MET B CA    1 
ATOM   3207 C  C     . MET A 1 466 ? -15.363 -45.034 4.686   1.00 47.21  ? 529  MET B C     1 
ATOM   3208 O  O     . MET A 1 466 ? -15.163 -45.971 5.369   1.00 55.48  ? 529  MET B O     1 
ATOM   3209 C  CB    . MET A 1 466 ? -13.593 -43.658 5.611   1.00 45.42  ? 529  MET B CB    1 
ATOM   3210 C  CG    . MET A 1 466 ? -12.553 -42.594 5.380   1.00 53.55  ? 529  MET B CG    1 
ATOM   3211 S  SD    . MET A 1 466 ? -12.052 -41.679 6.807   1.00 74.29  ? 529  MET B SD    1 
ATOM   3212 C  CE    . MET A 1 466 ? -11.097 -42.951 7.596   1.00 65.42  ? 529  MET B CE    1 
ATOM   3213 N  N     . ASP A 1 467 ? -16.578 -44.729 4.289   1.00 49.07  ? 530  ASP B N     1 
ATOM   3214 C  CA    . ASP A 1 467 ? -17.678 -45.603 4.694   1.00 46.42  ? 530  ASP B CA    1 
ATOM   3215 C  C     . ASP A 1 467 ? -18.530 -46.070 3.570   1.00 49.29  ? 530  ASP B C     1 
ATOM   3216 O  O     . ASP A 1 467 ? -18.736 -45.382 2.609   1.00 44.16  ? 530  ASP B O     1 
ATOM   3217 C  CB    . ASP A 1 467 ? -18.650 -44.952 5.680   1.00 47.04  ? 530  ASP B CB    1 
ATOM   3218 C  CG    . ASP A 1 467 ? -18.005 -44.283 6.825   1.00 50.37  ? 530  ASP B CG    1 
ATOM   3219 O  OD1   . ASP A 1 467 ? -17.068 -44.783 7.401   1.00 48.38  ? 530  ASP B OD1   1 
ATOM   3220 O  OD2   . ASP A 1 467 ? -18.488 -43.238 7.185   1.00 51.39  ? 530  ASP B OD2   1 
ATOM   3221 N  N     . ASP A 1 468 ? -18.939 -47.310 3.652   1.00 49.35  ? 531  ASP B N     1 
ATOM   3222 C  CA    . ASP A 1 468 ? -19.884 -47.837 2.711   1.00 51.11  ? 531  ASP B CA    1 
ATOM   3223 C  C     . ASP A 1 468 ? -21.270 -47.257 2.980   1.00 51.09  ? 531  ASP B C     1 
ATOM   3224 O  O     . ASP A 1 468 ? -21.990 -46.915 2.089   1.00 52.79  ? 531  ASP B O     1 
ATOM   3225 C  CB    . ASP A 1 468 ? -19.794 -49.344 2.667   1.00 57.12  ? 531  ASP B CB    1 
ATOM   3226 C  CG    . ASP A 1 468 ? -18.461 -49.816 2.165   1.00 59.34  ? 531  ASP B CG    1 
ATOM   3227 O  OD1   . ASP A 1 468 ? -18.029 -49.417 1.097   1.00 53.87  ? 531  ASP B OD1   1 
ATOM   3228 O  OD2   . ASP A 1 468 ? -17.819 -50.580 2.843   1.00 57.70  ? 531  ASP B OD2   1 
ATOM   3229 N  N     . ARG A 1 469 ? -21.592 -47.105 4.244   1.00 51.23  ? 532  ARG B N     1 
ATOM   3230 C  CA    . ARG A 1 469 ? -22.844 -46.568 4.697   1.00 49.65  ? 532  ARG B CA    1 
ATOM   3231 C  C     . ARG A 1 469 ? -22.662 -45.644 5.824   1.00 51.65  ? 532  ARG B C     1 
ATOM   3232 O  O     . ARG A 1 469 ? -21.687 -45.698 6.483   1.00 52.26  ? 532  ARG B O     1 
ATOM   3233 C  CB    . ARG A 1 469 ? -23.669 -47.650 5.329   1.00 54.83  ? 532  ARG B CB    1 
ATOM   3234 C  CG    . ARG A 1 469 ? -24.300 -48.599 4.375   1.00 62.03  ? 532  ARG B CG    1 
ATOM   3235 C  CD    . ARG A 1 469 ? -23.715 -49.946 4.629   1.00 69.36  ? 532  ARG B CD    1 
ATOM   3236 N  NE    . ARG A 1 469 ? -23.559 -50.646 3.392   1.00 74.39  ? 532  ARG B NE    1 
ATOM   3237 C  CZ    . ARG A 1 469 ? -23.566 -51.947 3.305   1.00 74.66  ? 532  ARG B CZ    1 
ATOM   3238 N  NH1   . ARG A 1 469 ? -23.412 -52.497 2.122   1.00 73.74  ? 532  ARG B NH1   1 
ATOM   3239 N  NH2   . ARG A 1 469 ? -23.741 -52.678 4.392   1.00 69.56  ? 532  ARG B NH2   1 
ATOM   3240 N  N     . GLY A 1 470 ? -23.651 -44.809 6.043   1.00 42.51  ? 533  GLY B N     1 
ATOM   3241 C  CA    . GLY A 1 470 ? -23.711 -43.913 7.155   1.00 35.62  ? 533  GLY B CA    1 
ATOM   3242 C  C     . GLY A 1 470 ? -24.884 -44.384 7.972   1.00 35.91  ? 533  GLY B C     1 
ATOM   3243 O  O     . GLY A 1 470 ? -25.849 -44.826 7.465   1.00 38.61  ? 533  GLY B O     1 
ATOM   3244 N  N     . ILE A 1 471 ? -24.792 -44.306 9.268   1.00 35.81  ? 534  ILE B N     1 
ATOM   3245 C  CA    . ILE A 1 471 ? -25.853 -44.745 10.102  1.00 34.42  ? 534  ILE B CA    1 
ATOM   3246 C  C     . ILE A 1 471 ? -26.288 -43.580 10.906  1.00 34.01  ? 534  ILE B C     1 
ATOM   3247 O  O     . ILE A 1 471 ? -25.481 -42.827 11.358  1.00 30.45  ? 534  ILE B O     1 
ATOM   3248 C  CB    . ILE A 1 471 ? -25.363 -45.838 11.011  1.00 32.46  ? 534  ILE B CB    1 
ATOM   3249 C  CG1   . ILE A 1 471 ? -25.041 -47.044 10.207  1.00 32.99  ? 534  ILE B CG1   1 
ATOM   3250 C  CG2   . ILE A 1 471 ? -26.410 -46.233 11.993  1.00 27.20  ? 534  ILE B CG2   1 
ATOM   3251 C  CD1   . ILE A 1 471 ? -23.772 -47.660 10.656  1.00 40.31  ? 534  ILE B CD1   1 
ATOM   3252 N  N     . VAL A 1 472 ? -27.586 -43.378 10.991  1.00 33.47  ? 535  VAL B N     1 
ATOM   3253 C  CA    . VAL A 1 472 ? -28.141 -42.309 11.749  1.00 30.88  ? 535  VAL B CA    1 
ATOM   3254 C  C     . VAL A 1 472 ? -29.085 -42.900 12.690  1.00 29.23  ? 535  VAL B C     1 
ATOM   3255 O  O     . VAL A 1 472 ? -29.822 -43.709 12.335  1.00 33.42  ? 535  VAL B O     1 
ATOM   3256 C  CB    . VAL A 1 472 ? -28.951 -41.403 10.899  1.00 25.67  ? 535  VAL B CB    1 
ATOM   3257 C  CG1   . VAL A 1 472 ? -29.191 -40.150 11.647  1.00 31.53  ? 535  VAL B CG1   1 
ATOM   3258 C  CG2   . VAL A 1 472 ? -28.194 -41.061 9.670   1.00 30.71  ? 535  VAL B CG2   1 
ATOM   3259 N  N     . ILE A 1 473 ? -29.024 -42.529 13.945  1.00 32.71  ? 536  ILE B N     1 
ATOM   3260 C  CA    . ILE A 1 473 ? -29.919 -43.099 14.928  1.00 33.95  ? 536  ILE B CA    1 
ATOM   3261 C  C     . ILE A 1 473 ? -30.818 -42.082 15.628  1.00 36.42  ? 536  ILE B C     1 
ATOM   3262 O  O     . ILE A 1 473 ? -30.379 -41.083 16.045  1.00 35.51  ? 536  ILE B O     1 
ATOM   3263 C  CB    . ILE A 1 473 ? -29.133 -43.896 15.947  1.00 33.37  ? 536  ILE B CB    1 
ATOM   3264 C  CG1   . ILE A 1 473 ? -28.296 -44.932 15.268  1.00 28.08  ? 536  ILE B CG1   1 
ATOM   3265 C  CG2   . ILE A 1 473 ? -30.053 -44.593 16.883  1.00 29.79  ? 536  ILE B CG2   1 
ATOM   3266 C  CD1   . ILE A 1 473 ? -27.506 -45.734 16.219  1.00 23.94  ? 536  ILE B CD1   1 
ATOM   3267 N  N     . LEU A 1 474 ? -32.097 -42.346 15.736  1.00 38.51  ? 537  LEU B N     1 
ATOM   3268 C  CA    . LEU A 1 474 ? -32.970 -41.429 16.395  1.00 36.28  ? 537  LEU B CA    1 
ATOM   3269 C  C     . LEU A 1 474 ? -33.455 -42.094 17.625  1.00 44.49  ? 537  LEU B C     1 
ATOM   3270 O  O     . LEU A 1 474 ? -34.037 -43.093 17.533  1.00 43.73  ? 537  LEU B O     1 
ATOM   3271 C  CB    . LEU A 1 474 ? -34.187 -41.213 15.550  1.00 35.45  ? 537  LEU B CB    1 
ATOM   3272 C  CG    . LEU A 1 474 ? -34.619 -39.844 15.157  1.00 30.84  ? 537  LEU B CG    1 
ATOM   3273 C  CD1   . LEU A 1 474 ? -36.107 -39.825 15.117  1.00 26.81  ? 537  LEU B CD1   1 
ATOM   3274 C  CD2   . LEU A 1 474 ? -34.144 -38.943 16.227  1.00 32.16  ? 537  LEU B CD2   1 
ATOM   3275 N  N     . MET A 1 475 ? -33.264 -41.497 18.781  1.00 42.94  ? 538  MET B N     1 
ATOM   3276 C  CA    . MET A 1 475 ? -33.742 -42.047 20.013  1.00 39.42  ? 538  MET B CA    1 
ATOM   3277 C  C     . MET A 1 475 ? -35.051 -41.351 20.203  1.00 44.42  ? 538  MET B C     1 
ATOM   3278 O  O     . MET A 1 475 ? -35.122 -40.180 20.104  1.00 49.58  ? 538  MET B O     1 
ATOM   3279 C  CB    . MET A 1 475 ? -32.808 -41.710 21.160  1.00 38.19  ? 538  MET B CB    1 
ATOM   3280 C  CG    . MET A 1 475 ? -31.335 -41.835 20.884  1.00 39.31  ? 538  MET B CG    1 
ATOM   3281 S  SD    . MET A 1 475 ? -30.408 -42.417 22.276  1.00 42.24  ? 538  MET B SD    1 
ATOM   3282 C  CE    . MET A 1 475 ? -31.347 -43.799 22.734  1.00 55.68  ? 538  MET B CE    1 
ATOM   3283 N  N     . VAL A 1 476 ? -36.120 -42.075 20.433  1.00 38.77  ? 539  VAL B N     1 
ATOM   3284 C  CA    . VAL A 1 476 ? -37.400 -41.440 20.555  1.00 39.77  ? 539  VAL B CA    1 
ATOM   3285 C  C     . VAL A 1 476 ? -38.210 -41.751 21.787  1.00 46.97  ? 539  VAL B C     1 
ATOM   3286 O  O     . VAL A 1 476 ? -38.673 -42.820 21.899  1.00 46.24  ? 539  VAL B O     1 
ATOM   3287 C  CB    . VAL A 1 476 ? -38.182 -41.882 19.368  1.00 39.90  ? 539  VAL B CB    1 
ATOM   3288 C  CG1   . VAL A 1 476 ? -39.630 -41.726 19.582  1.00 42.96  ? 539  VAL B CG1   1 
ATOM   3289 C  CG2   . VAL A 1 476 ? -37.767 -41.102 18.181  1.00 37.76  ? 539  VAL B CG2   1 
ATOM   3290 N  N     . ASP A 1 477 ? -38.481 -40.767 22.635  1.00 49.36  ? 540  ASP B N     1 
ATOM   3291 C  CA    . ASP A 1 477 ? -39.218 -40.980 23.873  1.00 44.53  ? 540  ASP B CA    1 
ATOM   3292 C  C     . ASP A 1 477 ? -40.702 -40.809 23.849  1.00 50.40  ? 540  ASP B C     1 
ATOM   3293 O  O     . ASP A 1 477 ? -41.349 -41.224 24.755  1.00 57.60  ? 540  ASP B O     1 
ATOM   3294 C  CB    . ASP A 1 477 ? -38.716 -40.047 24.952  1.00 43.70  ? 540  ASP B CB    1 
ATOM   3295 C  CG    . ASP A 1 477 ? -37.269 -40.166 25.200  1.00 49.07  ? 540  ASP B CG    1 
ATOM   3296 O  OD1   . ASP A 1 477 ? -36.525 -40.601 24.339  1.00 52.15  ? 540  ASP B OD1   1 
ATOM   3297 O  OD2   . ASP A 1 477 ? -36.858 -39.801 26.276  1.00 54.15  ? 540  ASP B OD2   1 
ATOM   3298 N  N     . GLU A 1 478 ? -41.245 -40.227 22.805  1.00 45.16  ? 541  GLU B N     1 
ATOM   3299 C  CA    . GLU A 1 478 ? -42.657 -39.968 22.695  1.00 42.45  ? 541  GLU B CA    1 
ATOM   3300 C  C     . GLU A 1 478 ? -43.200 -40.635 21.517  1.00 47.11  ? 541  GLU B C     1 
ATOM   3301 O  O     . GLU A 1 478 ? -42.522 -40.821 20.584  1.00 39.51  ? 541  GLU B O     1 
ATOM   3302 C  CB    . GLU A 1 478 ? -42.887 -38.513 22.432  1.00 44.16  ? 541  GLU B CB    1 
ATOM   3303 C  CG    . GLU A 1 478 ? -43.568 -37.777 23.531  1.00 49.70  ? 541  GLU B CG    1 
ATOM   3304 C  CD    . GLU A 1 478 ? -42.658 -37.583 24.686  1.00 56.82  ? 541  GLU B CD    1 
ATOM   3305 O  OE1   . GLU A 1 478 ? -41.571 -37.060 24.486  1.00 58.77  ? 541  GLU B OE1   1 
ATOM   3306 O  OE2   . GLU A 1 478 ? -43.029 -37.961 25.790  1.00 56.61  ? 541  GLU B OE2   1 
ATOM   3307 N  N     . LYS A 1 479 ? -44.469 -40.942 21.518  1.00 47.60  ? 542  LYS B N     1 
ATOM   3308 C  CA    . LYS A 1 479 ? -45.031 -41.604 20.381  1.00 38.83  ? 542  LYS B CA    1 
ATOM   3309 C  C     . LYS A 1 479 ? -45.011 -40.677 19.238  1.00 45.03  ? 542  LYS B C     1 
ATOM   3310 O  O     . LYS A 1 479 ? -45.325 -39.547 19.373  1.00 50.72  ? 542  LYS B O     1 
ATOM   3311 C  CB    . LYS A 1 479 ? -46.464 -42.000 20.643  1.00 30.12  ? 542  LYS B CB    1 
ATOM   3312 N  N     . MET A 1 480 ? -44.696 -41.184 18.074  1.00 47.84  ? 543  MET B N     1 
ATOM   3313 C  CA    . MET A 1 480 ? -44.657 -40.392 16.896  1.00 37.27  ? 543  MET B CA    1 
ATOM   3314 C  C     . MET A 1 480 ? -45.573 -40.974 15.903  1.00 34.88  ? 543  MET B C     1 
ATOM   3315 O  O     . MET A 1 480 ? -45.657 -42.114 15.806  1.00 39.60  ? 543  MET B O     1 
ATOM   3316 C  CB    . MET A 1 480 ? -43.299 -40.469 16.323  1.00 38.14  ? 543  MET B CB    1 
ATOM   3317 C  CG    . MET A 1 480 ? -43.021 -39.424 15.317  1.00 39.90  ? 543  MET B CG    1 
ATOM   3318 S  SD    . MET A 1 480 ? -41.368 -39.748 14.950  1.00 47.24  ? 543  MET B SD    1 
ATOM   3319 C  CE    . MET A 1 480 ? -40.582 -38.672 16.070  1.00 32.19  ? 543  MET B CE    1 
ATOM   3320 N  N     . SER A 1 481 ? -46.293 -40.165 15.178  1.00 37.36  ? 544  SER B N     1 
ATOM   3321 C  CA    . SER A 1 481 ? -47.215 -40.614 14.179  1.00 40.60  ? 544  SER B CA    1 
ATOM   3322 C  C     . SER A 1 481 ? -46.539 -40.955 12.904  1.00 43.10  ? 544  SER B C     1 
ATOM   3323 O  O     . SER A 1 481 ? -45.441 -40.597 12.713  1.00 43.77  ? 544  SER B O     1 
ATOM   3324 C  CB    . SER A 1 481 ? -48.175 -39.496 13.876  1.00 40.95  ? 544  SER B CB    1 
ATOM   3325 O  OG    . SER A 1 481 ? -48.588 -38.871 15.056  1.00 51.79  ? 544  SER B OG    1 
ATOM   3326 N  N     . PRO A 1 482 ? -47.149 -41.753 12.056  1.00 45.55  ? 545  PRO B N     1 
ATOM   3327 C  CA    . PRO A 1 482 ? -46.549 -41.994 10.768  1.00 38.16  ? 545  PRO B CA    1 
ATOM   3328 C  C     . PRO A 1 482 ? -46.524 -40.767 9.940   1.00 35.59  ? 545  PRO B C     1 
ATOM   3329 O  O     . PRO A 1 482 ? -45.589 -40.595 9.245   1.00 37.48  ? 545  PRO B O     1 
ATOM   3330 C  CB    . PRO A 1 482 ? -47.484 -42.986 10.165  1.00 44.65  ? 545  PRO B CB    1 
ATOM   3331 C  CG    . PRO A 1 482 ? -47.821 -43.804 11.297  1.00 50.20  ? 545  PRO B CG    1 
ATOM   3332 C  CD    . PRO A 1 482 ? -48.033 -42.848 12.413  1.00 49.82  ? 545  PRO B CD    1 
ATOM   3333 N  N     . THR A 1 483 ? -47.562 -39.963 9.957   1.00 32.19  ? 546  THR B N     1 
ATOM   3334 C  CA    . THR A 1 483 ? -47.522 -38.766 9.192   1.00 36.49  ? 546  THR B CA    1 
ATOM   3335 C  C     . THR A 1 483 ? -46.490 -37.832 9.729   1.00 37.80  ? 546  THR B C     1 
ATOM   3336 O  O     . THR A 1 483 ? -45.868 -37.156 8.989   1.00 43.98  ? 546  THR B O     1 
ATOM   3337 C  CB    . THR A 1 483 ? -48.902 -38.133 8.918   1.00 35.49  ? 546  THR B CB    1 
ATOM   3338 O  OG1   . THR A 1 483 ? -49.169 -37.067 9.810   1.00 39.90  ? 546  THR B OG1   1 
ATOM   3339 C  CG2   . THR A 1 483 ? -49.949 -39.133 9.027   1.00 40.50  ? 546  THR B CG2   1 
ATOM   3340 N  N     . ILE A 1 484 ? -46.362 -37.720 11.027  1.00 36.06  ? 547  ILE B N     1 
ATOM   3341 C  CA    . ILE A 1 484 ? -45.335 -36.900 11.646  1.00 33.64  ? 547  ILE B CA    1 
ATOM   3342 C  C     . ILE A 1 484 ? -43.944 -37.422 11.444  1.00 36.29  ? 547  ILE B C     1 
ATOM   3343 O  O     . ILE A 1 484 ? -43.043 -36.699 11.297  1.00 39.64  ? 547  ILE B O     1 
ATOM   3344 C  CB    . ILE A 1 484 ? -45.597 -36.712 13.130  1.00 33.93  ? 547  ILE B CB    1 
ATOM   3345 C  CG1   . ILE A 1 484 ? -46.662 -35.691 13.299  1.00 30.90  ? 547  ILE B CG1   1 
ATOM   3346 C  CG2   . ILE A 1 484 ? -44.392 -36.197 13.838  1.00 27.05  ? 547  ILE B CG2   1 
ATOM   3347 C  CD1   . ILE A 1 484 ? -47.041 -35.492 14.711  1.00 30.66  ? 547  ILE B CD1   1 
ATOM   3348 N  N     . GLY A 1 485 ? -43.771 -38.705 11.536  1.00 38.07  ? 548  GLY B N     1 
ATOM   3349 C  CA    . GLY A 1 485 ? -42.507 -39.347 11.305  1.00 35.99  ? 548  GLY B CA    1 
ATOM   3350 C  C     . GLY A 1 485 ? -41.963 -39.314 9.904   1.00 39.21  ? 548  GLY B C     1 
ATOM   3351 O  O     . GLY A 1 485 ? -40.793 -39.277 9.703   1.00 38.98  ? 548  GLY B O     1 
ATOM   3352 N  N     . LYS A 1 486 ? -42.838 -39.437 8.935   1.00 34.87  ? 549  LYS B N     1 
ATOM   3353 C  CA    . LYS A 1 486 ? -42.497 -39.374 7.541   1.00 33.10  ? 549  LYS B CA    1 
ATOM   3354 C  C     . LYS A 1 486 ? -41.969 -38.037 7.150   1.00 40.97  ? 549  LYS B C     1 
ATOM   3355 O  O     . LYS A 1 486 ? -41.224 -37.922 6.232   1.00 35.99  ? 549  LYS B O     1 
ATOM   3356 C  CB    . LYS A 1 486 ? -43.707 -39.614 6.712   1.00 37.49  ? 549  LYS B CB    1 
ATOM   3357 C  CG    . LYS A 1 486 ? -43.802 -40.955 6.092   1.00 33.66  ? 549  LYS B CG    1 
ATOM   3358 C  CD    . LYS A 1 486 ? -43.997 -40.822 4.602   1.00 44.12  ? 549  LYS B CD    1 
ATOM   3359 C  CE    . LYS A 1 486 ? -45.344 -40.228 4.206   1.00 66.02  ? 549  LYS B CE    1 
ATOM   3360 N  NZ    . LYS A 1 486 ? -45.565 -39.951 2.756   1.00 46.31  ? 549  LYS B NZ    1 
ATOM   3361 N  N     . GLN A 1 487 ? -42.507 -37.010 7.748   1.00 39.31  ? 550  GLN B N     1 
ATOM   3362 C  CA    . GLN A 1 487 ? -42.030 -35.689 7.510   1.00 32.24  ? 550  GLN B CA    1 
ATOM   3363 C  C     . GLN A 1 487 ? -40.665 -35.472 8.060   1.00 32.90  ? 550  GLN B C     1 
ATOM   3364 O  O     . GLN A 1 487 ? -39.861 -34.817 7.494   1.00 31.70  ? 550  GLN B O     1 
ATOM   3365 C  CB    . GLN A 1 487 ? -42.965 -34.685 8.116   1.00 32.41  ? 550  GLN B CB    1 
ATOM   3366 C  CG    . GLN A 1 487 ? -42.434 -33.282 8.132   1.00 30.26  ? 550  GLN B CG    1 
ATOM   3367 C  CD    . GLN A 1 487 ? -42.650 -32.599 6.845   1.00 38.90  ? 550  GLN B CD    1 
ATOM   3368 O  OE1   . GLN A 1 487 ? -41.944 -31.711 6.465   1.00 37.08  ? 550  GLN B OE1   1 
ATOM   3369 N  NE2   . GLN A 1 487 ? -43.636 -33.039 6.152   1.00 46.37  ? 550  GLN B NE2   1 
ATOM   3370 N  N     . LEU A 1 488 ? -40.411 -35.998 9.220   1.00 31.69  ? 551  LEU B N     1 
ATOM   3371 C  CA    . LEU A 1 488 ? -39.155 -35.776 9.843   1.00 30.21  ? 551  LEU B CA    1 
ATOM   3372 C  C     . LEU A 1 488 ? -38.015 -36.362 9.077   1.00 30.50  ? 551  LEU B C     1 
ATOM   3373 O  O     . LEU A 1 488 ? -37.063 -35.740 8.836   1.00 33.52  ? 551  LEU B O     1 
ATOM   3374 C  CB    . LEU A 1 488 ? -39.234 -36.372 11.249  1.00 29.81  ? 551  LEU B CB    1 
ATOM   3375 C  CG    . LEU A 1 488 ? -38.349 -35.939 12.392  1.00 26.39  ? 551  LEU B CG    1 
ATOM   3376 C  CD1   . LEU A 1 488 ? -39.121 -36.046 13.638  1.00 29.42  ? 551  LEU B CD1   1 
ATOM   3377 C  CD2   . LEU A 1 488 ? -37.174 -36.823 12.548  1.00 22.20  ? 551  LEU B CD2   1 
ATOM   3378 N  N     . LEU A 1 489 ? -38.139 -37.587 8.661   1.00 33.69  ? 552  LEU B N     1 
ATOM   3379 C  CA    . LEU A 1 489 ? -37.069 -38.264 7.990   1.00 33.27  ? 552  LEU B CA    1 
ATOM   3380 C  C     . LEU A 1 489 ? -36.973 -38.101 6.510   1.00 35.00  ? 552  LEU B C     1 
ATOM   3381 O  O     . LEU A 1 489 ? -35.918 -37.997 5.966   1.00 37.96  ? 552  LEU B O     1 
ATOM   3382 C  CB    . LEU A 1 489 ? -37.237 -39.740 8.251   1.00 31.81  ? 552  LEU B CB    1 
ATOM   3383 C  CG    . LEU A 1 489 ? -37.164 -40.507 9.550   1.00 30.21  ? 552  LEU B CG    1 
ATOM   3384 C  CD1   . LEU A 1 489 ? -37.163 -39.712 10.773  1.00 22.72  ? 552  LEU B CD1   1 
ATOM   3385 C  CD2   . LEU A 1 489 ? -38.323 -41.411 9.614   1.00 30.37  ? 552  LEU B CD2   1 
ATOM   3386 N  N     . LYS A 1 490 ? -38.090 -38.140 5.844   1.00 28.09  ? 553  LYS B N     1 
ATOM   3387 C  CA    . LYS A 1 490 ? -38.058 -38.081 4.416   1.00 31.43  ? 553  LYS B CA    1 
ATOM   3388 C  C     . LYS A 1 490 ? -38.443 -36.773 3.885   1.00 38.62  ? 553  LYS B C     1 
ATOM   3389 O  O     . LYS A 1 490 ? -38.494 -36.609 2.712   1.00 47.04  ? 553  LYS B O     1 
ATOM   3390 C  CB    . LYS A 1 490 ? -38.969 -39.140 3.807   1.00 30.84  ? 553  LYS B CB    1 
ATOM   3391 C  CG    . LYS A 1 490 ? -38.386 -40.500 3.623   1.00 30.10  ? 553  LYS B CG    1 
ATOM   3392 C  CD    . LYS A 1 490 ? -38.003 -40.716 2.194   1.00 39.96  ? 553  LYS B CD    1 
ATOM   3393 C  CE    . LYS A 1 490 ? -39.186 -40.538 1.251   1.00 49.62  ? 553  LYS B CE    1 
ATOM   3394 N  NZ    . LYS A 1 490 ? -39.890 -41.781 0.845   1.00 45.59  ? 553  LYS B NZ    1 
ATOM   3395 N  N     . GLY A 1 491 ? -38.695 -35.830 4.749   1.00 33.64  ? 554  GLY B N     1 
ATOM   3396 C  CA    . GLY A 1 491 ? -39.103 -34.511 4.385   1.00 26.47  ? 554  GLY B CA    1 
ATOM   3397 C  C     . GLY A 1 491 ? -38.012 -33.657 3.841   1.00 27.29  ? 554  GLY B C     1 
ATOM   3398 O  O     . GLY A 1 491 ? -36.882 -33.974 3.935   1.00 39.23  ? 554  GLY B O     1 
ATOM   3399 N  N     . SER A 1 492 ? -38.392 -32.566 3.230   1.00 23.88  ? 555  SER B N     1 
ATOM   3400 C  CA    . SER A 1 492 ? -37.488 -31.628 2.654   1.00 24.77  ? 555  SER B CA    1 
ATOM   3401 C  C     . SER A 1 492 ? -36.913 -30.649 3.600   1.00 32.57  ? 555  SER B C     1 
ATOM   3402 O  O     . SER A 1 492 ? -37.376 -30.472 4.651   1.00 27.87  ? 555  SER B O     1 
ATOM   3403 C  CB    . SER A 1 492 ? -38.238 -30.837 1.671   1.00 26.17  ? 555  SER B CB    1 
ATOM   3404 O  OG    . SER A 1 492 ? -39.267 -30.237 2.370   1.00 38.81  ? 555  SER B OG    1 
ATOM   3405 N  N     . ALA A 1 493 ? -35.879 -29.984 3.150   1.00 36.21  ? 556  ALA B N     1 
ATOM   3406 C  CA    . ALA A 1 493 ? -35.174 -28.965 3.864   1.00 34.66  ? 556  ALA B CA    1 
ATOM   3407 C  C     . ALA A 1 493 ? -35.886 -27.650 3.851   1.00 40.08  ? 556  ALA B C     1 
ATOM   3408 O  O     . ALA A 1 493 ? -36.852 -27.468 3.188   1.00 38.63  ? 556  ALA B O     1 
ATOM   3409 C  CB    . ALA A 1 493 ? -33.819 -28.793 3.271   1.00 33.04  ? 556  ALA B CB    1 
ATOM   3410 N  N     . ASP A 1 494 ? -35.441 -26.740 4.669   1.00 40.92  ? 557  ASP B N     1 
ATOM   3411 C  CA    . ASP A 1 494 ? -36.054 -25.465 4.724   1.00 40.62  ? 557  ASP B CA    1 
ATOM   3412 C  C     . ASP A 1 494 ? -35.708 -24.673 3.548   1.00 37.90  ? 557  ASP B C     1 
ATOM   3413 O  O     . ASP A 1 494 ? -34.602 -24.683 3.147   1.00 43.27  ? 557  ASP B O     1 
ATOM   3414 C  CB    . ASP A 1 494 ? -35.572 -24.724 5.932   1.00 44.50  ? 557  ASP B CB    1 
ATOM   3415 C  CG    . ASP A 1 494 ? -36.046 -25.317 7.170   1.00 44.76  ? 557  ASP B CG    1 
ATOM   3416 O  OD1   . ASP A 1 494 ? -37.205 -25.667 7.220   1.00 49.91  ? 557  ASP B OD1   1 
ATOM   3417 O  OD2   . ASP A 1 494 ? -35.275 -25.444 8.107   1.00 54.37  ? 557  ASP B OD2   1 
ATOM   3418 N  N     . PRO A 1 495 ? -36.650 -23.917 3.025   1.00 34.73  ? 558  PRO B N     1 
ATOM   3419 C  CA    . PRO A 1 495 ? -36.493 -23.070 1.877   1.00 32.57  ? 558  PRO B CA    1 
ATOM   3420 C  C     . PRO A 1 495 ? -35.625 -21.952 2.211   1.00 33.75  ? 558  PRO B C     1 
ATOM   3421 O  O     . PRO A 1 495 ? -35.737 -21.473 3.271   1.00 45.48  ? 558  PRO B O     1 
ATOM   3422 C  CB    . PRO A 1 495 ? -37.878 -22.552 1.690   1.00 31.36  ? 558  PRO B CB    1 
ATOM   3423 C  CG    . PRO A 1 495 ? -38.709 -23.599 2.215   1.00 29.82  ? 558  PRO B CG    1 
ATOM   3424 C  CD    . PRO A 1 495 ? -38.022 -23.868 3.468   1.00 39.43  ? 558  PRO B CD    1 
ATOM   3425 N  N     . LEU A 1 496 ? -34.807 -21.498 1.311   1.00 33.11  ? 559  LEU B N     1 
ATOM   3426 C  CA    . LEU A 1 496 ? -33.980 -20.406 1.646   1.00 36.08  ? 559  LEU B CA    1 
ATOM   3427 C  C     . LEU A 1 496 ? -34.837 -19.215 1.430   1.00 38.26  ? 559  LEU B C     1 
ATOM   3428 O  O     . LEU A 1 496 ? -35.021 -18.777 0.353   1.00 36.32  ? 559  LEU B O     1 
ATOM   3429 C  CB    . LEU A 1 496 ? -32.792 -20.367 0.741   1.00 35.87  ? 559  LEU B CB    1 
ATOM   3430 C  CG    . LEU A 1 496 ? -32.246 -18.996 0.538   1.00 35.53  ? 559  LEU B CG    1 
ATOM   3431 C  CD1   . LEU A 1 496 ? -31.801 -18.549 1.870   1.00 46.92  ? 559  LEU B CD1   1 
ATOM   3432 C  CD2   . LEU A 1 496 ? -31.048 -19.060 -0.345  1.00 32.47  ? 559  LEU B CD2   1 
ATOM   3433 N  N     . ASN A 1 497 ? -35.371 -18.717 2.519   1.00 41.76  ? 560  ASN B N     1 
ATOM   3434 C  CA    . ASN A 1 497 ? -36.208 -17.563 2.615   1.00 38.47  ? 560  ASN B CA    1 
ATOM   3435 C  C     . ASN A 1 497 ? -35.329 -16.567 3.270   1.00 41.39  ? 560  ASN B C     1 
ATOM   3436 O  O     . ASN A 1 497 ? -34.666 -16.861 4.220   1.00 42.32  ? 560  ASN B O     1 
ATOM   3437 C  CB    . ASN A 1 497 ? -37.298 -17.805 3.608   1.00 34.52  ? 560  ASN B CB    1 
ATOM   3438 C  CG    . ASN A 1 497 ? -38.346 -18.726 3.125   1.00 38.27  ? 560  ASN B CG    1 
ATOM   3439 O  OD1   . ASN A 1 497 ? -38.690 -18.754 1.984   1.00 36.90  ? 560  ASN B OD1   1 
ATOM   3440 N  ND2   . ASN A 1 497 ? -38.891 -19.448 4.020   1.00 38.06  ? 560  ASN B ND2   1 
ATOM   3441 N  N     . SER A 1 498 ? -35.343 -15.360 2.753   1.00 42.15  ? 561  SER B N     1 
ATOM   3442 C  CA    . SER A 1 498 ? -34.521 -14.281 3.241   1.00 40.44  ? 561  SER B CA    1 
ATOM   3443 C  C     . SER A 1 498 ? -34.903 -13.691 4.506   1.00 37.41  ? 561  SER B C     1 
ATOM   3444 O  O     . SER A 1 498 ? -36.014 -13.709 4.861   1.00 31.78  ? 561  SER B O     1 
ATOM   3445 C  CB    . SER A 1 498 ? -34.496 -13.138 2.263   1.00 40.43  ? 561  SER B CB    1 
ATOM   3446 O  OG    . SER A 1 498 ? -35.764 -12.614 2.118   1.00 36.43  ? 561  SER B OG    1 
ATOM   3447 N  N     . ALA A 1 499 ? -33.937 -13.105 5.165   1.00 38.92  ? 562  ALA B N     1 
ATOM   3448 C  CA    . ALA A 1 499 ? -34.175 -12.473 6.405   1.00 40.78  ? 562  ALA B CA    1 
ATOM   3449 C  C     . ALA A 1 499 ? -33.571 -11.130 6.338   1.00 41.42  ? 562  ALA B C     1 
ATOM   3450 O  O     . ALA A 1 499 ? -32.782 -10.756 7.151   1.00 47.34  ? 562  ALA B O     1 
ATOM   3451 C  CB    . ALA A 1 499 ? -33.525 -13.264 7.488   1.00 46.87  ? 562  ALA B CB    1 
ATOM   3452 N  N     . PHE A 1 500 ? -33.972 -10.383 5.353   1.00 31.75  ? 563  PHE B N     1 
ATOM   3453 C  CA    . PHE A 1 500 ? -33.472 -9.072  5.217   1.00 32.76  ? 563  PHE B CA    1 
ATOM   3454 C  C     . PHE A 1 500 ? -34.130 -8.219  6.216   1.00 40.35  ? 563  PHE B C     1 
ATOM   3455 O  O     . PHE A 1 500 ? -35.267 -8.399  6.501   1.00 45.01  ? 563  PHE B O     1 
ATOM   3456 C  CB    . PHE A 1 500 ? -33.851 -8.553  3.878   1.00 32.54  ? 563  PHE B CB    1 
ATOM   3457 C  CG    . PHE A 1 500 ? -33.212 -7.272  3.515   1.00 32.85  ? 563  PHE B CG    1 
ATOM   3458 C  CD1   . PHE A 1 500 ? -31.950 -7.238  3.065   1.00 31.85  ? 563  PHE B CD1   1 
ATOM   3459 C  CD2   . PHE A 1 500 ? -33.912 -6.117  3.554   1.00 36.81  ? 563  PHE B CD2   1 
ATOM   3460 C  CE1   . PHE A 1 500 ? -31.387 -6.078  2.682   1.00 34.43  ? 563  PHE B CE1   1 
ATOM   3461 C  CE2   . PHE A 1 500 ? -33.350 -4.941  3.186   1.00 31.98  ? 563  PHE B CE2   1 
ATOM   3462 C  CZ    . PHE A 1 500 ? -32.083 -4.929  2.745   1.00 35.01  ? 563  PHE B CZ    1 
ATOM   3463 N  N     . HIS A 1 501 ? -33.393 -7.301  6.784   1.00 37.60  ? 564  HIS B N     1 
ATOM   3464 C  CA    . HIS A 1 501 ? -33.966 -6.331  7.653   1.00 35.14  ? 564  HIS B CA    1 
ATOM   3465 C  C     . HIS A 1 501 ? -33.173 -5.078  7.581   1.00 37.02  ? 564  HIS B C     1 
ATOM   3466 O  O     . HIS A 1 501 ? -32.066 -5.063  7.116   1.00 40.58  ? 564  HIS B O     1 
ATOM   3467 C  CB    . HIS A 1 501 ? -34.139 -6.801  9.059   1.00 37.19  ? 564  HIS B CB    1 
ATOM   3468 C  CG    . HIS A 1 501 ? -32.919 -7.363  9.671   1.00 36.79  ? 564  HIS B CG    1 
ATOM   3469 N  ND1   . HIS A 1 501 ? -31.884 -6.584  10.098  1.00 40.31  ? 564  HIS B ND1   1 
ATOM   3470 C  CD2   . HIS A 1 501 ? -32.586 -8.628  9.966   1.00 43.12  ? 564  HIS B CD2   1 
ATOM   3471 C  CE1   . HIS A 1 501 ? -30.949 -7.341  10.615  1.00 41.08  ? 564  HIS B CE1   1 
ATOM   3472 N  NE2   . HIS A 1 501 ? -31.354 -8.588  10.548  1.00 60.21  ? 564  HIS B NE2   1 
ATOM   3473 N  N     . LEU A 1 502 ? -33.768 -3.996  8.017   1.00 34.22  ? 565  LEU B N     1 
ATOM   3474 C  CA    . LEU A 1 502 ? -33.107 -2.729  7.958   1.00 36.19  ? 565  LEU B CA    1 
ATOM   3475 C  C     . LEU A 1 502 ? -32.288 -2.501  9.155   1.00 38.20  ? 565  LEU B C     1 
ATOM   3476 O  O     . LEU A 1 502 ? -32.666 -2.841  10.204  1.00 40.76  ? 565  LEU B O     1 
ATOM   3477 C  CB    . LEU A 1 502 ? -34.105 -1.603  7.838   1.00 34.17  ? 565  LEU B CB    1 
ATOM   3478 C  CG    . LEU A 1 502 ? -34.644 -1.036  6.549   1.00 31.59  ? 565  LEU B CG    1 
ATOM   3479 C  CD1   . LEU A 1 502 ? -33.706 -1.241  5.411   1.00 29.79  ? 565  LEU B CD1   1 
ATOM   3480 C  CD2   . LEU A 1 502 ? -35.950 -1.677  6.244   1.00 38.29  ? 565  LEU B CD2   1 
ATOM   3481 N  N     . THR A 1 503 ? -31.104 -1.984  8.974   1.00 31.58  ? 566  THR B N     1 
ATOM   3482 C  CA    . THR A 1 503 ? -30.250 -1.655  10.062  1.00 32.95  ? 566  THR B CA    1 
ATOM   3483 C  C     . THR A 1 503 ? -29.759 -0.248  9.818   1.00 40.91  ? 566  THR B C     1 
ATOM   3484 O  O     . THR A 1 503 ? -29.630 0.165   8.718   1.00 42.44  ? 566  THR B O     1 
ATOM   3485 C  CB    . THR A 1 503 ? -29.036 -2.559  10.225  1.00 34.15  ? 566  THR B CB    1 
ATOM   3486 O  OG1   . THR A 1 503 ? -28.001 -2.143  9.361   1.00 37.08  ? 566  THR B OG1   1 
ATOM   3487 C  CG2   . THR A 1 503 ? -29.324 -3.927  9.952   1.00 34.60  ? 566  THR B CG2   1 
ATOM   3488 N  N     . TYR A 1 504 ? -29.425 0.493   10.856  1.00 42.02  ? 567  TYR B N     1 
ATOM   3489 C  CA    . TYR A 1 504 ? -28.935 1.842   10.702  1.00 38.90  ? 567  TYR B CA    1 
ATOM   3490 C  C     . TYR A 1 504 ? -27.649 1.908   9.978   1.00 38.01  ? 567  TYR B C     1 
ATOM   3491 O  O     . TYR A 1 504 ? -27.387 2.821   9.318   1.00 41.17  ? 567  TYR B O     1 
ATOM   3492 C  CB    . TYR A 1 504 ? -28.848 2.558   12.022  1.00 39.98  ? 567  TYR B CB    1 
ATOM   3493 C  CG    . TYR A 1 504 ? -30.173 2.969   12.525  1.00 40.38  ? 567  TYR B CG    1 
ATOM   3494 C  CD1   . TYR A 1 504 ? -30.909 3.871   11.862  1.00 43.72  ? 567  TYR B CD1   1 
ATOM   3495 C  CD2   . TYR A 1 504 ? -30.684 2.455   13.656  1.00 33.02  ? 567  TYR B CD2   1 
ATOM   3496 C  CE1   . TYR A 1 504 ? -32.124 4.241   12.319  1.00 41.31  ? 567  TYR B CE1   1 
ATOM   3497 C  CE2   . TYR A 1 504 ? -31.897 2.837   14.108  1.00 32.95  ? 567  TYR B CE2   1 
ATOM   3498 C  CZ    . TYR A 1 504 ? -32.585 3.732   13.415  1.00 36.52  ? 567  TYR B CZ    1 
ATOM   3499 O  OH    . TYR A 1 504 ? -33.766 4.105   13.818  1.00 45.27  ? 567  TYR B OH    1 
ATOM   3500 N  N     . ASN A 1 505 ? -26.790 0.956   10.187  1.00 36.51  ? 568  ASN B N     1 
ATOM   3501 C  CA    . ASN A 1 505 ? -25.545 0.878   9.485   1.00 42.10  ? 568  ASN B CA    1 
ATOM   3502 C  C     . ASN A 1 505 ? -25.763 0.631   8.039   1.00 39.50  ? 568  ASN B C     1 
ATOM   3503 O  O     . ASN A 1 505 ? -24.985 1.019   7.257   1.00 32.44  ? 568  ASN B O     1 
ATOM   3504 C  CB    . ASN A 1 505 ? -24.660 -0.196  10.061  1.00 44.22  ? 568  ASN B CB    1 
ATOM   3505 C  CG    . ASN A 1 505 ? -23.381 -0.338  9.317   1.00 47.14  ? 568  ASN B CG    1 
ATOM   3506 O  OD1   . ASN A 1 505 ? -23.259 -1.190  8.458   1.00 54.04  ? 568  ASN B OD1   1 
ATOM   3507 N  ND2   . ASN A 1 505 ? -22.418 0.477   9.644   1.00 43.23  ? 568  ASN B ND2   1 
ATOM   3508 N  N     . MET A 1 506 ? -26.741 -0.161  7.687   1.00 39.00  ? 569  MET B N     1 
ATOM   3509 C  CA    . MET A 1 506 ? -27.042 -0.342  6.326   1.00 39.94  ? 569  MET B CA    1 
ATOM   3510 C  C     . MET A 1 506 ? -27.529 0.918   5.743   1.00 36.84  ? 569  MET B C     1 
ATOM   3511 O  O     . MET A 1 506 ? -27.161 1.283   4.700   1.00 33.93  ? 569  MET B O     1 
ATOM   3512 C  CB    . MET A 1 506 ? -28.163 -1.303  6.263   1.00 38.68  ? 569  MET B CB    1 
ATOM   3513 C  CG    . MET A 1 506 ? -27.983 -2.370  5.258   1.00 44.76  ? 569  MET B CG    1 
ATOM   3514 S  SD    . MET A 1 506 ? -29.579 -3.002  5.117   1.00 52.08  ? 569  MET B SD    1 
ATOM   3515 C  CE    . MET A 1 506 ? -30.296 -1.715  4.209   1.00 36.25  ? 569  MET B CE    1 
ATOM   3516 N  N     . VAL A 1 507 ? -28.417 1.573   6.435   1.00 35.40  ? 570  VAL B N     1 
ATOM   3517 C  CA    . VAL A 1 507 ? -28.936 2.811   5.971   1.00 35.89  ? 570  VAL B CA    1 
ATOM   3518 C  C     . VAL A 1 507 ? -27.958 3.918   5.899   1.00 38.42  ? 570  VAL B C     1 
ATOM   3519 O  O     . VAL A 1 507 ? -27.983 4.704   5.023   1.00 35.71  ? 570  VAL B O     1 
ATOM   3520 C  CB    . VAL A 1 507 ? -30.025 3.293   6.859   1.00 29.72  ? 570  VAL B CB    1 
ATOM   3521 C  CG1   . VAL A 1 507 ? -30.496 4.610   6.351   1.00 30.81  ? 570  VAL B CG1   1 
ATOM   3522 C  CG2   . VAL A 1 507 ? -31.135 2.306   6.844   1.00 31.74  ? 570  VAL B CG2   1 
ATOM   3523 N  N     . LEU A 1 508 ? -27.136 4.040   6.900   1.00 43.07  ? 571  LEU B N     1 
ATOM   3524 C  CA    . LEU A 1 508 ? -26.166 5.082   6.895   1.00 40.07  ? 571  LEU B CA    1 
ATOM   3525 C  C     . LEU A 1 508 ? -25.166 4.894   5.863   1.00 41.37  ? 571  LEU B C     1 
ATOM   3526 O  O     . LEU A 1 508 ? -24.824 5.787   5.193   1.00 43.13  ? 571  LEU B O     1 
ATOM   3527 C  CB    . LEU A 1 508 ? -25.467 5.148   8.206   1.00 33.29  ? 571  LEU B CB    1 
ATOM   3528 C  CG    . LEU A 1 508 ? -26.271 5.839   9.242   1.00 32.97  ? 571  LEU B CG    1 
ATOM   3529 C  CD1   . LEU A 1 508 ? -25.334 6.381   10.261  1.00 40.88  ? 571  LEU B CD1   1 
ATOM   3530 C  CD2   . LEU A 1 508 ? -27.000 6.966   8.618   1.00 31.55  ? 571  LEU B CD2   1 
ATOM   3531 N  N     . ASN A 1 509 ? -24.685 3.694   5.718   1.00 40.47  ? 572  ASN B N     1 
ATOM   3532 C  CA    . ASN A 1 509 ? -23.688 3.437   4.734   1.00 39.87  ? 572  ASN B CA    1 
ATOM   3533 C  C     . ASN A 1 509 ? -24.225 3.634   3.354   1.00 40.74  ? 572  ASN B C     1 
ATOM   3534 O  O     . ASN A 1 509 ? -23.546 4.090   2.520   1.00 35.49  ? 572  ASN B O     1 
ATOM   3535 C  CB    . ASN A 1 509 ? -23.039 2.110   4.958   1.00 39.38  ? 572  ASN B CB    1 
ATOM   3536 C  CG    . ASN A 1 509 ? -21.673 2.232   5.488   1.00 41.41  ? 572  ASN B CG    1 
ATOM   3537 O  OD1   . ASN A 1 509 ? -20.862 2.897   4.941   1.00 41.02  ? 572  ASN B OD1   1 
ATOM   3538 N  ND2   . ASN A 1 509 ? -21.414 1.584   6.533   1.00 40.14  ? 572  ASN B ND2   1 
ATOM   3539 N  N     . LEU A 1 510 ? -25.451 3.263   3.089   1.00 38.56  ? 573  LEU B N     1 
ATOM   3540 C  CA    . LEU A 1 510 ? -26.010 3.503   1.798   1.00 37.04  ? 573  LEU B CA    1 
ATOM   3541 C  C     . LEU A 1 510 ? -26.146 4.969   1.527   1.00 40.03  ? 573  LEU B C     1 
ATOM   3542 O  O     . LEU A 1 510 ? -26.048 5.362   0.430   1.00 44.49  ? 573  LEU B O     1 
ATOM   3543 C  CB    . LEU A 1 510 ? -27.276 2.733   1.613   1.00 40.48  ? 573  LEU B CB    1 
ATOM   3544 C  CG    . LEU A 1 510 ? -27.063 1.272   1.317   1.00 35.63  ? 573  LEU B CG    1 
ATOM   3545 C  CD1   . LEU A 1 510 ? -28.281 0.487   1.611   1.00 35.67  ? 573  LEU B CD1   1 
ATOM   3546 C  CD2   . LEU A 1 510 ? -26.673 1.032   -0.085  1.00 34.55  ? 573  LEU B CD2   1 
ATOM   3547 N  N     . LEU A 1 511 ? -26.469 5.789   2.507   1.00 39.39  ? 574  LEU B N     1 
ATOM   3548 C  CA    . LEU A 1 511 ? -26.531 7.215   2.311   1.00 38.86  ? 574  LEU B CA    1 
ATOM   3549 C  C     . LEU A 1 511 ? -25.192 7.782   1.982   1.00 41.91  ? 574  LEU B C     1 
ATOM   3550 O  O     . LEU A 1 511 ? -25.116 8.739   1.269   1.00 40.81  ? 574  LEU B O     1 
ATOM   3551 C  CB    . LEU A 1 511 ? -27.039 7.888   3.529   1.00 37.00  ? 574  LEU B CB    1 
ATOM   3552 C  CG    . LEU A 1 511 ? -28.477 7.613   3.757   1.00 39.13  ? 574  LEU B CG    1 
ATOM   3553 C  CD1   . LEU A 1 511 ? -28.918 8.569   4.803   1.00 40.72  ? 574  LEU B CD1   1 
ATOM   3554 C  CD2   . LEU A 1 511 ? -29.240 7.842   2.505   1.00 39.34  ? 574  LEU B CD2   1 
ATOM   3555 N  N     . ARG A 1 512 ? -24.167 7.256   2.627   1.00 47.23  ? 575  ARG B N     1 
ATOM   3556 C  CA    . ARG A 1 512 ? -22.787 7.637   2.433   1.00 45.67  ? 575  ARG B CA    1 
ATOM   3557 C  C     . ARG A 1 512 ? -22.311 7.309   1.030   1.00 47.91  ? 575  ARG B C     1 
ATOM   3558 O  O     . ARG A 1 512 ? -21.637 8.083   0.412   1.00 53.11  ? 575  ARG B O     1 
ATOM   3559 C  CB    . ARG A 1 512 ? -21.932 6.852   3.397   1.00 41.43  ? 575  ARG B CB    1 
ATOM   3560 C  CG    . ARG A 1 512 ? -20.844 7.602   4.068   1.00 47.00  ? 575  ARG B CG    1 
ATOM   3561 C  CD    . ARG A 1 512 ? -19.495 6.937   3.983   1.00 50.15  ? 575  ARG B CD    1 
ATOM   3562 N  NE    . ARG A 1 512 ? -19.483 5.502   3.804   1.00 51.98  ? 575  ARG B NE    1 
ATOM   3563 C  CZ    . ARG A 1 512 ? -18.927 4.890   2.782   1.00 52.04  ? 575  ARG B CZ    1 
ATOM   3564 N  NH1   . ARG A 1 512 ? -18.370 5.576   1.823   1.00 50.76  ? 575  ARG B NH1   1 
ATOM   3565 N  NH2   . ARG A 1 512 ? -18.947 3.590   2.717   1.00 45.42  ? 575  ARG B NH2   1 
ATOM   3566 N  N     . VAL A 1 513 ? -22.647 6.151   0.514   1.00 38.76  ? 576  VAL B N     1 
ATOM   3567 C  CA    . VAL A 1 513 ? -22.166 5.796   -0.791  1.00 39.01  ? 576  VAL B CA    1 
ATOM   3568 C  C     . VAL A 1 513 ? -22.859 6.587   -1.846  1.00 48.25  ? 576  VAL B C     1 
ATOM   3569 O  O     . VAL A 1 513 ? -24.021 6.830   -1.780  1.00 48.32  ? 576  VAL B O     1 
ATOM   3570 C  CB    . VAL A 1 513 ? -22.145 4.299   -1.049  1.00 43.59  ? 576  VAL B CB    1 
ATOM   3571 C  CG1   . VAL A 1 513 ? -22.227 3.568   0.256   1.00 45.47  ? 576  VAL B CG1   1 
ATOM   3572 C  CG2   . VAL A 1 513 ? -23.258 3.879   -1.964  1.00 45.35  ? 576  VAL B CG2   1 
ATOM   3573 N  N     . GLU A 1 514 ? -22.085 6.936   -2.845  1.00 46.07  ? 577  GLU B N     1 
ATOM   3574 C  CA    . GLU A 1 514 ? -22.466 7.825   -3.895  1.00 51.31  ? 577  GLU B CA    1 
ATOM   3575 C  C     . GLU A 1 514 ? -23.549 7.596   -4.896  1.00 54.20  ? 577  GLU B C     1 
ATOM   3576 O  O     . GLU A 1 514 ? -24.285 8.508   -5.197  1.00 63.60  ? 577  GLU B O     1 
ATOM   3577 C  CB    . GLU A 1 514 ? -21.210 8.197   -4.663  1.00 51.90  ? 577  GLU B CB    1 
ATOM   3578 C  CG    . GLU A 1 514 ? -20.716 9.614   -4.482  1.00 55.59  ? 577  GLU B CG    1 
ATOM   3579 C  CD    . GLU A 1 514 ? -19.635 9.967   -5.466  1.00 65.72  ? 577  GLU B CD    1 
ATOM   3580 O  OE1   . GLU A 1 514 ? -18.852 10.879  -5.209  1.00 74.32  ? 577  GLU B OE1   1 
ATOM   3581 O  OE2   . GLU A 1 514 ? -19.555 9.328   -6.510  1.00 63.29  ? 577  GLU B OE2   1 
ATOM   3582 N  N     . GLU A 1 515 ? -23.654 6.422   -5.447  1.00 44.89  ? 578  GLU B N     1 
ATOM   3583 C  CA    . GLU A 1 515 ? -24.633 6.248   -6.476  1.00 48.07  ? 578  GLU B CA    1 
ATOM   3584 C  C     . GLU A 1 515 ? -25.738 5.346   -6.135  1.00 46.80  ? 578  GLU B C     1 
ATOM   3585 O  O     . GLU A 1 515 ? -26.453 4.936   -6.988  1.00 40.89  ? 578  GLU B O     1 
ATOM   3586 C  CB    . GLU A 1 515 ? -23.962 5.794   -7.752  1.00 50.26  ? 578  GLU B CB    1 
ATOM   3587 N  N     . ILE A 1 516 ? -25.857 5.044   -4.862  1.00 48.98  ? 579  ILE B N     1 
ATOM   3588 C  CA    . ILE A 1 516 ? -26.839 4.159   -4.307  1.00 45.11  ? 579  ILE B CA    1 
ATOM   3589 C  C     . ILE A 1 516 ? -27.514 4.871   -3.160  1.00 44.83  ? 579  ILE B C     1 
ATOM   3590 O  O     . ILE A 1 516 ? -26.981 5.792   -2.587  1.00 39.79  ? 579  ILE B O     1 
ATOM   3591 C  CB    . ILE A 1 516 ? -26.111 2.932   -3.733  1.00 46.54  ? 579  ILE B CB    1 
ATOM   3592 C  CG1   . ILE A 1 516 ? -25.340 2.250   -4.803  1.00 52.24  ? 579  ILE B CG1   1 
ATOM   3593 C  CG2   . ILE A 1 516 ? -27.002 1.773   -3.432  1.00 42.43  ? 579  ILE B CG2   1 
ATOM   3594 C  CD1   . ILE A 1 516 ? -26.214 1.895   -5.970  1.00 51.73  ? 579  ILE B CD1   1 
ATOM   3595 N  N     . ASN A 1 517 ? -28.719 4.451   -2.849  1.00 41.22  ? 580  ASN B N     1 
ATOM   3596 C  CA    . ASN A 1 517 ? -29.482 4.938   -1.724  1.00 41.13  ? 580  ASN B CA    1 
ATOM   3597 C  C     . ASN A 1 517 ? -29.991 3.757   -0.919  1.00 39.68  ? 580  ASN B C     1 
ATOM   3598 O  O     . ASN A 1 517 ? -29.727 2.657   -1.236  1.00 36.65  ? 580  ASN B O     1 
ATOM   3599 C  CB    . ASN A 1 517 ? -30.591 5.859   -2.169  1.00 31.66  ? 580  ASN B CB    1 
ATOM   3600 C  CG    . ASN A 1 517 ? -31.371 5.300   -3.264  1.00 38.97  ? 580  ASN B CG    1 
ATOM   3601 O  OD1   . ASN A 1 517 ? -31.888 4.254   -3.145  1.00 44.07  ? 580  ASN B OD1   1 
ATOM   3602 N  ND2   . ASN A 1 517 ? -31.456 5.982   -4.329  1.00 41.94  ? 580  ASN B ND2   1 
ATOM   3603 N  N     . PRO A 1 518 ? -30.576 3.986   0.233   1.00 36.80  ? 581  PRO B N     1 
ATOM   3604 C  CA    . PRO A 1 518 ? -31.128 2.952   1.078   1.00 35.47  ? 581  PRO B CA    1 
ATOM   3605 C  C     . PRO A 1 518 ? -32.290 2.248   0.480   1.00 33.94  ? 581  PRO B C     1 
ATOM   3606 O  O     . PRO A 1 518 ? -32.561 1.143   0.744   1.00 33.96  ? 581  PRO B O     1 
ATOM   3607 C  CB    . PRO A 1 518 ? -31.590 3.731   2.277   1.00 38.64  ? 581  PRO B CB    1 
ATOM   3608 C  CG    . PRO A 1 518 ? -30.743 4.893   2.301   1.00 35.67  ? 581  PRO B CG    1 
ATOM   3609 C  CD    . PRO A 1 518 ? -30.647 5.275   0.892   1.00 37.66  ? 581  PRO B CD    1 
ATOM   3610 N  N     . GLU A 1 519 ? -33.066 3.009   -0.218  1.00 33.71  ? 582  GLU B N     1 
ATOM   3611 C  CA    . GLU A 1 519 ? -34.228 2.572   -0.891  1.00 33.11  ? 582  GLU B CA    1 
ATOM   3612 C  C     . GLU A 1 519 ? -33.926 1.600   -1.996  1.00 33.78  ? 582  GLU B C     1 
ATOM   3613 O  O     . GLU A 1 519 ? -34.674 0.731   -2.254  1.00 32.72  ? 582  GLU B O     1 
ATOM   3614 C  CB    . GLU A 1 519 ? -34.997 3.792   -1.334  1.00 28.82  ? 582  GLU B CB    1 
ATOM   3615 C  CG    . GLU A 1 519 ? -35.484 4.634   -0.184  1.00 39.61  ? 582  GLU B CG    1 
ATOM   3616 C  CD    . GLU A 1 519 ? -34.606 5.775   0.149   1.00 40.60  ? 582  GLU B CD    1 
ATOM   3617 O  OE1   . GLU A 1 519 ? -33.939 6.211   -0.717  1.00 42.18  ? 582  GLU B OE1   1 
ATOM   3618 O  OE2   . GLU A 1 519 ? -34.594 6.289   1.243   1.00 45.79  ? 582  GLU B OE2   1 
ATOM   3619 N  N     . TYR A 1 520 ? -32.823 1.778   -2.682  1.00 31.50  ? 583  TYR B N     1 
ATOM   3620 C  CA    . TYR A 1 520 ? -32.396 0.893   -3.738  1.00 30.32  ? 583  TYR B CA    1 
ATOM   3621 C  C     . TYR A 1 520 ? -32.129 -0.494  -3.293  1.00 35.71  ? 583  TYR B C     1 
ATOM   3622 O  O     . TYR A 1 520 ? -32.217 -1.384  -4.054  1.00 34.67  ? 583  TYR B O     1 
ATOM   3623 C  CB    . TYR A 1 520 ? -31.121 1.376   -4.360  1.00 33.09  ? 583  TYR B CB    1 
ATOM   3624 C  CG    . TYR A 1 520 ? -30.464 0.386   -5.292  1.00 35.06  ? 583  TYR B CG    1 
ATOM   3625 C  CD1   . TYR A 1 520 ? -30.958 0.162   -6.539  1.00 38.29  ? 583  TYR B CD1   1 
ATOM   3626 C  CD2   . TYR A 1 520 ? -29.342 -0.264  -4.947  1.00 31.07  ? 583  TYR B CD2   1 
ATOM   3627 C  CE1   . TYR A 1 520 ? -30.355 -0.702  -7.396  1.00 37.00  ? 583  TYR B CE1   1 
ATOM   3628 C  CE2   . TYR A 1 520 ? -28.756 -1.133  -5.806  1.00 38.33  ? 583  TYR B CE2   1 
ATOM   3629 C  CZ    . TYR A 1 520 ? -29.266 -1.339  -7.034  1.00 39.72  ? 583  TYR B CZ    1 
ATOM   3630 O  OH    . TYR A 1 520 ? -28.703 -2.192  -7.903  1.00 28.99  ? 583  TYR B OH    1 
ATOM   3631 N  N     . MET A 1 521 ? -31.603 -0.653  -2.113  1.00 38.47  ? 584  MET B N     1 
ATOM   3632 C  CA    . MET A 1 521 ? -31.345 -1.935  -1.536  1.00 33.65  ? 584  MET B CA    1 
ATOM   3633 C  C     . MET A 1 521 ? -32.625 -2.713  -1.289  1.00 32.19  ? 584  MET B C     1 
ATOM   3634 O  O     . MET A 1 521 ? -32.660 -3.880  -1.430  1.00 34.52  ? 584  MET B O     1 
ATOM   3635 C  CB    . MET A 1 521 ? -30.574 -1.692  -0.265  1.00 34.61  ? 584  MET B CB    1 
ATOM   3636 C  CG    . MET A 1 521 ? -30.212 -2.875  0.564   1.00 31.25  ? 584  MET B CG    1 
ATOM   3637 S  SD    . MET A 1 521 ? -28.764 -3.654  0.025   1.00 38.11  ? 584  MET B SD    1 
ATOM   3638 C  CE    . MET A 1 521 ? -28.132 -2.395  -0.964  1.00 32.34  ? 584  MET B CE    1 
ATOM   3639 N  N     . LEU A 1 522 ? -33.661 -2.045  -0.857  1.00 31.83  ? 585  LEU B N     1 
ATOM   3640 C  CA    . LEU A 1 522 ? -34.923 -2.646  -0.586  1.00 32.30  ? 585  LEU B CA    1 
ATOM   3641 C  C     . LEU A 1 522 ? -35.623 -3.170  -1.752  1.00 35.38  ? 585  LEU B C     1 
ATOM   3642 O  O     . LEU A 1 522 ? -36.188 -4.192  -1.723  1.00 33.46  ? 585  LEU B O     1 
ATOM   3643 C  CB    . LEU A 1 522 ? -35.812 -1.583  -0.055  1.00 32.93  ? 585  LEU B CB    1 
ATOM   3644 C  CG    . LEU A 1 522 ? -36.295 -1.662  1.350   1.00 34.20  ? 585  LEU B CG    1 
ATOM   3645 C  CD1   . LEU A 1 522 ? -35.236 -2.297  2.159   1.00 39.64  ? 585  LEU B CD1   1 
ATOM   3646 C  CD2   . LEU A 1 522 ? -36.577 -0.299  1.858   1.00 32.79  ? 585  LEU B CD2   1 
ATOM   3647 N  N     . GLU A 1 523 ? -35.597 -2.409  -2.803  1.00 40.07  ? 586  GLU B N     1 
ATOM   3648 C  CA    . GLU A 1 523 ? -36.235 -2.731  -4.023  1.00 35.53  ? 586  GLU B CA    1 
ATOM   3649 C  C     . GLU A 1 523 ? -35.651 -3.893  -4.694  1.00 33.78  ? 586  GLU B C     1 
ATOM   3650 O  O     . GLU A 1 523 ? -36.328 -4.633  -5.328  1.00 36.67  ? 586  GLU B O     1 
ATOM   3651 C  CB    . GLU A 1 523 ? -36.280 -1.524  -4.913  1.00 33.70  ? 586  GLU B CB    1 
ATOM   3652 C  CG    . GLU A 1 523 ? -37.140 -0.430  -4.352  1.00 39.76  ? 586  GLU B CG    1 
ATOM   3653 C  CD    . GLU A 1 523 ? -38.028 0.192   -5.386  1.00 46.66  ? 586  GLU B CD    1 
ATOM   3654 O  OE1   . GLU A 1 523 ? -38.799 1.079   -5.071  1.00 50.65  ? 586  GLU B OE1   1 
ATOM   3655 O  OE2   . GLU A 1 523 ? -37.963 -0.215  -6.523  1.00 43.38  ? 586  GLU B OE2   1 
ATOM   3656 N  N     . LYS A 1 524 ? -34.360 -4.030  -4.591  1.00 31.82  ? 587  LYS B N     1 
ATOM   3657 C  CA    . LYS A 1 524 ? -33.646 -5.070  -5.218  1.00 29.82  ? 587  LYS B CA    1 
ATOM   3658 C  C     . LYS A 1 524 ? -33.435 -6.196  -4.348  1.00 31.15  ? 587  LYS B C     1 
ATOM   3659 O  O     . LYS A 1 524 ? -32.695 -6.991  -4.683  1.00 38.57  ? 587  LYS B O     1 
ATOM   3660 C  CB    . LYS A 1 524 ? -32.301 -4.570  -5.628  1.00 26.11  ? 587  LYS B CB    1 
ATOM   3661 C  CG    . LYS A 1 524 ? -32.374 -3.455  -6.623  1.00 39.42  ? 587  LYS B CG    1 
ATOM   3662 C  CD    . LYS A 1 524 ? -32.527 -3.949  -8.033  1.00 39.81  ? 587  LYS B CD    1 
ATOM   3663 C  CE    . LYS A 1 524 ? -32.318 -2.894  -9.088  1.00 34.61  ? 587  LYS B CE    1 
ATOM   3664 N  NZ    . LYS A 1 524 ? -32.081 -3.539  -10.406 1.00 37.53  ? 587  LYS B NZ    1 
ATOM   3665 N  N     . SER A 1 525 ? -34.018 -6.251  -3.185  1.00 30.31  ? 588  SER B N     1 
ATOM   3666 C  CA    . SER A 1 525 ? -33.842 -7.368  -2.290  1.00 32.21  ? 588  SER B CA    1 
ATOM   3667 C  C     . SER A 1 525 ? -34.579 -8.609  -2.634  1.00 32.20  ? 588  SER B C     1 
ATOM   3668 O  O     . SER A 1 525 ? -35.415 -8.576  -3.464  1.00 32.99  ? 588  SER B O     1 
ATOM   3669 C  CB    . SER A 1 525 ? -34.204 -6.962  -0.911  1.00 30.48  ? 588  SER B CB    1 
ATOM   3670 O  OG    . SER A 1 525 ? -35.484 -6.490  -0.914  1.00 34.18  ? 588  SER B OG    1 
ATOM   3671 N  N     . PHE A 1 526 ? -34.121 -9.723  -2.080  1.00 33.39  ? 589  PHE B N     1 
ATOM   3672 C  CA    . PHE A 1 526 ? -34.727 -11.050 -2.185  1.00 29.52  ? 589  PHE B CA    1 
ATOM   3673 C  C     . PHE A 1 526 ? -36.019 -11.078 -1.458  1.00 31.58  ? 589  PHE B C     1 
ATOM   3674 O  O     . PHE A 1 526 ? -36.938 -11.656 -1.891  1.00 33.40  ? 589  PHE B O     1 
ATOM   3675 C  CB    . PHE A 1 526 ? -33.836 -12.107 -1.630  1.00 27.81  ? 589  PHE B CB    1 
ATOM   3676 C  CG    . PHE A 1 526 ? -34.238 -13.487 -1.952  1.00 31.84  ? 589  PHE B CG    1 
ATOM   3677 C  CD1   . PHE A 1 526 ? -34.828 -13.776 -3.114  1.00 28.83  ? 589  PHE B CD1   1 
ATOM   3678 C  CD2   . PHE A 1 526 ? -33.960 -14.497 -1.112  1.00 30.92  ? 589  PHE B CD2   1 
ATOM   3679 C  CE1   . PHE A 1 526 ? -35.158 -15.042 -3.431  1.00 27.53  ? 589  PHE B CE1   1 
ATOM   3680 C  CE2   . PHE A 1 526 ? -34.298 -15.759 -1.415  1.00 31.36  ? 589  PHE B CE2   1 
ATOM   3681 C  CZ    . PHE A 1 526 ? -34.903 -16.033 -2.576  1.00 21.88  ? 589  PHE B CZ    1 
ATOM   3682 N  N     . TYR A 1 527 ? -36.108 -10.376 -0.352  1.00 34.81  ? 590  TYR B N     1 
ATOM   3683 C  CA    . TYR A 1 527 ? -37.300 -10.334 0.438   1.00 29.75  ? 590  TYR B CA    1 
ATOM   3684 C  C     . TYR A 1 527 ? -38.450 -9.801  -0.328  1.00 32.96  ? 590  TYR B C     1 
ATOM   3685 O  O     . TYR A 1 527 ? -39.544 -10.246 -0.159  1.00 33.12  ? 590  TYR B O     1 
ATOM   3686 C  CB    . TYR A 1 527 ? -37.076 -9.357  1.562   1.00 31.14  ? 590  TYR B CB    1 
ATOM   3687 C  CG    . TYR A 1 527 ? -38.094 -9.361  2.649   1.00 35.54  ? 590  TYR B CG    1 
ATOM   3688 C  CD1   . TYR A 1 527 ? -37.981 -10.225 3.687   1.00 46.03  ? 590  TYR B CD1   1 
ATOM   3689 C  CD2   . TYR A 1 527 ? -39.138 -8.499  2.650   1.00 29.29  ? 590  TYR B CD2   1 
ATOM   3690 C  CE1   . TYR A 1 527 ? -38.886 -10.249 4.695   1.00 42.36  ? 590  TYR B CE1   1 
ATOM   3691 C  CE2   . TYR A 1 527 ? -40.057 -8.522  3.649   1.00 31.14  ? 590  TYR B CE2   1 
ATOM   3692 C  CZ    . TYR A 1 527 ? -39.916 -9.409  4.662   1.00 40.34  ? 590  TYR B CZ    1 
ATOM   3693 O  OH    . TYR A 1 527 ? -40.785 -9.471  5.674   1.00 40.72  ? 590  TYR B OH    1 
ATOM   3694 N  N     . GLN A 1 528 ? -38.213 -8.751  -1.072  1.00 34.93  ? 591  GLN B N     1 
ATOM   3695 C  CA    . GLN A 1 528 ? -39.157 -8.154  -1.956  1.00 36.53  ? 591  GLN B CA    1 
ATOM   3696 C  C     . GLN A 1 528 ? -39.481 -9.080  -3.097  1.00 34.18  ? 591  GLN B C     1 
ATOM   3697 O  O     . GLN A 1 528 ? -40.578 -9.233  -3.483  1.00 32.63  ? 591  GLN B O     1 
ATOM   3698 C  CB    . GLN A 1 528 ? -38.533 -6.896  -2.476  1.00 38.91  ? 591  GLN B CB    1 
ATOM   3699 C  CG    . GLN A 1 528 ? -39.489 -5.874  -3.012  1.00 43.53  ? 591  GLN B CG    1 
ATOM   3700 C  CD    . GLN A 1 528 ? -40.631 -5.650  -2.118  1.00 44.38  ? 591  GLN B CD    1 
ATOM   3701 O  OE1   . GLN A 1 528 ? -40.476 -5.418  -0.962  1.00 38.10  ? 591  GLN B OE1   1 
ATOM   3702 N  NE2   . GLN A 1 528 ? -41.776 -5.724  -2.652  1.00 40.26  ? 591  GLN B NE2   1 
ATOM   3703 N  N     . PHE A 1 529 ? -38.489 -9.755  -3.605  1.00 32.39  ? 592  PHE B N     1 
ATOM   3704 C  CA    . PHE A 1 529 ? -38.690 -10.638 -4.690  1.00 30.29  ? 592  PHE B CA    1 
ATOM   3705 C  C     . PHE A 1 529 ? -39.584 -11.755 -4.328  1.00 34.29  ? 592  PHE B C     1 
ATOM   3706 O  O     . PHE A 1 529 ? -40.360 -12.170 -5.095  1.00 34.48  ? 592  PHE B O     1 
ATOM   3707 C  CB    . PHE A 1 529 ? -37.360 -11.185 -5.136  1.00 27.06  ? 592  PHE B CB    1 
ATOM   3708 C  CG    . PHE A 1 529 ? -37.409 -11.907 -6.425  1.00 29.94  ? 592  PHE B CG    1 
ATOM   3709 C  CD1   . PHE A 1 529 ? -37.896 -13.160 -6.492  1.00 31.61  ? 592  PHE B CD1   1 
ATOM   3710 C  CD2   . PHE A 1 529 ? -36.997 -11.319 -7.551  1.00 34.54  ? 592  PHE B CD2   1 
ATOM   3711 C  CE1   . PHE A 1 529 ? -37.964 -13.817 -7.660  1.00 29.05  ? 592  PHE B CE1   1 
ATOM   3712 C  CE2   . PHE A 1 529 ? -37.058 -11.970 -8.727  1.00 37.80  ? 592  PHE B CE2   1 
ATOM   3713 C  CZ    . PHE A 1 529 ? -37.550 -13.225 -8.782  1.00 30.64  ? 592  PHE B CZ    1 
ATOM   3714 N  N     . GLN A 1 530 ? -39.419 -12.309 -3.165  1.00 30.61  ? 593  GLN B N     1 
ATOM   3715 C  CA    . GLN A 1 530 ? -40.268 -13.357 -2.745  1.00 29.63  ? 593  GLN B CA    1 
ATOM   3716 C  C     . GLN A 1 530 ? -41.677 -12.929 -2.569  1.00 33.11  ? 593  GLN B C     1 
ATOM   3717 O  O     . GLN A 1 530 ? -42.519 -13.692 -2.788  1.00 37.14  ? 593  GLN B O     1 
ATOM   3718 C  CB    . GLN A 1 530 ? -39.742 -13.977 -1.504  1.00 27.79  ? 593  GLN B CB    1 
ATOM   3719 C  CG    . GLN A 1 530 ? -38.370 -14.525 -1.690  1.00 34.07  ? 593  GLN B CG    1 
ATOM   3720 C  CD    . GLN A 1 530 ? -38.002 -15.650 -0.763  1.00 40.08  ? 593  GLN B CD    1 
ATOM   3721 O  OE1   . GLN A 1 530 ? -38.386 -16.768 -0.954  1.00 37.69  ? 593  GLN B OE1   1 
ATOM   3722 N  NE2   . GLN A 1 530 ? -37.217 -15.353 0.209   1.00 37.17  ? 593  GLN B NE2   1 
ATOM   3723 N  N     . HIS A 1 531 ? -41.933 -11.740 -2.052  1.00 36.82  ? 594  HIS B N     1 
ATOM   3724 C  CA    . HIS A 1 531 ? -43.270 -11.211 -1.871  1.00 36.34  ? 594  HIS B CA    1 
ATOM   3725 C  C     . HIS A 1 531 ? -43.898 -11.024 -3.207  1.00 38.04  ? 594  HIS B C     1 
ATOM   3726 O  O     . HIS A 1 531 ? -45.009 -11.400 -3.413  1.00 37.21  ? 594  HIS B O     1 
ATOM   3727 C  CB    . HIS A 1 531 ? -43.208 -9.900  -1.067  1.00 35.53  ? 594  HIS B CB    1 
ATOM   3728 C  CG    . HIS A 1 531 ? -44.451 -9.063  -1.118  1.00 51.71  ? 594  HIS B CG    1 
ATOM   3729 N  ND1   . HIS A 1 531 ? -45.509 -9.256  -0.275  1.00 56.71  ? 594  HIS B ND1   1 
ATOM   3730 C  CD2   . HIS A 1 531 ? -44.799 -8.028  -1.909  1.00 51.51  ? 594  HIS B CD2   1 
ATOM   3731 C  CE1   . HIS A 1 531 ? -46.463 -8.402  -0.566  1.00 51.37  ? 594  HIS B CE1   1 
ATOM   3732 N  NE2   . HIS A 1 531 ? -46.056 -7.646  -1.555  1.00 44.09  ? 594  HIS B NE2   1 
ATOM   3733 N  N     . TYR A 1 532 ? -43.170 -10.482 -4.149  1.00 30.56  ? 595  TYR B N     1 
ATOM   3734 C  CA    . TYR A 1 532 ? -43.742 -10.328 -5.452  1.00 37.84  ? 595  TYR B CA    1 
ATOM   3735 C  C     . TYR A 1 532 ? -44.055 -11.635 -6.075  1.00 38.16  ? 595  TYR B C     1 
ATOM   3736 O  O     . TYR A 1 532 ? -45.046 -11.811 -6.655  1.00 41.80  ? 595  TYR B O     1 
ATOM   3737 C  CB    . TYR A 1 532 ? -42.813 -9.578  -6.393  1.00 37.10  ? 595  TYR B CB    1 
ATOM   3738 C  CG    . TYR A 1 532 ? -42.842 -8.125  -6.160  1.00 42.34  ? 595  TYR B CG    1 
ATOM   3739 C  CD1   . TYR A 1 532 ? -44.011 -7.499  -5.924  1.00 42.50  ? 595  TYR B CD1   1 
ATOM   3740 C  CD2   . TYR A 1 532 ? -41.700 -7.379  -6.165  1.00 46.77  ? 595  TYR B CD2   1 
ATOM   3741 C  CE1   . TYR A 1 532 ? -44.044 -6.171  -5.658  1.00 51.77  ? 595  TYR B CE1   1 
ATOM   3742 C  CE2   . TYR A 1 532 ? -41.723 -6.053  -5.899  1.00 41.42  ? 595  TYR B CE2   1 
ATOM   3743 C  CZ    . TYR A 1 532 ? -42.898 -5.469  -5.667  1.00 52.30  ? 595  TYR B CZ    1 
ATOM   3744 O  OH    . TYR A 1 532 ? -42.911 -4.160  -5.421  1.00 59.51  ? 595  TYR B OH    1 
ATOM   3745 N  N     . ARG A 1 533 ? -43.164 -12.563 -5.972  1.00 38.10  ? 596  ARG B N     1 
ATOM   3746 C  CA    . ARG A 1 533 ? -43.330 -13.839 -6.578  1.00 39.25  ? 596  ARG B CA    1 
ATOM   3747 C  C     . ARG A 1 533 ? -44.398 -14.706 -5.982  1.00 44.68  ? 596  ARG B C     1 
ATOM   3748 O  O     . ARG A 1 533 ? -44.945 -15.552 -6.639  1.00 46.91  ? 596  ARG B O     1 
ATOM   3749 C  CB    . ARG A 1 533 ? -42.010 -14.522 -6.614  1.00 36.31  ? 596  ARG B CB    1 
ATOM   3750 C  CG    . ARG A 1 533 ? -41.634 -14.962 -7.981  1.00 34.85  ? 596  ARG B CG    1 
ATOM   3751 C  CD    . ARG A 1 533 ? -41.660 -13.821 -8.944  1.00 28.95  ? 596  ARG B CD    1 
ATOM   3752 N  NE    . ARG A 1 533 ? -40.946 -14.032 -10.198 1.00 34.95  ? 596  ARG B NE    1 
ATOM   3753 C  CZ    . ARG A 1 533 ? -40.490 -15.165 -10.699 1.00 35.17  ? 596  ARG B CZ    1 
ATOM   3754 N  NH1   . ARG A 1 533 ? -40.625 -16.299 -10.108 1.00 29.91  ? 596  ARG B NH1   1 
ATOM   3755 N  NH2   . ARG A 1 533 ? -39.881 -15.146 -11.833 1.00 37.50  ? 596  ARG B NH2   1 
ATOM   3756 N  N     . ALA A 1 534 ? -44.634 -14.530 -4.698  1.00 46.81  ? 597  ALA B N     1 
ATOM   3757 C  CA    . ALA A 1 534 ? -45.620 -15.282 -3.959  1.00 45.21  ? 597  ALA B CA    1 
ATOM   3758 C  C     . ALA A 1 534 ? -47.026 -14.773 -4.075  1.00 46.84  ? 597  ALA B C     1 
ATOM   3759 O  O     . ALA A 1 534 ? -47.892 -15.357 -3.526  1.00 44.29  ? 597  ALA B O     1 
ATOM   3760 C  CB    . ALA A 1 534 ? -45.255 -15.324 -2.519  1.00 36.36  ? 597  ALA B CB    1 
ATOM   3761 N  N     . ILE A 1 535 ? -47.248 -13.683 -4.773  1.00 46.48  ? 598  ILE B N     1 
ATOM   3762 C  CA    . ILE A 1 535 ? -48.566 -13.090 -4.938  1.00 42.95  ? 598  ILE B CA    1 
ATOM   3763 C  C     . ILE A 1 535 ? -49.584 -13.906 -5.646  1.00 46.21  ? 598  ILE B C     1 
ATOM   3764 O  O     . ILE A 1 535 ? -50.719 -13.888 -5.297  1.00 45.81  ? 598  ILE B O     1 
ATOM   3765 C  CB    . ILE A 1 535 ? -48.491 -11.695 -5.523  1.00 44.13  ? 598  ILE B CB    1 
ATOM   3766 C  CG1   . ILE A 1 535 ? -48.609 -10.695 -4.395  1.00 48.94  ? 598  ILE B CG1   1 
ATOM   3767 C  CG2   . ILE A 1 535 ? -49.622 -11.421 -6.466  1.00 35.32  ? 598  ILE B CG2   1 
ATOM   3768 C  CD1   . ILE A 1 535 ? -48.116 -9.330  -4.754  1.00 48.38  ? 598  ILE B CD1   1 
ATOM   3769 N  N     . PRO A 1 536 ? -49.177 -14.651 -6.649  1.00 47.49  ? 599  PRO B N     1 
ATOM   3770 C  CA    . PRO A 1 536 ? -50.026 -15.530 -7.429  1.00 38.77  ? 599  PRO B CA    1 
ATOM   3771 C  C     . PRO A 1 536 ? -50.678 -16.584 -6.592  1.00 41.02  ? 599  PRO B C     1 
ATOM   3772 O  O     . PRO A 1 536 ? -51.715 -17.026 -6.932  1.00 44.31  ? 599  PRO B O     1 
ATOM   3773 C  CB    . PRO A 1 536 ? -49.037 -16.173 -8.348  1.00 28.20  ? 599  PRO B CB    1 
ATOM   3774 C  CG    . PRO A 1 536 ? -48.116 -15.093 -8.634  1.00 37.61  ? 599  PRO B CG    1 
ATOM   3775 C  CD    . PRO A 1 536 ? -47.916 -14.409 -7.335  1.00 42.75  ? 599  PRO B CD    1 
ATOM   3776 N  N     . GLY A 1 537 ? -49.939 -17.074 -5.611  1.00 40.21  ? 600  GLY B N     1 
ATOM   3777 C  CA    . GLY A 1 537 ? -50.407 -18.021 -4.624  1.00 38.41  ? 600  GLY B CA    1 
ATOM   3778 C  C     . GLY A 1 537 ? -51.437 -17.468 -3.682  1.00 41.37  ? 600  GLY B C     1 
ATOM   3779 O  O     . GLY A 1 537 ? -52.355 -18.150 -3.291  1.00 42.83  ? 600  GLY B O     1 
ATOM   3780 N  N     . VAL A 1 538 ? -51.247 -16.230 -3.267  1.00 45.96  ? 601  VAL B N     1 
ATOM   3781 C  CA    . VAL A 1 538 ? -52.188 -15.600 -2.367  1.00 45.38  ? 601  VAL B CA    1 
ATOM   3782 C  C     . VAL A 1 538 ? -53.537 -15.430 -3.023  1.00 45.60  ? 601  VAL B C     1 
ATOM   3783 O  O     . VAL A 1 538 ? -54.562 -15.591 -2.388  1.00 45.39  ? 601  VAL B O     1 
ATOM   3784 C  CB    . VAL A 1 538 ? -51.684 -14.257 -1.849  1.00 44.26  ? 601  VAL B CB    1 
ATOM   3785 C  CG1   . VAL A 1 538 ? -52.734 -13.638 -0.953  1.00 43.29  ? 601  VAL B CG1   1 
ATOM   3786 C  CG2   . VAL A 1 538 ? -50.403 -14.464 -1.069  1.00 51.28  ? 601  VAL B CG2   1 
ATOM   3787 N  N     . VAL A 1 539 ? -53.526 -15.075 -4.296  1.00 39.38  ? 602  VAL B N     1 
ATOM   3788 C  CA    . VAL A 1 539 ? -54.749 -14.977 -5.058  1.00 39.43  ? 602  VAL B CA    1 
ATOM   3789 C  C     . VAL A 1 539 ? -55.403 -16.331 -5.169  1.00 38.14  ? 602  VAL B C     1 
ATOM   3790 O  O     . VAL A 1 539 ? -56.601 -16.442 -5.073  1.00 39.91  ? 602  VAL B O     1 
ATOM   3791 C  CB    . VAL A 1 539 ? -54.494 -14.445 -6.469  1.00 45.08  ? 602  VAL B CB    1 
ATOM   3792 C  CG1   . VAL A 1 539 ? -55.796 -14.355 -7.237  1.00 34.95  ? 602  VAL B CG1   1 
ATOM   3793 C  CG2   . VAL A 1 539 ? -53.820 -13.095 -6.408  1.00 37.55  ? 602  VAL B CG2   1 
ATOM   3794 N  N     . GLU A 1 540 ? -54.603 -17.361 -5.384  1.00 38.01  ? 603  GLU B N     1 
ATOM   3795 C  CA    . GLU A 1 540 ? -55.111 -18.692 -5.550  1.00 36.12  ? 603  GLU B CA    1 
ATOM   3796 C  C     . GLU A 1 540 ? -55.675 -19.193 -4.299  1.00 39.65  ? 603  GLU B C     1 
ATOM   3797 O  O     . GLU A 1 540 ? -56.579 -19.939 -4.321  1.00 44.97  ? 603  GLU B O     1 
ATOM   3798 C  CB    . GLU A 1 540 ? -54.051 -19.627 -6.072  1.00 32.80  ? 603  GLU B CB    1 
ATOM   3799 N  N     . LYS A 1 541 ? -55.052 -18.877 -3.187  1.00 43.51  ? 604  LYS B N     1 
ATOM   3800 C  CA    . LYS A 1 541 ? -55.534 -19.259 -1.882  1.00 41.36  ? 604  LYS B CA    1 
ATOM   3801 C  C     . LYS A 1 541 ? -56.824 -18.600 -1.597  1.00 43.00  ? 604  LYS B C     1 
ATOM   3802 O  O     . LYS A 1 541 ? -57.600 -19.153 -0.937  1.00 47.61  ? 604  LYS B O     1 
ATOM   3803 C  CB    . LYS A 1 541 ? -54.543 -18.915 -0.785  1.00 34.85  ? 604  LYS B CB    1 
ATOM   3804 N  N     . VAL A 1 542 ? -57.015 -17.365 -1.985  1.00 39.26  ? 605  VAL B N     1 
ATOM   3805 C  CA    . VAL A 1 542 ? -58.273 -16.730 -1.741  1.00 38.85  ? 605  VAL B CA    1 
ATOM   3806 C  C     . VAL A 1 542 ? -59.408 -17.401 -2.465  1.00 42.97  ? 605  VAL B C     1 
ATOM   3807 O  O     . VAL A 1 542 ? -60.389 -17.715 -1.882  1.00 45.16  ? 605  VAL B O     1 
ATOM   3808 C  CB    . VAL A 1 542 ? -58.257 -15.290 -2.232  1.00 43.85  ? 605  VAL B CB    1 
ATOM   3809 C  CG1   . VAL A 1 542 ? -59.572 -14.642 -1.955  1.00 43.30  ? 605  VAL B CG1   1 
ATOM   3810 C  CG2   . VAL A 1 542 ? -57.208 -14.474 -1.549  1.00 39.13  ? 605  VAL B CG2   1 
ATOM   3811 N  N     . LYS A 1 543 ? -59.243 -17.703 -3.730  1.00 46.94  ? 606  LYS B N     1 
ATOM   3812 C  CA    . LYS A 1 543 ? -60.292 -18.318 -4.493  1.00 46.69  ? 606  LYS B CA    1 
ATOM   3813 C  C     . LYS A 1 543 ? -60.648 -19.672 -3.995  1.00 40.75  ? 606  LYS B C     1 
ATOM   3814 C  CB    . LYS A 1 543 ? -59.882 -18.412 -5.940  1.00 40.00  ? 606  LYS B CB    1 
ATOM   3815 N  N     . ASN A 1 544 ? -59.628 -20.444 -3.683  1.00 37.84  ? 607  ASN B N     1 
ATOM   3816 C  CA    . ASN A 1 544 ? -59.822 -21.764 -3.177  1.00 40.97  ? 607  ASN B CA    1 
ATOM   3817 C  C     . ASN A 1 544 ? -60.475 -21.689 -1.840  1.00 43.95  ? 607  ASN B C     1 
ATOM   3818 O  O     . ASN A 1 544 ? -61.314 -22.455 -1.547  1.00 43.73  ? 607  ASN B O     1 
ATOM   3819 C  CB    . ASN A 1 544 ? -58.532 -22.553 -3.169  1.00 31.20  ? 607  ASN B CB    1 
ATOM   3820 N  N     . SER A 1 545 ? -60.079 -20.759 -1.004  1.00 44.34  ? 608  SER B N     1 
ATOM   3821 C  CA    . SER A 1 545 ? -60.722 -20.586 0.277   1.00 46.02  ? 608  SER B CA    1 
ATOM   3822 C  C     . SER A 1 545 ? -62.141 -20.113 0.070   1.00 45.97  ? 608  SER B C     1 
ATOM   3823 O  O     . SER A 1 545 ? -63.013 -20.491 0.779   1.00 48.24  ? 608  SER B O     1 
ATOM   3824 C  CB    . SER A 1 545 ? -59.962 -19.621 1.195   1.00 45.45  ? 608  SER B CB    1 
ATOM   3825 O  OG    . SER A 1 545 ? -59.045 -20.220 2.053   1.00 33.40  ? 608  SER B OG    1 
ATOM   3826 N  N     . GLU A 1 546 ? -62.379 -19.257 -0.893  1.00 44.81  ? 609  GLU B N     1 
ATOM   3827 C  CA    . GLU A 1 546 ? -63.710 -18.782 -1.124  1.00 45.03  ? 609  GLU B CA    1 
ATOM   3828 C  C     . GLU A 1 546 ? -64.656 -19.899 -1.497  1.00 49.73  ? 609  GLU B C     1 
ATOM   3829 O  O     . GLU A 1 546 ? -65.739 -19.949 -1.017  1.00 52.21  ? 609  GLU B O     1 
ATOM   3830 C  CB    . GLU A 1 546 ? -63.692 -17.718 -2.190  1.00 41.16  ? 609  GLU B CB    1 
ATOM   3831 C  CG    . GLU A 1 546 ? -63.299 -16.349 -1.703  1.00 44.62  ? 609  GLU B CG    1 
ATOM   3832 C  CD    . GLU A 1 546 ? -63.115 -15.371 -2.815  1.00 47.44  ? 609  GLU B CD    1 
ATOM   3833 O  OE1   . GLU A 1 546 ? -63.168 -15.800 -3.955  1.00 47.15  ? 609  GLU B OE1   1 
ATOM   3834 O  OE2   . GLU A 1 546 ? -62.928 -14.187 -2.560  1.00 39.80  ? 609  GLU B OE2   1 
ATOM   3835 N  N     . GLU A 1 547 ? -64.218 -20.831 -2.315  1.00 46.06  ? 610  GLU B N     1 
ATOM   3836 C  CA    . GLU A 1 547 ? -64.972 -21.991 -2.735  1.00 47.40  ? 610  GLU B CA    1 
ATOM   3837 C  C     . GLU A 1 547 ? -65.317 -22.887 -1.588  1.00 49.26  ? 610  GLU B C     1 
ATOM   3838 O  O     . GLU A 1 547 ? -66.304 -23.545 -1.575  1.00 54.37  ? 610  GLU B O     1 
ATOM   3839 C  CB    . GLU A 1 547 ? -64.092 -22.807 -3.620  1.00 49.05  ? 610  GLU B CB    1 
ATOM   3840 C  CG    . GLU A 1 547 ? -64.827 -23.488 -4.717  1.00 45.48  ? 610  GLU B CG    1 
ATOM   3841 C  CD    . GLU A 1 547 ? -65.572 -22.501 -5.520  1.00 58.41  ? 610  GLU B CD    1 
ATOM   3842 O  OE1   . GLU A 1 547 ? -65.328 -21.322 -5.395  1.00 56.57  ? 610  GLU B OE1   1 
ATOM   3843 O  OE2   . GLU A 1 547 ? -66.410 -22.904 -6.289  1.00 66.86  ? 610  GLU B OE2   1 
ATOM   3844 N  N     . GLN A 1 548 ? -64.392 -23.010 -0.675  1.00 53.32  ? 611  GLN B N     1 
ATOM   3845 C  CA    . GLN A 1 548 ? -64.522 -23.789 0.513   1.00 57.02  ? 611  GLN B CA    1 
ATOM   3846 C  C     . GLN A 1 548 ? -65.609 -23.284 1.393   1.00 61.37  ? 611  GLN B C     1 
ATOM   3847 O  O     . GLN A 1 548 ? -66.274 -24.042 2.007   1.00 63.48  ? 611  GLN B O     1 
ATOM   3848 C  CB    . GLN A 1 548 ? -63.243 -23.710 1.261   1.00 52.87  ? 611  GLN B CB    1 
ATOM   3849 C  CG    . GLN A 1 548 ? -62.261 -24.696 0.746   1.00 63.07  ? 611  GLN B CG    1 
ATOM   3850 C  CD    . GLN A 1 548 ? -62.829 -26.073 0.777   1.00 79.32  ? 611  GLN B CD    1 
ATOM   3851 O  OE1   . GLN A 1 548 ? -63.253 -26.546 1.816   1.00 91.82  ? 611  GLN B OE1   1 
ATOM   3852 N  NE2   . GLN A 1 548 ? -62.836 -26.731 -0.354  1.00 68.55  ? 611  GLN B NE2   1 
ATOM   3853 N  N     . TYR A 1 549 ? -65.747 -21.985 1.501   1.00 56.37  ? 612  TYR B N     1 
ATOM   3854 C  CA    . TYR A 1 549 ? -66.780 -21.378 2.278   1.00 51.90  ? 612  TYR B CA    1 
ATOM   3855 C  C     . TYR A 1 549 ? -68.081 -21.730 1.669   1.00 61.10  ? 612  TYR B C     1 
ATOM   3856 O  O     . TYR A 1 549 ? -69.001 -21.983 2.367   1.00 66.15  ? 612  TYR B O     1 
ATOM   3857 C  CB    . TYR A 1 549 ? -66.610 -19.894 2.137   1.00 52.85  ? 612  TYR B CB    1 
ATOM   3858 C  CG    . TYR A 1 549 ? -67.260 -18.985 3.113   1.00 53.78  ? 612  TYR B CG    1 
ATOM   3859 C  CD1   . TYR A 1 549 ? -67.114 -19.135 4.450   1.00 63.84  ? 612  TYR B CD1   1 
ATOM   3860 C  CD2   . TYR A 1 549 ? -67.941 -17.909 2.681   1.00 51.93  ? 612  TYR B CD2   1 
ATOM   3861 C  CE1   . TYR A 1 549 ? -67.692 -18.255 5.335   1.00 62.46  ? 612  TYR B CE1   1 
ATOM   3862 C  CE2   . TYR A 1 549 ? -68.507 -17.027 3.552   1.00 57.14  ? 612  TYR B CE2   1 
ATOM   3863 C  CZ    . TYR A 1 549 ? -68.375 -17.208 4.875   1.00 57.91  ? 612  TYR B CZ    1 
ATOM   3864 O  OH    . TYR A 1 549 ? -68.948 -16.319 5.706   1.00 53.67  ? 612  TYR B OH    1 
ATOM   3865 N  N     . ASN A 1 550 ? -68.200 -21.654 0.358   1.00 59.71  ? 613  ASN B N     1 
ATOM   3866 C  CA    . ASN A 1 550 ? -69.426 -22.005 -0.331  1.00 54.86  ? 613  ASN B CA    1 
ATOM   3867 C  C     . ASN A 1 550 ? -69.756 -23.451 -0.278  1.00 59.57  ? 613  ASN B C     1 
ATOM   3868 O  O     . ASN A 1 550 ? -70.881 -23.821 -0.136  1.00 61.91  ? 613  ASN B O     1 
ATOM   3869 C  CB    . ASN A 1 550 ? -69.364 -21.557 -1.753  1.00 51.91  ? 613  ASN B CB    1 
ATOM   3870 C  CG    . ASN A 1 550 ? -69.284 -20.095 -1.851  1.00 59.18  ? 613  ASN B CG    1 
ATOM   3871 O  OD1   . ASN A 1 550 ? -69.398 -19.426 -0.869  1.00 65.91  ? 613  ASN B OD1   1 
ATOM   3872 N  ND2   . ASN A 1 550 ? -69.085 -19.592 -3.023  1.00 61.57  ? 613  ASN B ND2   1 
ATOM   3873 N  N     . LYS A 1 551 ? -68.754 -24.298 -0.388  1.00 56.96  ? 614  LYS B N     1 
ATOM   3874 C  CA    . LYS A 1 551 ? -69.000 -25.714 -0.348  1.00 56.06  ? 614  LYS B CA    1 
ATOM   3875 C  C     . LYS A 1 551 ? -69.559 -26.072 0.975   1.00 59.02  ? 614  LYS B C     1 
ATOM   3876 O  O     . LYS A 1 551 ? -70.565 -26.694 1.046   1.00 58.21  ? 614  LYS B O     1 
ATOM   3877 C  CB    . LYS A 1 551 ? -67.723 -26.479 -0.589  1.00 51.43  ? 614  LYS B CB    1 
ATOM   3878 N  N     . ILE A 1 552 ? -69.001 -25.544 2.048   1.00 67.34  ? 615  ILE B N     1 
ATOM   3879 C  CA    . ILE A 1 552 ? -69.520 -25.818 3.369   1.00 71.07  ? 615  ILE B CA    1 
ATOM   3880 C  C     . ILE A 1 552 ? -70.589 -24.888 3.735   1.00 65.17  ? 615  ILE B C     1 
ATOM   3881 O  O     . ILE A 1 552 ? -71.029 -24.966 4.820   1.00 71.08  ? 615  ILE B O     1 
ATOM   3882 C  CB    . ILE A 1 552 ? -68.528 -25.729 4.563   1.00 62.47  ? 615  ILE B CB    1 
ATOM   3883 C  CG1   . ILE A 1 552 ? -68.012 -24.328 4.750   1.00 58.83  ? 615  ILE B CG1   1 
ATOM   3884 C  CG2   . ILE A 1 552 ? -67.426 -26.753 4.478   1.00 65.75  ? 615  ILE B CG2   1 
ATOM   3885 C  CD1   . ILE A 1 552 ? -68.927 -23.413 5.510   1.00 61.53  ? 615  ILE B CD1   1 
ATOM   3886 N  N     . VAL A 1 553 ? -71.078 -23.996 2.897   1.00 66.13  ? 616  VAL B N     1 
ATOM   3887 C  CA    . VAL A 1 553 ? -72.156 -23.099 3.299   1.00 68.49  ? 616  VAL B CA    1 
ATOM   3888 C  C     . VAL A 1 553 ? -73.493 -23.777 3.169   1.00 74.16  ? 616  VAL B C     1 
ATOM   3889 O  O     . VAL A 1 553 ? -74.284 -23.475 2.310   1.00 86.08  ? 616  VAL B O     1 
ATOM   3890 C  CB    . VAL A 1 553 ? -72.214 -21.848 2.417   1.00 64.57  ? 616  VAL B CB    1 
ATOM   3891 N  N     . ILE A 1 554 ? -73.730 -24.699 4.076   1.00 63.64  ? 617  ILE B N     1 
ATOM   3892 C  CA    . ILE A 1 554 ? -74.870 -25.479 4.136   1.00 64.01  ? 617  ILE B CA    1 
ATOM   3893 C  C     . ILE A 1 554 ? -75.075 -25.735 5.590   1.00 63.61  ? 617  ILE B C     1 
ATOM   3894 O  O     . ILE A 1 554 ? -75.292 -26.858 5.940   1.00 72.57  ? 617  ILE B O     1 
ATOM   3895 C  CB    . ILE A 1 554 ? -74.672 -26.788 3.379   1.00 64.90  ? 617  ILE B CB    1 
ATOM   3896 N  N     . PRO A 1 555 ? -74.877 -24.735 6.455   1.00 55.54  ? 618  PRO B N     1 
ATOM   3897 C  CA    . PRO A 1 555 ? -75.331 -25.026 7.786   1.00 62.11  ? 618  PRO B CA    1 
ATOM   3898 C  C     . PRO A 1 555 ? -76.816 -24.993 7.549   1.00 59.83  ? 618  PRO B C     1 
ATOM   3899 O  O     . PRO A 1 555 ? -77.352 -24.025 7.016   1.00 53.26  ? 618  PRO B O     1 
ATOM   3900 C  CB    . PRO A 1 555 ? -74.808 -23.855 8.561   1.00 61.59  ? 618  PRO B CB    1 
ATOM   3901 C  CG    . PRO A 1 555 ? -73.497 -23.668 7.958   1.00 58.17  ? 618  PRO B CG    1 
ATOM   3902 C  CD    . PRO A 1 555 ? -73.891 -23.661 6.522   1.00 62.99  ? 618  PRO B CD    1 
ATOM   3903 N  N     . ASN A 1 556 ? -77.505 -25.951 8.117   1.00 57.41  ? 619  ASN B N     1 
ATOM   3904 C  CA    . ASN A 1 556 ? -78.878 -26.133 7.789   1.00 55.66  ? 619  ASN B CA    1 
ATOM   3905 C  C     . ASN A 1 556 ? -79.808 -24.984 7.980   1.00 63.71  ? 619  ASN B C     1 
ATOM   3906 O  O     . ASN A 1 556 ? -80.628 -24.769 7.129   1.00 70.33  ? 619  ASN B O     1 
ATOM   3907 C  CB    . ASN A 1 556 ? -79.396 -27.342 8.506   1.00 61.20  ? 619  ASN B CB    1 
ATOM   3908 N  N     . GLU A 1 557 ? -79.714 -24.229 9.046   1.00 59.15  ? 620  GLU B N     1 
ATOM   3909 C  CA    . GLU A 1 557 ? -80.581 -23.083 9.158   1.00 57.80  ? 620  GLU B CA    1 
ATOM   3910 C  C     . GLU A 1 557 ? -79.612 -22.020 9.476   1.00 61.61  ? 620  GLU B C     1 
ATOM   3911 O  O     . GLU A 1 557 ? -78.961 -22.122 10.441  1.00 63.84  ? 620  GLU B O     1 
ATOM   3912 C  CB    . GLU A 1 557 ? -81.600 -23.264 10.257  1.00 50.29  ? 620  GLU B CB    1 
ATOM   3913 N  N     . GLU A 1 558 ? -79.635 -20.904 8.780   1.00 68.37  ? 621  GLU B N     1 
ATOM   3914 C  CA    . GLU A 1 558 ? -78.656 -19.823 8.917   1.00 54.86  ? 621  GLU B CA    1 
ATOM   3915 C  C     . GLU A 1 558 ? -78.567 -19.056 10.216  1.00 59.81  ? 621  GLU B C     1 
ATOM   3916 O  O     . GLU A 1 558 ? -77.693 -18.281 10.389  1.00 53.64  ? 621  GLU B O     1 
ATOM   3917 C  CB    . GLU A 1 558 ? -78.840 -18.844 7.791   1.00 63.53  ? 621  GLU B CB    1 
ATOM   3918 N  N     . SER A 1 559 ? -79.544 -19.236 11.089  1.00 69.94  ? 622  SER B N     1 
ATOM   3919 C  CA    . SER A 1 559 ? -79.661 -18.673 12.425  1.00 61.15  ? 622  SER B CA    1 
ATOM   3920 C  C     . SER A 1 559 ? -78.673 -19.245 13.419  1.00 61.15  ? 622  SER B C     1 
ATOM   3921 O  O     . SER A 1 559 ? -78.539 -18.706 14.470  1.00 63.72  ? 622  SER B O     1 
ATOM   3922 C  CB    . SER A 1 559 ? -81.063 -18.886 12.983  1.00 62.30  ? 622  SER B CB    1 
ATOM   3923 O  OG    . SER A 1 559 ? -81.149 -20.016 13.826  1.00 52.19  ? 622  SER B OG    1 
ATOM   3924 N  N     . VAL A 1 560 ? -77.966 -20.340 13.119  1.00 56.28  ? 623  VAL B N     1 
ATOM   3925 C  CA    . VAL A 1 560 ? -76.950 -20.905 14.016  1.00 53.69  ? 623  VAL B CA    1 
ATOM   3926 C  C     . VAL A 1 560 ? -75.766 -20.001 14.249  1.00 48.16  ? 623  VAL B C     1 
ATOM   3927 O  O     . VAL A 1 560 ? -75.138 -20.040 15.257  1.00 44.77  ? 623  VAL B O     1 
ATOM   3928 C  CB    . VAL A 1 560 ? -76.494 -22.300 13.655  1.00 52.11  ? 623  VAL B CB    1 
ATOM   3929 C  CG1   . VAL A 1 560 ? -76.316 -22.474 12.198  1.00 53.71  ? 623  VAL B CG1   1 
ATOM   3930 C  CG2   . VAL A 1 560 ? -75.183 -22.570 14.316  1.00 50.30  ? 623  VAL B CG2   1 
ATOM   3931 N  N     . VAL A 1 561 ? -75.501 -19.131 13.299  1.00 53.43  ? 624  VAL B N     1 
ATOM   3932 C  CA    . VAL A 1 561 ? -74.514 -18.122 13.371  1.00 49.39  ? 624  VAL B CA    1 
ATOM   3933 C  C     . VAL A 1 561 ? -74.836 -17.243 14.522  1.00 50.35  ? 624  VAL B C     1 
ATOM   3934 O  O     . VAL A 1 561 ? -73.942 -16.854 15.179  1.00 56.20  ? 624  VAL B O     1 
ATOM   3935 C  CB    . VAL A 1 561 ? -74.637 -17.247 12.158  1.00 48.17  ? 624  VAL B CB    1 
ATOM   3936 C  CG1   . VAL A 1 561 ? -74.079 -15.883 12.398  1.00 44.28  ? 624  VAL B CG1   1 
ATOM   3937 C  CG2   . VAL A 1 561 ? -73.974 -17.891 10.990  1.00 44.34  ? 624  VAL B CG2   1 
ATOM   3938 N  N     . ILE A 1 562 ? -76.092 -16.946 14.749  1.00 53.68  ? 625  ILE B N     1 
ATOM   3939 C  CA    . ILE A 1 562 ? -76.475 -16.164 15.897  1.00 58.00  ? 625  ILE B CA    1 
ATOM   3940 C  C     . ILE A 1 562 ? -76.255 -16.897 17.213  1.00 58.55  ? 625  ILE B C     1 
ATOM   3941 O  O     . ILE A 1 562 ? -75.944 -16.310 18.210  1.00 57.09  ? 625  ILE B O     1 
ATOM   3942 C  CB    . ILE A 1 562 ? -77.877 -15.638 15.769  1.00 54.07  ? 625  ILE B CB    1 
ATOM   3943 C  CG1   . ILE A 1 562 ? -77.834 -14.292 15.097  1.00 52.84  ? 625  ILE B CG1   1 
ATOM   3944 C  CG2   . ILE A 1 562 ? -78.442 -15.408 17.128  1.00 57.22  ? 625  ILE B CG2   1 
ATOM   3945 C  CD1   . ILE A 1 562 ? -77.522 -13.182 16.052  1.00 60.25  ? 625  ILE B CD1   1 
ATOM   3946 N  N     . TYR A 1 563 ? -76.511 -18.179 17.241  1.00 54.16  ? 626  TYR B N     1 
ATOM   3947 C  CA    . TYR A 1 563 ? -76.270 -18.919 18.448  1.00 58.86  ? 626  TYR B CA    1 
ATOM   3948 C  C     . TYR A 1 563 ? -74.806 -18.956 18.769  1.00 60.12  ? 626  TYR B C     1 
ATOM   3949 O  O     . TYR A 1 563 ? -74.402 -18.608 19.834  1.00 57.79  ? 626  TYR B O     1 
ATOM   3950 C  CB    . TYR A 1 563 ? -76.760 -20.322 18.276  1.00 57.32  ? 626  TYR B CB    1 
ATOM   3951 C  CG    . TYR A 1 563 ? -76.394 -21.224 19.391  1.00 58.62  ? 626  TYR B CG    1 
ATOM   3952 C  CD1   . TYR A 1 563 ? -77.146 -21.281 20.520  1.00 59.36  ? 626  TYR B CD1   1 
ATOM   3953 C  CD2   . TYR A 1 563 ? -75.313 -22.016 19.300  1.00 52.37  ? 626  TYR B CD2   1 
ATOM   3954 C  CE1   . TYR A 1 563 ? -76.820 -22.116 21.528  1.00 59.02  ? 626  TYR B CE1   1 
ATOM   3955 C  CE2   . TYR A 1 563 ? -74.989 -22.862 20.295  1.00 53.15  ? 626  TYR B CE2   1 
ATOM   3956 C  CZ    . TYR A 1 563 ? -75.746 -22.899 21.400  1.00 58.69  ? 626  TYR B CZ    1 
ATOM   3957 O  OH    . TYR A 1 563 ? -75.402 -23.747 22.378  1.00 63.32  ? 626  TYR B OH    1 
ATOM   3958 N  N     . TYR A 1 564 ? -73.981 -19.178 17.759  1.00 56.91  ? 627  TYR B N     1 
ATOM   3959 C  CA    . TYR A 1 564 ? -72.547 -19.272 17.881  1.00 53.09  ? 627  TYR B CA    1 
ATOM   3960 C  C     . TYR A 1 564 ? -72.021 -17.998 18.419  1.00 53.87  ? 627  TYR B C     1 
ATOM   3961 O  O     . TYR A 1 564 ? -71.226 -18.011 19.300  1.00 52.75  ? 627  TYR B O     1 
ATOM   3962 C  CB    . TYR A 1 564 ? -71.992 -19.559 16.505  1.00 48.14  ? 627  TYR B CB    1 
ATOM   3963 C  CG    . TYR A 1 564 ? -70.529 -19.421 16.316  1.00 48.86  ? 627  TYR B CG    1 
ATOM   3964 C  CD1   . TYR A 1 564 ? -69.956 -18.200 16.214  1.00 53.18  ? 627  TYR B CD1   1 
ATOM   3965 C  CD2   . TYR A 1 564 ? -69.739 -20.506 16.189  1.00 49.57  ? 627  TYR B CD2   1 
ATOM   3966 C  CE1   . TYR A 1 564 ? -68.620 -18.061 16.037  1.00 49.87  ? 627  TYR B CE1   1 
ATOM   3967 C  CE2   . TYR A 1 564 ? -68.404 -20.371 16.017  1.00 52.33  ? 627  TYR B CE2   1 
ATOM   3968 C  CZ    . TYR A 1 564 ? -67.864 -19.142 15.940  1.00 53.15  ? 627  TYR B CZ    1 
ATOM   3969 O  OH    . TYR A 1 564 ? -66.536 -18.994 15.764  1.00 61.18  ? 627  TYR B OH    1 
ATOM   3970 N  N     . LYS A 1 565 ? -72.528 -16.873 17.953  1.00 54.28  ? 628  LYS B N     1 
ATOM   3971 C  CA    . LYS A 1 565 ? -72.171 -15.606 18.472  1.00 53.95  ? 628  LYS B CA    1 
ATOM   3972 C  C     . LYS A 1 565 ? -72.574 -15.518 19.920  1.00 55.62  ? 628  LYS B C     1 
ATOM   3973 O  O     . LYS A 1 565 ? -71.861 -14.926 20.680  1.00 54.87  ? 628  LYS B O     1 
ATOM   3974 C  CB    . LYS A 1 565 ? -72.797 -14.517 17.645  1.00 49.78  ? 628  LYS B CB    1 
ATOM   3975 N  N     . ILE A 1 566 ? -73.718 -16.049 20.329  1.00 56.57  ? 629  ILE B N     1 
ATOM   3976 C  CA    . ILE A 1 566 ? -74.040 -16.004 21.743  1.00 63.68  ? 629  ILE B CA    1 
ATOM   3977 C  C     . ILE A 1 566 ? -73.051 -16.788 22.581  1.00 58.49  ? 629  ILE B C     1 
ATOM   3978 O  O     . ILE A 1 566 ? -72.604 -16.326 23.577  1.00 62.25  ? 629  ILE B O     1 
ATOM   3979 C  CB    . ILE A 1 566 ? -75.449 -16.523 22.038  1.00 58.91  ? 629  ILE B CB    1 
ATOM   3980 N  N     . ARG A 1 567 ? -72.685 -17.973 22.154  1.00 53.69  ? 630  ARG B N     1 
ATOM   3981 C  CA    . ARG A 1 567 ? -71.719 -18.760 22.864  1.00 48.03  ? 630  ARG B CA    1 
ATOM   3982 C  C     . ARG A 1 567 ? -70.367 -18.108 22.860  1.00 52.91  ? 630  ARG B C     1 
ATOM   3983 O  O     . ARG A 1 567 ? -69.629 -18.241 23.768  1.00 52.01  ? 630  ARG B O     1 
ATOM   3984 C  CB    . ARG A 1 567 ? -71.628 -20.125 22.266  1.00 44.90  ? 630  ARG B CB    1 
ATOM   3985 C  CG    . ARG A 1 567 ? -72.782 -20.972 22.622  1.00 44.53  ? 630  ARG B CG    1 
ATOM   3986 C  CD    . ARG A 1 567 ? -72.321 -22.377 22.833  1.00 47.44  ? 630  ARG B CD    1 
ATOM   3987 N  NE    . ARG A 1 567 ? -71.943 -22.582 24.200  1.00 55.76  ? 630  ARG B NE    1 
ATOM   3988 C  CZ    . ARG A 1 567 ? -71.985 -23.737 24.818  1.00 53.49  ? 630  ARG B CZ    1 
ATOM   3989 N  NH1   . ARG A 1 567 ? -72.375 -24.806 24.196  1.00 47.85  ? 630  ARG B NH1   1 
ATOM   3990 N  NH2   . ARG A 1 567 ? -71.616 -23.817 26.062  1.00 57.08  ? 630  ARG B NH2   1 
ATOM   3991 N  N     . GLN A 1 568 ? -69.994 -17.478 21.770  1.00 52.37  ? 631  GLN B N     1 
ATOM   3992 C  CA    . GLN A 1 568 ? -68.732 -16.769 21.695  1.00 52.27  ? 631  GLN B CA    1 
ATOM   3993 C  C     . GLN A 1 568 ? -68.704 -15.624 22.640  1.00 55.19  ? 631  GLN B C     1 
ATOM   3994 O  O     . GLN A 1 568 ? -67.723 -15.341 23.237  1.00 53.15  ? 631  GLN B O     1 
ATOM   3995 C  CB    . GLN A 1 568 ? -68.471 -16.268 20.301  1.00 53.07  ? 631  GLN B CB    1 
ATOM   3996 C  CG    . GLN A 1 568 ? -67.962 -17.334 19.376  1.00 58.28  ? 631  GLN B CG    1 
ATOM   3997 C  CD    . GLN A 1 568 ? -66.484 -17.308 19.224  1.00 65.19  ? 631  GLN B CD    1 
ATOM   3998 O  OE1   . GLN A 1 568 ? -65.829 -18.282 19.485  1.00 65.97  ? 631  GLN B OE1   1 
ATOM   3999 N  NE2   . GLN A 1 568 ? -65.955 -16.195 18.790  1.00 64.16  ? 631  GLN B NE2   1 
ATOM   4000 N  N     . GLN A 1 569 ? -69.801 -14.928 22.775  1.00 55.42  ? 632  GLN B N     1 
ATOM   4001 C  CA    . GLN A 1 569 ? -69.863 -13.868 23.726  1.00 56.53  ? 632  GLN B CA    1 
ATOM   4002 C  C     . GLN A 1 569 ? -69.703 -14.395 25.139  1.00 59.50  ? 632  GLN B C     1 
ATOM   4003 O  O     . GLN A 1 569 ? -69.037 -13.816 25.955  1.00 57.83  ? 632  GLN B O     1 
ATOM   4004 C  CB    . GLN A 1 569 ? -71.154 -13.124 23.578  1.00 56.77  ? 632  GLN B CB    1 
ATOM   4005 C  CG    . GLN A 1 569 ? -71.034 -11.980 22.615  1.00 59.82  ? 632  GLN B CG    1 
ATOM   4006 C  CD    . GLN A 1 569 ? -69.893 -11.092 22.969  1.00 62.16  ? 632  GLN B CD    1 
ATOM   4007 O  OE1   . GLN A 1 569 ? -69.530 -10.990 24.115  1.00 60.18  ? 632  GLN B OE1   1 
ATOM   4008 N  NE2   . GLN A 1 569 ? -69.326 -10.442 21.987  1.00 65.28  ? 632  GLN B NE2   1 
ATOM   4009 N  N     . LEU A 1 570 ? -70.293 -15.525 25.439  1.00 53.43  ? 633  LEU B N     1 
ATOM   4010 C  CA    . LEU A 1 570 ? -70.154 -16.078 26.741  1.00 57.81  ? 633  LEU B CA    1 
ATOM   4011 C  C     . LEU A 1 570 ? -68.734 -16.399 27.036  1.00 57.49  ? 633  LEU B C     1 
ATOM   4012 O  O     . LEU A 1 570 ? -68.257 -16.068 28.076  1.00 64.05  ? 633  LEU B O     1 
ATOM   4013 C  CB    . LEU A 1 570 ? -70.976 -17.339 26.846  1.00 57.63  ? 633  LEU B CB    1 
ATOM   4014 C  CG    . LEU A 1 570 ? -72.459 -17.182 27.077  1.00 59.48  ? 633  LEU B CG    1 
ATOM   4015 C  CD1   . LEU A 1 570 ? -73.087 -18.548 26.977  1.00 59.13  ? 633  LEU B CD1   1 
ATOM   4016 C  CD2   . LEU A 1 570 ? -72.725 -16.567 28.416  1.00 54.31  ? 633  LEU B CD2   1 
ATOM   4017 N  N     . ALA A 1 571 ? -68.013 -16.968 26.098  1.00 53.80  ? 634  ALA B N     1 
ATOM   4018 C  CA    . ALA A 1 571 ? -66.641 -17.275 26.339  1.00 51.93  ? 634  ALA B CA    1 
ATOM   4019 C  C     . ALA A 1 571 ? -65.838 -16.020 26.599  1.00 58.46  ? 634  ALA B C     1 
ATOM   4020 O  O     . ALA A 1 571 ? -65.005 -16.006 27.452  1.00 55.20  ? 634  ALA B O     1 
ATOM   4021 C  CB    . ALA A 1 571 ? -66.086 -18.037 25.174  1.00 40.33  ? 634  ALA B CB    1 
ATOM   4022 N  N     . LYS A 1 572 ? -66.094 -14.952 25.870  1.00 55.62  ? 635  LYS B N     1 
ATOM   4023 C  CA    . LYS A 1 572 ? -65.382 -13.728 26.073  1.00 52.22  ? 635  LYS B CA    1 
ATOM   4024 C  C     . LYS A 1 572 ? -65.632 -13.164 27.427  1.00 60.03  ? 635  LYS B C     1 
ATOM   4025 O  O     . LYS A 1 572 ? -64.788 -12.549 27.986  1.00 61.70  ? 635  LYS B O     1 
ATOM   4026 C  CB    . LYS A 1 572 ? -65.817 -12.721 25.042  1.00 46.18  ? 635  LYS B CB    1 
ATOM   4027 N  N     . LEU A 1 573 ? -66.862 -13.226 27.874  1.00 63.12  ? 636  LEU B N     1 
ATOM   4028 C  CA    . LEU A 1 573 ? -67.266 -12.767 29.189  1.00 62.11  ? 636  LEU B CA    1 
ATOM   4029 C  C     . LEU A 1 573 ? -66.764 -13.618 30.283  1.00 53.50  ? 636  LEU B C     1 
ATOM   4030 O  O     . LEU A 1 573 ? -66.449 -13.173 31.322  1.00 50.74  ? 636  LEU B O     1 
ATOM   4031 C  CB    . LEU A 1 573 ? -68.754 -12.653 29.254  1.00 58.21  ? 636  LEU B CB    1 
ATOM   4032 C  CG    . LEU A 1 573 ? -69.054 -11.368 28.562  1.00 58.89  ? 636  LEU B CG    1 
ATOM   4033 C  CD1   . LEU A 1 573 ? -70.540 -11.298 28.442  1.00 62.80  ? 636  LEU B CD1   1 
ATOM   4034 C  CD2   . LEU A 1 573 ? -68.546 -10.274 29.442  1.00 49.61  ? 636  LEU B CD2   1 
ATOM   4035 N  N     . GLY A 1 574 ? -66.711 -14.896 30.020  1.00 51.00  ? 637  GLY B N     1 
ATOM   4036 C  CA    . GLY A 1 574 ? -66.248 -15.879 30.961  1.00 53.67  ? 637  GLY B CA    1 
ATOM   4037 C  C     . GLY A 1 574 ? -64.825 -15.626 31.321  1.00 56.67  ? 637  GLY B C     1 
ATOM   4038 O  O     . GLY A 1 574 ? -64.465 -15.861 32.418  1.00 51.71  ? 637  GLY B O     1 
ATOM   4039 N  N     . LYS A 1 575 ? -64.002 -15.243 30.361  1.00 53.51  ? 638  LYS B N     1 
ATOM   4040 C  CA    . LYS A 1 575 ? -62.657 -14.840 30.582  1.00 47.97  ? 638  LYS B CA    1 
ATOM   4041 C  C     . LYS A 1 575 ? -62.631 -13.561 31.391  1.00 57.89  ? 638  LYS B C     1 
ATOM   4042 O  O     . LYS A 1 575 ? -61.728 -13.357 32.135  1.00 58.82  ? 638  LYS B O     1 
ATOM   4043 C  CB    . LYS A 1 575 ? -61.945 -14.674 29.270  1.00 42.63  ? 638  LYS B CB    1 
ATOM   4044 N  N     . GLU A 1 576 ? -63.569 -12.654 31.179  1.00 53.91  ? 639  GLU B N     1 
ATOM   4045 C  CA    . GLU A 1 576 ? -63.667 -11.429 31.946  1.00 50.67  ? 639  GLU B CA    1 
ATOM   4046 C  C     . GLU A 1 576 ? -63.957 -11.696 33.412  1.00 54.71  ? 639  GLU B C     1 
ATOM   4047 O  O     . GLU A 1 576 ? -63.585 -10.939 34.246  1.00 51.23  ? 639  GLU B O     1 
ATOM   4048 C  CB    . GLU A 1 576 ? -64.675 -10.486 31.325  1.00 54.28  ? 639  GLU B CB    1 
ATOM   4049 N  N     . ILE A 1 577 ? -64.742 -12.704 33.717  1.00 54.62  ? 640  ILE B N     1 
ATOM   4050 C  CA    . ILE A 1 577 ? -64.996 -13.060 35.095  1.00 55.93  ? 640  ILE B CA    1 
ATOM   4051 C  C     . ILE A 1 577 ? -63.742 -13.532 35.752  1.00 55.85  ? 640  ILE B C     1 
ATOM   4052 O  O     . ILE A 1 577 ? -63.416 -13.105 36.798  1.00 51.40  ? 640  ILE B O     1 
ATOM   4053 C  CB    . ILE A 1 577 ? -65.980 -14.226 35.220  1.00 51.13  ? 640  ILE B CB    1 
ATOM   4054 C  CG1   . ILE A 1 577 ? -67.343 -13.818 34.734  1.00 54.18  ? 640  ILE B CG1   1 
ATOM   4055 C  CG2   . ILE A 1 577 ? -66.106 -14.678 36.649  1.00 46.05  ? 640  ILE B CG2   1 
ATOM   4056 C  CD1   . ILE A 1 577 ? -68.471 -14.372 35.543  1.00 50.55  ? 640  ILE B CD1   1 
ATOM   4057 N  N     . GLU A 1 578 ? -63.002 -14.387 35.082  1.00 53.36  ? 641  GLU B N     1 
ATOM   4058 C  CA    . GLU A 1 578 ? -61.786 -14.981 35.570  1.00 47.03  ? 641  GLU B CA    1 
ATOM   4059 C  C     . GLU A 1 578 ? -60.750 -13.964 35.883  1.00 49.44  ? 641  GLU B C     1 
ATOM   4060 O  O     . GLU A 1 578 ? -59.963 -14.143 36.748  1.00 46.30  ? 641  GLU B O     1 
ATOM   4061 C  CB    . GLU A 1 578 ? -61.204 -15.897 34.515  1.00 47.50  ? 641  GLU B CB    1 
ATOM   4062 C  CG    . GLU A 1 578 ? -61.955 -17.173 34.231  1.00 48.27  ? 641  GLU B CG    1 
ATOM   4063 C  CD    . GLU A 1 578 ? -61.265 -18.023 33.205  1.00 51.70  ? 641  GLU B CD    1 
ATOM   4064 O  OE1   . GLU A 1 578 ? -60.182 -17.648 32.828  1.00 51.79  ? 641  GLU B OE1   1 
ATOM   4065 O  OE2   . GLU A 1 578 ? -61.786 -19.059 32.798  1.00 46.72  ? 641  GLU B OE2   1 
ATOM   4066 N  N     . GLU A 1 579 ? -60.695 -12.911 35.117  1.00 51.08  ? 642  GLU B N     1 
ATOM   4067 C  CA    . GLU A 1 579 ? -59.725 -11.877 35.312  1.00 48.35  ? 642  GLU B CA    1 
ATOM   4068 C  C     . GLU A 1 579 ? -59.886 -11.186 36.633  1.00 49.33  ? 642  GLU B C     1 
ATOM   4069 O  O     . GLU A 1 579 ? -58.968 -10.682 37.177  1.00 50.00  ? 642  GLU B O     1 
ATOM   4070 C  CB    . GLU A 1 579 ? -59.805 -10.901 34.157  1.00 47.01  ? 642  GLU B CB    1 
ATOM   4071 N  N     . TYR A 1 580 ? -61.096 -10.971 37.051  1.00 49.14  ? 643  TYR B N     1 
ATOM   4072 C  CA    . TYR A 1 580 ? -61.367 -10.422 38.337  1.00 44.80  ? 643  TYR B CA    1 
ATOM   4073 C  C     . TYR A 1 580 ? -61.017 -11.397 39.439  1.00 41.87  ? 643  TYR B C     1 
ATOM   4074 O  O     . TYR A 1 580 ? -60.545 -11.022 40.435  1.00 47.39  ? 643  TYR B O     1 
ATOM   4075 C  CB    . TYR A 1 580 ? -62.832 -10.039 38.409  1.00 49.70  ? 643  TYR B CB    1 
ATOM   4076 N  N     . ILE A 1 581 ? -61.274 -12.666 39.262  1.00 42.01  ? 644  ILE B N     1 
ATOM   4077 C  CA    . ILE A 1 581 ? -60.971 -13.670 40.280  1.00 45.55  ? 644  ILE B CA    1 
ATOM   4078 C  C     . ILE A 1 581 ? -59.497 -13.873 40.605  1.00 47.25  ? 644  ILE B C     1 
ATOM   4079 O  O     . ILE A 1 581 ? -59.173 -14.350 41.628  1.00 44.26  ? 644  ILE B O     1 
ATOM   4080 C  CB    . ILE A 1 581 ? -61.612 -15.022 39.965  1.00 44.77  ? 644  ILE B CB    1 
ATOM   4081 C  CG1   . ILE A 1 581 ? -63.079 -14.985 40.269  1.00 47.88  ? 644  ILE B CG1   1 
ATOM   4082 C  CG2   . ILE A 1 581 ? -61.011 -16.123 40.785  1.00 37.95  ? 644  ILE B CG2   1 
ATOM   4083 C  CD1   . ILE A 1 581 ? -63.756 -16.304 40.061  1.00 46.28  ? 644  ILE B CD1   1 
ATOM   4084 N  N     . HIS A 1 582 ? -58.619 -13.572 39.687  1.00 44.92  ? 645  HIS B N     1 
ATOM   4085 C  CA    . HIS A 1 582 ? -57.227 -13.707 39.932  1.00 36.30  ? 645  HIS B CA    1 
ATOM   4086 C  C     . HIS A 1 582 ? -56.512 -12.443 40.177  1.00 39.16  ? 645  HIS B C     1 
ATOM   4087 O  O     . HIS A 1 582 ? -55.367 -12.338 39.980  1.00 44.07  ? 645  HIS B O     1 
ATOM   4088 C  CB    . HIS A 1 582 ? -56.493 -14.626 38.982  1.00 42.33  ? 645  HIS B CB    1 
ATOM   4089 C  CG    . HIS A 1 582 ? -56.600 -14.276 37.535  1.00 49.11  ? 645  HIS B CG    1 
ATOM   4090 N  ND1   . HIS A 1 582 ? -56.328 -15.187 36.549  1.00 48.08  ? 645  HIS B ND1   1 
ATOM   4091 C  CD2   . HIS A 1 582 ? -56.910 -13.132 36.906  1.00 47.84  ? 645  HIS B CD2   1 
ATOM   4092 C  CE1   . HIS A 1 582 ? -56.476 -14.618 35.378  1.00 46.30  ? 645  HIS B CE1   1 
ATOM   4093 N  NE2   . HIS A 1 582 ? -56.835 -13.372 35.567  1.00 46.95  ? 645  HIS B NE2   1 
ATOM   4094 N  N     . LYS A 1 583 ? -57.238 -11.432 40.550  1.00 40.51  ? 646  LYS B N     1 
ATOM   4095 C  CA    . LYS A 1 583 ? -56.605 -10.227 40.970  1.00 38.11  ? 646  LYS B CA    1 
ATOM   4096 C  C     . LYS A 1 583 ? -56.083 -10.581 42.341  1.00 41.84  ? 646  LYS B C     1 
ATOM   4097 O  O     . LYS A 1 583 ? -56.758 -11.195 43.114  1.00 46.04  ? 646  LYS B O     1 
ATOM   4098 C  CB    . LYS A 1 583 ? -57.616 -9.112  41.034  1.00 31.38  ? 646  LYS B CB    1 
ATOM   4099 N  N     . PRO A 1 584 ? -54.929 -10.087 42.717  1.00 41.13  ? 647  PRO B N     1 
ATOM   4100 C  CA    . PRO A 1 584 ? -54.312 -10.461 43.973  1.00 38.70  ? 647  PRO B CA    1 
ATOM   4101 C  C     . PRO A 1 584 ? -55.123 -10.212 45.203  1.00 38.58  ? 647  PRO B C     1 
ATOM   4102 O  O     . PRO A 1 584 ? -55.043 -10.986 46.089  1.00 40.65  ? 647  PRO B O     1 
ATOM   4103 C  CB    . PRO A 1 584 ? -53.129 -9.549  44.026  1.00 36.63  ? 647  PRO B CB    1 
ATOM   4104 C  CG    . PRO A 1 584 ? -52.783 -9.350  42.656  1.00 40.23  ? 647  PRO B CG    1 
ATOM   4105 C  CD    . PRO A 1 584 ? -54.015 -9.333  41.877  1.00 40.73  ? 647  PRO B CD    1 
ATOM   4106 N  N     . LYS A 1 585 ? -55.868 -9.136  45.274  1.00 39.99  ? 648  LYS B N     1 
ATOM   4107 C  CA    . LYS A 1 585 ? -56.585 -8.860  46.470  1.00 40.42  ? 648  LYS B CA    1 
ATOM   4108 C  C     . LYS A 1 585 ? -57.569 -9.908  46.745  1.00 46.33  ? 648  LYS B C     1 
ATOM   4109 O  O     . LYS A 1 585 ? -57.653 -10.393 47.838  1.00 46.39  ? 648  LYS B O     1 
ATOM   4110 C  CB    . LYS A 1 585 ? -57.292 -7.537  46.344  1.00 35.97  ? 648  LYS B CB    1 
ATOM   4111 N  N     . TYR A 1 586 ? -58.327 -10.280 45.739  1.00 45.38  ? 649  TYR B N     1 
ATOM   4112 C  CA    . TYR A 1 586 ? -59.304 -11.334 45.891  1.00 47.59  ? 649  TYR B CA    1 
ATOM   4113 C  C     . TYR A 1 586 ? -58.793 -12.736 46.016  1.00 43.84  ? 649  TYR B C     1 
ATOM   4114 O  O     . TYR A 1 586 ? -59.349 -13.483 46.715  1.00 47.99  ? 649  TYR B O     1 
ATOM   4115 C  CB    . TYR A 1 586 ? -60.433 -11.227 44.875  1.00 50.42  ? 649  TYR B CB    1 
ATOM   4116 C  CG    . TYR A 1 586 ? -60.926 -9.857  44.736  1.00 46.47  ? 649  TYR B CG    1 
ATOM   4117 C  CD1   . TYR A 1 586 ? -61.544 -9.244  45.747  1.00 49.66  ? 649  TYR B CD1   1 
ATOM   4118 C  CD2   . TYR A 1 586 ? -60.747 -9.181  43.603  1.00 50.97  ? 649  TYR B CD2   1 
ATOM   4119 C  CE1   . TYR A 1 586 ? -61.972 -7.958  45.630  1.00 58.28  ? 649  TYR B CE1   1 
ATOM   4120 C  CE2   . TYR A 1 586 ? -61.181 -7.902  43.473  1.00 56.40  ? 649  TYR B CE2   1 
ATOM   4121 C  CZ    . TYR A 1 586 ? -61.789 -7.301  44.492  1.00 55.20  ? 649  TYR B CZ    1 
ATOM   4122 O  OH    . TYR A 1 586 ? -62.211 -6.027  44.335  1.00 51.65  ? 649  TYR B OH    1 
ATOM   4123 N  N     . CYS A 1 587 ? -57.770 -13.111 45.288  1.00 35.72  ? 650  CYS B N     1 
ATOM   4124 C  CA    . CYS A 1 587 ? -57.265 -14.460 45.405  1.00 40.55  ? 650  CYS B CA    1 
ATOM   4125 C  C     . CYS A 1 587 ? -56.298 -14.784 46.484  1.00 41.11  ? 650  CYS B C     1 
ATOM   4126 O  O     . CYS A 1 587 ? -56.260 -15.863 46.875  1.00 42.60  ? 650  CYS B O     1 
ATOM   4127 C  CB    . CYS A 1 587 ? -56.793 -15.043 44.083  1.00 39.33  ? 650  CYS B CB    1 
ATOM   4128 S  SG    . CYS A 1 587 ? -55.373 -14.276 43.359  1.00 36.49  ? 650  CYS B SG    1 
ATOM   4129 N  N     . LEU A 1 588 ? -55.574 -13.847 47.039  1.00 41.78  ? 651  LEU B N     1 
ATOM   4130 C  CA    . LEU A 1 588 ? -54.564 -14.144 48.053  1.00 41.81  ? 651  LEU B CA    1 
ATOM   4131 C  C     . LEU A 1 588 ? -55.049 -14.742 49.308  1.00 41.55  ? 651  LEU B C     1 
ATOM   4132 O  O     . LEU A 1 588 ? -54.387 -15.472 49.935  1.00 40.62  ? 651  LEU B O     1 
ATOM   4133 C  CB    . LEU A 1 588 ? -53.679 -12.974 48.338  1.00 38.32  ? 651  LEU B CB    1 
ATOM   4134 C  CG    . LEU A 1 588 ? -52.309 -13.235 47.798  1.00 37.38  ? 651  LEU B CG    1 
ATOM   4135 C  CD1   . LEU A 1 588 ? -52.369 -13.450 46.330  1.00 35.50  ? 651  LEU B CD1   1 
ATOM   4136 C  CD2   . LEU A 1 588 ? -51.465 -12.061 48.107  1.00 38.70  ? 651  LEU B CD2   1 
ATOM   4137 N  N     . PRO A 1 589 ? -56.237 -14.389 49.702  1.00 42.25  ? 652  PRO B N     1 
ATOM   4138 C  CA    . PRO A 1 589 ? -57.060 -14.822 50.792  1.00 42.55  ? 652  PRO B CA    1 
ATOM   4139 C  C     . PRO A 1 589 ? -57.399 -16.246 50.637  1.00 43.65  ? 652  PRO B C     1 
ATOM   4140 O  O     . PRO A 1 589 ? -57.642 -16.868 51.595  1.00 45.47  ? 652  PRO B O     1 
ATOM   4141 C  CB    . PRO A 1 589 ? -58.261 -14.004 50.598  1.00 40.15  ? 652  PRO B CB    1 
ATOM   4142 C  CG    . PRO A 1 589 ? -57.720 -12.723 50.173  1.00 44.13  ? 652  PRO B CG    1 
ATOM   4143 C  CD    . PRO A 1 589 ? -56.526 -13.007 49.371  1.00 42.95  ? 652  PRO B CD    1 
ATOM   4144 N  N     . PHE A 1 590 ? -57.551 -16.732 49.440  1.00 42.26  ? 653  PHE B N     1 
ATOM   4145 C  CA    . PHE A 1 590 ? -57.816 -18.099 49.231  1.00 45.00  ? 653  PHE B CA    1 
ATOM   4146 C  C     . PHE A 1 590 ? -56.654 -18.967 48.838  1.00 44.12  ? 653  PHE B C     1 
ATOM   4147 O  O     . PHE A 1 590 ? -56.839 -20.093 48.551  1.00 40.94  ? 653  PHE B O     1 
ATOM   4148 C  CB    . PHE A 1 590 ? -58.923 -18.184 48.240  1.00 41.28  ? 653  PHE B CB    1 
ATOM   4149 C  CG    . PHE A 1 590 ? -60.140 -17.546 48.722  1.00 40.50  ? 653  PHE B CG    1 
ATOM   4150 C  CD1   . PHE A 1 590 ? -60.294 -16.221 48.586  1.00 42.66  ? 653  PHE B CD1   1 
ATOM   4151 C  CD2   . PHE A 1 590 ? -61.085 -18.255 49.361  1.00 45.48  ? 653  PHE B CD2   1 
ATOM   4152 C  CE1   . PHE A 1 590 ? -61.399 -15.595 49.035  1.00 45.28  ? 653  PHE B CE1   1 
ATOM   4153 C  CE2   . PHE A 1 590 ? -62.194 -17.642 49.822  1.00 48.82  ? 653  PHE B CE2   1 
ATOM   4154 C  CZ    . PHE A 1 590 ? -62.345 -16.304 49.661  1.00 46.22  ? 653  PHE B CZ    1 
ATOM   4155 N  N     . LEU A 1 591 ? -55.444 -18.475 48.837  1.00 41.96  ? 654  LEU B N     1 
ATOM   4156 C  CA    . LEU A 1 591 ? -54.342 -19.295 48.423  1.00 37.23  ? 654  LEU B CA    1 
ATOM   4157 C  C     . LEU A 1 591 ? -53.825 -20.036 49.569  1.00 36.30  ? 654  LEU B C     1 
ATOM   4158 O  O     . LEU A 1 591 ? -52.823 -19.715 50.081  1.00 40.47  ? 654  LEU B O     1 
ATOM   4159 C  CB    . LEU A 1 591 ? -53.253 -18.459 47.803  1.00 36.75  ? 654  LEU B CB    1 
ATOM   4160 C  CG    . LEU A 1 591 ? -53.566 -17.595 46.609  1.00 34.15  ? 654  LEU B CG    1 
ATOM   4161 C  CD1   . LEU A 1 591 ? -52.368 -16.841 46.204  1.00 30.49  ? 654  LEU B CD1   1 
ATOM   4162 C  CD2   . LEU A 1 591 ? -54.048 -18.381 45.452  1.00 34.33  ? 654  LEU B CD2   1 
ATOM   4163 N  N     . GLN A 1 592 ? -54.491 -21.111 49.904  1.00 38.16  ? 655  GLN B N     1 
ATOM   4164 C  CA    . GLN A 1 592 ? -54.162 -21.914 51.025  1.00 40.13  ? 655  GLN B CA    1 
ATOM   4165 C  C     . GLN A 1 592 ? -53.777 -23.213 50.562  1.00 36.01  ? 655  GLN B C     1 
ATOM   4166 O  O     . GLN A 1 592 ? -54.410 -23.734 49.731  1.00 36.63  ? 655  GLN B O     1 
ATOM   4167 C  CB    . GLN A 1 592 ? -55.396 -22.129 51.824  1.00 43.31  ? 655  GLN B CB    1 
ATOM   4168 C  CG    . GLN A 1 592 ? -55.687 -21.060 52.827  1.00 51.40  ? 655  GLN B CG    1 
ATOM   4169 C  CD    . GLN A 1 592 ? -56.671 -20.122 52.309  1.00 50.56  ? 655  GLN B CD    1 
ATOM   4170 O  OE1   . GLN A 1 592 ? -57.493 -20.490 51.547  1.00 39.89  ? 655  GLN B OE1   1 
ATOM   4171 N  NE2   . GLN A 1 592 ? -56.560 -18.902 52.677  1.00 54.30  ? 655  GLN B NE2   1 
ATOM   4172 N  N     . PRO A 1 593 ? -52.759 -23.776 51.149  1.00 32.64  ? 656  PRO B N     1 
ATOM   4173 C  CA    . PRO A 1 593 ? -52.266 -25.051 50.742  1.00 34.58  ? 656  PRO B CA    1 
ATOM   4174 C  C     . PRO A 1 593 ? -53.299 -26.120 50.761  1.00 36.48  ? 656  PRO B C     1 
ATOM   4175 O  O     . PRO A 1 593 ? -53.987 -26.336 51.715  1.00 34.74  ? 656  PRO B O     1 
ATOM   4176 C  CB    . PRO A 1 593 ? -51.235 -25.314 51.783  1.00 33.88  ? 656  PRO B CB    1 
ATOM   4177 C  CG    . PRO A 1 593 ? -50.660 -24.011 51.997  1.00 32.31  ? 656  PRO B CG    1 
ATOM   4178 C  CD    . PRO A 1 593 ? -51.799 -23.104 52.001  1.00 34.01  ? 656  PRO B CD    1 
ATOM   4179 N  N     . GLY A 1 594 ? -53.334 -26.827 49.654  1.00 34.41  ? 657  GLY B N     1 
ATOM   4180 C  CA    . GLY A 1 594 ? -54.276 -27.866 49.410  1.00 35.04  ? 657  GLY B CA    1 
ATOM   4181 C  C     . GLY A 1 594 ? -55.516 -27.410 48.726  1.00 37.97  ? 657  GLY B C     1 
ATOM   4182 O  O     . GLY A 1 594 ? -56.440 -28.156 48.587  1.00 42.03  ? 657  GLY B O     1 
ATOM   4183 N  N     . ARG A 1 595 ? -55.577 -26.161 48.353  1.00 32.96  ? 658  ARG B N     1 
ATOM   4184 C  CA    . ARG A 1 595 ? -56.739 -25.717 47.653  1.00 37.65  ? 658  ARG B CA    1 
ATOM   4185 C  C     . ARG A 1 595 ? -56.589 -26.150 46.239  1.00 42.58  ? 658  ARG B C     1 
ATOM   4186 O  O     . ARG A 1 595 ? -55.512 -26.189 45.724  1.00 42.77  ? 658  ARG B O     1 
ATOM   4187 C  CB    . ARG A 1 595 ? -56.982 -24.237 47.773  1.00 36.77  ? 658  ARG B CB    1 
ATOM   4188 C  CG    . ARG A 1 595 ? -58.388 -23.891 47.406  1.00 34.23  ? 658  ARG B CG    1 
ATOM   4189 C  CD    . ARG A 1 595 ? -58.795 -22.480 47.703  1.00 40.13  ? 658  ARG B CD    1 
ATOM   4190 N  NE    . ARG A 1 595 ? -58.745 -22.079 49.104  1.00 49.74  ? 658  ARG B NE    1 
ATOM   4191 C  CZ    . ARG A 1 595 ? -59.708 -22.295 49.986  1.00 47.57  ? 658  ARG B CZ    1 
ATOM   4192 N  NH1   . ARG A 1 595 ? -60.802 -22.923 49.662  1.00 40.86  ? 658  ARG B NH1   1 
ATOM   4193 N  NH2   . ARG A 1 595 ? -59.578 -21.905 51.215  1.00 47.64  ? 658  ARG B NH2   1 
ATOM   4194 N  N     . LEU A 1 596 ? -57.689 -26.487 45.604  1.00 42.62  ? 659  LEU B N     1 
ATOM   4195 C  CA    . LEU A 1 596 ? -57.679 -26.950 44.258  1.00 43.17  ? 659  LEU B CA    1 
ATOM   4196 C  C     . LEU A 1 596 ? -57.819 -25.782 43.400  1.00 42.13  ? 659  LEU B C     1 
ATOM   4197 O  O     . LEU A 1 596 ? -58.681 -25.035 43.610  1.00 42.88  ? 659  LEU B O     1 
ATOM   4198 C  CB    . LEU A 1 596 ? -58.842 -27.885 44.056  1.00 43.88  ? 659  LEU B CB    1 
ATOM   4199 C  CG    . LEU A 1 596 ? -58.578 -29.267 44.596  1.00 43.59  ? 659  LEU B CG    1 
ATOM   4200 C  CD1   . LEU A 1 596 ? -59.812 -30.104 44.536  1.00 38.52  ? 659  LEU B CD1   1 
ATOM   4201 C  CD2   . LEU A 1 596 ? -57.472 -29.910 43.815  1.00 43.77  ? 659  LEU B CD2   1 
ATOM   4202 N  N     . VAL A 1 597 ? -56.977 -25.666 42.393  1.00 43.15  ? 660  VAL B N     1 
ATOM   4203 C  CA    . VAL A 1 597 ? -56.969 -24.530 41.500  1.00 38.86  ? 660  VAL B CA    1 
ATOM   4204 C  C     . VAL A 1 597 ? -56.684 -24.974 40.099  1.00 36.40  ? 660  VAL B C     1 
ATOM   4205 O  O     . VAL A 1 597 ? -56.098 -25.954 39.924  1.00 38.00  ? 660  VAL B O     1 
ATOM   4206 C  CB    . VAL A 1 597 ? -55.867 -23.591 41.983  1.00 39.44  ? 660  VAL B CB    1 
ATOM   4207 C  CG1   . VAL A 1 597 ? -54.572 -23.828 41.289  1.00 32.44  ? 660  VAL B CG1   1 
ATOM   4208 C  CG2   . VAL A 1 597 ? -56.270 -22.160 41.890  1.00 44.83  ? 660  VAL B CG2   1 
ATOM   4209 N  N     . LYS A 1 598 ? -57.130 -24.251 39.095  1.00 38.31  ? 661  LYS B N     1 
ATOM   4210 C  CA    . LYS A 1 598 ? -56.861 -24.580 37.702  1.00 37.37  ? 661  LYS B CA    1 
ATOM   4211 C  C     . LYS A 1 598 ? -55.882 -23.622 37.129  1.00 38.38  ? 661  LYS B C     1 
ATOM   4212 O  O     . LYS A 1 598 ? -56.026 -22.469 37.318  1.00 41.56  ? 661  LYS B O     1 
ATOM   4213 C  CB    . LYS A 1 598 ? -58.091 -24.473 36.844  1.00 34.35  ? 661  LYS B CB    1 
ATOM   4214 C  CG    . LYS A 1 598 ? -58.804 -25.747 36.617  1.00 38.94  ? 661  LYS B CG    1 
ATOM   4215 C  CD    . LYS A 1 598 ? -59.532 -25.746 35.324  1.00 43.31  ? 661  LYS B CD    1 
ATOM   4216 C  CE    . LYS A 1 598 ? -60.988 -25.519 35.510  1.00 54.41  ? 661  LYS B CE    1 
ATOM   4217 N  NZ    . LYS A 1 598 ? -61.774 -26.282 34.515  1.00 59.22  ? 661  LYS B NZ    1 
ATOM   4218 N  N     . VAL A 1 599 ? -54.873 -24.103 36.431  1.00 32.89  ? 662  VAL B N     1 
ATOM   4219 C  CA    . VAL A 1 599 ? -53.896 -23.232 35.822  1.00 33.07  ? 662  VAL B CA    1 
ATOM   4220 C  C     . VAL A 1 599 ? -53.883 -23.314 34.313  1.00 35.72  ? 662  VAL B C     1 
ATOM   4221 O  O     . VAL A 1 599 ? -53.747 -24.320 33.772  1.00 37.06  ? 662  VAL B O     1 
ATOM   4222 C  CB    . VAL A 1 599 ? -52.514 -23.528 36.345  1.00 32.20  ? 662  VAL B CB    1 
ATOM   4223 C  CG1   . VAL A 1 599 ? -51.516 -22.742 35.581  1.00 36.09  ? 662  VAL B CG1   1 
ATOM   4224 C  CG2   . VAL A 1 599 ? -52.425 -23.122 37.769  1.00 28.65  ? 662  VAL B CG2   1 
ATOM   4225 N  N     . LYS A 1 600 ? -54.057 -22.215 33.638  1.00 35.48  ? 663  LYS B N     1 
ATOM   4226 C  CA    . LYS A 1 600 ? -54.056 -22.196 32.205  1.00 33.91  ? 663  LYS B CA    1 
ATOM   4227 C  C     . LYS A 1 600 ? -53.156 -21.103 31.747  1.00 32.90  ? 663  LYS B C     1 
ATOM   4228 O  O     . LYS A 1 600 ? -53.313 -19.975 32.100  1.00 30.99  ? 663  LYS B O     1 
ATOM   4229 C  CB    . LYS A 1 600 ? -55.455 -21.969 31.701  1.00 36.37  ? 663  LYS B CB    1 
ATOM   4230 C  CG    . LYS A 1 600 ? -55.605 -21.847 30.218  1.00 39.01  ? 663  LYS B CG    1 
ATOM   4231 C  CD    . LYS A 1 600 ? -57.038 -21.553 29.943  1.00 39.22  ? 663  LYS B CD    1 
ATOM   4232 C  CE    . LYS A 1 600 ? -57.394 -21.725 28.504  1.00 50.44  ? 663  LYS B CE    1 
ATOM   4233 N  NZ    . LYS A 1 600 ? -58.858 -21.586 28.458  1.00 60.47  ? 663  LYS B NZ    1 
ATOM   4234 N  N     . ASN A 1 601 ? -52.230 -21.450 30.910  1.00 31.81  ? 664  ASN B N     1 
ATOM   4235 C  CA    . ASN A 1 601 ? -51.311 -20.479 30.476  1.00 39.43  ? 664  ASN B CA    1 
ATOM   4236 C  C     . ASN A 1 601 ? -51.153 -20.292 29.007  1.00 42.41  ? 664  ASN B C     1 
ATOM   4237 O  O     . ASN A 1 601 ? -50.373 -20.965 28.409  1.00 38.82  ? 664  ASN B O     1 
ATOM   4238 C  CB    . ASN A 1 601 ? -50.001 -20.892 31.017  1.00 38.30  ? 664  ASN B CB    1 
ATOM   4239 C  CG    . ASN A 1 601 ? -48.918 -20.036 30.551  1.00 45.36  ? 664  ASN B CG    1 
ATOM   4240 O  OD1   . ASN A 1 601 ? -49.120 -18.924 30.153  1.00 37.66  ? 664  ASN B OD1   1 
ATOM   4241 N  ND2   . ASN A 1 601 ? -47.744 -20.549 30.634  1.00 42.93  ? 664  ASN B ND2   1 
ATOM   4242 N  N     . GLU A 1 602 ? -51.875 -19.342 28.454  1.00 41.66  ? 665  GLU B N     1 
ATOM   4243 C  CA    . GLU A 1 602 ? -51.800 -19.011 27.069  1.00 36.75  ? 665  GLU B CA    1 
ATOM   4244 C  C     . GLU A 1 602 ? -51.927 -20.183 26.179  1.00 39.79  ? 665  GLU B C     1 
ATOM   4245 O  O     . GLU A 1 602 ? -51.060 -20.451 25.413  1.00 49.42  ? 665  GLU B O     1 
ATOM   4246 C  CB    . GLU A 1 602 ? -50.543 -18.229 26.739  1.00 36.82  ? 665  GLU B CB    1 
ATOM   4247 N  N     . GLY A 1 603 ? -52.955 -20.962 26.338  1.00 33.86  ? 666  GLY B N     1 
ATOM   4248 C  CA    . GLY A 1 603 ? -53.138 -22.076 25.454  1.00 33.27  ? 666  GLY B CA    1 
ATOM   4249 C  C     . GLY A 1 603 ? -52.751 -23.432 25.906  1.00 40.30  ? 666  GLY B C     1 
ATOM   4250 O  O     . GLY A 1 603 ? -53.234 -24.363 25.371  1.00 40.73  ? 666  GLY B O     1 
ATOM   4251 N  N     . ASP A 1 604 ? -51.873 -23.555 26.870  1.00 43.69  ? 667  ASP B N     1 
ATOM   4252 C  CA    . ASP A 1 604 ? -51.665 -24.844 27.414  1.00 34.16  ? 667  ASP B CA    1 
ATOM   4253 C  C     . ASP A 1 604 ? -52.127 -24.689 28.800  1.00 34.65  ? 667  ASP B C     1 
ATOM   4254 O  O     . ASP A 1 604 ? -51.689 -23.884 29.521  1.00 36.65  ? 667  ASP B O     1 
ATOM   4255 C  CB    . ASP A 1 604 ? -50.407 -25.657 27.044  1.00 34.29  ? 667  ASP B CB    1 
ATOM   4256 C  CG    . ASP A 1 604 ? -49.121 -24.982 27.288  1.00 40.82  ? 667  ASP B CG    1 
ATOM   4257 O  OD1   . ASP A 1 604 ? -49.004 -24.126 28.142  1.00 39.76  ? 667  ASP B OD1   1 
ATOM   4258 O  OD2   . ASP A 1 604 ? -48.170 -25.400 26.629  1.00 46.60  ? 667  ASP B OD2   1 
ATOM   4259 N  N     . ASP A 1 605 ? -53.136 -25.471 29.058  1.00 36.39  ? 668  ASP B N     1 
ATOM   4260 C  CA    . ASP A 1 605 ? -53.937 -25.527 30.216  1.00 36.39  ? 668  ASP B CA    1 
ATOM   4261 C  C     . ASP A 1 605 ? -53.609 -26.767 30.886  1.00 38.76  ? 668  ASP B C     1 
ATOM   4262 O  O     . ASP A 1 605 ? -53.533 -27.769 30.263  1.00 37.52  ? 668  ASP B O     1 
ATOM   4263 C  CB    . ASP A 1 605 ? -55.335 -25.588 29.686  1.00 35.43  ? 668  ASP B CB    1 
ATOM   4264 C  CG    . ASP A 1 605 ? -56.306 -26.074 30.648  1.00 47.60  ? 668  ASP B CG    1 
ATOM   4265 O  OD1   . ASP A 1 605 ? -56.053 -26.200 31.833  1.00 42.11  ? 668  ASP B OD1   1 
ATOM   4266 O  OD2   . ASP A 1 605 ? -57.399 -26.331 30.207  1.00 53.33  ? 668  ASP B OD2   1 
ATOM   4267 N  N     . PHE A 1 606 ? -53.400 -26.688 32.189  1.00 39.77  ? 669  PHE B N     1 
ATOM   4268 C  CA    . PHE A 1 606 ? -52.999 -27.833 32.976  1.00 36.43  ? 669  PHE B CA    1 
ATOM   4269 C  C     . PHE A 1 606 ? -54.034 -28.535 33.743  1.00 33.59  ? 669  PHE B C     1 
ATOM   4270 O  O     . PHE A 1 606 ? -53.767 -29.519 34.337  1.00 36.51  ? 669  PHE B O     1 
ATOM   4271 C  CB    . PHE A 1 606 ? -52.015 -27.418 33.999  1.00 25.55  ? 669  PHE B CB    1 
ATOM   4272 C  CG    . PHE A 1 606 ? -50.824 -26.824 33.449  1.00 27.04  ? 669  PHE B CG    1 
ATOM   4273 C  CD1   . PHE A 1 606 ? -50.862 -25.604 32.955  1.00 28.85  ? 669  PHE B CD1   1 
ATOM   4274 C  CD2   . PHE A 1 606 ? -49.670 -27.488 33.469  1.00 31.49  ? 669  PHE B CD2   1 
ATOM   4275 C  CE1   . PHE A 1 606 ? -49.759 -25.030 32.458  1.00 30.72  ? 669  PHE B CE1   1 
ATOM   4276 C  CE2   . PHE A 1 606 ? -48.554 -26.925 32.981  1.00 30.49  ? 669  PHE B CE2   1 
ATOM   4277 C  CZ    . PHE A 1 606 ? -48.601 -25.685 32.479  1.00 31.75  ? 669  PHE B CZ    1 
ATOM   4278 N  N     . GLY A 1 607 ? -55.235 -28.067 33.671  1.00 31.97  ? 670  GLY B N     1 
ATOM   4279 C  CA    . GLY A 1 607 ? -56.259 -28.667 34.450  1.00 34.66  ? 670  GLY B CA    1 
ATOM   4280 C  C     . GLY A 1 607 ? -56.182 -28.397 35.913  1.00 40.16  ? 670  GLY B C     1 
ATOM   4281 O  O     . GLY A 1 607 ? -56.010 -27.313 36.270  1.00 43.91  ? 670  GLY B O     1 
ATOM   4282 N  N     . TRP A 1 608 ? -56.303 -29.386 36.759  1.00 41.38  ? 671  TRP B N     1 
ATOM   4283 C  CA    . TRP A 1 608 ? -56.361 -29.127 38.153  1.00 35.47  ? 671  TRP B CA    1 
ATOM   4284 C  C     . TRP A 1 608 ? -55.093 -29.319 38.906  1.00 39.57  ? 671  TRP B C     1 
ATOM   4285 O  O     . TRP A 1 608 ? -54.403 -30.260 38.726  1.00 39.44  ? 671  TRP B O     1 
ATOM   4286 C  CB    . TRP A 1 608 ? -57.459 -29.971 38.740  1.00 34.25  ? 671  TRP B CB    1 
ATOM   4287 C  CG    . TRP A 1 608 ? -58.823 -29.518 38.417  1.00 40.34  ? 671  TRP B CG    1 
ATOM   4288 C  CD1   . TRP A 1 608 ? -59.661 -30.085 37.570  1.00 37.62  ? 671  TRP B CD1   1 
ATOM   4289 C  CD2   . TRP A 1 608 ? -59.515 -28.416 38.979  1.00 46.37  ? 671  TRP B CD2   1 
ATOM   4290 N  NE1   . TRP A 1 608 ? -60.833 -29.415 37.535  1.00 34.97  ? 671  TRP B NE1   1 
ATOM   4291 C  CE2   . TRP A 1 608 ? -60.762 -28.376 38.397  1.00 36.36  ? 671  TRP B CE2   1 
ATOM   4292 C  CE3   . TRP A 1 608 ? -59.196 -27.460 39.925  1.00 41.87  ? 671  TRP B CE3   1 
ATOM   4293 C  CZ2   . TRP A 1 608 ? -61.670 -27.435 38.709  1.00 41.88  ? 671  TRP B CZ2   1 
ATOM   4294 C  CZ3   . TRP A 1 608 ? -60.100 -26.529 40.219  1.00 42.55  ? 671  TRP B CZ3   1 
ATOM   4295 C  CH2   . TRP A 1 608 ? -61.310 -26.510 39.626  1.00 45.90  ? 671  TRP B CH2   1 
ATOM   4296 N  N     . GLY A 1 609 ? -54.797 -28.369 39.755  1.00 39.29  ? 672  GLY B N     1 
ATOM   4297 C  CA    . GLY A 1 609 ? -53.627 -28.375 40.581  1.00 34.95  ? 672  GLY B CA    1 
ATOM   4298 C  C     . GLY A 1 609 ? -53.982 -28.011 41.990  1.00 36.47  ? 672  GLY B C     1 
ATOM   4299 O  O     . GLY A 1 609 ? -55.047 -27.581 42.254  1.00 34.42  ? 672  GLY B O     1 
ATOM   4300 N  N     . VAL A 1 610 ? -53.059 -28.216 42.898  1.00 33.04  ? 673  VAL B N     1 
ATOM   4301 C  CA    . VAL A 1 610 ? -53.225 -27.945 44.295  1.00 31.18  ? 673  VAL B CA    1 
ATOM   4302 C  C     . VAL A 1 610 ? -52.244 -26.866 44.687  1.00 31.72  ? 673  VAL B C     1 
ATOM   4303 O  O     . VAL A 1 610 ? -51.149 -26.865 44.256  1.00 35.78  ? 673  VAL B O     1 
ATOM   4304 C  CB    . VAL A 1 610 ? -52.904 -29.213 45.046  1.00 35.78  ? 673  VAL B CB    1 
ATOM   4305 C  CG1   . VAL A 1 610 ? -51.426 -29.387 45.179  1.00 33.96  ? 673  VAL B CG1   1 
ATOM   4306 C  CG2   . VAL A 1 610 ? -53.534 -29.229 46.389  1.00 41.10  ? 673  VAL B CG2   1 
ATOM   4307 N  N     . VAL A 1 611 ? -52.650 -25.909 45.481  1.00 29.99  ? 674  VAL B N     1 
ATOM   4308 C  CA    . VAL A 1 611 ? -51.768 -24.868 45.858  1.00 26.58  ? 674  VAL B CA    1 
ATOM   4309 C  C     . VAL A 1 611 ? -50.816 -25.334 46.880  1.00 25.54  ? 674  VAL B C     1 
ATOM   4310 O  O     . VAL A 1 611 ? -51.209 -25.893 47.801  1.00 30.47  ? 674  VAL B O     1 
ATOM   4311 C  CB    . VAL A 1 611 ? -52.575 -23.739 46.443  1.00 29.22  ? 674  VAL B CB    1 
ATOM   4312 C  CG1   . VAL A 1 611 ? -51.675 -22.675 46.994  1.00 31.62  ? 674  VAL B CG1   1 
ATOM   4313 C  CG2   . VAL A 1 611 ? -53.455 -23.139 45.397  1.00 25.38  ? 674  VAL B CG2   1 
ATOM   4314 N  N     . VAL A 1 612 ? -49.543 -25.124 46.690  1.00 24.15  ? 675  VAL B N     1 
ATOM   4315 C  CA    . VAL A 1 612 ? -48.609 -25.520 47.668  1.00 23.48  ? 675  VAL B CA    1 
ATOM   4316 C  C     . VAL A 1 612 ? -48.126 -24.411 48.526  1.00 25.73  ? 675  VAL B C     1 
ATOM   4317 O  O     . VAL A 1 612 ? -47.950 -24.612 49.659  1.00 38.05  ? 675  VAL B O     1 
ATOM   4318 C  CB    . VAL A 1 612 ? -47.404 -26.178 47.072  1.00 25.01  ? 675  VAL B CB    1 
ATOM   4319 C  CG1   . VAL A 1 612 ? -46.441 -26.460 48.156  1.00 31.15  ? 675  VAL B CG1   1 
ATOM   4320 C  CG2   . VAL A 1 612 ? -47.789 -27.472 46.447  1.00 29.75  ? 675  VAL B CG2   1 
ATOM   4321 N  N     . ASN A 1 613 ? -47.890 -23.244 47.984  1.00 28.41  ? 676  ASN B N     1 
ATOM   4322 C  CA    . ASN A 1 613 ? -47.359 -22.086 48.711  1.00 29.66  ? 676  ASN B CA    1 
ATOM   4323 C  C     . ASN A 1 613 ? -47.574 -20.816 47.913  1.00 30.69  ? 676  ASN B C     1 
ATOM   4324 O  O     . ASN A 1 613 ? -47.955 -20.895 46.826  1.00 27.54  ? 676  ASN B O     1 
ATOM   4325 C  CB    . ASN A 1 613 ? -45.866 -22.302 48.880  1.00 33.81  ? 676  ASN B CB    1 
ATOM   4326 C  CG    . ASN A 1 613 ? -45.274 -21.508 49.955  1.00 29.73  ? 676  ASN B CG    1 
ATOM   4327 O  OD1   . ASN A 1 613 ? -45.852 -20.621 50.404  1.00 34.10  ? 676  ASN B OD1   1 
ATOM   4328 N  ND2   . ASN A 1 613 ? -44.117 -21.789 50.302  1.00 25.03  ? 676  ASN B ND2   1 
ATOM   4329 N  N     . PHE A 1 614 ? -47.435 -19.632 48.469  1.00 27.75  ? 677  PHE B N     1 
ATOM   4330 C  CA    . PHE A 1 614 ? -47.486 -18.438 47.659  1.00 35.38  ? 677  PHE B CA    1 
ATOM   4331 C  C     . PHE A 1 614 ? -46.505 -17.418 48.157  1.00 33.38  ? 677  PHE B C     1 
ATOM   4332 O  O     . PHE A 1 614 ? -46.229 -17.360 49.284  1.00 34.30  ? 677  PHE B O     1 
ATOM   4333 C  CB    . PHE A 1 614 ? -48.889 -17.888 47.455  1.00 35.13  ? 677  PHE B CB    1 
ATOM   4334 C  CG    . PHE A 1 614 ? -49.296 -16.866 48.439  1.00 36.96  ? 677  PHE B CG    1 
ATOM   4335 C  CD1   . PHE A 1 614 ? -48.902 -15.589 48.297  1.00 37.57  ? 677  PHE B CD1   1 
ATOM   4336 C  CD2   . PHE A 1 614 ? -50.094 -17.190 49.479  1.00 36.31  ? 677  PHE B CD2   1 
ATOM   4337 C  CE1   . PHE A 1 614 ? -49.264 -14.670 49.198  1.00 37.67  ? 677  PHE B CE1   1 
ATOM   4338 C  CE2   . PHE A 1 614 ? -50.449 -16.274 50.377  1.00 29.43  ? 677  PHE B CE2   1 
ATOM   4339 C  CZ    . PHE A 1 614 ? -50.050 -15.017 50.227  1.00 33.77  ? 677  PHE B CZ    1 
ATOM   4340 N  N     . SER A 1 615 ? -45.943 -16.642 47.279  1.00 35.80  ? 678  SER B N     1 
ATOM   4341 C  CA    . SER A 1 615 ? -45.030 -15.633 47.697  1.00 34.04  ? 678  SER B CA    1 
ATOM   4342 C  C     . SER A 1 615 ? -45.180 -14.408 46.877  1.00 38.96  ? 678  SER B C     1 
ATOM   4343 O  O     . SER A 1 615 ? -45.727 -14.451 45.835  1.00 38.49  ? 678  SER B O     1 
ATOM   4344 C  CB    . SER A 1 615 ? -43.632 -16.129 47.599  1.00 34.58  ? 678  SER B CB    1 
ATOM   4345 O  OG    . SER A 1 615 ? -43.194 -16.047 46.302  1.00 39.65  ? 678  SER B OG    1 
ATOM   4346 N  N     . LYS A 1 616 ? -44.758 -13.281 47.392  1.00 40.67  ? 679  LYS B N     1 
ATOM   4347 C  CA    . LYS A 1 616 ? -44.801 -12.058 46.638  1.00 38.68  ? 679  LYS B CA    1 
ATOM   4348 C  C     . LYS A 1 616 ? -43.373 -11.772 46.359  1.00 48.67  ? 679  LYS B C     1 
ATOM   4349 O  O     . LYS A 1 616 ? -42.553 -11.842 47.220  1.00 53.22  ? 679  LYS B O     1 
ATOM   4350 C  CB    . LYS A 1 616 ? -45.376 -10.929 47.426  1.00 38.43  ? 679  LYS B CB    1 
ATOM   4351 C  CG    . LYS A 1 616 ? -45.275 -9.605  46.743  1.00 41.98  ? 679  LYS B CG    1 
ATOM   4352 C  CD    . LYS A 1 616 ? -45.290 -8.487  47.742  1.00 46.30  ? 679  LYS B CD    1 
ATOM   4353 C  CE    . LYS A 1 616 ? -43.875 -8.101  48.075  1.00 52.93  ? 679  LYS B CE    1 
ATOM   4354 N  NZ    . LYS A 1 616 ? -43.784 -7.184  49.224  1.00 41.46  ? 679  LYS B NZ    1 
ATOM   4355 N  N     . LYS A 1 617 ? -43.074 -11.457 45.125  1.00 47.65  ? 680  LYS B N     1 
ATOM   4356 C  CA    . LYS A 1 617 ? -41.726 -11.230 44.691  1.00 47.57  ? 680  LYS B CA    1 
ATOM   4357 C  C     . LYS A 1 617 ? -41.618 -9.911  44.052  1.00 55.90  ? 680  LYS B C     1 
ATOM   4358 O  O     . LYS A 1 617 ? -42.569 -9.355  43.618  1.00 60.16  ? 680  LYS B O     1 
ATOM   4359 C  CB    . LYS A 1 617 ? -41.351 -12.214 43.616  1.00 48.13  ? 680  LYS B CB    1 
ATOM   4360 C  CG    . LYS A 1 617 ? -41.506 -13.644 43.978  1.00 39.99  ? 680  LYS B CG    1 
ATOM   4361 C  CD    . LYS A 1 617 ? -40.238 -14.140 44.554  1.00 43.39  ? 680  LYS B CD    1 
ATOM   4362 C  CE    . LYS A 1 617 ? -40.555 -15.128 45.618  1.00 45.96  ? 680  LYS B CE    1 
ATOM   4363 N  NZ    . LYS A 1 617 ? -39.397 -15.184 46.508  1.00 52.59  ? 680  LYS B NZ    1 
ATOM   4364 N  N     . SER A 1 618 ? -40.429 -9.403  43.962  1.00 53.01  ? 681  SER B N     1 
ATOM   4365 C  CA    . SER A 1 618 ? -40.283 -8.105  43.382  1.00 61.97  ? 681  SER B CA    1 
ATOM   4366 C  C     . SER A 1 618 ? -39.568 -8.193  42.084  1.00 60.42  ? 681  SER B C     1 
ATOM   4367 O  O     . SER A 1 618 ? -38.875 -9.139  41.855  1.00 59.74  ? 681  SER B O     1 
ATOM   4368 C  CB    . SER A 1 618 ? -39.592 -7.164  44.354  1.00 70.24  ? 681  SER B CB    1 
ATOM   4369 O  OG    . SER A 1 618 ? -38.697 -7.854  45.201  1.00 76.70  ? 681  SER B OG    1 
ATOM   4370 N  N     . ASN A 1 619 ? -39.780 -7.230  41.201  1.00 60.42  ? 682  ASN B N     1 
ATOM   4371 C  CA    . ASN A 1 619 ? -39.108 -7.276  39.925  1.00 55.90  ? 682  ASN B CA    1 
ATOM   4372 C  C     . ASN A 1 619 ? -37.714 -6.794  40.011  1.00 55.86  ? 682  ASN B C     1 
ATOM   4373 O  O     . ASN A 1 619 ? -37.441 -5.719  40.431  1.00 60.85  ? 682  ASN B O     1 
ATOM   4374 C  CB    . ASN A 1 619 ? -39.840 -6.548  38.847  1.00 56.38  ? 682  ASN B CB    1 
ATOM   4375 C  CG    . ASN A 1 619 ? -39.344 -6.921  37.516  1.00 54.69  ? 682  ASN B CG    1 
ATOM   4376 O  OD1   . ASN A 1 619 ? -38.395 -7.641  37.417  1.00 53.91  ? 682  ASN B OD1   1 
ATOM   4377 N  ND2   . ASN A 1 619 ? -39.961 -6.443  36.503  1.00 59.79  ? 682  ASN B ND2   1 
ATOM   4378 N  N     . VAL A 1 620 ? -36.863 -7.621  39.479  1.00 50.86  ? 683  VAL B N     1 
ATOM   4379 C  CA    . VAL A 1 620 ? -35.454 -7.531  39.518  1.00 52.12  ? 683  VAL B CA    1 
ATOM   4380 C  C     . VAL A 1 620 ? -35.003 -7.578  38.079  1.00 62.34  ? 683  VAL B C     1 
ATOM   4381 O  O     . VAL A 1 620 ? -33.995 -8.131  37.736  1.00 64.35  ? 683  VAL B O     1 
ATOM   4382 C  CB    . VAL A 1 620 ? -35.144 -8.791  40.302  1.00 57.38  ? 683  VAL B CB    1 
ATOM   4383 C  CG1   . VAL A 1 620 ? -33.827 -9.460  40.044  1.00 62.88  ? 683  VAL B CG1   1 
ATOM   4384 C  CG2   . VAL A 1 620 ? -35.393 -8.554  41.763  1.00 55.98  ? 683  VAL B CG2   1 
ATOM   4385 N  N     . LYS A 1 621 ? -35.719 -6.895  37.220  1.00 63.63  ? 684  LYS B N     1 
ATOM   4386 C  CA    . LYS A 1 621 ? -35.467 -7.058  35.825  1.00 66.47  ? 684  LYS B CA    1 
ATOM   4387 C  C     . LYS A 1 621 ? -34.115 -6.763  35.261  1.00 74.20  ? 684  LYS B C     1 
ATOM   4388 O  O     . LYS A 1 621 ? -33.630 -7.524  34.455  1.00 81.48  ? 684  LYS B O     1 
ATOM   4389 C  CB    . LYS A 1 621 ? -36.511 -6.305  35.044  1.00 73.02  ? 684  LYS B CB    1 
ATOM   4390 N  N     . PRO A 1 622 ? -33.470 -5.690  35.643  1.00 72.56  ? 685  PRO B N     1 
ATOM   4391 C  CA    . PRO A 1 622 ? -33.788 -4.357  36.055  1.00 75.28  ? 685  PRO B CA    1 
ATOM   4392 C  C     . PRO A 1 622 ? -33.586 -3.507  34.853  1.00 81.48  ? 685  PRO B C     1 
ATOM   4393 O  O     . PRO A 1 622 ? -33.138 -2.397  35.004  1.00 87.84  ? 685  PRO B O     1 
ATOM   4394 C  CB    . PRO A 1 622 ? -32.642 -4.054  36.987  1.00 80.29  ? 685  PRO B CB    1 
ATOM   4395 C  CG    . PRO A 1 622 ? -31.481 -4.656  36.297  1.00 73.26  ? 685  PRO B CG    1 
ATOM   4396 C  CD    . PRO A 1 622 ? -32.014 -5.859  35.571  1.00 70.89  ? 685  PRO B CD    1 
ATOM   4397 N  N     . ASN A 1 623 ? -33.863 -4.010  33.658  1.00 79.92  ? 686  ASN B N     1 
ATOM   4398 C  CA    . ASN A 1 623 ? -33.635 -3.231  32.467  1.00 86.62  ? 686  ASN B CA    1 
ATOM   4399 C  C     . ASN A 1 623 ? -34.465 -1.987  32.545  1.00 88.78  ? 686  ASN B C     1 
ATOM   4400 O  O     . ASN A 1 623 ? -33.955 -0.912  32.386  1.00 88.71  ? 686  ASN B O     1 
ATOM   4401 C  CB    . ASN A 1 623 ? -34.061 -4.031  31.241  1.00 88.95  ? 686  ASN B CB    1 
ATOM   4402 N  N     . SER A 1 624 ? -35.730 -2.133  32.893  1.00 93.19  ? 687  SER B N     1 
ATOM   4403 C  CA    . SER A 1 624 ? -36.631 -1.034  33.074  1.00 93.50  ? 687  SER B CA    1 
ATOM   4404 C  C     . SER A 1 624 ? -36.702 -0.737  34.557  1.00 90.64  ? 687  SER B C     1 
ATOM   4405 O  O     . SER A 1 624 ? -35.828 -1.056  35.301  1.00 85.56  ? 687  SER B O     1 
ATOM   4406 C  CB    . SER A 1 624 ? -38.006 -1.405  32.530  1.00 83.81  ? 687  SER B CB    1 
ATOM   4407 N  N     . GLY A 1 625 ? -37.731 -0.033  34.969  1.00 98.23  ? 688  GLY B N     1 
ATOM   4408 C  CA    . GLY A 1 625 ? -37.948 0.269   36.369  1.00 93.21  ? 688  GLY B CA    1 
ATOM   4409 C  C     . GLY A 1 625 ? -38.517 -0.908  37.123  1.00 93.02  ? 688  GLY B C     1 
ATOM   4410 O  O     . GLY A 1 625 ? -39.095 -1.828  36.551  1.00 87.50  ? 688  GLY B O     1 
ATOM   4411 N  N     . GLU A 1 626 ? -38.367 -0.886  38.428  1.00 94.81  ? 689  GLU B N     1 
ATOM   4412 C  CA    . GLU A 1 626 ? -38.884 -1.986  39.195  1.00 97.84  ? 689  GLU B CA    1 
ATOM   4413 C  C     . GLU A 1 626 ? -40.407 -2.112  39.058  1.00 93.37  ? 689  GLU B C     1 
ATOM   4414 O  O     . GLU A 1 626 ? -40.935 -3.204  39.012  1.00 82.80  ? 689  GLU B O     1 
ATOM   4415 C  CB    . GLU A 1 626 ? -38.458 -1.866  40.653  1.00 86.12  ? 689  GLU B CB    1 
ATOM   4416 N  N     . LEU A 1 627 ? -41.110 -0.994  39.070  1.00 95.67  ? 690  LEU B N     1 
ATOM   4417 C  CA    . LEU A 1 627 ? -42.560 -0.982  38.931  1.00 96.91  ? 690  LEU B CA    1 
ATOM   4418 C  C     . LEU A 1 627 ? -43.261 -1.883  39.921  1.00 88.37  ? 690  LEU B C     1 
ATOM   4419 O  O     . LEU A 1 627 ? -42.901 -1.962  41.073  1.00 87.22  ? 690  LEU B O     1 
ATOM   4420 C  CB    . LEU A 1 627 ? -43.025 -1.300  37.501  1.00 83.88  ? 690  LEU B CB    1 
ATOM   4421 N  N     . ASP A 1 628 ? -44.238 -2.615  39.442  1.00 79.60  ? 691  ASP B N     1 
ATOM   4422 C  CA    . ASP A 1 628 ? -44.976 -3.464  40.322  1.00 81.06  ? 691  ASP B CA    1 
ATOM   4423 C  C     . ASP A 1 628 ? -44.277 -4.768  40.660  1.00 76.32  ? 691  ASP B C     1 
ATOM   4424 O  O     . ASP A 1 628 ? -43.402 -5.186  39.952  1.00 72.30  ? 691  ASP B O     1 
ATOM   4425 C  CB    . ASP A 1 628 ? -46.343 -3.701  39.711  1.00 77.23  ? 691  ASP B CB    1 
ATOM   4426 N  N     . PRO A 1 629 ? -44.653 -5.381  41.782  1.00 65.89  ? 692  PRO B N     1 
ATOM   4427 C  CA    . PRO A 1 629 ? -44.257 -6.650  42.358  1.00 60.80  ? 692  PRO B CA    1 
ATOM   4428 C  C     . PRO A 1 629 ? -45.179 -7.718  41.832  1.00 54.19  ? 692  PRO B C     1 
ATOM   4429 O  O     . PRO A 1 629 ? -46.353 -7.484  41.701  1.00 50.71  ? 692  PRO B O     1 
ATOM   4430 C  CB    . PRO A 1 629 ? -44.554 -6.433  43.807  1.00 57.82  ? 692  PRO B CB    1 
ATOM   4431 C  CG    . PRO A 1 629 ? -45.801 -5.679  43.751  1.00 56.35  ? 692  PRO B CG    1 
ATOM   4432 C  CD    . PRO A 1 629 ? -45.531 -4.664  42.700  1.00 59.56  ? 692  PRO B CD    1 
ATOM   4433 N  N     . LEU A 1 630 ? -44.645 -8.899  41.597  1.00 47.99  ? 693  LEU B N     1 
ATOM   4434 C  CA    . LEU A 1 630 ? -45.376 -9.994  41.011  1.00 47.19  ? 693  LEU B CA    1 
ATOM   4435 C  C     . LEU A 1 630 ? -45.810 -11.026 41.994  1.00 44.63  ? 693  LEU B C     1 
ATOM   4436 O  O     . LEU A 1 630 ? -45.130 -11.311 42.886  1.00 43.59  ? 693  LEU B O     1 
ATOM   4437 C  CB    . LEU A 1 630 ? -44.487 -10.623 39.967  1.00 48.54  ? 693  LEU B CB    1 
ATOM   4438 N  N     . TYR A 1 631 ? -46.993 -11.567 41.830  1.00 44.89  ? 694  TYR B N     1 
ATOM   4439 C  CA    . TYR A 1 631 ? -47.496 -12.540 42.753  1.00 41.06  ? 694  TYR B CA    1 
ATOM   4440 C  C     . TYR A 1 631 ? -47.407 -13.876 42.191  1.00 40.57  ? 694  TYR B C     1 
ATOM   4441 O  O     . TYR A 1 631 ? -48.109 -14.178 41.308  1.00 42.42  ? 694  TYR B O     1 
ATOM   4442 C  CB    . TYR A 1 631 ? -48.949 -12.262 43.001  1.00 35.87  ? 694  TYR B CB    1 
ATOM   4443 C  CG    . TYR A 1 631 ? -49.133 -11.153 43.948  1.00 40.21  ? 694  TYR B CG    1 
ATOM   4444 C  CD1   . TYR A 1 631 ? -49.194 -11.386 45.266  1.00 45.29  ? 694  TYR B CD1   1 
ATOM   4445 C  CD2   . TYR A 1 631 ? -49.210 -9.879  43.523  1.00 42.40  ? 694  TYR B CD2   1 
ATOM   4446 C  CE1   . TYR A 1 631 ? -49.344 -10.380 46.151  1.00 44.65  ? 694  TYR B CE1   1 
ATOM   4447 C  CE2   . TYR A 1 631 ? -49.360 -8.861  44.401  1.00 42.36  ? 694  TYR B CE2   1 
ATOM   4448 C  CZ    . TYR A 1 631 ? -49.427 -9.137  45.719  1.00 48.45  ? 694  TYR B CZ    1 
ATOM   4449 O  OH    . TYR A 1 631 ? -49.558 -8.155  46.626  1.00 51.25  ? 694  TYR B OH    1 
ATOM   4450 N  N     . VAL A 1 632 ? -46.647 -14.723 42.838  1.00 38.56  ? 695  VAL B N     1 
ATOM   4451 C  CA    . VAL A 1 632 ? -46.393 -16.039 42.367  1.00 34.50  ? 695  VAL B CA    1 
ATOM   4452 C  C     . VAL A 1 632 ? -46.962 -17.081 43.233  1.00 37.03  ? 695  VAL B C     1 
ATOM   4453 O  O     . VAL A 1 632 ? -46.811 -17.036 44.399  1.00 42.21  ? 695  VAL B O     1 
ATOM   4454 C  CB    . VAL A 1 632 ? -44.928 -16.241 42.424  1.00 35.09  ? 695  VAL B CB    1 
ATOM   4455 C  CG1   . VAL A 1 632 ? -44.521 -17.532 41.825  1.00 34.33  ? 695  VAL B CG1   1 
ATOM   4456 C  CG2   . VAL A 1 632 ? -44.277 -15.112 41.725  1.00 40.72  ? 695  VAL B CG2   1 
ATOM   4457 N  N     . VAL A 1 633 ? -47.613 -18.043 42.635  1.00 30.54  ? 696  VAL B N     1 
ATOM   4458 C  CA    . VAL A 1 633 ? -48.188 -19.101 43.359  1.00 31.64  ? 696  VAL B CA    1 
ATOM   4459 C  C     . VAL A 1 633 ? -47.520 -20.333 42.926  1.00 28.66  ? 696  VAL B C     1 
ATOM   4460 O  O     . VAL A 1 633 ? -47.358 -20.526 41.794  1.00 33.27  ? 696  VAL B O     1 
ATOM   4461 C  CB    . VAL A 1 633 ? -49.627 -19.251 42.977  1.00 28.50  ? 696  VAL B CB    1 
ATOM   4462 C  CG1   . VAL A 1 633 ? -50.376 -19.910 44.083  1.00 32.67  ? 696  VAL B CG1   1 
ATOM   4463 C  CG2   . VAL A 1 633 ? -50.232 -17.913 42.738  1.00 36.40  ? 696  VAL B CG2   1 
ATOM   4464 N  N     . GLU A 1 634 ? -47.112 -21.164 43.854  1.00 28.10  ? 697  GLU B N     1 
ATOM   4465 C  CA    . GLU A 1 634 ? -46.503 -22.425 43.546  1.00 30.61  ? 697  GLU B CA    1 
ATOM   4466 C  C     . GLU A 1 634 ? -47.556 -23.455 43.613  1.00 28.16  ? 697  GLU B C     1 
ATOM   4467 O  O     . GLU A 1 634 ? -48.075 -23.693 44.609  1.00 29.14  ? 697  GLU B O     1 
ATOM   4468 C  CB    . GLU A 1 634 ? -45.434 -22.754 44.539  1.00 25.92  ? 697  GLU B CB    1 
ATOM   4469 C  CG    . GLU A 1 634 ? -44.645 -21.555 44.874  1.00 24.72  ? 697  GLU B CG    1 
ATOM   4470 C  CD    . GLU A 1 634 ? -43.324 -21.883 45.369  1.00 28.66  ? 697  GLU B CD    1 
ATOM   4471 O  OE1   . GLU A 1 634 ? -42.597 -22.583 44.711  1.00 29.05  ? 697  GLU B OE1   1 
ATOM   4472 O  OE2   . GLU A 1 634 ? -42.996 -21.427 46.420  1.00 45.53  ? 697  GLU B OE2   1 
ATOM   4473 N  N     . VAL A 1 635 ? -47.815 -24.091 42.505  1.00 28.40  ? 698  VAL B N     1 
ATOM   4474 C  CA    . VAL A 1 635 ? -48.868 -25.050 42.349  1.00 27.90  ? 698  VAL B CA    1 
ATOM   4475 C  C     . VAL A 1 635 ? -48.442 -26.412 41.838  1.00 26.30  ? 698  VAL B C     1 
ATOM   4476 O  O     . VAL A 1 635 ? -47.703 -26.513 40.944  1.00 26.37  ? 698  VAL B O     1 
ATOM   4477 C  CB    . VAL A 1 635 ? -49.890 -24.436 41.395  1.00 24.53  ? 698  VAL B CB    1 
ATOM   4478 C  CG1   . VAL A 1 635 ? -50.962 -25.374 41.002  1.00 32.62  ? 698  VAL B CG1   1 
ATOM   4479 C  CG2   . VAL A 1 635 ? -50.553 -23.290 42.028  1.00 30.55  ? 698  VAL B CG2   1 
ATOM   4480 N  N     . LEU A 1 636 ? -48.939 -27.471 42.425  1.00 25.20  ? 699  LEU B N     1 
ATOM   4481 C  CA    . LEU A 1 636 ? -48.628 -28.769 41.942  1.00 28.18  ? 699  LEU B CA    1 
ATOM   4482 C  C     . LEU A 1 636 ? -49.574 -29.071 40.801  1.00 40.92  ? 699  LEU B C     1 
ATOM   4483 O  O     . LEU A 1 636 ? -50.745 -29.160 40.967  1.00 41.92  ? 699  LEU B O     1 
ATOM   4484 C  CB    . LEU A 1 636 ? -48.840 -29.747 43.037  1.00 26.43  ? 699  LEU B CB    1 
ATOM   4485 C  CG    . LEU A 1 636 ? -48.327 -31.142 42.924  1.00 32.66  ? 699  LEU B CG    1 
ATOM   4486 C  CD1   . LEU A 1 636 ? -47.010 -31.240 43.598  1.00 31.54  ? 699  LEU B CD1   1 
ATOM   4487 C  CD2   . LEU A 1 636 ? -49.283 -31.938 43.727  1.00 34.48  ? 699  LEU B CD2   1 
ATOM   4488 N  N     . LEU A 1 637 ? -49.016 -29.259 39.622  1.00 39.35  ? 700  LEU B N     1 
ATOM   4489 C  CA    . LEU A 1 637 ? -49.752 -29.505 38.415  1.00 33.15  ? 700  LEU B CA    1 
ATOM   4490 C  C     . LEU A 1 637 ? -49.354 -30.793 37.829  1.00 34.98  ? 700  LEU B C     1 
ATOM   4491 O  O     . LEU A 1 637 ? -48.369 -31.327 38.167  1.00 36.97  ? 700  LEU B O     1 
ATOM   4492 C  CB    . LEU A 1 637 ? -49.393 -28.458 37.398  1.00 32.92  ? 700  LEU B CB    1 
ATOM   4493 C  CG    . LEU A 1 637 ? -49.519 -27.001 37.714  1.00 28.00  ? 700  LEU B CG    1 
ATOM   4494 C  CD1   . LEU A 1 637 ? -48.575 -26.163 36.940  1.00 27.51  ? 700  LEU B CD1   1 
ATOM   4495 C  CD2   . LEU A 1 637 ? -50.908 -26.579 37.454  1.00 29.24  ? 700  LEU B CD2   1 
ATOM   4496 N  N     . ARG A 1 638 ? -50.161 -31.311 36.942  1.00 32.09  ? 701  ARG B N     1 
ATOM   4497 C  CA    . ARG A 1 638 ? -49.860 -32.552 36.283  1.00 36.60  ? 701  ARG B CA    1 
ATOM   4498 C  C     . ARG A 1 638 ? -49.149 -32.272 35.001  1.00 43.16  ? 701  ARG B C     1 
ATOM   4499 O  O     . ARG A 1 638 ? -49.777 -32.010 34.026  1.00 45.98  ? 701  ARG B O     1 
ATOM   4500 C  CB    . ARG A 1 638 ? -51.165 -33.262 35.948  1.00 43.78  ? 701  ARG B CB    1 
ATOM   4501 C  CG    . ARG A 1 638 ? -51.091 -34.756 35.807  1.00 44.48  ? 701  ARG B CG    1 
ATOM   4502 C  CD    . ARG A 1 638 ? -52.442 -35.347 35.600  1.00 46.16  ? 701  ARG B CD    1 
ATOM   4503 N  NE    . ARG A 1 638 ? -53.059 -34.866 34.382  1.00 58.64  ? 701  ARG B NE    1 
ATOM   4504 C  CZ    . ARG A 1 638 ? -53.191 -35.572 33.279  1.00 52.37  ? 701  ARG B CZ    1 
ATOM   4505 N  NH1   . ARG A 1 638 ? -52.763 -36.794 33.242  1.00 44.21  ? 701  ARG B NH1   1 
ATOM   4506 N  NH2   . ARG A 1 638 ? -53.766 -35.050 32.229  1.00 42.13  ? 701  ARG B NH2   1 
ATOM   4507 N  N     . CYS A 1 639 ? -47.843 -32.471 34.994  1.00 37.80  ? 702  CYS B N     1 
ATOM   4508 C  CA    . CYS A 1 639 ? -46.952 -32.179 33.893  1.00 39.96  ? 702  CYS B CA    1 
ATOM   4509 C  C     . CYS A 1 639 ? -46.482 -33.351 33.041  1.00 47.81  ? 702  CYS B C     1 
ATOM   4510 O  O     . CYS A 1 639 ? -46.540 -34.462 33.435  1.00 54.97  ? 702  CYS B O     1 
ATOM   4511 C  CB    . CYS A 1 639 ? -45.754 -31.457 34.469  1.00 43.43  ? 702  CYS B CB    1 
ATOM   4512 S  SG    . CYS A 1 639 ? -46.121 -29.865 35.161  1.00 39.60  ? 702  CYS B SG    1 
ATOM   4513 N  N     . SER A 1 640 ? -45.995 -33.075 31.858  1.00 49.22  ? 703  SER B N     1 
ATOM   4514 C  CA    . SER A 1 640 ? -45.541 -34.072 30.927  1.00 45.67  ? 703  SER B CA    1 
ATOM   4515 C  C     . SER A 1 640 ? -44.332 -34.802 31.308  1.00 46.49  ? 703  SER B C     1 
ATOM   4516 O  O     . SER A 1 640 ? -43.521 -34.271 31.964  1.00 50.43  ? 703  SER B O     1 
ATOM   4517 C  CB    . SER A 1 640 ? -45.048 -33.347 29.724  1.00 48.08  ? 703  SER B CB    1 
ATOM   4518 O  OG    . SER A 1 640 ? -46.050 -32.586 29.182  1.00 49.79  ? 703  SER B OG    1 
ATOM   4519 N  N     . LYS A 1 641 ? -44.125 -36.008 30.783  1.00 48.30  ? 704  LYS B N     1 
ATOM   4520 C  CA    . LYS A 1 641 ? -42.893 -36.745 31.036  1.00 48.95  ? 704  LYS B CA    1 
ATOM   4521 C  C     . LYS A 1 641 ? -41.745 -35.975 30.447  1.00 48.27  ? 704  LYS B C     1 
ATOM   4522 O  O     . LYS A 1 641 ? -40.693 -35.900 31.006  1.00 48.43  ? 704  LYS B O     1 
ATOM   4523 C  CB    . LYS A 1 641 ? -42.891 -38.116 30.381  1.00 60.57  ? 704  LYS B CB    1 
ATOM   4524 C  CG    . LYS A 1 641 ? -43.373 -39.271 31.237  1.00 64.05  ? 704  LYS B CG    1 
ATOM   4525 C  CD    . LYS A 1 641 ? -43.506 -40.533 30.413  1.00 65.48  ? 704  LYS B CD    1 
ATOM   4526 C  CE    . LYS A 1 641 ? -42.253 -41.374 30.479  1.00 70.74  ? 704  LYS B CE    1 
ATOM   4527 N  NZ    . LYS A 1 641 ? -42.211 -42.321 31.626  1.00 70.99  ? 704  LYS B NZ    1 
ATOM   4528 N  N     . GLU A 1 642 ? -41.965 -35.436 29.268  1.00 51.46  ? 705  GLU B N     1 
ATOM   4529 C  CA    . GLU A 1 642 ? -41.056 -34.601 28.585  1.00 51.41  ? 705  GLU B CA    1 
ATOM   4530 C  C     . GLU A 1 642 ? -40.777 -33.363 29.402  1.00 51.73  ? 705  GLU B C     1 
ATOM   4531 O  O     . GLU A 1 642 ? -39.659 -33.003 29.501  1.00 48.49  ? 705  GLU B O     1 
ATOM   4532 C  CB    . GLU A 1 642 ? -41.743 -34.201 27.316  1.00 47.60  ? 705  GLU B CB    1 
ATOM   4533 C  CG    . GLU A 1 642 ? -40.894 -33.571 26.259  1.00 51.10  ? 705  GLU B CG    1 
ATOM   4534 C  CD    . GLU A 1 642 ? -41.728 -33.166 25.104  1.00 53.06  ? 705  GLU B CD    1 
ATOM   4535 O  OE1   . GLU A 1 642 ? -42.930 -33.044 25.273  1.00 53.95  ? 705  GLU B OE1   1 
ATOM   4536 O  OE2   . GLU A 1 642 ? -41.189 -32.990 24.027  1.00 49.61  ? 705  GLU B OE2   1 
ATOM   4537 N  N     . SER A 1 643 ? -41.786 -32.764 30.026  1.00 50.08  ? 706  SER B N     1 
ATOM   4538 C  CA    . SER A 1 643 ? -41.673 -31.551 30.820  1.00 43.64  ? 706  SER B CA    1 
ATOM   4539 C  C     . SER A 1 643 ? -40.802 -31.621 32.001  1.00 44.53  ? 706  SER B C     1 
ATOM   4540 O  O     . SER A 1 643 ? -40.068 -30.728 32.257  1.00 47.94  ? 706  SER B O     1 
ATOM   4541 C  CB    . SER A 1 643 ? -43.010 -31.178 31.368  1.00 44.13  ? 706  SER B CB    1 
ATOM   4542 O  OG    . SER A 1 643 ? -43.431 -29.943 30.919  1.00 54.94  ? 706  SER B OG    1 
ATOM   4543 N  N     . LEU A 1 644 ? -40.842 -32.712 32.727  1.00 41.06  ? 707  LEU B N     1 
ATOM   4544 C  CA    . LEU A 1 644 ? -40.026 -32.873 33.907  1.00 42.96  ? 707  LEU B CA    1 
ATOM   4545 C  C     . LEU A 1 644 ? -38.561 -32.892 33.662  1.00 44.48  ? 707  LEU B C     1 
ATOM   4546 O  O     . LEU A 1 644 ? -37.802 -32.566 34.527  1.00 47.36  ? 707  LEU B O     1 
ATOM   4547 C  CB    . LEU A 1 644 ? -40.385 -34.105 34.659  1.00 39.74  ? 707  LEU B CB    1 
ATOM   4548 C  CG    . LEU A 1 644 ? -41.825 -34.352 34.696  1.00 41.63  ? 707  LEU B CG    1 
ATOM   4549 C  CD1   . LEU A 1 644 ? -41.814 -35.832 34.765  1.00 47.20  ? 707  LEU B CD1   1 
ATOM   4550 C  CD2   . LEU A 1 644 ? -42.371 -33.804 35.957  1.00 41.80  ? 707  LEU B CD2   1 
ATOM   4551 N  N     . LYS A 1 645 ? -38.153 -33.355 32.507  1.00 39.47  ? 708  LYS B N     1 
ATOM   4552 C  CA    . LYS A 1 645 ? -36.787 -33.398 32.104  1.00 37.96  ? 708  LYS B CA    1 
ATOM   4553 C  C     . LYS A 1 645 ? -36.132 -32.042 31.933  1.00 42.04  ? 708  LYS B C     1 
ATOM   4554 O  O     . LYS A 1 645 ? -34.946 -31.955 31.968  1.00 42.45  ? 708  LYS B O     1 
ATOM   4555 C  CB    . LYS A 1 645 ? -36.650 -34.260 30.863  1.00 34.43  ? 708  LYS B CB    1 
ATOM   4556 N  N     . ASN A 1 646 ? -36.888 -30.996 31.670  1.00 42.15  ? 709  ASN B N     1 
ATOM   4557 C  CA    . ASN A 1 646 ? -36.308 -29.691 31.543  1.00 48.36  ? 709  ASN B CA    1 
ATOM   4558 C  C     . ASN A 1 646 ? -36.298 -28.936 32.820  1.00 45.32  ? 709  ASN B C     1 
ATOM   4559 O  O     . ASN A 1 646 ? -37.297 -28.780 33.420  1.00 45.55  ? 709  ASN B O     1 
ATOM   4560 C  CB    . ASN A 1 646 ? -37.078 -28.896 30.554  1.00 48.54  ? 709  ASN B CB    1 
ATOM   4561 C  CG    . ASN A 1 646 ? -36.269 -28.574 29.368  1.00 54.55  ? 709  ASN B CG    1 
ATOM   4562 O  OD1   . ASN A 1 646 ? -36.145 -29.371 28.460  1.00 52.99  ? 709  ASN B OD1   1 
ATOM   4563 N  ND2   . ASN A 1 646 ? -35.684 -27.419 29.378  1.00 53.35  ? 709  ASN B ND2   1 
ATOM   4564 N  N     . SER A 1 647 ? -35.147 -28.456 33.227  1.00 41.47  ? 710  SER B N     1 
ATOM   4565 C  CA    . SER A 1 647 ? -34.997 -27.756 34.464  1.00 42.69  ? 710  SER B CA    1 
ATOM   4566 C  C     . SER A 1 647 ? -35.725 -26.497 34.552  1.00 41.90  ? 710  SER B C     1 
ATOM   4567 O  O     . SER A 1 647 ? -36.272 -26.160 35.557  1.00 42.43  ? 710  SER B O     1 
ATOM   4568 C  CB    . SER A 1 647 ? -33.568 -27.446 34.678  1.00 39.21  ? 710  SER B CB    1 
ATOM   4569 O  OG    . SER A 1 647 ? -32.889 -28.640 34.721  1.00 58.32  ? 710  SER B OG    1 
ATOM   4570 N  N     . ALA A 1 648 ? -35.772 -25.805 33.453  1.00 37.84  ? 711  ALA B N     1 
ATOM   4571 C  CA    . ALA A 1 648 ? -36.339 -24.514 33.403  1.00 32.82  ? 711  ALA B CA    1 
ATOM   4572 C  C     . ALA A 1 648 ? -37.760 -24.430 33.761  1.00 39.02  ? 711  ALA B C     1 
ATOM   4573 O  O     . ALA A 1 648 ? -38.529 -25.299 33.568  1.00 39.67  ? 711  ALA B O     1 
ATOM   4574 C  CB    . ALA A 1 648 ? -36.136 -23.954 32.041  1.00 30.76  ? 711  ALA B CB    1 
ATOM   4575 N  N     . THR A 1 649 ? -38.091 -23.320 34.345  1.00 36.25  ? 712  THR B N     1 
ATOM   4576 C  CA    . THR A 1 649 ? -39.426 -23.046 34.757  1.00 35.85  ? 712  THR B CA    1 
ATOM   4577 C  C     . THR A 1 649 ? -40.377 -22.945 33.605  1.00 30.87  ? 712  THR B C     1 
ATOM   4578 O  O     . THR A 1 649 ? -41.459 -23.338 33.708  1.00 31.43  ? 712  THR B O     1 
ATOM   4579 C  CB    . THR A 1 649 ? -39.491 -21.776 35.566  1.00 40.67  ? 712  THR B CB    1 
ATOM   4580 O  OG1   . THR A 1 649 ? -38.313 -21.644 36.346  1.00 48.11  ? 712  THR B OG1   1 
ATOM   4581 C  CG2   . THR A 1 649 ? -40.593 -21.848 36.470  1.00 35.51  ? 712  THR B CG2   1 
ATOM   4582 N  N     . GLU A 1 650 ? -39.944 -22.377 32.511  1.00 40.09  ? 713  GLU B N     1 
ATOM   4583 C  CA    . GLU A 1 650 ? -40.729 -22.148 31.308  1.00 43.88  ? 713  GLU B CA    1 
ATOM   4584 C  C     . GLU A 1 650 ? -41.215 -23.343 30.535  1.00 46.59  ? 713  GLU B C     1 
ATOM   4585 O  O     . GLU A 1 650 ? -42.181 -23.297 29.820  1.00 43.58  ? 713  GLU B O     1 
ATOM   4586 C  CB    . GLU A 1 650 ? -39.913 -21.302 30.384  1.00 48.34  ? 713  GLU B CB    1 
ATOM   4587 C  CG    . GLU A 1 650 ? -39.695 -19.914 30.917  1.00 64.07  ? 713  GLU B CG    1 
ATOM   4588 C  CD    . GLU A 1 650 ? -38.810 -19.092 30.011  1.00 92.03  ? 713  GLU B CD    1 
ATOM   4589 O  OE1   . GLU A 1 650 ? -38.211 -19.654 29.066  1.00 93.11  ? 713  GLU B OE1   1 
ATOM   4590 O  OE2   . GLU A 1 650 ? -38.732 -17.872 30.238  1.00 86.55  ? 713  GLU B OE2   1 
ATOM   4591 N  N     . ALA A 1 651 ? -40.475 -24.402 30.682  1.00 40.15  ? 714  ALA B N     1 
ATOM   4592 C  CA    . ALA A 1 651 ? -40.680 -25.656 30.056  1.00 34.70  ? 714  ALA B CA    1 
ATOM   4593 C  C     . ALA A 1 651 ? -41.799 -26.507 30.552  1.00 36.77  ? 714  ALA B C     1 
ATOM   4594 O  O     . ALA A 1 651 ? -42.040 -27.533 30.027  1.00 40.21  ? 714  ALA B O     1 
ATOM   4595 C  CB    . ALA A 1 651 ? -39.405 -26.422 30.122  1.00 37.53  ? 714  ALA B CB    1 
ATOM   4596 N  N     . ALA A 1 652 ? -42.424 -26.149 31.629  1.00 38.00  ? 715  ALA B N     1 
ATOM   4597 C  CA    . ALA A 1 652 ? -43.482 -26.949 32.136  1.00 41.46  ? 715  ALA B CA    1 
ATOM   4598 C  C     . ALA A 1 652 ? -44.609 -26.917 31.180  1.00 38.86  ? 715  ALA B C     1 
ATOM   4599 O  O     . ALA A 1 652 ? -44.955 -25.896 30.690  1.00 40.10  ? 715  ALA B O     1 
ATOM   4600 C  CB    . ALA A 1 652 ? -43.911 -26.468 33.484  1.00 39.32  ? 715  ALA B CB    1 
ATOM   4601 N  N     . LYS A 1 653 ? -45.184 -28.084 30.946  1.00 42.56  ? 716  LYS B N     1 
ATOM   4602 C  CA    . LYS A 1 653 ? -46.304 -28.301 30.055  1.00 39.94  ? 716  LYS B CA    1 
ATOM   4603 C  C     . LYS A 1 653 ? -47.268 -29.370 30.596  1.00 37.98  ? 716  LYS B C     1 
ATOM   4604 O  O     . LYS A 1 653 ? -46.878 -30.252 31.261  1.00 37.88  ? 716  LYS B O     1 
ATOM   4605 C  CB    . LYS A 1 653 ? -45.749 -28.717 28.711  1.00 34.71  ? 716  LYS B CB    1 
ATOM   4606 C  CG    . LYS A 1 653 ? -45.886 -27.729 27.597  1.00 37.51  ? 716  LYS B CG    1 
ATOM   4607 C  CD    . LYS A 1 653 ? -44.878 -26.618 27.555  1.00 34.99  ? 716  LYS B CD    1 
ATOM   4608 C  CE    . LYS A 1 653 ? -45.428 -25.549 26.647  1.00 41.80  ? 716  LYS B CE    1 
ATOM   4609 N  NZ    . LYS A 1 653 ? -46.920 -25.559 26.516  1.00 46.88  ? 716  LYS B NZ    1 
ATOM   4610 N  N     . PRO A 1 654 ? -48.539 -29.292 30.282  1.00 33.22  ? 717  PRO B N     1 
ATOM   4611 C  CA    . PRO A 1 654 ? -49.515 -30.248 30.746  1.00 35.32  ? 717  PRO B CA    1 
ATOM   4612 C  C     . PRO A 1 654 ? -49.372 -31.624 30.174  1.00 38.74  ? 717  PRO B C     1 
ATOM   4613 O  O     . PRO A 1 654 ? -48.800 -31.768 29.157  1.00 50.54  ? 717  PRO B O     1 
ATOM   4614 C  CB    . PRO A 1 654 ? -50.827 -29.624 30.320  1.00 35.19  ? 717  PRO B CB    1 
ATOM   4615 C  CG    . PRO A 1 654 ? -50.495 -28.598 29.369  1.00 36.71  ? 717  PRO B CG    1 
ATOM   4616 C  CD    . PRO A 1 654 ? -49.189 -28.096 29.787  1.00 36.27  ? 717  PRO B CD    1 
ATOM   4617 N  N     . ALA A 1 655 ? -49.864 -32.638 30.845  1.00 39.62  ? 718  ALA B N     1 
ATOM   4618 C  CA    . ALA A 1 655 ? -49.725 -33.965 30.360  1.00 41.55  ? 718  ALA B CA    1 
ATOM   4619 C  C     . ALA A 1 655 ? -50.558 -34.180 29.173  1.00 46.03  ? 718  ALA B C     1 
ATOM   4620 O  O     . ALA A 1 655 ? -51.614 -33.657 29.075  1.00 45.50  ? 718  ALA B O     1 
ATOM   4621 C  CB    . ALA A 1 655 ? -50.101 -34.925 31.421  1.00 41.64  ? 718  ALA B CB    1 
ATOM   4622 N  N     . LYS A 1 656 ? -50.044 -34.980 28.259  1.00 50.37  ? 719  LYS B N     1 
ATOM   4623 C  CA    . LYS A 1 656 ? -50.686 -35.321 27.005  1.00 53.53  ? 719  LYS B CA    1 
ATOM   4624 C  C     . LYS A 1 656 ? -51.825 -36.340 27.194  1.00 57.40  ? 719  LYS B C     1 
ATOM   4625 O  O     . LYS A 1 656 ? -51.800 -37.108 28.117  1.00 54.24  ? 719  LYS B O     1 
ATOM   4626 C  CB    . LYS A 1 656 ? -49.629 -35.790 26.018  1.00 48.89  ? 719  LYS B CB    1 
ATOM   4627 C  CG    . LYS A 1 656 ? -48.477 -34.842 25.796  1.00 40.44  ? 719  LYS B CG    1 
ATOM   4628 C  CD    . LYS A 1 656 ? -47.202 -35.402 26.358  1.00 43.02  ? 719  LYS B CD    1 
ATOM   4629 C  CE    . LYS A 1 656 ? -45.934 -34.777 25.812  1.00 40.96  ? 719  LYS B CE    1 
ATOM   4630 N  NZ    . LYS A 1 656 ? -45.598 -34.992 24.394  1.00 43.43  ? 719  LYS B NZ    1 
ATOM   4631 N  N     . PRO A 1 657 ? -52.756 -36.448 26.258  1.00 51.01  ? 720  PRO B N     1 
ATOM   4632 C  CA    . PRO A 1 657 ? -53.944 -37.271 26.458  1.00 49.91  ? 720  PRO B CA    1 
ATOM   4633 C  C     . PRO A 1 657 ? -53.705 -38.721 26.771  1.00 54.44  ? 720  PRO B C     1 
ATOM   4634 O  O     . PRO A 1 657 ? -54.466 -39.330 27.489  1.00 50.47  ? 720  PRO B O     1 
ATOM   4635 C  CB    . PRO A 1 657 ? -54.632 -37.167 25.127  1.00 44.96  ? 720  PRO B CB    1 
ATOM   4636 C  CG    . PRO A 1 657 ? -54.171 -35.898 24.606  1.00 43.02  ? 720  PRO B CG    1 
ATOM   4637 C  CD    . PRO A 1 657 ? -52.745 -35.875 24.929  1.00 39.95  ? 720  PRO B CD    1 
ATOM   4638 N  N     . ASP A 1 658 ? -52.708 -39.277 26.126  1.00 58.75  ? 721  ASP B N     1 
ATOM   4639 C  CA    . ASP A 1 658 ? -52.238 -40.623 26.293  1.00 65.48  ? 721  ASP B CA    1 
ATOM   4640 C  C     . ASP A 1 658 ? -51.611 -40.837 27.640  1.00 59.99  ? 721  ASP B C     1 
ATOM   4641 O  O     . ASP A 1 658 ? -51.635 -41.899 28.191  1.00 59.20  ? 721  ASP B O     1 
ATOM   4642 C  CB    . ASP A 1 658 ? -51.179 -40.874 25.242  1.00 60.26  ? 721  ASP B CB    1 
ATOM   4643 N  N     . GLU A 1 659 ? -50.954 -39.815 28.110  1.00 54.96  ? 722  GLU B N     1 
ATOM   4644 C  CA    . GLU A 1 659 ? -50.194 -39.870 29.326  1.00 59.20  ? 722  GLU B CA    1 
ATOM   4645 C  C     . GLU A 1 659 ? -50.805 -39.849 30.688  1.00 54.70  ? 722  GLU B C     1 
ATOM   4646 O  O     . GLU A 1 659 ? -51.876 -39.359 30.874  1.00 52.72  ? 722  GLU B O     1 
ATOM   4647 C  CB    . GLU A 1 659 ? -49.264 -38.711 29.270  1.00 55.75  ? 722  GLU B CB    1 
ATOM   4648 C  CG    . GLU A 1 659 ? -47.868 -38.994 29.685  1.00 49.71  ? 722  GLU B CG    1 
ATOM   4649 C  CD    . GLU A 1 659 ? -47.106 -37.748 29.767  1.00 55.92  ? 722  GLU B CD    1 
ATOM   4650 O  OE1   . GLU A 1 659 ? -47.548 -36.736 29.260  1.00 61.15  ? 722  GLU B OE1   1 
ATOM   4651 O  OE2   . GLU A 1 659 ? -46.066 -37.763 30.351  1.00 54.81  ? 722  GLU B OE2   1 
ATOM   4652 N  N     . LYS A 1 660 ? -50.089 -40.462 31.624  1.00 59.78  ? 723  LYS B N     1 
ATOM   4653 C  CA    . LYS A 1 660 ? -50.418 -40.485 33.036  1.00 57.37  ? 723  LYS B CA    1 
ATOM   4654 C  C     . LYS A 1 660 ? -50.253 -39.161 33.692  1.00 49.22  ? 723  LYS B C     1 
ATOM   4655 O  O     . LYS A 1 660 ? -51.121 -38.712 34.368  1.00 47.51  ? 723  LYS B O     1 
ATOM   4656 C  CB    . LYS A 1 660 ? -49.471 -41.427 33.761  1.00 57.19  ? 723  LYS B CB    1 
ATOM   4657 C  CG    . LYS A 1 660 ? -49.606 -41.368 35.267  1.00 57.31  ? 723  LYS B CG    1 
ATOM   4658 C  CD    . LYS A 1 660 ? -50.658 -42.324 35.766  1.00 54.14  ? 723  LYS B CD    1 
ATOM   4659 C  CE    . LYS A 1 660 ? -51.714 -41.628 36.590  1.00 52.60  ? 723  LYS B CE    1 
ATOM   4660 N  NZ    . LYS A 1 660 ? -51.485 -41.732 38.039  1.00 59.59  ? 723  LYS B NZ    1 
ATOM   4661 N  N     . GLY A 1 661 ? -49.134 -38.534 33.404  1.00 46.25  ? 724  GLY B N     1 
ATOM   4662 C  CA    . GLY A 1 661 ? -48.753 -37.256 33.940  1.00 44.70  ? 724  GLY B CA    1 
ATOM   4663 C  C     . GLY A 1 661 ? -47.925 -37.403 35.175  1.00 51.52  ? 724  GLY B C     1 
ATOM   4664 O  O     . GLY A 1 661 ? -47.757 -38.474 35.655  1.00 57.66  ? 724  GLY B O     1 
ATOM   4665 N  N     . GLU A 1 662 ? -47.345 -36.332 35.661  1.00 44.68  ? 725  GLU B N     1 
ATOM   4666 C  CA    . GLU A 1 662 ? -46.563 -36.393 36.874  1.00 45.53  ? 725  GLU B CA    1 
ATOM   4667 C  C     . GLU A 1 662 ? -46.753 -35.112 37.589  1.00 42.51  ? 725  GLU B C     1 
ATOM   4668 O  O     . GLU A 1 662 ? -46.842 -34.111 36.982  1.00 46.06  ? 725  GLU B O     1 
ATOM   4669 C  CB    . GLU A 1 662 ? -45.104 -36.656 36.530  1.00 47.63  ? 725  GLU B CB    1 
ATOM   4670 C  CG    . GLU A 1 662 ? -44.078 -36.249 37.569  1.00 53.53  ? 725  GLU B CG    1 
ATOM   4671 C  CD    . GLU A 1 662 ? -42.887 -37.152 37.630  1.00 56.58  ? 725  GLU B CD    1 
ATOM   4672 O  OE1   . GLU A 1 662 ? -41.951 -36.887 38.373  1.00 48.38  ? 725  GLU B OE1   1 
ATOM   4673 O  OE2   . GLU A 1 662 ? -42.904 -38.153 36.947  1.00 62.00  ? 725  GLU B OE2   1 
ATOM   4674 N  N     . MET A 1 663 ? -46.793 -35.121 38.898  1.00 39.01  ? 726  MET B N     1 
ATOM   4675 C  CA    . MET A 1 663 ? -47.008 -33.904 39.633  1.00 37.48  ? 726  MET B CA    1 
ATOM   4676 C  C     . MET A 1 663 ? -45.764 -33.197 39.963  1.00 39.65  ? 726  MET B C     1 
ATOM   4677 O  O     . MET A 1 663 ? -44.926 -33.743 40.572  1.00 37.75  ? 726  MET B O     1 
ATOM   4678 C  CB    . MET A 1 663 ? -47.671 -34.215 40.925  1.00 35.16  ? 726  MET B CB    1 
ATOM   4679 C  CG    . MET A 1 663 ? -48.857 -35.076 40.766  1.00 39.65  ? 726  MET B CG    1 
ATOM   4680 S  SD    . MET A 1 663 ? -49.986 -34.107 39.867  1.00 45.42  ? 726  MET B SD    1 
ATOM   4681 C  CE    . MET A 1 663 ? -50.792 -33.118 41.067  1.00 40.49  ? 726  MET B CE    1 
ATOM   4682 N  N     . GLN A 1 664 ? -45.694 -31.947 39.564  1.00 33.58  ? 727  GLN B N     1 
ATOM   4683 C  CA    . GLN A 1 664 ? -44.581 -31.099 39.822  1.00 31.97  ? 727  GLN B CA    1 
ATOM   4684 C  C     . GLN A 1 664 ? -45.079 -29.808 40.363  1.00 34.16  ? 727  GLN B C     1 
ATOM   4685 O  O     . GLN A 1 664 ? -46.118 -29.382 40.048  1.00 36.84  ? 727  GLN B O     1 
ATOM   4686 C  CB    . GLN A 1 664 ? -43.868 -30.800 38.554  1.00 28.34  ? 727  GLN B CB    1 
ATOM   4687 C  CG    . GLN A 1 664 ? -42.487 -31.353 38.463  1.00 30.14  ? 727  GLN B CG    1 
ATOM   4688 C  CD    . GLN A 1 664 ? -41.536 -30.374 37.894  1.00 31.76  ? 727  GLN B CD    1 
ATOM   4689 O  OE1   . GLN A 1 664 ? -40.355 -30.556 37.944  1.00 30.77  ? 727  GLN B OE1   1 
ATOM   4690 N  NE2   . GLN A 1 664 ? -42.050 -29.326 37.366  1.00 41.12  ? 727  GLN B NE2   1 
ATOM   4691 N  N     . VAL A 1 665 ? -44.306 -29.182 41.203  1.00 33.10  ? 728  VAL B N     1 
ATOM   4692 C  CA    . VAL A 1 665 ? -44.696 -27.938 41.738  1.00 33.29  ? 728  VAL B CA    1 
ATOM   4693 C  C     . VAL A 1 665 ? -43.886 -26.947 40.996  1.00 28.70  ? 728  VAL B C     1 
ATOM   4694 O  O     . VAL A 1 665 ? -42.704 -26.948 40.997  1.00 29.16  ? 728  VAL B O     1 
ATOM   4695 C  CB    . VAL A 1 665 ? -44.514 -27.887 43.237  1.00 31.68  ? 728  VAL B CB    1 
ATOM   4696 C  CG1   . VAL A 1 665 ? -43.311 -28.661 43.637  1.00 27.98  ? 728  VAL B CG1   1 
ATOM   4697 C  CG2   . VAL A 1 665 ? -44.496 -26.475 43.726  1.00 33.85  ? 728  VAL B CG2   1 
ATOM   4698 N  N     . VAL A 1 666 ? -44.609 -26.125 40.291  1.00 25.92  ? 729  VAL B N     1 
ATOM   4699 C  CA    . VAL A 1 666 ? -44.083 -25.142 39.452  1.00 24.84  ? 729  VAL B CA    1 
ATOM   4700 C  C     . VAL A 1 666 ? -44.707 -23.879 39.847  1.00 26.45  ? 729  VAL B C     1 
ATOM   4701 O  O     . VAL A 1 666 ? -45.851 -23.810 40.049  1.00 26.81  ? 729  VAL B O     1 
ATOM   4702 C  CB    . VAL A 1 666 ? -44.445 -25.475 38.029  1.00 26.99  ? 729  VAL B CB    1 
ATOM   4703 C  CG1   . VAL A 1 666 ? -45.784 -26.123 37.936  1.00 27.41  ? 729  VAL B CG1   1 
ATOM   4704 C  CG2   . VAL A 1 666 ? -44.386 -24.280 37.147  1.00 33.02  ? 729  VAL B CG2   1 
ATOM   4705 N  N     . PRO A 1 667 ? -43.910 -22.865 40.024  1.00 27.61  ? 730  PRO B N     1 
ATOM   4706 C  CA    . PRO A 1 667 ? -44.468 -21.593 40.363  1.00 28.44  ? 730  PRO B CA    1 
ATOM   4707 C  C     . PRO A 1 667 ? -45.022 -20.903 39.161  1.00 36.02  ? 730  PRO B C     1 
ATOM   4708 O  O     . PRO A 1 667 ? -44.410 -20.793 38.164  1.00 35.68  ? 730  PRO B O     1 
ATOM   4709 C  CB    . PRO A 1 667 ? -43.283 -20.860 40.893  1.00 26.58  ? 730  PRO B CB    1 
ATOM   4710 C  CG    . PRO A 1 667 ? -42.157 -21.485 40.228  1.00 30.52  ? 730  PRO B CG    1 
ATOM   4711 C  CD    . PRO A 1 667 ? -42.462 -22.878 40.107  1.00 28.58  ? 730  PRO B CD    1 
ATOM   4712 N  N     . VAL A 1 668 ? -46.226 -20.421 39.286  1.00 32.66  ? 731  VAL B N     1 
ATOM   4713 C  CA    . VAL A 1 668 ? -46.855 -19.714 38.232  1.00 35.33  ? 731  VAL B CA    1 
ATOM   4714 C  C     . VAL A 1 668 ? -47.266 -18.348 38.744  1.00 38.68  ? 731  VAL B C     1 
ATOM   4715 O  O     . VAL A 1 668 ? -47.386 -18.144 39.886  1.00 37.62  ? 731  VAL B O     1 
ATOM   4716 C  CB    . VAL A 1 668 ? -48.069 -20.471 37.701  1.00 30.45  ? 731  VAL B CB    1 
ATOM   4717 C  CG1   . VAL A 1 668 ? -47.753 -21.903 37.410  1.00 30.29  ? 731  VAL B CG1   1 
ATOM   4718 C  CG2   . VAL A 1 668 ? -49.219 -20.405 38.633  1.00 27.45  ? 731  VAL B CG2   1 
ATOM   4719 N  N     . LEU A 1 669 ? -47.472 -17.385 37.880  1.00 38.69  ? 732  LEU B N     1 
ATOM   4720 C  CA    . LEU A 1 669 ? -47.913 -16.075 38.261  1.00 35.06  ? 732  LEU B CA    1 
ATOM   4721 C  C     . LEU A 1 669 ? -49.361 -16.094 38.593  1.00 35.80  ? 732  LEU B C     1 
ATOM   4722 O  O     . LEU A 1 669 ? -50.070 -16.936 38.214  1.00 39.18  ? 732  LEU B O     1 
ATOM   4723 C  CB    . LEU A 1 669 ? -47.687 -15.106 37.135  1.00 39.67  ? 732  LEU B CB    1 
ATOM   4724 C  CG    . LEU A 1 669 ? -46.877 -13.866 37.432  1.00 42.65  ? 732  LEU B CG    1 
ATOM   4725 C  CD1   . LEU A 1 669 ? -45.616 -14.321 38.075  1.00 45.83  ? 732  LEU B CD1   1 
ATOM   4726 C  CD2   . LEU A 1 669 ? -46.513 -13.166 36.168  1.00 36.46  ? 732  LEU B CD2   1 
ATOM   4727 N  N     . VAL A 1 670 ? -49.836 -15.094 39.264  1.00 34.85  ? 733  VAL B N     1 
ATOM   4728 C  CA    . VAL A 1 670 ? -51.209 -15.088 39.705  1.00 35.69  ? 733  VAL B CA    1 
ATOM   4729 C  C     . VAL A 1 670 ? -52.306 -15.138 38.652  1.00 37.46  ? 733  VAL B C     1 
ATOM   4730 O  O     . VAL A 1 670 ? -53.298 -15.765 38.823  1.00 31.54  ? 733  VAL B O     1 
ATOM   4731 C  CB    . VAL A 1 670 ? -51.383 -14.015 40.763  1.00 33.46  ? 733  VAL B CB    1 
ATOM   4732 C  CG1   . VAL A 1 670 ? -51.872 -12.717 40.219  1.00 32.59  ? 733  VAL B CG1   1 
ATOM   4733 C  CG2   . VAL A 1 670 ? -52.263 -14.498 41.838  1.00 36.14  ? 733  VAL B CG2   1 
ATOM   4734 N  N     . HIS A 1 671 ? -52.092 -14.509 37.529  1.00 35.00  ? 734  HIS B N     1 
ATOM   4735 C  CA    . HIS A 1 671 ? -53.066 -14.435 36.497  1.00 38.18  ? 734  HIS B CA    1 
ATOM   4736 C  C     . HIS A 1 671 ? -53.320 -15.670 35.682  1.00 40.30  ? 734  HIS B C     1 
ATOM   4737 O  O     . HIS A 1 671 ? -54.246 -15.722 34.933  1.00 42.78  ? 734  HIS B O     1 
ATOM   4738 C  CB    . HIS A 1 671 ? -52.827 -13.208 35.644  1.00 38.05  ? 734  HIS B CB    1 
ATOM   4739 C  CG    . HIS A 1 671 ? -51.573 -13.250 34.858  1.00 35.47  ? 734  HIS B CG    1 
ATOM   4740 N  ND1   . HIS A 1 671 ? -50.361 -12.925 35.387  1.00 41.96  ? 734  HIS B ND1   1 
ATOM   4741 C  CD2   . HIS A 1 671 ? -51.354 -13.535 33.566  1.00 27.72  ? 734  HIS B CD2   1 
ATOM   4742 C  CE1   . HIS A 1 671 ? -49.443 -13.044 34.460  1.00 36.34  ? 734  HIS B CE1   1 
ATOM   4743 N  NE2   . HIS A 1 671 ? -50.024 -13.411 33.347  1.00 31.21  ? 734  HIS B NE2   1 
ATOM   4744 N  N     . LEU A 1 672 ? -52.503 -16.675 35.823  1.00 36.73  ? 735  LEU B N     1 
ATOM   4745 C  CA    . LEU A 1 672 ? -52.681 -17.888 35.114  1.00 34.50  ? 735  LEU B CA    1 
ATOM   4746 C  C     . LEU A 1 672 ? -53.640 -18.841 35.741  1.00 37.76  ? 735  LEU B C     1 
ATOM   4747 O  O     . LEU A 1 672 ? -53.811 -19.895 35.236  1.00 40.51  ? 735  LEU B O     1 
ATOM   4748 C  CB    . LEU A 1 672 ? -51.376 -18.596 35.015  1.00 35.38  ? 735  LEU B CB    1 
ATOM   4749 C  CG    . LEU A 1 672 ? -50.251 -17.700 34.691  1.00 38.79  ? 735  LEU B CG    1 
ATOM   4750 C  CD1   . LEU A 1 672 ? -49.131 -18.563 34.276  1.00 42.59  ? 735  LEU B CD1   1 
ATOM   4751 C  CD2   . LEU A 1 672 ? -50.703 -16.964 33.507  1.00 41.72  ? 735  LEU B CD2   1 
ATOM   4752 N  N     . LEU A 1 673 ? -54.204 -18.540 36.883  1.00 35.00  ? 736  LEU B N     1 
ATOM   4753 C  CA    . LEU A 1 673 ? -55.142 -19.445 37.456  1.00 40.33  ? 736  LEU B CA    1 
ATOM   4754 C  C     . LEU A 1 673 ? -56.476 -19.023 36.971  1.00 34.13  ? 736  LEU B C     1 
ATOM   4755 O  O     . LEU A 1 673 ? -56.867 -17.909 37.086  1.00 33.10  ? 736  LEU B O     1 
ATOM   4756 C  CB    . LEU A 1 673 ? -55.012 -19.611 38.977  1.00 36.82  ? 736  LEU B CB    1 
ATOM   4757 C  CG    . LEU A 1 673 ? -54.528 -18.529 39.895  1.00 34.67  ? 736  LEU B CG    1 
ATOM   4758 C  CD1   . LEU A 1 673 ? -55.679 -17.599 39.961  1.00 46.39  ? 736  LEU B CD1   1 
ATOM   4759 C  CD2   . LEU A 1 673 ? -54.242 -19.006 41.272  1.00 25.44  ? 736  LEU B CD2   1 
ATOM   4760 N  N     . SER A 1 674 ? -57.114 -19.965 36.322  1.00 31.70  ? 737  SER B N     1 
ATOM   4761 C  CA    . SER A 1 674 ? -58.401 -19.805 35.748  1.00 35.33  ? 737  SER B CA    1 
ATOM   4762 C  C     . SER A 1 674 ? -59.523 -20.205 36.638  1.00 39.78  ? 737  SER B C     1 
ATOM   4763 O  O     . SER A 1 674 ? -60.594 -19.765 36.472  1.00 41.99  ? 737  SER B O     1 
ATOM   4764 C  CB    . SER A 1 674 ? -58.465 -20.570 34.452  1.00 35.47  ? 737  SER B CB    1 
ATOM   4765 O  OG    . SER A 1 674 ? -57.679 -21.718 34.451  1.00 32.76  ? 737  SER B OG    1 
ATOM   4766 N  N     . ALA A 1 675 ? -59.279 -21.053 37.596  1.00 38.78  ? 738  ALA B N     1 
ATOM   4767 C  CA    . ALA A 1 675 ? -60.321 -21.446 38.477  1.00 36.33  ? 738  ALA B CA    1 
ATOM   4768 C  C     . ALA A 1 675 ? -59.835 -21.714 39.847  1.00 36.70  ? 738  ALA B C     1 
ATOM   4769 O  O     . ALA A 1 675 ? -58.769 -22.127 40.025  1.00 34.11  ? 738  ALA B O     1 
ATOM   4770 C  CB    . ALA A 1 675 ? -61.029 -22.641 37.918  1.00 35.70  ? 738  ALA B CB    1 
ATOM   4771 N  N     . ILE A 1 676 ? -60.656 -21.436 40.828  1.00 39.66  ? 739  ILE B N     1 
ATOM   4772 C  CA    . ILE A 1 676 ? -60.368 -21.647 42.225  1.00 34.94  ? 739  ILE B CA    1 
ATOM   4773 C  C     . ILE A 1 676 ? -61.547 -22.425 42.770  1.00 38.50  ? 739  ILE B C     1 
ATOM   4774 O  O     . ILE A 1 676 ? -62.625 -22.145 42.425  1.00 47.11  ? 739  ILE B O     1 
ATOM   4775 C  CB    . ILE A 1 676 ? -60.258 -20.313 42.958  1.00 34.15  ? 739  ILE B CB    1 
ATOM   4776 C  CG1   . ILE A 1 676 ? -59.319 -19.372 42.237  1.00 31.29  ? 739  ILE B CG1   1 
ATOM   4777 C  CG2   . ILE A 1 676 ? -59.713 -20.530 44.328  1.00 33.55  ? 739  ILE B CG2   1 
ATOM   4778 C  CD1   . ILE A 1 676 ? -59.036 -18.069 42.901  1.00 35.31  ? 739  ILE B CD1   1 
ATOM   4779 N  N     . SER A 1 677 ? -61.360 -23.359 43.660  1.00 35.71  ? 740  SER B N     1 
ATOM   4780 C  CA    . SER A 1 677 ? -62.458 -24.134 44.118  1.00 44.53  ? 740  SER B CA    1 
ATOM   4781 C  C     . SER A 1 677 ? -62.569 -24.155 45.573  1.00 51.20  ? 740  SER B C     1 
ATOM   4782 O  O     . SER A 1 677 ? -61.724 -23.691 46.256  1.00 52.42  ? 740  SER B O     1 
ATOM   4783 C  CB    . SER A 1 677 ? -62.286 -25.562 43.695  1.00 51.16  ? 740  SER B CB    1 
ATOM   4784 N  N     . SER A 1 678 ? -63.705 -24.631 46.027  1.00 50.39  ? 741  SER B N     1 
ATOM   4785 C  CA    . SER A 1 678 ? -64.006 -24.807 47.402  1.00 48.67  ? 741  SER B CA    1 
ATOM   4786 C  C     . SER A 1 678 ? -63.157 -25.829 47.998  1.00 51.27  ? 741  SER B C     1 
ATOM   4787 O  O     . SER A 1 678 ? -62.710 -25.682 49.068  1.00 57.17  ? 741  SER B O     1 
ATOM   4788 C  CB    . SER A 1 678 ? -65.368 -25.380 47.519  1.00 51.47  ? 741  SER B CB    1 
ATOM   4789 O  OG    . SER A 1 678 ? -66.289 -24.428 47.151  1.00 66.88  ? 741  SER B OG    1 
ATOM   4790 N  N     . VAL A 1 679 ? -62.924 -26.889 47.278  1.00 47.22  ? 742  VAL B N     1 
ATOM   4791 C  CA    . VAL A 1 679 ? -62.204 -27.984 47.821  1.00 46.09  ? 742  VAL B CA    1 
ATOM   4792 C  C     . VAL A 1 679 ? -60.830 -27.685 48.252  1.00 42.17  ? 742  VAL B C     1 
ATOM   4793 O  O     . VAL A 1 679 ? -60.109 -27.021 47.626  1.00 44.81  ? 742  VAL B O     1 
ATOM   4794 C  CB    . VAL A 1 679 ? -62.143 -29.064 46.776  1.00 51.25  ? 742  VAL B CB    1 
ATOM   4795 C  CG1   . VAL A 1 679 ? -61.759 -30.382 47.355  1.00 40.55  ? 742  VAL B CG1   1 
ATOM   4796 C  CG2   . VAL A 1 679 ? -63.504 -29.209 46.164  1.00 54.83  ? 742  VAL B CG2   1 
ATOM   4797 N  N     . ARG A 1 680 ? -60.497 -28.200 49.406  1.00 38.95  ? 743  ARG B N     1 
ATOM   4798 C  CA    . ARG A 1 680 ? -59.180 -28.133 49.945  1.00 37.85  ? 743  ARG B CA    1 
ATOM   4799 C  C     . ARG A 1 680 ? -58.861 -29.544 50.249  1.00 42.58  ? 743  ARG B C     1 
ATOM   4800 O  O     . ARG A 1 680 ? -59.633 -30.241 50.812  1.00 39.42  ? 743  ARG B O     1 
ATOM   4801 C  CB    . ARG A 1 680 ? -59.132 -27.486 51.291  1.00 43.07  ? 743  ARG B CB    1 
ATOM   4802 C  CG    . ARG A 1 680 ? -59.440 -26.047 51.401  1.00 41.11  ? 743  ARG B CG    1 
ATOM   4803 C  CD    . ARG A 1 680 ? -58.255 -25.158 51.611  1.00 39.71  ? 743  ARG B CD    1 
ATOM   4804 N  NE    . ARG A 1 680 ? -57.040 -25.654 52.211  1.00 50.64  ? 743  ARG B NE    1 
ATOM   4805 C  CZ    . ARG A 1 680 ? -56.521 -25.251 53.361  1.00 45.53  ? 743  ARG B CZ    1 
ATOM   4806 N  NH1   . ARG A 1 680 ? -55.373 -25.719 53.743  1.00 39.05  ? 743  ARG B NH1   1 
ATOM   4807 N  NH2   . ARG A 1 680 ? -57.141 -24.415 54.129  1.00 40.72  ? 743  ARG B NH2   1 
ATOM   4808 N  N     . LEU A 1 681 ? -57.683 -29.979 49.936  1.00 42.63  ? 744  LEU B N     1 
ATOM   4809 C  CA    . LEU A 1 681 ? -57.358 -31.345 50.244  1.00 45.68  ? 744  LEU B CA    1 
ATOM   4810 C  C     . LEU A 1 681 ? -56.116 -31.548 51.028  1.00 44.05  ? 744  LEU B C     1 
ATOM   4811 O  O     . LEU A 1 681 ? -55.374 -30.659 51.209  1.00 40.89  ? 744  LEU B O     1 
ATOM   4812 C  CB    . LEU A 1 681 ? -57.424 -32.247 49.046  1.00 39.97  ? 744  LEU B CB    1 
ATOM   4813 C  CG    . LEU A 1 681 ? -56.578 -32.003 47.861  1.00 36.22  ? 744  LEU B CG    1 
ATOM   4814 C  CD1   . LEU A 1 681 ? -56.768 -33.204 47.005  1.00 38.45  ? 744  LEU B CD1   1 
ATOM   4815 C  CD2   . LEU A 1 681 ? -57.232 -30.841 47.216  1.00 41.51  ? 744  LEU B CD2   1 
ATOM   4816 N  N     . TYR A 1 682 ? -56.003 -32.726 51.605  1.00 40.99  ? 745  TYR B N     1 
ATOM   4817 C  CA    . TYR A 1 682 ? -54.911 -33.113 52.425  1.00 36.05  ? 745  TYR B CA    1 
ATOM   4818 C  C     . TYR A 1 682 ? -53.763 -33.303 51.582  1.00 38.94  ? 745  TYR B C     1 
ATOM   4819 O  O     . TYR A 1 682 ? -53.809 -34.027 50.648  1.00 46.11  ? 745  TYR B O     1 
ATOM   4820 C  CB    . TYR A 1 682 ? -55.208 -34.435 53.042  1.00 34.40  ? 745  TYR B CB    1 
ATOM   4821 N  N     . ILE A 1 683 ? -52.640 -32.799 52.031  1.00 45.48  ? 746  ILE B N     1 
ATOM   4822 C  CA    . ILE A 1 683 ? -51.398 -32.857 51.329  1.00 44.05  ? 746  ILE B CA    1 
ATOM   4823 C  C     . ILE A 1 683 ? -50.347 -33.435 52.225  1.00 42.49  ? 746  ILE B C     1 
ATOM   4824 O  O     . ILE A 1 683 ? -50.256 -33.065 53.346  1.00 42.60  ? 746  ILE B O     1 
ATOM   4825 C  CB    . ILE A 1 683 ? -50.964 -31.430 51.026  1.00 37.73  ? 746  ILE B CB    1 
ATOM   4826 N  N     . PRO A 1 684 ? -49.536 -34.332 51.730  1.00 35.65  ? 747  PRO B N     1 
ATOM   4827 C  CA    . PRO A 1 684 ? -48.498 -34.926 52.530  1.00 38.14  ? 747  PRO B CA    1 
ATOM   4828 C  C     . PRO A 1 684 ? -47.483 -33.894 52.717  1.00 39.30  ? 747  PRO B C     1 
ATOM   4829 O  O     . PRO A 1 684 ? -47.459 -33.040 51.931  1.00 42.67  ? 747  PRO B O     1 
ATOM   4830 C  CB    . PRO A 1 684 ? -47.946 -35.975 51.626  1.00 29.51  ? 747  PRO B CB    1 
ATOM   4831 C  CG    . PRO A 1 684 ? -49.041 -36.296 50.773  1.00 42.54  ? 747  PRO B CG    1 
ATOM   4832 C  CD    . PRO A 1 684 ? -49.655 -35.009 50.464  1.00 43.04  ? 747  PRO B CD    1 
ATOM   4833 N  N     . LYS A 1 685 ? -46.681 -33.942 53.748  1.00 39.79  ? 748  LYS B N     1 
ATOM   4834 C  CA    . LYS A 1 685 ? -45.809 -32.840 54.033  1.00 40.09  ? 748  LYS B CA    1 
ATOM   4835 C  C     . LYS A 1 685 ? -44.441 -32.845 53.412  1.00 46.48  ? 748  LYS B C     1 
ATOM   4836 O  O     . LYS A 1 685 ? -43.714 -31.902 53.611  1.00 44.06  ? 748  LYS B O     1 
ATOM   4837 C  CB    . LYS A 1 685 ? -45.651 -32.625 55.519  1.00 30.50  ? 748  LYS B CB    1 
ATOM   4838 N  N     . ASP A 1 686 ? -44.057 -33.895 52.699  1.00 42.52  ? 749  ASP B N     1 
ATOM   4839 C  CA    . ASP A 1 686 ? -42.827 -33.863 51.954  1.00 38.15  ? 749  ASP B CA    1 
ATOM   4840 C  C     . ASP A 1 686 ? -43.318 -34.165 50.601  1.00 46.21  ? 749  ASP B C     1 
ATOM   4841 O  O     . ASP A 1 686 ? -43.834 -35.210 50.387  1.00 45.11  ? 749  ASP B O     1 
ATOM   4842 C  CB    . ASP A 1 686 ? -41.909 -34.955 52.441  1.00 34.41  ? 749  ASP B CB    1 
ATOM   4843 C  CG    . ASP A 1 686 ? -40.542 -34.838 51.926  1.00 42.22  ? 749  ASP B CG    1 
ATOM   4844 O  OD1   . ASP A 1 686 ? -40.365 -34.413 50.817  1.00 44.48  ? 749  ASP B OD1   1 
ATOM   4845 O  OD2   . ASP A 1 686 ? -39.637 -35.218 52.619  1.00 42.77  ? 749  ASP B OD2   1 
ATOM   4846 N  N     . LEU A 1 687 ? -43.164 -33.247 49.676  1.00 42.18  ? 750  LEU B N     1 
ATOM   4847 C  CA    . LEU A 1 687 ? -43.646 -33.453 48.356  1.00 35.23  ? 750  LEU B CA    1 
ATOM   4848 C  C     . LEU A 1 687 ? -42.530 -33.830 47.443  1.00 38.96  ? 750  LEU B C     1 
ATOM   4849 O  O     . LEU A 1 687 ? -42.702 -33.915 46.282  1.00 44.02  ? 750  LEU B O     1 
ATOM   4850 C  CB    . LEU A 1 687 ? -44.255 -32.171 47.903  1.00 34.59  ? 750  LEU B CB    1 
ATOM   4851 C  CG    . LEU A 1 687 ? -45.728 -32.146 47.653  1.00 35.08  ? 750  LEU B CG    1 
ATOM   4852 C  CD1   . LEU A 1 687 ? -46.365 -33.353 48.235  1.00 38.55  ? 750  LEU B CD1   1 
ATOM   4853 C  CD2   . LEU A 1 687 ? -46.345 -30.915 48.220  1.00 33.26  ? 750  LEU B CD2   1 
ATOM   4854 N  N     . ARG A 1 688 ? -41.351 -33.991 47.982  1.00 37.03  ? 751  ARG B N     1 
ATOM   4855 C  CA    . ARG A 1 688 ? -40.204 -34.197 47.157  1.00 41.19  ? 751  ARG B CA    1 
ATOM   4856 C  C     . ARG A 1 688 ? -40.196 -35.485 46.368  1.00 43.03  ? 751  ARG B C     1 
ATOM   4857 O  O     . ARG A 1 688 ? -39.739 -35.504 45.260  1.00 46.34  ? 751  ARG B O     1 
ATOM   4858 C  CB    . ARG A 1 688 ? -38.938 -34.022 47.957  1.00 35.91  ? 751  ARG B CB    1 
ATOM   4859 C  CG    . ARG A 1 688 ? -39.088 -33.170 49.181  1.00 40.58  ? 751  ARG B CG    1 
ATOM   4860 C  CD    . ARG A 1 688 ? -37.934 -32.215 49.336  1.00 41.56  ? 751  ARG B CD    1 
ATOM   4861 N  NE    . ARG A 1 688 ? -37.062 -32.468 50.474  1.00 39.72  ? 751  ARG B NE    1 
ATOM   4862 C  CZ    . ARG A 1 688 ? -37.426 -32.980 51.629  1.00 41.22  ? 751  ARG B CZ    1 
ATOM   4863 N  NH1   . ARG A 1 688 ? -38.652 -33.295 51.848  1.00 45.25  ? 751  ARG B NH1   1 
ATOM   4864 N  NH2   . ARG A 1 688 ? -36.563 -33.170 52.576  1.00 39.91  ? 751  ARG B NH2   1 
ATOM   4865 N  N     . PRO A 1 689 ? -40.653 -36.560 46.975  1.00 37.40  ? 752  PRO B N     1 
ATOM   4866 C  CA    . PRO A 1 689 ? -40.733 -37.868 46.384  1.00 40.65  ? 752  PRO B CA    1 
ATOM   4867 C  C     . PRO A 1 689 ? -41.809 -37.977 45.359  1.00 54.58  ? 752  PRO B C     1 
ATOM   4868 O  O     . PRO A 1 689 ? -42.834 -37.424 45.516  1.00 51.18  ? 752  PRO B O     1 
ATOM   4869 C  CB    . PRO A 1 689 ? -41.160 -38.701 47.536  1.00 38.86  ? 752  PRO B CB    1 
ATOM   4870 C  CG    . PRO A 1 689 ? -40.690 -38.021 48.702  1.00 33.83  ? 752  PRO B CG    1 
ATOM   4871 C  CD    . PRO A 1 689 ? -40.778 -36.615 48.418  1.00 42.77  ? 752  PRO B CD    1 
ATOM   4872 N  N     . VAL A 1 690 ? -41.604 -38.756 44.330  1.00 54.89  ? 753  VAL B N     1 
ATOM   4873 C  CA    . VAL A 1 690 ? -42.581 -38.838 43.303  1.00 51.73  ? 753  VAL B CA    1 
ATOM   4874 C  C     . VAL A 1 690 ? -43.808 -39.384 43.881  1.00 51.76  ? 753  VAL B C     1 
ATOM   4875 O  O     . VAL A 1 690 ? -44.877 -38.945 43.590  1.00 54.66  ? 753  VAL B O     1 
ATOM   4876 C  CB    . VAL A 1 690 ? -42.156 -39.838 42.260  1.00 49.01  ? 753  VAL B CB    1 
ATOM   4877 C  CG1   . VAL A 1 690 ? -42.902 -39.600 40.992  1.00 53.03  ? 753  VAL B CG1   1 
ATOM   4878 C  CG2   . VAL A 1 690 ? -40.682 -39.735 42.019  1.00 46.65  ? 753  VAL B CG2   1 
ATOM   4879 N  N     . ASP A 1 691 ? -43.644 -40.380 44.708  1.00 46.09  ? 754  ASP B N     1 
ATOM   4880 C  CA    . ASP A 1 691 ? -44.758 -41.099 45.225  1.00 53.84  ? 754  ASP B CA    1 
ATOM   4881 C  C     . ASP A 1 691 ? -45.643 -40.276 46.047  1.00 59.63  ? 754  ASP B C     1 
ATOM   4882 O  O     . ASP A 1 691 ? -46.832 -40.456 46.000  1.00 56.59  ? 754  ASP B O     1 
ATOM   4883 C  CB    . ASP A 1 691 ? -44.237 -42.194 46.093  1.00 53.47  ? 754  ASP B CB    1 
ATOM   4884 C  CG    . ASP A 1 691 ? -43.021 -42.782 45.559  1.00 64.66  ? 754  ASP B CG    1 
ATOM   4885 O  OD1   . ASP A 1 691 ? -43.066 -43.309 44.446  1.00 65.95  ? 754  ASP B OD1   1 
ATOM   4886 O  OD2   . ASP A 1 691 ? -42.015 -42.693 46.246  1.00 65.76  ? 754  ASP B OD2   1 
ATOM   4887 N  N     . ASN A 1 692 ? -45.056 -39.454 46.887  1.00 58.21  ? 755  ASN B N     1 
ATOM   4888 C  CA    . ASN A 1 692 ? -45.798 -38.544 47.708  1.00 50.93  ? 755  ASN B CA    1 
ATOM   4889 C  C     . ASN A 1 692 ? -46.473 -37.494 46.884  1.00 46.04  ? 755  ASN B C     1 
ATOM   4890 O  O     . ASN A 1 692 ? -47.514 -37.082 47.208  1.00 48.26  ? 755  ASN B O     1 
ATOM   4891 C  CB    . ASN A 1 692 ? -44.942 -37.960 48.799  1.00 51.86  ? 755  ASN B CB    1 
ATOM   4892 N  N     . ARG A 1 693 ? -45.851 -36.995 45.841  1.00 47.48  ? 756  ARG B N     1 
ATOM   4893 C  CA    . ARG A 1 693 ? -46.507 -36.028 44.956  1.00 45.73  ? 756  ARG B CA    1 
ATOM   4894 C  C     . ARG A 1 693 ? -47.566 -36.657 44.108  1.00 42.93  ? 756  ARG B C     1 
ATOM   4895 O  O     . ARG A 1 693 ? -48.550 -36.073 43.751  1.00 44.41  ? 756  ARG B O     1 
ATOM   4896 C  CB    . ARG A 1 693 ? -45.522 -35.266 44.120  1.00 44.30  ? 756  ARG B CB    1 
ATOM   4897 N  N     . GLN A 1 694 ? -47.366 -37.923 43.811  1.00 48.35  ? 757  GLN B N     1 
ATOM   4898 C  CA    . GLN A 1 694 ? -48.272 -38.736 43.035  1.00 49.88  ? 757  GLN B CA    1 
ATOM   4899 C  C     . GLN A 1 694 ? -49.601 -38.919 43.684  1.00 54.12  ? 757  GLN B C     1 
ATOM   4900 O  O     . GLN A 1 694 ? -50.592 -39.015 43.008  1.00 47.93  ? 757  GLN B O     1 
ATOM   4901 C  CB    . GLN A 1 694 ? -47.657 -40.066 42.772  1.00 40.81  ? 757  GLN B CB    1 
ATOM   4902 C  CG    . GLN A 1 694 ? -47.466 -40.352 41.323  1.00 43.93  ? 757  GLN B CG    1 
ATOM   4903 C  CD    . GLN A 1 694 ? -47.309 -39.125 40.530  1.00 42.66  ? 757  GLN B CD    1 
ATOM   4904 O  OE1   . GLN A 1 694 ? -48.072 -38.843 39.654  1.00 43.92  ? 757  GLN B OE1   1 
ATOM   4905 N  NE2   . GLN A 1 694 ? -46.317 -38.392 40.841  1.00 52.12  ? 757  GLN B NE2   1 
ATOM   4906 N  N     . SER A 1 695 ? -49.583 -38.961 45.009  1.00 54.45  ? 758  SER B N     1 
ATOM   4907 C  CA    . SER A 1 695 ? -50.673 -39.120 45.929  1.00 45.32  ? 758  SER B CA    1 
ATOM   4908 C  C     . SER A 1 695 ? -51.707 -38.048 45.753  1.00 41.16  ? 758  SER B C     1 
ATOM   4909 O  O     . SER A 1 695 ? -52.848 -38.313 45.894  1.00 35.62  ? 758  SER B O     1 
ATOM   4910 C  CB    . SER A 1 695 ? -50.079 -39.077 47.307  1.00 44.70  ? 758  SER B CB    1 
ATOM   4911 O  OG    . SER A 1 695 ? -51.040 -38.768 48.252  1.00 50.70  ? 758  SER B OG    1 
ATOM   4912 N  N     . VAL A 1 696 ? -51.315 -36.826 45.460  1.00 42.89  ? 759  VAL B N     1 
ATOM   4913 C  CA    . VAL A 1 696 ? -52.268 -35.765 45.203  1.00 49.09  ? 759  VAL B CA    1 
ATOM   4914 C  C     . VAL A 1 696 ? -53.097 -36.030 43.965  1.00 49.43  ? 759  VAL B C     1 
ATOM   4915 O  O     . VAL A 1 696 ? -54.253 -35.703 43.918  1.00 40.08  ? 759  VAL B O     1 
ATOM   4916 C  CB    . VAL A 1 696 ? -51.619 -34.421 45.105  1.00 35.32  ? 759  VAL B CB    1 
ATOM   4917 C  CG1   . VAL A 1 696 ? -52.636 -33.404 45.472  1.00 38.90  ? 759  VAL B CG1   1 
ATOM   4918 C  CG2   . VAL A 1 696 ? -50.504 -34.345 46.084  1.00 37.40  ? 759  VAL B CG2   1 
ATOM   4919 N  N     . LEU A 1 697 ? -52.501 -36.629 42.953  1.00 44.11  ? 760  LEU B N     1 
ATOM   4920 C  CA    . LEU A 1 697 ? -53.237 -36.938 41.764  1.00 48.18  ? 760  LEU B CA    1 
ATOM   4921 C  C     . LEU A 1 697 ? -54.397 -37.874 42.061  1.00 45.99  ? 760  LEU B C     1 
ATOM   4922 O  O     . LEU A 1 697 ? -55.452 -37.682 41.592  1.00 46.63  ? 760  LEU B O     1 
ATOM   4923 C  CB    . LEU A 1 697 ? -52.320 -37.543 40.724  1.00 45.45  ? 760  LEU B CB    1 
ATOM   4924 C  CG    . LEU A 1 697 ? -52.676 -37.043 39.336  1.00 45.46  ? 760  LEU B CG    1 
ATOM   4925 C  CD1   . LEU A 1 697 ? -52.354 -38.063 38.298  1.00 45.16  ? 760  LEU B CD1   1 
ATOM   4926 C  CD2   . LEU A 1 697 ? -54.139 -36.750 39.292  1.00 39.00  ? 760  LEU B CD2   1 
ATOM   4927 N  N     . LYS A 1 698 ? -54.196 -38.876 42.884  1.00 46.93  ? 761  LYS B N     1 
ATOM   4928 C  CA    . LYS A 1 698 ? -55.244 -39.784 43.268  1.00 45.95  ? 761  LYS B CA    1 
ATOM   4929 C  C     . LYS A 1 698 ? -56.284 -39.049 44.032  1.00 50.36  ? 761  LYS B C     1 
ATOM   4930 O  O     . LYS A 1 698 ? -57.425 -39.292 43.853  1.00 51.39  ? 761  LYS B O     1 
ATOM   4931 C  CB    . LYS A 1 698 ? -54.699 -40.912 44.113  1.00 33.93  ? 761  LYS B CB    1 
ATOM   4932 N  N     . SER A 1 699 ? -55.885 -38.155 44.915  1.00 47.63  ? 762  SER B N     1 
ATOM   4933 C  CA    . SER A 1 699 ? -56.795 -37.343 45.671  1.00 50.07  ? 762  SER B CA    1 
ATOM   4934 C  C     . SER A 1 699 ? -57.588 -36.445 44.795  1.00 51.94  ? 762  SER B C     1 
ATOM   4935 O  O     . SER A 1 699 ? -58.728 -36.211 45.028  1.00 44.04  ? 762  SER B O     1 
ATOM   4936 C  CB    . SER A 1 699 ? -56.018 -36.475 46.601  1.00 49.17  ? 762  SER B CB    1 
ATOM   4937 O  OG    . SER A 1 699 ? -55.778 -37.149 47.799  1.00 60.94  ? 762  SER B OG    1 
ATOM   4938 N  N     . ILE A 1 700 ? -56.949 -35.891 43.791  1.00 51.10  ? 763  ILE B N     1 
ATOM   4939 C  CA    . ILE A 1 700 ? -57.654 -35.049 42.890  1.00 44.78  ? 763  ILE B CA    1 
ATOM   4940 C  C     . ILE A 1 700 ? -58.694 -35.838 42.195  1.00 50.22  ? 763  ILE B C     1 
ATOM   4941 O  O     . ILE A 1 700 ? -59.755 -35.370 42.069  1.00 54.02  ? 763  ILE B O     1 
ATOM   4942 C  CB    . ILE A 1 700 ? -56.750 -34.477 41.831  1.00 42.07  ? 763  ILE B CB    1 
ATOM   4943 C  CG1   . ILE A 1 700 ? -55.898 -33.390 42.398  1.00 42.21  ? 763  ILE B CG1   1 
ATOM   4944 C  CG2   . ILE A 1 700 ? -57.580 -33.841 40.780  1.00 42.85  ? 763  ILE B CG2   1 
ATOM   4945 C  CD1   . ILE A 1 700 ? -54.886 -32.894 41.442  1.00 34.70  ? 763  ILE B CD1   1 
ATOM   4946 N  N     . GLN A 1 701 ? -58.416 -37.035 41.723  1.00 55.34  ? 764  GLN B N     1 
ATOM   4947 C  CA    . GLN A 1 701 ? -59.461 -37.800 41.076  1.00 51.90  ? 764  GLN B CA    1 
ATOM   4948 C  C     . GLN A 1 701 ? -60.551 -38.246 41.983  1.00 51.94  ? 764  GLN B C     1 
ATOM   4949 O  O     . GLN A 1 701 ? -61.649 -38.401 41.558  1.00 54.46  ? 764  GLN B O     1 
ATOM   4950 C  CB    . GLN A 1 701 ? -59.000 -38.890 40.145  1.00 50.05  ? 764  GLN B CB    1 
ATOM   4951 C  CG    . GLN A 1 701 ? -57.742 -39.619 40.462  1.00 46.31  ? 764  GLN B CG    1 
ATOM   4952 C  CD    . GLN A 1 701 ? -56.944 -39.847 39.220  1.00 57.73  ? 764  GLN B CD    1 
ATOM   4953 O  OE1   . GLN A 1 701 ? -56.244 -40.822 39.098  1.00 60.14  ? 764  GLN B OE1   1 
ATOM   4954 N  NE2   . GLN A 1 701 ? -57.051 -38.936 38.291  1.00 52.62  ? 764  GLN B NE2   1 
ATOM   4955 N  N     . GLU A 1 702 ? -60.252 -38.489 43.244  1.00 54.30  ? 765  GLU B N     1 
ATOM   4956 C  CA    . GLU A 1 702 ? -61.271 -38.860 44.183  1.00 53.02  ? 765  GLU B CA    1 
ATOM   4957 C  C     . GLU A 1 702 ? -62.245 -37.725 44.298  1.00 54.51  ? 765  GLU B C     1 
ATOM   4958 O  O     . GLU A 1 702 ? -63.409 -37.969 44.398  1.00 55.43  ? 765  GLU B O     1 
ATOM   4959 C  CB    . GLU A 1 702 ? -60.674 -39.187 45.529  1.00 57.83  ? 765  GLU B CB    1 
ATOM   4960 N  N     . VAL A 1 703 ? -61.804 -36.483 44.378  1.00 54.64  ? 766  VAL B N     1 
ATOM   4961 C  CA    . VAL A 1 703 ? -62.774 -35.418 44.318  1.00 54.34  ? 766  VAL B CA    1 
ATOM   4962 C  C     . VAL A 1 703 ? -63.415 -35.330 42.956  1.00 53.77  ? 766  VAL B C     1 
ATOM   4963 O  O     . VAL A 1 703 ? -64.540 -34.974 42.861  1.00 55.84  ? 766  VAL B O     1 
ATOM   4964 C  CB    . VAL A 1 703 ? -62.366 -34.062 44.851  1.00 55.43  ? 766  VAL B CB    1 
ATOM   4965 C  CG1   . VAL A 1 703 ? -61.050 -34.084 45.522  1.00 52.06  ? 766  VAL B CG1   1 
ATOM   4966 C  CG2   . VAL A 1 703 ? -62.481 -32.996 43.805  1.00 59.99  ? 766  VAL B CG2   1 
ATOM   4967 N  N     . GLN A 1 704 ? -62.699 -35.598 41.884  1.00 54.90  ? 767  GLN B N     1 
ATOM   4968 C  CA    . GLN A 1 704 ? -63.330 -35.551 40.580  1.00 59.26  ? 767  GLN B CA    1 
ATOM   4969 C  C     . GLN A 1 704 ? -64.418 -36.592 40.483  1.00 64.13  ? 767  GLN B C     1 
ATOM   4970 O  O     . GLN A 1 704 ? -65.474 -36.345 39.963  1.00 59.21  ? 767  GLN B O     1 
ATOM   4971 C  CB    . GLN A 1 704 ? -62.338 -35.832 39.474  1.00 59.49  ? 767  GLN B CB    1 
ATOM   4972 C  CG    . GLN A 1 704 ? -61.723 -34.634 38.799  1.00 56.62  ? 767  GLN B CG    1 
ATOM   4973 C  CD    . GLN A 1 704 ? -60.455 -35.022 38.101  1.00 63.42  ? 767  GLN B CD    1 
ATOM   4974 O  OE1   . GLN A 1 704 ? -60.028 -36.154 38.190  1.00 68.24  ? 767  GLN B OE1   1 
ATOM   4975 N  NE2   . GLN A 1 704 ? -59.855 -34.094 37.390  1.00 54.67  ? 767  GLN B NE2   1 
ATOM   4976 N  N     . LYS A 1 705 ? -64.161 -37.785 40.980  1.00 56.57  ? 768  LYS B N     1 
ATOM   4977 C  CA    . LYS A 1 705 ? -65.155 -38.823 40.952  1.00 53.13  ? 768  LYS B CA    1 
ATOM   4978 C  C     . LYS A 1 705 ? -66.343 -38.461 41.798  1.00 57.30  ? 768  LYS B C     1 
ATOM   4979 O  O     . LYS A 1 705 ? -67.451 -38.753 41.462  1.00 59.28  ? 768  LYS B O     1 
ATOM   4980 C  CB    . LYS A 1 705 ? -64.560 -40.138 41.401  1.00 52.30  ? 768  LYS B CB    1 
ATOM   4981 N  N     . ARG A 1 706 ? -66.104 -37.864 42.937  1.00 54.20  ? 769  ARG B N     1 
ATOM   4982 C  CA    . ARG A 1 706 ? -67.171 -37.462 43.807  1.00 54.38  ? 769  ARG B CA    1 
ATOM   4983 C  C     . ARG A 1 706 ? -68.094 -36.407 43.270  1.00 62.68  ? 769  ARG B C     1 
ATOM   4984 O  O     . ARG A 1 706 ? -69.201 -36.341 43.677  1.00 60.13  ? 769  ARG B O     1 
ATOM   4985 C  CB    . ARG A 1 706 ? -66.620 -37.009 45.135  1.00 55.87  ? 769  ARG B CB    1 
ATOM   4986 N  N     . PHE A 1 707 ? -67.592 -35.444 42.519  1.00 69.35  ? 770  PHE B N     1 
ATOM   4987 C  CA    . PHE A 1 707 ? -68.413 -34.387 41.937  1.00 67.31  ? 770  PHE B CA    1 
ATOM   4988 C  C     . PHE A 1 707 ? -68.275 -34.508 40.446  1.00 62.18  ? 770  PHE B C     1 
ATOM   4989 O  O     . PHE A 1 707 ? -67.359 -33.989 39.881  1.00 60.62  ? 770  PHE B O     1 
ATOM   4990 C  CB    . PHE A 1 707 ? -67.847 -33.002 42.251  1.00 63.41  ? 770  PHE B CB    1 
ATOM   4991 C  CG    . PHE A 1 707 ? -67.983 -32.547 43.658  1.00 58.53  ? 770  PHE B CG    1 
ATOM   4992 C  CD1   . PHE A 1 707 ? -67.778 -33.370 44.698  1.00 59.01  ? 770  PHE B CD1   1 
ATOM   4993 C  CD2   . PHE A 1 707 ? -68.213 -31.253 43.910  1.00 62.24  ? 770  PHE B CD2   1 
ATOM   4994 C  CE1   . PHE A 1 707 ? -67.873 -32.937 45.975  1.00 64.46  ? 770  PHE B CE1   1 
ATOM   4995 C  CE2   . PHE A 1 707 ? -68.303 -30.791 45.180  1.00 56.14  ? 770  PHE B CE2   1 
ATOM   4996 C  CZ    . PHE A 1 707 ? -68.139 -31.635 46.217  1.00 61.23  ? 770  PHE B CZ    1 
ATOM   4997 N  N     . PRO A 1 708 ? -69.218 -35.153 39.784  1.00 68.77  ? 771  PRO B N     1 
ATOM   4998 C  CA    . PRO A 1 708 ? -69.078 -35.272 38.345  1.00 64.61  ? 771  PRO B CA    1 
ATOM   4999 C  C     . PRO A 1 708 ? -69.805 -34.231 37.591  1.00 61.81  ? 771  PRO B C     1 
ATOM   5000 O  O     . PRO A 1 708 ? -69.839 -34.235 36.394  1.00 67.60  ? 771  PRO B O     1 
ATOM   5001 C  CB    . PRO A 1 708 ? -69.591 -36.655 38.055  1.00 58.28  ? 771  PRO B CB    1 
ATOM   5002 C  CG    . PRO A 1 708 ? -69.410 -37.381 39.314  1.00 68.77  ? 771  PRO B CG    1 
ATOM   5003 C  CD    . PRO A 1 708 ? -69.799 -36.369 40.336  1.00 71.44  ? 771  PRO B CD    1 
ATOM   5004 N  N     . ASP A 1 709 ? -70.368 -33.287 38.305  1.00 63.61  ? 772  ASP B N     1 
ATOM   5005 C  CA    . ASP A 1 709 ? -70.984 -32.148 37.661  1.00 68.48  ? 772  ASP B CA    1 
ATOM   5006 C  C     . ASP A 1 709 ? -69.979 -30.985 37.591  1.00 67.67  ? 772  ASP B C     1 
ATOM   5007 O  O     . ASP A 1 709 ? -70.303 -29.908 37.145  1.00 63.68  ? 772  ASP B O     1 
ATOM   5008 C  CB    . ASP A 1 709 ? -72.248 -31.740 38.390  1.00 67.90  ? 772  ASP B CB    1 
ATOM   5009 N  N     . GLY A 1 710 ? -68.762 -31.233 38.055  1.00 63.31  ? 773  GLY B N     1 
ATOM   5010 C  CA    . GLY A 1 710 ? -67.656 -30.329 38.072  1.00 60.09  ? 773  GLY B CA    1 
ATOM   5011 C  C     . GLY A 1 710 ? -67.312 -30.093 39.497  1.00 60.98  ? 773  GLY B C     1 
ATOM   5012 O  O     . GLY A 1 710 ? -68.178 -30.023 40.320  1.00 59.76  ? 773  GLY B O     1 
ATOM   5013 N  N     . ILE A 1 711 ? -66.039 -29.969 39.801  1.00 57.88  ? 774  ILE B N     1 
ATOM   5014 C  CA    . ILE A 1 711 ? -65.682 -29.682 41.155  1.00 54.17  ? 774  ILE B CA    1 
ATOM   5015 C  C     . ILE A 1 711 ? -66.025 -28.230 41.330  1.00 56.82  ? 774  ILE B C     1 
ATOM   5016 O  O     . ILE A 1 711 ? -65.805 -27.436 40.468  1.00 63.41  ? 774  ILE B O     1 
ATOM   5017 C  CB    . ILE A 1 711 ? -64.239 -30.042 41.482  1.00 52.25  ? 774  ILE B CB    1 
ATOM   5018 C  CG1   . ILE A 1 711 ? -63.321 -28.949 41.077  1.00 50.98  ? 774  ILE B CG1   1 
ATOM   5019 C  CG2   . ILE A 1 711 ? -63.827 -31.332 40.836  1.00 48.60  ? 774  ILE B CG2   1 
ATOM   5020 C  CD1   . ILE A 1 711 ? -63.305 -27.913 42.135  1.00 54.19  ? 774  ILE B CD1   1 
ATOM   5021 N  N     . PRO A 1 712 ? -66.536 -27.894 42.485  1.00 51.94  ? 775  PRO B N     1 
ATOM   5022 C  CA    . PRO A 1 712 ? -67.090 -26.648 42.961  1.00 51.02  ? 775  PRO B CA    1 
ATOM   5023 C  C     . PRO A 1 712 ? -66.169 -25.507 43.006  1.00 55.50  ? 775  PRO B C     1 
ATOM   5024 O  O     . PRO A 1 712 ? -65.053 -25.632 43.368  1.00 61.21  ? 775  PRO B O     1 
ATOM   5025 C  CB    . PRO A 1 712 ? -67.516 -26.995 44.355  1.00 47.17  ? 775  PRO B CB    1 
ATOM   5026 C  CG    . PRO A 1 712 ? -66.650 -28.081 44.739  1.00 53.41  ? 775  PRO B CG    1 
ATOM   5027 C  CD    . PRO A 1 712 ? -66.494 -28.894 43.535  1.00 51.98  ? 775  PRO B CD    1 
ATOM   5028 N  N     . LEU A 1 713 ? -66.699 -24.356 42.694  1.00 52.64  ? 776  LEU B N     1 
ATOM   5029 C  CA    . LEU A 1 713 ? -65.932 -23.182 42.634  1.00 50.61  ? 776  LEU B CA    1 
ATOM   5030 C  C     . LEU A 1 713 ? -66.514 -22.164 43.526  1.00 57.41  ? 776  LEU B C     1 
ATOM   5031 O  O     . LEU A 1 713 ? -67.670 -22.140 43.760  1.00 64.94  ? 776  LEU B O     1 
ATOM   5032 C  CB    . LEU A 1 713 ? -66.050 -22.637 41.240  1.00 55.01  ? 776  LEU B CB    1 
ATOM   5033 C  CG    . LEU A 1 713 ? -65.170 -23.066 40.093  1.00 48.33  ? 776  LEU B CG    1 
ATOM   5034 C  CD1   . LEU A 1 713 ? -64.809 -24.519 40.060  1.00 48.17  ? 776  LEU B CD1   1 
ATOM   5035 C  CD2   . LEU A 1 713 ? -65.876 -22.692 38.842  1.00 42.24  ? 776  LEU B CD2   1 
ATOM   5036 N  N     . LEU A 1 714 ? -65.681 -21.296 44.029  1.00 60.27  ? 777  LEU B N     1 
ATOM   5037 C  CA    . LEU A 1 714 ? -66.116 -20.249 44.875  1.00 57.65  ? 777  LEU B CA    1 
ATOM   5038 C  C     . LEU A 1 714 ? -66.678 -19.170 44.033  1.00 62.17  ? 777  LEU B C     1 
ATOM   5039 O  O     . LEU A 1 714 ? -66.089 -18.804 43.064  1.00 70.09  ? 777  LEU B O     1 
ATOM   5040 C  CB    . LEU A 1 714 ? -64.922 -19.658 45.560  1.00 59.38  ? 777  LEU B CB    1 
ATOM   5041 C  CG    . LEU A 1 714 ? -63.902 -20.565 46.189  1.00 60.03  ? 777  LEU B CG    1 
ATOM   5042 C  CD1   . LEU A 1 714 ? -62.779 -19.656 46.588  1.00 55.25  ? 777  LEU B CD1   1 
ATOM   5043 C  CD2   . LEU A 1 714 ? -64.458 -21.284 47.392  1.00 52.86  ? 777  LEU B CD2   1 
ATOM   5044 N  N     . ASP A 1 715 ? -67.819 -18.651 44.433  1.00 62.32  ? 778  ASP B N     1 
ATOM   5045 C  CA    . ASP A 1 715 ? -68.497 -17.576 43.764  1.00 61.80  ? 778  ASP B CA    1 
ATOM   5046 C  C     . ASP A 1 715 ? -67.682 -16.363 43.997  1.00 56.71  ? 778  ASP B C     1 
ATOM   5047 O  O     . ASP A 1 715 ? -67.202 -16.162 45.052  1.00 47.94  ? 778  ASP B O     1 
ATOM   5048 C  CB    . ASP A 1 715 ? -69.815 -17.349 44.476  1.00 62.94  ? 778  ASP B CB    1 
ATOM   5049 C  CG    . ASP A 1 715 ? -70.973 -17.262 43.556  1.00 65.09  ? 778  ASP B CG    1 
ATOM   5050 O  OD1   . ASP A 1 715 ? -71.108 -18.115 42.688  1.00 68.18  ? 778  ASP B OD1   1 
ATOM   5051 O  OD2   . ASP A 1 715 ? -71.784 -16.354 43.713  1.00 73.03  ? 778  ASP B OD2   1 
ATOM   5052 N  N     . PRO A 1 716 ? -67.565 -15.512 43.014  1.00 63.15  ? 779  PRO B N     1 
ATOM   5053 C  CA    . PRO A 1 716 ? -66.802 -14.311 43.218  1.00 62.08  ? 779  PRO B CA    1 
ATOM   5054 C  C     . PRO A 1 716 ? -67.377 -13.404 44.245  1.00 62.26  ? 779  PRO B C     1 
ATOM   5055 O  O     . PRO A 1 716 ? -66.604 -12.697 44.829  1.00 62.94  ? 779  PRO B O     1 
ATOM   5056 C  CB    . PRO A 1 716 ? -66.784 -13.686 41.854  1.00 55.73  ? 779  PRO B CB    1 
ATOM   5057 C  CG    . PRO A 1 716 ? -66.750 -14.850 40.988  1.00 55.82  ? 779  PRO B CG    1 
ATOM   5058 C  CD    . PRO A 1 716 ? -67.803 -15.715 41.595  1.00 58.56  ? 779  PRO B CD    1 
ATOM   5059 N  N     . ILE A 1 717 ? -68.677 -13.284 44.374  1.00 59.76  ? 780  ILE B N     1 
ATOM   5060 C  CA    . ILE A 1 717 ? -69.140 -12.398 45.393  1.00 63.17  ? 780  ILE B CA    1 
ATOM   5061 C  C     . ILE A 1 717 ? -69.564 -13.132 46.616  1.00 65.83  ? 780  ILE B C     1 
ATOM   5062 O  O     . ILE A 1 717 ? -69.292 -12.731 47.705  1.00 63.35  ? 780  ILE B O     1 
ATOM   5063 C  CB    . ILE A 1 717 ? -70.282 -11.551 44.928  1.00 61.92  ? 780  ILE B CB    1 
ATOM   5064 C  CG1   . ILE A 1 717 ? -70.264 -11.406 43.431  1.00 57.91  ? 780  ILE B CG1   1 
ATOM   5065 C  CG2   . ILE A 1 717 ? -70.182 -10.225 45.619  1.00 60.25  ? 780  ILE B CG2   1 
ATOM   5066 C  CD1   . ILE A 1 717 ? -71.113 -10.272 42.957  1.00 49.36  ? 780  ILE B CD1   1 
ATOM   5067 N  N     . ASP A 1 718 ? -70.254 -14.228 46.436  1.00 63.37  ? 781  ASP B N     1 
ATOM   5068 C  CA    . ASP A 1 718 ? -70.701 -14.947 47.579  1.00 60.01  ? 781  ASP B CA    1 
ATOM   5069 C  C     . ASP A 1 718 ? -69.585 -15.486 48.380  1.00 60.93  ? 781  ASP B C     1 
ATOM   5070 O  O     . ASP A 1 718 ? -69.670 -15.552 49.563  1.00 60.15  ? 781  ASP B O     1 
ATOM   5071 C  CB    . ASP A 1 718 ? -71.702 -16.011 47.188  1.00 65.47  ? 781  ASP B CB    1 
ATOM   5072 C  CG    . ASP A 1 718 ? -73.048 -15.451 46.976  1.00 67.56  ? 781  ASP B CG    1 
ATOM   5073 O  OD1   . ASP A 1 718 ? -73.185 -14.241 47.108  1.00 67.70  ? 781  ASP B OD1   1 
ATOM   5074 O  OD2   . ASP A 1 718 ? -73.978 -16.196 46.680  1.00 65.33  ? 781  ASP B OD2   1 
ATOM   5075 N  N     . ASP A 1 719 ? -68.566 -15.999 47.742  1.00 61.15  ? 782  ASP B N     1 
ATOM   5076 C  CA    . ASP A 1 719 ? -67.464 -16.498 48.482  1.00 56.82  ? 782  ASP B CA    1 
ATOM   5077 C  C     . ASP A 1 719 ? -66.229 -15.586 48.428  1.00 53.66  ? 782  ASP B C     1 
ATOM   5078 O  O     . ASP A 1 719 ? -65.775 -15.176 49.435  1.00 51.77  ? 782  ASP B O     1 
ATOM   5079 C  CB    . ASP A 1 719 ? -67.191 -17.913 48.043  1.00 51.14  ? 782  ASP B CB    1 
ATOM   5080 C  CG    . ASP A 1 719 ? -68.293 -18.833 48.382  1.00 51.30  ? 782  ASP B CG    1 
ATOM   5081 O  OD1   . ASP A 1 719 ? -69.064 -18.510 49.240  1.00 48.00  ? 782  ASP B OD1   1 
ATOM   5082 O  OD2   . ASP A 1 719 ? -68.389 -19.915 47.842  1.00 54.25  ? 782  ASP B OD2   1 
ATOM   5083 N  N     . MET A 1 720 ? -65.727 -15.199 47.267  1.00 56.26  ? 783  MET B N     1 
ATOM   5084 C  CA    . MET A 1 720 ? -64.561 -14.324 47.195  1.00 48.68  ? 783  MET B CA    1 
ATOM   5085 C  C     . MET A 1 720 ? -64.865 -12.976 47.704  1.00 51.98  ? 783  MET B C     1 
ATOM   5086 O  O     . MET A 1 720 ? -64.040 -12.314 48.247  1.00 50.17  ? 783  MET B O     1 
ATOM   5087 C  CB    . MET A 1 720 ? -63.958 -14.193 45.812  1.00 48.77  ? 783  MET B CB    1 
ATOM   5088 C  CG    . MET A 1 720 ? -64.080 -15.379 44.921  1.00 51.38  ? 783  MET B CG    1 
ATOM   5089 S  SD    . MET A 1 720 ? -62.602 -16.234 44.607  1.00 53.36  ? 783  MET B SD    1 
ATOM   5090 C  CE    . MET A 1 720 ? -61.521 -14.886 44.370  1.00 45.91  ? 783  MET B CE    1 
ATOM   5091 N  N     . GLY A 1 721 ? -66.054 -12.520 47.428  1.00 57.56  ? 784  GLY B N     1 
ATOM   5092 C  CA    . GLY A 1 721 ? -66.460 -11.249 47.915  1.00 52.08  ? 784  GLY B CA    1 
ATOM   5093 C  C     . GLY A 1 721 ? -66.068 -10.103 47.083  1.00 56.76  ? 784  GLY B C     1 
ATOM   5094 O  O     . GLY A 1 721 ? -66.259 -9.024  47.540  1.00 61.88  ? 784  GLY B O     1 
ATOM   5095 N  N     . ILE A 1 722 ? -65.579 -10.310 45.868  1.00 61.64  ? 785  ILE B N     1 
ATOM   5096 C  CA    . ILE A 1 722 ? -65.142 -9.180  45.065  1.00 66.54  ? 785  ILE B CA    1 
ATOM   5097 C  C     . ILE A 1 722 ? -66.355 -8.311  44.808  1.00 65.31  ? 785  ILE B C     1 
ATOM   5098 O  O     . ILE A 1 722 ? -67.319 -8.729  44.265  1.00 60.00  ? 785  ILE B O     1 
ATOM   5099 C  CB    . ILE A 1 722 ? -64.366 -9.630  43.804  1.00 53.74  ? 785  ILE B CB    1 
ATOM   5100 N  N     . GLN A 1 723 ? -66.249 -7.064  45.242  1.00 73.01  ? 786  GLN B N     1 
ATOM   5101 C  CA    . GLN A 1 723 ? -67.324 -6.072  45.235  1.00 67.81  ? 786  GLN B CA    1 
ATOM   5102 C  C     . GLN A 1 723 ? -67.273 -5.063  44.139  1.00 67.84  ? 786  GLN B C     1 
ATOM   5103 O  O     . GLN A 1 723 ? -68.028 -4.118  44.135  1.00 58.83  ? 786  GLN B O     1 
ATOM   5104 C  CB    . GLN A 1 723 ? -67.349 -5.336  46.564  1.00 54.15  ? 786  GLN B CB    1 
ATOM   5105 N  N     . ASP A 1 724 ? -66.381 -5.286  43.197  1.00 72.21  ? 787  ASP B N     1 
ATOM   5106 C  CA    . ASP A 1 724 ? -66.221 -4.387  42.099  1.00 74.75  ? 787  ASP B CA    1 
ATOM   5107 C  C     . ASP A 1 724 ? -67.545 -4.403  41.359  1.00 73.84  ? 787  ASP B C     1 
ATOM   5108 O  O     . ASP A 1 724 ? -68.112 -5.428  41.059  1.00 70.00  ? 787  ASP B O     1 
ATOM   5109 C  CB    . ASP A 1 724 ? -65.051 -4.855  41.231  1.00 70.20  ? 787  ASP B CB    1 
ATOM   5110 C  CG    . ASP A 1 724 ? -64.074 -3.741  40.896  1.00 79.86  ? 787  ASP B CG    1 
ATOM   5111 O  OD1   . ASP A 1 724 ? -63.954 -2.793  41.668  1.00 84.04  ? 787  ASP B OD1   1 
ATOM   5112 O  OD2   . ASP A 1 724 ? -63.419 -3.805  39.853  1.00 75.80  ? 787  ASP B OD2   1 
ATOM   5113 N  N     . GLN A 1 725 ? -68.046 -3.230  41.066  1.00 72.50  ? 788  GLN B N     1 
ATOM   5114 C  CA    . GLN A 1 725 ? -69.309 -3.148  40.406  1.00 70.53  ? 788  GLN B CA    1 
ATOM   5115 C  C     . GLN A 1 725 ? -69.257 -3.737  39.035  1.00 67.51  ? 788  GLN B C     1 
ATOM   5116 O  O     . GLN A 1 725 ? -70.093 -4.513  38.686  1.00 67.31  ? 788  GLN B O     1 
ATOM   5117 C  CB    . GLN A 1 725 ? -69.804 -1.710  40.380  1.00 70.73  ? 788  GLN B CB    1 
ATOM   5118 N  N     . GLY A 1 726 ? -68.181 -3.509  38.316  1.00 65.55  ? 789  GLY B N     1 
ATOM   5119 C  CA    . GLY A 1 726 ? -68.051 -3.975  36.959  1.00 63.73  ? 789  GLY B CA    1 
ATOM   5120 C  C     . GLY A 1 726 ? -68.208 -5.457  36.770  1.00 62.50  ? 789  GLY B C     1 
ATOM   5121 O  O     . GLY A 1 726 ? -68.689 -5.876  35.768  1.00 64.49  ? 789  GLY B O     1 
ATOM   5122 N  N     . LEU A 1 727 ? -67.766 -6.269  37.701  1.00 60.35  ? 790  LEU B N     1 
ATOM   5123 C  CA    . LEU A 1 727 ? -67.957 -7.689  37.627  1.00 59.65  ? 790  LEU B CA    1 
ATOM   5124 C  C     . LEU A 1 727 ? -69.395 -8.062  37.661  1.00 60.58  ? 790  LEU B C     1 
ATOM   5125 O  O     . LEU A 1 727 ? -69.800 -8.959  36.987  1.00 65.86  ? 790  LEU B O     1 
ATOM   5126 C  CB    . LEU A 1 727 ? -67.257 -8.412  38.752  1.00 56.62  ? 790  LEU B CB    1 
ATOM   5127 C  CG    . LEU A 1 727 ? -67.792 -9.823  38.786  1.00 57.82  ? 790  LEU B CG    1 
ATOM   5128 C  CD1   . LEU A 1 727 ? -67.206 -10.691 37.703  1.00 55.39  ? 790  LEU B CD1   1 
ATOM   5129 C  CD2   . LEU A 1 727 ? -67.639 -10.441 40.140  1.00 52.32  ? 790  LEU B CD2   1 
ATOM   5130 N  N     . LYS A 1 728 ? -70.218 -7.361  38.422  1.00 62.34  ? 791  LYS B N     1 
ATOM   5131 C  CA    . LYS A 1 728 ? -71.635 -7.667  38.494  1.00 68.08  ? 791  LYS B CA    1 
ATOM   5132 C  C     . LYS A 1 728 ? -72.258 -7.541  37.132  1.00 67.50  ? 791  LYS B C     1 
ATOM   5133 O  O     . LYS A 1 728 ? -72.972 -8.412  36.709  1.00 62.75  ? 791  LYS B O     1 
ATOM   5134 C  CB    . LYS A 1 728 ? -72.306 -6.704  39.447  1.00 60.18  ? 791  LYS B CB    1 
ATOM   5135 N  N     . LYS A 1 729 ? -71.885 -6.502  36.399  1.00 60.08  ? 792  LYS B N     1 
ATOM   5136 C  CA    . LYS A 1 729 ? -72.321 -6.308  35.062  1.00 60.54  ? 792  LYS B CA    1 
ATOM   5137 C  C     . LYS A 1 729 ? -71.890 -7.472  34.234  1.00 65.79  ? 792  LYS B C     1 
ATOM   5138 O  O     . LYS A 1 729 ? -72.691 -8.028  33.541  1.00 69.94  ? 792  LYS B O     1 
ATOM   5139 C  CB    . LYS A 1 729 ? -71.638 -5.093  34.507  1.00 57.36  ? 792  LYS B CB    1 
ATOM   5140 C  CG    . LYS A 1 729 ? -72.383 -3.804  34.747  1.00 61.66  ? 792  LYS B CG    1 
ATOM   5141 C  CD    . LYS A 1 729 ? -72.402 -2.965  33.488  1.00 70.46  ? 792  LYS B CD    1 
ATOM   5142 N  N     . VAL A 1 730 ? -70.654 -7.944  34.363  1.00 61.62  ? 793  VAL B N     1 
ATOM   5143 C  CA    . VAL A 1 730 ? -70.223 -9.088  33.598  1.00 59.45  ? 793  VAL B CA    1 
ATOM   5144 C  C     . VAL A 1 730 ? -71.030 -10.254 33.989  1.00 60.54  ? 793  VAL B C     1 
ATOM   5145 O  O     . VAL A 1 730 ? -71.517 -10.940 33.148  1.00 57.17  ? 793  VAL B O     1 
ATOM   5146 C  CB    . VAL A 1 730 ? -68.795 -9.474  33.845  1.00 52.42  ? 793  VAL B CB    1 
ATOM   5147 C  CG1   . VAL A 1 730 ? -68.456 -10.618 32.946  1.00 51.17  ? 793  VAL B CG1   1 
ATOM   5148 C  CG2   . VAL A 1 730 ? -67.888 -8.338  33.513  1.00 51.66  ? 793  VAL B CG2   1 
ATOM   5149 N  N     . ILE A 1 731 ? -71.266 -10.430 35.277  1.00 64.00  ? 794  ILE B N     1 
ATOM   5150 C  CA    . ILE A 1 731 ? -72.100 -11.501 35.703  1.00 66.35  ? 794  ILE B CA    1 
ATOM   5151 C  C     . ILE A 1 731 ? -73.492 -11.340 35.134  1.00 66.60  ? 794  ILE B C     1 
ATOM   5152 O  O     . ILE A 1 731 ? -74.071 -12.292 34.692  1.00 61.84  ? 794  ILE B O     1 
ATOM   5153 C  CB    . ILE A 1 731 ? -72.202 -11.554 37.217  1.00 59.76  ? 794  ILE B CB    1 
ATOM   5154 C  CG1   . ILE A 1 731 ? -71.043 -12.339 37.775  1.00 63.65  ? 794  ILE B CG1   1 
ATOM   5155 C  CG2   . ILE A 1 731 ? -73.450 -12.291 37.594  1.00 63.55  ? 794  ILE B CG2   1 
ATOM   5156 C  CD1   . ILE A 1 731 ? -71.406 -13.294 38.894  1.00 62.57  ? 794  ILE B CD1   1 
ATOM   5157 N  N     . GLN A 1 732 ? -74.040 -10.143 35.141  1.00 66.01  ? 795  GLN B N     1 
ATOM   5158 C  CA    . GLN A 1 732 ? -75.359 -9.991  34.596  1.00 73.11  ? 795  GLN B CA    1 
ATOM   5159 C  C     . GLN A 1 732 ? -75.361 -10.316 33.134  1.00 66.76  ? 795  GLN B C     1 
ATOM   5160 O  O     . GLN A 1 732 ? -76.135 -11.130 32.708  1.00 62.73  ? 795  GLN B O     1 
ATOM   5161 C  CB    . GLN A 1 732 ? -75.873 -8.566  34.805  1.00 69.19  ? 795  GLN B CB    1 
ATOM   5162 N  N     . LYS A 1 733 ? -74.396 -9.806  32.390  1.00 64.42  ? 796  LYS B N     1 
ATOM   5163 C  CA    . LYS A 1 733 ? -74.359 -10.059 30.967  1.00 62.22  ? 796  LYS B CA    1 
ATOM   5164 C  C     . LYS A 1 733 ? -74.192 -11.543 30.705  1.00 61.87  ? 796  LYS B C     1 
ATOM   5165 O  O     . LYS A 1 733 ? -74.867 -12.082 29.918  1.00 62.58  ? 796  LYS B O     1 
ATOM   5166 C  CB    . LYS A 1 733 ? -73.343 -9.186  30.259  1.00 51.87  ? 796  LYS B CB    1 
ATOM   5167 N  N     . VAL A 1 734 ? -73.387 -12.247 31.466  1.00 66.47  ? 797  VAL B N     1 
ATOM   5168 C  CA    . VAL A 1 734 ? -73.281 -13.682 31.327  1.00 62.63  ? 797  VAL B CA    1 
ATOM   5169 C  C     . VAL A 1 734 ? -74.597 -14.322 31.638  1.00 60.93  ? 797  VAL B C     1 
ATOM   5170 O  O     . VAL A 1 734 ? -74.981 -15.243 31.017  1.00 63.74  ? 797  VAL B O     1 
ATOM   5171 C  CB    . VAL A 1 734 ? -72.260 -14.255 32.310  1.00 54.09  ? 797  VAL B CB    1 
ATOM   5172 C  CG1   . VAL A 1 734 ? -72.589 -15.666 32.664  1.00 54.70  ? 797  VAL B CG1   1 
ATOM   5173 C  CG2   . VAL A 1 734 ? -70.898 -14.250 31.705  1.00 54.46  ? 797  VAL B CG2   1 
ATOM   5174 N  N     . GLU A 1 735 ? -75.291 -13.861 32.647  1.00 63.67  ? 798  GLU B N     1 
ATOM   5175 C  CA    . GLU A 1 735 ? -76.560 -14.431 32.981  1.00 67.12  ? 798  GLU B CA    1 
ATOM   5176 C  C     . GLU A 1 735 ? -77.553 -14.220 31.872  1.00 64.03  ? 798  GLU B C     1 
ATOM   5177 O  O     . GLU A 1 735 ? -78.305 -15.094 31.573  1.00 67.10  ? 798  GLU B O     1 
ATOM   5178 C  CB    . GLU A 1 735 ? -77.053 -13.855 34.299  1.00 66.97  ? 798  GLU B CB    1 
ATOM   5179 N  N     . ALA A 1 736 ? -77.542 -13.052 31.259  1.00 62.91  ? 799  ALA B N     1 
ATOM   5180 C  CA    . ALA A 1 736 ? -78.446 -12.724 30.184  1.00 62.76  ? 799  ALA B CA    1 
ATOM   5181 C  C     . ALA A 1 736 ? -78.285 -13.593 28.976  1.00 66.25  ? 799  ALA B C     1 
ATOM   5182 O  O     . ALA A 1 736 ? -79.246 -13.999 28.394  1.00 64.33  ? 799  ALA B O     1 
ATOM   5183 C  CB    . ALA A 1 736 ? -78.237 -11.291 29.781  1.00 52.60  ? 799  ALA B CB    1 
ATOM   5184 N  N     . PHE A 1 737 ? -77.057 -13.835 28.569  1.00 63.49  ? 800  PHE B N     1 
ATOM   5185 C  CA    . PHE A 1 737 ? -76.787 -14.644 27.409  1.00 60.11  ? 800  PHE B CA    1 
ATOM   5186 C  C     . PHE A 1 737 ? -77.125 -16.054 27.614  1.00 61.69  ? 800  PHE B C     1 
ATOM   5187 O  O     . PHE A 1 737 ? -77.279 -16.789 26.700  1.00 66.52  ? 800  PHE B O     1 
ATOM   5188 C  CB    . PHE A 1 737 ? -75.383 -14.510 26.947  1.00 61.18  ? 800  PHE B CB    1 
ATOM   5189 C  CG    . PHE A 1 737 ? -75.151 -13.306 26.126  1.00 59.47  ? 800  PHE B CG    1 
ATOM   5190 C  CD1   . PHE A 1 737 ? -74.937 -12.103 26.713  1.00 59.61  ? 800  PHE B CD1   1 
ATOM   5191 C  CD2   . PHE A 1 737 ? -75.144 -13.387 24.784  1.00 57.66  ? 800  PHE B CD2   1 
ATOM   5192 C  CE1   . PHE A 1 737 ? -74.690 -10.994 25.971  1.00 54.54  ? 800  PHE B CE1   1 
ATOM   5193 C  CE2   . PHE A 1 737 ? -74.919 -12.285 24.024  1.00 60.30  ? 800  PHE B CE2   1 
ATOM   5194 C  CZ    . PHE A 1 737 ? -74.682 -11.086 24.620  1.00 56.54  ? 800  PHE B CZ    1 
ATOM   5195 N  N     . GLU A 1 738 ? -77.130 -16.470 28.847  1.00 62.96  ? 801  GLU B N     1 
ATOM   5196 C  CA    . GLU A 1 738 ? -77.528 -17.802 29.162  1.00 62.20  ? 801  GLU B CA    1 
ATOM   5197 C  C     . GLU A 1 738 ? -79.018 -17.977 28.868  1.00 67.56  ? 801  GLU B C     1 
ATOM   5198 O  O     . GLU A 1 738 ? -79.456 -19.038 28.488  1.00 68.62  ? 801  GLU B O     1 
ATOM   5199 C  CB    . GLU A 1 738 ? -77.173 -18.119 30.595  1.00 61.08  ? 801  GLU B CB    1 
ATOM   5200 C  CG    . GLU A 1 738 ? -75.706 -17.989 30.906  1.00 60.09  ? 801  GLU B CG    1 
ATOM   5201 C  CD    . GLU A 1 738 ? -75.242 -19.024 31.891  1.00 67.35  ? 801  GLU B CD    1 
ATOM   5202 O  OE1   . GLU A 1 738 ? -76.071 -19.539 32.627  1.00 63.50  ? 801  GLU B OE1   1 
ATOM   5203 O  OE2   . GLU A 1 738 ? -74.050 -19.344 31.932  1.00 68.24  ? 801  GLU B OE2   1 
ATOM   5204 N  N     . HIS A 1 739 ? -79.806 -16.948 29.150  1.00 67.46  ? 802  HIS B N     1 
ATOM   5205 C  CA    . HIS A 1 739 ? -81.219 -16.888 28.886  1.00 70.19  ? 802  HIS B CA    1 
ATOM   5206 C  C     . HIS A 1 739 ? -81.412 -16.972 27.380  1.00 71.64  ? 802  HIS B C     1 
ATOM   5207 O  O     . HIS A 1 739 ? -82.140 -17.791 26.876  1.00 66.37  ? 802  HIS B O     1 
ATOM   5208 C  CB    . HIS A 1 739 ? -81.635 -15.529 29.441  1.00 69.69  ? 802  HIS B CB    1 
ATOM   5209 C  CG    . HIS A 1 739 ? -83.022 -15.090 29.103  1.00 70.23  ? 802  HIS B CG    1 
ATOM   5210 N  ND1   . HIS A 1 739 ? -83.746 -15.625 28.074  1.00 79.79  ? 802  HIS B ND1   1 
ATOM   5211 C  CD2   . HIS A 1 739 ? -83.782 -14.102 29.615  1.00 68.49  ? 802  HIS B CD2   1 
ATOM   5212 C  CE1   . HIS A 1 739 ? -84.907 -15.012 27.988  1.00 75.36  ? 802  HIS B CE1   1 
ATOM   5213 N  NE2   . HIS A 1 739 ? -84.952 -14.081 28.911  1.00 72.65  ? 802  HIS B NE2   1 
ATOM   5214 N  N     . ARG A 1 740 ? -80.639 -16.196 26.649  1.00 69.81  ? 803  ARG B N     1 
ATOM   5215 C  CA    . ARG A 1 740 ? -80.672 -16.201 25.205  1.00 60.59  ? 803  ARG B CA    1 
ATOM   5216 C  C     . ARG A 1 740 ? -80.231 -17.513 24.698  1.00 60.22  ? 803  ARG B C     1 
ATOM   5217 O  O     . ARG A 1 740 ? -80.758 -18.004 23.782  1.00 67.62  ? 803  ARG B O     1 
ATOM   5218 C  CB    . ARG A 1 740 ? -79.692 -15.195 24.661  1.00 58.52  ? 803  ARG B CB    1 
ATOM   5219 C  CG    . ARG A 1 740 ? -80.181 -13.778 24.593  1.00 56.11  ? 803  ARG B CG    1 
ATOM   5220 C  CD    . ARG A 1 740 ? -80.479 -13.364 23.178  1.00 59.96  ? 803  ARG B CD    1 
ATOM   5221 N  NE    . ARG A 1 740 ? -79.332 -12.775 22.512  1.00 69.02  ? 803  ARG B NE    1 
ATOM   5222 C  CZ    . ARG A 1 740 ? -79.184 -12.745 21.197  1.00 78.13  ? 803  ARG B CZ    1 
ATOM   5223 N  NH1   . ARG A 1 740 ? -80.099 -13.288 20.423  1.00 71.69  ? 803  ARG B NH1   1 
ATOM   5224 N  NH2   . ARG A 1 740 ? -78.124 -12.202 20.652  1.00 76.33  ? 803  ARG B NH2   1 
ATOM   5225 N  N     . MET A 1 741 ? -79.218 -18.081 25.283  1.00 65.66  ? 804  MET B N     1 
ATOM   5226 C  CA    . MET A 1 741 ? -78.734 -19.329 24.808  1.00 64.36  ? 804  MET B CA    1 
ATOM   5227 C  C     . MET A 1 741 ? -79.703 -20.433 24.893  1.00 63.24  ? 804  MET B C     1 
ATOM   5228 O  O     . MET A 1 741 ? -79.685 -21.272 24.059  1.00 66.27  ? 804  MET B O     1 
ATOM   5229 C  CB    . MET A 1 741 ? -77.506 -19.770 25.528  1.00 61.69  ? 804  MET B CB    1 
ATOM   5230 C  CG    . MET A 1 741 ? -77.103 -21.104 25.022  1.00 60.46  ? 804  MET B CG    1 
ATOM   5231 S  SD    . MET A 1 741 ? -75.793 -21.660 26.047  1.00 69.09  ? 804  MET B SD    1 
ATOM   5232 C  CE    . MET A 1 741 ? -74.840 -20.179 26.021  1.00 56.95  ? 804  MET B CE    1 
ATOM   5233 N  N     . TYR A 1 742 ? -80.452 -20.518 25.964  1.00 70.50  ? 805  TYR B N     1 
ATOM   5234 C  CA    . TYR A 1 742 ? -81.445 -21.571 26.105  1.00 76.27  ? 805  TYR B CA    1 
ATOM   5235 C  C     . TYR A 1 742 ? -82.681 -21.372 25.268  1.00 73.69  ? 805  TYR B C     1 
ATOM   5236 O  O     . TYR A 1 742 ? -83.422 -22.311 25.048  1.00 75.03  ? 805  TYR B O     1 
ATOM   5237 C  CB    . TYR A 1 742 ? -81.813 -21.799 27.558  1.00 78.39  ? 805  TYR B CB    1 
ATOM   5238 N  N     . SER A 1 743 ? -82.952 -20.129 24.886  1.00 76.49  ? 806  SER B N     1 
ATOM   5239 C  CA    . SER A 1 743 ? -84.092 -19.807 24.036  1.00 77.65  ? 806  SER B CA    1 
ATOM   5240 C  C     . SER A 1 743 ? -83.943 -20.421 22.695  1.00 75.72  ? 806  SER B C     1 
ATOM   5241 O  O     . SER A 1 743 ? -84.871 -20.923 22.128  1.00 79.12  ? 806  SER B O     1 
ATOM   5242 C  CB    . SER A 1 743 ? -84.187 -18.319 23.785  1.00 75.12  ? 806  SER B CB    1 
ATOM   5243 O  OG    . SER A 1 743 ? -84.461 -17.632 24.970  1.00 81.68  ? 806  SER B OG    1 
ATOM   5244 N  N     . HIS A 1 744 ? -82.740 -20.362 22.184  1.00 73.98  ? 807  HIS B N     1 
ATOM   5245 C  CA    . HIS A 1 744 ? -82.449 -20.849 20.883  1.00 68.48  ? 807  HIS B CA    1 
ATOM   5246 C  C     . HIS A 1 744 ? -82.690 -22.298 20.865  1.00 65.96  ? 807  HIS B C     1 
ATOM   5247 O  O     . HIS A 1 744 ? -82.285 -23.001 21.734  1.00 59.92  ? 807  HIS B O     1 
ATOM   5248 C  CB    . HIS A 1 744 ? -80.994 -20.599 20.613  1.00 71.88  ? 807  HIS B CB    1 
ATOM   5249 C  CG    . HIS A 1 744 ? -80.695 -20.081 19.247  1.00 69.66  ? 807  HIS B CG    1 
ATOM   5250 N  ND1   . HIS A 1 744 ? -80.312 -20.894 18.210  1.00 61.97  ? 807  HIS B ND1   1 
ATOM   5251 C  CD2   . HIS A 1 744 ? -80.658 -18.821 18.774  1.00 68.29  ? 807  HIS B CD2   1 
ATOM   5252 C  CE1   . HIS A 1 744 ? -80.080 -20.155 17.147  1.00 63.07  ? 807  HIS B CE1   1 
ATOM   5253 N  NE2   . HIS A 1 744 ? -80.280 -18.895 17.464  1.00 63.18  ? 807  HIS B NE2   1 
ATOM   5254 N  N     . PRO A 1 745 ? -83.308 -22.737 19.806  1.00 70.20  ? 808  PRO B N     1 
ATOM   5255 C  CA    . PRO A 1 745 ? -83.806 -23.983 19.265  1.00 70.25  ? 808  PRO B CA    1 
ATOM   5256 C  C     . PRO A 1 745 ? -82.691 -24.925 19.007  1.00 73.41  ? 808  PRO B C     1 
ATOM   5257 O  O     . PRO A 1 745 ? -82.802 -26.124 19.198  1.00 74.62  ? 808  PRO B O     1 
ATOM   5258 C  CB    . PRO A 1 745 ? -84.394 -23.565 17.950  1.00 68.71  ? 808  PRO B CB    1 
ATOM   5259 C  CG    . PRO A 1 745 ? -84.684 -22.139 18.110  1.00 75.22  ? 808  PRO B CG    1 
ATOM   5260 C  CD    . PRO A 1 745 ? -83.554 -21.630 18.901  1.00 70.35  ? 808  PRO B CD    1 
ATOM   5261 N  N     . LEU A 1 746 ? -81.577 -24.368 18.585  1.00 70.21  ? 809  LEU B N     1 
ATOM   5262 C  CA    . LEU A 1 746 ? -80.425 -25.158 18.255  1.00 71.34  ? 809  LEU B CA    1 
ATOM   5263 C  C     . LEU A 1 746 ? -79.906 -25.939 19.403  1.00 64.23  ? 809  LEU B C     1 
ATOM   5264 O  O     . LEU A 1 746 ? -79.571 -27.072 19.261  1.00 63.42  ? 809  LEU B O     1 
ATOM   5265 C  CB    . LEU A 1 746 ? -79.315 -24.251 17.779  1.00 66.33  ? 809  LEU B CB    1 
ATOM   5266 C  CG    . LEU A 1 746 ? -78.377 -24.892 16.776  1.00 62.32  ? 809  LEU B CG    1 
ATOM   5267 C  CD1   . LEU A 1 746 ? -76.942 -24.538 17.062  1.00 59.46  ? 809  LEU B CD1   1 
ATOM   5268 C  CD2   . LEU A 1 746 ? -78.541 -26.378 16.867  1.00 68.24  ? 809  LEU B CD2   1 
ATOM   5269 N  N     . HIS A 1 747 ? -79.896 -25.344 20.568  1.00 68.22  ? 810  HIS B N     1 
ATOM   5270 C  CA    . HIS A 1 747 ? -79.337 -25.959 21.728  1.00 70.84  ? 810  HIS B CA    1 
ATOM   5271 C  C     . HIS A 1 747 ? -80.008 -27.246 22.059  1.00 71.80  ? 810  HIS B C     1 
ATOM   5272 O  O     . HIS A 1 747 ? -79.373 -28.249 22.320  1.00 66.74  ? 810  HIS B O     1 
ATOM   5273 C  CB    . HIS A 1 747 ? -79.624 -25.002 22.852  1.00 66.65  ? 810  HIS B CB    1 
ATOM   5274 C  CG    . HIS A 1 747 ? -78.772 -25.210 24.044  1.00 66.78  ? 810  HIS B CG    1 
ATOM   5275 N  ND1   . HIS A 1 747 ? -78.645 -26.428 24.653  1.00 66.42  ? 810  HIS B ND1   1 
ATOM   5276 C  CD2   . HIS A 1 747 ? -78.011 -24.354 24.744  1.00 62.94  ? 810  HIS B CD2   1 
ATOM   5277 C  CE1   . HIS A 1 747 ? -77.833 -26.313 25.681  1.00 69.40  ? 810  HIS B CE1   1 
ATOM   5278 N  NE2   . HIS A 1 747 ? -77.438 -25.061 25.758  1.00 70.39  ? 810  HIS B NE2   1 
ATOM   5279 N  N     . ASN A 1 748 ? -81.319 -27.198 22.037  1.00 77.25  ? 811  ASN B N     1 
ATOM   5280 C  CA    . ASN A 1 748 ? -82.151 -28.340 22.283  1.00 80.58  ? 811  ASN B CA    1 
ATOM   5281 C  C     . ASN A 1 748 ? -82.049 -29.337 21.162  1.00 84.42  ? 811  ASN B C     1 
ATOM   5282 O  O     . ASN A 1 748 ? -82.057 -30.525 21.400  1.00 85.69  ? 811  ASN B O     1 
ATOM   5283 C  CB    . ASN A 1 748 ? -83.582 -27.903 22.505  1.00 78.86  ? 811  ASN B CB    1 
ATOM   5284 N  N     . ASP A 1 749 ? -81.949 -28.863 19.929  1.00 80.02  ? 812  ASP B N     1 
ATOM   5285 C  CA    . ASP A 1 749 ? -81.874 -29.789 18.818  1.00 78.71  ? 812  ASP B CA    1 
ATOM   5286 C  C     . ASP A 1 749 ? -80.685 -30.656 18.875  1.00 78.25  ? 812  ASP B C     1 
ATOM   5287 O  O     . ASP A 1 749 ? -79.623 -30.246 19.252  1.00 71.57  ? 812  ASP B O     1 
ATOM   5288 C  CB    . ASP A 1 749 ? -81.813 -29.099 17.468  1.00 70.87  ? 812  ASP B CB    1 
ATOM   5289 N  N     . PRO A 1 750 ? -80.899 -31.892 18.486  1.00 86.49  ? 813  PRO B N     1 
ATOM   5290 C  CA    . PRO A 1 750 ? -80.041 -33.046 18.273  1.00 80.45  ? 813  PRO B CA    1 
ATOM   5291 C  C     . PRO A 1 750 ? -79.304 -32.704 17.004  1.00 79.83  ? 813  PRO B C     1 
ATOM   5292 O  O     . PRO A 1 750 ? -79.896 -32.089 16.112  1.00 80.90  ? 813  PRO B O     1 
ATOM   5293 C  CB    . PRO A 1 750 ? -81.040 -34.123 17.961  1.00 81.82  ? 813  PRO B CB    1 
ATOM   5294 C  CG    . PRO A 1 750 ? -82.032 -33.402 17.123  1.00 82.02  ? 813  PRO B CG    1 
ATOM   5295 C  CD    . PRO A 1 750 ? -82.105 -32.000 17.661  1.00 86.49  ? 813  PRO B CD    1 
ATOM   5296 N  N     . ASN A 1 751 ? -78.051 -33.128 16.905  1.00 71.73  ? 814  ASN B N     1 
ATOM   5297 C  CA    . ASN A 1 751 ? -77.128 -32.800 15.804  1.00 76.75  ? 814  ASN B CA    1 
ATOM   5298 C  C     . ASN A 1 751 ? -76.679 -31.343 15.862  1.00 76.49  ? 814  ASN B C     1 
ATOM   5299 O  O     . ASN A 1 751 ? -76.420 -30.738 14.870  1.00 75.46  ? 814  ASN B O     1 
ATOM   5300 C  CB    . ASN A 1 751 ? -77.519 -33.341 14.380  1.00 78.37  ? 814  ASN B CB    1 
ATOM   5301 C  CG    . ASN A 1 751 ? -78.142 -32.299 13.456  1.00 72.20  ? 814  ASN B CG    1 
ATOM   5302 O  OD1   . ASN A 1 751 ? -78.190 -32.477 12.262  1.00 69.45  ? 814  ASN B OD1   1 
ATOM   5303 N  ND2   . ASN A 1 751 ? -78.671 -31.255 14.020  1.00 68.96  ? 814  ASN B ND2   1 
ATOM   5304 N  N     . LEU A 1 752 ? -76.720 -30.770 17.045  1.00 72.47  ? 815  LEU B N     1 
ATOM   5305 C  CA    . LEU A 1 752 ? -76.285 -29.440 17.309  1.00 61.68  ? 815  LEU B CA    1 
ATOM   5306 C  C     . LEU A 1 752 ? -74.829 -29.367 17.158  1.00 63.48  ? 815  LEU B C     1 
ATOM   5307 O  O     . LEU A 1 752 ? -74.325 -28.421 16.634  1.00 61.81  ? 815  LEU B O     1 
ATOM   5308 C  CB    . LEU A 1 752 ? -76.602 -29.147 18.751  1.00 63.67  ? 815  LEU B CB    1 
ATOM   5309 C  CG    . LEU A 1 752 ? -75.802 -28.199 19.598  1.00 60.69  ? 815  LEU B CG    1 
ATOM   5310 C  CD1   . LEU A 1 752 ? -74.794 -28.886 20.472  1.00 53.36  ? 815  LEU B CD1   1 
ATOM   5311 C  CD2   . LEU A 1 752 ? -75.206 -27.080 18.804  1.00 57.80  ? 815  LEU B CD2   1 
ATOM   5312 N  N     . GLU A 1 753 ? -74.131 -30.366 17.664  1.00 63.43  ? 816  GLU B N     1 
ATOM   5313 C  CA    . GLU A 1 753 ? -72.691 -30.357 17.609  1.00 64.51  ? 816  GLU B CA    1 
ATOM   5314 C  C     . GLU A 1 753 ? -72.186 -30.444 16.219  1.00 65.99  ? 816  GLU B C     1 
ATOM   5315 O  O     . GLU A 1 753 ? -71.177 -29.883 15.897  1.00 60.07  ? 816  GLU B O     1 
ATOM   5316 C  CB    . GLU A 1 753 ? -72.093 -31.447 18.459  1.00 64.03  ? 816  GLU B CB    1 
ATOM   5317 N  N     . THR A 1 754 ? -72.847 -31.241 15.406  1.00 70.90  ? 817  THR B N     1 
ATOM   5318 C  CA    . THR A 1 754 ? -72.465 -31.368 14.034  1.00 65.27  ? 817  THR B CA    1 
ATOM   5319 C  C     . THR A 1 754 ? -72.681 -30.029 13.330  1.00 64.69  ? 817  THR B C     1 
ATOM   5320 O  O     . THR A 1 754 ? -71.839 -29.586 12.577  1.00 61.82  ? 817  THR B O     1 
ATOM   5321 C  CB    . THR A 1 754 ? -73.104 -32.628 13.408  1.00 65.17  ? 817  THR B CB    1 
ATOM   5322 O  OG1   . THR A 1 754 ? -72.351 -33.069 12.292  1.00 75.96  ? 817  THR B OG1   1 
ATOM   5323 C  CG2   . THR A 1 754 ? -74.480 -32.435 12.960  1.00 69.16  ? 817  THR B CG2   1 
ATOM   5324 N  N     . VAL A 1 755 ? -73.786 -29.357 13.615  1.00 62.27  ? 818  VAL B N     1 
ATOM   5325 C  CA    . VAL A 1 755 ? -74.090 -28.066 13.039  1.00 57.95  ? 818  VAL B CA    1 
ATOM   5326 C  C     . VAL A 1 755 ? -73.166 -26.948 13.464  1.00 56.96  ? 818  VAL B C     1 
ATOM   5327 O  O     . VAL A 1 755 ? -72.750 -26.157 12.669  1.00 55.18  ? 818  VAL B O     1 
ATOM   5328 C  CB    . VAL A 1 755 ? -75.524 -27.677 13.364  1.00 56.00  ? 818  VAL B CB    1 
ATOM   5329 C  CG1   . VAL A 1 755 ? -75.689 -26.197 13.337  1.00 54.13  ? 818  VAL B CG1   1 
ATOM   5330 C  CG2   . VAL A 1 755 ? -76.460 -28.277 12.368  1.00 61.39  ? 818  VAL B CG2   1 
ATOM   5331 N  N     . TYR A 1 756 ? -72.847 -26.901 14.738  1.00 59.01  ? 819  TYR B N     1 
ATOM   5332 C  CA    . TYR A 1 756 ? -71.994 -25.874 15.297  1.00 54.31  ? 819  TYR B CA    1 
ATOM   5333 C  C     . TYR A 1 756 ? -70.621 -25.965 14.740  1.00 54.84  ? 819  TYR B C     1 
ATOM   5334 O  O     . TYR A 1 756 ? -70.043 -24.974 14.393  1.00 51.53  ? 819  TYR B O     1 
ATOM   5335 C  CB    . TYR A 1 756 ? -71.960 -26.013 16.807  1.00 57.11  ? 819  TYR B CB    1 
ATOM   5336 C  CG    . TYR A 1 756 ? -71.309 -24.901 17.547  1.00 53.50  ? 819  TYR B CG    1 
ATOM   5337 C  CD1   . TYR A 1 756 ? -71.944 -23.726 17.725  1.00 57.06  ? 819  TYR B CD1   1 
ATOM   5338 C  CD2   . TYR A 1 756 ? -70.080 -25.049 18.079  1.00 47.64  ? 819  TYR B CD2   1 
ATOM   5339 C  CE1   . TYR A 1 756 ? -71.363 -22.710 18.395  1.00 58.06  ? 819  TYR B CE1   1 
ATOM   5340 C  CE2   . TYR A 1 756 ? -69.493 -24.035 18.754  1.00 51.22  ? 819  TYR B CE2   1 
ATOM   5341 C  CZ    . TYR A 1 756 ? -70.147 -22.865 18.896  1.00 57.43  ? 819  TYR B CZ    1 
ATOM   5342 O  OH    . TYR A 1 756 ? -69.587 -21.825 19.565  1.00 60.72  ? 819  TYR B OH    1 
ATOM   5343 N  N     . THR A 1 757 ? -70.128 -27.184 14.563  1.00 55.68  ? 820  THR B N     1 
ATOM   5344 C  CA    . THR A 1 757 ? -68.806 -27.432 14.039  1.00 53.52  ? 820  THR B CA    1 
ATOM   5345 C  C     . THR A 1 757 ? -68.660 -26.870 12.659  1.00 59.26  ? 820  THR B C     1 
ATOM   5346 O  O     . THR A 1 757 ? -67.630 -26.377 12.305  1.00 57.27  ? 820  THR B O     1 
ATOM   5347 C  CB    . THR A 1 757 ? -68.520 -28.910 13.940  1.00 54.54  ? 820  THR B CB    1 
ATOM   5348 O  OG1   . THR A 1 757 ? -68.134 -29.391 15.211  1.00 56.08  ? 820  THR B OG1   1 
ATOM   5349 C  CG2   . THR A 1 757 ? -67.386 -29.149 13.023  1.00 52.09  ? 820  THR B CG2   1 
ATOM   5350 N  N     . LEU A 1 758 ? -69.680 -26.976 11.831  1.00 57.60  ? 821  LEU B N     1 
ATOM   5351 C  CA    . LEU A 1 758 ? -69.636 -26.383 10.539  1.00 53.61  ? 821  LEU B CA    1 
ATOM   5352 C  C     . LEU A 1 758 ? -69.543 -24.892 10.671  1.00 52.14  ? 821  LEU B C     1 
ATOM   5353 O  O     . LEU A 1 758 ? -68.777 -24.268 9.988   1.00 55.91  ? 821  LEU B O     1 
ATOM   5354 C  CB    . LEU A 1 758 ? -70.878 -26.750 9.803   1.00 60.70  ? 821  LEU B CB    1 
ATOM   5355 C  CG    . LEU A 1 758 ? -70.860 -28.219 9.527   1.00 56.48  ? 821  LEU B CG    1 
ATOM   5356 C  CD1   . LEU A 1 758 ? -71.953 -28.441 8.519   1.00 45.65  ? 821  LEU B CD1   1 
ATOM   5357 C  CD2   . LEU A 1 758 ? -69.522 -28.589 8.959   1.00 43.80  ? 821  LEU B CD2   1 
ATOM   5358 N  N     . CYS A 1 759 ? -70.284 -24.305 11.587  1.00 49.52  ? 822  CYS B N     1 
ATOM   5359 C  CA    . CYS A 1 759 ? -70.219 -22.885 11.787  1.00 56.24  ? 822  CYS B CA    1 
ATOM   5360 C  C     . CYS A 1 759 ? -68.843 -22.479 12.228  1.00 55.54  ? 822  CYS B C     1 
ATOM   5361 O  O     . CYS A 1 759 ? -68.324 -21.502 11.774  1.00 58.20  ? 822  CYS B O     1 
ATOM   5362 C  CB    . CYS A 1 759 ? -71.246 -22.457 12.788  1.00 59.03  ? 822  CYS B CB    1 
ATOM   5363 S  SG    . CYS A 1 759 ? -71.799 -20.812 12.531  1.00 54.35  ? 822  CYS B SG    1 
ATOM   5364 N  N     . GLU A 1 760 ? -68.210 -23.228 13.104  1.00 55.37  ? 823  GLU B N     1 
ATOM   5365 C  CA    . GLU A 1 760 ? -66.842 -22.908 13.460  1.00 57.62  ? 823  GLU B CA    1 
ATOM   5366 C  C     . GLU A 1 760 ? -65.981 -23.055 12.240  1.00 51.35  ? 823  GLU B C     1 
ATOM   5367 O  O     . GLU A 1 760 ? -65.175 -22.227 11.969  1.00 49.83  ? 823  GLU B O     1 
ATOM   5368 C  CB    . GLU A 1 760 ? -66.317 -23.828 14.559  1.00 48.77  ? 823  GLU B CB    1 
ATOM   5369 N  N     . LYS A 1 761 ? -66.163 -24.100 11.463  1.00 51.34  ? 824  LYS B N     1 
ATOM   5370 C  CA    . LYS A 1 761 ? -65.353 -24.256 10.289  1.00 50.58  ? 824  LYS B CA    1 
ATOM   5371 C  C     . LYS A 1 761 ? -65.577 -23.160 9.319   1.00 52.13  ? 824  LYS B C     1 
ATOM   5372 O  O     . LYS A 1 761 ? -64.670 -22.638 8.784   1.00 51.03  ? 824  LYS B O     1 
ATOM   5373 C  CB    . LYS A 1 761 ? -65.651 -25.573 9.611   1.00 38.80  ? 824  LYS B CB    1 
ATOM   5374 N  N     . LYS A 1 762 ? -66.807 -22.783 9.117   1.00 52.21  ? 825  LYS B N     1 
ATOM   5375 C  CA    . LYS A 1 762 ? -67.107 -21.747 8.181   1.00 52.68  ? 825  LYS B CA    1 
ATOM   5376 C  C     . LYS A 1 762 ? -66.488 -20.449 8.622   1.00 53.99  ? 825  LYS B C     1 
ATOM   5377 O  O     . LYS A 1 762 ? -66.101 -19.655 7.832   1.00 49.76  ? 825  LYS B O     1 
ATOM   5378 C  CB    . LYS A 1 762 ? -68.603 -21.654 8.032   1.00 54.67  ? 825  LYS B CB    1 
ATOM   5379 C  CG    . LYS A 1 762 ? -69.089 -21.561 6.615   1.00 58.51  ? 825  LYS B CG    1 
ATOM   5380 C  CD    . LYS A 1 762 ? -69.538 -20.166 6.302   1.00 55.03  ? 825  LYS B CD    1 
ATOM   5381 C  CE    . LYS A 1 762 ? -70.453 -20.209 5.123   1.00 62.10  ? 825  LYS B CE    1 
ATOM   5382 N  NZ    . LYS A 1 762 ? -71.263 -18.989 4.960   1.00 63.09  ? 825  LYS B NZ    1 
ATOM   5383 N  N     . ALA A 1 763 ? -66.466 -20.210 9.908   1.00 50.40  ? 826  ALA B N     1 
ATOM   5384 C  CA    . ALA A 1 763 ? -65.898 -19.003 10.448  1.00 52.70  ? 826  ALA B CA    1 
ATOM   5385 C  C     . ALA A 1 763 ? -64.421 -18.915 10.214  1.00 51.83  ? 826  ALA B C     1 
ATOM   5386 O  O     . ALA A 1 763 ? -63.891 -17.864 10.017  1.00 51.51  ? 826  ALA B O     1 
ATOM   5387 C  CB    . ALA A 1 763 ? -66.219 -18.885 11.914  1.00 47.73  ? 826  ALA B CB    1 
ATOM   5388 N  N     . GLN A 1 764 ? -63.748 -20.034 10.306  1.00 51.22  ? 827  GLN B N     1 
ATOM   5389 C  CA    . GLN A 1 764 ? -62.332 -20.074 10.088  1.00 51.88  ? 827  GLN B CA    1 
ATOM   5390 C  C     . GLN A 1 764 ? -61.950 -19.702 8.718   1.00 47.88  ? 827  GLN B C     1 
ATOM   5391 O  O     . GLN A 1 764 ? -61.003 -19.033 8.539   1.00 48.77  ? 827  GLN B O     1 
ATOM   5392 C  CB    . GLN A 1 764 ? -61.814 -21.454 10.325  1.00 53.02  ? 827  GLN B CB    1 
ATOM   5393 C  CG    . GLN A 1 764 ? -60.349 -21.453 10.578  1.00 55.49  ? 827  GLN B CG    1 
ATOM   5394 C  CD    . GLN A 1 764 ? -60.034 -20.657 11.787  1.00 59.54  ? 827  GLN B CD    1 
ATOM   5395 O  OE1   . GLN A 1 764 ? -59.144 -19.827 11.789  1.00 54.57  ? 827  GLN B OE1   1 
ATOM   5396 N  NE2   . GLN A 1 764 ? -60.789 -20.880 12.823  1.00 62.83  ? 827  GLN B NE2   1 
ATOM   5397 N  N     . ILE A 1 765 ? -62.665 -20.145 7.720   1.00 48.29  ? 828  ILE B N     1 
ATOM   5398 C  CA    . ILE A 1 765 ? -62.309 -19.774 6.380   1.00 50.36  ? 828  ILE B CA    1 
ATOM   5399 C  C     . ILE A 1 765 ? -62.458 -18.315 6.130   1.00 49.70  ? 828  ILE B C     1 
ATOM   5400 O  O     . ILE A 1 765 ? -61.640 -17.722 5.519   1.00 51.27  ? 828  ILE B O     1 
ATOM   5401 C  CB    . ILE A 1 765 ? -62.859 -20.672 5.300   1.00 42.98  ? 828  ILE B CB    1 
ATOM   5402 C  CG1   . ILE A 1 765 ? -63.818 -21.648 5.896   1.00 52.33  ? 828  ILE B CG1   1 
ATOM   5403 C  CG2   . ILE A 1 765 ? -61.731 -21.494 4.757   1.00 48.57  ? 828  ILE B CG2   1 
ATOM   5404 C  CD1   . ILE A 1 765 ? -63.809 -23.007 5.280   1.00 46.34  ? 828  ILE B CD1   1 
ATOM   5405 N  N     . ALA A 1 766 ? -63.462 -17.698 6.682   1.00 44.31  ? 829  ALA B N     1 
ATOM   5406 C  CA    . ALA A 1 766 ? -63.653 -16.305 6.510   1.00 47.22  ? 829  ALA B CA    1 
ATOM   5407 C  C     . ALA A 1 766 ? -62.522 -15.495 7.043   1.00 52.20  ? 829  ALA B C     1 
ATOM   5408 O  O     . ALA A 1 766 ? -62.185 -14.492 6.497   1.00 58.73  ? 829  ALA B O     1 
ATOM   5409 C  CB    . ALA A 1 766 ? -64.875 -15.926 7.246   1.00 53.95  ? 829  ALA B CB    1 
ATOM   5410 N  N     . ILE A 1 767 ? -61.988 -15.872 8.179   1.00 52.84  ? 830  ILE B N     1 
ATOM   5411 C  CA    . ILE A 1 767 ? -60.871 -15.200 8.764   1.00 48.37  ? 830  ILE B CA    1 
ATOM   5412 C  C     . ILE A 1 767 ? -59.687 -15.321 7.862   1.00 52.10  ? 830  ILE B C     1 
ATOM   5413 O  O     . ILE A 1 767 ? -59.008 -14.376 7.663   1.00 52.27  ? 830  ILE B O     1 
ATOM   5414 C  CB    . ILE A 1 767 ? -60.537 -15.858 10.074  1.00 49.13  ? 830  ILE B CB    1 
ATOM   5415 C  CG1   . ILE A 1 767 ? -61.427 -15.302 11.159  1.00 46.69  ? 830  ILE B CG1   1 
ATOM   5416 C  CG2   . ILE A 1 767 ? -59.114 -15.587 10.418  1.00 55.13  ? 830  ILE B CG2   1 
ATOM   5417 C  CD1   . ILE A 1 767 ? -61.393 -16.105 12.418  1.00 36.77  ? 830  ILE B CD1   1 
ATOM   5418 N  N     . ASP A 1 768 ? -59.451 -16.503 7.320   1.00 51.16  ? 831  ASP B N     1 
ATOM   5419 C  CA    . ASP A 1 768 ? -58.383 -16.763 6.367   1.00 47.68  ? 831  ASP B CA    1 
ATOM   5420 C  C     . ASP A 1 768 ? -58.574 -16.035 5.064   1.00 48.11  ? 831  ASP B C     1 
ATOM   5421 O  O     . ASP A 1 768 ? -57.634 -15.644 4.453   1.00 44.69  ? 831  ASP B O     1 
ATOM   5422 C  CB    . ASP A 1 768 ? -58.270 -18.232 6.087   1.00 39.98  ? 831  ASP B CB    1 
ATOM   5423 C  CG    . ASP A 1 768 ? -57.952 -18.998 7.279   1.00 55.54  ? 831  ASP B CG    1 
ATOM   5424 O  OD1   . ASP A 1 768 ? -57.327 -18.467 8.179   1.00 60.75  ? 831  ASP B OD1   1 
ATOM   5425 O  OD2   . ASP A 1 768 ? -58.301 -20.155 7.329   1.00 60.26  ? 831  ASP B OD2   1 
ATOM   5426 N  N     . ILE A 1 769 ? -59.801 -15.950 4.588   1.00 47.51  ? 832  ILE B N     1 
ATOM   5427 C  CA    . ILE A 1 769 ? -60.101 -15.229 3.374   1.00 47.91  ? 832  ILE B CA    1 
ATOM   5428 C  C     . ILE A 1 769 ? -59.828 -13.774 3.563   1.00 48.54  ? 832  ILE B C     1 
ATOM   5429 O  O     . ILE A 1 769 ? -59.427 -13.114 2.662   1.00 44.54  ? 832  ILE B O     1 
ATOM   5430 C  CB    . ILE A 1 769 ? -61.575 -15.358 2.967   1.00 52.28  ? 832  ILE B CB    1 
ATOM   5431 C  CG1   . ILE A 1 769 ? -61.896 -16.740 2.474   1.00 46.89  ? 832  ILE B CG1   1 
ATOM   5432 C  CG2   . ILE A 1 769 ? -61.895 -14.437 1.827   1.00 39.74  ? 832  ILE B CG2   1 
ATOM   5433 C  CD1   . ILE A 1 769 ? -63.361 -17.042 2.500   1.00 40.86  ? 832  ILE B CD1   1 
ATOM   5434 N  N     . LYS A 1 770 ? -60.186 -13.246 4.711   1.00 50.14  ? 833  LYS B N     1 
ATOM   5435 C  CA    . LYS A 1 770 ? -59.948 -11.859 5.014   1.00 48.52  ? 833  LYS B CA    1 
ATOM   5436 C  C     . LYS A 1 770 ? -58.496 -11.572 5.135   1.00 53.33  ? 833  LYS B C     1 
ATOM   5437 O  O     . LYS A 1 770 ? -58.022 -10.580 4.672   1.00 57.24  ? 833  LYS B O     1 
ATOM   5438 C  CB    . LYS A 1 770 ? -60.607 -11.493 6.329   1.00 41.44  ? 833  LYS B CB    1 
ATOM   5439 N  N     . SER A 1 771 ? -57.805 -12.468 5.804   1.00 47.94  ? 834  SER B N     1 
ATOM   5440 C  CA    . SER A 1 771 ? -56.397 -12.390 6.040   1.00 41.61  ? 834  SER B CA    1 
ATOM   5441 C  C     . SER A 1 771 ? -55.673 -12.491 4.778   1.00 46.20  ? 834  SER B C     1 
ATOM   5442 O  O     . SER A 1 771 ? -54.728 -11.836 4.596   1.00 53.82  ? 834  SER B O     1 
ATOM   5443 C  CB    . SER A 1 771 ? -55.995 -13.511 6.946   1.00 46.80  ? 834  SER B CB    1 
ATOM   5444 O  OG    . SER A 1 771 ? -54.628 -13.660 7.032   1.00 51.15  ? 834  SER B OG    1 
ATOM   5445 N  N     . ALA A 1 772 ? -56.076 -13.361 3.888   1.00 47.08  ? 835  ALA B N     1 
ATOM   5446 C  CA    . ALA A 1 772 ? -55.416 -13.458 2.603   1.00 43.81  ? 835  ALA B CA    1 
ATOM   5447 C  C     . ALA A 1 772 ? -55.648 -12.248 1.786   1.00 45.63  ? 835  ALA B C     1 
ATOM   5448 O  O     . ALA A 1 772 ? -54.798 -11.777 1.099   1.00 46.31  ? 835  ALA B O     1 
ATOM   5449 C  CB    . ALA A 1 772 ? -55.861 -14.659 1.861   1.00 42.73  ? 835  ALA B CB    1 
ATOM   5450 N  N     . LYS A 1 773 ? -56.840 -11.710 1.864   1.00 49.83  ? 836  LYS B N     1 
ATOM   5451 C  CA    . LYS A 1 773 ? -57.155 -10.505 1.160   1.00 54.63  ? 836  LYS B CA    1 
ATOM   5452 C  C     . LYS A 1 773 ? -56.294 -9.363  1.661   1.00 57.79  ? 836  LYS B C     1 
ATOM   5453 O  O     . LYS A 1 773 ? -55.906 -8.525  0.889   1.00 60.18  ? 836  LYS B O     1 
ATOM   5454 C  CB    . LYS A 1 773 ? -58.640 -10.216 1.211   1.00 52.72  ? 836  LYS B CB    1 
ATOM   5455 C  CG    . LYS A 1 773 ? -59.402 -10.870 0.089   1.00 51.31  ? 836  LYS B CG    1 
ATOM   5456 C  CD    . LYS A 1 773 ? -60.860 -10.502 0.071   1.00 50.74  ? 836  LYS B CD    1 
ATOM   5457 C  CE    . LYS A 1 773 ? -61.032 -9.012  -0.065  1.00 67.58  ? 836  LYS B CE    1 
ATOM   5458 N  NZ    . LYS A 1 773 ? -61.375 -8.335  1.209   1.00 73.46  ? 836  LYS B NZ    1 
ATOM   5459 N  N     . ARG A 1 774 ? -56.032 -9.288  2.952   1.00 49.41  ? 837  ARG B N     1 
ATOM   5460 C  CA    . ARG A 1 774 ? -55.133 -8.306  3.475   1.00 50.67  ? 837  ARG B CA    1 
ATOM   5461 C  C     . ARG A 1 774 ? -53.734 -8.531  2.894   1.00 53.48  ? 837  ARG B C     1 
ATOM   5462 O  O     . ARG A 1 774 ? -53.091 -7.603  2.488   1.00 52.68  ? 837  ARG B O     1 
ATOM   5463 C  CB    . ARG A 1 774 ? -55.091 -8.415  4.986   1.00 50.59  ? 837  ARG B CB    1 
ATOM   5464 N  N     . GLU A 1 775 ? -53.278 -9.773  2.794   1.00 48.94  ? 838  GLU B N     1 
ATOM   5465 C  CA    . GLU A 1 775 ? -51.958 -10.059 2.255   1.00 48.11  ? 838  GLU B CA    1 
ATOM   5466 C  C     . GLU A 1 775 ? -51.837 -9.667  0.823   1.00 50.82  ? 838  GLU B C     1 
ATOM   5467 O  O     . GLU A 1 775 ? -50.810 -9.270  0.366   1.00 49.58  ? 838  GLU B O     1 
ATOM   5468 C  CB    . GLU A 1 775 ? -51.584 -11.506 2.421   1.00 49.56  ? 838  GLU B CB    1 
ATOM   5469 N  N     . LEU A 1 776 ? -52.900 -9.879  0.083   1.00 59.37  ? 839  LEU B N     1 
ATOM   5470 C  CA    . LEU A 1 776 ? -52.991 -9.471  -1.292  1.00 54.88  ? 839  LEU B CA    1 
ATOM   5471 C  C     . LEU A 1 776 ? -52.943 -7.963  -1.381  1.00 51.69  ? 839  LEU B C     1 
ATOM   5472 O  O     . LEU A 1 776 ? -52.318 -7.443  -2.217  1.00 45.95  ? 839  LEU B O     1 
ATOM   5473 C  CB    . LEU A 1 776 ? -54.251 -10.024 -1.936  1.00 45.84  ? 839  LEU B CB    1 
ATOM   5474 N  N     . LYS A 1 777 ? -53.518 -7.223  -0.450  1.00 52.23  ? 840  LYS B N     1 
ATOM   5475 C  CA    . LYS A 1 777 ? -53.524 -5.764  -0.516  1.00 52.38  ? 840  LYS B CA    1 
ATOM   5476 C  C     . LYS A 1 777 ? -52.198 -5.083  -0.514  1.00 52.65  ? 840  LYS B C     1 
ATOM   5477 O  O     . LYS A 1 777 ? -52.094 -3.987  -0.978  1.00 49.47  ? 840  LYS B O     1 
ATOM   5478 C  CB    . LYS A 1 777 ? -54.350 -5.167  0.601   1.00 47.86  ? 840  LYS B CB    1 
ATOM   5479 N  N     . LYS A 1 778 ? -51.195 -5.785  -0.013  1.00 51.96  ? 841  LYS B N     1 
ATOM   5480 C  CA    . LYS A 1 778 ? -49.848 -5.272  0.113   1.00 45.23  ? 841  LYS B CA    1 
ATOM   5481 C  C     . LYS A 1 778 ? -49.013 -5.703  -1.072  1.00 46.38  ? 841  LYS B C     1 
ATOM   5482 O  O     . LYS A 1 778 ? -47.814 -5.546  -1.072  1.00 51.08  ? 841  LYS B O     1 
ATOM   5483 C  CB    . LYS A 1 778 ? -49.217 -5.760  1.411   1.00 36.75  ? 841  LYS B CB    1 
ATOM   5484 N  N     . ALA A 1 779 ? -49.662 -6.265  -2.077  1.00 48.96  ? 842  ALA B N     1 
ATOM   5485 C  CA    . ALA A 1 779 ? -48.987 -6.864  -3.217  1.00 46.25  ? 842  ALA B CA    1 
ATOM   5486 C  C     . ALA A 1 779 ? -48.144 -5.908  -4.029  1.00 40.73  ? 842  ALA B C     1 
ATOM   5487 O  O     . ALA A 1 779 ? -47.087 -6.269  -4.503  1.00 40.55  ? 842  ALA B O     1 
ATOM   5488 C  CB    . ALA A 1 779 ? -50.003 -7.540  -4.113  1.00 42.93  ? 842  ALA B CB    1 
ATOM   5489 N  N     . ARG A 1 780 ? -48.620 -4.695  -4.214  1.00 41.13  ? 843  ARG B N     1 
ATOM   5490 C  CA    . ARG A 1 780 ? -47.926 -3.741  -5.055  1.00 49.22  ? 843  ARG B CA    1 
ATOM   5491 C  C     . ARG A 1 780 ? -47.049 -2.808  -4.249  1.00 42.85  ? 843  ARG B C     1 
ATOM   5492 O  O     . ARG A 1 780 ? -46.590 -1.798  -4.741  1.00 44.61  ? 843  ARG B O     1 
ATOM   5493 C  CB    . ARG A 1 780 ? -48.917 -2.946  -5.899  1.00 57.09  ? 843  ARG B CB    1 
ATOM   5494 N  N     . THR A 1 781 ? -46.852 -3.132  -2.989  1.00 38.38  ? 844  THR B N     1 
ATOM   5495 C  CA    . THR A 1 781 ? -46.138 -2.252  -2.095  1.00 48.29  ? 844  THR B CA    1 
ATOM   5496 C  C     . THR A 1 781 ? -44.809 -2.834  -1.666  1.00 48.30  ? 844  THR B C     1 
ATOM   5497 O  O     . THR A 1 781 ? -44.669 -4.035  -1.581  1.00 52.22  ? 844  THR B O     1 
ATOM   5498 C  CB    . THR A 1 781 ? -46.980 -1.981  -0.855  1.00 44.20  ? 844  THR B CB    1 
ATOM   5499 O  OG1   . THR A 1 781 ? -46.146 -2.022  0.296   1.00 45.01  ? 844  THR B OG1   1 
ATOM   5500 C  CG2   . THR A 1 781 ? -48.019 -3.034  -0.726  1.00 45.88  ? 844  THR B CG2   1 
ATOM   5501 N  N     . VAL A 1 782 ? -43.823 -1.978  -1.421  1.00 40.69  ? 845  VAL B N     1 
ATOM   5502 C  CA    . VAL A 1 782 ? -42.539 -2.431  -0.930  1.00 38.20  ? 845  VAL B CA    1 
ATOM   5503 C  C     . VAL A 1 782 ? -42.686 -2.570  0.554   1.00 33.62  ? 845  VAL B C     1 
ATOM   5504 O  O     . VAL A 1 782 ? -42.977 -1.618  1.229   1.00 39.12  ? 845  VAL B O     1 
ATOM   5505 C  CB    . VAL A 1 782 ? -41.455 -1.386  -1.183  1.00 38.85  ? 845  VAL B CB    1 
ATOM   5506 C  CG1   . VAL A 1 782 ? -40.091 -1.918  -0.791  1.00 39.08  ? 845  VAL B CG1   1 
ATOM   5507 C  CG2   . VAL A 1 782 ? -41.460 -0.966  -2.636  1.00 44.66  ? 845  VAL B CG2   1 
ATOM   5508 N  N     . LEU A 1 783 ? -42.478 -3.764  1.063   1.00 30.74  ? 846  LEU B N     1 
ATOM   5509 C  CA    . LEU A 1 783 ? -42.801 -4.045  2.436   1.00 31.91  ? 846  LEU B CA    1 
ATOM   5510 C  C     . LEU A 1 783 ? -42.036 -3.279  3.499   1.00 33.52  ? 846  LEU B C     1 
ATOM   5511 O  O     . LEU A 1 783 ? -42.642 -2.811  4.446   1.00 37.65  ? 846  LEU B O     1 
ATOM   5512 C  CB    . LEU A 1 783 ? -42.670 -5.535  2.690   1.00 39.16  ? 846  LEU B CB    1 
ATOM   5513 C  CG    . LEU A 1 783 ? -43.578 -6.384  1.823   1.00 37.82  ? 846  LEU B CG    1 
ATOM   5514 C  CD1   . LEU A 1 783 ? -43.712 -7.752  2.442   1.00 30.77  ? 846  LEU B CD1   1 
ATOM   5515 C  CD2   . LEU A 1 783 ? -44.927 -5.709  1.753   1.00 42.87  ? 846  LEU B CD2   1 
ATOM   5516 N  N     . GLN A 1 784 ? -40.725 -3.132  3.366   1.00 30.37  ? 847  GLN B N     1 
ATOM   5517 C  CA    . GLN A 1 784 ? -39.992 -2.502  4.424   1.00 33.42  ? 847  GLN B CA    1 
ATOM   5518 C  C     . GLN A 1 784 ? -39.733 -1.058  4.198   1.00 39.31  ? 847  GLN B C     1 
ATOM   5519 O  O     . GLN A 1 784 ? -39.065 -0.476  4.957   1.00 43.43  ? 847  GLN B O     1 
ATOM   5520 C  CB    . GLN A 1 784 ? -38.659 -3.167  4.661   1.00 25.73  ? 847  GLN B CB    1 
ATOM   5521 C  CG    . GLN A 1 784 ? -38.627 -4.634  4.438   1.00 29.32  ? 847  GLN B CG    1 
ATOM   5522 C  CD    . GLN A 1 784 ? -37.650 -5.314  5.331   1.00 38.09  ? 847  GLN B CD    1 
ATOM   5523 O  OE1   . GLN A 1 784 ? -37.600 -6.503  5.388   1.00 40.38  ? 847  GLN B OE1   1 
ATOM   5524 N  NE2   . GLN A 1 784 ? -36.894 -4.558  6.050   1.00 39.22  ? 847  GLN B NE2   1 
ATOM   5525 N  N     . MET A 1 785 ? -40.219 -0.474  3.137   1.00 37.86  ? 848  MET B N     1 
ATOM   5526 C  CA    . MET A 1 785 ? -39.959 0.908   2.901   1.00 35.77  ? 848  MET B CA    1 
ATOM   5527 C  C     . MET A 1 785 ? -40.522 1.844   3.912   1.00 33.99  ? 848  MET B C     1 
ATOM   5528 O  O     . MET A 1 785 ? -39.948 2.842   4.191   1.00 36.79  ? 848  MET B O     1 
ATOM   5529 C  CB    . MET A 1 785 ? -40.290 1.318   1.506   1.00 38.02  ? 848  MET B CB    1 
ATOM   5530 C  CG    . MET A 1 785 ? -40.060 2.766   1.292   1.00 36.77  ? 848  MET B CG    1 
ATOM   5531 S  SD    . MET A 1 785 ? -39.097 2.953   -0.134  1.00 40.53  ? 848  MET B SD    1 
ATOM   5532 C  CE    . MET A 1 785 ? -37.525 2.636   0.521   1.00 38.20  ? 848  MET B CE    1 
ATOM   5533 N  N     . ASP A 1 786 ? -41.676 1.552   4.457   1.00 34.56  ? 849  ASP B N     1 
ATOM   5534 C  CA    . ASP A 1 786 ? -42.224 2.423   5.460   1.00 41.35  ? 849  ASP B CA    1 
ATOM   5535 C  C     . ASP A 1 786 ? -41.345 2.495   6.667   1.00 45.02  ? 849  ASP B C     1 
ATOM   5536 O  O     . ASP A 1 786 ? -41.209 3.525   7.230   1.00 39.64  ? 849  ASP B O     1 
ATOM   5537 C  CB    . ASP A 1 786 ? -43.619 2.021   5.873   1.00 37.45  ? 849  ASP B CB    1 
ATOM   5538 C  CG    . ASP A 1 786 ? -44.665 2.866   5.238   1.00 51.67  ? 849  ASP B CG    1 
ATOM   5539 O  OD1   . ASP A 1 786 ? -44.303 3.718   4.432   1.00 67.30  ? 849  ASP B OD1   1 
ATOM   5540 O  OD2   . ASP A 1 786 ? -45.840 2.683   5.516   1.00 55.46  ? 849  ASP B OD2   1 
ATOM   5541 N  N     . GLU A 1 787 ? -40.765 1.387   7.041   1.00 40.51  ? 850  GLU B N     1 
ATOM   5542 C  CA    . GLU A 1 787 ? -39.867 1.340   8.150   1.00 33.40  ? 850  GLU B CA    1 
ATOM   5543 C  C     . GLU A 1 787 ? -38.625 2.068   7.940   1.00 36.86  ? 850  GLU B C     1 
ATOM   5544 O  O     . GLU A 1 787 ? -38.051 2.451   8.862   1.00 38.62  ? 850  GLU B O     1 
ATOM   5545 C  CB    . GLU A 1 787 ? -39.501 -0.055  8.513   1.00 40.23  ? 850  GLU B CB    1 
ATOM   5546 C  CG    . GLU A 1 787 ? -38.390 -0.144  9.533   1.00 33.73  ? 850  GLU B CG    1 
ATOM   5547 C  CD    . GLU A 1 787 ? -38.118 -1.544  9.864   1.00 33.41  ? 850  GLU B CD    1 
ATOM   5548 O  OE1   . GLU A 1 787 ? -39.062 -2.268  9.867   1.00 31.82  ? 850  GLU B OE1   1 
ATOM   5549 O  OE2   . GLU A 1 787 ? -37.000 -1.904  10.110  1.00 37.30  ? 850  GLU B OE2   1 
ATOM   5550 N  N     . LEU A 1 788 ? -38.119 2.108   6.729   1.00 37.53  ? 851  LEU B N     1 
ATOM   5551 C  CA    . LEU A 1 788 ? -36.914 2.828   6.375   1.00 35.43  ? 851  LEU B CA    1 
ATOM   5552 C  C     . LEU A 1 788 ? -37.111 4.267   6.572   1.00 37.00  ? 851  LEU B C     1 
ATOM   5553 O  O     . LEU A 1 788 ? -36.276 4.940   7.028   1.00 41.39  ? 851  LEU B O     1 
ATOM   5554 C  CB    . LEU A 1 788 ? -36.636 2.644   4.906   1.00 33.99  ? 851  LEU B CB    1 
ATOM   5555 C  CG    . LEU A 1 788 ? -35.575 3.495   4.252   1.00 34.48  ? 851  LEU B CG    1 
ATOM   5556 C  CD1   . LEU A 1 788 ? -34.285 2.809   4.488   1.00 36.79  ? 851  LEU B CD1   1 
ATOM   5557 C  CD2   . LEU A 1 788 ? -35.798 3.566   2.789   1.00 29.05  ? 851  LEU B CD2   1 
ATOM   5558 N  N     . LYS A 1 789 ? -38.251 4.759   6.179   1.00 34.83  ? 852  LYS B N     1 
ATOM   5559 C  CA    . LYS A 1 789 ? -38.585 6.144   6.322   1.00 37.45  ? 852  LYS B CA    1 
ATOM   5560 C  C     . LYS A 1 789 ? -38.710 6.555   7.757   1.00 38.89  ? 852  LYS B C     1 
ATOM   5561 O  O     . LYS A 1 789 ? -38.506 7.678   8.077   1.00 36.09  ? 852  LYS B O     1 
ATOM   5562 C  CB    . LYS A 1 789 ? -39.824 6.472   5.545   1.00 39.79  ? 852  LYS B CB    1 
ATOM   5563 C  CG    . LYS A 1 789 ? -39.674 6.330   4.063   1.00 40.27  ? 852  LYS B CG    1 
ATOM   5564 C  CD    . LYS A 1 789 ? -38.325 6.799   3.620   1.00 45.01  ? 852  LYS B CD    1 
ATOM   5565 C  CE    . LYS A 1 789 ? -38.260 7.136   2.155   1.00 35.34  ? 852  LYS B CE    1 
ATOM   5566 N  NZ    . LYS A 1 789 ? -39.186 6.260   1.484   1.00 41.25  ? 852  LYS B NZ    1 
ATOM   5567 N  N     . CYS A 1 790 ? -39.222 5.672   8.580   1.00 35.35  ? 853  CYS B N     1 
ATOM   5568 C  CA    . CYS A 1 790 ? -39.306 5.885   9.976   1.00 28.98  ? 853  CYS B CA    1 
ATOM   5569 C  C     . CYS A 1 790 ? -37.915 5.937   10.529  1.00 33.84  ? 853  CYS B C     1 
ATOM   5570 O  O     . CYS A 1 790 ? -37.609 6.766   11.299  1.00 41.11  ? 853  CYS B O     1 
ATOM   5571 C  CB    . CYS A 1 790 ? -40.059 4.765   10.606  1.00 34.54  ? 853  CYS B CB    1 
ATOM   5572 S  SG    . CYS A 1 790 ? -41.795 4.892   10.384  1.00 34.84  ? 853  CYS B SG    1 
ATOM   5573 N  N     . ARG A 1 791 ? -37.031 5.073   10.106  1.00 26.74  ? 854  ARG B N     1 
ATOM   5574 C  CA    . ARG A 1 791 ? -35.673 5.159   10.537  1.00 28.25  ? 854  ARG B CA    1 
ATOM   5575 C  C     . ARG A 1 791 ? -35.072 6.386   10.039  1.00 30.55  ? 854  ARG B C     1 
ATOM   5576 O  O     . ARG A 1 791 ? -34.379 6.991   10.727  1.00 34.69  ? 854  ARG B O     1 
ATOM   5577 C  CB    . ARG A 1 791 ? -34.845 4.067   9.962   1.00 31.55  ? 854  ARG B CB    1 
ATOM   5578 C  CG    . ARG A 1 791 ? -35.255 2.727   10.417  1.00 38.49  ? 854  ARG B CG    1 
ATOM   5579 C  CD    . ARG A 1 791 ? -34.333 1.705   9.886   1.00 35.11  ? 854  ARG B CD    1 
ATOM   5580 N  NE    . ARG A 1 791 ? -33.731 1.099   11.016  1.00 40.44  ? 854  ARG B NE    1 
ATOM   5581 C  CZ    . ARG A 1 791 ? -34.318 0.169   11.705  1.00 38.76  ? 854  ARG B CZ    1 
ATOM   5582 N  NH1   . ARG A 1 791 ? -35.484 -0.243  11.341  1.00 34.76  ? 854  ARG B NH1   1 
ATOM   5583 N  NH2   . ARG A 1 791 ? -33.740 -0.337  12.738  1.00 33.97  ? 854  ARG B NH2   1 
ATOM   5584 N  N     . LYS A 1 792 ? -35.333 6.772   8.814   1.00 34.38  ? 855  LYS B N     1 
ATOM   5585 C  CA    . LYS A 1 792 ? -34.777 7.955   8.263   1.00 33.58  ? 855  LYS B CA    1 
ATOM   5586 C  C     . LYS A 1 792 ? -35.208 9.152   9.072   1.00 38.96  ? 855  LYS B C     1 
ATOM   5587 O  O     . LYS A 1 792 ? -34.415 9.970   9.351   1.00 37.34  ? 855  LYS B O     1 
ATOM   5588 C  CB    . LYS A 1 792 ? -35.201 8.091   6.814   1.00 36.11  ? 855  LYS B CB    1 
ATOM   5589 C  CG    . LYS A 1 792 ? -34.220 7.691   5.716   1.00 39.72  ? 855  LYS B CG    1 
ATOM   5590 C  CD    . LYS A 1 792 ? -34.895 7.779   4.357   1.00 39.39  ? 855  LYS B CD    1 
ATOM   5591 C  CE    . LYS A 1 792 ? -33.960 7.755   3.170   1.00 39.22  ? 855  LYS B CE    1 
ATOM   5592 N  NZ    . LYS A 1 792 ? -34.509 7.131   1.924   1.00 48.86  ? 855  LYS B NZ    1 
ATOM   5593 N  N     . ARG A 1 793 ? -36.442 9.253   9.519   1.00 37.79  ? 856  ARG B N     1 
ATOM   5594 C  CA    . ARG A 1 793 ? -36.857 10.364  10.338  1.00 40.33  ? 856  ARG B CA    1 
ATOM   5595 C  C     . ARG A 1 793 ? -36.087 10.389  11.595  1.00 39.85  ? 856  ARG B C     1 
ATOM   5596 O  O     . ARG A 1 793 ? -35.605 11.393  11.960  1.00 44.73  ? 856  ARG B O     1 
ATOM   5597 C  CB    . ARG A 1 793 ? -38.331 10.282  10.662  1.00 38.84  ? 856  ARG B CB    1 
ATOM   5598 C  CG    . ARG A 1 793 ? -38.768 11.380  11.586  1.00 47.13  ? 856  ARG B CG    1 
ATOM   5599 C  CD    . ARG A 1 793 ? -40.249 11.538  11.712  1.00 55.67  ? 856  ARG B CD    1 
ATOM   5600 N  NE    . ARG A 1 793 ? -40.531 12.708  12.532  1.00 72.76  ? 856  ARG B NE    1 
ATOM   5601 C  CZ    . ARG A 1 793 ? -41.136 13.811  12.095  1.00 82.29  ? 856  ARG B CZ    1 
ATOM   5602 N  NH1   . ARG A 1 793 ? -41.535 13.878  10.847  1.00 82.96  ? 856  ARG B NH1   1 
ATOM   5603 N  NH2   . ARG A 1 793 ? -41.351 14.845  12.894  1.00 70.15  ? 856  ARG B NH2   1 
ATOM   5604 N  N     . VAL A 1 794 ? -35.868 9.263   12.225  1.00 35.53  ? 857  VAL B N     1 
ATOM   5605 C  CA    . VAL A 1 794 ? -35.091 9.211   13.432  1.00 38.60  ? 857  VAL B CA    1 
ATOM   5606 C  C     . VAL A 1 794 ? -33.694 9.668   13.209  1.00 38.85  ? 857  VAL B C     1 
ATOM   5607 O  O     . VAL A 1 794 ? -33.162 10.374  13.984  1.00 44.96  ? 857  VAL B O     1 
ATOM   5608 C  CB    . VAL A 1 794 ? -34.978 7.805   13.965  1.00 32.69  ? 857  VAL B CB    1 
ATOM   5609 C  CG1   . VAL A 1 794 ? -34.104 7.774   15.170  1.00 31.88  ? 857  VAL B CG1   1 
ATOM   5610 C  CG2   . VAL A 1 794 ? -36.321 7.282   14.302  1.00 36.20  ? 857  VAL B CG2   1 
ATOM   5611 N  N     . LEU A 1 795 ? -33.089 9.308   12.110  1.00 35.17  ? 858  LEU B N     1 
ATOM   5612 C  CA    . LEU A 1 795 ? -31.756 9.721   11.850  1.00 36.09  ? 858  LEU B CA    1 
ATOM   5613 C  C     . LEU A 1 795 ? -31.627 11.181  11.742  1.00 37.83  ? 858  LEU B C     1 
ATOM   5614 O  O     . LEU A 1 795 ? -30.649 11.673  12.125  1.00 42.37  ? 858  LEU B O     1 
ATOM   5615 C  CB    . LEU A 1 795 ? -31.282 9.131   10.558  1.00 38.08  ? 858  LEU B CB    1 
ATOM   5616 C  CG    . LEU A 1 795 ? -30.997 7.680   10.399  1.00 38.92  ? 858  LEU B CG    1 
ATOM   5617 C  CD1   . LEU A 1 795 ? -30.786 7.506   8.920   1.00 39.22  ? 858  LEU B CD1   1 
ATOM   5618 C  CD2   . LEU A 1 795 ? -29.715 7.430   11.115  1.00 37.88  ? 858  LEU B CD2   1 
ATOM   5619 N  N     . ARG A 1 796 ? -32.574 11.845  11.110  1.00 39.79  ? 859  ARG B N     1 
ATOM   5620 C  CA    . ARG A 1 796 ? -32.596 13.282  10.955  1.00 43.87  ? 859  ARG B CA    1 
ATOM   5621 C  C     . ARG A 1 796 ? -32.748 14.031  12.253  1.00 46.72  ? 859  ARG B C     1 
ATOM   5622 O  O     . ARG A 1 796 ? -32.029 14.962  12.527  1.00 39.56  ? 859  ARG B O     1 
ATOM   5623 C  CB    . ARG A 1 796 ? -33.723 13.658  10.035  1.00 37.82  ? 859  ARG B CB    1 
ATOM   5624 C  CG    . ARG A 1 796 ? -33.557 13.191  8.618   1.00 37.19  ? 859  ARG B CG    1 
ATOM   5625 C  CD    . ARG A 1 796 ? -34.887 13.000  7.937   1.00 38.37  ? 859  ARG B CD    1 
ATOM   5626 N  NE    . ARG A 1 796 ? -34.818 13.320  6.533   1.00 44.19  ? 859  ARG B NE    1 
ATOM   5627 C  CZ    . ARG A 1 796 ? -35.548 12.756  5.609   1.00 44.81  ? 859  ARG B CZ    1 
ATOM   5628 N  NH1   . ARG A 1 796 ? -36.382 11.853  5.951   1.00 51.78  ? 859  ARG B NH1   1 
ATOM   5629 N  NH2   . ARG A 1 796 ? -35.439 13.086  4.364   1.00 42.61  ? 859  ARG B NH2   1 
ATOM   5630 N  N     . ARG A 1 797 ? -33.650 13.562  13.088  1.00 49.85  ? 860  ARG B N     1 
ATOM   5631 C  CA    . ARG A 1 797 ? -33.900 14.179  14.364  1.00 46.26  ? 860  ARG B CA    1 
ATOM   5632 C  C     . ARG A 1 797 ? -32.724 14.096  15.255  1.00 44.46  ? 860  ARG B C     1 
ATOM   5633 O  O     . ARG A 1 797 ? -32.417 15.022  15.949  1.00 48.00  ? 860  ARG B O     1 
ATOM   5634 C  CB    . ARG A 1 797 ? -35.119 13.584  15.032  1.00 42.09  ? 860  ARG B CB    1 
ATOM   5635 C  CG    . ARG A 1 797 ? -36.337 13.633  14.147  1.00 52.23  ? 860  ARG B CG    1 
ATOM   5636 C  CD    . ARG A 1 797 ? -37.573 14.243  14.779  1.00 68.66  ? 860  ARG B CD    1 
ATOM   5637 N  NE    . ARG A 1 797 ? -37.806 15.609  14.311  1.00 74.18  ? 860  ARG B NE    1 
ATOM   5638 C  CZ    . ARG A 1 797 ? -38.833 16.381  14.653  1.00 72.38  ? 860  ARG B CZ    1 
ATOM   5639 N  NH1   . ARG A 1 797 ? -39.763 15.947  15.459  1.00 78.13  ? 860  ARG B NH1   1 
ATOM   5640 N  NH2   . ARG A 1 797 ? -38.918 17.602  14.189  1.00 63.41  ? 860  ARG B NH2   1 
ATOM   5641 N  N     . LEU A 1 798 ? -32.050 12.969  15.234  1.00 44.08  ? 861  LEU B N     1 
ATOM   5642 C  CA    . LEU A 1 798 ? -30.860 12.734  16.040  1.00 42.01  ? 861  LEU B CA    1 
ATOM   5643 C  C     . LEU A 1 798 ? -29.595 13.374  15.517  1.00 45.79  ? 861  LEU B C     1 
ATOM   5644 O  O     . LEU A 1 798 ? -28.600 13.337  16.157  1.00 41.38  ? 861  LEU B O     1 
ATOM   5645 C  CB    . LEU A 1 798 ? -30.650 11.262  16.286  1.00 37.62  ? 861  LEU B CB    1 
ATOM   5646 C  CG    . LEU A 1 798 ? -30.863 10.754  17.685  1.00 35.91  ? 861  LEU B CG    1 
ATOM   5647 C  CD1   . LEU A 1 798 ? -32.090 11.345  18.275  1.00 31.56  ? 861  LEU B CD1   1 
ATOM   5648 C  CD2   . LEU A 1 798 ? -30.970 9.260   17.664  1.00 34.97  ? 861  LEU B CD2   1 
ATOM   5649 N  N     . GLY A 1 799 ? -29.635 13.925  14.326  1.00 45.77  ? 862  GLY B N     1 
ATOM   5650 C  CA    . GLY A 1 799 ? -28.535 14.652  13.750  1.00 51.42  ? 862  GLY B CA    1 
ATOM   5651 C  C     . GLY A 1 799 ? -27.496 13.981  12.946  1.00 47.58  ? 862  GLY B C     1 
ATOM   5652 O  O     . GLY A 1 799 ? -26.547 14.605  12.567  1.00 45.82  ? 862  GLY B O     1 
ATOM   5653 N  N     . PHE A 1 800 ? -27.673 12.693  12.750  1.00 49.16  ? 863  PHE B N     1 
ATOM   5654 C  CA    . PHE A 1 800 ? -26.800 11.854  11.982  1.00 46.11  ? 863  PHE B CA    1 
ATOM   5655 C  C     . PHE A 1 800 ? -26.816 12.212  10.518  1.00 46.74  ? 863  PHE B C     1 
ATOM   5656 O  O     . PHE A 1 800 ? -25.832 12.140  9.866   1.00 46.36  ? 863  PHE B O     1 
ATOM   5657 C  CB    . PHE A 1 800 ? -27.207 10.404  12.139  1.00 42.85  ? 863  PHE B CB    1 
ATOM   5658 C  CG    . PHE A 1 800 ? -26.949 9.810   13.491  1.00 45.05  ? 863  PHE B CG    1 
ATOM   5659 C  CD1   . PHE A 1 800 ? -25.745 9.284   13.818  1.00 44.01  ? 863  PHE B CD1   1 
ATOM   5660 C  CD2   . PHE A 1 800 ? -27.950 9.696   14.379  1.00 45.99  ? 863  PHE B CD2   1 
ATOM   5661 C  CE1   . PHE A 1 800 ? -25.539 8.693   15.019  1.00 41.62  ? 863  PHE B CE1   1 
ATOM   5662 C  CE2   . PHE A 1 800 ? -27.746 9.137   15.593  1.00 45.06  ? 863  PHE B CE2   1 
ATOM   5663 C  CZ    . PHE A 1 800 ? -26.540 8.621   15.909  1.00 42.05  ? 863  PHE B CZ    1 
ATOM   5664 N  N     . ALA A 1 801 ? -27.965 12.536  9.976   1.00 43.44  ? 864  ALA B N     1 
ATOM   5665 C  CA    . ALA A 1 801 ? -28.013 12.878  8.586   1.00 38.40  ? 864  ALA B CA    1 
ATOM   5666 C  C     . ALA A 1 801 ? -28.957 13.974  8.329   1.00 35.11  ? 864  ALA B C     1 
ATOM   5667 O  O     . ALA A 1 801 ? -29.768 14.255  9.104   1.00 38.31  ? 864  ALA B O     1 
ATOM   5668 C  CB    . ALA A 1 801 ? -28.393 11.686  7.771   1.00 35.56  ? 864  ALA B CB    1 
ATOM   5669 N  N     . THR A 1 802 ? -28.804 14.636  7.223   1.00 34.64  ? 865  THR B N     1 
ATOM   5670 C  CA    . THR A 1 802 ? -29.707 15.682  6.879   1.00 31.11  ? 865  THR B CA    1 
ATOM   5671 C  C     . THR A 1 802 ? -30.980 15.244  6.173   1.00 40.63  ? 865  THR B C     1 
ATOM   5672 O  O     . THR A 1 802 ? -31.160 14.140  5.750   1.00 45.90  ? 865  THR B O     1 
ATOM   5673 C  CB    . THR A 1 802 ? -29.035 16.808  6.105   1.00 34.21  ? 865  THR B CB    1 
ATOM   5674 O  OG1   . THR A 1 802 ? -29.337 16.712  4.739   1.00 36.80  ? 865  THR B OG1   1 
ATOM   5675 C  CG2   . THR A 1 802 ? -27.599 16.736  6.212   1.00 40.27  ? 865  THR B CG2   1 
ATOM   5676 N  N     . SER A 1 803 ? -31.873 16.187  6.030   1.00 42.93  ? 866  SER B N     1 
ATOM   5677 C  CA    . SER A 1 803 ? -33.114 16.019  5.353   1.00 38.45  ? 866  SER B CA    1 
ATOM   5678 C  C     . SER A 1 803 ? -32.997 15.734  3.900   1.00 40.81  ? 866  SER B C     1 
ATOM   5679 O  O     . SER A 1 803 ? -33.849 15.144  3.353   1.00 52.23  ? 866  SER B O     1 
ATOM   5680 C  CB    . SER A 1 803 ? -33.916 17.256  5.503   1.00 48.30  ? 866  SER B CB    1 
ATOM   5681 O  OG    . SER A 1 803 ? -34.716 17.156  6.625   1.00 56.54  ? 866  SER B OG    1 
ATOM   5682 N  N     . SER A 1 804 ? -31.947 16.170  3.248   1.00 40.50  ? 867  SER B N     1 
ATOM   5683 C  CA    . SER A 1 804 ? -31.737 15.923  1.853   1.00 43.39  ? 867  SER B CA    1 
ATOM   5684 C  C     . SER A 1 804 ? -30.864 14.707  1.597   1.00 40.85  ? 867  SER B C     1 
ATOM   5685 O  O     . SER A 1 804 ? -30.353 14.548  0.533   1.00 38.26  ? 867  SER B O     1 
ATOM   5686 C  CB    . SER A 1 804 ? -31.125 17.118  1.205   1.00 38.20  ? 867  SER B CB    1 
ATOM   5687 O  OG    . SER A 1 804 ? -31.731 18.271  1.669   1.00 47.23  ? 867  SER B OG    1 
ATOM   5688 N  N     . ASP A 1 805 ? -30.724 13.872  2.608   1.00 41.78  ? 868  ASP B N     1 
ATOM   5689 C  CA    . ASP A 1 805 ? -29.977 12.649  2.630   1.00 41.90  ? 868  ASP B CA    1 
ATOM   5690 C  C     . ASP A 1 805 ? -28.518 12.721  2.371   1.00 37.90  ? 868  ASP B C     1 
ATOM   5691 O  O     . ASP A 1 805 ? -27.987 11.956  1.641   1.00 39.57  ? 868  ASP B O     1 
ATOM   5692 C  CB    . ASP A 1 805 ? -30.651 11.603  1.780   1.00 34.43  ? 868  ASP B CB    1 
ATOM   5693 C  CG    . ASP A 1 805 ? -31.811 11.019  2.444   1.00 44.42  ? 868  ASP B CG    1 
ATOM   5694 O  OD1   . ASP A 1 805 ? -31.966 11.232  3.626   1.00 50.14  ? 868  ASP B OD1   1 
ATOM   5695 O  OD2   . ASP A 1 805 ? -32.553 10.316  1.796   1.00 46.88  ? 868  ASP B OD2   1 
ATOM   5696 N  N     . VAL A 1 806 ? -27.878 13.674  2.986   1.00 35.70  ? 869  VAL B N     1 
ATOM   5697 C  CA    . VAL A 1 806 ? -26.484 13.806  2.869   1.00 40.07  ? 869  VAL B CA    1 
ATOM   5698 C  C     . VAL A 1 806 ? -25.967 13.394  4.190   1.00 40.99  ? 869  VAL B C     1 
ATOM   5699 O  O     . VAL A 1 806 ? -26.427 13.830  5.186   1.00 37.99  ? 869  VAL B O     1 
ATOM   5700 C  CB    . VAL A 1 806 ? -26.140 15.231  2.658   1.00 36.66  ? 869  VAL B CB    1 
ATOM   5701 C  CG1   . VAL A 1 806 ? -24.686 15.364  2.348   1.00 35.08  ? 869  VAL B CG1   1 
ATOM   5702 C  CG2   . VAL A 1 806 ? -26.933 15.729  1.506   1.00 39.17  ? 869  VAL B CG2   1 
ATOM   5703 N  N     . ILE A 1 807 ? -25.017 12.507  4.201   1.00 37.98  ? 870  ILE B N     1 
ATOM   5704 C  CA    . ILE A 1 807 ? -24.489 12.065  5.439   1.00 48.32  ? 870  ILE B CA    1 
ATOM   5705 C  C     . ILE A 1 807 ? -23.738 13.197  6.102   1.00 46.80  ? 870  ILE B C     1 
ATOM   5706 O  O     . ILE A 1 807 ? -23.071 13.996  5.462   1.00 41.97  ? 870  ILE B O     1 
ATOM   5707 C  CB    . ILE A 1 807 ? -23.652 10.821  5.221   1.00 46.00  ? 870  ILE B CB    1 
ATOM   5708 C  CG1   . ILE A 1 807 ? -23.307 10.164  6.511   1.00 41.38  ? 870  ILE B CG1   1 
ATOM   5709 C  CG2   . ILE A 1 807 ? -22.427 11.152  4.448   1.00 47.01  ? 870  ILE B CG2   1 
ATOM   5710 C  CD1   . ILE A 1 807 ? -24.502 9.502   7.116   1.00 39.71  ? 870  ILE B CD1   1 
ATOM   5711 N  N     . GLU A 1 808 ? -23.845 13.236  7.413   1.00 45.89  ? 871  GLU B N     1 
ATOM   5712 C  CA    . GLU A 1 808 ? -23.246 14.253  8.224   1.00 47.71  ? 871  GLU B CA    1 
ATOM   5713 C  C     . GLU A 1 808 ? -22.183 13.658  9.070   1.00 48.17  ? 871  GLU B C     1 
ATOM   5714 O  O     . GLU A 1 808 ? -22.169 12.495  9.305   1.00 46.86  ? 871  GLU B O     1 
ATOM   5715 C  CB    . GLU A 1 808 ? -24.306 14.863  9.088   1.00 45.58  ? 871  GLU B CB    1 
ATOM   5716 C  CG    . GLU A 1 808 ? -24.035 16.276  9.466   1.00 45.24  ? 871  GLU B CG    1 
ATOM   5717 C  CD    . GLU A 1 808 ? -25.229 17.130  9.295   1.00 50.79  ? 871  GLU B CD    1 
ATOM   5718 O  OE1   . GLU A 1 808 ? -25.128 18.172  8.656   1.00 58.83  ? 871  GLU B OE1   1 
ATOM   5719 O  OE2   . GLU A 1 808 ? -26.263 16.777  9.813   1.00 45.78  ? 871  GLU B OE2   1 
ATOM   5720 N  N     . MET A 1 809 ? -21.349 14.476  9.669   1.00 59.01  ? 872  MET B N     1 
ATOM   5721 C  CA    . MET A 1 809 ? -20.209 14.006  10.457  1.00 66.09  ? 872  MET B CA    1 
ATOM   5722 C  C     . MET A 1 809 ? -20.583 13.080  11.585  1.00 58.96  ? 872  MET B C     1 
ATOM   5723 O  O     . MET A 1 809 ? -19.850 12.208  11.905  1.00 53.50  ? 872  MET B O     1 
ATOM   5724 C  CB    . MET A 1 809 ? -19.381 15.171  10.977  1.00 59.94  ? 872  MET B CB    1 
ATOM   5725 C  CG    . MET A 1 809 ? -17.923 14.843  11.200  1.00 66.68  ? 872  MET B CG    1 
ATOM   5726 S  SD    . MET A 1 809 ? -17.307 15.518  12.755  1.00 97.18  ? 872  MET B SD    1 
ATOM   5727 C  CE    . MET A 1 809 ? -16.590 17.077  12.298  1.00 66.95  ? 872  MET B CE    1 
ATOM   5728 N  N     . LYS A 1 810 ? -21.711 13.284  12.234  1.00 58.96  ? 873  LYS B N     1 
ATOM   5729 C  CA    . LYS A 1 810 ? -22.181 12.374  13.243  1.00 53.34  ? 873  LYS B CA    1 
ATOM   5730 C  C     . LYS A 1 810 ? -22.511 11.069  12.654  1.00 49.24  ? 873  LYS B C     1 
ATOM   5731 O  O     . LYS A 1 810 ? -22.421 10.109  13.323  1.00 51.97  ? 873  LYS B O     1 
ATOM   5732 C  CB    . LYS A 1 810 ? -23.411 12.904  13.901  1.00 53.82  ? 873  LYS B CB    1 
ATOM   5733 C  CG    . LYS A 1 810 ? -23.822 12.172  15.145  1.00 50.82  ? 873  LYS B CG    1 
ATOM   5734 C  CD    . LYS A 1 810 ? -24.622 13.120  15.996  1.00 53.57  ? 873  LYS B CD    1 
ATOM   5735 C  CE    . LYS A 1 810 ? -25.404 12.437  17.080  1.00 52.61  ? 873  LYS B CE    1 
ATOM   5736 N  NZ    . LYS A 1 810 ? -26.433 13.358  17.599  1.00 51.23  ? 873  LYS B NZ    1 
ATOM   5737 N  N     . GLY A 1 811 ? -23.069 11.070  11.461  1.00 48.70  ? 874  GLY B N     1 
ATOM   5738 C  CA    . GLY A 1 811 ? -23.408 9.885   10.717  1.00 49.16  ? 874  GLY B CA    1 
ATOM   5739 C  C     . GLY A 1 811 ? -22.225 9.084   10.291  1.00 47.81  ? 874  GLY B C     1 
ATOM   5740 O  O     . GLY A 1 811 ? -22.278 7.896   10.274  1.00 40.93  ? 874  GLY B O     1 
ATOM   5741 N  N     . ARG A 1 812 ? -21.166 9.765   9.911   1.00 47.84  ? 875  ARG B N     1 
ATOM   5742 C  CA    . ARG A 1 812 ? -19.948 9.134   9.471   1.00 46.58  ? 875  ARG B CA    1 
ATOM   5743 C  C     . ARG A 1 812 ? -19.287 8.311   10.525  1.00 47.56  ? 875  ARG B C     1 
ATOM   5744 O  O     . ARG A 1 812 ? -18.702 7.330   10.229  1.00 48.91  ? 875  ARG B O     1 
ATOM   5745 C  CB    . ARG A 1 812 ? -18.984 10.132  8.884   1.00 41.79  ? 875  ARG B CB    1 
ATOM   5746 C  CG    . ARG A 1 812 ? -19.280 10.438  7.445   1.00 50.20  ? 875  ARG B CG    1 
ATOM   5747 C  CD    . ARG A 1 812 ? -18.284 11.372  6.791   1.00 45.52  ? 875  ARG B CD    1 
ATOM   5748 N  NE    . ARG A 1 812 ? -18.172 11.072  5.373   1.00 55.99  ? 875  ARG B NE    1 
ATOM   5749 C  CZ    . ARG A 1 812 ? -18.981 11.533  4.436   1.00 51.98  ? 875  ARG B CZ    1 
ATOM   5750 N  NH1   . ARG A 1 812 ? -19.949 12.359  4.728   1.00 55.62  ? 875  ARG B NH1   1 
ATOM   5751 N  NH2   . ARG A 1 812 ? -18.809 11.187  3.194   1.00 45.43  ? 875  ARG B NH2   1 
ATOM   5752 N  N     . VAL A 1 813 ? -19.317 8.742   11.760  1.00 44.31  ? 876  VAL B N     1 
ATOM   5753 C  CA    . VAL A 1 813 ? -18.733 7.983   12.830  1.00 51.27  ? 876  VAL B CA    1 
ATOM   5754 C  C     . VAL A 1 813 ? -19.441 6.693   13.043  1.00 47.85  ? 876  VAL B C     1 
ATOM   5755 O  O     . VAL A 1 813 ? -18.850 5.689   13.234  1.00 48.35  ? 876  VAL B O     1 
ATOM   5756 C  CB    . VAL A 1 813 ? -18.711 8.764   14.138  1.00 45.59  ? 876  VAL B CB    1 
ATOM   5757 N  N     . ALA A 1 814 ? -20.746 6.736   12.942  1.00 45.45  ? 877  ALA B N     1 
ATOM   5758 C  CA    . ALA A 1 814 ? -21.646 5.628   13.118  1.00 44.14  ? 877  ALA B CA    1 
ATOM   5759 C  C     . ALA A 1 814 ? -21.506 4.517   12.127  1.00 44.00  ? 877  ALA B C     1 
ATOM   5760 O  O     . ALA A 1 814 ? -21.865 3.429   12.385  1.00 42.34  ? 877  ALA B O     1 
ATOM   5761 C  CB    . ALA A 1 814 ? -23.051 6.133   13.135  1.00 41.67  ? 877  ALA B CB    1 
ATOM   5762 N  N     . CYS A 1 815 ? -20.996 4.798   10.958  1.00 44.39  ? 878  CYS B N     1 
ATOM   5763 C  CA    . CYS A 1 815 ? -20.796 3.811   9.954   1.00 47.36  ? 878  CYS B CA    1 
ATOM   5764 C  C     . CYS A 1 815 ? -19.855 2.745   10.351  1.00 53.14  ? 878  CYS B C     1 
ATOM   5765 O  O     . CYS A 1 815 ? -20.035 1.611   10.030  1.00 59.77  ? 878  CYS B O     1 
ATOM   5766 C  CB    . CYS A 1 815 ? -20.228 4.468   8.754   1.00 46.76  ? 878  CYS B CB    1 
ATOM   5767 S  SG    . CYS A 1 815 ? -21.454 5.377   7.909   1.00 52.24  ? 878  CYS B SG    1 
ATOM   5768 N  N     . GLU A 1 816 ? -18.814 3.109   11.039  1.00 51.40  ? 879  GLU B N     1 
ATOM   5769 C  CA    . GLU A 1 816 ? -17.828 2.193   11.501  1.00 56.57  ? 879  GLU B CA    1 
ATOM   5770 C  C     . GLU A 1 816 ? -18.359 1.180   12.458  1.00 54.92  ? 879  GLU B C     1 
ATOM   5771 O  O     . GLU A 1 816 ? -17.898 0.082   12.470  1.00 59.62  ? 879  GLU B O     1 
ATOM   5772 C  CB    . GLU A 1 816 ? -16.735 2.974   12.147  1.00 55.36  ? 879  GLU B CB    1 
ATOM   5773 C  CG    . GLU A 1 816 ? -16.282 4.104   11.293  1.00 53.01  ? 879  GLU B CG    1 
ATOM   5774 C  CD    . GLU A 1 816 ? -15.537 3.623   10.121  1.00 56.86  ? 879  GLU B CD    1 
ATOM   5775 O  OE1   . GLU A 1 816 ? -15.589 2.447   9.834   1.00 54.77  ? 879  GLU B OE1   1 
ATOM   5776 O  OE2   . GLU A 1 816 ? -14.880 4.425   9.490   1.00 60.81  ? 879  GLU B OE2   1 
ATOM   5777 N  N     . ILE A 1 817 ? -19.300 1.548   13.293  1.00 48.24  ? 880  ILE B N     1 
ATOM   5778 C  CA    . ILE A 1 817 ? -19.807 0.624   14.246  1.00 52.22  ? 880  ILE B CA    1 
ATOM   5779 C  C     . ILE A 1 817 ? -20.859 -0.277  13.664  1.00 51.75  ? 880  ILE B C     1 
ATOM   5780 O  O     . ILE A 1 817 ? -21.979 0.070   13.537  1.00 50.69  ? 880  ILE B O     1 
ATOM   5781 C  CB    . ILE A 1 817 ? -20.412 1.398   15.378  1.00 49.84  ? 880  ILE B CB    1 
ATOM   5782 C  CG1   . ILE A 1 817 ? -19.450 2.450   15.841  1.00 46.69  ? 880  ILE B CG1   1 
ATOM   5783 C  CG2   . ILE A 1 817 ? -20.719 0.479   16.517  1.00 55.17  ? 880  ILE B CG2   1 
ATOM   5784 C  CD1   . ILE A 1 817 ? -19.952 3.167   17.042  1.00 45.58  ? 880  ILE B CD1   1 
ATOM   5785 N  N     . SER A 1 818 ? -20.468 -1.485  13.346  1.00 57.04  ? 881  SER B N     1 
ATOM   5786 C  CA    . SER A 1 818 ? -21.374 -2.409  12.778  1.00 51.22  ? 881  SER B CA    1 
ATOM   5787 C  C     . SER A 1 818 ? -21.592 -3.612  13.595  1.00 50.85  ? 881  SER B C     1 
ATOM   5788 O  O     . SER A 1 818 ? -22.236 -4.508  13.179  1.00 51.02  ? 881  SER B O     1 
ATOM   5789 C  CB    . SER A 1 818 ? -20.781 -2.886  11.509  1.00 52.23  ? 881  SER B CB    1 
ATOM   5790 O  OG    . SER A 1 818 ? -21.596 -3.894  10.999  1.00 68.83  ? 881  SER B OG    1 
ATOM   5791 N  N     . SER A 1 819 ? -20.974 -3.677  14.723  1.00 58.14  ? 882  SER B N     1 
ATOM   5792 C  CA    . SER A 1 819 ? -21.080 -4.845  15.516  1.00 49.73  ? 882  SER B CA    1 
ATOM   5793 C  C     . SER A 1 819 ? -22.112 -4.706  16.621  1.00 47.27  ? 882  SER B C     1 
ATOM   5794 O  O     . SER A 1 819 ? -22.419 -5.645  17.283  1.00 44.20  ? 882  SER B O     1 
ATOM   5795 C  CB    . SER A 1 819 ? -19.675 -5.136  16.076  1.00 56.60  ? 882  SER B CB    1 
ATOM   5796 O  OG    . SER A 1 819 ? -18.618 -4.718  15.221  1.00 57.89  ? 882  SER B OG    1 
ATOM   5797 N  N     . ALA A 1 820 ? -22.693 -3.536  16.776  1.00 53.42  ? 883  ALA B N     1 
ATOM   5798 C  CA    . ALA A 1 820 ? -23.599 -3.296  17.881  1.00 52.26  ? 883  ALA B CA    1 
ATOM   5799 C  C     . ALA A 1 820 ? -24.534 -2.177  17.615  1.00 48.84  ? 883  ALA B C     1 
ATOM   5800 O  O     . ALA A 1 820 ? -24.679 -1.795  16.510  1.00 52.11  ? 883  ALA B O     1 
ATOM   5801 C  CB    . ALA A 1 820 ? -22.818 -3.005  19.109  1.00 51.38  ? 883  ALA B CB    1 
ATOM   5802 N  N     . ASP A 1 821 ? -25.160 -1.622  18.630  1.00 45.65  ? 884  ASP B N     1 
ATOM   5803 C  CA    . ASP A 1 821 ? -26.101 -0.559  18.359  1.00 49.19  ? 884  ASP B CA    1 
ATOM   5804 C  C     . ASP A 1 821 ? -25.376 0.695   18.117  1.00 48.07  ? 884  ASP B C     1 
ATOM   5805 O  O     . ASP A 1 821 ? -25.196 1.459   18.963  1.00 51.81  ? 884  ASP B O     1 
ATOM   5806 C  CB    . ASP A 1 821 ? -27.028 -0.331  19.539  1.00 45.76  ? 884  ASP B CB    1 
ATOM   5807 C  CG    . ASP A 1 821 ? -28.088 0.616   19.228  1.00 50.22  ? 884  ASP B CG    1 
ATOM   5808 O  OD1   . ASP A 1 821 ? -28.016 1.238   18.199  1.00 53.22  ? 884  ASP B OD1   1 
ATOM   5809 O  OD2   . ASP A 1 821 ? -29.023 0.742   19.981  1.00 48.91  ? 884  ASP B OD2   1 
ATOM   5810 N  N     . GLU A 1 822 ? -25.094 0.958   16.876  1.00 47.03  ? 885  GLU B N     1 
ATOM   5811 C  CA    . GLU A 1 822 ? -24.354 2.122   16.495  1.00 46.04  ? 885  GLU B CA    1 
ATOM   5812 C  C     . GLU A 1 822 ? -25.000 3.403   16.825  1.00 45.97  ? 885  GLU B C     1 
ATOM   5813 O  O     . GLU A 1 822 ? -24.332 4.327   17.072  1.00 49.88  ? 885  GLU B O     1 
ATOM   5814 C  CB    . GLU A 1 822 ? -24.007 2.083   15.019  1.00 47.26  ? 885  GLU B CB    1 
ATOM   5815 C  CG    . GLU A 1 822 ? -25.160 2.132   14.063  1.00 47.16  ? 885  GLU B CG    1 
ATOM   5816 C  CD    . GLU A 1 822 ? -25.856 0.827   13.890  1.00 51.93  ? 885  GLU B CD    1 
ATOM   5817 O  OE1   . GLU A 1 822 ? -25.338 -0.035  13.201  1.00 55.42  ? 885  GLU B OE1   1 
ATOM   5818 O  OE2   . GLU A 1 822 ? -26.954 0.664   14.385  1.00 49.74  ? 885  GLU B OE2   1 
ATOM   5819 N  N     . LEU A 1 823 ? -26.301 3.492   16.770  1.00 45.09  ? 886  LEU B N     1 
ATOM   5820 C  CA    . LEU A 1 823 ? -26.932 4.727   17.042  1.00 46.35  ? 886  LEU B CA    1 
ATOM   5821 C  C     . LEU A 1 823 ? -26.667 5.192   18.433  1.00 50.58  ? 886  LEU B C     1 
ATOM   5822 O  O     . LEU A 1 823 ? -26.434 6.326   18.645  1.00 51.71  ? 886  LEU B O     1 
ATOM   5823 C  CB    . LEU A 1 823 ? -28.383 4.533   16.875  1.00 42.67  ? 886  LEU B CB    1 
ATOM   5824 C  CG    . LEU A 1 823 ? -28.964 5.755   16.269  1.00 49.83  ? 886  LEU B CG    1 
ATOM   5825 C  CD1   . LEU A 1 823 ? -28.509 5.823   14.852  1.00 45.96  ? 886  LEU B CD1   1 
ATOM   5826 C  CD2   . LEU A 1 823 ? -30.447 5.604   16.332  1.00 48.70  ? 886  LEU B CD2   1 
ATOM   5827 N  N     . LEU A 1 824 ? -26.751 4.319   19.400  1.00 49.01  ? 887  LEU B N     1 
ATOM   5828 C  CA    . LEU A 1 824 ? -26.468 4.686   20.758  1.00 52.48  ? 887  LEU B CA    1 
ATOM   5829 C  C     . LEU A 1 824 ? -25.035 5.009   21.026  1.00 55.68  ? 887  LEU B C     1 
ATOM   5830 O  O     . LEU A 1 824 ? -24.724 5.960   21.681  1.00 60.18  ? 887  LEU B O     1 
ATOM   5831 C  CB    . LEU A 1 824 ? -26.854 3.566   21.690  1.00 51.50  ? 887  LEU B CB    1 
ATOM   5832 C  CG    . LEU A 1 824 ? -27.458 3.930   23.031  1.00 52.67  ? 887  LEU B CG    1 
ATOM   5833 C  CD1   . LEU A 1 824 ? -27.811 2.699   23.790  1.00 45.87  ? 887  LEU B CD1   1 
ATOM   5834 C  CD2   . LEU A 1 824 ? -26.526 4.754   23.855  1.00 56.60  ? 887  LEU B CD2   1 
ATOM   5835 N  N     . LEU A 1 825 ? -24.147 4.217   20.503  1.00 51.74  ? 888  LEU B N     1 
ATOM   5836 C  CA    . LEU A 1 825 ? -22.775 4.441   20.802  1.00 55.89  ? 888  LEU B CA    1 
ATOM   5837 C  C     . LEU A 1 825 ? -22.272 5.754   20.264  1.00 56.77  ? 888  LEU B C     1 
ATOM   5838 O  O     . LEU A 1 825 ? -21.575 6.440   20.943  1.00 61.99  ? 888  LEU B O     1 
ATOM   5839 C  CB    . LEU A 1 825 ? -21.919 3.207   20.502  1.00 54.03  ? 888  LEU B CB    1 
ATOM   5840 C  CG    . LEU A 1 825 ? -22.426 2.188   19.472  1.00 56.79  ? 888  LEU B CG    1 
ATOM   5841 C  CD1   . LEU A 1 825 ? -21.250 1.354   19.073  1.00 60.47  ? 888  LEU B CD1   1 
ATOM   5842 C  CD2   . LEU A 1 825 ? -23.628 1.285   19.735  1.00 65.47  ? 888  LEU B CD2   1 
ATOM   5843 N  N     . THR A 1 826 ? -22.620 6.139   19.053  1.00 53.90  ? 889  THR B N     1 
ATOM   5844 C  CA    . THR A 1 826 ? -22.169 7.438   18.596  1.00 62.50  ? 889  THR B CA    1 
ATOM   5845 C  C     . THR A 1 826 ? -22.840 8.520   19.362  1.00 64.30  ? 889  THR B C     1 
ATOM   5846 O  O     . THR A 1 826 ? -22.256 9.510   19.640  1.00 62.96  ? 889  THR B O     1 
ATOM   5847 C  CB    . THR A 1 826 ? -22.238 7.708   17.116  1.00 58.85  ? 889  THR B CB    1 
ATOM   5848 O  OG1   . THR A 1 826 ? -23.476 8.316   16.812  1.00 63.40  ? 889  THR B OG1   1 
ATOM   5849 C  CG2   . THR A 1 826 ? -22.073 6.489   16.373  1.00 50.32  ? 889  THR B CG2   1 
ATOM   5850 N  N     . GLU A 1 827 ? -24.105 8.358   19.700  1.00 60.86  ? 890  GLU B N     1 
ATOM   5851 C  CA    . GLU A 1 827 ? -24.777 9.354   20.486  1.00 60.12  ? 890  GLU B CA    1 
ATOM   5852 C  C     . GLU A 1 827 ? -24.105 9.429   21.835  1.00 65.21  ? 890  GLU B C     1 
ATOM   5853 O  O     . GLU A 1 827 ? -23.789 10.495  22.299  1.00 69.66  ? 890  GLU B O     1 
ATOM   5854 C  CB    . GLU A 1 827 ? -26.246 9.023   20.605  1.00 51.47  ? 890  GLU B CB    1 
ATOM   5855 N  N     . MET A 1 828 ? -23.779 8.288   22.426  1.00 62.33  ? 891  MET B N     1 
ATOM   5856 C  CA    . MET A 1 828 ? -23.041 8.256   23.657  1.00 61.23  ? 891  MET B CA    1 
ATOM   5857 C  C     . MET A 1 828 ? -21.712 8.895   23.433  1.00 58.09  ? 891  MET B C     1 
ATOM   5858 O  O     . MET A 1 828 ? -21.289 9.623   24.241  1.00 65.98  ? 891  MET B O     1 
ATOM   5859 C  CB    . MET A 1 828 ? -22.729 6.849   24.033  1.00 62.62  ? 891  MET B CB    1 
ATOM   5860 C  CG    . MET A 1 828 ? -23.656 6.175   24.986  1.00 62.42  ? 891  MET B CG    1 
ATOM   5861 S  SD    . MET A 1 828 ? -23.173 4.492   24.805  1.00 66.82  ? 891  MET B SD    1 
ATOM   5862 C  CE    . MET A 1 828 ? -23.718 3.774   26.321  1.00 62.55  ? 891  MET B CE    1 
ATOM   5863 N  N     . MET A 1 829 ? -21.027 8.662   22.336  1.00 57.79  ? 892  MET B N     1 
ATOM   5864 C  CA    . MET A 1 829 ? -19.784 9.340   22.104  1.00 56.65  ? 892  MET B CA    1 
ATOM   5865 C  C     . MET A 1 829 ? -20.007 10.818  22.026  1.00 61.80  ? 892  MET B C     1 
ATOM   5866 O  O     . MET A 1 829 ? -19.233 11.555  22.542  1.00 66.56  ? 892  MET B O     1 
ATOM   5867 C  CB    . MET A 1 829 ? -19.183 8.902   20.791  1.00 62.19  ? 892  MET B CB    1 
ATOM   5868 C  CG    . MET A 1 829 ? -18.191 7.779   20.866  1.00 66.33  ? 892  MET B CG    1 
ATOM   5869 S  SD    . MET A 1 829 ? -17.369 7.749   19.302  1.00 78.78  ? 892  MET B SD    1 
ATOM   5870 C  CE    . MET A 1 829 ? -15.684 7.458   19.730  1.00 74.94  ? 892  MET B CE    1 
ATOM   5871 N  N     . PHE A 1 830 ? -21.067 11.266  21.365  1.00 70.64  ? 893  PHE B N     1 
ATOM   5872 C  CA    . PHE A 1 830 ? -21.396 12.682  21.262  1.00 70.33  ? 893  PHE B CA    1 
ATOM   5873 C  C     . PHE A 1 830 ? -21.936 13.314  22.510  1.00 68.37  ? 893  PHE B C     1 
ATOM   5874 O  O     . PHE A 1 830 ? -22.064 14.494  22.555  1.00 73.68  ? 893  PHE B O     1 
ATOM   5875 C  CB    . PHE A 1 830 ? -22.256 12.998  20.075  1.00 63.69  ? 893  PHE B CB    1 
ATOM   5876 C  CG    . PHE A 1 830 ? -21.507 13.014  18.808  1.00 57.27  ? 893  PHE B CG    1 
ATOM   5877 C  CD1   . PHE A 1 830 ? -20.613 12.025  18.534  1.00 62.66  ? 893  PHE B CD1   1 
ATOM   5878 C  CD2   . PHE A 1 830 ? -21.694 13.998  17.905  1.00 57.70  ? 893  PHE B CD2   1 
ATOM   5879 C  CE1   . PHE A 1 830 ? -19.926 11.995  17.369  1.00 62.06  ? 893  PHE B CE1   1 
ATOM   5880 C  CE2   . PHE A 1 830 ? -21.010 13.996  16.734  1.00 60.31  ? 893  PHE B CE2   1 
ATOM   5881 C  CZ    . PHE A 1 830 ? -20.116 12.995  16.467  1.00 63.36  ? 893  PHE B CZ    1 
ATOM   5882 N  N     . ASN A 1 831 ? -22.312 12.526  23.508  1.00 64.71  ? 894  ASN B N     1 
ATOM   5883 C  CA    . ASN A 1 831 ? -22.667 13.058  24.808  1.00 68.16  ? 894  ASN B CA    1 
ATOM   5884 C  C     . ASN A 1 831 ? -21.387 13.109  25.651  1.00 72.57  ? 894  ASN B C     1 
ATOM   5885 O  O     . ASN A 1 831 ? -21.403 13.543  26.779  1.00 77.78  ? 894  ASN B O     1 
ATOM   5886 C  CB    . ASN A 1 831 ? -23.765 12.230  25.489  1.00 74.23  ? 894  ASN B CB    1 
ATOM   5887 C  CG    . ASN A 1 831 ? -23.813 12.413  27.021  1.00 86.90  ? 894  ASN B CG    1 
ATOM   5888 O  OD1   . ASN A 1 831 ? -24.229 11.518  27.770  1.00 85.91  ? 894  ASN B OD1   1 
ATOM   5889 N  ND2   . ASN A 1 831 ? -23.352 13.566  27.487  1.00 76.25  ? 894  ASN B ND2   1 
ATOM   5890 N  N     . GLY A 1 832 ? -20.270 12.592  25.145  1.00 68.42  ? 895  GLY B N     1 
ATOM   5891 C  CA    . GLY A 1 832 ? -18.988 12.658  25.796  1.00 70.62  ? 895  GLY B CA    1 
ATOM   5892 C  C     . GLY A 1 832 ? -18.848 11.716  26.927  1.00 76.74  ? 895  GLY B C     1 
ATOM   5893 O  O     . GLY A 1 832 ? -17.905 11.796  27.662  1.00 81.92  ? 895  GLY B O     1 
ATOM   5894 N  N     . LEU A 1 833 ? -19.704 10.715  26.977  1.00 72.02  ? 896  LEU B N     1 
ATOM   5895 C  CA    . LEU A 1 833 ? -19.741 9.767   28.041  1.00 68.16  ? 896  LEU B CA    1 
ATOM   5896 C  C     . LEU A 1 833 ? -18.434 9.047   28.134  1.00 68.53  ? 896  LEU B C     1 
ATOM   5897 O  O     . LEU A 1 833 ? -17.911 8.888   29.189  1.00 73.44  ? 896  LEU B O     1 
ATOM   5898 C  CB    . LEU A 1 833 ? -20.865 8.815   27.729  1.00 65.57  ? 896  LEU B CB    1 
ATOM   5899 C  CG    . LEU A 1 833 ? -21.372 7.905   28.806  1.00 65.33  ? 896  LEU B CG    1 
ATOM   5900 C  CD1   . LEU A 1 833 ? -22.855 7.703   28.652  1.00 65.54  ? 896  LEU B CD1   1 
ATOM   5901 C  CD2   . LEU A 1 833 ? -20.626 6.612   28.642  1.00 71.71  ? 896  LEU B CD2   1 
ATOM   5902 N  N     . PHE A 1 834 ? -17.894 8.653   27.004  1.00 68.38  ? 897  PHE B N     1 
ATOM   5903 C  CA    . PHE A 1 834 ? -16.628 8.006   26.910  1.00 72.52  ? 897  PHE B CA    1 
ATOM   5904 C  C     . PHE A 1 834 ? -15.407 8.831   27.288  1.00 79.92  ? 897  PHE B C     1 
ATOM   5905 O  O     . PHE A 1 834 ? -14.360 8.304   27.637  1.00 81.01  ? 897  PHE B O     1 
ATOM   5906 C  CB    . PHE A 1 834 ? -16.500 7.349   25.568  1.00 66.05  ? 897  PHE B CB    1 
ATOM   5907 C  CG    . PHE A 1 834 ? -17.400 6.207   25.432  1.00 66.98  ? 897  PHE B CG    1 
ATOM   5908 C  CD1   . PHE A 1 834 ? -17.076 5.024   25.982  1.00 66.64  ? 897  PHE B CD1   1 
ATOM   5909 C  CD2   . PHE A 1 834 ? -18.593 6.353   24.838  1.00 69.00  ? 897  PHE B CD2   1 
ATOM   5910 C  CE1   . PHE A 1 834 ? -17.932 3.987   25.910  1.00 73.78  ? 897  PHE B CE1   1 
ATOM   5911 C  CE2   . PHE A 1 834 ? -19.454 5.318   24.729  1.00 66.86  ? 897  PHE B CE2   1 
ATOM   5912 C  CZ    . PHE A 1 834 ? -19.128 4.129   25.270  1.00 74.01  ? 897  PHE B CZ    1 
ATOM   5913 N  N     . ASN A 1 835 ? -15.519 10.137  27.203  1.00 82.33  ? 898  ASN B N     1 
ATOM   5914 C  CA    . ASN A 1 835 ? -14.391 10.969  27.504  1.00 82.48  ? 898  ASN B CA    1 
ATOM   5915 C  C     . ASN A 1 835 ? -13.888 10.816  28.936  1.00 80.86  ? 898  ASN B C     1 
ATOM   5916 O  O     . ASN A 1 835 ? -12.691 10.779  29.182  1.00 74.27  ? 898  ASN B O     1 
ATOM   5917 C  CB    . ASN A 1 835 ? -14.778 12.411  27.241  1.00 75.39  ? 898  ASN B CB    1 
ATOM   5918 N  N     . ASP A 1 836 ? -14.797 10.696  29.882  1.00 76.40  ? 899  ASP B N     1 
ATOM   5919 C  CA    . ASP A 1 836 ? -14.393 10.635  31.265  1.00 77.27  ? 899  ASP B CA    1 
ATOM   5920 C  C     . ASP A 1 836 ? -14.251 9.323   31.968  1.00 79.83  ? 899  ASP B C     1 
ATOM   5921 O  O     . ASP A 1 836 ? -14.134 9.323   33.163  1.00 82.79  ? 899  ASP B O     1 
ATOM   5922 C  CB    . ASP A 1 836 ? -15.259 11.543  32.102  1.00 78.79  ? 899  ASP B CB    1 
ATOM   5923 C  CG    . ASP A 1 836 ? -14.797 12.936  32.054  1.00 81.72  ? 899  ASP B CG    1 
ATOM   5924 O  OD1   . ASP A 1 836 ? -14.188 13.311  31.057  1.00 79.25  ? 899  ASP B OD1   1 
ATOM   5925 O  OD2   . ASP A 1 836 ? -15.023 13.647  33.013  1.00 84.24  ? 899  ASP B OD2   1 
ATOM   5926 N  N     . LEU A 1 837 ? -14.438 8.285   31.186  1.00 80.86  ? 900  LEU B N     1 
ATOM   5927 C  CA    . LEU A 1 837 ? -14.404 6.930   31.602  1.00 71.96  ? 900  LEU B CA    1 
ATOM   5928 C  C     . LEU A 1 837 ? -13.056 6.373   31.871  1.00 68.96  ? 900  LEU B C     1 
ATOM   5929 O  O     . LEU A 1 837 ? -12.050 6.824   31.371  1.00 64.45  ? 900  LEU B O     1 
ATOM   5930 C  CB    . LEU A 1 837 ? -15.071 6.115   30.533  1.00 62.88  ? 900  LEU B CB    1 
ATOM   5931 C  CG    . LEU A 1 837 ? -16.460 6.626   30.280  1.00 67.92  ? 900  LEU B CG    1 
ATOM   5932 C  CD1   . LEU A 1 837 ? -17.035 6.973   31.632  1.00 71.57  ? 900  LEU B CD1   1 
ATOM   5933 C  CD2   . LEU A 1 837 ? -16.519 7.825   29.337  1.00 76.16  ? 900  LEU B CD2   1 
ATOM   5934 N  N     . SER A 1 838 ? -13.077 5.362   32.706  1.00 64.21  ? 901  SER B N     1 
ATOM   5935 C  CA    . SER A 1 838 ? -11.913 4.598   33.034  1.00 67.51  ? 901  SER B CA    1 
ATOM   5936 C  C     . SER A 1 838 ? -11.669 3.748   31.802  1.00 72.13  ? 901  SER B C     1 
ATOM   5937 O  O     . SER A 1 838 ? -12.610 3.278   31.180  1.00 65.69  ? 901  SER B O     1 
ATOM   5938 C  CB    . SER A 1 838 ? -12.193 3.677   34.212  1.00 62.19  ? 901  SER B CB    1 
ATOM   5939 O  OG    . SER A 1 838 ? -13.266 4.123   35.007  1.00 54.33  ? 901  SER B OG    1 
ATOM   5940 N  N     . ALA A 1 839 ? -10.421 3.408   31.499  1.00 72.32  ? 902  ALA B N     1 
ATOM   5941 C  CA    . ALA A 1 839 ? -10.146 2.597   30.310  1.00 70.30  ? 902  ALA B CA    1 
ATOM   5942 C  C     . ALA A 1 839 ? -10.807 1.246   30.403  1.00 66.60  ? 902  ALA B C     1 
ATOM   5943 O  O     . ALA A 1 839 ? -11.263 0.710   29.447  1.00 60.35  ? 902  ALA B O     1 
ATOM   5944 C  CB    . ALA A 1 839 ? -8.663  2.441   30.110  1.00 72.21  ? 902  ALA B CB    1 
ATOM   5945 N  N     . GLU A 1 840 ? -10.765 0.678   31.583  1.00 69.93  ? 903  GLU B N     1 
ATOM   5946 C  CA    . GLU A 1 840 ? -11.434 -0.512  31.937  1.00 63.55  ? 903  GLU B CA    1 
ATOM   5947 C  C     . GLU A 1 840 ? -12.893 -0.268  31.938  1.00 61.35  ? 903  GLU B C     1 
ATOM   5948 O  O     . GLU A 1 840 ? -13.625 -1.128  31.645  1.00 66.45  ? 903  GLU B O     1 
ATOM   5949 C  CB    . GLU A 1 840 ? -10.978 -0.885  33.300  1.00 68.88  ? 903  GLU B CB    1 
ATOM   5950 C  CG    . GLU A 1 840 ? -9.486  -0.964  33.338  1.00 66.12  ? 903  GLU B CG    1 
ATOM   5951 C  CD    . GLU A 1 840 ? -8.976  -0.532  34.645  1.00 74.58  ? 903  GLU B CD    1 
ATOM   5952 O  OE1   . GLU A 1 840 ? -9.532  0.427   35.160  1.00 78.20  ? 903  GLU B OE1   1 
ATOM   5953 O  OE2   . GLU A 1 840 ? -8.037  -1.141  35.155  1.00 84.84  ? 903  GLU B OE2   1 
ATOM   5954 N  N     . GLN A 1 841 ? -13.351 0.883   32.366  1.00 61.96  ? 904  GLN B N     1 
ATOM   5955 C  CA    . GLN A 1 841 ? -14.759 1.152   32.316  1.00 63.41  ? 904  GLN B CA    1 
ATOM   5956 C  C     . GLN A 1 841 ? -15.235 1.267   30.923  1.00 62.55  ? 904  GLN B C     1 
ATOM   5957 O  O     . GLN A 1 841 ? -16.334 0.878   30.618  1.00 57.79  ? 904  GLN B O     1 
ATOM   5958 C  CB    . GLN A 1 841 ? -15.110 2.422   33.016  1.00 65.79  ? 904  GLN B CB    1 
ATOM   5959 N  N     . ALA A 1 842 ? -14.433 1.871   30.080  1.00 57.28  ? 905  ALA B N     1 
ATOM   5960 C  CA    . ALA A 1 842 ? -14.827 2.031   28.740  1.00 61.29  ? 905  ALA B CA    1 
ATOM   5961 C  C     . ALA A 1 842 ? -15.044 0.699   28.108  1.00 66.93  ? 905  ALA B C     1 
ATOM   5962 O  O     . ALA A 1 842 ? -16.046 0.504   27.493  1.00 70.02  ? 905  ALA B O     1 
ATOM   5963 C  CB    . ALA A 1 842 ? -13.756 2.768   28.010  1.00 64.47  ? 905  ALA B CB    1 
ATOM   5964 N  N     . THR A 1 843 ? -14.135 -0.241  28.264  1.00 63.14  ? 906  THR B N     1 
ATOM   5965 C  CA    . THR A 1 843 ? -14.374 -1.550  27.703  1.00 62.71  ? 906  THR B CA    1 
ATOM   5966 C  C     . THR A 1 843 ? -15.438 -2.340  28.413  1.00 59.28  ? 906  THR B C     1 
ATOM   5967 O  O     . THR A 1 843 ? -16.158 -3.059  27.818  1.00 66.53  ? 906  THR B O     1 
ATOM   5968 C  CB    . THR A 1 843 ? -13.132 -2.369  27.575  1.00 64.17  ? 906  THR B CB    1 
ATOM   5969 O  OG1   . THR A 1 843 ? -12.929 -3.041  28.802  1.00 66.70  ? 906  THR B OG1   1 
ATOM   5970 C  CG2   . THR A 1 843 ? -11.962 -1.500  27.225  1.00 54.09  ? 906  THR B CG2   1 
ATOM   5971 N  N     . ALA A 1 844 ? -15.515 -2.248  29.712  1.00 54.32  ? 907  ALA B N     1 
ATOM   5972 C  CA    . ALA A 1 844 ? -16.534 -2.966  30.429  1.00 53.07  ? 907  ALA B CA    1 
ATOM   5973 C  C     . ALA A 1 844 ? -17.925 -2.518  30.114  1.00 57.93  ? 907  ALA B C     1 
ATOM   5974 O  O     . ALA A 1 844 ? -18.842 -3.284  30.189  1.00 54.39  ? 907  ALA B O     1 
ATOM   5975 C  CB    . ALA A 1 844 ? -16.294 -2.893  31.896  1.00 56.13  ? 907  ALA B CB    1 
ATOM   5976 N  N     . LEU A 1 845 ? -18.101 -1.227  29.867  1.00 63.68  ? 908  LEU B N     1 
ATOM   5977 C  CA    . LEU A 1 845 ? -19.400 -0.663  29.514  1.00 65.48  ? 908  LEU B CA    1 
ATOM   5978 C  C     . LEU A 1 845 ? -19.873 -1.238  28.218  1.00 61.75  ? 908  LEU B C     1 
ATOM   5979 O  O     . LEU A 1 845 ? -20.974 -1.720  28.107  1.00 59.65  ? 908  LEU B O     1 
ATOM   5980 C  CB    . LEU A 1 845 ? -19.317 0.847   29.414  1.00 59.17  ? 908  LEU B CB    1 
ATOM   5981 C  CG    . LEU A 1 845 ? -20.580 1.620   29.112  1.00 53.42  ? 908  LEU B CG    1 
ATOM   5982 C  CD1   . LEU A 1 845 ? -21.795 1.094   29.827  1.00 48.37  ? 908  LEU B CD1   1 
ATOM   5983 C  CD2   . LEU A 1 845 ? -20.298 3.038   29.455  1.00 53.25  ? 908  LEU B CD2   1 
ATOM   5984 N  N     . LEU A 1 846 ? -18.954 -1.365  27.278  1.00 57.00  ? 909  LEU B N     1 
ATOM   5985 C  CA    . LEU A 1 846 ? -19.197 -1.958  25.981  1.00 58.02  ? 909  LEU B CA    1 
ATOM   5986 C  C     . LEU A 1 846 ? -19.554 -3.423  26.005  1.00 59.59  ? 909  LEU B C     1 
ATOM   5987 O  O     . LEU A 1 846 ? -20.106 -3.892  25.087  1.00 64.66  ? 909  LEU B O     1 
ATOM   5988 C  CB    . LEU A 1 846 ? -18.019 -1.770  25.085  1.00 55.15  ? 909  LEU B CB    1 
ATOM   5989 C  CG    . LEU A 1 846 ? -17.805 -0.308  24.942  1.00 59.24  ? 909  LEU B CG    1 
ATOM   5990 C  CD1   . LEU A 1 846 ? -16.470 0.013   24.332  1.00 57.93  ? 909  LEU B CD1   1 
ATOM   5991 C  CD2   . LEU A 1 846 ? -18.901 0.136   24.047  1.00 65.38  ? 909  LEU B CD2   1 
ATOM   5992 N  N     . SER A 1 847 ? -19.325 -4.166  27.079  1.00 57.71  ? 910  SER B N     1 
ATOM   5993 C  CA    . SER A 1 847 ? -19.693 -5.542  27.207  1.00 55.36  ? 910  SER B CA    1 
ATOM   5994 C  C     . SER A 1 847 ? -21.180 -5.637  27.034  1.00 55.92  ? 910  SER B C     1 
ATOM   5995 O  O     . SER A 1 847 ? -21.635 -6.444  26.305  1.00 62.71  ? 910  SER B O     1 
ATOM   5996 C  CB    . SER A 1 847 ? -19.276 -6.035  28.573  1.00 53.47  ? 910  SER B CB    1 
ATOM   5997 O  OG    . SER A 1 847 ? -20.351 -6.355  29.408  1.00 52.75  ? 910  SER B OG    1 
ATOM   5998 N  N     . CYS A 1 848 ? -21.951 -4.730  27.601  1.00 59.94  ? 911  CYS B N     1 
ATOM   5999 C  CA    . CYS A 1 848 ? -23.361 -4.674  27.413  1.00 61.83  ? 911  CYS B CA    1 
ATOM   6000 C  C     . CYS A 1 848 ? -23.703 -4.490  25.958  1.00 61.75  ? 911  CYS B C     1 
ATOM   6001 O  O     . CYS A 1 848 ? -24.705 -4.967  25.553  1.00 66.80  ? 911  CYS B O     1 
ATOM   6002 C  CB    . CYS A 1 848 ? -23.897 -3.504  28.196  1.00 70.17  ? 911  CYS B CB    1 
ATOM   6003 S  SG    . CYS A 1 848 ? -23.865 -3.765  29.956  1.00 77.95  ? 911  CYS B SG    1 
ATOM   6004 N  N     . PHE A 1 849 ? -22.960 -3.730  25.183  1.00 54.13  ? 912  PHE B N     1 
ATOM   6005 C  CA    . PHE A 1 849 ? -23.267 -3.623  23.798  1.00 55.46  ? 912  PHE B CA    1 
ATOM   6006 C  C     . PHE A 1 849 ? -23.182 -4.960  23.070  1.00 61.82  ? 912  PHE B C     1 
ATOM   6007 O  O     . PHE A 1 849 ? -23.979 -5.224  22.189  1.00 61.07  ? 912  PHE B O     1 
ATOM   6008 C  CB    . PHE A 1 849 ? -22.341 -2.628  23.161  1.00 60.47  ? 912  PHE B CB    1 
ATOM   6009 C  CG    . PHE A 1 849 ? -22.853 -1.241  23.181  1.00 63.01  ? 912  PHE B CG    1 
ATOM   6010 C  CD1   . PHE A 1 849 ? -23.663 -0.839  24.179  1.00 60.12  ? 912  PHE B CD1   1 
ATOM   6011 C  CD2   . PHE A 1 849 ? -22.508 -0.355  22.194  1.00 62.49  ? 912  PHE B CD2   1 
ATOM   6012 C  CE1   . PHE A 1 849 ? -24.140 0.418   24.192  1.00 58.78  ? 912  PHE B CE1   1 
ATOM   6013 C  CE2   . PHE A 1 849 ? -22.980 0.905   22.189  1.00 65.14  ? 912  PHE B CE2   1 
ATOM   6014 C  CZ    . PHE A 1 849 ? -23.797 1.285   23.198  1.00 67.09  ? 912  PHE B CZ    1 
ATOM   6015 N  N     . VAL A 1 850 ? -22.197 -5.790  23.391  1.00 64.76  ? 913  VAL B N     1 
ATOM   6016 C  CA    . VAL A 1 850 ? -22.060 -7.090  22.740  1.00 62.36  ? 913  VAL B CA    1 
ATOM   6017 C  C     . VAL A 1 850 ? -22.346 -8.354  23.513  1.00 62.28  ? 913  VAL B C     1 
ATOM   6018 O  O     . VAL A 1 850 ? -22.123 -9.393  22.984  1.00 71.42  ? 913  VAL B O     1 
ATOM   6019 C  CB    . VAL A 1 850 ? -20.668 -7.318  22.157  1.00 60.28  ? 913  VAL B CB    1 
ATOM   6020 C  CG1   . VAL A 1 850 ? -20.184 -6.128  21.394  1.00 63.05  ? 913  VAL B CG1   1 
ATOM   6021 C  CG2   . VAL A 1 850 ? -19.692 -7.624  23.244  1.00 60.29  ? 913  VAL B CG2   1 
ATOM   6022 N  N     . PHE A 1 851 ? -22.820 -8.315  24.738  1.00 62.04  ? 914  PHE B N     1 
ATOM   6023 C  CA    . PHE A 1 851 ? -23.086 -9.562  25.436  1.00 63.39  ? 914  PHE B CA    1 
ATOM   6024 C  C     . PHE A 1 851 ? -24.520 -9.826  25.254  1.00 60.89  ? 914  PHE B C     1 
ATOM   6025 O  O     . PHE A 1 851 ? -25.336 -9.040  25.623  1.00 62.84  ? 914  PHE B O     1 
ATOM   6026 C  CB    . PHE A 1 851 ? -22.787 -9.447  26.923  1.00 54.88  ? 914  PHE B CB    1 
ATOM   6027 C  CG    . PHE A 1 851 ? -23.260 -10.611 27.739  1.00 59.75  ? 914  PHE B CG    1 
ATOM   6028 C  CD1   . PHE A 1 851 ? -22.602 -11.819 27.709  1.00 67.23  ? 914  PHE B CD1   1 
ATOM   6029 C  CD2   . PHE A 1 851 ? -24.324 -10.487 28.568  1.00 59.93  ? 914  PHE B CD2   1 
ATOM   6030 C  CE1   . PHE A 1 851 ? -23.027 -12.883 28.462  1.00 57.33  ? 914  PHE B CE1   1 
ATOM   6031 C  CE2   . PHE A 1 851 ? -24.760 -11.545 29.327  1.00 62.14  ? 914  PHE B CE2   1 
ATOM   6032 C  CZ    . PHE A 1 851 ? -24.116 -12.743 29.270  1.00 57.28  ? 914  PHE B CZ    1 
ATOM   6033 N  N     . GLN A 1 852 ? -24.839 -10.947 24.675  1.00 58.80  ? 915  GLN B N     1 
ATOM   6034 C  CA    . GLN A 1 852 ? -26.218 -11.217 24.435  1.00 66.71  ? 915  GLN B CA    1 
ATOM   6035 C  C     . GLN A 1 852 ? -26.786 -12.388 25.133  1.00 65.96  ? 915  GLN B C     1 
ATOM   6036 O  O     . GLN A 1 852 ? -27.970 -12.412 25.368  1.00 66.43  ? 915  GLN B O     1 
ATOM   6037 C  CB    . GLN A 1 852 ? -26.452 -11.395 22.935  1.00 68.65  ? 915  GLN B CB    1 
ATOM   6038 N  N     . GLU A 1 853 ? -25.939 -13.296 25.584  1.00 69.49  ? 916  GLU B N     1 
ATOM   6039 C  CA    . GLU A 1 853 ? -26.390 -14.553 26.156  1.00 68.16  ? 916  GLU B CA    1 
ATOM   6040 C  C     . GLU A 1 853 ? -27.187 -14.416 27.411  1.00 63.19  ? 916  GLU B C     1 
ATOM   6041 O  O     . GLU A 1 853 ? -27.038 -13.479 28.137  1.00 71.16  ? 916  GLU B O     1 
ATOM   6042 C  CB    . GLU A 1 853 ? -25.238 -15.543 26.361  1.00 72.58  ? 916  GLU B CB    1 
ATOM   6043 C  CG    . GLU A 1 853 ? -24.002 -15.292 25.523  1.00 71.20  ? 916  GLU B CG    1 
ATOM   6044 C  CD    . GLU A 1 853 ? -23.310 -16.554 25.096  1.00 69.23  ? 916  GLU B CD    1 
ATOM   6045 O  OE1   . GLU A 1 853 ? -23.856 -17.630 25.277  1.00 69.08  ? 916  GLU B OE1   1 
ATOM   6046 O  OE2   . GLU A 1 853 ? -22.216 -16.463 24.561  1.00 65.81  ? 916  GLU B OE2   1 
ATOM   6047 N  N     . ASN A 1 854 ? -28.057 -15.376 27.645  1.00 59.38  ? 917  ASN B N     1 
ATOM   6048 C  CA    . ASN A 1 854 ? -28.894 -15.341 28.805  1.00 68.67  ? 917  ASN B CA    1 
ATOM   6049 C  C     . ASN A 1 854 ? -28.257 -15.956 30.031  1.00 74.18  ? 917  ASN B C     1 
ATOM   6050 O  O     . ASN A 1 854 ? -28.168 -17.160 30.157  1.00 61.98  ? 917  ASN B O     1 
ATOM   6051 C  CB    . ASN A 1 854 ? -30.170 -16.104 28.517  1.00 58.69  ? 917  ASN B CB    1 
ATOM   6052 N  N     . SER A 1 855 ? -27.888 -15.085 30.960  1.00 79.11  ? 918  SER B N     1 
ATOM   6053 C  CA    . SER A 1 855 ? -27.300 -15.434 32.235  1.00 74.44  ? 918  SER B CA    1 
ATOM   6054 C  C     . SER A 1 855 ? -28.350 -15.126 33.269  1.00 78.43  ? 918  SER B C     1 
ATOM   6055 O  O     . SER A 1 855 ? -29.162 -14.237 33.090  1.00 84.77  ? 918  SER B O     1 
ATOM   6056 C  CB    . SER A 1 855 ? -26.084 -14.576 32.514  1.00 68.06  ? 918  SER B CB    1 
ATOM   6057 N  N     . SER A 1 856 ? -28.355 -15.844 34.371  1.00 80.97  ? 919  SER B N     1 
ATOM   6058 C  CA    . SER A 1 856 ? -29.384 -15.585 35.349  1.00 83.25  ? 919  SER B CA    1 
ATOM   6059 C  C     . SER A 1 856 ? -29.371 -14.197 35.916  1.00 87.78  ? 919  SER B C     1 
ATOM   6060 O  O     . SER A 1 856 ? -30.365 -13.502 35.821  1.00 86.62  ? 919  SER B O     1 
ATOM   6061 C  CB    . SER A 1 856 ? -29.183 -16.521 36.527  1.00 76.08  ? 919  SER B CB    1 
ATOM   6062 N  N     . GLU A 1 857 ? -28.224 -13.732 36.379  1.00 87.30  ? 920  GLU B N     1 
ATOM   6063 C  CA    . GLU A 1 857 ? -28.185 -12.416 36.984  1.00 83.21  ? 920  GLU B CA    1 
ATOM   6064 C  C     . GLU A 1 857 ? -26.854 -11.760 37.061  1.00 77.09  ? 920  GLU B C     1 
ATOM   6065 O  O     . GLU A 1 857 ? -25.826 -12.384 37.013  1.00 65.18  ? 920  GLU B O     1 
ATOM   6066 C  CB    . GLU A 1 857 ? -28.769 -12.440 38.394  1.00 84.40  ? 920  GLU B CB    1 
ATOM   6067 N  N     . MET A 1 858 ? -26.947 -10.452 37.216  1.00 83.15  ? 921  MET B N     1 
ATOM   6068 C  CA    . MET A 1 858 ? -25.838 -9.536  37.315  1.00 78.10  ? 921  MET B CA    1 
ATOM   6069 C  C     . MET A 1 858 ? -25.301 -9.542  38.701  1.00 79.80  ? 921  MET B C     1 
ATOM   6070 O  O     . MET A 1 858 ? -25.928 -10.025 39.609  1.00 82.02  ? 921  MET B O     1 
ATOM   6071 C  CB    . MET A 1 858 ? -26.276 -8.117  36.938  1.00 68.00  ? 921  MET B CB    1 
ATOM   6072 N  N     . PRO A 1 859 ? -24.126 -8.992  38.855  1.00 75.72  ? 922  PRO B N     1 
ATOM   6073 C  CA    . PRO A 1 859 ? -23.381 -8.840  40.069  1.00 75.36  ? 922  PRO B CA    1 
ATOM   6074 C  C     . PRO A 1 859 ? -23.468 -7.399  40.421  1.00 72.80  ? 922  PRO B C     1 
ATOM   6075 O  O     . PRO A 1 859 ? -23.407 -6.548  39.572  1.00 68.76  ? 922  PRO B O     1 
ATOM   6076 C  CB    . PRO A 1 859 ? -21.976 -9.151  39.608  1.00 79.37  ? 922  PRO B CB    1 
ATOM   6077 C  CG    . PRO A 1 859 ? -21.942 -8.658  38.199  1.00 81.40  ? 922  PRO B CG    1 
ATOM   6078 C  CD    . PRO A 1 859 ? -23.355 -8.511  37.715  1.00 75.82  ? 922  PRO B CD    1 
ATOM   6079 N  N     . LYS A 1 860 ? -23.601 -7.112  41.691  1.00 72.91  ? 923  LYS B N     1 
ATOM   6080 C  CA    . LYS A 1 860 ? -23.688 -5.751  42.111  1.00 75.35  ? 923  LYS B CA    1 
ATOM   6081 C  C     . LYS A 1 860 ? -22.407 -5.070  41.780  1.00 63.74  ? 923  LYS B C     1 
ATOM   6082 O  O     . LYS A 1 860 ? -21.350 -5.599  41.996  1.00 64.75  ? 923  LYS B O     1 
ATOM   6083 C  CB    . LYS A 1 860 ? -23.950 -5.699  43.606  1.00 73.63  ? 923  LYS B CB    1 
ATOM   6084 N  N     . LEU A 1 861 ? -22.491 -3.845  41.329  1.00 58.03  ? 924  LEU B N     1 
ATOM   6085 C  CA    . LEU A 1 861 ? -21.286 -3.202  40.918  1.00 64.59  ? 924  LEU B CA    1 
ATOM   6086 C  C     . LEU A 1 861 ? -20.819 -1.985  41.635  1.00 69.97  ? 924  LEU B C     1 
ATOM   6087 O  O     . LEU A 1 861 ? -21.578 -1.134  42.030  1.00 63.64  ? 924  LEU B O     1 
ATOM   6088 C  CB    . LEU A 1 861 ? -21.380 -2.873  39.454  1.00 78.10  ? 924  LEU B CB    1 
ATOM   6089 N  N     . THR A 1 862 ? -19.504 -1.921  41.750  1.00 71.56  ? 925  THR B N     1 
ATOM   6090 C  CA    . THR A 1 862 ? -18.868 -0.788  42.362  1.00 76.69  ? 925  THR B CA    1 
ATOM   6091 C  C     . THR A 1 862 ? -19.244 0.348   41.463  1.00 79.77  ? 925  THR B C     1 
ATOM   6092 O  O     . THR A 1 862 ? -19.333 0.202   40.246  1.00 77.58  ? 925  THR B O     1 
ATOM   6093 C  CB    . THR A 1 862 ? -17.327 -0.887  42.415  1.00 72.87  ? 925  THR B CB    1 
ATOM   6094 O  OG1   . THR A 1 862 ? -16.815 -1.143  41.112  1.00 68.92  ? 925  THR B OG1   1 
ATOM   6095 C  CG2   . THR A 1 862 ? -16.879 -1.967  43.369  1.00 66.07  ? 925  THR B CG2   1 
ATOM   6096 N  N     . GLU A 1 863 ? -19.307 1.539   42.035  1.00 84.91  ? 926  GLU B N     1 
ATOM   6097 C  CA    . GLU A 1 863 ? -19.784 2.709   41.313  1.00 80.73  ? 926  GLU B CA    1 
ATOM   6098 C  C     . GLU A 1 863 ? -19.047 3.011   40.019  1.00 75.85  ? 926  GLU B C     1 
ATOM   6099 O  O     . GLU A 1 863 ? -19.675 3.442   39.088  1.00 71.85  ? 926  GLU B O     1 
ATOM   6100 C  CB    . GLU A 1 863 ? -19.858 3.935   42.223  1.00 64.28  ? 926  GLU B CB    1 
ATOM   6101 N  N     . GLN A 1 864 ? -17.753 2.761   39.927  1.00 69.99  ? 927  GLN B N     1 
ATOM   6102 C  CA    . GLN A 1 864 ? -17.054 3.045   38.694  1.00 73.35  ? 927  GLN B CA    1 
ATOM   6103 C  C     . GLN A 1 864 ? -17.625 2.277   37.518  1.00 75.05  ? 927  GLN B C     1 
ATOM   6104 O  O     . GLN A 1 864 ? -17.652 2.791   36.420  1.00 69.48  ? 927  GLN B O     1 
ATOM   6105 C  CB    . GLN A 1 864 ? -15.569 2.716   38.839  1.00 63.06  ? 927  GLN B CB    1 
ATOM   6106 N  N     . LEU A 1 865 ? -17.944 1.011   37.711  1.00 73.98  ? 928  LEU B N     1 
ATOM   6107 C  CA    . LEU A 1 865 ? -18.582 0.241   36.672  1.00 73.62  ? 928  LEU B CA    1 
ATOM   6108 C  C     . LEU A 1 865 ? -20.040 0.598   36.465  1.00 73.85  ? 928  LEU B C     1 
ATOM   6109 O  O     . LEU A 1 865 ? -20.469 0.758   35.363  1.00 73.86  ? 928  LEU B O     1 
ATOM   6110 C  CB    . LEU A 1 865 ? -18.399 -1.266  36.878  1.00 66.97  ? 928  LEU B CB    1 
ATOM   6111 N  N     . ALA A 1 866 ? -20.798 0.788   37.531  1.00 72.37  ? 929  ALA B N     1 
ATOM   6112 C  CA    . ALA A 1 866 ? -22.214 1.057   37.370  1.00 69.04  ? 929  ALA B CA    1 
ATOM   6113 C  C     . ALA A 1 866 ? -22.547 2.487   37.227  1.00 70.68  ? 929  ALA B C     1 
ATOM   6114 O  O     . ALA A 1 866 ? -23.698 2.835   37.159  1.00 70.40  ? 929  ALA B O     1 
ATOM   6115 C  CB    . ALA A 1 866 ? -23.019 0.472   38.499  1.00 61.03  ? 929  ALA B CB    1 
ATOM   6116 N  N     . GLY A 1 867 ? -21.564 3.339   37.296  1.00 72.08  ? 930  GLY B N     1 
ATOM   6117 C  CA    . GLY A 1 867 ? -21.875 4.732   37.133  1.00 76.06  ? 930  GLY B CA    1 
ATOM   6118 C  C     . GLY A 1 867 ? -22.365 4.981   35.746  1.00 73.43  ? 930  GLY B C     1 
ATOM   6119 O  O     . GLY A 1 867 ? -23.384 5.580   35.572  1.00 79.56  ? 930  GLY B O     1 
ATOM   6120 N  N     . PRO A 1 868 ? -21.661 4.453   34.757  1.00 71.07  ? 931  PRO B N     1 
ATOM   6121 C  CA    . PRO A 1 868 ? -21.877 4.475   33.318  1.00 73.58  ? 931  PRO B CA    1 
ATOM   6122 C  C     . PRO A 1 868 ? -23.110 3.692   32.946  1.00 63.95  ? 931  PRO B C     1 
ATOM   6123 O  O     . PRO A 1 868 ? -23.858 4.003   32.048  1.00 61.38  ? 931  PRO B O     1 
ATOM   6124 C  CB    . PRO A 1 868 ? -20.610 3.856   32.790  1.00 68.51  ? 931  PRO B CB    1 
ATOM   6125 C  CG    . PRO A 1 868 ? -19.601 4.262   33.789  1.00 66.06  ? 931  PRO B CG    1 
ATOM   6126 C  CD    . PRO A 1 868 ? -20.318 3.972   35.056  1.00 66.30  ? 931  PRO B CD    1 
ATOM   6127 N  N     . LEU A 1 869 ? -23.370 2.666   33.723  1.00 63.20  ? 932  LEU B N     1 
ATOM   6128 C  CA    . LEU A 1 869 ? -24.527 1.855   33.533  1.00 61.31  ? 932  LEU B CA    1 
ATOM   6129 C  C     . LEU A 1 869 ? -25.757 2.705   33.698  1.00 68.53  ? 932  LEU B C     1 
ATOM   6130 O  O     . LEU A 1 869 ? -26.694 2.552   32.942  1.00 66.32  ? 932  LEU B O     1 
ATOM   6131 C  CB    . LEU A 1 869 ? -24.561 0.789   34.593  1.00 65.81  ? 932  LEU B CB    1 
ATOM   6132 C  CG    . LEU A 1 869 ? -25.346 -0.434  34.212  1.00 67.95  ? 932  LEU B CG    1 
ATOM   6133 C  CD1   . LEU A 1 869 ? -26.205 -0.933  35.346  1.00 65.43  ? 932  LEU B CD1   1 
ATOM   6134 C  CD2   . LEU A 1 869 ? -26.222 -0.097  33.039  1.00 70.62  ? 932  LEU B CD2   1 
ATOM   6135 N  N     . ARG A 1 870 ? -25.774 3.583   34.708  1.00 74.99  ? 933  ARG B N     1 
ATOM   6136 C  CA    . ARG A 1 870 ? -26.841 4.532   34.947  1.00 68.55  ? 933  ARG B CA    1 
ATOM   6137 C  C     . ARG A 1 870 ? -26.902 5.486   33.817  1.00 64.23  ? 933  ARG B C     1 
ATOM   6138 O  O     . ARG A 1 870 ? -27.958 5.829   33.356  1.00 59.47  ? 933  ARG B O     1 
ATOM   6139 C  CB    . ARG A 1 870 ? -26.535 5.351   36.188  1.00 59.47  ? 933  ARG B CB    1 
ATOM   6140 N  N     . GLN A 1 871 ? -25.730 5.920   33.402  1.00 64.31  ? 934  GLN B N     1 
ATOM   6141 C  CA    . GLN A 1 871 ? -25.594 6.859   32.320  1.00 68.98  ? 934  GLN B CA    1 
ATOM   6142 C  C     . GLN A 1 871 ? -26.048 6.353   30.990  1.00 68.78  ? 934  GLN B C     1 
ATOM   6143 O  O     . GLN A 1 871 ? -26.707 7.069   30.284  1.00 70.02  ? 934  GLN B O     1 
ATOM   6144 C  CB    . GLN A 1 871 ? -24.177 7.429   32.244  1.00 65.32  ? 934  GLN B CB    1 
ATOM   6145 C  CG    . GLN A 1 871 ? -23.952 8.575   33.203  1.00 63.25  ? 934  GLN B CG    1 
ATOM   6146 C  CD    . GLN A 1 871 ? -22.667 9.293   32.940  1.00 72.86  ? 934  GLN B CD    1 
ATOM   6147 O  OE1   . GLN A 1 871 ? -22.594 10.511  32.965  1.00 62.57  ? 934  GLN B OE1   1 
ATOM   6148 N  NE2   . GLN A 1 871 ? -21.637 8.539   32.696  1.00 76.57  ? 934  GLN B NE2   1 
ATOM   6149 N  N     . MET A 1 872 ? -25.716 5.130   30.634  1.00 67.49  ? 935  MET B N     1 
ATOM   6150 C  CA    . MET A 1 872 ? -26.164 4.652   29.361  1.00 60.93  ? 935  MET B CA    1 
ATOM   6151 C  C     . MET A 1 872 ? -27.629 4.494   29.271  1.00 60.06  ? 935  MET B C     1 
ATOM   6152 O  O     . MET A 1 872 ? -28.194 4.814   28.285  1.00 60.90  ? 935  MET B O     1 
ATOM   6153 C  CB    . MET A 1 872 ? -25.426 3.396   28.882  1.00 65.58  ? 935  MET B CB    1 
ATOM   6154 C  CG    . MET A 1 872 ? -26.032 2.036   29.198  1.00 70.03  ? 935  MET B CG    1 
ATOM   6155 S  SD    . MET A 1 872 ? -26.888 1.161   27.924  1.00 53.16  ? 935  MET B SD    1 
ATOM   6156 C  CE    . MET A 1 872 ? -25.447 0.944   26.942  1.00 67.64  ? 935  MET B CE    1 
ATOM   6157 N  N     . GLN A 1 873 ? -28.277 4.044   30.316  1.00 61.75  ? 936  GLN B N     1 
ATOM   6158 C  CA    . GLN A 1 873 ? -29.679 3.784   30.204  1.00 60.04  ? 936  GLN B CA    1 
ATOM   6159 C  C     . GLN A 1 873 ? -30.507 4.996   29.903  1.00 64.80  ? 936  GLN B C     1 
ATOM   6160 O  O     . GLN A 1 873 ? -31.476 4.900   29.219  1.00 65.76  ? 936  GLN B O     1 
ATOM   6161 C  CB    . GLN A 1 873 ? -30.189 2.977   31.366  1.00 64.22  ? 936  GLN B CB    1 
ATOM   6162 N  N     . GLU A 1 874 ? -30.149 6.149   30.441  1.00 70.43  ? 937  GLU B N     1 
ATOM   6163 C  CA    . GLU A 1 874 ? -30.852 7.369   30.146  1.00 65.59  ? 937  GLU B CA    1 
ATOM   6164 C  C     . GLU A 1 874 ? -30.650 7.673   28.712  1.00 60.71  ? 937  GLU B C     1 
ATOM   6165 O  O     . GLU A 1 874 ? -31.585 7.947   28.035  1.00 64.13  ? 937  GLU B O     1 
ATOM   6166 C  CB    . GLU A 1 874 ? -30.320 8.510   30.982  1.00 70.38  ? 937  GLU B CB    1 
ATOM   6167 N  N     . CYS A 1 875 ? -29.430 7.523   28.225  1.00 60.85  ? 938  CYS B N     1 
ATOM   6168 C  CA    . CYS A 1 875 ? -29.085 7.760   26.837  1.00 60.19  ? 938  CYS B CA    1 
ATOM   6169 C  C     . CYS A 1 875 ? -29.829 6.842   25.921  1.00 57.02  ? 938  CYS B C     1 
ATOM   6170 O  O     . CYS A 1 875 ? -30.251 7.214   24.883  1.00 49.09  ? 938  CYS B O     1 
ATOM   6171 C  CB    . CYS A 1 875 ? -27.625 7.527   26.666  1.00 56.34  ? 938  CYS B CB    1 
ATOM   6172 S  SG    . CYS A 1 875 ? -26.941 8.535   25.410  1.00 77.07  ? 938  CYS B SG    1 
ATOM   6173 N  N     . ALA A 1 876 ? -29.941 5.607   26.328  1.00 56.25  ? 939  ALA B N     1 
ATOM   6174 C  CA    . ALA A 1 876 ? -30.721 4.623   25.648  1.00 56.34  ? 939  ALA B CA    1 
ATOM   6175 C  C     . ALA A 1 876 ? -32.173 4.987   25.696  1.00 57.30  ? 939  ALA B C     1 
ATOM   6176 O  O     . ALA A 1 876 ? -32.886 4.776   24.745  1.00 59.78  ? 939  ALA B O     1 
ATOM   6177 C  CB    . ALA A 1 876 ? -30.539 3.287   26.315  1.00 59.97  ? 939  ALA B CB    1 
ATOM   6178 N  N     . LYS A 1 877 ? -32.622 5.493   26.832  1.00 53.74  ? 940  LYS B N     1 
ATOM   6179 C  CA    . LYS A 1 877 ? -33.991 5.892   27.002  1.00 56.43  ? 940  LYS B CA    1 
ATOM   6180 C  C     . LYS A 1 877 ? -34.392 7.020   26.108  1.00 58.42  ? 940  LYS B C     1 
ATOM   6181 O  O     . LYS A 1 877 ? -35.536 7.100   25.739  1.00 55.81  ? 940  LYS B O     1 
ATOM   6182 C  CB    . LYS A 1 877 ? -34.284 6.244   28.438  1.00 56.69  ? 940  LYS B CB    1 
ATOM   6183 N  N     . ARG A 1 878 ? -33.480 7.947   25.872  1.00 50.55  ? 941  ARG B N     1 
ATOM   6184 C  CA    . ARG A 1 878 ? -33.715 9.070   24.996  1.00 55.66  ? 941  ARG B CA    1 
ATOM   6185 C  C     . ARG A 1 878 ? -33.959 8.689   23.551  1.00 56.32  ? 941  ARG B C     1 
ATOM   6186 O  O     . ARG A 1 878 ? -34.813 9.227   22.923  1.00 47.94  ? 941  ARG B O     1 
ATOM   6187 C  CB    . ARG A 1 878 ? -32.540 10.022  25.062  1.00 54.31  ? 941  ARG B CB    1 
ATOM   6188 N  N     . ILE A 1 879 ? -33.181 7.747   23.039  1.00 56.52  ? 942  ILE B N     1 
ATOM   6189 C  CA    . ILE A 1 879 ? -33.276 7.222   21.694  1.00 46.73  ? 942  ILE B CA    1 
ATOM   6190 C  C     . ILE A 1 879 ? -34.572 6.535   21.513  1.00 50.69  ? 942  ILE B C     1 
ATOM   6191 O  O     . ILE A 1 879 ? -35.228 6.656   20.533  1.00 50.09  ? 942  ILE B O     1 
ATOM   6192 C  CB    . ILE A 1 879 ? -32.250 6.137   21.494  1.00 43.05  ? 942  ILE B CB    1 
ATOM   6193 C  CG1   . ILE A 1 879 ? -30.906 6.707   21.175  1.00 42.96  ? 942  ILE B CG1   1 
ATOM   6194 C  CG2   . ILE A 1 879 ? -32.585 5.359   20.266  1.00 48.35  ? 942  ILE B CG2   1 
ATOM   6195 C  CD1   . ILE A 1 879 ? -30.844 8.175   21.380  1.00 48.56  ? 942  ILE B CD1   1 
ATOM   6196 N  N     . ALA A 1 880 ? -34.942 5.794   22.521  1.00 48.29  ? 943  ALA B N     1 
ATOM   6197 C  CA    . ALA A 1 880 ? -36.169 5.085   22.553  1.00 50.71  ? 943  ALA B CA    1 
ATOM   6198 C  C     . ALA A 1 880 ? -37.331 6.033   22.487  1.00 58.41  ? 943  ALA B C     1 
ATOM   6199 O  O     . ALA A 1 880 ? -38.320 5.709   21.892  1.00 54.26  ? 943  ALA B O     1 
ATOM   6200 C  CB    . ALA A 1 880 ? -36.233 4.294   23.816  1.00 49.64  ? 943  ALA B CB    1 
ATOM   6201 N  N     . LYS A 1 881 ? -37.249 7.183   23.158  1.00 61.96  ? 944  LYS B N     1 
ATOM   6202 C  CA    . LYS A 1 881 ? -38.284 8.170   23.121  1.00 57.63  ? 944  LYS B CA    1 
ATOM   6203 C  C     . LYS A 1 881 ? -38.444 8.630   21.735  1.00 54.67  ? 944  LYS B C     1 
ATOM   6204 O  O     . LYS A 1 881 ? -39.522 8.694   21.263  1.00 59.63  ? 944  LYS B O     1 
ATOM   6205 C  CB    . LYS A 1 881 ? -37.860 9.379   23.929  1.00 54.16  ? 944  LYS B CB    1 
ATOM   6206 N  N     . VAL A 1 882 ? -37.363 8.945   21.058  1.00 48.58  ? 945  VAL B N     1 
ATOM   6207 C  CA    . VAL A 1 882 ? -37.478 9.378   19.694  1.00 55.49  ? 945  VAL B CA    1 
ATOM   6208 C  C     . VAL A 1 882 ? -37.939 8.320   18.724  1.00 58.47  ? 945  VAL B C     1 
ATOM   6209 O  O     . VAL A 1 882 ? -38.640 8.627   17.802  1.00 55.82  ? 945  VAL B O     1 
ATOM   6210 C  CB    . VAL A 1 882 ? -36.339 10.244  19.187  1.00 47.57  ? 945  VAL B CB    1 
ATOM   6211 C  CG1   . VAL A 1 882 ? -36.132 11.393  20.114  1.00 56.10  ? 945  VAL B CG1   1 
ATOM   6212 C  CG2   . VAL A 1 882 ? -35.072 9.478   19.006  1.00 45.37  ? 945  VAL B CG2   1 
ATOM   6213 N  N     . SER A 1 883 ? -37.545 7.074   18.897  1.00 52.30  ? 946  SER B N     1 
ATOM   6214 C  CA    . SER A 1 883 ? -38.006 6.075   17.980  1.00 48.70  ? 946  SER B CA    1 
ATOM   6215 C  C     . SER A 1 883 ? -39.484 5.942   18.039  1.00 51.90  ? 946  SER B C     1 
ATOM   6216 O  O     . SER A 1 883 ? -40.112 5.945   17.042  1.00 59.38  ? 946  SER B O     1 
ATOM   6217 C  CB    . SER A 1 883 ? -37.378 4.755   18.264  1.00 49.29  ? 946  SER B CB    1 
ATOM   6218 O  OG    . SER A 1 883 ? -36.103 4.746   17.731  1.00 50.32  ? 946  SER B OG    1 
ATOM   6219 N  N     . ALA A 1 884 ? -40.082 5.954   19.210  1.00 54.98  ? 947  ALA B N     1 
ATOM   6220 C  CA    . ALA A 1 884 ? -41.527 5.822   19.323  1.00 57.45  ? 947  ALA B CA    1 
ATOM   6221 C  C     . ALA A 1 884 ? -42.278 6.950   18.656  1.00 60.17  ? 947  ALA B C     1 
ATOM   6222 O  O     . ALA A 1 884 ? -43.302 6.738   18.019  1.00 53.13  ? 947  ALA B O     1 
ATOM   6223 C  CB    . ALA A 1 884 ? -41.931 5.694   20.761  1.00 49.15  ? 947  ALA B CB    1 
ATOM   6224 N  N     . GLU A 1 885 ? -41.707 8.152   18.777  1.00 53.68  ? 948  GLU B N     1 
ATOM   6225 C  CA    . GLU A 1 885 ? -42.164 9.405   18.215  1.00 50.32  ? 948  GLU B CA    1 
ATOM   6226 C  C     . GLU A 1 885 ? -42.185 9.331   16.711  1.00 54.34  ? 948  GLU B C     1 
ATOM   6227 O  O     . GLU A 1 885 ? -43.116 9.734   16.065  1.00 49.18  ? 948  GLU B O     1 
ATOM   6228 C  CB    . GLU A 1 885 ? -41.281 10.534  18.717  1.00 51.13  ? 948  GLU B CB    1 
ATOM   6229 C  CG    . GLU A 1 885 ? -41.622 10.866  20.154  1.00 63.83  ? 948  GLU B CG    1 
ATOM   6230 C  CD    . GLU A 1 885 ? -40.797 11.944  20.815  1.00 71.76  ? 948  GLU B CD    1 
ATOM   6231 O  OE1   . GLU A 1 885 ? -39.859 12.476  20.235  1.00 60.30  ? 948  GLU B OE1   1 
ATOM   6232 O  OE2   . GLU A 1 885 ? -41.115 12.264  21.961  1.00 73.17  ? 948  GLU B OE2   1 
ATOM   6233 N  N     . ALA A 1 886 ? -41.209 8.651   16.148  1.00 54.71  ? 949  ALA B N     1 
ATOM   6234 C  CA    . ALA A 1 886 ? -41.100 8.473   14.737  1.00 49.81  ? 949  ALA B CA    1 
ATOM   6235 C  C     . ALA A 1 886 ? -41.900 7.344   14.187  1.00 48.73  ? 949  ALA B C     1 
ATOM   6236 O  O     . ALA A 1 886 ? -41.684 7.041   13.074  1.00 50.85  ? 949  ALA B O     1 
ATOM   6237 C  CB    . ALA A 1 886 ? -39.676 8.311   14.339  1.00 44.63  ? 949  ALA B CB    1 
ATOM   6238 N  N     . LYS A 1 887 ? -42.753 6.768   15.012  1.00 48.17  ? 950  LYS B N     1 
ATOM   6239 C  CA    . LYS A 1 887 ? -43.696 5.742   14.632  1.00 47.55  ? 950  LYS B CA    1 
ATOM   6240 C  C     . LYS A 1 887 ? -43.249 4.315   14.481  1.00 51.93  ? 950  LYS B C     1 
ATOM   6241 O  O     . LYS A 1 887 ? -43.937 3.510   13.913  1.00 43.62  ? 950  LYS B O     1 
ATOM   6242 C  CB    . LYS A 1 887 ? -44.477 6.215   13.429  1.00 41.01  ? 950  LYS B CB    1 
ATOM   6243 N  N     . LEU A 1 888 ? -42.083 4.028   15.018  1.00 49.69  ? 951  LEU B N     1 
ATOM   6244 C  CA    . LEU A 1 888 ? -41.478 2.718   15.004  1.00 49.06  ? 951  LEU B CA    1 
ATOM   6245 C  C     . LEU A 1 888 ? -42.023 1.797   16.060  1.00 47.07  ? 951  LEU B C     1 
ATOM   6246 O  O     . LEU A 1 888 ? -42.663 2.232   16.958  1.00 53.09  ? 951  LEU B O     1 
ATOM   6247 C  CB    . LEU A 1 888 ? -39.995 2.877   15.197  1.00 45.45  ? 951  LEU B CB    1 
ATOM   6248 C  CG    . LEU A 1 888 ? -39.382 3.525   13.998  1.00 43.47  ? 951  LEU B CG    1 
ATOM   6249 C  CD1   . LEU A 1 888 ? -37.976 3.951   14.277  1.00 35.51  ? 951  LEU B CD1   1 
ATOM   6250 C  CD2   . LEU A 1 888 ? -39.382 2.484   12.923  1.00 37.46  ? 951  LEU B CD2   1 
ATOM   6251 N  N     . GLU A 1 889 ? -41.805 0.509   15.939  1.00 49.06  ? 952  GLU B N     1 
ATOM   6252 C  CA    . GLU A 1 889 ? -42.279 -0.363  16.966  1.00 54.34  ? 952  GLU B CA    1 
ATOM   6253 C  C     . GLU A 1 889 ? -41.126 -0.872  17.770  1.00 61.89  ? 952  GLU B C     1 
ATOM   6254 O  O     . GLU A 1 889 ? -40.241 -1.514  17.271  1.00 58.18  ? 952  GLU B O     1 
ATOM   6255 C  CB    . GLU A 1 889 ? -43.069 -1.519  16.392  1.00 50.11  ? 952  GLU B CB    1 
ATOM   6256 N  N     . ILE A 1 890 ? -41.151 -0.478  19.023  1.00 61.52  ? 953  ILE B N     1 
ATOM   6257 C  CA    . ILE A 1 890 ? -40.235 -0.842  20.075  1.00 62.02  ? 953  ILE B CA    1 
ATOM   6258 C  C     . ILE A 1 890 ? -40.918 -0.529  21.386  1.00 70.81  ? 953  ILE B C     1 
ATOM   6259 O  O     . ILE A 1 890 ? -41.870 0.237   21.423  1.00 76.16  ? 953  ILE B O     1 
ATOM   6260 C  CB    . ILE A 1 890 ? -38.953 0.007   20.076  1.00 63.19  ? 953  ILE B CB    1 
ATOM   6261 C  CG1   . ILE A 1 890 ? -39.181 1.394   19.522  1.00 58.82  ? 953  ILE B CG1   1 
ATOM   6262 C  CG2   . ILE A 1 890 ? -37.861 -0.641  19.253  1.00 65.40  ? 953  ILE B CG2   1 
ATOM   6263 C  CD1   . ILE A 1 890 ? -40.467 1.996   19.945  1.00 57.22  ? 953  ILE B CD1   1 
ATOM   6264 N  N     . ASP A 1 891 ? -40.487 -1.123  22.478  1.00 67.94  ? 954  ASP B N     1 
ATOM   6265 C  CA    . ASP A 1 891 ? -41.021 -0.657  23.737  1.00 66.68  ? 954  ASP B CA    1 
ATOM   6266 C  C     . ASP A 1 891 ? -39.907 -0.289  24.661  1.00 68.05  ? 954  ASP B C     1 
ATOM   6267 O  O     . ASP A 1 891 ? -38.927 -0.969  24.732  1.00 67.19  ? 954  ASP B O     1 
ATOM   6268 C  CB    . ASP A 1 891 ? -42.365 -1.237  24.240  1.00 67.97  ? 954  ASP B CB    1 
ATOM   6269 C  CG    . ASP A 1 891 ? -42.282 -2.582  24.856  1.00 72.99  ? 954  ASP B CG    1 
ATOM   6270 O  OD1   . ASP A 1 891 ? -41.805 -2.683  25.974  1.00 75.01  ? 954  ASP B OD1   1 
ATOM   6271 O  OD2   . ASP A 1 891 ? -42.817 -3.525  24.279  1.00 71.24  ? 954  ASP B OD2   1 
ATOM   6272 N  N     . GLU A 1 892 ? -40.064 0.792   25.399  1.00 68.98  ? 955  GLU B N     1 
ATOM   6273 C  CA    . GLU A 1 892 ? -38.975 1.328   26.185  1.00 65.55  ? 955  GLU B CA    1 
ATOM   6274 C  C     . GLU A 1 892 ? -38.398 0.400   27.176  1.00 72.28  ? 955  GLU B C     1 
ATOM   6275 O  O     . GLU A 1 892 ? -37.216 0.430   27.414  1.00 74.28  ? 955  GLU B O     1 
ATOM   6276 C  CB    . GLU A 1 892 ? -39.373 2.612   26.869  1.00 67.59  ? 955  GLU B CB    1 
ATOM   6277 N  N     . GLU A 1 893 ? -39.215 -0.404  27.809  1.00 72.89  ? 956  GLU B N     1 
ATOM   6278 C  CA    . GLU A 1 893 ? -38.658 -1.354  28.711  1.00 75.64  ? 956  GLU B CA    1 
ATOM   6279 C  C     . GLU A 1 893 ? -37.746 -2.304  27.939  1.00 78.20  ? 956  GLU B C     1 
ATOM   6280 O  O     . GLU A 1 893 ? -36.608 -2.509  28.311  1.00 78.78  ? 956  GLU B O     1 
ATOM   6281 C  CB    . GLU A 1 893 ? -39.802 -2.128  29.339  1.00 72.05  ? 956  GLU B CB    1 
ATOM   6282 N  N     . THR A 1 894 ? -38.204 -2.806  26.807  1.00 69.04  ? 957  THR B N     1 
ATOM   6283 C  CA    . THR A 1 894 ? -37.395 -3.724  26.062  1.00 65.25  ? 957  THR B CA    1 
ATOM   6284 C  C     . THR A 1 894 ? -36.114 -3.182  25.532  1.00 70.76  ? 957  THR B C     1 
ATOM   6285 O  O     . THR A 1 894 ? -35.136 -3.850  25.636  1.00 81.44  ? 957  THR B O     1 
ATOM   6286 C  CB    . THR A 1 894 ? -38.129 -4.332  24.882  1.00 70.48  ? 957  THR B CB    1 
ATOM   6287 O  OG1   . THR A 1 894 ? -39.275 -5.001  25.355  1.00 75.59  ? 957  THR B OG1   1 
ATOM   6288 C  CG2   . THR A 1 894 ? -37.269 -5.335  24.204  1.00 56.76  ? 957  THR B CG2   1 
ATOM   6289 N  N     . TYR A 1 895 ? -36.059 -1.982  24.987  1.00 62.04  ? 958  TYR B N     1 
ATOM   6290 C  CA    . TYR A 1 895 ? -34.788 -1.519  24.450  1.00 59.95  ? 958  TYR B CA    1 
ATOM   6291 C  C     . TYR A 1 895 ? -33.764 -1.388  25.522  1.00 66.27  ? 958  TYR B C     1 
ATOM   6292 O  O     . TYR A 1 895 ? -32.667 -1.875  25.429  1.00 57.43  ? 958  TYR B O     1 
ATOM   6293 C  CB    . TYR A 1 895 ? -34.958 -0.172  23.790  1.00 54.25  ? 958  TYR B CB    1 
ATOM   6294 C  CG    . TYR A 1 895 ? -33.746 0.385   23.113  1.00 37.99  ? 958  TYR B CG    1 
ATOM   6295 C  CD1   . TYR A 1 895 ? -33.192 -0.228  22.057  1.00 37.89  ? 958  TYR B CD1   1 
ATOM   6296 C  CD2   . TYR A 1 895 ? -33.221 1.550   23.498  1.00 38.04  ? 958  TYR B CD2   1 
ATOM   6297 C  CE1   . TYR A 1 895 ? -32.110 0.299   21.434  1.00 40.28  ? 958  TYR B CE1   1 
ATOM   6298 C  CE2   . TYR A 1 895 ? -32.144 2.075   22.879  1.00 39.70  ? 958  TYR B CE2   1 
ATOM   6299 C  CZ    . TYR A 1 895 ? -31.599 1.439   21.853  1.00 37.15  ? 958  TYR B CZ    1 
ATOM   6300 O  OH    . TYR A 1 895 ? -30.533 1.946   21.234  1.00 35.97  ? 958  TYR B OH    1 
ATOM   6301 N  N     . LEU A 1 896 ? -34.212 -0.825  26.627  1.00 74.07  ? 959  LEU B N     1 
ATOM   6302 C  CA    . LEU A 1 896 ? -33.437 -0.589  27.814  1.00 75.33  ? 959  LEU B CA    1 
ATOM   6303 C  C     . LEU A 1 896 ? -32.959 -1.869  28.446  1.00 81.54  ? 959  LEU B C     1 
ATOM   6304 O  O     . LEU A 1 896 ? -31.933 -1.890  29.096  1.00 82.48  ? 959  LEU B O     1 
ATOM   6305 C  CB    . LEU A 1 896 ? -34.243 0.242   28.784  1.00 68.47  ? 959  LEU B CB    1 
ATOM   6306 N  N     . SER A 1 897 ? -33.755 -2.914  28.341  1.00 75.79  ? 960  SER B N     1 
ATOM   6307 C  CA    . SER A 1 897 ? -33.384 -4.180  28.865  1.00 77.13  ? 960  SER B CA    1 
ATOM   6308 C  C     . SER A 1 897 ? -32.809 -5.103  27.797  1.00 71.69  ? 960  SER B C     1 
ATOM   6309 O  O     . SER A 1 897 ? -32.776 -6.294  27.951  1.00 72.32  ? 960  SER B O     1 
ATOM   6310 C  CB    . SER A 1 897 ? -34.511 -4.757  29.710  1.00 81.69  ? 960  SER B CB    1 
ATOM   6311 O  OG    . SER A 1 897 ? -35.642 -4.997  28.883  1.00 89.25  ? 960  SER B OG    1 
ATOM   6312 N  N     . SER A 1 898 ? -32.412 -4.540  26.671  1.00 73.25  ? 961  SER B N     1 
ATOM   6313 C  CA    . SER A 1 898 ? -31.752 -5.331  25.638  1.00 73.23  ? 961  SER B CA    1 
ATOM   6314 C  C     . SER A 1 898 ? -30.268 -5.303  25.789  1.00 70.52  ? 961  SER B C     1 
ATOM   6315 O  O     . SER A 1 898 ? -29.572 -5.859  24.983  1.00 71.50  ? 961  SER B O     1 
ATOM   6316 C  CB    . SER A 1 898 ? -32.001 -4.787  24.265  1.00 70.26  ? 961  SER B CB    1 
ATOM   6317 O  OG    . SER A 1 898 ? -31.316 -3.568  24.116  1.00 72.20  ? 961  SER B OG    1 
ATOM   6318 N  N     . PHE A 1 899 ? -29.786 -4.573  26.765  1.00 66.92  ? 962  PHE B N     1 
ATOM   6319 C  CA    . PHE A 1 899 ? -28.395 -4.474  27.023  1.00 64.57  ? 962  PHE B CA    1 
ATOM   6320 C  C     . PHE A 1 899 ? -28.228 -5.222  28.287  1.00 67.94  ? 962  PHE B C     1 
ATOM   6321 O  O     . PHE A 1 899 ? -28.987 -5.071  29.219  1.00 67.49  ? 962  PHE B O     1 
ATOM   6322 C  CB    . PHE A 1 899 ? -27.994 -3.037  27.206  1.00 63.24  ? 962  PHE B CB    1 
ATOM   6323 C  CG    . PHE A 1 899 ? -28.228 -2.212  26.006  1.00 63.35  ? 962  PHE B CG    1 
ATOM   6324 C  CD1   . PHE A 1 899 ? -27.352 -2.226  24.976  1.00 64.88  ? 962  PHE B CD1   1 
ATOM   6325 C  CD2   . PHE A 1 899 ? -29.336 -1.453  25.902  1.00 64.22  ? 962  PHE B CD2   1 
ATOM   6326 C  CE1   . PHE A 1 899 ? -27.572 -1.488  23.860  1.00 59.56  ? 962  PHE B CE1   1 
ATOM   6327 C  CE2   . PHE A 1 899 ? -29.565 -0.717  24.793  1.00 61.06  ? 962  PHE B CE2   1 
ATOM   6328 C  CZ    . PHE A 1 899 ? -28.681 -0.735  23.770  1.00 56.78  ? 962  PHE B CZ    1 
ATOM   6329 N  N     . LYS A 1 900 ? -27.238 -6.077  28.307  1.00 66.49  ? 963  LYS B N     1 
ATOM   6330 C  CA    . LYS A 1 900 ? -27.014 -6.856  29.465  1.00 62.06  ? 963  LYS B CA    1 
ATOM   6331 C  C     . LYS A 1 900 ? -25.679 -6.539  30.029  1.00 65.74  ? 963  LYS B C     1 
ATOM   6332 O  O     . LYS A 1 900 ? -24.694 -6.555  29.353  1.00 57.13  ? 963  LYS B O     1 
ATOM   6333 C  CB    . LYS A 1 900 ? -27.163 -8.301  29.102  1.00 57.89  ? 963  LYS B CB    1 
ATOM   6334 C  CG    . LYS A 1 900 ? -28.509 -8.565  28.477  1.00 58.79  ? 963  LYS B CG    1 
ATOM   6335 C  CD    . LYS A 1 900 ? -28.803 -10.028 28.329  1.00 70.14  ? 963  LYS B CD    1 
ATOM   6336 C  CE    . LYS A 1 900 ? -30.282 -10.319 28.462  1.00 76.09  ? 963  LYS B CE    1 
ATOM   6337 N  NZ    . LYS A 1 900 ? -30.619 -11.092 29.685  1.00 75.44  ? 963  LYS B NZ    1 
ATOM   6338 N  N     . PRO A 1 901 ? -25.684 -6.189  31.298  1.00 67.24  ? 964  PRO B N     1 
ATOM   6339 C  CA    . PRO A 1 901 ? -24.654 -5.791  32.230  1.00 66.65  ? 964  PRO B CA    1 
ATOM   6340 C  C     . PRO A 1 901 ? -24.164 -6.941  33.081  1.00 69.99  ? 964  PRO B C     1 
ATOM   6341 O  O     . PRO A 1 901 ? -23.363 -6.777  33.965  1.00 71.91  ? 964  PRO B O     1 
ATOM   6342 C  CB    . PRO A 1 901 ? -25.409 -4.829  33.104  1.00 65.86  ? 964  PRO B CB    1 
ATOM   6343 C  CG    . PRO A 1 901 ? -26.733 -5.456  33.198  1.00 60.22  ? 964  PRO B CG    1 
ATOM   6344 C  CD    . PRO A 1 901 ? -27.006 -5.809  31.800  1.00 64.14  ? 964  PRO B CD    1 
ATOM   6345 N  N     . HIS A 1 902 ? -24.608 -8.136  32.777  1.00 64.49  ? 965  HIS B N     1 
ATOM   6346 C  CA    . HIS A 1 902 ? -24.277 -9.309  33.541  1.00 57.89  ? 965  HIS B CA    1 
ATOM   6347 C  C     . HIS A 1 902 ? -22.818 -9.657  33.607  1.00 62.56  ? 965  HIS B C     1 
ATOM   6348 O  O     . HIS A 1 902 ? -22.387 -10.286 34.534  1.00 65.64  ? 965  HIS B O     1 
ATOM   6349 C  CB    . HIS A 1 902 ? -25.121 -10.447 33.057  1.00 57.70  ? 965  HIS B CB    1 
ATOM   6350 C  CG    . HIS A 1 902 ? -26.578 -10.129 33.054  1.00 68.44  ? 965  HIS B CG    1 
ATOM   6351 N  ND1   . HIS A 1 902 ? -27.557 -11.088 33.073  1.00 78.47  ? 965  HIS B ND1   1 
ATOM   6352 C  CD2   . HIS A 1 902 ? -27.223 -8.951  33.067  1.00 67.43  ? 965  HIS B CD2   1 
ATOM   6353 C  CE1   . HIS A 1 902 ? -28.741 -10.520 33.084  1.00 69.67  ? 965  HIS B CE1   1 
ATOM   6354 N  NE2   . HIS A 1 902 ? -28.565 -9.220  33.079  1.00 67.72  ? 965  HIS B NE2   1 
ATOM   6355 N  N     . LEU A 1 903 ? -22.062 -9.345  32.586  1.00 58.05  ? 966  LEU B N     1 
ATOM   6356 C  CA    . LEU A 1 903 ? -20.663 -9.624  32.632  1.00 58.42  ? 966  LEU B CA    1 
ATOM   6357 C  C     . LEU A 1 903 ? -19.887 -8.366  32.789  1.00 62.02  ? 966  LEU B C     1 
ATOM   6358 O  O     . LEU A 1 903 ? -18.727 -8.350  32.522  1.00 57.66  ? 966  LEU B O     1 
ATOM   6359 C  CB    . LEU A 1 903 ? -20.225 -10.321 31.359  1.00 57.77  ? 966  LEU B CB    1 
ATOM   6360 N  N     . MET A 1 904 ? -20.516 -7.293  33.210  1.00 66.71  ? 967  MET B N     1 
ATOM   6361 C  CA    . MET A 1 904 ? -19.800 -6.038  33.314  1.00 60.13  ? 967  MET B CA    1 
ATOM   6362 C  C     . MET A 1 904 ? -18.649 -6.091  34.237  1.00 58.41  ? 967  MET B C     1 
ATOM   6363 O  O     . MET A 1 904 ? -17.625 -5.576  33.927  1.00 56.48  ? 967  MET B O     1 
ATOM   6364 C  CB    . MET A 1 904 ? -20.707 -4.969  33.874  1.00 61.64  ? 967  MET B CB    1 
ATOM   6365 C  CG    . MET A 1 904 ? -21.623 -4.312  32.890  1.00 66.69  ? 967  MET B CG    1 
ATOM   6366 S  SD    . MET A 1 904 ? -22.430 -2.950  33.667  1.00 66.84  ? 967  MET B SD    1 
ATOM   6367 C  CE    . MET A 1 904 ? -21.331 -1.685  33.080  1.00 56.79  ? 967  MET B CE    1 
ATOM   6368 N  N     . ASP A 1 905 ? -18.817 -6.700  35.392  1.00 60.25  ? 968  ASP B N     1 
ATOM   6369 C  CA    . ASP A 1 905 ? -17.725 -6.773  36.332  1.00 61.56  ? 968  ASP B CA    1 
ATOM   6370 C  C     . ASP A 1 905 ? -16.591 -7.577  35.792  1.00 60.64  ? 968  ASP B C     1 
ATOM   6371 O  O     . ASP A 1 905 ? -15.476 -7.139  35.782  1.00 58.48  ? 968  ASP B O     1 
ATOM   6372 C  CB    . ASP A 1 905 ? -18.187 -7.399  37.656  1.00 68.96  ? 968  ASP B CB    1 
ATOM   6373 C  CG    . ASP A 1 905 ? -19.214 -8.489  37.452  1.00 72.15  ? 968  ASP B CG    1 
ATOM   6374 O  OD1   . ASP A 1 905 ? -19.940 -8.366  36.481  1.00 69.04  ? 968  ASP B OD1   1 
ATOM   6375 O  OD2   . ASP A 1 905 ? -19.293 -9.467  38.205  1.00 67.96  ? 968  ASP B OD2   1 
ATOM   6376 N  N     . VAL A 1 906 ? -16.916 -8.704  35.197  1.00 59.25  ? 969  VAL B N     1 
ATOM   6377 C  CA    . VAL A 1 906 ? -15.961 -9.649  34.746  1.00 52.95  ? 969  VAL B CA    1 
ATOM   6378 C  C     . VAL A 1 906 ? -15.071 -9.087  33.733  1.00 52.72  ? 969  VAL B C     1 
ATOM   6379 O  O     . VAL A 1 906 ? -13.897 -9.262  33.783  1.00 52.06  ? 969  VAL B O     1 
ATOM   6380 C  CB    . VAL A 1 906 ? -16.723 -10.789 34.141  1.00 57.79  ? 969  VAL B CB    1 
ATOM   6381 C  CG1   . VAL A 1 906 ? -15.801 -11.799 33.527  1.00 55.31  ? 969  VAL B CG1   1 
ATOM   6382 C  CG2   . VAL A 1 906 ? -17.563 -11.419 35.196  1.00 59.66  ? 969  VAL B CG2   1 
ATOM   6383 N  N     . VAL A 1 907 ? -15.626 -8.360  32.805  1.00 58.06  ? 970  VAL B N     1 
ATOM   6384 C  CA    . VAL A 1 907 ? -14.814 -7.766  31.796  1.00 58.21  ? 970  VAL B CA    1 
ATOM   6385 C  C     . VAL A 1 907 ? -13.869 -6.769  32.383  1.00 59.81  ? 970  VAL B C     1 
ATOM   6386 O  O     . VAL A 1 907 ? -12.731 -6.721  31.999  1.00 61.60  ? 970  VAL B O     1 
ATOM   6387 C  CB    . VAL A 1 907 ? -15.663 -7.087  30.753  1.00 53.46  ? 970  VAL B CB    1 
ATOM   6388 C  CG1   . VAL A 1 907 ? -14.783 -6.534  29.675  1.00 51.12  ? 970  VAL B CG1   1 
ATOM   6389 C  CG2   . VAL A 1 907 ? -16.590 -8.075  30.147  1.00 47.01  ? 970  VAL B CG2   1 
ATOM   6390 N  N     . TYR A 1 908 ? -14.324 -5.970  33.337  1.00 60.86  ? 971  TYR B N     1 
ATOM   6391 C  CA    . TYR A 1 908 ? -13.454 -4.993  33.941  1.00 63.33  ? 971  TYR B CA    1 
ATOM   6392 C  C     . TYR A 1 908 ? -12.319 -5.663  34.629  1.00 63.34  ? 971  TYR B C     1 
ATOM   6393 O  O     . TYR A 1 908 ? -11.184 -5.342  34.402  1.00 62.27  ? 971  TYR B O     1 
ATOM   6394 C  CB    . TYR A 1 908 ? -14.208 -4.207  34.984  1.00 63.18  ? 971  TYR B CB    1 
ATOM   6395 N  N     . THR A 1 909 ? -12.624 -6.706  35.370  1.00 54.92  ? 972  THR B N     1 
ATOM   6396 C  CA    . THR A 1 909 ? -11.656 -7.435  36.106  1.00 50.59  ? 972  THR B CA    1 
ATOM   6397 C  C     . THR A 1 909 ? -10.647 -8.013  35.168  1.00 62.71  ? 972  THR B C     1 
ATOM   6398 O  O     . THR A 1 909 ? -9.491  -7.910  35.411  1.00 65.16  ? 972  THR B O     1 
ATOM   6399 C  CB    . THR A 1 909 ? -12.375 -8.528  36.842  1.00 58.03  ? 972  THR B CB    1 
ATOM   6400 O  OG1   . THR A 1 909 ? -13.472 -7.952  37.533  1.00 64.92  ? 972  THR B OG1   1 
ATOM   6401 C  CG2   . THR A 1 909 ? -11.508 -9.123  37.829  1.00 59.77  ? 972  THR B CG2   1 
ATOM   6402 N  N     . TRP A 1 910 ? -11.056 -8.564  34.036  1.00 66.65  ? 973  TRP B N     1 
ATOM   6403 C  CA    . TRP A 1 910 ? -10.128 -9.079  33.049  1.00 64.39  ? 973  TRP B CA    1 
ATOM   6404 C  C     . TRP A 1 910 ? -9.286  -7.944  32.515  1.00 64.51  ? 973  TRP B C     1 
ATOM   6405 O  O     . TRP A 1 910 ? -8.105  -8.068  32.360  1.00 62.08  ? 973  TRP B O     1 
ATOM   6406 C  CB    . TRP A 1 910 ? -10.899 -9.743  31.887  1.00 59.96  ? 973  TRP B CB    1 
ATOM   6407 C  CG    . TRP A 1 910 ? -10.074 -10.161 30.703  1.00 55.11  ? 973  TRP B CG    1 
ATOM   6408 C  CD1   . TRP A 1 910 ? -9.937  -9.517  29.546  1.00 52.47  ? 973  TRP B CD1   1 
ATOM   6409 C  CD2   . TRP A 1 910 ? -9.289  -11.318 30.599  1.00 53.21  ? 973  TRP B CD2   1 
ATOM   6410 N  NE1   . TRP A 1 910 ? -9.118  -10.188 28.723  1.00 48.94  ? 973  TRP B NE1   1 
ATOM   6411 C  CE2   . TRP A 1 910 ? -8.714  -11.316 29.360  1.00 51.24  ? 973  TRP B CE2   1 
ATOM   6412 C  CE3   . TRP A 1 910 ? -9.009  -12.359 31.451  1.00 53.13  ? 973  TRP B CE3   1 
ATOM   6413 C  CZ2   . TRP A 1 910 ? -7.867  -12.295 28.960  1.00 51.19  ? 973  TRP B CZ2   1 
ATOM   6414 C  CZ3   . TRP A 1 910 ? -8.187  -13.322 31.044  1.00 51.24  ? 973  TRP B CZ3   1 
ATOM   6415 C  CH2   . TRP A 1 910 ? -7.620  -13.294 29.825  1.00 52.33  ? 973  TRP B CH2   1 
ATOM   6416 N  N     . ALA A 1 911 ? -9.896  -6.808  32.281  1.00 64.22  ? 974  ALA B N     1 
ATOM   6417 C  CA    . ALA A 1 911 ? -9.202  -5.701  31.705  1.00 69.84  ? 974  ALA B CA    1 
ATOM   6418 C  C     . ALA A 1 911 ? -8.016  -5.196  32.505  1.00 74.20  ? 974  ALA B C     1 
ATOM   6419 O  O     . ALA A 1 911 ? -7.014  -4.812  31.938  1.00 72.30  ? 974  ALA B O     1 
ATOM   6420 C  CB    . ALA A 1 911 ? -10.187 -4.585  31.445  1.00 66.46  ? 974  ALA B CB    1 
ATOM   6421 N  N     . THR A 1 912 ? -8.147  -5.219  33.816  1.00 73.33  ? 975  THR B N     1 
ATOM   6422 C  CA    . THR A 1 912 ? -7.148  -4.730  34.740  1.00 74.12  ? 975  THR B CA    1 
ATOM   6423 C  C     . THR A 1 912 ? -5.917  -5.607  34.910  1.00 76.90  ? 975  THR B C     1 
ATOM   6424 O  O     . THR A 1 912 ? -4.955  -5.224  35.548  1.00 77.77  ? 975  THR B O     1 
ATOM   6425 C  CB    . THR A 1 912 ? -7.792  -4.518  36.092  1.00 71.62  ? 975  THR B CB    1 
ATOM   6426 O  OG1   . THR A 1 912 ? -7.942  -5.770  36.752  1.00 73.72  ? 975  THR B OG1   1 
ATOM   6427 C  CG2   . THR A 1 912 ? -9.144  -3.945  35.894  1.00 69.94  ? 975  THR B CG2   1 
ATOM   6428 N  N     . GLY A 1 913 ? -5.939  -6.795  34.345  1.00 73.29  ? 976  GLY B N     1 
ATOM   6429 C  CA    . GLY A 1 913 ? -4.812  -7.678  34.488  1.00 68.11  ? 976  GLY B CA    1 
ATOM   6430 C  C     . GLY A 1 913 ? -5.101  -9.001  35.140  1.00 70.00  ? 976  GLY B C     1 
ATOM   6431 O  O     . GLY A 1 913 ? -4.194  -9.780  35.325  1.00 75.07  ? 976  GLY B O     1 
ATOM   6432 N  N     . ALA A 1 914 ? -6.345  -9.290  35.468  1.00 64.32  ? 977  ALA B N     1 
ATOM   6433 C  CA    . ALA A 1 914 ? -6.654  -10.569 36.055  1.00 58.17  ? 977  ALA B CA    1 
ATOM   6434 C  C     . ALA A 1 914 ? -6.462  -11.736 35.095  1.00 57.76  ? 977  ALA B C     1 
ATOM   6435 O  O     . ALA A 1 914 ? -6.503  -11.596 33.884  1.00 56.69  ? 977  ALA B O     1 
ATOM   6436 C  CB    . ALA A 1 914 ? -8.049  -10.566 36.624  1.00 52.11  ? 977  ALA B CB    1 
ATOM   6437 N  N     . THR A 1 915 ? -6.148  -12.884 35.654  1.00 58.57  ? 978  THR B N     1 
ATOM   6438 C  CA    . THR A 1 915 ? -5.964  -14.070 34.863  1.00 56.33  ? 978  THR B CA    1 
ATOM   6439 C  C     . THR A 1 915 ? -7.297  -14.625 34.515  1.00 62.50  ? 978  THR B C     1 
ATOM   6440 O  O     . THR A 1 915 ? -8.252  -14.407 35.229  1.00 60.24  ? 978  THR B O     1 
ATOM   6441 C  CB    . THR A 1 915 ? -5.194  -15.143 35.599  1.00 59.61  ? 978  THR B CB    1 
ATOM   6442 O  OG1   . THR A 1 915 ? -5.630  -15.200 36.945  1.00 60.24  ? 978  THR B OG1   1 
ATOM   6443 C  CG2   . THR A 1 915 ? -3.797  -14.819 35.584  1.00 62.62  ? 978  THR B CG2   1 
ATOM   6444 N  N     . PHE A 1 916 ? -7.363  -15.436 33.472  1.00 54.66  ? 979  PHE B N     1 
ATOM   6445 C  CA    . PHE A 1 916 ? -8.625  -15.970 33.040  1.00 48.61  ? 979  PHE B CA    1 
ATOM   6446 C  C     . PHE A 1 916 ? -9.308  -16.831 34.026  1.00 55.79  ? 979  PHE B C     1 
ATOM   6447 O  O     . PHE A 1 916 ? -10.496 -16.806 34.171  1.00 58.16  ? 979  PHE B O     1 
ATOM   6448 C  CB    . PHE A 1 916 ? -8.547  -16.718 31.750  1.00 54.05  ? 979  PHE B CB    1 
ATOM   6449 C  CG    . PHE A 1 916 ? -9.880  -16.951 31.170  1.00 56.62  ? 979  PHE B CG    1 
ATOM   6450 C  CD1   . PHE A 1 916 ? -10.470 -16.000 30.437  1.00 52.76  ? 979  PHE B CD1   1 
ATOM   6451 C  CD2   . PHE A 1 916 ? -10.565 -18.080 31.431  1.00 56.98  ? 979  PHE B CD2   1 
ATOM   6452 C  CE1   . PHE A 1 916 ? -11.704 -16.184 29.935  1.00 50.18  ? 979  PHE B CE1   1 
ATOM   6453 C  CE2   . PHE A 1 916 ? -11.794 -18.281 30.912  1.00 54.71  ? 979  PHE B CE2   1 
ATOM   6454 C  CZ    . PHE A 1 916 ? -12.375 -17.328 30.173  1.00 53.98  ? 979  PHE B CZ    1 
ATOM   6455 N  N     . ALA A 1 917 ? -8.536  -17.593 34.755  1.00 55.76  ? 980  ALA B N     1 
ATOM   6456 C  CA    . ALA A 1 917 ? -9.059  -18.480 35.731  1.00 50.01  ? 980  ALA B CA    1 
ATOM   6457 C  C     . ALA A 1 917 ? -9.832  -17.733 36.770  1.00 60.12  ? 980  ALA B C     1 
ATOM   6458 O  O     . ALA A 1 917 ? -10.906 -18.130 37.129  1.00 54.57  ? 980  ALA B O     1 
ATOM   6459 C  CB    . ALA A 1 917 ? -7.885  -19.150 36.380  1.00 46.26  ? 980  ALA B CB    1 
ATOM   6460 N  N     . HIS A 1 918 ? -9.302  -16.616 37.226  1.00 59.15  ? 981  HIS B N     1 
ATOM   6461 C  CA    . HIS A 1 918 ? -9.956  -15.846 38.216  1.00 61.14  ? 981  HIS B CA    1 
ATOM   6462 C  C     . HIS A 1 918 ? -11.308 -15.367 37.771  1.00 60.18  ? 981  HIS B C     1 
ATOM   6463 O  O     . HIS A 1 918 ? -12.281 -15.609 38.438  1.00 53.50  ? 981  HIS B O     1 
ATOM   6464 C  CB    . HIS A 1 918 ? -9.093  -14.622 38.464  1.00 61.07  ? 981  HIS B CB    1 
ATOM   6465 N  N     . ILE A 1 919 ? -11.419 -14.836 36.572  1.00 52.48  ? 982  ILE B N     1 
ATOM   6466 C  CA    . ILE A 1 919 ? -12.693 -14.287 36.136  1.00 54.80  ? 982  ILE B CA    1 
ATOM   6467 C  C     . ILE A 1 919 ? -13.833 -15.242 36.009  1.00 57.34  ? 982  ILE B C     1 
ATOM   6468 O  O     . ILE A 1 919 ? -14.932 -14.857 36.170  1.00 53.63  ? 982  ILE B O     1 
ATOM   6469 C  CB    . ILE A 1 919 ? -12.564 -13.421 34.911  1.00 58.44  ? 982  ILE B CB    1 
ATOM   6470 C  CG1   . ILE A 1 919 ? -12.839 -14.202 33.639  1.00 55.85  ? 982  ILE B CG1   1 
ATOM   6471 C  CG2   . ILE A 1 919 ? -11.192 -12.814 34.893  1.00 57.71  ? 982  ILE B CG2   1 
ATOM   6472 C  CD1   . ILE A 1 919 ? -12.191 -13.608 32.416  1.00 54.91  ? 982  ILE B CD1   1 
ATOM   6473 N  N     . CYS A 1 920 ? -13.566 -16.513 35.771  1.00 57.92  ? 983  CYS B N     1 
ATOM   6474 C  CA    . CYS A 1 920 ? -14.560 -17.554 35.643  1.00 54.39  ? 983  CYS B CA    1 
ATOM   6475 C  C     . CYS A 1 920 ? -15.350 -17.817 36.869  1.00 57.93  ? 983  CYS B C     1 
ATOM   6476 O  O     . CYS A 1 920 ? -16.414 -18.351 36.778  1.00 61.33  ? 983  CYS B O     1 
ATOM   6477 C  CB    . CYS A 1 920 ? -13.901 -18.846 35.267  1.00 58.11  ? 983  CYS B CB    1 
ATOM   6478 S  SG    . CYS A 1 920 ? -13.895 -19.134 33.529  1.00 59.87  ? 983  CYS B SG    1 
ATOM   6479 N  N     . LYS A 1 921 ? -14.752 -17.573 38.020  1.00 66.48  ? 984  LYS B N     1 
ATOM   6480 C  CA    . LYS A 1 921 ? -15.321 -17.753 39.333  1.00 59.68  ? 984  LYS B CA    1 
ATOM   6481 C  C     . LYS A 1 921 ? -16.517 -16.882 39.581  1.00 51.75  ? 984  LYS B C     1 
ATOM   6482 O  O     . LYS A 1 921 ? -17.482 -17.252 40.206  1.00 39.40  ? 984  LYS B O     1 
ATOM   6483 C  CB    . LYS A 1 921 ? -14.245 -17.364 40.325  1.00 43.62  ? 984  LYS B CB    1 
ATOM   6484 N  N     . MET A 1 922 ? -16.410 -15.688 39.074  1.00 51.38  ? 985  MET B N     1 
ATOM   6485 C  CA    . MET A 1 922 ? -17.393 -14.679 39.256  1.00 49.12  ? 985  MET B CA    1 
ATOM   6486 C  C     . MET A 1 922 ? -18.764 -14.915 38.726  1.00 52.40  ? 985  MET B C     1 
ATOM   6487 O  O     . MET A 1 922 ? -19.735 -14.586 39.369  1.00 48.93  ? 985  MET B O     1 
ATOM   6488 C  CB    . MET A 1 922 ? -16.878 -13.437 38.579  1.00 47.53  ? 985  MET B CB    1 
ATOM   6489 C  CG    . MET A 1 922 ? -15.572 -12.933 39.104  1.00 49.35  ? 985  MET B CG    1 
ATOM   6490 S  SD    . MET A 1 922 ? -15.507 -11.265 38.589  1.00 51.04  ? 985  MET B SD    1 
ATOM   6491 C  CE    . MET A 1 922 ? -13.798 -11.071 38.272  1.00 52.61  ? 985  MET B CE    1 
ATOM   6492 N  N     . THR A 1 923 ? -18.849 -15.491 37.547  1.00 57.99  ? 986  THR B N     1 
ATOM   6493 C  CA    . THR A 1 923 ? -20.127 -15.644 36.897  1.00 58.32  ? 986  THR B CA    1 
ATOM   6494 C  C     . THR A 1 923 ? -20.480 -17.045 36.530  1.00 55.17  ? 986  THR B C     1 
ATOM   6495 O  O     . THR A 1 923 ? -19.646 -17.872 36.444  1.00 57.74  ? 986  THR B O     1 
ATOM   6496 C  CB    . THR A 1 923 ? -20.150 -14.768 35.667  1.00 55.52  ? 986  THR B CB    1 
ATOM   6497 O  OG1   . THR A 1 923 ? -21.486 -14.598 35.223  1.00 58.75  ? 986  THR B OG1   1 
ATOM   6498 C  CG2   . THR A 1 923 ? -19.357 -15.368 34.643  1.00 54.62  ? 986  THR B CG2   1 
ATOM   6499 N  N     . ASP A 1 924 ? -21.756 -17.321 36.390  1.00 57.08  ? 987  ASP B N     1 
ATOM   6500 C  CA    . ASP A 1 924 ? -22.187 -18.649 36.059  1.00 61.79  ? 987  ASP B CA    1 
ATOM   6501 C  C     . ASP A 1 924 ? -22.257 -18.958 34.596  1.00 57.26  ? 987  ASP B C     1 
ATOM   6502 O  O     . ASP A 1 924 ? -22.513 -20.062 34.250  1.00 55.99  ? 987  ASP B O     1 
ATOM   6503 C  CB    . ASP A 1 924 ? -23.543 -18.941 36.671  1.00 68.71  ? 987  ASP B CB    1 
ATOM   6504 C  CG    . ASP A 1 924 ? -24.548 -17.878 36.373  1.00 73.18  ? 987  ASP B CG    1 
ATOM   6505 O  OD1   . ASP A 1 924 ? -24.201 -16.720 36.473  1.00 68.05  ? 987  ASP B OD1   1 
ATOM   6506 O  OD2   . ASP A 1 924 ? -25.696 -18.188 36.051  1.00 73.01  ? 987  ASP B OD2   1 
ATOM   6507 N  N     . VAL A 1 925 ? -22.058 -17.993 33.731  1.00 55.82  ? 988  VAL B N     1 
ATOM   6508 C  CA    . VAL A 1 925 ? -22.129 -18.295 32.328  1.00 58.01  ? 988  VAL B CA    1 
ATOM   6509 C  C     . VAL A 1 925 ? -20.900 -19.075 31.992  1.00 58.13  ? 988  VAL B C     1 
ATOM   6510 O  O     . VAL A 1 925 ? -19.868 -18.733 32.461  1.00 60.13  ? 988  VAL B O     1 
ATOM   6511 C  CB    . VAL A 1 925 ? -22.210 -17.040 31.475  1.00 55.46  ? 988  VAL B CB    1 
ATOM   6512 C  CG1   . VAL A 1 925 ? -22.732 -15.898 32.280  1.00 56.49  ? 988  VAL B CG1   1 
ATOM   6513 C  CG2   . VAL A 1 925 ? -20.876 -16.661 30.933  1.00 48.45  ? 988  VAL B CG2   1 
ATOM   6514 N  N     . PHE A 1 926 ? -20.970 -20.022 31.071  1.00 52.85  ? 989  PHE B N     1 
ATOM   6515 C  CA    . PHE A 1 926 ? -19.838 -20.872 30.739  1.00 46.88  ? 989  PHE B CA    1 
ATOM   6516 C  C     . PHE A 1 926 ? -18.681 -20.185 30.119  1.00 48.44  ? 989  PHE B C     1 
ATOM   6517 O  O     . PHE A 1 926 ? -18.774 -19.132 29.581  1.00 50.04  ? 989  PHE B O     1 
ATOM   6518 C  CB    . PHE A 1 926 ? -20.222 -21.976 29.808  1.00 53.75  ? 989  PHE B CB    1 
ATOM   6519 C  CG    . PHE A 1 926 ? -21.167 -22.938 30.386  1.00 51.08  ? 989  PHE B CG    1 
ATOM   6520 C  CD1   . PHE A 1 926 ? -21.668 -22.749 31.615  1.00 53.14  ? 989  PHE B CD1   1 
ATOM   6521 C  CD2   . PHE A 1 926 ? -21.585 -23.995 29.670  1.00 48.62  ? 989  PHE B CD2   1 
ATOM   6522 C  CE1   . PHE A 1 926 ? -22.560 -23.629 32.142  1.00 52.48  ? 989  PHE B CE1   1 
ATOM   6523 C  CE2   . PHE A 1 926 ? -22.474 -24.878 30.181  1.00 51.92  ? 989  PHE B CE2   1 
ATOM   6524 C  CZ    . PHE A 1 926 ? -22.970 -24.698 31.420  1.00 47.59  ? 989  PHE B CZ    1 
ATOM   6525 N  N     . GLU A 1 927 ? -17.569 -20.864 30.162  1.00 46.91  ? 990  GLU B N     1 
ATOM   6526 C  CA    . GLU A 1 927 ? -16.340 -20.316 29.712  1.00 40.23  ? 990  GLU B CA    1 
ATOM   6527 C  C     . GLU A 1 927 ? -16.354 -19.887 28.310  1.00 47.94  ? 990  GLU B C     1 
ATOM   6528 O  O     . GLU A 1 927 ? -15.909 -18.839 28.023  1.00 50.05  ? 990  GLU B O     1 
ATOM   6529 C  CB    . GLU A 1 927 ? -15.261 -21.354 29.907  1.00 38.87  ? 990  GLU B CB    1 
ATOM   6530 C  CG    . GLU A 1 927 ? -15.579 -22.783 29.468  1.00 48.72  ? 990  GLU B CG    1 
ATOM   6531 C  CD    . GLU A 1 927 ? -16.268 -23.634 30.495  1.00 48.85  ? 990  GLU B CD    1 
ATOM   6532 O  OE1   . GLU A 1 927 ? -16.656 -23.123 31.510  1.00 49.85  ? 990  GLU B OE1   1 
ATOM   6533 O  OE2   . GLU A 1 927 ? -16.436 -24.819 30.305  1.00 48.19  ? 990  GLU B OE2   1 
ATOM   6534 N  N     . GLY A 1 928 ? -16.927 -20.660 27.425  1.00 51.78  ? 991  GLY B N     1 
ATOM   6535 C  CA    . GLY A 1 928 ? -16.969 -20.304 26.025  1.00 51.83  ? 991  GLY B CA    1 
ATOM   6536 C  C     . GLY A 1 928 ? -17.764 -19.080 25.727  1.00 51.05  ? 991  GLY B C     1 
ATOM   6537 O  O     . GLY A 1 928 ? -17.480 -18.334 24.829  1.00 48.91  ? 991  GLY B O     1 
ATOM   6538 N  N     . SER A 1 929 ? -18.849 -18.953 26.463  1.00 52.02  ? 992  SER B N     1 
ATOM   6539 C  CA    . SER A 1 929 ? -19.744 -17.843 26.391  1.00 52.55  ? 992  SER B CA    1 
ATOM   6540 C  C     . SER A 1 929 ? -19.049 -16.635 26.850  1.00 54.61  ? 992  SER B C     1 
ATOM   6541 O  O     . SER A 1 929 ? -19.241 -15.584 26.320  1.00 56.94  ? 992  SER B O     1 
ATOM   6542 C  CB    . SER A 1 929 ? -20.937 -18.111 27.257  1.00 55.07  ? 992  SER B CB    1 
ATOM   6543 O  OG    . SER A 1 929 ? -21.716 -19.139 26.674  1.00 68.43  ? 992  SER B OG    1 
ATOM   6544 N  N     . ILE A 1 930 ? -18.268 -16.758 27.899  1.00 56.11  ? 993  ILE B N     1 
ATOM   6545 C  CA    . ILE A 1 930 ? -17.514 -15.637 28.343  1.00 52.91  ? 993  ILE B CA    1 
ATOM   6546 C  C     . ILE A 1 930 ? -16.529 -15.242 27.304  1.00 53.09  ? 993  ILE B C     1 
ATOM   6547 O  O     . ILE A 1 930 ? -16.439 -14.121 26.941  1.00 58.50  ? 993  ILE B O     1 
ATOM   6548 C  CB    . ILE A 1 930 ? -16.679 -16.006 29.528  1.00 52.98  ? 993  ILE B CB    1 
ATOM   6549 C  CG1   . ILE A 1 930 ? -17.519 -16.212 30.753  1.00 55.32  ? 993  ILE B CG1   1 
ATOM   6550 C  CG2   . ILE A 1 930 ? -15.787 -14.858 29.862  1.00 54.45  ? 993  ILE B CG2   1 
ATOM   6551 C  CD1   . ILE A 1 930 ? -16.705 -16.169 32.017  1.00 49.62  ? 993  ILE B CD1   1 
ATOM   6552 N  N     . ILE A 1 931 ? -15.833 -16.192 26.749  1.00 47.08  ? 994  ILE B N     1 
ATOM   6553 C  CA    . ILE A 1 931 ? -14.817 -15.897 25.762  1.00 52.12  ? 994  ILE B CA    1 
ATOM   6554 C  C     . ILE A 1 931 ? -15.349 -15.278 24.489  1.00 57.47  ? 994  ILE B C     1 
ATOM   6555 O  O     . ILE A 1 931 ? -14.753 -14.427 23.854  1.00 49.28  ? 994  ILE B O     1 
ATOM   6556 C  CB    . ILE A 1 931 ? -14.010 -17.143 25.490  1.00 52.00  ? 994  ILE B CB    1 
ATOM   6557 C  CG1   . ILE A 1 931 ? -13.280 -17.496 26.746  1.00 50.78  ? 994  ILE B CG1   1 
ATOM   6558 C  CG2   . ILE A 1 931 ? -13.027 -16.931 24.381  1.00 48.27  ? 994  ILE B CG2   1 
ATOM   6559 C  CD1   . ILE A 1 931 ? -11.951 -18.087 26.486  1.00 56.60  ? 994  ILE B CD1   1 
ATOM   6560 N  N     . ARG A 1 932 ? -16.513 -15.735 24.105  1.00 58.29  ? 995  ARG B N     1 
ATOM   6561 C  CA    . ARG A 1 932 ? -17.157 -15.255 22.928  1.00 56.36  ? 995  ARG B CA    1 
ATOM   6562 C  C     . ARG A 1 932 ? -17.466 -13.823 23.044  1.00 50.84  ? 995  ARG B C     1 
ATOM   6563 O  O     . ARG A 1 932 ? -17.231 -13.082 22.153  1.00 49.80  ? 995  ARG B O     1 
ATOM   6564 C  CB    . ARG A 1 932 ? -18.433 -16.015 22.765  1.00 55.22  ? 995  ARG B CB    1 
ATOM   6565 C  CG    . ARG A 1 932 ? -19.300 -15.529 21.664  1.00 52.39  ? 995  ARG B CG    1 
ATOM   6566 C  CD    . ARG A 1 932 ? -20.422 -16.493 21.483  1.00 52.93  ? 995  ARG B CD    1 
ATOM   6567 N  NE    . ARG A 1 932 ? -19.971 -17.629 20.737  1.00 63.75  ? 995  ARG B NE    1 
ATOM   6568 C  CZ    . ARG A 1 932 ? -19.976 -18.870 21.179  1.00 67.89  ? 995  ARG B CZ    1 
ATOM   6569 N  NH1   . ARG A 1 932 ? -20.424 -19.156 22.377  1.00 61.93  ? 995  ARG B NH1   1 
ATOM   6570 N  NH2   . ARG A 1 932 ? -19.540 -19.836 20.400  1.00 63.28  ? 995  ARG B NH2   1 
ATOM   6571 N  N     . CYS A 1 933 ? -17.968 -13.419 24.181  1.00 56.65  ? 996  CYS B N     1 
ATOM   6572 C  CA    . CYS A 1 933 ? -18.306 -12.042 24.412  1.00 58.49  ? 996  CYS B CA    1 
ATOM   6573 C  C     . CYS A 1 933 ? -17.120 -11.146 24.372  1.00 53.09  ? 996  CYS B C     1 
ATOM   6574 O  O     . CYS A 1 933 ? -17.206 -10.043 23.971  1.00 50.97  ? 996  CYS B O     1 
ATOM   6575 C  CB    . CYS A 1 933 ? -19.000 -11.894 25.718  1.00 53.87  ? 996  CYS B CB    1 
ATOM   6576 S  SG    . CYS A 1 933 ? -18.923 -10.211 26.159  1.00 60.64  ? 996  CYS B SG    1 
ATOM   6577 N  N     . MET A 1 934 ? -16.014 -11.589 24.892  1.00 53.20  ? 997  MET B N     1 
ATOM   6578 C  CA    . MET A 1 934 ? -14.822 -10.815 24.821  1.00 52.79  ? 997  MET B CA    1 
ATOM   6579 C  C     . MET A 1 934 ? -14.318 -10.655 23.406  1.00 58.49  ? 997  MET B C     1 
ATOM   6580 O  O     . MET A 1 934 ? -13.748 -9.654  23.050  1.00 55.37  ? 997  MET B O     1 
ATOM   6581 C  CB    . MET A 1 934 ? -13.769 -11.456 25.661  1.00 52.75  ? 997  MET B CB    1 
ATOM   6582 C  CG    . MET A 1 934 ? -14.090 -11.447 27.131  1.00 65.26  ? 997  MET B CG    1 
ATOM   6583 S  SD    . MET A 1 934 ? -13.294 -10.093 27.933  1.00 50.64  ? 997  MET B SD    1 
ATOM   6584 C  CE    . MET A 1 934 ? -12.165 -9.625  26.682  1.00 52.04  ? 997  MET B CE    1 
ATOM   6585 N  N     . ARG A 1 935 ? -14.460 -11.694 22.598  1.00 59.60  ? 998  ARG B N     1 
ATOM   6586 C  CA    . ARG A 1 935 ? -13.977 -11.656 21.233  1.00 48.91  ? 998  ARG B CA    1 
ATOM   6587 C  C     . ARG A 1 935 ? -14.679 -10.653 20.423  1.00 48.89  ? 998  ARG B C     1 
ATOM   6588 O  O     . ARG A 1 935 ? -14.110 -10.092 19.565  1.00 53.16  ? 998  ARG B O     1 
ATOM   6589 C  CB    . ARG A 1 935 ? -14.006 -13.020 20.598  1.00 49.50  ? 998  ARG B CB    1 
ATOM   6590 N  N     . ARG A 1 936 ? -15.973 -10.537 20.631  1.00 53.29  ? 999  ARG B N     1 
ATOM   6591 C  CA    . ARG A 1 936 ? -16.832 -9.527  20.052  1.00 53.70  ? 999  ARG B CA    1 
ATOM   6592 C  C     . ARG A 1 936 ? -16.472 -8.184  20.640  1.00 59.95  ? 999  ARG B C     1 
ATOM   6593 O  O     . ARG A 1 936 ? -16.647 -7.184  20.023  1.00 59.34  ? 999  ARG B O     1 
ATOM   6594 C  CB    . ARG A 1 936 ? -18.289 -9.831  20.314  1.00 50.58  ? 999  ARG B CB    1 
ATOM   6595 C  CG    . ARG A 1 936 ? -18.859 -10.934 19.471  1.00 49.89  ? 999  ARG B CG    1 
ATOM   6596 C  CD    . ARG A 1 936 ? -19.598 -10.431 18.254  1.00 62.49  ? 999  ARG B CD    1 
ATOM   6597 N  NE    . ARG A 1 936 ? -19.309 -11.266 17.084  1.00 76.69  ? 999  ARG B NE    1 
ATOM   6598 C  CZ    . ARG A 1 936 ? -20.151 -11.527 16.081  1.00 83.55  ? 999  ARG B CZ    1 
ATOM   6599 N  NH1   . ARG A 1 936 ? -21.376 -11.036 16.073  1.00 82.88  ? 999  ARG B NH1   1 
ATOM   6600 N  NH2   . ARG A 1 936 ? -19.770 -12.297 15.080  1.00 73.21  ? 999  ARG B NH2   1 
ATOM   6601 N  N     . LEU A 1 937 ? -16.006 -8.189  21.868  1.00 61.37  ? 1000 LEU B N     1 
ATOM   6602 C  CA    . LEU A 1 937 ? -15.603 -6.972  22.514  1.00 57.55  ? 1000 LEU B CA    1 
ATOM   6603 C  C     . LEU A 1 937 ? -14.430 -6.328  21.826  1.00 56.87  ? 1000 LEU B C     1 
ATOM   6604 O  O     . LEU A 1 937 ? -14.387 -5.146  21.665  1.00 59.34  ? 1000 LEU B O     1 
ATOM   6605 C  CB    . LEU A 1 937 ? -15.334 -7.209  23.968  1.00 55.70  ? 1000 LEU B CB    1 
ATOM   6606 C  CG    . LEU A 1 937 ? -16.073 -6.100  24.647  1.00 60.55  ? 1000 LEU B CG    1 
ATOM   6607 C  CD1   . LEU A 1 937 ? -15.918 -6.098  26.126  1.00 55.34  ? 1000 LEU B CD1   1 
ATOM   6608 C  CD2   . LEU A 1 937 ? -15.618 -4.805  24.055  1.00 59.97  ? 1000 LEU B CD2   1 
ATOM   6609 N  N     . GLU A 1 938 ? -13.466 -7.112  21.395  1.00 54.07  ? 1001 GLU B N     1 
ATOM   6610 C  CA    . GLU A 1 938 ? -12.324 -6.620  20.641  1.00 57.77  ? 1001 GLU B CA    1 
ATOM   6611 C  C     . GLU A 1 938 ? -12.794 -6.143  19.302  1.00 57.55  ? 1001 GLU B C     1 
ATOM   6612 O  O     . GLU A 1 938 ? -12.289 -5.208  18.761  1.00 56.69  ? 1001 GLU B O     1 
ATOM   6613 C  CB    . GLU A 1 938 ? -11.278 -7.724  20.442  1.00 61.42  ? 1001 GLU B CB    1 
ATOM   6614 C  CG    . GLU A 1 938 ? -9.870  -7.299  20.057  1.00 48.04  ? 1001 GLU B CG    1 
ATOM   6615 C  CD    . GLU A 1 938 ? -9.595  -7.263  18.583  1.00 57.61  ? 1001 GLU B CD    1 
ATOM   6616 O  OE1   . GLU A 1 938 ? -8.558  -6.731  18.198  1.00 58.12  ? 1001 GLU B OE1   1 
ATOM   6617 O  OE2   . GLU A 1 938 ? -10.393 -7.753  17.801  1.00 64.22  ? 1001 GLU B OE2   1 
ATOM   6618 N  N     . GLU A 1 939 ? -13.738 -6.870  18.744  1.00 57.59  ? 1002 GLU B N     1 
ATOM   6619 C  CA    . GLU A 1 939 ? -14.329 -6.592  17.480  1.00 62.69  ? 1002 GLU B CA    1 
ATOM   6620 C  C     . GLU A 1 939 ? -14.995 -5.260  17.539  1.00 61.26  ? 1002 GLU B C     1 
ATOM   6621 O  O     . GLU A 1 939 ? -14.842 -4.478  16.662  1.00 55.05  ? 1002 GLU B O     1 
ATOM   6622 C  CB    . GLU A 1 939 ? -15.401 -7.640  17.317  1.00 66.71  ? 1002 GLU B CB    1 
ATOM   6623 C  CG    . GLU A 1 939 ? -15.993 -7.823  15.956  1.00 74.45  ? 1002 GLU B CG    1 
ATOM   6624 C  CD    . GLU A 1 939 ? -15.045 -8.502  15.032  1.00 87.74  ? 1002 GLU B CD    1 
ATOM   6625 O  OE1   . GLU A 1 939 ? -15.426 -9.522  14.427  1.00 93.00  ? 1002 GLU B OE1   1 
ATOM   6626 O  OE2   . GLU A 1 939 ? -13.918 -7.994  14.920  1.00 90.55  ? 1002 GLU B OE2   1 
ATOM   6627 N  N     . LEU A 1 940 ? -15.747 -5.021  18.593  1.00 58.80  ? 1003 LEU B N     1 
ATOM   6628 C  CA    . LEU A 1 940 ? -16.407 -3.771  18.800  1.00 53.83  ? 1003 LEU B CA    1 
ATOM   6629 C  C     . LEU A 1 940 ? -15.441 -2.662  19.035  1.00 56.86  ? 1003 LEU B C     1 
ATOM   6630 O  O     . LEU A 1 940 ? -15.607 -1.598  18.534  1.00 56.57  ? 1003 LEU B O     1 
ATOM   6631 C  CB    . LEU A 1 940 ? -17.346 -3.864  19.968  1.00 54.25  ? 1003 LEU B CB    1 
ATOM   6632 C  CG    . LEU A 1 940 ? -17.953 -2.527  20.296  1.00 50.29  ? 1003 LEU B CG    1 
ATOM   6633 C  CD1   . LEU A 1 940 ? -18.366 -1.897  19.007  1.00 55.12  ? 1003 LEU B CD1   1 
ATOM   6634 C  CD2   . LEU A 1 940 ? -19.134 -2.704  21.206  1.00 47.65  ? 1003 LEU B CD2   1 
ATOM   6635 N  N     . LEU A 1 941 ? -14.382 -2.903  19.783  1.00 57.93  ? 1004 LEU B N     1 
ATOM   6636 C  CA    . LEU A 1 941 ? -13.417 -1.859  20.041  1.00 52.25  ? 1004 LEU B CA    1 
ATOM   6637 C  C     . LEU A 1 941 ? -12.770 -1.402  18.790  1.00 56.84  ? 1004 LEU B C     1 
ATOM   6638 O  O     . LEU A 1 941 ? -12.485 -0.282  18.659  1.00 59.88  ? 1004 LEU B O     1 
ATOM   6639 C  CB    . LEU A 1 941 ? -12.368 -2.295  21.015  1.00 52.69  ? 1004 LEU B CB    1 
ATOM   6640 C  CG    . LEU A 1 941 ? -12.559 -1.977  22.463  1.00 55.27  ? 1004 LEU B CG    1 
ATOM   6641 C  CD1   . LEU A 1 941 ? -14.003 -2.131  22.725  1.00 58.03  ? 1004 LEU B CD1   1 
ATOM   6642 C  CD2   . LEU A 1 941 ? -11.899 -3.018  23.283  1.00 54.18  ? 1004 LEU B CD2   1 
ATOM   6643 N  N     . ARG A 1 942 ? -12.462 -2.286  17.879  1.00 57.64  ? 1005 ARG B N     1 
ATOM   6644 C  CA    . ARG A 1 942 ? -11.939 -1.904  16.608  1.00 57.58  ? 1005 ARG B CA    1 
ATOM   6645 C  C     . ARG A 1 942 ? -12.953 -1.114  15.842  1.00 56.78  ? 1005 ARG B C     1 
ATOM   6646 O  O     . ARG A 1 942 ? -12.579 -0.223  15.141  1.00 58.22  ? 1005 ARG B O     1 
ATOM   6647 C  CB    . ARG A 1 942 ? -11.545 -3.123  15.824  1.00 60.63  ? 1005 ARG B CB    1 
ATOM   6648 N  N     . GLN A 1 943 ? -14.241 -1.471  15.915  1.00 56.24  ? 1006 GLN B N     1 
ATOM   6649 C  CA    . GLN A 1 943 ? -15.299 -0.708  15.260  1.00 53.02  ? 1006 GLN B CA    1 
ATOM   6650 C  C     . GLN A 1 943 ? -15.304 0.648   15.952  1.00 57.91  ? 1006 GLN B C     1 
ATOM   6651 O  O     . GLN A 1 943 ? -15.382 1.648   15.315  1.00 64.54  ? 1006 GLN B O     1 
ATOM   6652 C  CB    . GLN A 1 943 ? -16.670 -1.409  15.312  1.00 52.62  ? 1006 GLN B CB    1 
ATOM   6653 C  CG    . GLN A 1 943 ? -16.831 -2.743  14.561  1.00 52.53  ? 1006 GLN B CG    1 
ATOM   6654 C  CD    . GLN A 1 943 ? -16.702 -2.686  13.018  1.00 63.03  ? 1006 GLN B CD    1 
ATOM   6655 O  OE1   . GLN A 1 943 ? -15.638 -3.017  12.445  1.00 65.15  ? 1006 GLN B OE1   1 
ATOM   6656 N  NE2   . GLN A 1 943 ? -17.786 -2.308  12.335  1.00 60.05  ? 1006 GLN B NE2   1 
ATOM   6657 N  N     . MET A 1 944 ? -15.199 0.698   17.263  1.00 54.15  ? 1007 MET B N     1 
ATOM   6658 C  CA    . MET A 1 944 ? -15.118 1.947   17.970  1.00 57.28  ? 1007 MET B CA    1 
ATOM   6659 C  C     . MET A 1 944 ? -13.841 2.758   17.721  1.00 63.68  ? 1007 MET B C     1 
ATOM   6660 O  O     . MET A 1 944 ? -13.846 3.962   17.646  1.00 66.71  ? 1007 MET B O     1 
ATOM   6661 C  CB    . MET A 1 944 ? -15.307 1.690   19.423  1.00 52.98  ? 1007 MET B CB    1 
ATOM   6662 C  CG    . MET A 1 944 ? -16.340 2.587   20.017  1.00 62.29  ? 1007 MET B CG    1 
ATOM   6663 S  SD    . MET A 1 944 ? -17.982 2.006   19.737  1.00 70.46  ? 1007 MET B SD    1 
ATOM   6664 C  CE    . MET A 1 944 ? -18.833 2.909   20.980  1.00 61.63  ? 1007 MET B CE    1 
ATOM   6665 N  N     . CYS A 1 945 ? -12.729 2.086   17.586  1.00 60.47  ? 1008 CYS B N     1 
ATOM   6666 C  CA    . CYS A 1 945 ? -11.479 2.756   17.367  1.00 57.65  ? 1008 CYS B CA    1 
ATOM   6667 C  C     . CYS A 1 945 ? -11.499 3.558   16.108  1.00 60.92  ? 1008 CYS B C     1 
ATOM   6668 O  O     . CYS A 1 945 ? -11.075 4.668   16.069  1.00 58.16  ? 1008 CYS B O     1 
ATOM   6669 C  CB    . CYS A 1 945 ? -10.443 1.669   17.142  1.00 61.86  ? 1008 CYS B CB    1 
ATOM   6670 S  SG    . CYS A 1 945 ? -8.805  1.867   17.837  1.00 78.63  ? 1008 CYS B SG    1 
ATOM   6671 N  N     . GLN A 1 946 ? -12.007 2.963   15.059  1.00 65.73  ? 1009 GLN B N     1 
ATOM   6672 C  CA    . GLN A 1 946 ? -12.096 3.579   13.760  1.00 62.48  ? 1009 GLN B CA    1 
ATOM   6673 C  C     . GLN A 1 946 ? -13.006 4.757   13.763  1.00 61.50  ? 1009 GLN B C     1 
ATOM   6674 O  O     . GLN A 1 946 ? -12.741 5.745   13.136  1.00 60.86  ? 1009 GLN B O     1 
ATOM   6675 C  CB    . GLN A 1 946 ? -12.601 2.567   12.770  1.00 59.48  ? 1009 GLN B CB    1 
ATOM   6676 C  CG    . GLN A 1 946 ? -12.122 2.812   11.378  1.00 59.85  ? 1009 GLN B CG    1 
ATOM   6677 C  CD    . GLN A 1 946 ? -10.644 2.740   11.288  1.00 65.12  ? 1009 GLN B CD    1 
ATOM   6678 O  OE1   . GLN A 1 946 ? -10.085 2.888   10.224  1.00 69.08  ? 1009 GLN B OE1   1 
ATOM   6679 N  NE2   . GLN A 1 946 ? -9.995  2.498   12.401  1.00 62.05  ? 1009 GLN B NE2   1 
ATOM   6680 N  N     . ALA A 1 947 ? -14.092 4.658   14.507  1.00 60.44  ? 1010 ALA B N     1 
ATOM   6681 C  CA    . ALA A 1 947 ? -15.068 5.710   14.609  1.00 57.73  ? 1010 ALA B CA    1 
ATOM   6682 C  C     . ALA A 1 947 ? -14.459 6.925   15.181  1.00 67.72  ? 1010 ALA B C     1 
ATOM   6683 O  O     . ALA A 1 947 ? -14.661 7.995   14.691  1.00 68.35  ? 1010 ALA B O     1 
ATOM   6684 C  CB    . ALA A 1 947 ? -16.188 5.276   15.497  1.00 54.53  ? 1010 ALA B CB    1 
ATOM   6685 N  N     . ALA A 1 948 ? -13.633 6.771   16.190  1.00 68.36  ? 1011 ALA B N     1 
ATOM   6686 C  CA    . ALA A 1 948 ? -12.963 7.893   16.771  1.00 62.81  ? 1011 ALA B CA    1 
ATOM   6687 C  C     . ALA A 1 948 ? -12.099 8.612   15.747  1.00 59.21  ? 1011 ALA B C     1 
ATOM   6688 O  O     . ALA A 1 948 ? -12.132 9.788   15.653  1.00 57.54  ? 1011 ALA B O     1 
ATOM   6689 C  CB    . ALA A 1 948 ? -12.131 7.422   17.918  1.00 60.01  ? 1011 ALA B CB    1 
ATOM   6690 N  N     . LYS A 1 949 ? -11.403 7.920   14.878  1.00 61.16  ? 1012 LYS B N     1 
ATOM   6691 C  CA    . LYS A 1 949 ? -10.593 8.571   13.874  1.00 63.70  ? 1012 LYS B CA    1 
ATOM   6692 C  C     . LYS A 1 949 ? -11.409 9.454   12.932  1.00 71.37  ? 1012 LYS B C     1 
ATOM   6693 O  O     . LYS A 1 949 ? -10.939 10.457  12.446  1.00 74.79  ? 1012 LYS B O     1 
ATOM   6694 C  CB    . LYS A 1 949 ? -9.817  7.539   13.075  1.00 60.28  ? 1012 LYS B CB    1 
ATOM   6695 N  N     . ALA A 1 950 ? -12.607 9.029   12.609  1.00 67.94  ? 1013 ALA B N     1 
ATOM   6696 C  CA    . ALA A 1 950 ? -13.492 9.773   11.784  1.00 70.76  ? 1013 ALA B CA    1 
ATOM   6697 C  C     . ALA A 1 950 ? -13.876 11.105  12.419  1.00 67.88  ? 1013 ALA B C     1 
ATOM   6698 O  O     . ALA A 1 950 ? -14.041 12.082  11.739  1.00 74.73  ? 1013 ALA B O     1 
ATOM   6699 C  CB    . ALA A 1 950 ? -14.708 8.925   11.508  1.00 70.37  ? 1013 ALA B CB    1 
ATOM   6700 N  N     . ILE A 1 951 ? -14.065 11.148  13.720  1.00 66.81  ? 1014 ILE B N     1 
ATOM   6701 C  CA    . ILE A 1 951 ? -14.404 12.416  14.361  1.00 67.98  ? 1014 ILE B CA    1 
ATOM   6702 C  C     . ILE A 1 951 ? -13.218 13.062  14.997  1.00 67.44  ? 1014 ILE B C     1 
ATOM   6703 O  O     . ILE A 1 951 ? -13.357 13.879  15.867  1.00 65.52  ? 1014 ILE B O     1 
ATOM   6704 C  CB    . ILE A 1 951 ? -15.494 12.341  15.429  1.00 70.49  ? 1014 ILE B CB    1 
ATOM   6705 C  CG1   . ILE A 1 951 ? -15.174 11.296  16.481  1.00 58.74  ? 1014 ILE B CG1   1 
ATOM   6706 C  CG2   . ILE A 1 951 ? -16.851 12.142  14.789  1.00 71.13  ? 1014 ILE B CG2   1 
ATOM   6707 C  CD1   . ILE A 1 951 ? -14.051 11.713  17.368  1.00 61.43  ? 1014 ILE B CD1   1 
ATOM   6708 N  N     . GLY A 1 952 ? -12.051 12.564  14.662  1.00 69.44  ? 1015 GLY B N     1 
ATOM   6709 C  CA    . GLY A 1 952 ? -10.803 13.114  15.126  1.00 70.52  ? 1015 GLY B CA    1 
ATOM   6710 C  C     . GLY A 1 952 ? -10.482 13.274  16.586  1.00 62.75  ? 1015 GLY B C     1 
ATOM   6711 O  O     . GLY A 1 952 ? -9.876  14.254  16.949  1.00 65.72  ? 1015 GLY B O     1 
ATOM   6712 N  N     . ASN A 1 953 ? -10.869 12.343  17.427  1.00 56.81  ? 1016 ASN B N     1 
ATOM   6713 C  CA    . ASN A 1 953 ? -10.481 12.474  18.786  1.00 66.08  ? 1016 ASN B CA    1 
ATOM   6714 C  C     . ASN A 1 953 ? -9.331  11.523  18.890  1.00 67.27  ? 1016 ASN B C     1 
ATOM   6715 O  O     . ASN A 1 953 ? -9.501  10.346  18.781  1.00 70.73  ? 1016 ASN B O     1 
ATOM   6716 C  CB    . ASN A 1 953 ? -11.602 12.046  19.701  1.00 62.38  ? 1016 ASN B CB    1 
ATOM   6717 N  N     . THR A 1 954 ? -8.126  12.023  19.050  1.00 59.90  ? 1017 THR B N     1 
ATOM   6718 C  CA    . THR A 1 954 ? -7.025  11.137  19.222  1.00 59.88  ? 1017 THR B CA    1 
ATOM   6719 C  C     . THR A 1 954 ? -7.111  10.474  20.573  1.00 60.99  ? 1017 THR B C     1 
ATOM   6720 O  O     . THR A 1 954 ? -6.866  9.316   20.709  1.00 65.66  ? 1017 THR B O     1 
ATOM   6721 C  CB    . THR A 1 954 ? -5.713  11.792  18.887  1.00 61.74  ? 1017 THR B CB    1 
ATOM   6722 O  OG1   . THR A 1 954 ? -5.868  12.433  17.628  1.00 73.33  ? 1017 THR B OG1   1 
ATOM   6723 C  CG2   . THR A 1 954 ? -4.668  10.775  18.719  1.00 61.70  ? 1017 THR B CG2   1 
ATOM   6724 N  N     . GLU A 1 955 ? -7.563  11.202  21.570  1.00 60.53  ? 1018 GLU B N     1 
ATOM   6725 C  CA    . GLU A 1 955 ? -7.678  10.691  22.917  1.00 69.88  ? 1018 GLU B CA    1 
ATOM   6726 C  C     . GLU A 1 955 ? -8.586  9.520   23.015  1.00 69.67  ? 1018 GLU B C     1 
ATOM   6727 O  O     . GLU A 1 955 ? -8.362  8.609   23.786  1.00 67.65  ? 1018 GLU B O     1 
ATOM   6728 C  CB    . GLU A 1 955 ? -8.296  11.777  23.778  1.00 72.50  ? 1018 GLU B CB    1 
ATOM   6729 N  N     . LEU A 1 956 ? -9.692  9.632   22.319  1.00 66.19  ? 1019 LEU B N     1 
ATOM   6730 C  CA    . LEU A 1 956 ? -10.661 8.603   22.216  1.00 61.21  ? 1019 LEU B CA    1 
ATOM   6731 C  C     . LEU A 1 956 ? -10.103 7.451   21.456  1.00 64.54  ? 1019 LEU B C     1 
ATOM   6732 O  O     . LEU A 1 956 ? -10.448 6.359   21.737  1.00 65.55  ? 1019 LEU B O     1 
ATOM   6733 C  CB    . LEU A 1 956 ? -11.862 9.137   21.518  1.00 63.27  ? 1019 LEU B CB    1 
ATOM   6734 C  CG    . LEU A 1 956 ? -12.570 10.010  22.498  1.00 67.98  ? 1019 LEU B CG    1 
ATOM   6735 C  CD1   . LEU A 1 956 ? -13.791 10.597  21.857  1.00 75.58  ? 1019 LEU B CD1   1 
ATOM   6736 C  CD2   . LEU A 1 956 ? -12.948 9.198   23.701  1.00 62.32  ? 1019 LEU B CD2   1 
ATOM   6737 N  N     . GLU A 1 957 ? -9.311  7.688   20.424  1.00 63.50  ? 1020 GLU B N     1 
ATOM   6738 C  CA    . GLU A 1 957 ? -8.796  6.566   19.692  1.00 61.62  ? 1020 GLU B CA    1 
ATOM   6739 C  C     . GLU A 1 957 ? -7.925  5.785   20.594  1.00 69.73  ? 1020 GLU B C     1 
ATOM   6740 O  O     . GLU A 1 957 ? -8.140  4.636   20.776  1.00 73.21  ? 1020 GLU B O     1 
ATOM   6741 C  CB    . GLU A 1 957 ? -7.977  7.008   18.508  1.00 55.18  ? 1020 GLU B CB    1 
ATOM   6742 N  N     . ASN A 1 958 ? -7.023  6.443   21.284  1.00 72.55  ? 1021 ASN B N     1 
ATOM   6743 C  CA    . ASN A 1 958 ? -6.119  5.759   22.193  1.00 73.22  ? 1021 ASN B CA    1 
ATOM   6744 C  C     . ASN A 1 958 ? -6.761  5.108   23.411  1.00 70.14  ? 1021 ASN B C     1 
ATOM   6745 O  O     . ASN A 1 958 ? -6.346  4.062   23.827  1.00 69.01  ? 1021 ASN B O     1 
ATOM   6746 C  CB    . ASN A 1 958 ? -4.934  6.645   22.542  1.00 72.29  ? 1021 ASN B CB    1 
ATOM   6747 C  CG    . ASN A 1 958 ? -4.023  6.847   21.370  1.00 74.15  ? 1021 ASN B CG    1 
ATOM   6748 O  OD1   . ASN A 1 958 ? -4.200  6.229   20.352  1.00 75.54  ? 1021 ASN B OD1   1 
ATOM   6749 N  ND2   . ASN A 1 958 ? -3.045  7.709   21.511  1.00 76.13  ? 1021 ASN B ND2   1 
ATOM   6750 N  N     . LYS A 1 959 ? -7.758  5.727   24.003  1.00 61.40  ? 1022 LYS B N     1 
ATOM   6751 C  CA    . LYS A 1 959 ? -8.380  5.115   25.138  1.00 61.76  ? 1022 LYS B CA    1 
ATOM   6752 C  C     . LYS A 1 959 ? -9.008  3.806   24.723  1.00 66.81  ? 1022 LYS B C     1 
ATOM   6753 O  O     . LYS A 1 959 ? -8.854  2.809   25.365  1.00 65.64  ? 1022 LYS B O     1 
ATOM   6754 C  CB    . LYS A 1 959 ? -9.431  6.057   25.667  1.00 60.32  ? 1022 LYS B CB    1 
ATOM   6755 C  CG    . LYS A 1 959 ? -10.341 5.497   26.723  1.00 58.29  ? 1022 LYS B CG    1 
ATOM   6756 C  CD    . LYS A 1 959 ? -11.575 6.352   26.787  1.00 70.18  ? 1022 LYS B CD    1 
ATOM   6757 C  CE    . LYS A 1 959 ? -11.958 6.695   28.206  1.00 70.72  ? 1022 LYS B CE    1 
ATOM   6758 N  NZ    . LYS A 1 959 ? -13.108 7.639   28.269  1.00 74.13  ? 1022 LYS B NZ    1 
ATOM   6759 N  N     . PHE A 1 960 ? -9.713  3.807   23.619  1.00 69.44  ? 1023 PHE B N     1 
ATOM   6760 C  CA    . PHE A 1 960 ? -10.281 2.600   23.109  1.00 61.26  ? 1023 PHE B CA    1 
ATOM   6761 C  C     . PHE A 1 960 ? -9.221  1.675   22.619  1.00 64.46  ? 1023 PHE B C     1 
ATOM   6762 O  O     . PHE A 1 960 ? -9.262  0.532   22.897  1.00 67.09  ? 1023 PHE B O     1 
ATOM   6763 C  CB    . PHE A 1 960 ? -11.212 2.906   21.973  1.00 65.11  ? 1023 PHE B CB    1 
ATOM   6764 C  CG    . PHE A 1 960 ? -12.547 3.331   22.409  1.00 61.09  ? 1023 PHE B CG    1 
ATOM   6765 C  CD1   . PHE A 1 960 ? -13.178 2.656   23.392  1.00 61.66  ? 1023 PHE B CD1   1 
ATOM   6766 C  CD2   . PHE A 1 960 ? -13.161 4.376   21.830  1.00 61.40  ? 1023 PHE B CD2   1 
ATOM   6767 C  CE1   . PHE A 1 960 ? -14.414 3.008   23.811  1.00 60.38  ? 1023 PHE B CE1   1 
ATOM   6768 C  CE2   . PHE A 1 960 ? -14.392 4.753   22.239  1.00 66.49  ? 1023 PHE B CE2   1 
ATOM   6769 C  CZ    . PHE A 1 960 ? -15.023 4.062   23.234  1.00 66.35  ? 1023 PHE B CZ    1 
ATOM   6770 N  N     . ALA A 1 961 ? -8.231  2.187   21.912  1.00 65.46  ? 1024 ALA B N     1 
ATOM   6771 C  CA    . ALA A 1 961 ? -7.157  1.356   21.384  1.00 68.69  ? 1024 ALA B CA    1 
ATOM   6772 C  C     . ALA A 1 961 ? -6.254  0.795   22.396  1.00 70.90  ? 1024 ALA B C     1 
ATOM   6773 O  O     . ALA A 1 961 ? -5.473  -0.044  22.065  1.00 76.42  ? 1024 ALA B O     1 
ATOM   6774 C  CB    . ALA A 1 961 ? -6.333  2.036   20.322  1.00 74.21  ? 1024 ALA B CB    1 
ATOM   6775 N  N     . GLU A 1 962 ? -6.226  1.371   23.559  1.00 72.89  ? 1025 GLU B N     1 
ATOM   6776 C  CA    . GLU A 1 962 ? -5.438  0.745   24.575  1.00 67.35  ? 1025 GLU B CA    1 
ATOM   6777 C  C     . GLU A 1 962 ? -6.292  -0.150  25.434  1.00 65.34  ? 1025 GLU B C     1 
ATOM   6778 O  O     . GLU A 1 962 ? -5.810  -0.984  26.128  1.00 65.66  ? 1025 GLU B O     1 
ATOM   6779 C  CB    . GLU A 1 962 ? -4.638  1.774   25.300  1.00 74.26  ? 1025 GLU B CB    1 
ATOM   6780 C  CG    . GLU A 1 962 ? -3.844  2.577   24.294  1.00 78.19  ? 1025 GLU B CG    1 
ATOM   6781 C  CD    . GLU A 1 962 ? -3.109  1.703   23.311  1.00 78.16  ? 1025 GLU B CD    1 
ATOM   6782 O  OE1   . GLU A 1 962 ? -2.688  2.186   22.251  1.00 77.87  ? 1025 GLU B OE1   1 
ATOM   6783 O  OE2   . GLU A 1 962 ? -2.940  0.529   23.604  1.00 69.37  ? 1025 GLU B OE2   1 
ATOM   6784 N  N     . GLY A 1 963 ? -7.594  -0.002  25.293  1.00 66.16  ? 1026 GLY B N     1 
ATOM   6785 C  CA    . GLY A 1 963 ? -8.602  -0.811  25.915  1.00 64.55  ? 1026 GLY B CA    1 
ATOM   6786 C  C     . GLY A 1 963 ? -8.528  -2.197  25.361  1.00 65.10  ? 1026 GLY B C     1 
ATOM   6787 O  O     . GLY A 1 963 ? -8.805  -3.126  26.036  1.00 64.08  ? 1026 GLY B O     1 
ATOM   6788 N  N     . ILE A 1 964 ? -8.235  -2.339  24.089  1.00 56.52  ? 1027 ILE B N     1 
ATOM   6789 C  CA    . ILE A 1 964 ? -8.115  -3.622  23.535  1.00 53.69  ? 1027 ILE B CA    1 
ATOM   6790 C  C     . ILE A 1 964 ? -6.980  -4.350  24.193  1.00 61.57  ? 1027 ILE B C     1 
ATOM   6791 O  O     . ILE A 1 964 ? -7.174  -5.409  24.698  1.00 65.05  ? 1027 ILE B O     1 
ATOM   6792 C  CB    . ILE A 1 964 ? -7.840  -3.510  22.044  1.00 57.20  ? 1027 ILE B CB    1 
ATOM   6793 C  CG1   . ILE A 1 964 ? -7.028  -2.284  21.721  1.00 68.99  ? 1027 ILE B CG1   1 
ATOM   6794 C  CG2   . ILE A 1 964 ? -9.093  -3.170  21.317  1.00 58.12  ? 1027 ILE B CG2   1 
ATOM   6795 C  CD1   . ILE A 1 964 ? -5.602  -2.560  21.335  1.00 63.66  ? 1027 ILE B CD1   1 
ATOM   6796 N  N     . THR A 1 965 ? -5.850  -3.701  24.366  1.00 61.30  ? 1028 THR B N     1 
ATOM   6797 C  CA    . THR A 1 965 ? -4.643  -4.299  24.874  1.00 61.79  ? 1028 THR B CA    1 
ATOM   6798 C  C     . THR A 1 965 ? -4.806  -4.866  26.250  1.00 59.30  ? 1028 THR B C     1 
ATOM   6799 O  O     . THR A 1 965 ? -4.206  -5.857  26.565  1.00 57.12  ? 1028 THR B O     1 
ATOM   6800 C  CB    . THR A 1 965 ? -3.444  -3.344  24.802  1.00 64.09  ? 1028 THR B CB    1 
ATOM   6801 O  OG1   . THR A 1 965 ? -3.711  -2.261  23.928  1.00 73.07  ? 1028 THR B OG1   1 
ATOM   6802 C  CG2   . THR A 1 965 ? -2.263  -4.034  24.235  1.00 57.72  ? 1028 THR B CG2   1 
ATOM   6803 N  N     . LYS A 1 966 ? -5.549  -4.210  27.107  1.00 57.59  ? 1029 LYS B N     1 
ATOM   6804 C  CA    . LYS A 1 966 ? -5.817  -4.785  28.405  1.00 60.03  ? 1029 LYS B CA    1 
ATOM   6805 C  C     . LYS A 1 966 ? -6.665  -6.031  28.261  1.00 63.41  ? 1029 LYS B C     1 
ATOM   6806 O  O     . LYS A 1 966 ? -6.578  -6.950  29.034  1.00 62.85  ? 1029 LYS B O     1 
ATOM   6807 C  CB    . LYS A 1 966 ? -6.560  -3.801  29.269  1.00 55.07  ? 1029 LYS B CB    1 
ATOM   6808 C  CG    . LYS A 1 966 ? -5.847  -2.488  29.414  1.00 64.45  ? 1029 LYS B CG    1 
ATOM   6809 C  CD    . LYS A 1 966 ? -5.338  -2.303  30.822  1.00 64.57  ? 1029 LYS B CD    1 
ATOM   6810 C  CE    . LYS A 1 966 ? -4.107  -1.444  30.867  1.00 59.05  ? 1029 LYS B CE    1 
ATOM   6811 N  NZ    . LYS A 1 966 ? -4.344  -0.140  30.205  1.00 74.32  ? 1029 LYS B NZ    1 
ATOM   6812 N  N     . ILE A 1 967 ? -7.635  -5.960  27.377  1.00 61.39  ? 1030 ILE B N     1 
ATOM   6813 C  CA    . ILE A 1 967 ? -8.502  -7.060  27.109  1.00 56.01  ? 1030 ILE B CA    1 
ATOM   6814 C  C     . ILE A 1 967 ? -7.959  -8.185  26.322  1.00 54.26  ? 1030 ILE B C     1 
ATOM   6815 O  O     . ILE A 1 967 ? -8.146  -9.294  26.696  1.00 58.46  ? 1030 ILE B O     1 
ATOM   6816 C  CB    . ILE A 1 967 ? -9.816  -6.579  26.550  1.00 57.45  ? 1030 ILE B CB    1 
ATOM   6817 C  CG1   . ILE A 1 967 ? -10.760 -6.414  27.703  1.00 51.54  ? 1030 ILE B CG1   1 
ATOM   6818 C  CG2   . ILE A 1 967 ? -10.428 -7.590  25.631  1.00 51.40  ? 1030 ILE B CG2   1 
ATOM   6819 C  CD1   . ILE A 1 967 ? -11.842 -5.412  27.449  1.00 58.67  ? 1030 ILE B CD1   1 
ATOM   6820 N  N     . LYS A 1 968 ? -7.221  -7.907  25.283  1.00 48.16  ? 1031 LYS B N     1 
ATOM   6821 C  CA    . LYS A 1 968 ? -6.775  -8.970  24.427  1.00 46.60  ? 1031 LYS B CA    1 
ATOM   6822 C  C     . LYS A 1 968 ? -5.533  -9.696  24.770  1.00 51.93  ? 1031 LYS B C     1 
ATOM   6823 O  O     . LYS A 1 968 ? -4.489  -9.400  24.254  1.00 53.18  ? 1031 LYS B O     1 
ATOM   6824 C  CB    . LYS A 1 968 ? -6.611  -8.439  23.029  1.00 47.89  ? 1031 LYS B CB    1 
ATOM   6825 C  CG    . LYS A 1 968 ? -6.078  -9.435  22.064  1.00 45.73  ? 1031 LYS B CG    1 
ATOM   6826 C  CD    . LYS A 1 968 ? -5.982  -8.784  20.723  1.00 49.05  ? 1031 LYS B CD    1 
ATOM   6827 C  CE    . LYS A 1 968 ? -5.602  -9.768  19.642  1.00 62.45  ? 1031 LYS B CE    1 
ATOM   6828 N  NZ    . LYS A 1 968 ? -4.182  -10.202 19.653  1.00 58.33  ? 1031 LYS B NZ    1 
ATOM   6829 N  N     . ARG A 1 969 ? -5.661  -10.713 25.595  1.00 50.94  ? 1032 ARG B N     1 
ATOM   6830 C  CA    . ARG A 1 969 ? -4.523  -11.509 25.950  1.00 49.88  ? 1032 ARG B CA    1 
ATOM   6831 C  C     . ARG A 1 969 ? -4.785  -12.978 26.294  1.00 63.24  ? 1032 ARG B C     1 
ATOM   6832 O  O     . ARG A 1 969 ? -5.865  -13.360 26.690  1.00 61.74  ? 1032 ARG B O     1 
ATOM   6833 C  CB    . ARG A 1 969 ? -3.835  -10.864 27.134  1.00 53.12  ? 1032 ARG B CB    1 
ATOM   6834 C  CG    . ARG A 1 969 ? -4.783  -10.454 28.228  1.00 55.77  ? 1032 ARG B CG    1 
ATOM   6835 C  CD    . ARG A 1 969 ? -4.361  -10.818 29.624  1.00 51.46  ? 1032 ARG B CD    1 
ATOM   6836 N  NE    . ARG A 1 969 ? -5.162  -10.025 30.522  1.00 51.17  ? 1032 ARG B NE    1 
ATOM   6837 C  CZ    . ARG A 1 969 ? -5.642  -10.401 31.689  1.00 57.52  ? 1032 ARG B CZ    1 
ATOM   6838 N  NH1   . ARG A 1 969 ? -5.460  -11.598 32.173  1.00 57.82  ? 1032 ARG B NH1   1 
ATOM   6839 N  NH2   . ARG A 1 969 ? -6.360  -9.554  32.367  1.00 61.42  ? 1032 ARG B NH2   1 
ATOM   6840 N  N     . ASP A 1 970 ? -3.736  -13.778 26.148  1.00 63.24  ? 1033 ASP B N     1 
ATOM   6841 C  CA    . ASP A 1 970 ? -3.666  -15.188 26.519  1.00 59.36  ? 1033 ASP B CA    1 
ATOM   6842 C  C     . ASP A 1 970 ? -4.604  -16.207 25.910  1.00 66.52  ? 1033 ASP B C     1 
ATOM   6843 O  O     . ASP A 1 970 ? -4.675  -16.243 24.720  1.00 71.22  ? 1033 ASP B O     1 
ATOM   6844 C  CB    . ASP A 1 970 ? -3.549  -15.287 28.016  1.00 61.00  ? 1033 ASP B CB    1 
ATOM   6845 C  CG    . ASP A 1 970 ? -2.362  -14.552 28.518  1.00 68.24  ? 1033 ASP B CG    1 
ATOM   6846 O  OD1   . ASP A 1 970 ? -1.339  -14.539 27.853  1.00 73.19  ? 1033 ASP B OD1   1 
ATOM   6847 O  OD2   . ASP A 1 970 ? -2.435  -13.961 29.574  1.00 69.48  ? 1033 ASP B OD2   1 
ATOM   6848 N  N     . ILE A 1 971 ? -5.294  -17.064 26.669  1.00 62.80  ? 1034 ILE B N     1 
ATOM   6849 C  CA    . ILE A 1 971 ? -6.164  -18.061 26.017  1.00 58.01  ? 1034 ILE B CA    1 
ATOM   6850 C  C     . ILE A 1 971 ? -7.337  -17.545 25.338  1.00 62.93  ? 1034 ILE B C     1 
ATOM   6851 O  O     . ILE A 1 971 ? -7.838  -18.158 24.444  1.00 69.27  ? 1034 ILE B O     1 
ATOM   6852 C  CB    . ILE A 1 971 ? -6.776  -19.159 26.838  1.00 48.08  ? 1034 ILE B CB    1 
ATOM   6853 C  CG1   . ILE A 1 971 ? -7.400  -18.620 28.079  1.00 49.03  ? 1034 ILE B CG1   1 
ATOM   6854 C  CG2   . ILE A 1 971 ? -5.814  -20.304 26.969  1.00 57.78  ? 1034 ILE B CG2   1 
ATOM   6855 C  CD1   . ILE A 1 971 ? -8.308  -19.627 28.671  1.00 53.25  ? 1034 ILE B CD1   1 
ATOM   6856 N  N     . VAL A 1 972 ? -7.820  -16.406 25.743  1.00 59.12  ? 1035 VAL B N     1 
ATOM   6857 C  CA    . VAL A 1 972 ? -8.940  -15.845 25.102  1.00 58.16  ? 1035 VAL B CA    1 
ATOM   6858 C  C     . VAL A 1 972 ? -8.713  -15.490 23.648  1.00 54.94  ? 1035 VAL B C     1 
ATOM   6859 O  O     . VAL A 1 972 ? -9.667  -15.391 22.937  1.00 50.61  ? 1035 VAL B O     1 
ATOM   6860 C  CB    . VAL A 1 972 ? -9.407  -14.681 25.916  1.00 57.47  ? 1035 VAL B CB    1 
ATOM   6861 C  CG1   . VAL A 1 972 ? -10.679 -14.112 25.367  1.00 57.37  ? 1035 VAL B CG1   1 
ATOM   6862 C  CG2   . VAL A 1 972 ? -9.674  -15.192 27.277  1.00 50.77  ? 1035 VAL B CG2   1 
ATOM   6863 N  N     . PHE A 1 973 ? -7.494  -15.151 23.244  1.00 50.11  ? 1036 PHE B N     1 
ATOM   6864 C  CA    . PHE A 1 973 ? -7.171  -14.803 21.891  1.00 56.43  ? 1036 PHE B CA    1 
ATOM   6865 C  C     . PHE A 1 973 ? -6.195  -15.688 21.110  1.00 57.01  ? 1036 PHE B C     1 
ATOM   6866 O  O     . PHE A 1 973 ? -5.521  -15.209 20.238  1.00 60.97  ? 1036 PHE B O     1 
ATOM   6867 C  CB    . PHE A 1 973 ? -6.781  -13.341 21.870  1.00 50.96  ? 1036 PHE B CB    1 
ATOM   6868 C  CG    . PHE A 1 973 ? -7.898  -12.472 22.256  1.00 51.33  ? 1036 PHE B CG    1 
ATOM   6869 C  CD1   . PHE A 1 973 ? -8.779  -12.057 21.335  1.00 51.93  ? 1036 PHE B CD1   1 
ATOM   6870 C  CD2   . PHE A 1 973 ? -8.118  -12.166 23.548  1.00 51.20  ? 1036 PHE B CD2   1 
ATOM   6871 C  CE1   . PHE A 1 973 ? -9.846  -11.298 21.700  1.00 56.65  ? 1036 PHE B CE1   1 
ATOM   6872 C  CE2   . PHE A 1 973 ? -9.183  -11.424 23.925  1.00 52.40  ? 1036 PHE B CE2   1 
ATOM   6873 C  CZ    . PHE A 1 973 ? -10.050 -10.986 23.000  1.00 54.03  ? 1036 PHE B CZ    1 
ATOM   6874 N  N     . ALA A 1 974 ? -6.152  -16.971 21.397  1.00 53.61  ? 1037 ALA B N     1 
ATOM   6875 C  CA    . ALA A 1 974 ? -5.184  -17.884 20.791  1.00 51.51  ? 1037 ALA B CA    1 
ATOM   6876 C  C     . ALA A 1 974 ? -5.011  -18.302 19.308  1.00 58.87  ? 1037 ALA B C     1 
ATOM   6877 O  O     . ALA A 1 974 ? -3.898  -18.331 18.860  1.00 63.47  ? 1037 ALA B O     1 
ATOM   6878 C  CB    . ALA A 1 974 ? -5.164  -19.117 21.632  1.00 50.56  ? 1037 ALA B CB    1 
ATOM   6879 N  N     . ALA A 1 975 ? -6.076  -18.614 18.577  1.00 65.03  ? 1038 ALA B N     1 
ATOM   6880 C  CA    . ALA A 1 975 ? -6.094  -19.111 17.156  1.00 65.17  ? 1038 ALA B CA    1 
ATOM   6881 C  C     . ALA A 1 975 ? -5.593  -20.538 16.765  1.00 66.48  ? 1038 ALA B C     1 
ATOM   6882 O  O     . ALA A 1 975 ? -5.296  -20.778 15.619  1.00 58.88  ? 1038 ALA B O     1 
ATOM   6883 C  CB    . ALA A 1 975 ? -5.588  -18.064 16.166  1.00 58.69  ? 1038 ALA B CB    1 
ATOM   6884 N  N     . SER A 1 976 ? -5.630  -21.504 17.675  1.00 65.71  ? 1039 SER B N     1 
ATOM   6885 C  CA    . SER A 1 976 ? -5.098  -22.847 17.389  1.00 73.53  ? 1039 SER B CA    1 
ATOM   6886 C  C     . SER A 1 976 ? -5.797  -23.536 16.267  1.00 70.71  ? 1039 SER B C     1 
ATOM   6887 O  O     . SER A 1 976 ? -5.335  -24.540 15.765  1.00 62.16  ? 1039 SER B O     1 
ATOM   6888 C  CB    . SER A 1 976 ? -5.077  -23.794 18.591  1.00 69.07  ? 1039 SER B CB    1 
ATOM   6889 O  OG    . SER A 1 976 ? -4.859  -25.114 18.149  1.00 44.46  ? 1039 SER B OG    1 
ATOM   6890 N  N     . LEU A 1 977 ? -6.990  -23.119 15.954  1.00 74.77  ? 1040 LEU B N     1 
ATOM   6891 C  CA    . LEU A 1 977 ? -7.560  -23.817 14.842  1.00 78.73  ? 1040 LEU B CA    1 
ATOM   6892 C  C     . LEU A 1 977 ? -6.448  -23.481 13.897  1.00 78.23  ? 1040 LEU B C     1 
ATOM   6893 O  O     . LEU A 1 977 ? -6.346  -22.316 13.538  1.00 75.78  ? 1040 LEU B O     1 
ATOM   6894 C  CB    . LEU A 1 977 ? -8.789  -23.047 14.382  1.00 72.24  ? 1040 LEU B CB    1 
ATOM   6895 N  N     . TYR A 1 978 ? -5.756  -24.492 13.376  1.00 71.13  ? 1041 TYR B N     1 
ATOM   6896 C  CA    . TYR A 1 978 ? -4.576  -24.258 12.609  1.00 65.37  ? 1041 TYR B CA    1 
ATOM   6897 C  C     . TYR A 1 978 ? -4.836  -23.376 11.452  1.00 61.45  ? 1041 TYR B C     1 
ATOM   6898 O  O     . TYR A 1 978 ? -5.781  -23.535 10.748  1.00 56.82  ? 1041 TYR B O     1 
ATOM   6899 C  CB    . TYR A 1 978 ? -3.960  -25.579 12.192  1.00 66.77  ? 1041 TYR B CB    1 
ATOM   6900 N  N     . LEU A 1 979 ? -3.987  -22.376 11.350  1.00 57.71  ? 1042 LEU B N     1 
ATOM   6901 C  CA    . LEU A 1 979 ? -4.120  -21.359 10.354  1.00 61.17  ? 1042 LEU B CA    1 
ATOM   6902 C  C     . LEU A 1 979 ? -2.745  -20.916 9.943   1.00 60.41  ? 1042 LEU B C     1 
ATOM   6903 O  O     . LEU A 1 979 ? -1.864  -20.848 10.769  1.00 48.84  ? 1042 LEU B O     1 
ATOM   6904 C  CB    . LEU A 1 979 ? -4.846  -20.184 10.973  1.00 48.79  ? 1042 LEU B CB    1 
ATOM   6905 C  CG    . LEU A 1 979 ? -5.829  -19.344 10.220  1.00 38.23  ? 1042 LEU B CG    1 
ATOM   6906 C  CD1   . LEU A 1 979 ? -5.918  -18.055 10.965  1.00 40.54  ? 1042 LEU B CD1   1 
ATOM   6907 C  CD2   . LEU A 1 979 ? -5.245  -19.094 8.883   1.00 44.53  ? 1042 LEU B CD2   1 
ATOM   6908 N  N     . SER B 2 1   ? -58.182 -37.435 52.327  1.00 37.32  ? 162  SER A N     1 
ATOM   6909 C  CA    . SER B 2 1   ? -58.155 -36.475 51.239  1.00 49.72  ? 162  SER A CA    1 
ATOM   6910 C  C     . SER B 2 1   ? -58.905 -35.209 51.496  1.00 48.74  ? 162  SER A C     1 
ATOM   6911 O  O     . SER B 2 1   ? -58.683 -34.484 52.417  1.00 51.81  ? 162  SER A O     1 
ATOM   6912 C  CB    . SER B 2 1   ? -58.775 -37.074 49.999  1.00 56.96  ? 162  SER A CB    1 
ATOM   6913 O  OG    . SER B 2 1   ? -57.895 -37.986 49.384  1.00 70.28  ? 162  SER A OG    1 
ATOM   6914 N  N     . PHE B 2 2   ? -59.835 -34.987 50.619  1.00 45.53  ? 163  PHE A N     1 
ATOM   6915 C  CA    . PHE B 2 2   ? -60.585 -33.764 50.503  1.00 51.30  ? 163  PHE A CA    1 
ATOM   6916 C  C     . PHE B 2 2   ? -61.612 -33.324 51.536  1.00 49.88  ? 163  PHE A C     1 
ATOM   6917 O  O     . PHE B 2 2   ? -62.196 -34.091 52.251  1.00 49.13  ? 163  PHE A O     1 
ATOM   6918 C  CB    . PHE B 2 2   ? -61.191 -33.691 49.110  1.00 52.42  ? 163  PHE A CB    1 
ATOM   6919 C  CG    . PHE B 2 2   ? -62.567 -34.252 48.999  1.00 51.25  ? 163  PHE A CG    1 
ATOM   6920 C  CD1   . PHE B 2 2   ? -62.752 -35.568 48.718  1.00 56.98  ? 163  PHE A CD1   1 
ATOM   6921 C  CD2   . PHE B 2 2   ? -63.655 -33.450 49.117  1.00 47.27  ? 163  PHE A CD2   1 
ATOM   6922 C  CE1   . PHE B 2 2   ? -63.999 -36.086 48.586  1.00 53.17  ? 163  PHE A CE1   1 
ATOM   6923 C  CE2   . PHE B 2 2   ? -64.901 -33.954 49.000  1.00 51.26  ? 163  PHE A CE2   1 
ATOM   6924 C  CZ    . PHE B 2 2   ? -65.075 -35.277 48.736  1.00 60.16  ? 163  PHE A CZ    1 
ATOM   6925 N  N     . ARG B 2 3   ? -61.773 -32.022 51.587  1.00 48.50  ? 164  ARG A N     1 
ATOM   6926 C  CA    . ARG B 2 3   ? -62.698 -31.315 52.438  1.00 48.65  ? 164  ARG A CA    1 
ATOM   6927 C  C     . ARG B 2 3   ? -63.046 -29.991 51.739  1.00 53.84  ? 164  ARG A C     1 
ATOM   6928 O  O     . ARG B 2 3   ? -62.339 -29.570 50.857  1.00 55.29  ? 164  ARG A O     1 
ATOM   6929 C  CB    . ARG B 2 3   ? -62.045 -31.052 53.785  1.00 45.02  ? 164  ARG A CB    1 
ATOM   6930 C  CG    . ARG B 2 3   ? -61.562 -29.634 53.998  1.00 51.71  ? 164  ARG A CG    1 
ATOM   6931 C  CD    . ARG B 2 3   ? -60.450 -29.457 55.000  1.00 58.73  ? 164  ARG A CD    1 
ATOM   6932 N  NE    . ARG B 2 3   ? -59.141 -29.753 54.455  1.00 59.01  ? 164  ARG A NE    1 
ATOM   6933 C  CZ    . ARG B 2 3   ? -58.051 -29.079 54.770  1.00 59.96  ? 164  ARG A CZ    1 
ATOM   6934 N  NH1   . ARG B 2 3   ? -58.126 -28.071 55.594  1.00 60.58  ? 164  ARG A NH1   1 
ATOM   6935 N  NH2   . ARG B 2 3   ? -56.891 -29.405 54.267  1.00 57.46  ? 164  ARG A NH2   1 
ATOM   6936 N  N     . THR B 2 4   ? -64.138 -29.334 52.078  1.00 51.66  ? 165  THR A N     1 
ATOM   6937 C  CA    . THR B 2 4   ? -64.409 -28.058 51.468  1.00 52.71  ? 165  THR A CA    1 
ATOM   6938 C  C     . THR B 2 4   ? -64.267 -26.989 52.522  1.00 55.90  ? 165  THR A C     1 
ATOM   6939 O  O     . THR B 2 4   ? -64.848 -27.096 53.545  1.00 62.14  ? 165  THR A O     1 
ATOM   6940 C  CB    . THR B 2 4   ? -65.798 -28.016 50.800  1.00 58.88  ? 165  THR A CB    1 
ATOM   6941 O  OG1   . THR B 2 4   ? -66.663 -27.107 51.468  1.00 59.10  ? 165  THR A OG1   1 
ATOM   6942 C  CG2   . THR B 2 4   ? -66.424 -29.366 50.767  1.00 51.32  ? 165  THR A CG2   1 
ATOM   6943 N  N     . ASP B 2 5   ? -63.446 -25.991 52.282  1.00 53.40  ? 166  ASP A N     1 
ATOM   6944 C  CA    . ASP B 2 5   ? -63.271 -24.888 53.167  1.00 44.90  ? 166  ASP A CA    1 
ATOM   6945 C  C     . ASP B 2 5   ? -63.528 -23.714 52.298  1.00 50.88  ? 166  ASP A C     1 
ATOM   6946 O  O     . ASP B 2 5   ? -62.861 -23.549 51.327  1.00 47.36  ? 166  ASP A O     1 
ATOM   6947 C  CB    . ASP B 2 5   ? -61.846 -24.812 53.594  1.00 38.37  ? 166  ASP A CB    1 
ATOM   6948 C  CG    . ASP B 2 5   ? -61.418 -23.429 53.832  1.00 51.86  ? 166  ASP A CG    1 
ATOM   6949 O  OD1   . ASP B 2 5   ? -62.089 -22.723 54.539  1.00 56.85  ? 166  ASP A OD1   1 
ATOM   6950 O  OD2   . ASP B 2 5   ? -60.425 -22.983 53.302  1.00 59.76  ? 166  ASP A OD2   1 
ATOM   6951 N  N     . LYS B 2 6   ? -64.511 -22.899 52.636  1.00 50.88  ? 167  LYS A N     1 
ATOM   6952 C  CA    . LYS B 2 6   ? -64.825 -21.698 51.892  1.00 48.16  ? 167  LYS A CA    1 
ATOM   6953 C  C     . LYS B 2 6   ? -64.370 -20.462 52.590  1.00 50.31  ? 167  LYS A C     1 
ATOM   6954 O  O     . LYS B 2 6   ? -64.820 -19.403 52.247  1.00 55.74  ? 167  LYS A O     1 
ATOM   6955 C  CB    . LYS B 2 6   ? -66.317 -21.567 51.679  1.00 50.70  ? 167  LYS A CB    1 
ATOM   6956 C  CG    . LYS B 2 6   ? -66.939 -22.737 50.952  1.00 59.97  ? 167  LYS A CG    1 
ATOM   6957 C  CD    . LYS B 2 6   ? -68.264 -22.365 50.336  1.00 57.02  ? 167  LYS A CD    1 
ATOM   6958 C  CE    . LYS B 2 6   ? -69.049 -23.603 49.981  1.00 59.69  ? 167  LYS A CE    1 
ATOM   6959 N  NZ    . LYS B 2 6   ? -69.619 -23.532 48.613  1.00 66.39  ? 167  LYS A NZ    1 
ATOM   6960 N  N     . LYS B 2 7   ? -63.425 -20.599 53.495  1.00 48.15  ? 168  LYS A N     1 
ATOM   6961 C  CA    . LYS B 2 7   ? -63.100 -19.529 54.388  1.00 51.02  ? 168  LYS A CA    1 
ATOM   6962 C  C     . LYS B 2 7   ? -61.780 -18.864 54.100  1.00 51.75  ? 168  LYS A C     1 
ATOM   6963 O  O     . LYS B 2 7   ? -60.769 -19.497 54.056  1.00 51.74  ? 168  LYS A O     1 
ATOM   6964 C  CB    . LYS B 2 7   ? -63.121 -20.081 55.791  1.00 54.68  ? 168  LYS A CB    1 
ATOM   6965 C  CG    . LYS B 2 7   ? -61.927 -19.707 56.618  1.00 58.06  ? 168  LYS A CG    1 
ATOM   6966 C  CD    . LYS B 2 7   ? -62.210 -19.843 58.097  1.00 65.76  ? 168  LYS A CD    1 
ATOM   6967 C  CE    . LYS B 2 7   ? -61.403 -18.828 58.890  1.00 75.69  ? 168  LYS A CE    1 
ATOM   6968 N  NZ    . LYS B 2 7   ? -61.077 -19.301 60.264  1.00 72.12  ? 168  LYS A NZ    1 
ATOM   6969 N  N     . PRO B 2 8   ? -61.845 -17.563 53.901  1.00 44.65  ? 169  PRO A N     1 
ATOM   6970 C  CA    . PRO B 2 8   ? -60.787 -16.633 53.557  1.00 43.33  ? 169  PRO A CA    1 
ATOM   6971 C  C     . PRO B 2 8   ? -59.852 -16.328 54.688  1.00 53.64  ? 169  PRO A C     1 
ATOM   6972 O  O     . PRO B 2 8   ? -60.246 -16.271 55.826  1.00 54.52  ? 169  PRO A O     1 
ATOM   6973 C  CB    . PRO B 2 8   ? -61.541 -15.390 53.188  1.00 34.77  ? 169  PRO A CB    1 
ATOM   6974 C  CG    . PRO B 2 8   ? -62.804 -15.506 53.875  1.00 37.04  ? 169  PRO A CG    1 
ATOM   6975 C  CD    . PRO B 2 8   ? -63.144 -16.927 53.834  1.00 41.57  ? 169  PRO A CD    1 
ATOM   6976 N  N     . ASP B 2 9   ? -58.594 -16.146 54.368  1.00 48.03  ? 170  ASP A N     1 
ATOM   6977 C  CA    . ASP B 2 9   ? -57.639 -15.853 55.367  1.00 44.58  ? 170  ASP A CA    1 
ATOM   6978 C  C     . ASP B 2 9   ? -57.071 -14.586 54.878  1.00 45.12  ? 170  ASP A C     1 
ATOM   6979 O  O     . ASP B 2 9   ? -56.216 -14.617 54.083  1.00 49.09  ? 170  ASP A O     1 
ATOM   6980 C  CB    . ASP B 2 9   ? -56.626 -16.963 55.315  1.00 48.66  ? 170  ASP A CB    1 
ATOM   6981 C  CG    . ASP B 2 9   ? -55.500 -16.766 56.222  1.00 52.87  ? 170  ASP A CG    1 
ATOM   6982 O  OD1   . ASP B 2 9   ? -55.527 -15.894 57.049  1.00 54.17  ? 170  ASP A OD1   1 
ATOM   6983 O  OD2   . ASP B 2 9   ? -54.544 -17.494 56.116  1.00 52.61  ? 170  ASP A OD2   1 
ATOM   6984 N  N     . PRO B 2 10  ? -57.458 -13.458 55.459  1.00 44.68  ? 171  PRO A N     1 
ATOM   6985 C  CA    . PRO B 2 10  ? -57.145 -12.054 55.192  1.00 42.25  ? 171  PRO A CA    1 
ATOM   6986 C  C     . PRO B 2 10  ? -55.748 -11.627 55.468  1.00 46.45  ? 171  PRO A C     1 
ATOM   6987 O  O     . PRO B 2 10  ? -55.341 -10.575 55.098  1.00 48.93  ? 171  PRO A O     1 
ATOM   6988 C  CB    . PRO B 2 10  ? -58.088 -11.304 56.091  1.00 30.29  ? 171  PRO A CB    1 
ATOM   6989 C  CG    . PRO B 2 10  ? -58.422 -12.248 57.123  1.00 41.66  ? 171  PRO A CG    1 
ATOM   6990 C  CD    . PRO B 2 10  ? -58.445 -13.577 56.514  1.00 41.33  ? 171  PRO A CD    1 
ATOM   6991 N  N     . ALA B 2 11  ? -55.056 -12.441 56.210  1.00 42.11  ? 172  ALA A N     1 
ATOM   6992 C  CA    . ALA B 2 11  ? -53.714 -12.250 56.558  1.00 43.75  ? 172  ALA A CA    1 
ATOM   6993 C  C     . ALA B 2 11  ? -52.807 -12.271 55.381  1.00 43.30  ? 172  ALA A C     1 
ATOM   6994 O  O     . ALA B 2 11  ? -51.864 -11.530 55.335  1.00 38.54  ? 172  ALA A O     1 
ATOM   6995 C  CB    . ALA B 2 11  ? -53.357 -13.344 57.490  1.00 53.49  ? 172  ALA A CB    1 
ATOM   6996 N  N     . ASN B 2 12  ? -53.094 -13.159 54.446  1.00 48.17  ? 173  ASN A N     1 
ATOM   6997 C  CA    . ASN B 2 12  ? -52.285 -13.279 53.277  1.00 41.99  ? 173  ASN A CA    1 
ATOM   6998 C  C     . ASN B 2 12  ? -52.317 -12.027 52.541  1.00 45.33  ? 173  ASN A C     1 
ATOM   6999 O  O     . ASN B 2 12  ? -51.304 -11.561 52.089  1.00 41.58  ? 173  ASN A O     1 
ATOM   7000 C  CB    . ASN B 2 12  ? -52.834 -14.350 52.440  1.00 35.30  ? 173  ASN A CB    1 
ATOM   7001 C  CG    . ASN B 2 12  ? -53.190 -15.511 53.250  1.00 47.02  ? 173  ASN A CG    1 
ATOM   7002 O  OD1   . ASN B 2 12  ? -53.476 -15.347 54.399  1.00 52.91  ? 173  ASN A OD1   1 
ATOM   7003 N  ND2   . ASN B 2 12  ? -53.184 -16.680 52.677  1.00 43.44  ? 173  ASN A ND2   1 
ATOM   7004 N  N     . TRP B 2 13  ? -53.486 -11.464 52.369  1.00 47.23  ? 174  TRP A N     1 
ATOM   7005 C  CA    . TRP B 2 13  ? -53.513 -10.176 51.734  1.00 47.08  ? 174  TRP A CA    1 
ATOM   7006 C  C     . TRP B 2 13  ? -52.968 -9.087  52.625  1.00 43.81  ? 174  TRP A C     1 
ATOM   7007 O  O     . TRP B 2 13  ? -52.106 -8.399  52.234  1.00 48.19  ? 174  TRP A O     1 
ATOM   7008 C  CB    . TRP B 2 13  ? -54.884 -9.856  51.183  1.00 44.63  ? 174  TRP A CB    1 
ATOM   7009 C  CG    . TRP B 2 13  ? -54.957 -8.564  50.492  1.00 41.89  ? 174  TRP A CG    1 
ATOM   7010 C  CD1   . TRP B 2 13  ? -55.709 -7.540  50.836  1.00 46.21  ? 174  TRP A CD1   1 
ATOM   7011 C  CD2   . TRP B 2 13  ? -54.249 -8.165  49.335  1.00 43.20  ? 174  TRP A CD2   1 
ATOM   7012 N  NE1   . TRP B 2 13  ? -55.533 -6.521  49.985  1.00 47.29  ? 174  TRP A NE1   1 
ATOM   7013 C  CE2   . TRP B 2 13  ? -54.629 -6.890  49.047  1.00 41.44  ? 174  TRP A CE2   1 
ATOM   7014 C  CE3   . TRP B 2 13  ? -53.344 -8.778  48.514  1.00 44.76  ? 174  TRP A CE3   1 
ATOM   7015 C  CZ2   . TRP B 2 13  ? -54.137 -6.214  48.006  1.00 39.81  ? 174  TRP A CZ2   1 
ATOM   7016 C  CZ3   . TRP B 2 13  ? -52.870 -8.114  47.507  1.00 42.75  ? 174  TRP A CZ3   1 
ATOM   7017 C  CH2   . TRP B 2 13  ? -53.260 -6.844  47.241  1.00 36.82  ? 174  TRP A CH2   1 
ATOM   7018 N  N     . GLU B 2 14  ? -53.410 -8.959  53.853  1.00 45.69  ? 175  GLU A N     1 
ATOM   7019 C  CA    . GLU B 2 14  ? -52.889 -7.907  54.705  1.00 51.81  ? 175  GLU A CA    1 
ATOM   7020 C  C     . GLU B 2 14  ? -51.430 -7.975  55.002  1.00 48.32  ? 175  GLU A C     1 
ATOM   7021 O  O     . GLU B 2 14  ? -50.762 -6.998  54.939  1.00 47.42  ? 175  GLU A O     1 
ATOM   7022 C  CB    . GLU B 2 14  ? -53.570 -7.947  56.049  1.00 52.62  ? 175  GLU A CB    1 
ATOM   7023 C  CG    . GLU B 2 14  ? -53.484 -6.666  56.847  1.00 51.56  ? 175  GLU A CG    1 
ATOM   7024 C  CD    . GLU B 2 14  ? -54.519 -5.676  56.378  1.00 72.39  ? 175  GLU A CD    1 
ATOM   7025 O  OE1   . GLU B 2 14  ? -55.358 -5.220  57.168  1.00 67.42  ? 175  GLU A OE1   1 
ATOM   7026 O  OE2   . GLU B 2 14  ? -54.508 -5.385  55.181  1.00 80.55  ? 175  GLU A OE2   1 
ATOM   7027 N  N     . TYR B 2 15  ? -50.921 -9.148  55.297  1.00 47.61  ? 176  TYR A N     1 
ATOM   7028 C  CA    . TYR B 2 15  ? -49.538 -9.273  55.646  1.00 45.65  ? 176  TYR A CA    1 
ATOM   7029 C  C     . TYR B 2 15  ? -48.609 -9.535  54.558  1.00 45.95  ? 176  TYR A C     1 
ATOM   7030 O  O     . TYR B 2 15  ? -47.491 -9.693  54.868  1.00 51.72  ? 176  TYR A O     1 
ATOM   7031 C  CB    . TYR B 2 15  ? -49.314 -10.382 56.647  1.00 43.43  ? 176  TYR A CB    1 
ATOM   7032 C  CG    . TYR B 2 15  ? -49.730 -10.024 58.010  1.00 45.59  ? 176  TYR A CG    1 
ATOM   7033 C  CD1   . TYR B 2 15  ? -49.299 -8.878  58.607  1.00 47.06  ? 176  TYR A CD1   1 
ATOM   7034 C  CD2   . TYR B 2 15  ? -50.554 -10.824 58.691  1.00 41.12  ? 176  TYR A CD2   1 
ATOM   7035 C  CE1   . TYR B 2 15  ? -49.712 -8.538  59.853  1.00 44.16  ? 176  TYR A CE1   1 
ATOM   7036 C  CE2   . TYR B 2 15  ? -50.964 -10.495 59.929  1.00 50.00  ? 176  TYR A CE2   1 
ATOM   7037 C  CZ    . TYR B 2 15  ? -50.533 -9.361  60.494  1.00 48.78  ? 176  TYR A CZ    1 
ATOM   7038 O  OH    . TYR B 2 15  ? -50.961 -9.119  61.724  1.00 53.99  ? 176  TYR A OH    1 
ATOM   7039 N  N     . LYS B 2 16  ? -49.120 -9.770  53.363  1.00 47.06  ? 177  LYS A N     1 
ATOM   7040 C  CA    . LYS B 2 16  ? -48.445 -10.026 52.095  1.00 41.63  ? 177  LYS A CA    1 
ATOM   7041 C  C     . LYS B 2 16  ? -47.874 -11.369 51.928  1.00 40.02  ? 177  LYS A C     1 
ATOM   7042 O  O     . LYS B 2 16  ? -47.265 -11.630 50.955  1.00 42.37  ? 177  LYS A O     1 
ATOM   7043 C  CB    . LYS B 2 16  ? -47.352 -9.023  51.759  1.00 48.87  ? 177  LYS A CB    1 
ATOM   7044 N  N     . SER B 2 17  ? -48.093 -12.243 52.864  1.00 39.39  ? 178  SER A N     1 
ATOM   7045 C  CA    . SER B 2 17  ? -47.535 -13.536 52.759  1.00 40.44  ? 178  SER A CA    1 
ATOM   7046 C  C     . SER B 2 17  ? -48.381 -14.528 53.468  1.00 37.08  ? 178  SER A C     1 
ATOM   7047 O  O     . SER B 2 17  ? -49.130 -14.210 54.303  1.00 42.36  ? 178  SER A O     1 
ATOM   7048 C  CB    . SER B 2 17  ? -46.135 -13.531 53.291  1.00 44.87  ? 178  SER A CB    1 
ATOM   7049 O  OG    . SER B 2 17  ? -46.161 -13.688 54.647  1.00 42.46  ? 178  SER A OG    1 
ATOM   7050 N  N     . LEU B 2 18  ? -48.214 -15.772 53.134  1.00 36.29  ? 179  LEU A N     1 
ATOM   7051 C  CA    . LEU B 2 18  ? -49.024 -16.774 53.713  1.00 40.89  ? 179  LEU A CA    1 
ATOM   7052 C  C     . LEU B 2 18  ? -48.885 -16.971 55.164  1.00 38.35  ? 179  LEU A C     1 
ATOM   7053 O  O     . LEU B 2 18  ? -47.841 -17.173 55.720  1.00 40.36  ? 179  LEU A O     1 
ATOM   7054 C  CB    . LEU B 2 18  ? -48.840 -18.090 52.980  1.00 37.18  ? 179  LEU A CB    1 
ATOM   7055 C  CG    . LEU B 2 18  ? -49.424 -19.348 53.557  1.00 37.12  ? 179  LEU A CG    1 
ATOM   7056 C  CD1   . LEU B 2 18  ? -50.807 -19.639 53.103  1.00 37.75  ? 179  LEU A CD1   1 
ATOM   7057 C  CD2   . LEU B 2 18  ? -48.544 -20.495 53.196  1.00 30.87  ? 179  LEU A CD2   1 
ATOM   7058 N  N     . TYR B 2 19  ? -50.059 -17.000 55.707  1.00 38.33  ? 180  TYR A N     1 
ATOM   7059 C  CA    . TYR B 2 19  ? -50.470 -17.217 57.061  1.00 45.75  ? 180  TYR A CA    1 
ATOM   7060 C  C     . TYR B 2 19  ? -51.453 -18.383 56.971  1.00 49.46  ? 180  TYR A C     1 
ATOM   7061 O  O     . TYR B 2 19  ? -52.015 -18.654 55.920  1.00 55.70  ? 180  TYR A O     1 
ATOM   7062 C  CB    . TYR B 2 19  ? -51.285 -16.016 57.438  1.00 37.85  ? 180  TYR A CB    1 
ATOM   7063 C  CG    . TYR B 2 19  ? -51.318 -15.575 58.852  1.00 45.96  ? 180  TYR A CG    1 
ATOM   7064 C  CD1   . TYR B 2 19  ? -51.553 -16.421 59.874  1.00 50.50  ? 180  TYR A CD1   1 
ATOM   7065 C  CD2   . TYR B 2 19  ? -51.175 -14.281 59.144  1.00 53.71  ? 180  TYR A CD2   1 
ATOM   7066 C  CE1   . TYR B 2 19  ? -51.583 -15.992 61.157  1.00 45.03  ? 180  TYR A CE1   1 
ATOM   7067 C  CE2   . TYR B 2 19  ? -51.213 -13.848 60.422  1.00 48.02  ? 180  TYR A CE2   1 
ATOM   7068 C  CZ    . TYR B 2 19  ? -51.421 -14.709 61.403  1.00 49.67  ? 180  TYR A CZ    1 
ATOM   7069 O  OH    . TYR B 2 19  ? -51.460 -14.201 62.626  1.00 50.75  ? 180  TYR A OH    1 
ATOM   7070 N  N     . ARG B 2 20  ? -51.678 -19.052 58.060  1.00 38.73  ? 181  ARG A N     1 
ATOM   7071 C  CA    . ARG B 2 20  ? -52.642 -20.143 58.064  1.00 45.09  ? 181  ARG A CA    1 
ATOM   7072 C  C     . ARG B 2 20  ? -52.419 -21.192 57.022  1.00 50.75  ? 181  ARG A C     1 
ATOM   7073 O  O     . ARG B 2 20  ? -53.261 -21.459 56.226  1.00 50.23  ? 181  ARG A O     1 
ATOM   7074 C  CB    . ARG B 2 20  ? -54.106 -19.689 58.044  1.00 46.55  ? 181  ARG A CB    1 
ATOM   7075 C  CG    . ARG B 2 20  ? -54.912 -19.900 59.287  1.00 51.70  ? 181  ARG A CG    1 
ATOM   7076 C  CD    . ARG B 2 20  ? -56.381 -19.685 58.982  1.00 59.49  ? 181  ARG A CD    1 
ATOM   7077 N  NE    . ARG B 2 20  ? -56.892 -20.571 57.952  1.00 58.96  ? 181  ARG A NE    1 
ATOM   7078 C  CZ    . ARG B 2 20  ? -57.448 -20.186 56.822  1.00 57.21  ? 181  ARG A CZ    1 
ATOM   7079 N  NH1   . ARG B 2 20  ? -57.573 -18.914 56.519  1.00 50.58  ? 181  ARG A NH1   1 
ATOM   7080 N  NH2   . ARG B 2 20  ? -57.855 -21.097 55.983  1.00 56.66  ? 181  ARG A NH2   1 
ATOM   7081 N  N     . GLY B 2 21  ? -51.230 -21.735 56.941  1.00 52.89  ? 182  GLY A N     1 
ATOM   7082 C  CA    . GLY B 2 21  ? -50.987 -22.801 56.034  1.00 40.65  ? 182  GLY A CA    1 
ATOM   7083 C  C     . GLY B 2 21  ? -49.874 -23.649 56.500  1.00 39.53  ? 182  GLY A C     1 
ATOM   7084 O  O     . GLY B 2 21  ? -48.998 -23.183 57.117  1.00 35.82  ? 182  GLY A O     1 
ATOM   7085 N  N     . ASP B 2 22  ? -49.895 -24.902 56.142  1.00 42.23  ? 183  ASP A N     1 
ATOM   7086 C  CA    . ASP B 2 22  ? -48.835 -25.775 56.508  1.00 36.81  ? 183  ASP A CA    1 
ATOM   7087 C  C     . ASP B 2 22  ? -48.142 -25.955 55.237  1.00 37.03  ? 183  ASP A C     1 
ATOM   7088 O  O     . ASP B 2 22  ? -48.707 -26.466 54.349  1.00 42.96  ? 183  ASP A O     1 
ATOM   7089 C  CB    . ASP B 2 22  ? -49.380 -27.112 56.920  1.00 35.31  ? 183  ASP A CB    1 
ATOM   7090 C  CG    . ASP B 2 22  ? -48.401 -27.908 57.641  1.00 46.38  ? 183  ASP A CG    1 
ATOM   7091 O  OD1   . ASP B 2 22  ? -47.377 -27.360 58.021  1.00 48.94  ? 183  ASP A OD1   1 
ATOM   7092 O  OD2   . ASP B 2 22  ? -48.641 -29.089 57.821  1.00 43.10  ? 183  ASP A OD2   1 
ATOM   7093 N  N     . ILE B 2 23  ? -46.888 -25.598 55.164  1.00 35.39  ? 184  ILE A N     1 
ATOM   7094 C  CA    . ILE B 2 23  ? -46.166 -25.713 53.944  1.00 30.75  ? 184  ILE A CA    1 
ATOM   7095 C  C     . ILE B 2 23  ? -45.375 -26.991 53.848  1.00 41.51  ? 184  ILE A C     1 
ATOM   7096 O  O     . ILE B 2 23  ? -44.784 -27.428 54.772  1.00 43.14  ? 184  ILE A O     1 
ATOM   7097 C  CB    . ILE B 2 23  ? -45.253 -24.510 53.734  1.00 34.23  ? 184  ILE A CB    1 
ATOM   7098 C  CG1   . ILE B 2 23  ? -46.014 -23.225 53.897  1.00 34.64  ? 184  ILE A CG1   1 
ATOM   7099 C  CG2   . ILE B 2 23  ? -44.691 -24.496 52.344  1.00 37.22  ? 184  ILE A CG2   1 
ATOM   7100 C  CD1   . ILE B 2 23  ? -45.167 -22.082 54.356  1.00 26.02  ? 184  ILE A CD1   1 
ATOM   7101 N  N     . ALA B 2 24  ? -45.457 -27.620 52.703  1.00 37.54  ? 185  ALA A N     1 
ATOM   7102 C  CA    . ALA B 2 24  ? -44.750 -28.814 52.397  1.00 38.18  ? 185  ALA A CA    1 
ATOM   7103 C  C     . ALA B 2 24  ? -43.329 -28.574 52.005  1.00 40.85  ? 185  ALA A C     1 
ATOM   7104 O  O     . ALA B 2 24  ? -42.948 -27.481 51.725  1.00 48.63  ? 185  ALA A O     1 
ATOM   7105 C  CB    . ALA B 2 24  ? -45.445 -29.482 51.266  1.00 37.87  ? 185  ALA A CB    1 
ATOM   7106 N  N     . ARG B 2 25  ? -42.522 -29.608 52.009  1.00 37.96  ? 186  ARG A N     1 
ATOM   7107 C  CA    . ARG B 2 25  ? -41.166 -29.471 51.548  1.00 42.25  ? 186  ARG A CA    1 
ATOM   7108 C  C     . ARG B 2 25  ? -41.279 -29.948 50.130  1.00 38.50  ? 186  ARG A C     1 
ATOM   7109 O  O     . ARG B 2 25  ? -41.820 -30.957 49.856  1.00 36.84  ? 186  ARG A O     1 
ATOM   7110 C  CB    . ARG B 2 25  ? -40.202 -30.302 52.370  1.00 41.73  ? 186  ARG A CB    1 
ATOM   7111 C  CG    . ARG B 2 25  ? -38.942 -29.564 52.793  1.00 44.18  ? 186  ARG A CG    1 
ATOM   7112 C  CD    . ARG B 2 25  ? -38.330 -30.219 54.014  1.00 51.41  ? 186  ARG A CD    1 
ATOM   7113 N  NE    . ARG B 2 25  ? -37.302 -29.419 54.657  1.00 49.82  ? 186  ARG A NE    1 
ATOM   7114 C  CZ    . ARG B 2 25  ? -36.996 -29.497 55.948  1.00 54.81  ? 186  ARG A CZ    1 
ATOM   7115 N  NH1   . ARG B 2 25  ? -37.638 -30.331 56.723  1.00 43.76  ? 186  ARG A NH1   1 
ATOM   7116 N  NH2   . ARG B 2 25  ? -36.053 -28.739 56.470  1.00 49.67  ? 186  ARG A NH2   1 
ATOM   7117 N  N     . TYR B 2 26  ? -40.830 -29.127 49.219  1.00 38.65  ? 187  TYR A N     1 
ATOM   7118 C  CA    . TYR B 2 26  ? -40.952 -29.400 47.830  1.00 41.32  ? 187  TYR A CA    1 
ATOM   7119 C  C     . TYR B 2 26  ? -39.871 -28.776 47.021  1.00 37.10  ? 187  TYR A C     1 
ATOM   7120 O  O     . TYR B 2 26  ? -39.307 -27.830 47.414  1.00 37.30  ? 187  TYR A O     1 
ATOM   7121 C  CB    . TYR B 2 26  ? -42.274 -28.829 47.368  1.00 37.93  ? 187  TYR A CB    1 
ATOM   7122 C  CG    . TYR B 2 26  ? -42.400 -27.346 47.484  1.00 40.24  ? 187  TYR A CG    1 
ATOM   7123 C  CD1   . TYR B 2 26  ? -41.589 -26.524 46.787  1.00 41.26  ? 187  TYR A CD1   1 
ATOM   7124 C  CD2   . TYR B 2 26  ? -43.349 -26.775 48.271  1.00 37.84  ? 187  TYR A CD2   1 
ATOM   7125 C  CE1   . TYR B 2 26  ? -41.697 -25.190 46.876  1.00 34.09  ? 187  TYR A CE1   1 
ATOM   7126 C  CE2   . TYR B 2 26  ? -43.443 -25.422 48.356  1.00 32.77  ? 187  TYR A CE2   1 
ATOM   7127 C  CZ    . TYR B 2 26  ? -42.598 -24.669 47.639  1.00 30.45  ? 187  TYR A CZ    1 
ATOM   7128 O  OH    . TYR B 2 26  ? -42.646 -23.358 47.666  1.00 31.64  ? 187  TYR A OH    1 
ATOM   7129 N  N     . LYS B 2 27  ? -39.624 -29.303 45.846  1.00 38.21  ? 188  LYS A N     1 
ATOM   7130 C  CA    . LYS B 2 27  ? -38.642 -28.744 44.976  1.00 39.30  ? 188  LYS A CA    1 
ATOM   7131 C  C     . LYS B 2 27  ? -39.391 -28.195 43.822  1.00 42.52  ? 188  LYS A C     1 
ATOM   7132 O  O     . LYS B 2 27  ? -40.137 -28.876 43.221  1.00 44.66  ? 188  LYS A O     1 
ATOM   7133 C  CB    . LYS B 2 27  ? -37.771 -29.839 44.502  1.00 39.30  ? 188  LYS A CB    1 
ATOM   7134 C  CG    . LYS B 2 27  ? -36.338 -29.436 44.435  1.00 52.19  ? 188  LYS A CG    1 
ATOM   7135 C  CD    . LYS B 2 27  ? -36.193 -28.163 43.667  1.00 44.60  ? 188  LYS A CD    1 
ATOM   7136 C  CE    . LYS B 2 27  ? -34.840 -28.121 43.042  1.00 55.95  ? 188  LYS A CE    1 
ATOM   7137 N  NZ    . LYS B 2 27  ? -34.890 -27.272 41.837  1.00 61.74  ? 188  LYS A NZ    1 
ATOM   7138 N  N     . ARG B 2 28  ? -39.222 -26.936 43.520  1.00 38.78  ? 189  ARG A N     1 
ATOM   7139 C  CA    . ARG B 2 28  ? -39.976 -26.343 42.454  1.00 38.58  ? 189  ARG A CA    1 
ATOM   7140 C  C     . ARG B 2 28  ? -39.307 -26.494 41.145  1.00 39.04  ? 189  ARG A C     1 
ATOM   7141 O  O     . ARG B 2 28  ? -38.168 -26.784 41.083  1.00 41.81  ? 189  ARG A O     1 
ATOM   7142 C  CB    . ARG B 2 28  ? -40.186 -24.899 42.737  1.00 30.95  ? 189  ARG A CB    1 
ATOM   7143 C  CG    . ARG B 2 28  ? -38.905 -24.186 42.603  1.00 33.77  ? 189  ARG A CG    1 
ATOM   7144 C  CD    . ARG B 2 28  ? -39.109 -22.737 42.761  1.00 34.93  ? 189  ARG A CD    1 
ATOM   7145 N  NE    . ARG B 2 28  ? -39.371 -22.440 44.130  1.00 39.79  ? 189  ARG A NE    1 
ATOM   7146 C  CZ    . ARG B 2 28  ? -38.479 -21.960 44.947  1.00 35.13  ? 189  ARG A CZ    1 
ATOM   7147 N  NH1   . ARG B 2 28  ? -38.804 -21.713 46.165  1.00 37.24  ? 189  ARG A NH1   1 
ATOM   7148 N  NH2   . ARG B 2 28  ? -37.273 -21.760 44.542  1.00 32.16  ? 189  ARG A NH2   1 
ATOM   7149 N  N     . LYS B 2 29  ? -40.014 -26.225 40.093  1.00 32.46  ? 190  LYS A N     1 
ATOM   7150 C  CA    . LYS B 2 29  ? -39.454 -26.371 38.804  1.00 36.65  ? 190  LYS A CA    1 
ATOM   7151 C  C     . LYS B 2 29  ? -38.700 -25.151 38.454  1.00 36.34  ? 190  LYS A C     1 
ATOM   7152 O  O     . LYS B 2 29  ? -39.262 -24.162 38.222  1.00 36.24  ? 190  LYS A O     1 
ATOM   7153 C  CB    . LYS B 2 29  ? -40.601 -26.575 37.839  1.00 36.54  ? 190  LYS A CB    1 
ATOM   7154 C  CG    . LYS B 2 29  ? -40.346 -26.364 36.404  1.00 28.90  ? 190  LYS A CG    1 
ATOM   7155 C  CD    . LYS B 2 29  ? -39.936 -27.631 35.771  1.00 32.47  ? 190  LYS A CD    1 
ATOM   7156 C  CE    . LYS B 2 29  ? -40.039 -27.486 34.304  1.00 38.89  ? 190  LYS A CE    1 
ATOM   7157 N  NZ    . LYS B 2 29  ? -39.964 -28.860 33.843  1.00 39.47  ? 190  LYS A NZ    1 
ATOM   7158 N  N     . GLY B 2 30  ? -37.395 -25.250 38.436  1.00 36.38  ? 191  GLY A N     1 
ATOM   7159 C  CA    . GLY B 2 30  ? -36.573 -24.171 38.021  1.00 40.77  ? 191  GLY A CA    1 
ATOM   7160 C  C     . GLY B 2 30  ? -36.496 -22.933 38.833  1.00 43.08  ? 191  GLY A C     1 
ATOM   7161 O  O     . GLY B 2 30  ? -36.832 -22.906 39.983  1.00 46.21  ? 191  GLY A O     1 
ATOM   7162 N  N     . ASP B 2 31  ? -36.018 -21.891 38.185  1.00 45.54  ? 192  ASP A N     1 
ATOM   7163 C  CA    . ASP B 2 31  ? -35.877 -20.627 38.816  1.00 42.18  ? 192  ASP A CA    1 
ATOM   7164 C  C     . ASP B 2 31  ? -36.745 -19.511 38.354  1.00 45.03  ? 192  ASP A C     1 
ATOM   7165 O  O     . ASP B 2 31  ? -36.565 -18.422 38.816  1.00 51.28  ? 192  ASP A O     1 
ATOM   7166 C  CB    . ASP B 2 31  ? -34.454 -20.188 38.750  1.00 45.17  ? 192  ASP A CB    1 
ATOM   7167 C  CG    . ASP B 2 31  ? -33.590 -21.052 39.513  1.00 51.61  ? 192  ASP A CG    1 
ATOM   7168 O  OD1   . ASP B 2 31  ? -33.227 -22.091 39.019  1.00 51.72  ? 192  ASP A OD1   1 
ATOM   7169 O  OD2   . ASP B 2 31  ? -33.287 -20.724 40.642  1.00 65.12  ? 192  ASP A OD2   1 
ATOM   7170 N  N     . SER B 2 32  ? -37.687 -19.745 37.472  1.00 43.44  ? 193  SER A N     1 
ATOM   7171 C  CA    . SER B 2 32  ? -38.516 -18.641 37.064  1.00 42.70  ? 193  SER A CA    1 
ATOM   7172 C  C     . SER B 2 32  ? -39.963 -18.746 37.469  1.00 48.54  ? 193  SER A C     1 
ATOM   7173 O  O     . SER B 2 32  ? -40.286 -19.229 38.508  1.00 44.46  ? 193  SER A O     1 
ATOM   7174 C  CB    . SER B 2 32  ? -38.372 -18.339 35.599  1.00 39.36  ? 193  SER A CB    1 
ATOM   7175 O  OG    . SER B 2 32  ? -38.254 -16.959 35.442  1.00 46.32  ? 193  SER A OG    1 
ATOM   7176 N  N     . CYS B 2 33  ? -40.834 -18.168 36.674  1.00 53.67  ? 194  CYS A N     1 
ATOM   7177 C  CA    . CYS B 2 33  ? -42.237 -18.198 36.950  1.00 45.12  ? 194  CYS A CA    1 
ATOM   7178 C  C     . CYS B 2 33  ? -42.940 -18.481 35.670  1.00 42.63  ? 194  CYS A C     1 
ATOM   7179 O  O     . CYS B 2 33  ? -42.621 -17.906 34.694  1.00 42.36  ? 194  CYS A O     1 
ATOM   7180 C  CB    . CYS B 2 33  ? -42.616 -16.858 37.410  1.00 43.45  ? 194  CYS A CB    1 
ATOM   7181 S  SG    . CYS B 2 33  ? -43.980 -16.918 38.444  1.00 43.35  ? 194  CYS A SG    1 
ATOM   7182 N  N     . LEU B 2 34  ? -43.933 -19.335 35.670  1.00 42.22  ? 195  LEU A N     1 
ATOM   7183 C  CA    . LEU B 2 34  ? -44.560 -19.663 34.421  1.00 40.48  ? 195  LEU A CA    1 
ATOM   7184 C  C     . LEU B 2 34  ? -45.243 -18.527 33.752  1.00 44.75  ? 195  LEU A C     1 
ATOM   7185 O  O     . LEU B 2 34  ? -45.082 -18.290 32.558  1.00 53.59  ? 195  LEU A O     1 
ATOM   7186 C  CB    . LEU B 2 34  ? -45.534 -20.806 34.563  1.00 42.13  ? 195  LEU A CB    1 
ATOM   7187 C  CG    . LEU B 2 34  ? -45.832 -21.424 33.230  1.00 32.86  ? 195  LEU A CG    1 
ATOM   7188 C  CD1   . LEU B 2 34  ? -44.547 -21.460 32.491  1.00 35.85  ? 195  LEU A CD1   1 
ATOM   7189 C  CD2   . LEU B 2 34  ? -46.358 -22.805 33.362  1.00 36.71  ? 195  LEU A CD2   1 
ATOM   7190 N  N     . GLY B 2 35  ? -45.953 -17.754 34.512  1.00 39.61  ? 196  GLY A N     1 
ATOM   7191 C  CA    . GLY B 2 35  ? -46.684 -16.693 33.874  1.00 54.11  ? 196  GLY A CA    1 
ATOM   7192 C  C     . GLY B 2 35  ? -45.893 -15.642 33.151  1.00 49.52  ? 196  GLY A C     1 
ATOM   7193 O  O     . GLY B 2 35  ? -46.282 -15.147 32.128  1.00 41.93  ? 196  GLY A O     1 
ATOM   7194 N  N     . ILE B 2 36  ? -44.701 -15.364 33.657  1.00 55.10  ? 197  ILE A N     1 
ATOM   7195 C  CA    . ILE B 2 36  ? -43.968 -14.181 33.270  1.00 52.50  ? 197  ILE A CA    1 
ATOM   7196 C  C     . ILE B 2 36  ? -43.881 -14.238 31.765  1.00 56.57  ? 197  ILE A C     1 
ATOM   7197 O  O     . ILE B 2 36  ? -43.410 -15.220 31.221  1.00 58.97  ? 197  ILE A O     1 
ATOM   7198 C  CB    . ILE B 2 36  ? -42.591 -14.187 33.998  1.00 52.80  ? 197  ILE A CB    1 
ATOM   7199 C  CG1   . ILE B 2 36  ? -42.417 -12.919 34.822  1.00 57.62  ? 197  ILE A CG1   1 
ATOM   7200 C  CG2   . ILE B 2 36  ? -41.381 -14.440 33.097  1.00 46.61  ? 197  ILE A CG2   1 
ATOM   7201 C  CD1   . ILE B 2 36  ? -42.035 -13.182 36.258  1.00 53.16  ? 197  ILE A CD1   1 
ATOM   7202 N  N     . ASN B 2 37  ? -44.299 -13.169 31.101  1.00 64.90  ? 198  ASN A N     1 
ATOM   7203 C  CA    . ASN B 2 37  ? -44.594 -13.256 29.677  1.00 68.92  ? 198  ASN A CA    1 
ATOM   7204 C  C     . ASN B 2 37  ? -43.561 -12.726 28.718  1.00 79.46  ? 198  ASN A C     1 
ATOM   7205 O  O     . ASN B 2 37  ? -43.168 -13.439 27.786  1.00 85.66  ? 198  ASN A O     1 
ATOM   7206 C  CB    . ASN B 2 37  ? -45.925 -12.565 29.379  1.00 63.98  ? 198  ASN A CB    1 
ATOM   7207 N  N     . PRO B 2 38  ? -43.127 -11.413 28.957  1.00 74.97  ? 199  PRO A N     1 
ATOM   7208 C  CA    . PRO B 2 38  ? -42.102 -10.973 28.011  1.00 75.91  ? 199  PRO A CA    1 
ATOM   7209 C  C     . PRO B 2 38  ? -40.742 -11.215 28.601  1.00 74.85  ? 199  PRO A C     1 
ATOM   7210 O  O     . PRO B 2 38  ? -39.741 -10.964 27.947  1.00 78.98  ? 199  PRO A O     1 
ATOM   7211 C  CB    . PRO B 2 38  ? -42.356 -9.467  27.864  1.00 78.62  ? 199  PRO A CB    1 
ATOM   7212 C  CG    . PRO B 2 38  ? -43.328 -9.080  28.916  1.00 71.09  ? 199  PRO A CG    1 
ATOM   7213 C  CD    . PRO B 2 38  ? -43.356 -10.210 29.881  1.00 59.41  ? 199  PRO A CD    1 
ATOM   7214 N  N     . LYS B 2 39  ? -40.697 -11.674 29.843  1.00 59.69  ? 200  LYS A N     1 
ATOM   7215 C  CA    . LYS B 2 39  ? -39.439 -11.756 30.538  1.00 58.17  ? 200  LYS A CA    1 
ATOM   7216 C  C     . LYS B 2 39  ? -38.854 -10.352 30.552  1.00 74.24  ? 200  LYS A C     1 
ATOM   7217 O  O     . LYS B 2 39  ? -37.658 -10.146 30.383  1.00 76.20  ? 200  LYS A O     1 
ATOM   7218 C  CB    . LYS B 2 39  ? -38.530 -12.746 29.842  1.00 50.69  ? 200  LYS A CB    1 
ATOM   7219 C  CG    . LYS B 2 39  ? -39.283 -13.950 29.328  1.00 50.02  ? 200  LYS A CG    1 
ATOM   7220 C  CD    . LYS B 2 39  ? -38.356 -15.104 29.005  1.00 66.01  ? 200  LYS A CD    1 
ATOM   7221 C  CE    . LYS B 2 39  ? -39.124 -16.406 28.821  1.00 72.28  ? 200  LYS A CE    1 
ATOM   7222 N  NZ    . LYS B 2 39  ? -40.548 -16.198 28.435  1.00 69.19  ? 200  LYS A NZ    1 
ATOM   7223 N  N     . LYS B 2 40  ? -39.758 -9.393  30.727  1.00 80.27  ? 201  LYS A N     1 
ATOM   7224 C  CA    . LYS B 2 40  ? -39.449 -7.994  30.979  1.00 77.13  ? 201  LYS A CA    1 
ATOM   7225 C  C     . LYS B 2 40  ? -39.439 -7.894  32.489  1.00 76.50  ? 201  LYS A C     1 
ATOM   7226 O  O     . LYS B 2 40  ? -39.364 -6.812  33.058  1.00 66.58  ? 201  LYS A O     1 
ATOM   7227 C  CB    . LYS B 2 40  ? -40.537 -7.084  30.415  1.00 71.09  ? 201  LYS A CB    1 
ATOM   7228 C  CG    . LYS B 2 40  ? -40.327 -6.665  28.968  1.00 83.64  ? 201  LYS A CG    1 
ATOM   7229 C  CD    . LYS B 2 40  ? -41.615 -6.150  28.331  1.00 84.82  ? 201  LYS A CD    1 
ATOM   7230 C  CE    . LYS B 2 40  ? -41.738 -6.594  26.878  1.00 76.78  ? 201  LYS A CE    1 
ATOM   7231 N  NZ    . LYS B 2 40  ? -43.121 -6.475  26.342  1.00 72.56  ? 201  LYS A NZ    1 
ATOM   7232 N  N     . GLN B 2 41  ? -39.559 -9.063  33.113  1.00 73.82  ? 202  GLN A N     1 
ATOM   7233 C  CA    . GLN B 2 41  ? -39.661 -9.216  34.513  1.00 62.92  ? 202  GLN A CA    1 
ATOM   7234 C  C     . GLN B 2 41  ? -38.745 -10.373 34.860  1.00 63.84  ? 202  GLN A C     1 
ATOM   7235 O  O     . GLN B 2 41  ? -38.504 -11.260 34.073  1.00 59.39  ? 202  GLN A O     1 
ATOM   7236 C  CB    . GLN B 2 41  ? -41.076 -9.604  34.833  1.00 62.17  ? 202  GLN A CB    1 
ATOM   7237 C  CG    . GLN B 2 41  ? -42.062 -8.504  34.560  1.00 72.04  ? 202  GLN A CG    1 
ATOM   7238 C  CD    . GLN B 2 41  ? -43.457 -9.004  34.368  1.00 69.50  ? 202  GLN A CD    1 
ATOM   7239 O  OE1   . GLN B 2 41  ? -44.404 -8.359  34.761  1.00 67.87  ? 202  GLN A OE1   1 
ATOM   7240 N  NE2   . GLN B 2 41  ? -43.588 -10.150 33.750  1.00 61.80  ? 202  GLN A NE2   1 
ATOM   7241 N  N     . CYS B 2 42  ? -38.185 -10.326 36.049  1.00 61.13  ? 203  CYS A N     1 
ATOM   7242 C  CA    . CYS B 2 42  ? -37.346 -11.382 36.556  1.00 54.74  ? 203  CYS A CA    1 
ATOM   7243 C  C     . CYS B 2 42  ? -37.530 -11.410 38.053  1.00 56.41  ? 203  CYS A C     1 
ATOM   7244 O  O     . CYS B 2 42  ? -37.711 -10.388 38.639  1.00 56.99  ? 203  CYS A O     1 
ATOM   7245 C  CB    . CYS B 2 42  ? -35.916 -11.082 36.195  1.00 51.15  ? 203  CYS A CB    1 
ATOM   7246 S  SG    . CYS B 2 42  ? -34.796 -12.415 36.502  1.00 58.98  ? 203  CYS A SG    1 
ATOM   7247 N  N     . ILE B 2 43  ? -37.478 -12.573 38.675  1.00 56.85  ? 204  ILE A N     1 
ATOM   7248 C  CA    . ILE B 2 43  ? -37.617 -12.674 40.114  1.00 56.36  ? 204  ILE A CA    1 
ATOM   7249 C  C     . ILE B 2 43  ? -36.578 -13.571 40.673  1.00 51.62  ? 204  ILE A C     1 
ATOM   7250 O  O     . ILE B 2 43  ? -36.123 -14.441 40.014  1.00 53.21  ? 204  ILE A O     1 
ATOM   7251 C  CB    . ILE B 2 43  ? -38.910 -13.321 40.520  1.00 54.21  ? 204  ILE A CB    1 
ATOM   7252 C  CG1   . ILE B 2 43  ? -38.906 -14.749 40.092  1.00 47.23  ? 204  ILE A CG1   1 
ATOM   7253 C  CG2   . ILE B 2 43  ? -40.100 -12.624 39.907  1.00 50.75  ? 204  ILE A CG2   1 
ATOM   7254 C  CD1   . ILE B 2 43  ? -40.308 -15.251 39.965  1.00 54.81  ? 204  ILE A CD1   1 
ATOM   7255 N  N     . SER B 2 44  ? -36.223 -13.390 41.920  1.00 46.13  ? 205  SER A N     1 
ATOM   7256 C  CA    . SER B 2 44  ? -35.190 -14.223 42.472  1.00 43.87  ? 205  SER A CA    1 
ATOM   7257 C  C     . SER B 2 44  ? -35.561 -15.075 43.657  1.00 46.57  ? 205  SER A C     1 
ATOM   7258 O  O     . SER B 2 44  ? -35.918 -14.584 44.689  1.00 56.61  ? 205  SER A O     1 
ATOM   7259 C  CB    . SER B 2 44  ? -34.063 -13.309 42.894  1.00 57.30  ? 205  SER A CB    1 
ATOM   7260 O  OG    . SER B 2 44  ? -32.829 -13.964 42.882  1.00 59.50  ? 205  SER A OG    1 
ATOM   7261 N  N     . TRP B 2 45  ? -35.465 -16.367 43.531  1.00 42.19  ? 206  TRP A N     1 
ATOM   7262 C  CA    . TRP B 2 45  ? -35.723 -17.128 44.695  1.00 44.32  ? 206  TRP A CA    1 
ATOM   7263 C  C     . TRP B 2 45  ? -34.525 -17.001 45.609  1.00 52.02  ? 206  TRP A C     1 
ATOM   7264 O  O     . TRP B 2 45  ? -34.646 -17.053 46.802  1.00 61.05  ? 206  TRP A O     1 
ATOM   7265 C  CB    . TRP B 2 45  ? -35.983 -18.559 44.349  1.00 35.23  ? 206  TRP A CB    1 
ATOM   7266 C  CG    . TRP B 2 45  ? -37.101 -18.733 43.424  1.00 42.65  ? 206  TRP A CG    1 
ATOM   7267 C  CD1   . TRP B 2 45  ? -37.015 -18.936 42.121  1.00 46.34  ? 206  TRP A CD1   1 
ATOM   7268 C  CD2   . TRP B 2 45  ? -38.484 -18.691 43.721  1.00 41.26  ? 206  TRP A CD2   1 
ATOM   7269 N  NE1   . TRP B 2 45  ? -38.229 -19.023 41.575  1.00 41.09  ? 206  TRP A NE1   1 
ATOM   7270 C  CE2   . TRP B 2 45  ? -39.159 -18.880 42.547  1.00 40.62  ? 206  TRP A CE2   1 
ATOM   7271 C  CE3   . TRP B 2 45  ? -39.209 -18.497 44.865  1.00 37.06  ? 206  TRP A CE3   1 
ATOM   7272 C  CZ2   . TRP B 2 45  ? -40.499 -18.904 42.479  1.00 35.50  ? 206  TRP A CZ2   1 
ATOM   7273 C  CZ3   . TRP B 2 45  ? -40.518 -18.528 44.787  1.00 44.21  ? 206  TRP A CZ3   1 
ATOM   7274 C  CH2   . TRP B 2 45  ? -41.161 -18.730 43.612  1.00 41.26  ? 206  TRP A CH2   1 
ATOM   7275 N  N     . GLU B 2 46  ? -33.366 -16.815 45.012  1.00 59.20  ? 207  GLU A N     1 
ATOM   7276 C  CA    . GLU B 2 46  ? -32.076 -16.688 45.646  1.00 64.82  ? 207  GLU A CA    1 
ATOM   7277 C  C     . GLU B 2 46  ? -31.753 -17.918 46.450  1.00 69.82  ? 207  GLU A C     1 
ATOM   7278 O  O     . GLU B 2 46  ? -31.207 -18.873 45.910  1.00 75.69  ? 207  GLU A O     1 
ATOM   7279 C  CB    . GLU B 2 46  ? -31.931 -15.392 46.444  1.00 56.78  ? 207  GLU A CB    1 
ATOM   7280 N  N     . THR B 2 50  ? -24.170 -24.330 41.911  1.00 81.45  ? 211  THR A N     1 
ATOM   7281 C  CA    . THR B 2 50  ? -24.575 -25.721 42.114  1.00 84.88  ? 211  THR A CA    1 
ATOM   7282 C  C     . THR B 2 50  ? -24.468 -26.450 40.780  1.00 80.01  ? 211  THR A C     1 
ATOM   7283 O  O     . THR B 2 50  ? -25.226 -27.350 40.433  1.00 73.74  ? 211  THR A O     1 
ATOM   7284 C  CB    . THR B 2 50  ? -26.004 -25.844 42.671  1.00 78.34  ? 211  THR A CB    1 
ATOM   7285 O  OG1   . THR B 2 50  ? -26.578 -24.567 42.897  1.00 71.12  ? 211  THR A OG1   1 
ATOM   7286 C  CG2   . THR B 2 50  ? -25.983 -26.578 43.961  1.00 72.32  ? 211  THR A CG2   1 
ATOM   7287 N  N     . GLU B 2 51  ? -23.425 -26.068 40.076  1.00 81.46  ? 212  GLU A N     1 
ATOM   7288 C  CA    . GLU B 2 51  ? -23.117 -26.577 38.782  1.00 80.15  ? 212  GLU A CA    1 
ATOM   7289 C  C     . GLU B 2 51  ? -22.532 -27.939 38.841  1.00 73.48  ? 212  GLU A C     1 
ATOM   7290 O  O     . GLU B 2 51  ? -22.077 -28.390 39.862  1.00 77.51  ? 212  GLU A O     1 
ATOM   7291 C  CB    . GLU B 2 51  ? -22.222 -25.556 38.033  1.00 76.35  ? 212  GLU A CB    1 
ATOM   7292 C  CG    . GLU B 2 51  ? -20.857 -25.969 37.487  1.00 61.42  ? 212  GLU A CG    1 
ATOM   7293 C  CD    . GLU B 2 51  ? -19.712 -25.633 38.394  1.00 71.62  ? 212  GLU A CD    1 
ATOM   7294 O  OE1   . GLU B 2 51  ? -18.919 -24.763 38.032  1.00 62.39  ? 212  GLU A OE1   1 
ATOM   7295 O  OE2   . GLU B 2 51  ? -19.570 -26.238 39.459  1.00 85.30  ? 212  GLU A OE2   1 
ATOM   7296 N  N     . LYS B 2 52  ? -22.657 -28.629 37.735  1.00 74.81  ? 213  LYS A N     1 
ATOM   7297 C  CA    . LYS B 2 52  ? -22.055 -29.890 37.553  1.00 65.07  ? 213  LYS A CA    1 
ATOM   7298 C  C     . LYS B 2 52  ? -21.398 -29.801 36.212  1.00 63.28  ? 213  LYS A C     1 
ATOM   7299 O  O     . LYS B 2 52  ? -21.993 -30.209 35.251  1.00 71.40  ? 213  LYS A O     1 
ATOM   7300 C  CB    . LYS B 2 52  ? -23.118 -30.952 37.518  1.00 64.23  ? 213  LYS A CB    1 
ATOM   7301 C  CG    . LYS B 2 52  ? -22.658 -32.238 36.911  1.00 68.25  ? 213  LYS A CG    1 
ATOM   7302 C  CD    . LYS B 2 52  ? -21.889 -33.051 37.903  1.00 69.22  ? 213  LYS A CD    1 
ATOM   7303 C  CE    . LYS B 2 52  ? -20.800 -32.250 38.533  1.00 62.37  ? 213  LYS A CE    1 
ATOM   7304 N  NZ    . LYS B 2 52  ? -20.141 -33.164 39.452  1.00 61.50  ? 213  LYS A NZ    1 
ATOM   7305 N  N     . LYS B 2 53  ? -20.186 -29.303 36.140  1.00 59.41  ? 214  LYS A N     1 
ATOM   7306 C  CA    . LYS B 2 53  ? -19.520 -29.257 34.867  1.00 57.52  ? 214  LYS A CA    1 
ATOM   7307 C  C     . LYS B 2 53  ? -18.467 -30.302 34.770  1.00 56.18  ? 214  LYS A C     1 
ATOM   7308 O  O     . LYS B 2 53  ? -18.255 -31.059 35.678  1.00 50.99  ? 214  LYS A O     1 
ATOM   7309 C  CB    . LYS B 2 53  ? -18.968 -27.894 34.571  1.00 54.73  ? 214  LYS A CB    1 
ATOM   7310 C  CG    . LYS B 2 53  ? -19.941 -27.067 33.781  1.00 48.91  ? 214  LYS A CG    1 
ATOM   7311 C  CD    . LYS B 2 53  ? -19.585 -27.121 32.338  1.00 48.47  ? 214  LYS A CD    1 
ATOM   7312 C  CE    . LYS B 2 53  ? -18.428 -26.217 32.101  1.00 50.28  ? 214  LYS A CE    1 
ATOM   7313 N  NZ    . LYS B 2 53  ? -18.568 -25.748 30.738  1.00 50.23  ? 214  LYS A NZ    1 
ATOM   7314 N  N     . HIS B 2 54  ? -17.844 -30.393 33.625  1.00 59.86  ? 215  HIS A N     1 
ATOM   7315 C  CA    . HIS B 2 54  ? -16.877 -31.453 33.462  1.00 52.59  ? 215  HIS A CA    1 
ATOM   7316 C  C     . HIS B 2 54  ? -15.721 -31.424 34.416  1.00 56.14  ? 215  HIS A C     1 
ATOM   7317 O  O     . HIS B 2 54  ? -15.192 -32.440 34.746  1.00 57.88  ? 215  HIS A O     1 
ATOM   7318 C  CB    . HIS B 2 54  ? -16.454 -31.702 31.992  1.00 44.29  ? 215  HIS A CB    1 
ATOM   7319 C  CG    . HIS B 2 54  ? -15.577 -30.655 31.360  1.00 49.94  ? 215  HIS A CG    1 
ATOM   7320 N  ND1   . HIS B 2 54  ? -14.213 -30.745 31.337  1.00 56.96  ? 215  HIS A ND1   1 
ATOM   7321 C  CD2   . HIS B 2 54  ? -15.872 -29.560 30.630  1.00 54.51  ? 215  HIS A CD2   1 
ATOM   7322 C  CE1   . HIS B 2 54  ? -13.701 -29.721 30.689  1.00 48.76  ? 215  HIS A CE1   1 
ATOM   7323 N  NE2   . HIS B 2 54  ? -14.689 -28.993 30.238  1.00 47.08  ? 215  HIS A NE2   1 
ATOM   7324 N  N     . SER B 2 55  ? -15.301 -30.244 34.814  1.00 57.89  ? 216  SER A N     1 
ATOM   7325 C  CA    . SER B 2 55  ? -14.168 -30.063 35.685  1.00 60.28  ? 216  SER A CA    1 
ATOM   7326 C  C     . SER B 2 55  ? -14.537 -29.981 37.164  1.00 61.96  ? 216  SER A C     1 
ATOM   7327 O  O     . SER B 2 55  ? -13.729 -29.653 37.996  1.00 58.32  ? 216  SER A O     1 
ATOM   7328 C  CB    . SER B 2 55  ? -13.333 -28.897 35.196  1.00 57.38  ? 216  SER A CB    1 
ATOM   7329 O  OG    . SER B 2 55  ? -14.152 -27.877 34.696  1.00 65.80  ? 216  SER A OG    1 
ATOM   7330 N  N     . ARG B 2 56  ? -15.797 -30.257 37.443  1.00 58.36  ? 217  ARG A N     1 
ATOM   7331 C  CA    . ARG B 2 56  ? -16.320 -30.261 38.784  1.00 62.88  ? 217  ARG A CA    1 
ATOM   7332 C  C     . ARG B 2 56  ? -15.714 -31.413 39.544  1.00 70.10  ? 217  ARG A C     1 
ATOM   7333 O  O     . ARG B 2 56  ? -15.559 -32.471 39.009  1.00 62.63  ? 217  ARG A O     1 
ATOM   7334 C  CB    . ARG B 2 56  ? -17.822 -30.370 38.774  1.00 63.24  ? 217  ARG A CB    1 
ATOM   7335 N  N     . LYS B 2 57  ? -15.502 -31.255 40.839  1.00 80.57  ? 218  LYS A N     1 
ATOM   7336 C  CA    . LYS B 2 57  ? -14.791 -32.271 41.598  1.00 77.10  ? 218  LYS A CA    1 
ATOM   7337 C  C     . LYS B 2 57  ? -15.407 -33.637 41.609  1.00 77.10  ? 218  LYS A C     1 
ATOM   7338 O  O     . LYS B 2 57  ? -14.712 -34.624 41.544  1.00 73.27  ? 218  LYS A O     1 
ATOM   7339 C  CB    . LYS B 2 57  ? -14.570 -31.811 43.022  1.00 70.95  ? 218  LYS A CB    1 
ATOM   7340 C  CG    . LYS B 2 57  ? -13.198 -31.235 43.274  1.00 71.06  ? 218  LYS A CG    1 
ATOM   7341 C  CD    . LYS B 2 57  ? -12.763 -30.332 42.140  1.00 70.78  ? 218  LYS A CD    1 
ATOM   7342 C  CE    . LYS B 2 57  ? -11.853 -31.056 41.170  1.00 67.11  ? 218  LYS A CE    1 
ATOM   7343 N  NZ    . LYS B 2 57  ? -10.698 -30.215 40.789  1.00 60.96  ? 218  LYS A NZ    1 
ATOM   7344 N  N     . GLN B 2 58  ? -16.719 -33.719 41.676  1.00 75.85  ? 219  GLN A N     1 
ATOM   7345 C  CA    . GLN B 2 58  ? -17.331 -35.020 41.713  1.00 73.04  ? 219  GLN A CA    1 
ATOM   7346 C  C     . GLN B 2 58  ? -17.003 -35.721 40.440  1.00 78.64  ? 219  GLN A C     1 
ATOM   7347 O  O     . GLN B 2 58  ? -16.715 -36.898 40.436  1.00 83.67  ? 219  GLN A O     1 
ATOM   7348 C  CB    . GLN B 2 58  ? -18.829 -34.907 41.857  1.00 66.89  ? 219  GLN A CB    1 
ATOM   7349 N  N     . VAL B 2 59  ? -17.012 -34.973 39.355  1.00 78.82  ? 220  VAL A N     1 
ATOM   7350 C  CA    . VAL B 2 59  ? -16.753 -35.520 38.043  1.00 68.54  ? 220  VAL A CA    1 
ATOM   7351 C  C     . VAL B 2 59  ? -15.316 -35.852 37.865  1.00 75.20  ? 220  VAL A C     1 
ATOM   7352 O  O     . VAL B 2 59  ? -14.978 -36.895 37.386  1.00 76.75  ? 220  VAL A O     1 
ATOM   7353 C  CB    . VAL B 2 59  ? -17.086 -34.500 36.988  1.00 58.13  ? 220  VAL A CB    1 
ATOM   7354 C  CG1   . VAL B 2 59  ? -16.388 -34.814 35.706  1.00 54.02  ? 220  VAL A CG1   1 
ATOM   7355 C  CG2   . VAL B 2 59  ? -18.569 -34.400 36.801  1.00 56.28  ? 220  VAL A CG2   1 
ATOM   7356 N  N     . GLU B 2 60  ? -14.444 -34.970 38.302  1.00 75.82  ? 221  GLU A N     1 
ATOM   7357 C  CA    . GLU B 2 60  ? -13.037 -35.196 38.104  1.00 75.38  ? 221  GLU A CA    1 
ATOM   7358 C  C     . GLU B 2 60  ? -12.451 -36.469 38.692  1.00 82.54  ? 221  GLU A C     1 
ATOM   7359 O  O     . GLU B 2 60  ? -11.520 -37.006 38.136  1.00 86.56  ? 221  GLU A O     1 
ATOM   7360 C  CB    . GLU B 2 60  ? -12.231 -33.967 38.486  1.00 72.75  ? 221  GLU A CB    1 
ATOM   7361 C  CG    . GLU B 2 60  ? -10.743 -34.207 38.596  1.00 74.94  ? 221  GLU A CG    1 
ATOM   7362 C  CD    . GLU B 2 60  ? -9.912  -33.482 37.551  1.00 84.60  ? 221  GLU A CD    1 
ATOM   7363 O  OE1   . GLU B 2 60  ? -10.214 -32.330 37.176  1.00 83.33  ? 221  GLU A OE1   1 
ATOM   7364 O  OE2   . GLU B 2 60  ? -8.914  -34.073 37.118  1.00 80.41  ? 221  GLU A OE2   1 
ATOM   7365 N  N     . ARG B 2 61  ? -12.989 -37.006 39.774  1.00 77.29  ? 222  ARG A N     1 
ATOM   7366 C  CA    . ARG B 2 61  ? -12.421 -38.222 40.346  1.00 81.21  ? 222  ARG A CA    1 
ATOM   7367 C  C     . ARG B 2 61  ? -12.873 -39.498 39.683  1.00 81.80  ? 222  ARG A C     1 
ATOM   7368 O  O     . ARG B 2 61  ? -12.388 -40.551 40.017  1.00 80.65  ? 222  ARG A O     1 
ATOM   7369 C  CB    . ARG B 2 61  ? -12.747 -38.316 41.837  1.00 85.50  ? 222  ARG A CB    1 
ATOM   7370 C  CG    . ARG B 2 61  ? -11.604 -37.987 42.783  1.00 66.09  ? 222  ARG A CG    1 
ATOM   7371 C  CD    . ARG B 2 61  ? -12.137 -37.791 44.181  1.00 49.73  ? 222  ARG A CD    1 
ATOM   7372 N  N     . TYR B 2 62  ? -13.824 -39.395 38.766  1.00 82.16  ? 223  TYR A N     1 
ATOM   7373 C  CA    . TYR B 2 62  ? -14.359 -40.516 38.034  1.00 79.08  ? 223  TYR A CA    1 
ATOM   7374 C  C     . TYR B 2 62  ? -13.411 -40.899 36.957  1.00 76.84  ? 223  TYR A C     1 
ATOM   7375 O  O     . TYR B 2 62  ? -13.437 -42.012 36.491  1.00 81.45  ? 223  TYR A O     1 
ATOM   7376 C  CB    . TYR B 2 62  ? -15.609 -40.096 37.308  1.00 82.15  ? 223  TYR A CB    1 
ATOM   7377 C  CG    . TYR B 2 62  ? -16.853 -39.959 38.113  1.00 84.66  ? 223  TYR A CG    1 
ATOM   7378 C  CD1   . TYR B 2 62  ? -17.765 -40.965 38.148  1.00 85.40  ? 223  TYR A CD1   1 
ATOM   7379 C  CD2   . TYR B 2 62  ? -17.128 -38.816 38.784  1.00 80.25  ? 223  TYR A CD2   1 
ATOM   7380 C  CE1   . TYR B 2 62  ? -18.916 -40.852 38.861  1.00 86.90  ? 223  TYR A CE1   1 
ATOM   7381 C  CE2   . TYR B 2 62  ? -18.271 -38.687 39.500  1.00 87.47  ? 223  TYR A CE2   1 
ATOM   7382 C  CZ    . TYR B 2 62  ? -19.167 -39.713 39.530  1.00 91.57  ? 223  TYR A CZ    1 
ATOM   7383 O  OH    . TYR B 2 62  ? -20.327 -39.587 40.247  1.00 93.34  ? 223  TYR A OH    1 
ATOM   7384 N  N     . PHE B 2 63  ? -12.626 -39.953 36.485  1.00 74.97  ? 224  PHE A N     1 
ATOM   7385 C  CA    . PHE B 2 63  ? -11.688 -40.262 35.455  1.00 77.33  ? 224  PHE A CA    1 
ATOM   7386 C  C     . PHE B 2 63  ? -10.397 -40.792 36.024  1.00 83.84  ? 224  PHE A C     1 
ATOM   7387 O  O     . PHE B 2 63  ? -9.636  -41.437 35.320  1.00 84.97  ? 224  PHE A O     1 
ATOM   7388 C  CB    . PHE B 2 63  ? -11.353 -39.036 34.665  1.00 74.86  ? 224  PHE A CB    1 
ATOM   7389 C  CG    . PHE B 2 63  ? -12.526 -38.350 34.097  1.00 70.18  ? 224  PHE A CG    1 
ATOM   7390 C  CD1   . PHE B 2 63  ? -13.787 -38.857 34.271  1.00 67.81  ? 224  PHE A CD1   1 
ATOM   7391 C  CD2   . PHE B 2 63  ? -12.362 -37.175 33.393  1.00 65.78  ? 224  PHE A CD2   1 
ATOM   7392 C  CE1   . PHE B 2 63  ? -14.870 -38.219 33.730  1.00 62.44  ? 224  PHE A CE1   1 
ATOM   7393 C  CE2   . PHE B 2 63  ? -13.433 -36.522 32.870  1.00 60.34  ? 224  PHE A CE2   1 
ATOM   7394 C  CZ    . PHE B 2 63  ? -14.690 -37.051 33.031  1.00 60.29  ? 224  PHE A CZ    1 
ATOM   7395 N  N     . THR B 2 64  ? -10.098 -40.478 37.267  1.00 80.44  ? 225  THR A N     1 
ATOM   7396 C  CA    . THR B 2 64  ? -8.880  -40.994 37.804  1.00 80.91  ? 225  THR A CA    1 
ATOM   7397 C  C     . THR B 2 64  ? -9.169  -42.472 37.921  1.00 80.70  ? 225  THR A C     1 
ATOM   7398 O  O     . THR B 2 64  ? -8.283  -43.287 37.751  1.00 79.15  ? 225  THR A O     1 
ATOM   7399 C  CB    . THR B 2 64  ? -8.466  -40.348 39.142  1.00 78.60  ? 225  THR A CB    1 
ATOM   7400 O  OG1   . THR B 2 64  ? -8.897  -38.986 39.194  1.00 74.75  ? 225  THR A OG1   1 
ATOM   7401 C  CG2   . THR B 2 64  ? -6.984  -40.377 39.276  1.00 72.03  ? 225  THR A CG2   1 
ATOM   7402 N  N     . LYS B 2 65  ? -10.431 -42.820 38.151  1.00 78.74  ? 226  LYS A N     1 
ATOM   7403 C  CA    . LYS B 2 65  ? -10.794 -44.210 38.280  1.00 75.85  ? 226  LYS A CA    1 
ATOM   7404 C  C     . LYS B 2 65  ? -11.046 -44.827 36.943  1.00 73.44  ? 226  LYS A C     1 
ATOM   7405 O  O     . LYS B 2 65  ? -11.880 -44.428 36.192  1.00 67.98  ? 226  LYS A O     1 
ATOM   7406 C  CB    . LYS B 2 65  ? -11.918 -44.410 39.261  1.00 74.36  ? 226  LYS A CB    1 
ATOM   7407 C  CG    . LYS B 2 65  ? -11.365 -44.398 40.668  1.00 76.43  ? 226  LYS A CG    1 
ATOM   7408 C  CD    . LYS B 2 65  ? -12.287 -45.039 41.673  1.00 70.04  ? 226  LYS A CD    1 
ATOM   7409 C  CE    . LYS B 2 65  ? -11.824 -44.680 43.061  1.00 79.64  ? 226  LYS A CE    1 
ATOM   7410 N  NZ    . LYS B 2 65  ? -12.980 -44.456 43.947  1.00 90.07  ? 226  LYS A NZ    1 
ATOM   7411 N  N     . LYS B 2 66  ? -10.338 -45.898 36.724  1.00 77.94  ? 227  LYS A N     1 
ATOM   7412 C  CA    . LYS B 2 66  ? -10.300 -46.563 35.471  1.00 73.79  ? 227  LYS A CA    1 
ATOM   7413 C  C     . LYS B 2 66  ? -11.519 -47.241 34.981  1.00 73.85  ? 227  LYS A C     1 
ATOM   7414 O  O     . LYS B 2 66  ? -12.481 -47.427 35.680  1.00 76.12  ? 227  LYS A O     1 
ATOM   7415 C  CB    . LYS B 2 66  ? -9.071  -47.440 35.366  1.00 76.27  ? 227  LYS A CB    1 
ATOM   7416 C  CG    . LYS B 2 66  ? -7.977  -46.754 34.568  1.00 77.50  ? 227  LYS A CG    1 
ATOM   7417 C  CD    . LYS B 2 66  ? -8.596  -45.865 33.494  1.00 71.77  ? 227  LYS A CD    1 
ATOM   7418 C  CE    . LYS B 2 66  ? -8.052  -46.250 32.135  1.00 71.40  ? 227  LYS A CE    1 
ATOM   7419 N  NZ    . LYS B 2 66  ? -8.531  -45.417 31.012  1.00 63.67  ? 227  LYS A NZ    1 
ATOM   7420 N  N     . SER B 2 67  ? -11.427 -47.523 33.697  1.00 74.66  ? 228  SER A N     1 
ATOM   7421 C  CA    . SER B 2 67  ? -12.480 -48.021 32.833  1.00 71.57  ? 228  SER A CA    1 
ATOM   7422 C  C     . SER B 2 67  ? -12.090 -49.106 31.786  1.00 68.73  ? 228  SER A C     1 
ATOM   7423 O  O     . SER B 2 67  ? -10.971 -49.143 31.324  1.00 69.47  ? 228  SER A O     1 
ATOM   7424 C  CB    . SER B 2 67  ? -13.074 -46.782 32.149  1.00 71.90  ? 228  SER A CB    1 
ATOM   7425 O  OG    . SER B 2 67  ? -12.176 -45.654 32.079  1.00 70.59  ? 228  SER A OG    1 
ATOM   7426 N  N     . VAL B 2 68  ? -13.027 -49.978 31.420  1.00 67.26  ? 229  VAL A N     1 
ATOM   7427 C  CA    . VAL B 2 68  ? -12.825 -51.100 30.476  1.00 71.46  ? 229  VAL A CA    1 
ATOM   7428 C  C     . VAL B 2 68  ? -12.725 -50.755 29.031  1.00 69.08  ? 229  VAL A C     1 
ATOM   7429 O  O     . VAL B 2 68  ? -13.427 -49.902 28.615  1.00 74.00  ? 229  VAL A O     1 
ATOM   7430 C  CB    . VAL B 2 68  ? -14.066 -51.971 30.468  1.00 73.29  ? 229  VAL A CB    1 
ATOM   7431 C  CG1   . VAL B 2 68  ? -13.725 -53.385 30.072  1.00 77.54  ? 229  VAL A CG1   1 
ATOM   7432 C  CG2   . VAL B 2 68  ? -14.709 -51.968 31.829  1.00 79.39  ? 229  VAL A CG2   1 
ATOM   7433 N  N     . GLY B 2 69  ? -11.909 -51.425 28.237  1.00 59.32  ? 230  GLY A N     1 
ATOM   7434 C  CA    . GLY B 2 69  ? -11.859 -51.100 26.825  1.00 69.69  ? 230  GLY A CA    1 
ATOM   7435 C  C     . GLY B 2 69  ? -12.409 -52.237 26.008  1.00 78.48  ? 230  GLY A C     1 
ATOM   7436 O  O     . GLY B 2 69  ? -11.787 -53.255 25.919  1.00 77.95  ? 230  GLY A O     1 
ATOM   7437 N  N     . LEU B 2 70  ? -13.556 -52.042 25.372  1.00 77.65  ? 231  LEU A N     1 
ATOM   7438 C  CA    . LEU B 2 70  ? -14.242 -53.114 24.633  1.00 84.18  ? 231  LEU A CA    1 
ATOM   7439 C  C     . LEU B 2 70  ? -13.785 -53.760 23.354  1.00 83.67  ? 231  LEU A C     1 
ATOM   7440 O  O     . LEU B 2 70  ? -13.752 -54.973 23.263  1.00 83.03  ? 231  LEU A O     1 
ATOM   7441 C  CB    . LEU B 2 70  ? -15.679 -52.713 24.377  1.00 73.89  ? 231  LEU A CB    1 
ATOM   7442 C  CG    . LEU B 2 70  ? -15.986 -51.249 24.377  1.00 67.68  ? 231  LEU A CG    1 
ATOM   7443 C  CD1   . LEU B 2 70  ? -17.407 -51.136 23.936  1.00 61.64  ? 231  LEU A CD1   1 
ATOM   7444 C  CD2   . LEU B 2 70  ? -15.928 -50.794 25.806  1.00 70.87  ? 231  LEU A CD2   1 
ATOM   7445 N  N     . MET B 2 71  ? -13.435 -52.973 22.368  1.00 83.86  ? 232  MET A N     1 
ATOM   7446 C  CA    . MET B 2 71  ? -13.052 -53.574 21.125  1.00 85.38  ? 232  MET A CA    1 
ATOM   7447 C  C     . MET B 2 71  ? -12.168 -52.743 20.259  1.00 91.51  ? 232  MET A C     1 
ATOM   7448 O  O     . MET B 2 71  ? -12.639 -51.785 19.662  1.00 92.90  ? 232  MET A O     1 
ATOM   7449 C  CB    . MET B 2 71  ? -14.294 -53.895 20.295  1.00 76.91  ? 232  MET A CB    1 
ATOM   7450 C  CG    . MET B 2 71  ? -14.000 -53.976 18.817  1.00 85.71  ? 232  MET A CG    1 
ATOM   7451 S  SD    . MET B 2 71  ? -14.968 -55.230 18.009  1.00 86.52  ? 232  MET A SD    1 
ATOM   7452 C  CE    . MET B 2 71  ? -14.404 -54.986 16.361  1.00 80.64  ? 232  MET A CE    1 
ATOM   7453 N  N     . ASN B 2 72  ? -10.914 -53.120 20.107  1.00 92.53  ? 233  ASN A N     1 
ATOM   7454 C  CA    . ASN B 2 72  ? -10.099 -52.348 19.190  1.00 99.13  ? 233  ASN A CA    1 
ATOM   7455 C  C     . ASN B 2 72  ? -9.541  -53.211 18.069  1.00 100.60 ? 233  ASN A C     1 
ATOM   7456 O  O     . ASN B 2 72  ? -8.882  -54.207 18.318  1.00 101.74 ? 233  ASN A O     1 
ATOM   7457 C  CB    . ASN B 2 72  ? -9.012  -51.597 19.927  1.00 90.78  ? 233  ASN A CB    1 
ATOM   7458 C  CG    . ASN B 2 72  ? -9.564  -50.482 20.749  1.00 83.46  ? 233  ASN A CG    1 
ATOM   7459 O  OD1   . ASN B 2 72  ? -9.697  -49.374 20.265  1.00 81.15  ? 233  ASN A OD1   1 
ATOM   7460 N  ND2   . ASN B 2 72  ? -9.924  -50.776 21.992  1.00 77.60  ? 233  ASN A ND2   1 
ATOM   7461 N  N     . ILE B 2 73  ? -9.814  -52.795 16.846  1.00 89.86  ? 234  ILE A N     1 
ATOM   7462 C  CA    . ILE B 2 73  ? -9.385  -53.484 15.665  1.00 91.98  ? 234  ILE A CA    1 
ATOM   7463 C  C     . ILE B 2 73  ? -9.678  -54.988 15.727  1.00 105.24 ? 234  ILE A C     1 
ATOM   7464 O  O     . ILE B 2 73  ? -9.960  -55.645 14.719  1.00 106.36 ? 234  ILE A O     1 
ATOM   7465 C  CB    . ILE B 2 73  ? -7.903  -53.220 15.416  1.00 88.10  ? 234  ILE A CB    1 
ATOM   7466 N  N     . SER B 2 80  ? -14.574 -56.676 13.564  1.00 96.58  ? 241  SER A N     1 
ATOM   7467 C  CA    . SER B 2 80  ? -13.314 -57.148 13.019  1.00 104.23 ? 241  SER A CA    1 
ATOM   7468 C  C     . SER B 2 80  ? -13.030 -56.469 11.722  1.00 104.79 ? 241  SER A C     1 
ATOM   7469 O  O     . SER B 2 80  ? -12.060 -55.740 11.576  1.00 106.01 ? 241  SER A O     1 
ATOM   7470 C  CB    . SER B 2 80  ? -13.394 -58.625 12.729  1.00 96.98  ? 241  SER A CB    1 
ATOM   7471 O  OG    . SER B 2 80  ? -14.111 -59.267 13.745  1.00 105.18 ? 241  SER A OG    1 
ATOM   7472 N  N     . LYS B 2 81  ? -13.982 -56.630 10.819  1.00 98.22  ? 242  LYS A N     1 
ATOM   7473 C  CA    . LYS B 2 81  ? -13.918 -56.166 9.452   1.00 92.18  ? 242  LYS A CA    1 
ATOM   7474 C  C     . LYS B 2 81  ? -14.245 -54.704 9.274   1.00 91.12  ? 242  LYS A C     1 
ATOM   7475 O  O     . LYS B 2 81  ? -14.351 -53.963 10.234  1.00 87.61  ? 242  LYS A O     1 
ATOM   7476 C  CB    . LYS B 2 81  ? -14.824 -57.040 8.604   1.00 90.82  ? 242  LYS A CB    1 
ATOM   7477 C  CG    . LYS B 2 81  ? -14.632 -58.529 8.841   1.00 86.28  ? 242  LYS A CG    1 
ATOM   7478 C  CD    . LYS B 2 81  ? -15.957 -59.269 8.821   1.00 74.20  ? 242  LYS A CD    1 
ATOM   7479 C  CE    . LYS B 2 81  ? -15.784 -60.761 8.990   1.00 63.64  ? 242  LYS A CE    1 
ATOM   7480 N  NZ    . LYS B 2 81  ? -17.058 -61.507 8.895   1.00 47.94  ? 242  LYS A NZ    1 
ATOM   7481 N  N     . THR B 2 82  ? -14.350 -54.276 8.027   1.00 85.42  ? 243  THR A N     1 
ATOM   7482 C  CA    . THR B 2 82  ? -14.591 -52.872 7.741   1.00 89.47  ? 243  THR A CA    1 
ATOM   7483 C  C     . THR B 2 82  ? -15.876 -52.291 8.291   1.00 83.78  ? 243  THR A C     1 
ATOM   7484 O  O     . THR B 2 82  ? -15.834 -51.246 8.906   1.00 74.48  ? 243  THR A O     1 
ATOM   7485 C  CB    . THR B 2 82  ? -14.552 -52.625 6.237   1.00 95.41  ? 243  THR A CB    1 
ATOM   7486 O  OG1   . THR B 2 82  ? -13.415 -53.287 5.686   1.00 97.73  ? 243  THR A OG1   1 
ATOM   7487 C  CG2   . THR B 2 82  ? -14.423 -51.149 5.955   1.00 90.39  ? 243  THR A CG2   1 
ATOM   7488 N  N     . GLU B 2 83  ? -16.962 -53.038 8.123   1.00 87.09  ? 244  GLU A N     1 
ATOM   7489 C  CA    . GLU B 2 83  ? -18.331 -52.739 8.554   1.00 82.90  ? 244  GLU A CA    1 
ATOM   7490 C  C     . GLU B 2 83  ? -19.225 -53.857 8.031   1.00 87.11  ? 244  GLU A C     1 
ATOM   7491 O  O     . GLU B 2 83  ? -18.754 -54.867 7.518   1.00 83.96  ? 244  GLU A O     1 
ATOM   7492 C  CB    . GLU B 2 83  ? -18.856 -51.453 7.930   1.00 76.92  ? 244  GLU A CB    1 
ATOM   7493 C  CG    . GLU B 2 83  ? -19.730 -50.598 8.813   1.00 73.14  ? 244  GLU A CG    1 
ATOM   7494 C  CD    . GLU B 2 83  ? -20.343 -49.493 8.020   1.00 70.96  ? 244  GLU A CD    1 
ATOM   7495 O  OE1   . GLU B 2 83  ? -19.620 -48.893 7.238   1.00 66.13  ? 244  GLU A OE1   1 
ATOM   7496 O  OE2   . GLU B 2 83  ? -21.537 -49.261 8.147   1.00 63.54  ? 244  GLU A OE2   1 
ATOM   7497 N  N     . PRO B 2 84  ? -20.530 -53.686 8.194   1.00 84.27  ? 245  PRO A N     1 
ATOM   7498 C  CA    . PRO B 2 84  ? -21.584 -54.557 7.724   1.00 83.14  ? 245  PRO A CA    1 
ATOM   7499 C  C     . PRO B 2 84  ? -22.572 -53.702 6.975   1.00 78.95  ? 245  PRO A C     1 
ATOM   7500 O  O     . PRO B 2 84  ? -23.249 -52.959 7.677   1.00 81.73  ? 245  PRO A O     1 
ATOM   7501 C  CB    . PRO B 2 84  ? -22.238 -54.991 9.015   1.00 84.55  ? 245  PRO A CB    1 
ATOM   7502 C  CG    . PRO B 2 84  ? -22.062 -53.831 9.928   1.00 77.60  ? 245  PRO A CG    1 
ATOM   7503 C  CD    . PRO B 2 84  ? -20.994 -52.935 9.356   1.00 78.98  ? 245  PRO A CD    1 
ATOM   7504 N  N     . GLU B 2 88  ? -25.235 -54.419 5.340   1.00 68.39  ? 249  GLU A N     1 
ATOM   7505 C  CA    . GLU B 2 88  ? -26.253 -53.690 4.650   1.00 67.85  ? 249  GLU A CA    1 
ATOM   7506 C  C     . GLU B 2 88  ? -27.217 -53.126 5.594   1.00 66.81  ? 249  GLU A C     1 
ATOM   7507 O  O     . GLU B 2 88  ? -26.978 -53.079 6.764   1.00 59.90  ? 249  GLU A O     1 
ATOM   7508 C  CB    . GLU B 2 88  ? -27.027 -54.636 3.799   1.00 70.82  ? 249  GLU A CB    1 
ATOM   7509 C  CG    . GLU B 2 88  ? -26.215 -55.793 3.312   1.00 70.20  ? 249  GLU A CG    1 
ATOM   7510 C  CD    . GLU B 2 88  ? -25.973 -55.676 1.847   1.00 77.12  ? 249  GLU A CD    1 
ATOM   7511 O  OE1   . GLU B 2 88  ? -26.892 -55.219 1.132   1.00 79.58  ? 249  GLU A OE1   1 
ATOM   7512 O  OE2   . GLU B 2 88  ? -24.859 -56.009 1.417   1.00 77.67  ? 249  GLU A OE2   1 
ATOM   7513 N  N     . PRO B 2 89  ? -28.331 -52.662 5.053   1.00 71.59  ? 250  PRO A N     1 
ATOM   7514 C  CA    . PRO B 2 89  ? -29.489 -52.090 5.713   1.00 62.86  ? 250  PRO A CA    1 
ATOM   7515 C  C     . PRO B 2 89  ? -30.297 -53.193 6.298   1.00 64.22  ? 250  PRO A C     1 
ATOM   7516 O  O     . PRO B 2 89  ? -31.230 -53.646 5.675   1.00 64.96  ? 250  PRO A O     1 
ATOM   7517 C  CB    . PRO B 2 89  ? -30.265 -51.452 4.577   1.00 60.18  ? 250  PRO A CB    1 
ATOM   7518 C  CG    . PRO B 2 89  ? -29.742 -52.055 3.340   1.00 66.83  ? 250  PRO A CG    1 
ATOM   7519 C  CD    . PRO B 2 89  ? -28.323 -52.360 3.621   1.00 71.08  ? 250  PRO A CD    1 
ATOM   7520 N  N     . ILE B 2 90  ? -29.925 -53.626 7.489   1.00 61.96  ? 251  ILE A N     1 
ATOM   7521 C  CA    . ILE B 2 90  ? -30.613 -54.690 8.169   1.00 53.95  ? 251  ILE A CA    1 
ATOM   7522 C  C     . ILE B 2 90  ? -31.655 -54.047 9.014   1.00 48.11  ? 251  ILE A C     1 
ATOM   7523 O  O     . ILE B 2 90  ? -31.367 -53.141 9.742   1.00 47.15  ? 251  ILE A O     1 
ATOM   7524 C  CB    . ILE B 2 90  ? -29.637 -55.592 8.940   1.00 55.23  ? 251  ILE A CB    1 
ATOM   7525 C  CG1   . ILE B 2 90  ? -30.072 -55.827 10.360  1.00 59.96  ? 251  ILE A CG1   1 
ATOM   7526 C  CG2   . ILE B 2 90  ? -28.258 -55.009 8.982   1.00 56.20  ? 251  ILE A CG2   1 
ATOM   7527 C  CD1   . ILE B 2 90  ? -29.998 -57.265 10.792  1.00 54.50  ? 251  ILE A CD1   1 
ATOM   7528 N  N     . SER B 2 91  ? -32.875 -54.538 8.891   1.00 41.35  ? 252  SER A N     1 
ATOM   7529 C  CA    . SER B 2 91  ? -34.052 -53.993 9.551   1.00 42.56  ? 252  SER A CA    1 
ATOM   7530 C  C     . SER B 2 91  ? -34.110 -53.872 11.072  1.00 45.45  ? 252  SER A C     1 
ATOM   7531 O  O     . SER B 2 91  ? -34.789 -53.019 11.576  1.00 37.36  ? 252  SER A O     1 
ATOM   7532 C  CB    . SER B 2 91  ? -35.278 -54.660 9.017   1.00 33.07  ? 252  SER A CB    1 
ATOM   7533 O  OG    . SER B 2 91  ? -35.760 -53.897 7.981   1.00 39.63  ? 252  SER A OG    1 
ATOM   7534 N  N     . PHE B 2 92  ? -33.404 -54.732 11.779  1.00 49.92  ? 253  PHE A N     1 
ATOM   7535 C  CA    . PHE B 2 92  ? -33.350 -54.691 13.204  1.00 48.15  ? 253  PHE A CA    1 
ATOM   7536 C  C     . PHE B 2 92  ? -31.979 -54.990 13.673  1.00 53.56  ? 253  PHE A C     1 
ATOM   7537 O  O     . PHE B 2 92  ? -31.465 -56.014 13.386  1.00 57.96  ? 253  PHE A O     1 
ATOM   7538 C  CB    . PHE B 2 92  ? -34.225 -55.745 13.797  1.00 46.74  ? 253  PHE A CB    1 
ATOM   7539 C  CG    . PHE B 2 92  ? -34.121 -55.827 15.277  1.00 54.08  ? 253  PHE A CG    1 
ATOM   7540 C  CD1   . PHE B 2 92  ? -34.738 -54.907 16.064  1.00 58.34  ? 253  PHE A CD1   1 
ATOM   7541 C  CD2   . PHE B 2 92  ? -33.396 -56.797 15.868  1.00 52.88  ? 253  PHE A CD2   1 
ATOM   7542 C  CE1   . PHE B 2 92  ? -34.657 -54.962 17.417  1.00 50.42  ? 253  PHE A CE1   1 
ATOM   7543 C  CE2   . PHE B 2 92  ? -33.320 -56.864 17.224  1.00 57.37  ? 253  PHE A CE2   1 
ATOM   7544 C  CZ    . PHE B 2 92  ? -33.944 -55.941 17.995  1.00 53.04  ? 253  PHE A CZ    1 
ATOM   7545 N  N     . ILE B 2 93  ? -31.388 -54.100 14.426  1.00 50.82  ? 254  ILE A N     1 
ATOM   7546 C  CA    . ILE B 2 93  ? -30.085 -54.328 14.937  1.00 51.87  ? 254  ILE A CA    1 
ATOM   7547 C  C     . ILE B 2 93  ? -30.337 -54.415 16.372  1.00 54.79  ? 254  ILE A C     1 
ATOM   7548 O  O     . ILE B 2 93  ? -30.817 -53.495 16.931  1.00 59.56  ? 254  ILE A O     1 
ATOM   7549 C  CB    . ILE B 2 93  ? -29.201 -53.126 14.700  1.00 50.28  ? 254  ILE A CB    1 
ATOM   7550 C  CG1   . ILE B 2 93  ? -28.542 -53.249 13.356  1.00 52.43  ? 254  ILE A CG1   1 
ATOM   7551 C  CG2   . ILE B 2 93  ? -28.131 -53.060 15.747  1.00 52.40  ? 254  ILE A CG2   1 
ATOM   7552 C  CD1   . ILE B 2 93  ? -28.310 -51.942 12.687  1.00 46.35  ? 254  ILE A CD1   1 
ATOM   7553 N  N     . PRO B 2 94  ? -29.998 -55.524 16.994  1.00 58.82  ? 255  PRO A N     1 
ATOM   7554 C  CA    . PRO B 2 94  ? -30.290 -55.608 18.407  1.00 61.21  ? 255  PRO A CA    1 
ATOM   7555 C  C     . PRO B 2 94  ? -29.267 -54.997 19.262  1.00 58.19  ? 255  PRO A C     1 
ATOM   7556 O  O     . PRO B 2 94  ? -28.159 -54.779 18.831  1.00 54.34  ? 255  PRO A O     1 
ATOM   7557 C  CB    . PRO B 2 94  ? -30.274 -57.104 18.671  1.00 57.02  ? 255  PRO A CB    1 
ATOM   7558 C  CG    . PRO B 2 94  ? -29.400 -57.664 17.650  1.00 53.12  ? 255  PRO A CG    1 
ATOM   7559 C  CD    . PRO B 2 94  ? -29.413 -56.758 16.475  1.00 57.94  ? 255  PRO A CD    1 
ATOM   7560 N  N     . VAL B 2 95  ? -29.662 -54.738 20.482  1.00 56.39  ? 256  VAL A N     1 
ATOM   7561 C  CA    . VAL B 2 95  ? -28.710 -54.304 21.433  1.00 64.36  ? 256  VAL A CA    1 
ATOM   7562 C  C     . VAL B 2 95  ? -29.111 -54.609 22.831  1.00 68.74  ? 256  VAL A C     1 
ATOM   7563 O  O     . VAL B 2 95  ? -29.947 -53.969 23.418  1.00 67.77  ? 256  VAL A O     1 
ATOM   7564 C  CB    . VAL B 2 95  ? -28.311 -52.898 21.324  1.00 64.45  ? 256  VAL A CB    1 
ATOM   7565 C  CG1   . VAL B 2 95  ? -29.493 -52.029 21.593  1.00 60.82  ? 256  VAL A CG1   1 
ATOM   7566 C  CG2   . VAL B 2 95  ? -27.247 -52.735 22.363  1.00 65.37  ? 256  VAL A CG2   1 
ATOM   7567 N  N     . LYS B 2 96  ? -28.416 -55.595 23.359  1.00 75.27  ? 257  LYS A N     1 
ATOM   7568 C  CA    . LYS B 2 96  ? -28.596 -56.165 24.672  1.00 81.53  ? 257  LYS A CA    1 
ATOM   7569 C  C     . LYS B 2 96  ? -28.648 -55.235 25.851  1.00 79.68  ? 257  LYS A C     1 
ATOM   7570 O  O     . LYS B 2 96  ? -28.116 -54.154 25.838  1.00 78.51  ? 257  LYS A O     1 
ATOM   7571 C  CB    . LYS B 2 96  ? -27.504 -57.186 24.892  1.00 82.30  ? 257  LYS A CB    1 
ATOM   7572 C  CG    . LYS B 2 96  ? -26.223 -56.834 24.149  1.00 88.07  ? 257  LYS A CG    1 
ATOM   7573 C  CD    . LYS B 2 96  ? -25.474 -58.061 23.650  1.00 88.27  ? 257  LYS A CD    1 
ATOM   7574 C  CE    . LYS B 2 96  ? -23.977 -57.838 23.617  1.00 76.68  ? 257  LYS A CE    1 
ATOM   7575 N  NZ    . LYS B 2 96  ? -23.459 -57.988 22.236  1.00 71.69  ? 257  LYS A NZ    1 
ATOM   7576 N  N     . ASP B 2 97  ? -29.241 -55.724 26.920  1.00 77.77  ? 258  ASP A N     1 
ATOM   7577 C  CA    . ASP B 2 97  ? -29.418 -54.922 28.091  1.00 75.68  ? 258  ASP A CA    1 
ATOM   7578 C  C     . ASP B 2 97  ? -28.285 -55.018 29.075  1.00 73.90  ? 258  ASP A C     1 
ATOM   7579 O  O     . ASP B 2 97  ? -28.176 -54.185 29.960  1.00 78.39  ? 258  ASP A O     1 
ATOM   7580 C  CB    . ASP B 2 97  ? -30.744 -55.293 28.728  1.00 75.84  ? 258  ASP A CB    1 
ATOM   7581 C  CG    . ASP B 2 97  ? -31.631 -54.090 28.959  1.00 88.28  ? 258  ASP A CG    1 
ATOM   7582 O  OD1   . ASP B 2 97  ? -31.088 -52.974 29.024  1.00 83.76  ? 258  ASP A OD1   1 
ATOM   7583 O  OD2   . ASP B 2 97  ? -32.857 -54.254 29.081  1.00 89.03  ? 258  ASP A OD2   1 
HETATM 7584 CL CL    . CL  C 3 .   ? -42.591 -34.671 43.017  1.00 52.19  ? 1101 CL  B CL    1 
HETATM 7585 P  PG    . ATP D 4 .   ? -19.060 -27.697 1.552   1.00 62.32  ? 1102 ATP B PG    1 
HETATM 7586 O  O1G   . ATP D 4 .   ? -19.429 -26.435 0.919   1.00 41.15  ? 1102 ATP B O1G   1 
HETATM 7587 O  O2G   . ATP D 4 .   ? -17.661 -27.663 1.959   1.00 53.12  ? 1102 ATP B O2G   1 
HETATM 7588 O  O3G   . ATP D 4 .   ? -19.929 -28.242 2.570   1.00 41.42  ? 1102 ATP B O3G   1 
HETATM 7589 P  PB    . ATP D 4 .   ? -19.547 -30.232 0.058   1.00 43.58  ? 1102 ATP B PB    1 
HETATM 7590 O  O1B   . ATP D 4 .   ? -20.199 -30.312 -1.207  1.00 33.90  ? 1102 ATP B O1B   1 
HETATM 7591 O  O2B   . ATP D 4 .   ? -20.381 -30.760 1.087   1.00 43.24  ? 1102 ATP B O2B   1 
HETATM 7592 O  O3B   . ATP D 4 .   ? -19.196 -28.717 0.338   1.00 51.19  ? 1102 ATP B O3B   1 
HETATM 7593 P  PA    . ATP D 4 .   ? -16.822 -30.674 -0.335  1.00 44.53  ? 1102 ATP B PA    1 
HETATM 7594 O  O1A   . ATP D 4 .   ? -16.207 -30.518 0.932   1.00 52.09  ? 1102 ATP B O1A   1 
HETATM 7595 O  O2A   . ATP D 4 .   ? -16.599 -29.672 -1.347  1.00 45.58  ? 1102 ATP B O2A   1 
HETATM 7596 O  O3A   . ATP D 4 .   ? -18.241 -31.072 0.032   1.00 38.72  ? 1102 ATP B O3A   1 
HETATM 7597 O  "O5'" . ATP D 4 .   ? -16.528 -32.045 -0.907  1.00 36.27  ? 1102 ATP B "O5'" 1 
HETATM 7598 C  "C5'" . ATP D 4 .   ? -16.546 -33.084 0.013   1.00 37.25  ? 1102 ATP B "C5'" 1 
HETATM 7599 C  "C4'" . ATP D 4 .   ? -15.543 -34.175 -0.307  1.00 40.00  ? 1102 ATP B "C4'" 1 
HETATM 7600 O  "O4'" . ATP D 4 .   ? -15.874 -34.740 -1.515  1.00 39.59  ? 1102 ATP B "O4'" 1 
HETATM 7601 C  "C3'" . ATP D 4 .   ? -14.117 -33.735 -0.492  1.00 46.60  ? 1102 ATP B "C3'" 1 
HETATM 7602 O  "O3'" . ATP D 4 .   ? -13.279 -34.347 0.480   1.00 47.18  ? 1102 ATP B "O3'" 1 
HETATM 7603 C  "C2'" . ATP D 4 .   ? -13.757 -34.112 -1.885  1.00 35.30  ? 1102 ATP B "C2'" 1 
HETATM 7604 O  "O2'" . ATP D 4 .   ? -12.450 -34.613 -1.984  1.00 38.67  ? 1102 ATP B "O2'" 1 
HETATM 7605 C  "C1'" . ATP D 4 .   ? -14.723 -35.201 -2.140  1.00 37.33  ? 1102 ATP B "C1'" 1 
HETATM 7606 N  N9    . ATP D 4 .   ? -15.156 -35.375 -3.529  1.00 47.63  ? 1102 ATP B N9    1 
HETATM 7607 C  C8    . ATP D 4 .   ? -15.899 -34.561 -4.237  1.00 45.73  ? 1102 ATP B C8    1 
HETATM 7608 N  N7    . ATP D 4 .   ? -16.132 -35.029 -5.439  1.00 38.86  ? 1102 ATP B N7    1 
HETATM 7609 C  C5    . ATP D 4 .   ? -15.542 -36.178 -5.520  1.00 41.43  ? 1102 ATP B C5    1 
HETATM 7610 C  C6    . ATP D 4 .   ? -15.407 -37.205 -6.520  1.00 47.71  ? 1102 ATP B C6    1 
HETATM 7611 N  N6    . ATP D 4 .   ? -15.936 -37.149 -7.729  1.00 44.40  ? 1102 ATP B N6    1 
HETATM 7612 N  N1    . ATP D 4 .   ? -14.707 -38.255 -6.196  1.00 53.14  ? 1102 ATP B N1    1 
HETATM 7613 C  C2    . ATP D 4 .   ? -14.145 -38.376 -5.019  1.00 48.42  ? 1102 ATP B C2    1 
HETATM 7614 N  N3    . ATP D 4 .   ? -14.247 -37.490 -4.081  1.00 43.10  ? 1102 ATP B N3    1 
HETATM 7615 C  C4    . ATP D 4 .   ? -14.917 -36.397 -4.270  1.00 43.70  ? 1102 ATP B C4    1 
HETATM 7616 O  O     . HOH E 5 .   ? -22.855 -27.434 1.513   1.00 42.44  ? 1201 HOH B O     1 
HETATM 7617 O  O     . HOH E 5 .   ? -23.414 -26.104 22.355  1.00 55.29  ? 1202 HOH B O     1 
HETATM 7618 O  O     . HOH E 5 .   ? -29.722 -42.604 29.421  1.00 50.57  ? 1203 HOH B O     1 
HETATM 7619 O  O     . HOH E 5 .   ? -38.271 -38.283 22.175  1.00 38.00  ? 1204 HOH B O     1 
HETATM 7620 O  O     . HOH E 5 .   ? -24.407 -15.156 -15.522 1.00 37.78  ? 1205 HOH B O     1 
HETATM 7621 O  O     . HOH E 5 .   ? -0.645  -44.713 27.621  1.00 46.78  ? 1206 HOH B O     1 
HETATM 7622 O  O     . HOH E 5 .   ? -26.630 7.918   -1.112  1.00 40.13  ? 1207 HOH B O     1 
HETATM 7623 O  O     . HOH E 5 .   ? -35.672 -0.541  -7.796  1.00 43.21  ? 1208 HOH B O     1 
HETATM 7624 O  O     . HOH E 5 .   ? -50.111 -37.358 16.742  1.00 41.52  ? 1209 HOH B O     1 
HETATM 7625 O  O     . HOH E 5 .   ? -52.064 -25.848 23.221  1.00 48.13  ? 1210 HOH B O     1 
HETATM 7626 O  O     . HOH E 5 .   ? -35.457 -28.750 -22.711 1.00 53.44  ? 1211 HOH B O     1 
HETATM 7627 O  O     . HOH E 5 .   ? -79.462 -21.946 29.145  1.00 45.99  ? 1212 HOH B O     1 
HETATM 7628 O  O     . HOH E 5 .   ? -12.318 -49.529 12.296  1.00 53.49  ? 1213 HOH B O     1 
HETATM 7629 O  O     . HOH E 5 .   ? -44.124 0.752   2.796   1.00 36.59  ? 1214 HOH B O     1 
HETATM 7630 O  O     . HOH E 5 .   ? -29.273 -36.927 30.155  1.00 25.96  ? 1215 HOH B O     1 
HETATM 7631 O  O     . HOH E 5 .   ? -47.189 -47.384 29.579  1.00 68.59  ? 1216 HOH B O     1 
HETATM 7632 O  O     . HOH E 5 .   ? -26.437 -18.817 -23.092 1.00 35.78  ? 1217 HOH B O     1 
HETATM 7633 O  O     . HOH E 5 .   ? -14.177 -31.619 -16.469 1.00 60.35  ? 1218 HOH B O     1 
HETATM 7634 O  O     . HOH E 5 .   ? -49.617 -7.607  49.890  1.00 40.34  ? 1219 HOH B O     1 
HETATM 7635 O  O     . HOH E 5 .   ? -29.526 -45.246 -3.699  1.00 32.31  ? 1220 HOH B O     1 
HETATM 7636 O  O     . HOH E 5 .   ? -18.047 -6.525  39.276  1.00 51.79  ? 1221 HOH B O     1 
HETATM 7637 O  O     . HOH E 5 .   ? -65.310 -12.710 51.843  1.00 34.85  ? 1222 HOH B O     1 
HETATM 7638 O  O     . HOH E 5 .   ? -39.309 -24.795 -16.084 1.00 29.00  ? 1223 HOH B O     1 
HETATM 7639 O  O     . HOH E 5 .   ? -23.627 -21.601 19.833  1.00 34.87  ? 1224 HOH B O     1 
HETATM 7640 O  O     . HOH E 5 .   ? -26.098 -40.771 -9.497  1.00 48.60  ? 1225 HOH B O     1 
HETATM 7641 O  O     . HOH E 5 .   ? -31.093 -8.940  -26.608 1.00 58.49  ? 1226 HOH B O     1 
HETATM 7642 O  O     . HOH E 5 .   ? -64.089 -7.477  37.494  1.00 34.81  ? 1227 HOH B O     1 
HETATM 7643 O  O     . HOH F 5 .   ? -58.071 -32.490 55.358  1.00 40.23  ? 301  HOH A O     1 
HETATM 7644 O  O     . HOH F 5 .   ? -61.002 -26.958 55.826  1.00 62.00  ? 302  HOH A O     1 
HETATM 7645 O  O     . HOH F 5 .   ? -52.490 -11.885 64.494  1.00 45.32  ? 303  HOH A O     1 
HETATM 7646 O  O     . HOH F 5 .   ? -55.647 -23.634 57.636  1.00 37.59  ? 304  HOH A O     1 
HETATM 7647 O  O     . HOH F 5 .   ? -64.760 -14.442 56.534  1.00 33.41  ? 305  HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   64   ?    ?   ?   B . n 
A 1 2   ALA 2   65   ?    ?   ?   B . n 
A 1 3   MET 3   66   ?    ?   ?   B . n 
A 1 4   ASP 4   67   ?    ?   ?   B . n 
A 1 5   PRO 5   68   ?    ?   ?   B . n 
A 1 6   GLU 6   69   ?    ?   ?   B . n 
A 1 7   PHE 7   70   ?    ?   ?   B . n 
A 1 8   THR 8   71   ?    ?   ?   B . n 
A 1 9   ASP 9   72   ?    ?   ?   B . n 
A 1 10  GLU 10  73   ?    ?   ?   B . n 
A 1 11  PRO 11  74   ?    ?   ?   B . n 
A 1 12  ILE 12  75   ?    ?   ?   B . n 
A 1 13  PHE 13  76   ?    ?   ?   B . n 
A 1 14  GLY 14  77   ?    ?   ?   B . n 
A 1 15  LYS 15  78   ?    ?   ?   B . n 
A 1 16  LYS 16  79   ?    ?   ?   B . n 
A 1 17  PRO 17  80   ?    ?   ?   B . n 
A 1 18  ARG 18  81   ?    ?   ?   B . n 
A 1 19  ILE 19  82   ?    ?   ?   B . n 
A 1 20  GLU 20  83   ?    ?   ?   B . n 
A 1 21  GLU 21  84   ?    ?   ?   B . n 
A 1 22  SER 22  85   ?    ?   ?   B . n 
A 1 23  ILE 23  86   ?    ?   ?   B . n 
A 1 24  THR 24  87   ?    ?   ?   B . n 
A 1 25  GLU 25  88   ?    ?   ?   B . n 
A 1 26  ASP 26  89   ?    ?   ?   B . n 
A 1 27  LEU 27  90   ?    ?   ?   B . n 
A 1 28  SER 28  91   ?    ?   ?   B . n 
A 1 29  LEU 29  92   ?    ?   ?   B . n 
A 1 30  ALA 30  93   ?    ?   ?   B . n 
A 1 31  ASP 31  94   ?    ?   ?   B . n 
A 1 32  LEU 32  95   ?    ?   ?   B . n 
A 1 33  MET 33  96   ?    ?   ?   B . n 
A 1 34  PRO 34  97   ?    ?   ?   B . n 
A 1 35  ARG 35  98   98   ARG ARG B . n 
A 1 36  VAL 36  99   99   VAL VAL B . n 
A 1 37  LYS 37  100  100  LYS LYS B . n 
A 1 38  VAL 38  101  101  VAL VAL B . n 
A 1 39  GLN 39  102  102  GLN GLN B . n 
A 1 40  SER 40  103  103  SER SER B . n 
A 1 41  VAL 41  104  104  VAL VAL B . n 
A 1 42  GLU 42  105  105  GLU GLU B . n 
A 1 43  THR 43  106  106  THR THR B . n 
A 1 44  VAL 44  107  107  VAL VAL B . n 
A 1 45  GLU 45  108  108  GLU GLU B . n 
A 1 46  GLY 46  109  109  GLY GLY B . n 
A 1 47  CYS 47  110  110  CYS CYS B . n 
A 1 48  THR 48  111  111  THR THR B . n 
A 1 49  HIS 49  112  112  HIS HIS B . n 
A 1 50  GLU 50  113  113  GLU GLU B . n 
A 1 51  VAL 51  114  114  VAL VAL B . n 
A 1 52  ALA 52  115  115  ALA ALA B . n 
A 1 53  LEU 53  116  116  LEU LEU B . n 
A 1 54  PRO 54  117  117  PRO PRO B . n 
A 1 55  ALA 55  118  118  ALA ALA B . n 
A 1 56  GLU 56  119  119  GLU GLU B . n 
A 1 57  GLU 57  120  120  GLU GLU B . n 
A 1 58  ASP 58  121  121  ASP ASP B . n 
A 1 59  TYR 59  122  122  TYR TYR B . n 
A 1 60  LEU 60  123  123  LEU LEU B . n 
A 1 61  PRO 61  124  124  PRO PRO B . n 
A 1 62  LEU 62  125  125  LEU LEU B . n 
A 1 63  LYS 63  126  126  LYS LYS B . n 
A 1 64  PRO 64  127  127  PRO PRO B . n 
A 1 65  ARG 65  128  128  ARG ARG B . n 
A 1 66  VAL 66  129  129  VAL VAL B . n 
A 1 67  GLY 67  130  130  GLY GLY B . n 
A 1 68  LYS 68  131  131  LYS LYS B . n 
A 1 69  ALA 69  132  132  ALA ALA B . n 
A 1 70  ALA 70  133  133  ALA ALA B . n 
A 1 71  LYS 71  134  134  LYS LYS B . n 
A 1 72  GLU 72  135  135  GLU GLU B . n 
A 1 73  TYR 73  136  136  TYR TYR B . n 
A 1 74  PRO 74  137  137  PRO PRO B . n 
A 1 75  PHE 75  138  138  PHE PHE B . n 
A 1 76  ILE 76  139  139  ILE ILE B . n 
A 1 77  LEU 77  140  140  LEU LEU B . n 
A 1 78  ASP 78  141  141  ASP ASP B . n 
A 1 79  ALA 79  142  142  ALA ALA B . n 
A 1 80  PHE 80  143  143  PHE PHE B . n 
A 1 81  GLN 81  144  144  GLN GLN B . n 
A 1 82  ARG 82  145  145  ARG ARG B . n 
A 1 83  GLU 83  146  146  GLU GLU B . n 
A 1 84  ALA 84  147  147  ALA ALA B . n 
A 1 85  ILE 85  148  148  ILE ILE B . n 
A 1 86  GLN 86  149  149  GLN GLN B . n 
A 1 87  CYS 87  150  150  CYS CYS B . n 
A 1 88  VAL 88  151  151  VAL VAL B . n 
A 1 89  ASP 89  152  152  ASP ASP B . n 
A 1 90  ASN 90  153  153  ASN ASN B . n 
A 1 91  ASN 91  154  154  ASN ASN B . n 
A 1 92  GLN 92  155  155  GLN GLN B . n 
A 1 93  SER 93  156  156  SER SER B . n 
A 1 94  VAL 94  157  157  VAL VAL B . n 
A 1 95  LEU 95  158  158  LEU LEU B . n 
A 1 96  VAL 96  159  159  VAL VAL B . n 
A 1 97  SER 97  160  160  SER SER B . n 
A 1 98  ALA 98  161  161  ALA ALA B . n 
A 1 99  HIS 99  162  162  HIS HIS B . n 
A 1 100 THR 100 163  163  THR THR B . n 
A 1 101 SER 101 164  164  SER SER B . n 
A 1 102 ALA 102 165  165  ALA ALA B . n 
A 1 103 GLY 103 166  166  GLY GLY B . n 
A 1 104 LYS 104 167  167  LYS LYS B . n 
A 1 105 THR 105 168  168  THR THR B . n 
A 1 106 VAL 106 169  169  VAL VAL B . n 
A 1 107 CYS 107 170  170  CYS CYS B . n 
A 1 108 ALA 108 171  171  ALA ALA B . n 
A 1 109 GLU 109 172  172  GLU GLU B . n 
A 1 110 TYR 110 173  173  TYR TYR B . n 
A 1 111 ALA 111 174  174  ALA ALA B . n 
A 1 112 ILE 112 175  175  ILE ILE B . n 
A 1 113 ALA 113 176  176  ALA ALA B . n 
A 1 114 LEU 114 177  177  LEU LEU B . n 
A 1 115 ALA 115 178  178  ALA ALA B . n 
A 1 116 LEU 116 179  179  LEU LEU B . n 
A 1 117 ARG 117 180  180  ARG ARG B . n 
A 1 118 GLU 118 181  181  GLU GLU B . n 
A 1 119 LYS 119 182  182  LYS LYS B . n 
A 1 120 GLN 120 183  183  GLN GLN B . n 
A 1 121 ARG 121 184  184  ARG ARG B . n 
A 1 122 VAL 122 185  185  VAL VAL B . n 
A 1 123 ILE 123 186  186  ILE ILE B . n 
A 1 124 PHE 124 187  187  PHE PHE B . n 
A 1 125 THR 125 188  188  THR THR B . n 
A 1 126 SER 126 189  189  SER SER B . n 
A 1 127 PRO 127 190  190  PRO PRO B . n 
A 1 128 ILE 128 191  191  ILE ILE B . n 
A 1 129 LYS 129 192  192  LYS LYS B . n 
A 1 130 ALA 130 193  193  ALA ALA B . n 
A 1 131 LEU 131 194  194  LEU LEU B . n 
A 1 132 SER 132 195  195  SER SER B . n 
A 1 133 ASN 133 196  196  ASN ASN B . n 
A 1 134 GLN 134 197  197  GLN GLN B . n 
A 1 135 LYS 135 198  198  LYS LYS B . n 
A 1 136 TYR 136 199  199  TYR TYR B . n 
A 1 137 ARG 137 200  200  ARG ARG B . n 
A 1 138 GLU 138 201  201  GLU GLU B . n 
A 1 139 MET 139 202  202  MET MET B . n 
A 1 140 TYR 140 203  203  TYR TYR B . n 
A 1 141 GLU 141 204  204  GLU GLU B . n 
A 1 142 GLU 142 205  205  GLU GLU B . n 
A 1 143 PHE 143 206  206  PHE PHE B . n 
A 1 144 GLN 144 207  207  GLN GLN B . n 
A 1 145 ASP 145 208  208  ASP ASP B . n 
A 1 146 VAL 146 209  209  VAL VAL B . n 
A 1 147 GLY 147 210  210  GLY GLY B . n 
A 1 148 LEU 148 211  211  LEU LEU B . n 
A 1 149 MET 149 212  212  MET MET B . n 
A 1 150 THR 150 213  213  THR THR B . n 
A 1 151 GLY 151 214  214  GLY GLY B . n 
A 1 152 ASP 152 215  215  ASP ASP B . n 
A 1 153 VAL 153 216  216  VAL VAL B . n 
A 1 154 THR 154 217  217  THR THR B . n 
A 1 155 ILE 155 218  218  ILE ILE B . n 
A 1 156 ASN 156 219  219  ASN ASN B . n 
A 1 157 PRO 157 220  220  PRO PRO B . n 
A 1 158 THR 158 221  221  THR THR B . n 
A 1 159 ALA 159 222  222  ALA ALA B . n 
A 1 160 SER 160 223  223  SER SER B . n 
A 1 161 CYS 161 224  224  CYS CYS B . n 
A 1 162 LEU 162 225  225  LEU LEU B . n 
A 1 163 VAL 163 226  226  VAL VAL B . n 
A 1 164 MET 164 227  227  MET MET B . n 
A 1 165 THR 165 228  228  THR THR B . n 
A 1 166 THR 166 229  229  THR THR B . n 
A 1 167 GLU 167 230  230  GLU GLU B . n 
A 1 168 ILE 168 231  231  ILE ILE B . n 
A 1 169 LEU 169 232  232  LEU LEU B . n 
A 1 170 ARG 170 233  233  ARG ARG B . n 
A 1 171 SER 171 234  234  SER SER B . n 
A 1 172 MET 172 235  235  MET MET B . n 
A 1 173 LEU 173 236  236  LEU LEU B . n 
A 1 174 TYR 174 237  237  TYR TYR B . n 
A 1 175 ARG 175 238  238  ARG ARG B . n 
A 1 176 GLY 176 239  239  GLY GLY B . n 
A 1 177 SER 177 240  240  SER SER B . n 
A 1 178 GLU 178 241  241  GLU GLU B . n 
A 1 179 VAL 179 242  242  VAL VAL B . n 
A 1 180 MET 180 243  243  MET MET B . n 
A 1 181 ARG 181 244  244  ARG ARG B . n 
A 1 182 GLU 182 245  245  GLU GLU B . n 
A 1 183 VAL 183 246  246  VAL VAL B . n 
A 1 184 ALA 184 247  247  ALA ALA B . n 
A 1 185 TRP 185 248  248  TRP TRP B . n 
A 1 186 VAL 186 249  249  VAL VAL B . n 
A 1 187 ILE 187 250  250  ILE ILE B . n 
A 1 188 PHE 188 251  251  PHE PHE B . n 
A 1 189 ASP 189 252  252  ASP ASP B . n 
A 1 190 GLU 190 253  253  GLU GLU B . n 
A 1 191 ILE 191 254  254  ILE ILE B . n 
A 1 192 HIS 192 255  255  HIS HIS B . n 
A 1 193 TYR 193 256  256  TYR TYR B . n 
A 1 194 MET 194 257  257  MET MET B . n 
A 1 195 ARG 195 258  258  ARG ARG B . n 
A 1 196 ASP 196 259  259  ASP ASP B . n 
A 1 197 SER 197 260  260  SER SER B . n 
A 1 198 GLU 198 261  261  GLU GLU B . n 
A 1 199 ARG 199 262  262  ARG ARG B . n 
A 1 200 GLY 200 263  263  GLY GLY B . n 
A 1 201 VAL 201 264  264  VAL VAL B . n 
A 1 202 VAL 202 265  265  VAL VAL B . n 
A 1 203 TRP 203 266  266  TRP TRP B . n 
A 1 204 GLU 204 267  267  GLU GLU B . n 
A 1 205 GLU 205 268  268  GLU GLU B . n 
A 1 206 THR 206 269  269  THR THR B . n 
A 1 207 ILE 207 270  270  ILE ILE B . n 
A 1 208 ILE 208 271  271  ILE ILE B . n 
A 1 209 LEU 209 272  272  LEU LEU B . n 
A 1 210 LEU 210 273  273  LEU LEU B . n 
A 1 211 PRO 211 274  274  PRO PRO B . n 
A 1 212 ASP 212 275  275  ASP ASP B . n 
A 1 213 ASN 213 276  276  ASN ASN B . n 
A 1 214 VAL 214 277  277  VAL VAL B . n 
A 1 215 HIS 215 278  278  HIS HIS B . n 
A 1 216 TYR 216 279  279  TYR TYR B . n 
A 1 217 VAL 217 280  280  VAL VAL B . n 
A 1 218 PHE 218 281  281  PHE PHE B . n 
A 1 219 LEU 219 282  282  LEU LEU B . n 
A 1 220 SER 220 283  283  SER SER B . n 
A 1 221 ALA 221 284  284  ALA ALA B . n 
A 1 222 THR 222 285  285  THR THR B . n 
A 1 223 ILE 223 286  286  ILE ILE B . n 
A 1 224 PRO 224 287  287  PRO PRO B . n 
A 1 225 ASN 225 288  288  ASN ASN B . n 
A 1 226 ALA 226 289  289  ALA ALA B . n 
A 1 227 ARG 227 290  290  ARG ARG B . n 
A 1 228 GLN 228 291  291  GLN GLN B . n 
A 1 229 PHE 229 292  292  PHE PHE B . n 
A 1 230 ALA 230 293  293  ALA ALA B . n 
A 1 231 GLU 231 294  294  GLU GLU B . n 
A 1 232 TRP 232 295  295  TRP TRP B . n 
A 1 233 ILE 233 296  296  ILE ILE B . n 
A 1 234 CYS 234 297  297  CYS CYS B . n 
A 1 235 HIS 235 298  298  HIS HIS B . n 
A 1 236 LEU 236 299  299  LEU LEU B . n 
A 1 237 HIS 237 300  300  HIS HIS B . n 
A 1 238 LYS 238 301  301  LYS LYS B . n 
A 1 239 GLN 239 302  302  GLN GLN B . n 
A 1 240 PRO 240 303  303  PRO PRO B . n 
A 1 241 CYS 241 304  304  CYS CYS B . n 
A 1 242 HIS 242 305  305  HIS HIS B . n 
A 1 243 VAL 243 306  306  VAL VAL B . n 
A 1 244 ILE 244 307  307  ILE ILE B . n 
A 1 245 TYR 245 308  308  TYR TYR B . n 
A 1 246 THR 246 309  309  THR THR B . n 
A 1 247 ASP 247 310  310  ASP ASP B . n 
A 1 248 TYR 248 311  311  TYR TYR B . n 
A 1 249 ARG 249 312  312  ARG ARG B . n 
A 1 250 PRO 250 313  313  PRO PRO B . n 
A 1 251 THR 251 314  314  THR THR B . n 
A 1 252 PRO 252 315  315  PRO PRO B . n 
A 1 253 LEU 253 316  316  LEU LEU B . n 
A 1 254 GLN 254 317  317  GLN GLN B . n 
A 1 255 HIS 255 318  318  HIS HIS B . n 
A 1 256 TYR 256 319  319  TYR TYR B . n 
A 1 257 ILE 257 320  320  ILE ILE B . n 
A 1 258 PHE 258 321  321  PHE PHE B . n 
A 1 259 PRO 259 322  322  PRO PRO B . n 
A 1 260 ALA 260 323  323  ALA ALA B . n 
A 1 261 GLY 261 324  324  GLY GLY B . n 
A 1 262 GLY 262 325  325  GLY GLY B . n 
A 1 263 ASP 263 326  326  ASP ASP B . n 
A 1 264 GLY 264 327  327  GLY GLY B . n 
A 1 265 LEU 265 328  328  LEU LEU B . n 
A 1 266 HIS 266 329  329  HIS HIS B . n 
A 1 267 LEU 267 330  330  LEU LEU B . n 
A 1 268 VAL 268 331  331  VAL VAL B . n 
A 1 269 VAL 269 332  332  VAL VAL B . n 
A 1 270 ASP 270 333  333  ASP ASP B . n 
A 1 271 GLU 271 334  334  GLU GLU B . n 
A 1 272 ASN 272 335  335  ASN ASN B . n 
A 1 273 GLY 273 336  336  GLY GLY B . n 
A 1 274 ASP 274 337  337  ASP ASP B . n 
A 1 275 PHE 275 338  338  PHE PHE B . n 
A 1 276 ARG 276 339  339  ARG ARG B . n 
A 1 277 GLU 277 340  340  GLU GLU B . n 
A 1 278 ASP 278 341  341  ASP ASP B . n 
A 1 279 ASN 279 342  342  ASN ASN B . n 
A 1 280 PHE 280 343  343  PHE PHE B . n 
A 1 281 ASN 281 344  344  ASN ASN B . n 
A 1 282 THR 282 345  345  THR THR B . n 
A 1 283 ALA 283 346  346  ALA ALA B . n 
A 1 284 MET 284 347  347  MET MET B . n 
A 1 285 GLN 285 348  348  GLN GLN B . n 
A 1 286 VAL 286 349  349  VAL VAL B . n 
A 1 287 LEU 287 350  350  LEU LEU B . n 
A 1 288 ARG 288 351  351  ARG ARG B . n 
A 1 289 ASP 289 352  352  ASP ASP B . n 
A 1 290 ALA 290 353  353  ALA ALA B . n 
A 1 291 GLY 291 354  354  GLY GLY B . n 
A 1 292 ASP 292 355  355  ASP ASP B . n 
A 1 293 LEU 293 356  ?    ?   ?   B . n 
A 1 294 ALA 294 357  ?    ?   ?   B . n 
A 1 295 LYS 295 358  ?    ?   ?   B . n 
A 1 296 GLY 296 359  ?    ?   ?   B . n 
A 1 297 ASP 297 360  ?    ?   ?   B . n 
A 1 298 GLN 298 361  ?    ?   ?   B . n 
A 1 299 LYS 299 362  ?    ?   ?   B . n 
A 1 300 GLY 300 363  ?    ?   ?   B . n 
A 1 301 ARG 301 364  ?    ?   ?   B . n 
A 1 302 LYS 302 365  ?    ?   ?   B . n 
A 1 303 GLY 303 366  ?    ?   ?   B . n 
A 1 304 GLY 304 367  ?    ?   ?   B . n 
A 1 305 THR 305 368  ?    ?   ?   B . n 
A 1 306 LYS 306 369  ?    ?   ?   B . n 
A 1 307 GLY 307 370  ?    ?   ?   B . n 
A 1 308 PRO 308 371  ?    ?   ?   B . n 
A 1 309 SER 309 372  372  SER SER B . n 
A 1 310 ASN 310 373  373  ASN ASN B . n 
A 1 311 VAL 311 374  374  VAL VAL B . n 
A 1 312 PHE 312 375  375  PHE PHE B . n 
A 1 313 LYS 313 376  376  LYS LYS B . n 
A 1 314 ILE 314 377  377  ILE ILE B . n 
A 1 315 VAL 315 378  378  VAL VAL B . n 
A 1 316 LYS 316 379  379  LYS LYS B . n 
A 1 317 MET 317 380  380  MET MET B . n 
A 1 318 ILE 318 381  381  ILE ILE B . n 
A 1 319 MET 319 382  382  MET MET B . n 
A 1 320 GLU 320 383  383  GLU GLU B . n 
A 1 321 ARG 321 384  384  ARG ARG B . n 
A 1 322 ASN 322 385  385  ASN ASN B . n 
A 1 323 PHE 323 386  386  PHE PHE B . n 
A 1 324 GLN 324 387  387  GLN GLN B . n 
A 1 325 PRO 325 388  388  PRO PRO B . n 
A 1 326 VAL 326 389  389  VAL VAL B . n 
A 1 327 ILE 327 390  390  ILE ILE B . n 
A 1 328 ILE 328 391  391  ILE ILE B . n 
A 1 329 PHE 329 392  392  PHE PHE B . n 
A 1 330 SER 330 393  393  SER SER B . n 
A 1 331 PHE 331 394  394  PHE PHE B . n 
A 1 332 SER 332 395  395  SER SER B . n 
A 1 333 LYS 333 396  396  LYS LYS B . n 
A 1 334 LYS 334 397  397  LYS LYS B . n 
A 1 335 ASP 335 398  398  ASP ASP B . n 
A 1 336 CYS 336 399  399  CYS CYS B . n 
A 1 337 GLU 337 400  400  GLU GLU B . n 
A 1 338 ALA 338 401  401  ALA ALA B . n 
A 1 339 TYR 339 402  402  TYR TYR B . n 
A 1 340 ALA 340 403  403  ALA ALA B . n 
A 1 341 LEU 341 404  404  LEU LEU B . n 
A 1 342 GLN 342 405  405  GLN GLN B . n 
A 1 343 MET 343 406  406  MET MET B . n 
A 1 344 THR 344 407  407  THR THR B . n 
A 1 345 LYS 345 408  408  LYS LYS B . n 
A 1 346 LEU 346 409  409  LEU LEU B . n 
A 1 347 ASP 347 410  410  ASP ASP B . n 
A 1 348 PHE 348 411  411  PHE PHE B . n 
A 1 349 ASN 349 412  412  ASN ASN B . n 
A 1 350 THR 350 413  413  THR THR B . n 
A 1 351 ASP 351 414  414  ASP ASP B . n 
A 1 352 GLU 352 415  415  GLU GLU B . n 
A 1 353 GLU 353 416  416  GLU GLU B . n 
A 1 354 LYS 354 417  417  LYS LYS B . n 
A 1 355 LYS 355 418  418  LYS LYS B . n 
A 1 356 MET 356 419  419  MET MET B . n 
A 1 357 VAL 357 420  420  VAL VAL B . n 
A 1 358 GLU 358 421  421  GLU GLU B . n 
A 1 359 GLU 359 422  422  GLU GLU B . n 
A 1 360 VAL 360 423  423  VAL VAL B . n 
A 1 361 PHE 361 424  424  PHE PHE B . n 
A 1 362 SER 362 425  425  SER SER B . n 
A 1 363 ASN 363 426  426  ASN ASN B . n 
A 1 364 ALA 364 427  427  ALA ALA B . n 
A 1 365 ILE 365 428  428  ILE ILE B . n 
A 1 366 ASP 366 429  429  ASP ASP B . n 
A 1 367 CYS 367 430  430  CYS CYS B . n 
A 1 368 LEU 368 431  431  LEU LEU B . n 
A 1 369 SER 369 432  432  SER SER B . n 
A 1 370 ASP 370 433  433  ASP ASP B . n 
A 1 371 GLU 371 434  434  GLU GLU B . n 
A 1 372 ASP 372 435  435  ASP ASP B . n 
A 1 373 LYS 373 436  436  LYS LYS B . n 
A 1 374 LYS 374 437  437  LYS LYS B . n 
A 1 375 LEU 375 438  438  LEU LEU B . n 
A 1 376 PRO 376 439  439  PRO PRO B . n 
A 1 377 GLN 377 440  440  GLN GLN B . n 
A 1 378 VAL 378 441  441  VAL VAL B . n 
A 1 379 GLU 379 442  442  GLU GLU B . n 
A 1 380 HIS 380 443  443  HIS HIS B . n 
A 1 381 VAL 381 444  444  VAL VAL B . n 
A 1 382 LEU 382 445  445  LEU LEU B . n 
A 1 383 PRO 383 446  446  PRO PRO B . n 
A 1 384 LEU 384 447  447  LEU LEU B . n 
A 1 385 LEU 385 448  448  LEU LEU B . n 
A 1 386 LYS 386 449  449  LYS LYS B . n 
A 1 387 ARG 387 450  450  ARG ARG B . n 
A 1 388 GLY 388 451  451  GLY GLY B . n 
A 1 389 ILE 389 452  452  ILE ILE B . n 
A 1 390 GLY 390 453  453  GLY GLY B . n 
A 1 391 ILE 391 454  454  ILE ILE B . n 
A 1 392 HIS 392 455  455  HIS HIS B . n 
A 1 393 HIS 393 456  456  HIS HIS B . n 
A 1 394 GLY 394 457  457  GLY GLY B . n 
A 1 395 GLY 395 458  458  GLY GLY B . n 
A 1 396 LEU 396 459  459  LEU LEU B . n 
A 1 397 LEU 397 460  460  LEU LEU B . n 
A 1 398 PRO 398 461  461  PRO PRO B . n 
A 1 399 ILE 399 462  462  ILE ILE B . n 
A 1 400 LEU 400 463  463  LEU LEU B . n 
A 1 401 LYS 401 464  464  LYS LYS B . n 
A 1 402 GLU 402 465  465  GLU GLU B . n 
A 1 403 THR 403 466  466  THR THR B . n 
A 1 404 ILE 404 467  467  ILE ILE B . n 
A 1 405 GLU 405 468  468  GLU GLU B . n 
A 1 406 ILE 406 469  469  ILE ILE B . n 
A 1 407 LEU 407 470  470  LEU LEU B . n 
A 1 408 PHE 408 471  471  PHE PHE B . n 
A 1 409 SER 409 472  472  SER SER B . n 
A 1 410 GLU 410 473  473  GLU GLU B . n 
A 1 411 GLY 411 474  474  GLY GLY B . n 
A 1 412 LEU 412 475  475  LEU LEU B . n 
A 1 413 ILE 413 476  476  ILE ILE B . n 
A 1 414 LYS 414 477  477  LYS LYS B . n 
A 1 415 ALA 415 478  478  ALA ALA B . n 
A 1 416 LEU 416 479  479  LEU LEU B . n 
A 1 417 PHE 417 480  480  PHE PHE B . n 
A 1 418 ALA 418 481  481  ALA ALA B . n 
A 1 419 THR 419 482  482  THR THR B . n 
A 1 420 GLU 420 483  483  GLU GLU B . n 
A 1 421 THR 421 484  484  THR THR B . n 
A 1 422 PHE 422 485  485  PHE PHE B . n 
A 1 423 ALA 423 486  486  ALA ALA B . n 
A 1 424 MET 424 487  487  MET MET B . n 
A 1 425 GLY 425 488  488  GLY GLY B . n 
A 1 426 ILE 426 489  489  ILE ILE B . n 
A 1 427 ASN 427 490  490  ASN ASN B . n 
A 1 428 MET 428 491  491  MET MET B . n 
A 1 429 PRO 429 492  492  PRO PRO B . n 
A 1 430 ALA 430 493  493  ALA ALA B . n 
A 1 431 ARG 431 494  494  ARG ARG B . n 
A 1 432 THR 432 495  495  THR THR B . n 
A 1 433 VAL 433 496  496  VAL VAL B . n 
A 1 434 LEU 434 497  497  LEU LEU B . n 
A 1 435 PHE 435 498  498  PHE PHE B . n 
A 1 436 THR 436 499  499  THR THR B . n 
A 1 437 ASN 437 500  500  ASN ASN B . n 
A 1 438 ALA 438 501  501  ALA ALA B . n 
A 1 439 ARG 439 502  502  ARG ARG B . n 
A 1 440 LYS 440 503  503  LYS LYS B . n 
A 1 441 PHE 441 504  504  PHE PHE B . n 
A 1 442 ASP 442 505  505  ASP ASP B . n 
A 1 443 GLY 443 506  506  GLY GLY B . n 
A 1 444 LYS 444 507  507  LYS LYS B . n 
A 1 445 ASP 445 508  508  ASP ASP B . n 
A 1 446 PHE 446 509  509  PHE PHE B . n 
A 1 447 ARG 447 510  510  ARG ARG B . n 
A 1 448 TRP 448 511  511  TRP TRP B . n 
A 1 449 ILE 449 512  512  ILE ILE B . n 
A 1 450 SER 450 513  513  SER SER B . n 
A 1 451 SER 451 514  514  SER SER B . n 
A 1 452 GLY 452 515  515  GLY GLY B . n 
A 1 453 GLU 453 516  516  GLU GLU B . n 
A 1 454 TYR 454 517  517  TYR TYR B . n 
A 1 455 ILE 455 518  518  ILE ILE B . n 
A 1 456 GLN 456 519  519  GLN GLN B . n 
A 1 457 MET 457 520  520  MET MET B . n 
A 1 458 SER 458 521  521  SER SER B . n 
A 1 459 GLY 459 522  522  GLY GLY B . n 
A 1 460 ARG 460 523  523  ARG ARG B . n 
A 1 461 ALA 461 524  524  ALA ALA B . n 
A 1 462 GLY 462 525  525  GLY GLY B . n 
A 1 463 ARG 463 526  526  ARG ARG B . n 
A 1 464 ARG 464 527  527  ARG ARG B . n 
A 1 465 GLY 465 528  528  GLY GLY B . n 
A 1 466 MET 466 529  529  MET MET B . n 
A 1 467 ASP 467 530  530  ASP ASP B . n 
A 1 468 ASP 468 531  531  ASP ASP B . n 
A 1 469 ARG 469 532  532  ARG ARG B . n 
A 1 470 GLY 470 533  533  GLY GLY B . n 
A 1 471 ILE 471 534  534  ILE ILE B . n 
A 1 472 VAL 472 535  535  VAL VAL B . n 
A 1 473 ILE 473 536  536  ILE ILE B . n 
A 1 474 LEU 474 537  537  LEU LEU B . n 
A 1 475 MET 475 538  538  MET MET B . n 
A 1 476 VAL 476 539  539  VAL VAL B . n 
A 1 477 ASP 477 540  540  ASP ASP B . n 
A 1 478 GLU 478 541  541  GLU GLU B . n 
A 1 479 LYS 479 542  542  LYS LYS B . n 
A 1 480 MET 480 543  543  MET MET B . n 
A 1 481 SER 481 544  544  SER SER B . n 
A 1 482 PRO 482 545  545  PRO PRO B . n 
A 1 483 THR 483 546  546  THR THR B . n 
A 1 484 ILE 484 547  547  ILE ILE B . n 
A 1 485 GLY 485 548  548  GLY GLY B . n 
A 1 486 LYS 486 549  549  LYS LYS B . n 
A 1 487 GLN 487 550  550  GLN GLN B . n 
A 1 488 LEU 488 551  551  LEU LEU B . n 
A 1 489 LEU 489 552  552  LEU LEU B . n 
A 1 490 LYS 490 553  553  LYS LYS B . n 
A 1 491 GLY 491 554  554  GLY GLY B . n 
A 1 492 SER 492 555  555  SER SER B . n 
A 1 493 ALA 493 556  556  ALA ALA B . n 
A 1 494 ASP 494 557  557  ASP ASP B . n 
A 1 495 PRO 495 558  558  PRO PRO B . n 
A 1 496 LEU 496 559  559  LEU LEU B . n 
A 1 497 ASN 497 560  560  ASN ASN B . n 
A 1 498 SER 498 561  561  SER SER B . n 
A 1 499 ALA 499 562  562  ALA ALA B . n 
A 1 500 PHE 500 563  563  PHE PHE B . n 
A 1 501 HIS 501 564  564  HIS HIS B . n 
A 1 502 LEU 502 565  565  LEU LEU B . n 
A 1 503 THR 503 566  566  THR THR B . n 
A 1 504 TYR 504 567  567  TYR TYR B . n 
A 1 505 ASN 505 568  568  ASN ASN B . n 
A 1 506 MET 506 569  569  MET MET B . n 
A 1 507 VAL 507 570  570  VAL VAL B . n 
A 1 508 LEU 508 571  571  LEU LEU B . n 
A 1 509 ASN 509 572  572  ASN ASN B . n 
A 1 510 LEU 510 573  573  LEU LEU B . n 
A 1 511 LEU 511 574  574  LEU LEU B . n 
A 1 512 ARG 512 575  575  ARG ARG B . n 
A 1 513 VAL 513 576  576  VAL VAL B . n 
A 1 514 GLU 514 577  577  GLU GLU B . n 
A 1 515 GLU 515 578  578  GLU GLU B . n 
A 1 516 ILE 516 579  579  ILE ILE B . n 
A 1 517 ASN 517 580  580  ASN ASN B . n 
A 1 518 PRO 518 581  581  PRO PRO B . n 
A 1 519 GLU 519 582  582  GLU GLU B . n 
A 1 520 TYR 520 583  583  TYR TYR B . n 
A 1 521 MET 521 584  584  MET MET B . n 
A 1 522 LEU 522 585  585  LEU LEU B . n 
A 1 523 GLU 523 586  586  GLU GLU B . n 
A 1 524 LYS 524 587  587  LYS LYS B . n 
A 1 525 SER 525 588  588  SER SER B . n 
A 1 526 PHE 526 589  589  PHE PHE B . n 
A 1 527 TYR 527 590  590  TYR TYR B . n 
A 1 528 GLN 528 591  591  GLN GLN B . n 
A 1 529 PHE 529 592  592  PHE PHE B . n 
A 1 530 GLN 530 593  593  GLN GLN B . n 
A 1 531 HIS 531 594  594  HIS HIS B . n 
A 1 532 TYR 532 595  595  TYR TYR B . n 
A 1 533 ARG 533 596  596  ARG ARG B . n 
A 1 534 ALA 534 597  597  ALA ALA B . n 
A 1 535 ILE 535 598  598  ILE ILE B . n 
A 1 536 PRO 536 599  599  PRO PRO B . n 
A 1 537 GLY 537 600  600  GLY GLY B . n 
A 1 538 VAL 538 601  601  VAL VAL B . n 
A 1 539 VAL 539 602  602  VAL VAL B . n 
A 1 540 GLU 540 603  603  GLU GLU B . n 
A 1 541 LYS 541 604  604  LYS LYS B . n 
A 1 542 VAL 542 605  605  VAL VAL B . n 
A 1 543 LYS 543 606  606  LYS LYS B . n 
A 1 544 ASN 544 607  607  ASN ASN B . n 
A 1 545 SER 545 608  608  SER SER B . n 
A 1 546 GLU 546 609  609  GLU GLU B . n 
A 1 547 GLU 547 610  610  GLU GLU B . n 
A 1 548 GLN 548 611  611  GLN GLN B . n 
A 1 549 TYR 549 612  612  TYR TYR B . n 
A 1 550 ASN 550 613  613  ASN ASN B . n 
A 1 551 LYS 551 614  614  LYS LYS B . n 
A 1 552 ILE 552 615  615  ILE ILE B . n 
A 1 553 VAL 553 616  616  VAL VAL B . n 
A 1 554 ILE 554 617  617  ILE ILE B . n 
A 1 555 PRO 555 618  618  PRO PRO B . n 
A 1 556 ASN 556 619  619  ASN ASN B . n 
A 1 557 GLU 557 620  620  GLU GLU B . n 
A 1 558 GLU 558 621  621  GLU GLU B . n 
A 1 559 SER 559 622  622  SER SER B . n 
A 1 560 VAL 560 623  623  VAL VAL B . n 
A 1 561 VAL 561 624  624  VAL VAL B . n 
A 1 562 ILE 562 625  625  ILE ILE B . n 
A 1 563 TYR 563 626  626  TYR TYR B . n 
A 1 564 TYR 564 627  627  TYR TYR B . n 
A 1 565 LYS 565 628  628  LYS LYS B . n 
A 1 566 ILE 566 629  629  ILE ILE B . n 
A 1 567 ARG 567 630  630  ARG ARG B . n 
A 1 568 GLN 568 631  631  GLN GLN B . n 
A 1 569 GLN 569 632  632  GLN GLN B . n 
A 1 570 LEU 570 633  633  LEU LEU B . n 
A 1 571 ALA 571 634  634  ALA ALA B . n 
A 1 572 LYS 572 635  635  LYS LYS B . n 
A 1 573 LEU 573 636  636  LEU LEU B . n 
A 1 574 GLY 574 637  637  GLY GLY B . n 
A 1 575 LYS 575 638  638  LYS LYS B . n 
A 1 576 GLU 576 639  639  GLU GLU B . n 
A 1 577 ILE 577 640  640  ILE ILE B . n 
A 1 578 GLU 578 641  641  GLU GLU B . n 
A 1 579 GLU 579 642  642  GLU GLU B . n 
A 1 580 TYR 580 643  643  TYR TYR B . n 
A 1 581 ILE 581 644  644  ILE ILE B . n 
A 1 582 HIS 582 645  645  HIS HIS B . n 
A 1 583 LYS 583 646  646  LYS LYS B . n 
A 1 584 PRO 584 647  647  PRO PRO B . n 
A 1 585 LYS 585 648  648  LYS LYS B . n 
A 1 586 TYR 586 649  649  TYR TYR B . n 
A 1 587 CYS 587 650  650  CYS CYS B . n 
A 1 588 LEU 588 651  651  LEU LEU B . n 
A 1 589 PRO 589 652  652  PRO PRO B . n 
A 1 590 PHE 590 653  653  PHE PHE B . n 
A 1 591 LEU 591 654  654  LEU LEU B . n 
A 1 592 GLN 592 655  655  GLN GLN B . n 
A 1 593 PRO 593 656  656  PRO PRO B . n 
A 1 594 GLY 594 657  657  GLY GLY B . n 
A 1 595 ARG 595 658  658  ARG ARG B . n 
A 1 596 LEU 596 659  659  LEU LEU B . n 
A 1 597 VAL 597 660  660  VAL VAL B . n 
A 1 598 LYS 598 661  661  LYS LYS B . n 
A 1 599 VAL 599 662  662  VAL VAL B . n 
A 1 600 LYS 600 663  663  LYS LYS B . n 
A 1 601 ASN 601 664  664  ASN ASN B . n 
A 1 602 GLU 602 665  665  GLU GLU B . n 
A 1 603 GLY 603 666  666  GLY GLY B . n 
A 1 604 ASP 604 667  667  ASP ASP B . n 
A 1 605 ASP 605 668  668  ASP ASP B . n 
A 1 606 PHE 606 669  669  PHE PHE B . n 
A 1 607 GLY 607 670  670  GLY GLY B . n 
A 1 608 TRP 608 671  671  TRP TRP B . n 
A 1 609 GLY 609 672  672  GLY GLY B . n 
A 1 610 VAL 610 673  673  VAL VAL B . n 
A 1 611 VAL 611 674  674  VAL VAL B . n 
A 1 612 VAL 612 675  675  VAL VAL B . n 
A 1 613 ASN 613 676  676  ASN ASN B . n 
A 1 614 PHE 614 677  677  PHE PHE B . n 
A 1 615 SER 615 678  678  SER SER B . n 
A 1 616 LYS 616 679  679  LYS LYS B . n 
A 1 617 LYS 617 680  680  LYS LYS B . n 
A 1 618 SER 618 681  681  SER SER B . n 
A 1 619 ASN 619 682  682  ASN ASN B . n 
A 1 620 VAL 620 683  683  VAL VAL B . n 
A 1 621 LYS 621 684  684  LYS LYS B . n 
A 1 622 PRO 622 685  685  PRO PRO B . n 
A 1 623 ASN 623 686  686  ASN ASN B . n 
A 1 624 SER 624 687  687  SER SER B . n 
A 1 625 GLY 625 688  688  GLY GLY B . n 
A 1 626 GLU 626 689  689  GLU GLU B . n 
A 1 627 LEU 627 690  690  LEU LEU B . n 
A 1 628 ASP 628 691  691  ASP ASP B . n 
A 1 629 PRO 629 692  692  PRO PRO B . n 
A 1 630 LEU 630 693  693  LEU LEU B . n 
A 1 631 TYR 631 694  694  TYR TYR B . n 
A 1 632 VAL 632 695  695  VAL VAL B . n 
A 1 633 VAL 633 696  696  VAL VAL B . n 
A 1 634 GLU 634 697  697  GLU GLU B . n 
A 1 635 VAL 635 698  698  VAL VAL B . n 
A 1 636 LEU 636 699  699  LEU LEU B . n 
A 1 637 LEU 637 700  700  LEU LEU B . n 
A 1 638 ARG 638 701  701  ARG ARG B . n 
A 1 639 CYS 639 702  702  CYS CYS B . n 
A 1 640 SER 640 703  703  SER SER B . n 
A 1 641 LYS 641 704  704  LYS LYS B . n 
A 1 642 GLU 642 705  705  GLU GLU B . n 
A 1 643 SER 643 706  706  SER SER B . n 
A 1 644 LEU 644 707  707  LEU LEU B . n 
A 1 645 LYS 645 708  708  LYS LYS B . n 
A 1 646 ASN 646 709  709  ASN ASN B . n 
A 1 647 SER 647 710  710  SER SER B . n 
A 1 648 ALA 648 711  711  ALA ALA B . n 
A 1 649 THR 649 712  712  THR THR B . n 
A 1 650 GLU 650 713  713  GLU GLU B . n 
A 1 651 ALA 651 714  714  ALA ALA B . n 
A 1 652 ALA 652 715  715  ALA ALA B . n 
A 1 653 LYS 653 716  716  LYS LYS B . n 
A 1 654 PRO 654 717  717  PRO PRO B . n 
A 1 655 ALA 655 718  718  ALA ALA B . n 
A 1 656 LYS 656 719  719  LYS LYS B . n 
A 1 657 PRO 657 720  720  PRO PRO B . n 
A 1 658 ASP 658 721  721  ASP ASP B . n 
A 1 659 GLU 659 722  722  GLU GLU B . n 
A 1 660 LYS 660 723  723  LYS LYS B . n 
A 1 661 GLY 661 724  724  GLY GLY B . n 
A 1 662 GLU 662 725  725  GLU GLU B . n 
A 1 663 MET 663 726  726  MET MET B . n 
A 1 664 GLN 664 727  727  GLN GLN B . n 
A 1 665 VAL 665 728  728  VAL VAL B . n 
A 1 666 VAL 666 729  729  VAL VAL B . n 
A 1 667 PRO 667 730  730  PRO PRO B . n 
A 1 668 VAL 668 731  731  VAL VAL B . n 
A 1 669 LEU 669 732  732  LEU LEU B . n 
A 1 670 VAL 670 733  733  VAL VAL B . n 
A 1 671 HIS 671 734  734  HIS HIS B . n 
A 1 672 LEU 672 735  735  LEU LEU B . n 
A 1 673 LEU 673 736  736  LEU LEU B . n 
A 1 674 SER 674 737  737  SER SER B . n 
A 1 675 ALA 675 738  738  ALA ALA B . n 
A 1 676 ILE 676 739  739  ILE ILE B . n 
A 1 677 SER 677 740  740  SER SER B . n 
A 1 678 SER 678 741  741  SER SER B . n 
A 1 679 VAL 679 742  742  VAL VAL B . n 
A 1 680 ARG 680 743  743  ARG ARG B . n 
A 1 681 LEU 681 744  744  LEU LEU B . n 
A 1 682 TYR 682 745  745  TYR TYR B . n 
A 1 683 ILE 683 746  746  ILE ILE B . n 
A 1 684 PRO 684 747  747  PRO PRO B . n 
A 1 685 LYS 685 748  748  LYS LYS B . n 
A 1 686 ASP 686 749  749  ASP ASP B . n 
A 1 687 LEU 687 750  750  LEU LEU B . n 
A 1 688 ARG 688 751  751  ARG ARG B . n 
A 1 689 PRO 689 752  752  PRO PRO B . n 
A 1 690 VAL 690 753  753  VAL VAL B . n 
A 1 691 ASP 691 754  754  ASP ASP B . n 
A 1 692 ASN 692 755  755  ASN ASN B . n 
A 1 693 ARG 693 756  756  ARG ARG B . n 
A 1 694 GLN 694 757  757  GLN GLN B . n 
A 1 695 SER 695 758  758  SER SER B . n 
A 1 696 VAL 696 759  759  VAL VAL B . n 
A 1 697 LEU 697 760  760  LEU LEU B . n 
A 1 698 LYS 698 761  761  LYS LYS B . n 
A 1 699 SER 699 762  762  SER SER B . n 
A 1 700 ILE 700 763  763  ILE ILE B . n 
A 1 701 GLN 701 764  764  GLN GLN B . n 
A 1 702 GLU 702 765  765  GLU GLU B . n 
A 1 703 VAL 703 766  766  VAL VAL B . n 
A 1 704 GLN 704 767  767  GLN GLN B . n 
A 1 705 LYS 705 768  768  LYS LYS B . n 
A 1 706 ARG 706 769  769  ARG ARG B . n 
A 1 707 PHE 707 770  770  PHE PHE B . n 
A 1 708 PRO 708 771  771  PRO PRO B . n 
A 1 709 ASP 709 772  772  ASP ASP B . n 
A 1 710 GLY 710 773  773  GLY GLY B . n 
A 1 711 ILE 711 774  774  ILE ILE B . n 
A 1 712 PRO 712 775  775  PRO PRO B . n 
A 1 713 LEU 713 776  776  LEU LEU B . n 
A 1 714 LEU 714 777  777  LEU LEU B . n 
A 1 715 ASP 715 778  778  ASP ASP B . n 
A 1 716 PRO 716 779  779  PRO PRO B . n 
A 1 717 ILE 717 780  780  ILE ILE B . n 
A 1 718 ASP 718 781  781  ASP ASP B . n 
A 1 719 ASP 719 782  782  ASP ASP B . n 
A 1 720 MET 720 783  783  MET MET B . n 
A 1 721 GLY 721 784  784  GLY GLY B . n 
A 1 722 ILE 722 785  785  ILE ILE B . n 
A 1 723 GLN 723 786  786  GLN GLN B . n 
A 1 724 ASP 724 787  787  ASP ASP B . n 
A 1 725 GLN 725 788  788  GLN GLN B . n 
A 1 726 GLY 726 789  789  GLY GLY B . n 
A 1 727 LEU 727 790  790  LEU LEU B . n 
A 1 728 LYS 728 791  791  LYS LYS B . n 
A 1 729 LYS 729 792  792  LYS LYS B . n 
A 1 730 VAL 730 793  793  VAL VAL B . n 
A 1 731 ILE 731 794  794  ILE ILE B . n 
A 1 732 GLN 732 795  795  GLN GLN B . n 
A 1 733 LYS 733 796  796  LYS LYS B . n 
A 1 734 VAL 734 797  797  VAL VAL B . n 
A 1 735 GLU 735 798  798  GLU GLU B . n 
A 1 736 ALA 736 799  799  ALA ALA B . n 
A 1 737 PHE 737 800  800  PHE PHE B . n 
A 1 738 GLU 738 801  801  GLU GLU B . n 
A 1 739 HIS 739 802  802  HIS HIS B . n 
A 1 740 ARG 740 803  803  ARG ARG B . n 
A 1 741 MET 741 804  804  MET MET B . n 
A 1 742 TYR 742 805  805  TYR TYR B . n 
A 1 743 SER 743 806  806  SER SER B . n 
A 1 744 HIS 744 807  807  HIS HIS B . n 
A 1 745 PRO 745 808  808  PRO PRO B . n 
A 1 746 LEU 746 809  809  LEU LEU B . n 
A 1 747 HIS 747 810  810  HIS HIS B . n 
A 1 748 ASN 748 811  811  ASN ASN B . n 
A 1 749 ASP 749 812  812  ASP ASP B . n 
A 1 750 PRO 750 813  813  PRO PRO B . n 
A 1 751 ASN 751 814  814  ASN ASN B . n 
A 1 752 LEU 752 815  815  LEU LEU B . n 
A 1 753 GLU 753 816  816  GLU GLU B . n 
A 1 754 THR 754 817  817  THR THR B . n 
A 1 755 VAL 755 818  818  VAL VAL B . n 
A 1 756 TYR 756 819  819  TYR TYR B . n 
A 1 757 THR 757 820  820  THR THR B . n 
A 1 758 LEU 758 821  821  LEU LEU B . n 
A 1 759 CYS 759 822  822  CYS CYS B . n 
A 1 760 GLU 760 823  823  GLU GLU B . n 
A 1 761 LYS 761 824  824  LYS LYS B . n 
A 1 762 LYS 762 825  825  LYS LYS B . n 
A 1 763 ALA 763 826  826  ALA ALA B . n 
A 1 764 GLN 764 827  827  GLN GLN B . n 
A 1 765 ILE 765 828  828  ILE ILE B . n 
A 1 766 ALA 766 829  829  ALA ALA B . n 
A 1 767 ILE 767 830  830  ILE ILE B . n 
A 1 768 ASP 768 831  831  ASP ASP B . n 
A 1 769 ILE 769 832  832  ILE ILE B . n 
A 1 770 LYS 770 833  833  LYS LYS B . n 
A 1 771 SER 771 834  834  SER SER B . n 
A 1 772 ALA 772 835  835  ALA ALA B . n 
A 1 773 LYS 773 836  836  LYS LYS B . n 
A 1 774 ARG 774 837  837  ARG ARG B . n 
A 1 775 GLU 775 838  838  GLU GLU B . n 
A 1 776 LEU 776 839  839  LEU LEU B . n 
A 1 777 LYS 777 840  840  LYS LYS B . n 
A 1 778 LYS 778 841  841  LYS LYS B . n 
A 1 779 ALA 779 842  842  ALA ALA B . n 
A 1 780 ARG 780 843  843  ARG ARG B . n 
A 1 781 THR 781 844  844  THR THR B . n 
A 1 782 VAL 782 845  845  VAL VAL B . n 
A 1 783 LEU 783 846  846  LEU LEU B . n 
A 1 784 GLN 784 847  847  GLN GLN B . n 
A 1 785 MET 785 848  848  MET MET B . n 
A 1 786 ASP 786 849  849  ASP ASP B . n 
A 1 787 GLU 787 850  850  GLU GLU B . n 
A 1 788 LEU 788 851  851  LEU LEU B . n 
A 1 789 LYS 789 852  852  LYS LYS B . n 
A 1 790 CYS 790 853  853  CYS CYS B . n 
A 1 791 ARG 791 854  854  ARG ARG B . n 
A 1 792 LYS 792 855  855  LYS LYS B . n 
A 1 793 ARG 793 856  856  ARG ARG B . n 
A 1 794 VAL 794 857  857  VAL VAL B . n 
A 1 795 LEU 795 858  858  LEU LEU B . n 
A 1 796 ARG 796 859  859  ARG ARG B . n 
A 1 797 ARG 797 860  860  ARG ARG B . n 
A 1 798 LEU 798 861  861  LEU LEU B . n 
A 1 799 GLY 799 862  862  GLY GLY B . n 
A 1 800 PHE 800 863  863  PHE PHE B . n 
A 1 801 ALA 801 864  864  ALA ALA B . n 
A 1 802 THR 802 865  865  THR THR B . n 
A 1 803 SER 803 866  866  SER SER B . n 
A 1 804 SER 804 867  867  SER SER B . n 
A 1 805 ASP 805 868  868  ASP ASP B . n 
A 1 806 VAL 806 869  869  VAL VAL B . n 
A 1 807 ILE 807 870  870  ILE ILE B . n 
A 1 808 GLU 808 871  871  GLU GLU B . n 
A 1 809 MET 809 872  872  MET MET B . n 
A 1 810 LYS 810 873  873  LYS LYS B . n 
A 1 811 GLY 811 874  874  GLY GLY B . n 
A 1 812 ARG 812 875  875  ARG ARG B . n 
A 1 813 VAL 813 876  876  VAL VAL B . n 
A 1 814 ALA 814 877  877  ALA ALA B . n 
A 1 815 CYS 815 878  878  CYS CYS B . n 
A 1 816 GLU 816 879  879  GLU GLU B . n 
A 1 817 ILE 817 880  880  ILE ILE B . n 
A 1 818 SER 818 881  881  SER SER B . n 
A 1 819 SER 819 882  882  SER SER B . n 
A 1 820 ALA 820 883  883  ALA ALA B . n 
A 1 821 ASP 821 884  884  ASP ASP B . n 
A 1 822 GLU 822 885  885  GLU GLU B . n 
A 1 823 LEU 823 886  886  LEU LEU B . n 
A 1 824 LEU 824 887  887  LEU LEU B . n 
A 1 825 LEU 825 888  888  LEU LEU B . n 
A 1 826 THR 826 889  889  THR THR B . n 
A 1 827 GLU 827 890  890  GLU GLU B . n 
A 1 828 MET 828 891  891  MET MET B . n 
A 1 829 MET 829 892  892  MET MET B . n 
A 1 830 PHE 830 893  893  PHE PHE B . n 
A 1 831 ASN 831 894  894  ASN ASN B . n 
A 1 832 GLY 832 895  895  GLY GLY B . n 
A 1 833 LEU 833 896  896  LEU LEU B . n 
A 1 834 PHE 834 897  897  PHE PHE B . n 
A 1 835 ASN 835 898  898  ASN ASN B . n 
A 1 836 ASP 836 899  899  ASP ASP B . n 
A 1 837 LEU 837 900  900  LEU LEU B . n 
A 1 838 SER 838 901  901  SER SER B . n 
A 1 839 ALA 839 902  902  ALA ALA B . n 
A 1 840 GLU 840 903  903  GLU GLU B . n 
A 1 841 GLN 841 904  904  GLN GLN B . n 
A 1 842 ALA 842 905  905  ALA ALA B . n 
A 1 843 THR 843 906  906  THR THR B . n 
A 1 844 ALA 844 907  907  ALA ALA B . n 
A 1 845 LEU 845 908  908  LEU LEU B . n 
A 1 846 LEU 846 909  909  LEU LEU B . n 
A 1 847 SER 847 910  910  SER SER B . n 
A 1 848 CYS 848 911  911  CYS CYS B . n 
A 1 849 PHE 849 912  912  PHE PHE B . n 
A 1 850 VAL 850 913  913  VAL VAL B . n 
A 1 851 PHE 851 914  914  PHE PHE B . n 
A 1 852 GLN 852 915  915  GLN GLN B . n 
A 1 853 GLU 853 916  916  GLU GLU B . n 
A 1 854 ASN 854 917  917  ASN ASN B . n 
A 1 855 SER 855 918  918  SER SER B . n 
A 1 856 SER 856 919  919  SER SER B . n 
A 1 857 GLU 857 920  920  GLU GLU B . n 
A 1 858 MET 858 921  921  MET MET B . n 
A 1 859 PRO 859 922  922  PRO PRO B . n 
A 1 860 LYS 860 923  923  LYS LYS B . n 
A 1 861 LEU 861 924  924  LEU LEU B . n 
A 1 862 THR 862 925  925  THR THR B . n 
A 1 863 GLU 863 926  926  GLU GLU B . n 
A 1 864 GLN 864 927  927  GLN GLN B . n 
A 1 865 LEU 865 928  928  LEU LEU B . n 
A 1 866 ALA 866 929  929  ALA ALA B . n 
A 1 867 GLY 867 930  930  GLY GLY B . n 
A 1 868 PRO 868 931  931  PRO PRO B . n 
A 1 869 LEU 869 932  932  LEU LEU B . n 
A 1 870 ARG 870 933  933  ARG ARG B . n 
A 1 871 GLN 871 934  934  GLN GLN B . n 
A 1 872 MET 872 935  935  MET MET B . n 
A 1 873 GLN 873 936  936  GLN GLN B . n 
A 1 874 GLU 874 937  937  GLU GLU B . n 
A 1 875 CYS 875 938  938  CYS CYS B . n 
A 1 876 ALA 876 939  939  ALA ALA B . n 
A 1 877 LYS 877 940  940  LYS LYS B . n 
A 1 878 ARG 878 941  941  ARG ARG B . n 
A 1 879 ILE 879 942  942  ILE ILE B . n 
A 1 880 ALA 880 943  943  ALA ALA B . n 
A 1 881 LYS 881 944  944  LYS LYS B . n 
A 1 882 VAL 882 945  945  VAL VAL B . n 
A 1 883 SER 883 946  946  SER SER B . n 
A 1 884 ALA 884 947  947  ALA ALA B . n 
A 1 885 GLU 885 948  948  GLU GLU B . n 
A 1 886 ALA 886 949  949  ALA ALA B . n 
A 1 887 LYS 887 950  950  LYS LYS B . n 
A 1 888 LEU 888 951  951  LEU LEU B . n 
A 1 889 GLU 889 952  952  GLU GLU B . n 
A 1 890 ILE 890 953  953  ILE ILE B . n 
A 1 891 ASP 891 954  954  ASP ASP B . n 
A 1 892 GLU 892 955  955  GLU GLU B . n 
A 1 893 GLU 893 956  956  GLU GLU B . n 
A 1 894 THR 894 957  957  THR THR B . n 
A 1 895 TYR 895 958  958  TYR TYR B . n 
A 1 896 LEU 896 959  959  LEU LEU B . n 
A 1 897 SER 897 960  960  SER SER B . n 
A 1 898 SER 898 961  961  SER SER B . n 
A 1 899 PHE 899 962  962  PHE PHE B . n 
A 1 900 LYS 900 963  963  LYS LYS B . n 
A 1 901 PRO 901 964  964  PRO PRO B . n 
A 1 902 HIS 902 965  965  HIS HIS B . n 
A 1 903 LEU 903 966  966  LEU LEU B . n 
A 1 904 MET 904 967  967  MET MET B . n 
A 1 905 ASP 905 968  968  ASP ASP B . n 
A 1 906 VAL 906 969  969  VAL VAL B . n 
A 1 907 VAL 907 970  970  VAL VAL B . n 
A 1 908 TYR 908 971  971  TYR TYR B . n 
A 1 909 THR 909 972  972  THR THR B . n 
A 1 910 TRP 910 973  973  TRP TRP B . n 
A 1 911 ALA 911 974  974  ALA ALA B . n 
A 1 912 THR 912 975  975  THR THR B . n 
A 1 913 GLY 913 976  976  GLY GLY B . n 
A 1 914 ALA 914 977  977  ALA ALA B . n 
A 1 915 THR 915 978  978  THR THR B . n 
A 1 916 PHE 916 979  979  PHE PHE B . n 
A 1 917 ALA 917 980  980  ALA ALA B . n 
A 1 918 HIS 918 981  981  HIS HIS B . n 
A 1 919 ILE 919 982  982  ILE ILE B . n 
A 1 920 CYS 920 983  983  CYS CYS B . n 
A 1 921 LYS 921 984  984  LYS LYS B . n 
A 1 922 MET 922 985  985  MET MET B . n 
A 1 923 THR 923 986  986  THR THR B . n 
A 1 924 ASP 924 987  987  ASP ASP B . n 
A 1 925 VAL 925 988  988  VAL VAL B . n 
A 1 926 PHE 926 989  989  PHE PHE B . n 
A 1 927 GLU 927 990  990  GLU GLU B . n 
A 1 928 GLY 928 991  991  GLY GLY B . n 
A 1 929 SER 929 992  992  SER SER B . n 
A 1 930 ILE 930 993  993  ILE ILE B . n 
A 1 931 ILE 931 994  994  ILE ILE B . n 
A 1 932 ARG 932 995  995  ARG ARG B . n 
A 1 933 CYS 933 996  996  CYS CYS B . n 
A 1 934 MET 934 997  997  MET MET B . n 
A 1 935 ARG 935 998  998  ARG ARG B . n 
A 1 936 ARG 936 999  999  ARG ARG B . n 
A 1 937 LEU 937 1000 1000 LEU LEU B . n 
A 1 938 GLU 938 1001 1001 GLU GLU B . n 
A 1 939 GLU 939 1002 1002 GLU GLU B . n 
A 1 940 LEU 940 1003 1003 LEU LEU B . n 
A 1 941 LEU 941 1004 1004 LEU LEU B . n 
A 1 942 ARG 942 1005 1005 ARG ARG B . n 
A 1 943 GLN 943 1006 1006 GLN GLN B . n 
A 1 944 MET 944 1007 1007 MET MET B . n 
A 1 945 CYS 945 1008 1008 CYS CYS B . n 
A 1 946 GLN 946 1009 1009 GLN GLN B . n 
A 1 947 ALA 947 1010 1010 ALA ALA B . n 
A 1 948 ALA 948 1011 1011 ALA ALA B . n 
A 1 949 LYS 949 1012 1012 LYS LYS B . n 
A 1 950 ALA 950 1013 1013 ALA ALA B . n 
A 1 951 ILE 951 1014 1014 ILE ILE B . n 
A 1 952 GLY 952 1015 1015 GLY GLY B . n 
A 1 953 ASN 953 1016 1016 ASN ASN B . n 
A 1 954 THR 954 1017 1017 THR THR B . n 
A 1 955 GLU 955 1018 1018 GLU GLU B . n 
A 1 956 LEU 956 1019 1019 LEU LEU B . n 
A 1 957 GLU 957 1020 1020 GLU GLU B . n 
A 1 958 ASN 958 1021 1021 ASN ASN B . n 
A 1 959 LYS 959 1022 1022 LYS LYS B . n 
A 1 960 PHE 960 1023 1023 PHE PHE B . n 
A 1 961 ALA 961 1024 1024 ALA ALA B . n 
A 1 962 GLU 962 1025 1025 GLU GLU B . n 
A 1 963 GLY 963 1026 1026 GLY GLY B . n 
A 1 964 ILE 964 1027 1027 ILE ILE B . n 
A 1 965 THR 965 1028 1028 THR THR B . n 
A 1 966 LYS 966 1029 1029 LYS LYS B . n 
A 1 967 ILE 967 1030 1030 ILE ILE B . n 
A 1 968 LYS 968 1031 1031 LYS LYS B . n 
A 1 969 ARG 969 1032 1032 ARG ARG B . n 
A 1 970 ASP 970 1033 1033 ASP ASP B . n 
A 1 971 ILE 971 1034 1034 ILE ILE B . n 
A 1 972 VAL 972 1035 1035 VAL VAL B . n 
A 1 973 PHE 973 1036 1036 PHE PHE B . n 
A 1 974 ALA 974 1037 1037 ALA ALA B . n 
A 1 975 ALA 975 1038 1038 ALA ALA B . n 
A 1 976 SER 976 1039 1039 SER SER B . n 
A 1 977 LEU 977 1040 1040 LEU LEU B . n 
A 1 978 TYR 978 1041 1041 TYR TYR B . n 
A 1 979 LEU 979 1042 1042 LEU LEU B . n 
B 2 1   SER 1   162  162  SER SER A . n 
B 2 2   PHE 2   163  163  PHE PHE A . n 
B 2 3   ARG 3   164  164  ARG ARG A . n 
B 2 4   THR 4   165  165  THR THR A . n 
B 2 5   ASP 5   166  166  ASP ASP A . n 
B 2 6   LYS 6   167  167  LYS LYS A . n 
B 2 7   LYS 7   168  168  LYS LYS A . n 
B 2 8   PRO 8   169  169  PRO PRO A . n 
B 2 9   ASP 9   170  170  ASP ASP A . n 
B 2 10  PRO 10  171  171  PRO PRO A . n 
B 2 11  ALA 11  172  172  ALA ALA A . n 
B 2 12  ASN 12  173  173  ASN ASN A . n 
B 2 13  TRP 13  174  174  TRP TRP A . n 
B 2 14  GLU 14  175  175  GLU GLU A . n 
B 2 15  TYR 15  176  176  TYR TYR A . n 
B 2 16  LYS 16  177  177  LYS LYS A . n 
B 2 17  SER 17  178  178  SER SER A . n 
B 2 18  LEU 18  179  179  LEU LEU A . n 
B 2 19  TYR 19  180  180  TYR TYR A . n 
B 2 20  ARG 20  181  181  ARG ARG A . n 
B 2 21  GLY 21  182  182  GLY GLY A . n 
B 2 22  ASP 22  183  183  ASP ASP A . n 
B 2 23  ILE 23  184  184  ILE ILE A . n 
B 2 24  ALA 24  185  185  ALA ALA A . n 
B 2 25  ARG 25  186  186  ARG ARG A . n 
B 2 26  TYR 26  187  187  TYR TYR A . n 
B 2 27  LYS 27  188  188  LYS LYS A . n 
B 2 28  ARG 28  189  189  ARG ARG A . n 
B 2 29  LYS 29  190  190  LYS LYS A . n 
B 2 30  GLY 30  191  191  GLY GLY A . n 
B 2 31  ASP 31  192  192  ASP ASP A . n 
B 2 32  SER 32  193  193  SER SER A . n 
B 2 33  CYS 33  194  194  CYS CYS A . n 
B 2 34  LEU 34  195  195  LEU LEU A . n 
B 2 35  GLY 35  196  196  GLY GLY A . n 
B 2 36  ILE 36  197  197  ILE ILE A . n 
B 2 37  ASN 37  198  198  ASN ASN A . n 
B 2 38  PRO 38  199  199  PRO PRO A . n 
B 2 39  LYS 39  200  200  LYS LYS A . n 
B 2 40  LYS 40  201  201  LYS LYS A . n 
B 2 41  GLN 41  202  202  GLN GLN A . n 
B 2 42  CYS 42  203  203  CYS CYS A . n 
B 2 43  ILE 43  204  204  ILE ILE A . n 
B 2 44  SER 44  205  205  SER SER A . n 
B 2 45  TRP 45  206  206  TRP TRP A . n 
B 2 46  GLU 46  207  207  GLU GLU A . n 
B 2 47  GLY 47  208  ?    ?   ?   A . n 
B 2 48  THR 48  209  ?    ?   ?   A . n 
B 2 49  SER 49  210  ?    ?   ?   A . n 
B 2 50  THR 50  211  211  THR THR A . n 
B 2 51  GLU 51  212  212  GLU GLU A . n 
B 2 52  LYS 52  213  213  LYS LYS A . n 
B 2 53  LYS 53  214  214  LYS LYS A . n 
B 2 54  HIS 54  215  215  HIS HIS A . n 
B 2 55  SER 55  216  216  SER SER A . n 
B 2 56  ARG 56  217  217  ARG ARG A . n 
B 2 57  LYS 57  218  218  LYS LYS A . n 
B 2 58  GLN 58  219  219  GLN GLN A . n 
B 2 59  VAL 59  220  220  VAL VAL A . n 
B 2 60  GLU 60  221  221  GLU GLU A . n 
B 2 61  ARG 61  222  222  ARG ARG A . n 
B 2 62  TYR 62  223  223  TYR TYR A . n 
B 2 63  PHE 63  224  224  PHE PHE A . n 
B 2 64  THR 64  225  225  THR THR A . n 
B 2 65  LYS 65  226  226  LYS LYS A . n 
B 2 66  LYS 66  227  227  LYS LYS A . n 
B 2 67  SER 67  228  228  SER SER A . n 
B 2 68  VAL 68  229  229  VAL VAL A . n 
B 2 69  GLY 69  230  230  GLY GLY A . n 
B 2 70  LEU 70  231  231  LEU LEU A . n 
B 2 71  MET 71  232  232  MET MET A . n 
B 2 72  ASN 72  233  233  ASN ASN A . n 
B 2 73  ILE 73  234  234  ILE ILE A . n 
B 2 74  ASP 74  235  ?    ?   ?   A . n 
B 2 75  GLY 75  236  ?    ?   ?   A . n 
B 2 76  VAL 76  237  ?    ?   ?   A . n 
B 2 77  ALA 77  238  ?    ?   ?   A . n 
B 2 78  ILE 78  239  ?    ?   ?   A . n 
B 2 79  SER 79  240  ?    ?   ?   A . n 
B 2 80  SER 80  241  241  SER SER A . n 
B 2 81  LYS 81  242  242  LYS LYS A . n 
B 2 82  THR 82  243  243  THR THR A . n 
B 2 83  GLU 83  244  244  GLU GLU A . n 
B 2 84  PRO 84  245  245  PRO PRO A . n 
B 2 85  PRO 85  246  ?    ?   ?   A . n 
B 2 86  SER 86  247  ?    ?   ?   A . n 
B 2 87  SER 87  248  ?    ?   ?   A . n 
B 2 88  GLU 88  249  249  GLU GLU A . n 
B 2 89  PRO 89  250  250  PRO PRO A . n 
B 2 90  ILE 90  251  251  ILE ILE A . n 
B 2 91  SER 91  252  252  SER SER A . n 
B 2 92  PHE 92  253  253  PHE PHE A . n 
B 2 93  ILE 93  254  254  ILE ILE A . n 
B 2 94  PRO 94  255  255  PRO PRO A . n 
B 2 95  VAL 95  256  256  VAL VAL A . n 
B 2 96  LYS 96  257  257  LYS LYS A . n 
B 2 97  ASP 97  258  258  ASP ASP A . n 
B 2 98  LEU 98  259  ?    ?   ?   A . n 
B 2 99  GLU 99  260  ?    ?   ?   A . n 
B 2 100 ASP 100 261  ?    ?   ?   A . n 
B 2 101 ALA 101 262  ?    ?   ?   A . n 
B 2 102 ALA 102 263  ?    ?   ?   A . n 
B 2 103 PRO 103 264  ?    ?   ?   A . n 
B 2 104 VAL 104 265  ?    ?   ?   A . n 
B 2 105 THR 105 266  ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CL  1  1101 1   CL  CL  B . 
D 4 ATP 1  1102 501 ATP ATP B . 
E 5 HOH 1  1201 31  HOH HOH B . 
E 5 HOH 2  1202 18  HOH HOH B . 
E 5 HOH 3  1203 14  HOH HOH B . 
E 5 HOH 4  1204 4   HOH HOH B . 
E 5 HOH 5  1205 10  HOH HOH B . 
E 5 HOH 6  1206 17  HOH HOH B . 
E 5 HOH 7  1207 21  HOH HOH B . 
E 5 HOH 8  1208 22  HOH HOH B . 
E 5 HOH 9  1209 20  HOH HOH B . 
E 5 HOH 10 1210 23  HOH HOH B . 
E 5 HOH 11 1211 5   HOH HOH B . 
E 5 HOH 12 1212 27  HOH HOH B . 
E 5 HOH 13 1213 15  HOH HOH B . 
E 5 HOH 14 1214 28  HOH HOH B . 
E 5 HOH 15 1215 16  HOH HOH B . 
E 5 HOH 16 1216 13  HOH HOH B . 
E 5 HOH 17 1217 9   HOH HOH B . 
E 5 HOH 18 1218 3   HOH HOH B . 
E 5 HOH 19 1219 30  HOH HOH B . 
E 5 HOH 20 1220 12  HOH HOH B . 
E 5 HOH 21 1221 29  HOH HOH B . 
E 5 HOH 22 1222 24  HOH HOH B . 
E 5 HOH 23 1223 7   HOH HOH B . 
E 5 HOH 24 1224 19  HOH HOH B . 
E 5 HOH 25 1225 11  HOH HOH B . 
E 5 HOH 26 1226 8   HOH HOH B . 
E 5 HOH 27 1227 26  HOH HOH B . 
F 5 HOH 1  301  33  HOH HOH A . 
F 5 HOH 2  302  34  HOH HOH A . 
F 5 HOH 3  303  6   HOH HOH A . 
F 5 HOH 4  304  32  HOH HOH A . 
F 5 HOH 5  305  25  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8500  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  43180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-04-03 
2 'Structure model' 1 1 2019-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_ISSN' 
2 2 'Structure model' '_citation.journal_volume'  
3 2 'Structure model' '_citation.page_first'      
4 2 'Structure model' '_citation.page_last'       
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.13_2998: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .                  4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OE2 B GLU 582 ? ? NZ  B LYS 855  ? ? 1.09 
2  1 NZ  B LYS 167 ? ? O   B HOH 1201 ? ? 1.47 
3  1 O   B PHE 897 ? ? NZ  B LYS 1022 ? ? 1.55 
4  1 OE2 B GLU 465 ? ? CB  B LEU 1040 ? ? 1.65 
5  1 CB  B PRO 313 ? ? NH1 B ARG 527  ? ? 1.72 
6  1 CB  B ASN 686 ? ? CB  B SER 960  ? ? 1.75 
7  1 O   B ASP 884 ? ? CD2 B LEU 888  ? ? 1.76 
8  1 O   B LEU 896 ? ? CD2 B LEU 900  ? ? 1.76 
9  1 CG  B PRO 313 ? ? NH1 B ARG 527  ? ? 1.77 
10 1 CG2 B THR 168 ? ? O2A B ATP 1102 ? ? 1.80 
11 1 NH2 B ARG 233 ? ? OD1 B ASN 568  ? ? 1.83 
12 1 CG  B LYS 396 ? ? ND1 B HIS 456  ? ? 1.83 
13 1 CB  B ASP 968 ? ? O   B HOH 1221 ? ? 1.85 
14 1 O   B GLU 468 ? ? CE  B MET 491  ? ? 1.90 
15 1 OE1 B GLU 253 ? ? O   B HOH 1201 ? ? 1.91 
16 1 OE1 B GLU 442 ? ? OE1 A GLU 221  ? ? 1.94 
17 1 CB  B THR 168 ? ? O2A B ATP 1102 ? ? 1.97 
18 1 OH  B TYR 237 ? ? OE1 B GLU 268  ? ? 2.00 
19 1 O   B ALA 977 ? ? NH1 B ARG 1032 ? ? 2.00 
20 1 NH1 B ARG 258 ? ? O   B ASP 557  ? ? 2.02 
21 1 OE2 B GLU 713 ? ? CE  A LYS 200  ? ? 2.08 
22 1 OG1 B THR 482 ? ? O   B HOH 1202 ? ? 2.11 
23 1 O   B GLY 458 ? ? N   B GLY 991  ? ? 2.13 
24 1 CD1 B ILE 615 ? ? CG  B LYS 825  ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD  B GLU 113 ? ? OE1 B GLU 113 ? ? 1.181 1.252 -0.071 0.011 N 
2 1 CD  B GLU 172 ? ? OE1 B GLU 172 ? ? 1.182 1.252 -0.070 0.011 N 
3 1 CE1 B TYR 279 ? ? CZ  B TYR 279 ? ? 1.302 1.381 -0.079 0.013 N 
4 1 CE1 B TYR 308 ? ? CZ  B TYR 308 ? ? 1.291 1.381 -0.090 0.013 N 
5 1 CE1 B TYR 402 ? ? CZ  B TYR 402 ? ? 1.297 1.381 -0.084 0.013 N 
6 1 CE1 B TYR 567 ? ? CZ  B TYR 567 ? ? 1.293 1.381 -0.088 0.013 N 
7 1 CD  B GLU 582 ? ? OE1 B GLU 582 ? ? 1.177 1.252 -0.075 0.011 N 
8 1 CE1 A TYR 187 ? ? CZ  A TYR 187 ? ? 1.291 1.381 -0.090 0.013 N 
9 1 CB  A CYS 194 ? ? SG  A CYS 194 ? ? 1.713 1.812 -0.099 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA  B CYS 110  ? ? CB B CYS 110  ? ? SG  B CYS 110  ? ? 121.01 114.20 6.81   1.10 N 
2  1 CA  B CYS 150  ? ? CB B CYS 150  ? ? SG  B CYS 150  ? ? 122.30 114.20 8.10   1.10 N 
3  1 C   B SER 189  ? ? N  B PRO 190  ? ? CA  B PRO 190  ? ? 129.63 119.30 10.33  1.50 Y 
4  1 C   B ILE 286  ? ? N  B PRO 287  ? ? CA  B PRO 287  ? ? 131.66 119.30 12.36  1.50 Y 
5  1 CA  B LEU 316  ? ? CB B LEU 316  ? ? CG  B LEU 316  ? ? 129.40 115.30 14.10  2.30 N 
6  1 C   B LEU 460  ? ? N  B PRO 461  ? ? CA  B PRO 461  ? ? 129.31 119.30 10.01  1.50 Y 
7  1 CB  B ASP 505  ? ? CA B ASP 505  ? ? C   B ASP 505  ? ? 97.02  110.40 -13.38 2.00 N 
8  1 CA  B LEU 552  ? ? CB B LEU 552  ? ? CG  B LEU 552  ? ? 129.82 115.30 14.52  2.30 N 
9  1 CG1 B ILE 579  ? ? CB B ILE 579  ? ? CG2 B ILE 579  ? ? 95.66  111.40 -15.74 2.20 N 
10 1 C   B LEU 651  ? ? N  B PRO 652  ? ? CA  B PRO 652  ? ? 132.31 119.30 13.01  1.50 Y 
11 1 C   B LEU 651  ? ? N  B PRO 652  ? ? CD  B PRO 652  ? ? 111.81 128.40 -16.59 2.10 Y 
12 1 CB  B ASP 667  ? ? CA B ASP 667  ? ? C   B ASP 667  ? ? 122.56 110.40 12.16  2.00 N 
13 1 C   B ASP 691  ? ? N  B PRO 692  ? ? CA  B PRO 692  ? ? 131.34 119.30 12.04  1.50 Y 
14 1 CB  B LEU 707  ? ? CG B LEU 707  ? ? CD1 B LEU 707  ? ? 99.36  111.00 -11.64 1.70 N 
15 1 C   B ILE 774  ? ? N  B PRO 775  ? ? CA  B PRO 775  ? ? 131.53 119.30 12.23  1.50 Y 
16 1 C   B HIS 807  ? ? N  B PRO 808  ? ? CA  B PRO 808  ? ? 139.26 119.30 19.96  1.50 Y 
17 1 C   B HIS 807  ? ? N  B PRO 808  ? ? CD  B PRO 808  ? ? 109.30 128.40 -19.10 2.10 Y 
18 1 C   B ASP 812  ? ? N  B PRO 813  ? ? CA  B PRO 813  ? ? 133.97 119.30 14.67  1.50 Y 
19 1 C   B ASP 812  ? ? N  B PRO 813  ? ? CD  B PRO 813  ? ? 111.73 128.40 -16.67 2.10 Y 
20 1 CB  B LEU 888  ? ? CG B LEU 888  ? ? CD2 B LEU 888  ? ? 122.50 111.00 11.50  1.70 N 
21 1 C   B GLY 930  ? ? N  B PRO 931  ? ? CA  B PRO 931  ? ? 130.83 119.30 11.53  1.50 Y 
22 1 CB  B ASP 954  ? ? CA B ASP 954  ? ? C   B ASP 954  ? ? 122.62 110.40 12.22  2.00 N 
23 1 C   B LYS 963  ? ? N  B PRO 964  ? ? CA  B PRO 964  ? ? 133.81 119.30 14.51  1.50 Y 
24 1 C   B LYS 963  ? ? N  B PRO 964  ? ? CD  B PRO 964  ? ? 113.76 128.40 -14.64 2.10 Y 
25 1 N   B ALA 1037 ? ? CA B ALA 1037 ? ? C   B ALA 1037 ? ? 129.69 111.00 18.69  2.70 N 
26 1 C   A LYS 168  ? ? N  A PRO 169  ? ? CA  A PRO 169  ? ? 129.28 119.30 9.98   1.50 Y 
27 1 C   A ASP 170  ? ? N  A PRO 171  ? ? CA  A PRO 171  ? ? 132.35 119.30 13.05  1.50 Y 
28 1 C   A ASN 198  ? ? N  A PRO 199  ? ? CD  A PRO 199  ? ? 142.19 128.40 13.79  2.10 Y 
29 1 C   A GLU 249  ? ? N  A PRO 250  ? ? CA  A PRO 250  ? ? 128.66 119.30 9.36   1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL B 107  ? ? -104.71 -72.88  
2  1 LYS B 182  ? ? 80.42   6.61    
3  1 ASP B 352  ? ? 82.08   15.18   
4  1 GLN B 387  ? ? 52.65   -121.45 
5  1 LYS B 507  ? ? -120.80 -58.33  
6  1 ILE B 617  ? ? -148.17 41.19   
7  1 PRO B 685  ? ? -98.92  34.21   
8  1 LEU B 690  ? ? 53.34   -136.48 
9  1 ASP B 1033 ? ? 59.78   -129.92 
10 1 SER A 193  ? ? -113.84 -150.00 
11 1 GLU A 244  ? ? 175.73  -172.76 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    684 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    685 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -32.59 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 B ARG 98   ? CG  ? A ARG 35  CG  
2   1 Y 1 B ARG 98   ? CD  ? A ARG 35  CD  
3   1 Y 1 B ARG 98   ? NE  ? A ARG 35  NE  
4   1 Y 1 B ARG 98   ? CZ  ? A ARG 35  CZ  
5   1 Y 1 B ARG 98   ? NH1 ? A ARG 35  NH1 
6   1 Y 1 B ARG 98   ? NH2 ? A ARG 35  NH2 
7   1 Y 1 B GLU 105  ? CG  ? A GLU 42  CG  
8   1 Y 1 B GLU 105  ? CD  ? A GLU 42  CD  
9   1 Y 1 B GLU 105  ? OE1 ? A GLU 42  OE1 
10  1 Y 1 B GLU 105  ? OE2 ? A GLU 42  OE2 
11  1 Y 1 B GLU 108  ? CG  ? A GLU 45  CG  
12  1 Y 1 B GLU 108  ? CD  ? A GLU 45  CD  
13  1 Y 1 B GLU 108  ? OE1 ? A GLU 45  OE1 
14  1 Y 1 B GLU 108  ? OE2 ? A GLU 45  OE2 
15  1 Y 1 B GLU 120  ? CG  ? A GLU 57  CG  
16  1 Y 1 B GLU 120  ? CD  ? A GLU 57  CD  
17  1 Y 1 B GLU 120  ? OE1 ? A GLU 57  OE1 
18  1 Y 1 B GLU 120  ? OE2 ? A GLU 57  OE2 
19  1 Y 1 B LYS 126  ? CG  ? A LYS 63  CG  
20  1 Y 1 B LYS 126  ? CD  ? A LYS 63  CD  
21  1 Y 1 B LYS 126  ? CE  ? A LYS 63  CE  
22  1 Y 1 B LYS 126  ? NZ  ? A LYS 63  NZ  
23  1 Y 1 B LYS 131  ? CG  ? A LYS 68  CG  
24  1 Y 1 B LYS 131  ? CD  ? A LYS 68  CD  
25  1 Y 1 B LYS 131  ? CE  ? A LYS 68  CE  
26  1 Y 1 B LYS 131  ? NZ  ? A LYS 68  NZ  
27  1 Y 1 B ARG 184  ? CG  ? A ARG 121 CG  
28  1 Y 1 B ARG 184  ? CD  ? A ARG 121 CD  
29  1 Y 1 B ARG 184  ? NE  ? A ARG 121 NE  
30  1 Y 1 B ARG 184  ? CZ  ? A ARG 121 CZ  
31  1 Y 1 B ARG 184  ? NH1 ? A ARG 121 NH1 
32  1 Y 1 B ARG 184  ? NH2 ? A ARG 121 NH2 
33  1 Y 1 B GLN 197  ? CG  ? A GLN 134 CG  
34  1 Y 1 B GLN 197  ? CD  ? A GLN 134 CD  
35  1 Y 1 B GLN 197  ? OE1 ? A GLN 134 OE1 
36  1 Y 1 B GLN 197  ? NE2 ? A GLN 134 NE2 
37  1 Y 1 B TYR 203  ? CG  ? A TYR 140 CG  
38  1 Y 1 B TYR 203  ? CD1 ? A TYR 140 CD1 
39  1 Y 1 B TYR 203  ? CD2 ? A TYR 140 CD2 
40  1 Y 1 B TYR 203  ? CE1 ? A TYR 140 CE1 
41  1 Y 1 B TYR 203  ? CE2 ? A TYR 140 CE2 
42  1 Y 1 B TYR 203  ? CZ  ? A TYR 140 CZ  
43  1 Y 1 B TYR 203  ? OH  ? A TYR 140 OH  
44  1 Y 1 B SER 223  ? OG  ? A SER 160 OG  
45  1 Y 1 B ARG 238  ? NE  ? A ARG 175 NE  
46  1 Y 1 B ARG 238  ? CZ  ? A ARG 175 CZ  
47  1 Y 1 B ARG 238  ? NH1 ? A ARG 175 NH1 
48  1 Y 1 B ARG 238  ? NH2 ? A ARG 175 NH2 
49  1 Y 1 B SER 240  ? OG  ? A SER 177 OG  
50  1 Y 1 B ARG 244  ? CG  ? A ARG 181 CG  
51  1 Y 1 B ARG 244  ? CD  ? A ARG 181 CD  
52  1 Y 1 B ARG 244  ? NE  ? A ARG 181 NE  
53  1 Y 1 B ARG 244  ? CZ  ? A ARG 181 CZ  
54  1 Y 1 B ARG 244  ? NH1 ? A ARG 181 NH1 
55  1 Y 1 B ARG 244  ? NH2 ? A ARG 181 NH2 
56  1 Y 1 B GLU 245  ? CG  ? A GLU 182 CG  
57  1 Y 1 B GLU 245  ? CD  ? A GLU 182 CD  
58  1 Y 1 B GLU 245  ? OE1 ? A GLU 182 OE1 
59  1 Y 1 B GLU 245  ? OE2 ? A GLU 182 OE2 
60  1 Y 1 B GLU 261  ? CG  ? A GLU 198 CG  
61  1 Y 1 B GLU 261  ? CD  ? A GLU 198 CD  
62  1 Y 1 B GLU 261  ? OE1 ? A GLU 198 OE1 
63  1 Y 1 B GLU 261  ? OE2 ? A GLU 198 OE2 
64  1 Y 1 B ARG 262  ? CZ  ? A ARG 199 CZ  
65  1 Y 1 B ARG 262  ? NH1 ? A ARG 199 NH1 
66  1 Y 1 B ARG 262  ? NH2 ? A ARG 199 NH2 
67  1 Y 1 B ARG 351  ? CG  ? A ARG 288 CG  
68  1 Y 1 B ARG 351  ? CD  ? A ARG 288 CD  
69  1 Y 1 B ARG 351  ? NE  ? A ARG 288 NE  
70  1 Y 1 B ARG 351  ? CZ  ? A ARG 288 CZ  
71  1 Y 1 B ARG 351  ? NH1 ? A ARG 288 NH1 
72  1 Y 1 B ARG 351  ? NH2 ? A ARG 288 NH2 
73  1 Y 1 B ASP 355  ? CG  ? A ASP 292 CG  
74  1 Y 1 B ASP 355  ? OD1 ? A ASP 292 OD1 
75  1 Y 1 B ASP 355  ? OD2 ? A ASP 292 OD2 
76  1 Y 1 B LYS 397  ? CG  ? A LYS 334 CG  
77  1 Y 1 B LYS 397  ? CD  ? A LYS 334 CD  
78  1 Y 1 B LYS 397  ? CE  ? A LYS 334 CE  
79  1 Y 1 B LYS 397  ? NZ  ? A LYS 334 NZ  
80  1 Y 1 B LYS 418  ? CG  ? A LYS 355 CG  
81  1 Y 1 B LYS 418  ? CD  ? A LYS 355 CD  
82  1 Y 1 B LYS 418  ? CE  ? A LYS 355 CE  
83  1 Y 1 B LYS 418  ? NZ  ? A LYS 355 NZ  
84  1 Y 1 B VAL 420  ? CG1 ? A VAL 357 CG1 
85  1 Y 1 B VAL 420  ? CG2 ? A VAL 357 CG2 
86  1 Y 1 B GLU 422  ? CG  ? A GLU 359 CG  
87  1 Y 1 B GLU 422  ? CD  ? A GLU 359 CD  
88  1 Y 1 B GLU 422  ? OE1 ? A GLU 359 OE1 
89  1 Y 1 B GLU 422  ? OE2 ? A GLU 359 OE2 
90  1 Y 1 B VAL 423  ? CG1 ? A VAL 360 CG1 
91  1 Y 1 B VAL 423  ? CG2 ? A VAL 360 CG2 
92  1 Y 1 B SER 432  ? OG  ? A SER 369 OG  
93  1 Y 1 B LYS 436  ? CG  ? A LYS 373 CG  
94  1 Y 1 B LYS 436  ? CD  ? A LYS 373 CD  
95  1 Y 1 B LYS 436  ? CE  ? A LYS 373 CE  
96  1 Y 1 B LYS 436  ? NZ  ? A LYS 373 NZ  
97  1 Y 1 B LYS 437  ? CG  ? A LYS 374 CG  
98  1 Y 1 B LYS 437  ? CD  ? A LYS 374 CD  
99  1 Y 1 B LYS 437  ? CE  ? A LYS 374 CE  
100 1 Y 1 B LYS 437  ? NZ  ? A LYS 374 NZ  
101 1 Y 1 B LEU 438  ? CG  ? A LEU 375 CG  
102 1 Y 1 B LEU 438  ? CD1 ? A LEU 375 CD1 
103 1 Y 1 B LEU 438  ? CD2 ? A LEU 375 CD2 
104 1 Y 1 B HIS 443  ? CG  ? A HIS 380 CG  
105 1 Y 1 B HIS 443  ? ND1 ? A HIS 380 ND1 
106 1 Y 1 B HIS 443  ? CD2 ? A HIS 380 CD2 
107 1 Y 1 B HIS 443  ? CE1 ? A HIS 380 CE1 
108 1 Y 1 B HIS 443  ? NE2 ? A HIS 380 NE2 
109 1 Y 1 B VAL 444  ? CG1 ? A VAL 381 CG1 
110 1 Y 1 B VAL 444  ? CG2 ? A VAL 381 CG2 
111 1 Y 1 B LYS 449  ? CG  ? A LYS 386 CG  
112 1 Y 1 B LYS 449  ? CD  ? A LYS 386 CD  
113 1 Y 1 B LYS 449  ? CE  ? A LYS 386 CE  
114 1 Y 1 B LYS 449  ? NZ  ? A LYS 386 NZ  
115 1 Y 1 B LYS 542  ? CG  ? A LYS 479 CG  
116 1 Y 1 B LYS 542  ? CD  ? A LYS 479 CD  
117 1 Y 1 B LYS 542  ? CE  ? A LYS 479 CE  
118 1 Y 1 B LYS 542  ? NZ  ? A LYS 479 NZ  
119 1 Y 1 B GLU 578  ? CG  ? A GLU 515 CG  
120 1 Y 1 B GLU 578  ? CD  ? A GLU 515 CD  
121 1 Y 1 B GLU 578  ? OE1 ? A GLU 515 OE1 
122 1 Y 1 B GLU 578  ? OE2 ? A GLU 515 OE2 
123 1 Y 1 B GLU 603  ? CG  ? A GLU 540 CG  
124 1 Y 1 B GLU 603  ? CD  ? A GLU 540 CD  
125 1 Y 1 B GLU 603  ? OE1 ? A GLU 540 OE1 
126 1 Y 1 B GLU 603  ? OE2 ? A GLU 540 OE2 
127 1 Y 1 B LYS 604  ? CG  ? A LYS 541 CG  
128 1 Y 1 B LYS 604  ? CD  ? A LYS 541 CD  
129 1 Y 1 B LYS 604  ? CE  ? A LYS 541 CE  
130 1 Y 1 B LYS 604  ? NZ  ? A LYS 541 NZ  
131 1 Y 1 B LYS 606  ? O   ? A LYS 543 O   
132 1 Y 1 B LYS 606  ? CG  ? A LYS 543 CG  
133 1 Y 1 B LYS 606  ? CD  ? A LYS 543 CD  
134 1 Y 1 B LYS 606  ? CE  ? A LYS 543 CE  
135 1 Y 1 B LYS 606  ? NZ  ? A LYS 543 NZ  
136 1 Y 1 B ASN 607  ? CG  ? A ASN 544 CG  
137 1 Y 1 B ASN 607  ? OD1 ? A ASN 544 OD1 
138 1 Y 1 B ASN 607  ? ND2 ? A ASN 544 ND2 
139 1 Y 1 B LYS 614  ? CG  ? A LYS 551 CG  
140 1 Y 1 B LYS 614  ? CD  ? A LYS 551 CD  
141 1 Y 1 B LYS 614  ? CE  ? A LYS 551 CE  
142 1 Y 1 B LYS 614  ? NZ  ? A LYS 551 NZ  
143 1 Y 1 B VAL 616  ? CG1 ? A VAL 553 CG1 
144 1 Y 1 B VAL 616  ? CG2 ? A VAL 553 CG2 
145 1 Y 1 B ILE 617  ? CG1 ? A ILE 554 CG1 
146 1 Y 1 B ILE 617  ? CG2 ? A ILE 554 CG2 
147 1 Y 1 B ILE 617  ? CD1 ? A ILE 554 CD1 
148 1 Y 1 B ASN 619  ? CG  ? A ASN 556 CG  
149 1 Y 1 B ASN 619  ? OD1 ? A ASN 556 OD1 
150 1 Y 1 B ASN 619  ? ND2 ? A ASN 556 ND2 
151 1 Y 1 B GLU 620  ? CG  ? A GLU 557 CG  
152 1 Y 1 B GLU 620  ? CD  ? A GLU 557 CD  
153 1 Y 1 B GLU 620  ? OE1 ? A GLU 557 OE1 
154 1 Y 1 B GLU 620  ? OE2 ? A GLU 557 OE2 
155 1 Y 1 B GLU 621  ? CG  ? A GLU 558 CG  
156 1 Y 1 B GLU 621  ? CD  ? A GLU 558 CD  
157 1 Y 1 B GLU 621  ? OE1 ? A GLU 558 OE1 
158 1 Y 1 B GLU 621  ? OE2 ? A GLU 558 OE2 
159 1 Y 1 B LYS 628  ? CG  ? A LYS 565 CG  
160 1 Y 1 B LYS 628  ? CD  ? A LYS 565 CD  
161 1 Y 1 B LYS 628  ? CE  ? A LYS 565 CE  
162 1 Y 1 B LYS 628  ? NZ  ? A LYS 565 NZ  
163 1 Y 1 B ILE 629  ? CG1 ? A ILE 566 CG1 
164 1 Y 1 B ILE 629  ? CG2 ? A ILE 566 CG2 
165 1 Y 1 B ILE 629  ? CD1 ? A ILE 566 CD1 
166 1 Y 1 B LYS 635  ? CG  ? A LYS 572 CG  
167 1 Y 1 B LYS 635  ? CD  ? A LYS 572 CD  
168 1 Y 1 B LYS 635  ? CE  ? A LYS 572 CE  
169 1 Y 1 B LYS 635  ? NZ  ? A LYS 572 NZ  
170 1 Y 1 B LYS 638  ? CG  ? A LYS 575 CG  
171 1 Y 1 B LYS 638  ? CD  ? A LYS 575 CD  
172 1 Y 1 B LYS 638  ? CE  ? A LYS 575 CE  
173 1 Y 1 B LYS 638  ? NZ  ? A LYS 575 NZ  
174 1 Y 1 B GLU 639  ? CG  ? A GLU 576 CG  
175 1 Y 1 B GLU 639  ? CD  ? A GLU 576 CD  
176 1 Y 1 B GLU 639  ? OE1 ? A GLU 576 OE1 
177 1 Y 1 B GLU 639  ? OE2 ? A GLU 576 OE2 
178 1 Y 1 B GLU 642  ? CG  ? A GLU 579 CG  
179 1 Y 1 B GLU 642  ? CD  ? A GLU 579 CD  
180 1 Y 1 B GLU 642  ? OE1 ? A GLU 579 OE1 
181 1 Y 1 B GLU 642  ? OE2 ? A GLU 579 OE2 
182 1 Y 1 B TYR 643  ? CG  ? A TYR 580 CG  
183 1 Y 1 B TYR 643  ? CD1 ? A TYR 580 CD1 
184 1 Y 1 B TYR 643  ? CD2 ? A TYR 580 CD2 
185 1 Y 1 B TYR 643  ? CE1 ? A TYR 580 CE1 
186 1 Y 1 B TYR 643  ? CE2 ? A TYR 580 CE2 
187 1 Y 1 B TYR 643  ? CZ  ? A TYR 580 CZ  
188 1 Y 1 B TYR 643  ? OH  ? A TYR 580 OH  
189 1 Y 1 B LYS 646  ? CG  ? A LYS 583 CG  
190 1 Y 1 B LYS 646  ? CD  ? A LYS 583 CD  
191 1 Y 1 B LYS 646  ? CE  ? A LYS 583 CE  
192 1 Y 1 B LYS 646  ? NZ  ? A LYS 583 NZ  
193 1 Y 1 B LYS 648  ? CG  ? A LYS 585 CG  
194 1 Y 1 B LYS 648  ? CD  ? A LYS 585 CD  
195 1 Y 1 B LYS 648  ? CE  ? A LYS 585 CE  
196 1 Y 1 B LYS 648  ? NZ  ? A LYS 585 NZ  
197 1 Y 1 B GLU 665  ? CG  ? A GLU 602 CG  
198 1 Y 1 B GLU 665  ? CD  ? A GLU 602 CD  
199 1 Y 1 B GLU 665  ? OE1 ? A GLU 602 OE1 
200 1 Y 1 B GLU 665  ? OE2 ? A GLU 602 OE2 
201 1 Y 1 B LYS 684  ? CG  ? A LYS 621 CG  
202 1 Y 1 B LYS 684  ? CD  ? A LYS 621 CD  
203 1 Y 1 B LYS 684  ? CE  ? A LYS 621 CE  
204 1 Y 1 B LYS 684  ? NZ  ? A LYS 621 NZ  
205 1 Y 1 B ASN 686  ? CG  ? A ASN 623 CG  
206 1 Y 1 B ASN 686  ? OD1 ? A ASN 623 OD1 
207 1 Y 1 B ASN 686  ? ND2 ? A ASN 623 ND2 
208 1 Y 1 B SER 687  ? OG  ? A SER 624 OG  
209 1 Y 1 B GLU 689  ? CG  ? A GLU 626 CG  
210 1 Y 1 B GLU 689  ? CD  ? A GLU 626 CD  
211 1 Y 1 B GLU 689  ? OE1 ? A GLU 626 OE1 
212 1 Y 1 B GLU 689  ? OE2 ? A GLU 626 OE2 
213 1 Y 1 B LEU 690  ? CG  ? A LEU 627 CG  
214 1 Y 1 B LEU 690  ? CD1 ? A LEU 627 CD1 
215 1 Y 1 B LEU 690  ? CD2 ? A LEU 627 CD2 
216 1 Y 1 B ASP 691  ? CG  ? A ASP 628 CG  
217 1 Y 1 B ASP 691  ? OD1 ? A ASP 628 OD1 
218 1 Y 1 B ASP 691  ? OD2 ? A ASP 628 OD2 
219 1 Y 1 B LEU 693  ? CG  ? A LEU 630 CG  
220 1 Y 1 B LEU 693  ? CD1 ? A LEU 630 CD1 
221 1 Y 1 B LEU 693  ? CD2 ? A LEU 630 CD2 
222 1 Y 1 B LYS 708  ? CG  ? A LYS 645 CG  
223 1 Y 1 B LYS 708  ? CD  ? A LYS 645 CD  
224 1 Y 1 B LYS 708  ? CE  ? A LYS 645 CE  
225 1 Y 1 B LYS 708  ? NZ  ? A LYS 645 NZ  
226 1 Y 1 B ASP 721  ? CG  ? A ASP 658 CG  
227 1 Y 1 B ASP 721  ? OD1 ? A ASP 658 OD1 
228 1 Y 1 B ASP 721  ? OD2 ? A ASP 658 OD2 
229 1 Y 1 B SER 740  ? OG  ? A SER 677 OG  
230 1 Y 1 B TYR 745  ? CG  ? A TYR 682 CG  
231 1 Y 1 B TYR 745  ? CD1 ? A TYR 682 CD1 
232 1 Y 1 B TYR 745  ? CD2 ? A TYR 682 CD2 
233 1 Y 1 B TYR 745  ? CE1 ? A TYR 682 CE1 
234 1 Y 1 B TYR 745  ? CE2 ? A TYR 682 CE2 
235 1 Y 1 B TYR 745  ? CZ  ? A TYR 682 CZ  
236 1 Y 1 B TYR 745  ? OH  ? A TYR 682 OH  
237 1 Y 1 B ILE 746  ? CG1 ? A ILE 683 CG1 
238 1 Y 1 B ILE 746  ? CG2 ? A ILE 683 CG2 
239 1 Y 1 B ILE 746  ? CD1 ? A ILE 683 CD1 
240 1 Y 1 B LYS 748  ? CG  ? A LYS 685 CG  
241 1 Y 1 B LYS 748  ? CD  ? A LYS 685 CD  
242 1 Y 1 B LYS 748  ? CE  ? A LYS 685 CE  
243 1 Y 1 B LYS 748  ? NZ  ? A LYS 685 NZ  
244 1 Y 1 B ASN 755  ? CG  ? A ASN 692 CG  
245 1 Y 1 B ASN 755  ? OD1 ? A ASN 692 OD1 
246 1 Y 1 B ASN 755  ? ND2 ? A ASN 692 ND2 
247 1 Y 1 B ARG 756  ? CG  ? A ARG 693 CG  
248 1 Y 1 B ARG 756  ? CD  ? A ARG 693 CD  
249 1 Y 1 B ARG 756  ? NE  ? A ARG 693 NE  
250 1 Y 1 B ARG 756  ? CZ  ? A ARG 693 CZ  
251 1 Y 1 B ARG 756  ? NH1 ? A ARG 693 NH1 
252 1 Y 1 B ARG 756  ? NH2 ? A ARG 693 NH2 
253 1 Y 1 B LYS 761  ? CG  ? A LYS 698 CG  
254 1 Y 1 B LYS 761  ? CD  ? A LYS 698 CD  
255 1 Y 1 B LYS 761  ? CE  ? A LYS 698 CE  
256 1 Y 1 B LYS 761  ? NZ  ? A LYS 698 NZ  
257 1 Y 1 B GLU 765  ? CG  ? A GLU 702 CG  
258 1 Y 1 B GLU 765  ? CD  ? A GLU 702 CD  
259 1 Y 1 B GLU 765  ? OE1 ? A GLU 702 OE1 
260 1 Y 1 B GLU 765  ? OE2 ? A GLU 702 OE2 
261 1 Y 1 B LYS 768  ? CG  ? A LYS 705 CG  
262 1 Y 1 B LYS 768  ? CD  ? A LYS 705 CD  
263 1 Y 1 B LYS 768  ? CE  ? A LYS 705 CE  
264 1 Y 1 B LYS 768  ? NZ  ? A LYS 705 NZ  
265 1 Y 1 B ARG 769  ? CG  ? A ARG 706 CG  
266 1 Y 1 B ARG 769  ? CD  ? A ARG 706 CD  
267 1 Y 1 B ARG 769  ? NE  ? A ARG 706 NE  
268 1 Y 1 B ARG 769  ? CZ  ? A ARG 706 CZ  
269 1 Y 1 B ARG 769  ? NH1 ? A ARG 706 NH1 
270 1 Y 1 B ARG 769  ? NH2 ? A ARG 706 NH2 
271 1 Y 1 B ASP 772  ? CG  ? A ASP 709 CG  
272 1 Y 1 B ASP 772  ? OD1 ? A ASP 709 OD1 
273 1 Y 1 B ASP 772  ? OD2 ? A ASP 709 OD2 
274 1 Y 1 B ILE 785  ? CG1 ? A ILE 722 CG1 
275 1 Y 1 B ILE 785  ? CG2 ? A ILE 722 CG2 
276 1 Y 1 B ILE 785  ? CD1 ? A ILE 722 CD1 
277 1 Y 1 B GLN 786  ? CG  ? A GLN 723 CG  
278 1 Y 1 B GLN 786  ? CD  ? A GLN 723 CD  
279 1 Y 1 B GLN 786  ? OE1 ? A GLN 723 OE1 
280 1 Y 1 B GLN 786  ? NE2 ? A GLN 723 NE2 
281 1 Y 1 B GLN 788  ? CG  ? A GLN 725 CG  
282 1 Y 1 B GLN 788  ? CD  ? A GLN 725 CD  
283 1 Y 1 B GLN 788  ? OE1 ? A GLN 725 OE1 
284 1 Y 1 B GLN 788  ? NE2 ? A GLN 725 NE2 
285 1 Y 1 B LYS 791  ? CG  ? A LYS 728 CG  
286 1 Y 1 B LYS 791  ? CD  ? A LYS 728 CD  
287 1 Y 1 B LYS 791  ? CE  ? A LYS 728 CE  
288 1 Y 1 B LYS 791  ? NZ  ? A LYS 728 NZ  
289 1 Y 1 B LYS 792  ? CE  ? A LYS 729 CE  
290 1 Y 1 B LYS 792  ? NZ  ? A LYS 729 NZ  
291 1 Y 1 B GLN 795  ? CG  ? A GLN 732 CG  
292 1 Y 1 B GLN 795  ? CD  ? A GLN 732 CD  
293 1 Y 1 B GLN 795  ? OE1 ? A GLN 732 OE1 
294 1 Y 1 B GLN 795  ? NE2 ? A GLN 732 NE2 
295 1 Y 1 B LYS 796  ? CG  ? A LYS 733 CG  
296 1 Y 1 B LYS 796  ? CD  ? A LYS 733 CD  
297 1 Y 1 B LYS 796  ? CE  ? A LYS 733 CE  
298 1 Y 1 B LYS 796  ? NZ  ? A LYS 733 NZ  
299 1 Y 1 B GLU 798  ? CG  ? A GLU 735 CG  
300 1 Y 1 B GLU 798  ? CD  ? A GLU 735 CD  
301 1 Y 1 B GLU 798  ? OE1 ? A GLU 735 OE1 
302 1 Y 1 B GLU 798  ? OE2 ? A GLU 735 OE2 
303 1 Y 1 B TYR 805  ? CG  ? A TYR 742 CG  
304 1 Y 1 B TYR 805  ? CD1 ? A TYR 742 CD1 
305 1 Y 1 B TYR 805  ? CD2 ? A TYR 742 CD2 
306 1 Y 1 B TYR 805  ? CE1 ? A TYR 742 CE1 
307 1 Y 1 B TYR 805  ? CE2 ? A TYR 742 CE2 
308 1 Y 1 B TYR 805  ? CZ  ? A TYR 742 CZ  
309 1 Y 1 B TYR 805  ? OH  ? A TYR 742 OH  
310 1 Y 1 B ASN 811  ? CG  ? A ASN 748 CG  
311 1 Y 1 B ASN 811  ? OD1 ? A ASN 748 OD1 
312 1 Y 1 B ASN 811  ? ND2 ? A ASN 748 ND2 
313 1 Y 1 B ASP 812  ? CG  ? A ASP 749 CG  
314 1 Y 1 B ASP 812  ? OD1 ? A ASP 749 OD1 
315 1 Y 1 B ASP 812  ? OD2 ? A ASP 749 OD2 
316 1 Y 1 B GLU 816  ? CG  ? A GLU 753 CG  
317 1 Y 1 B GLU 816  ? CD  ? A GLU 753 CD  
318 1 Y 1 B GLU 816  ? OE1 ? A GLU 753 OE1 
319 1 Y 1 B GLU 816  ? OE2 ? A GLU 753 OE2 
320 1 Y 1 B GLU 823  ? CG  ? A GLU 760 CG  
321 1 Y 1 B GLU 823  ? CD  ? A GLU 760 CD  
322 1 Y 1 B GLU 823  ? OE1 ? A GLU 760 OE1 
323 1 Y 1 B GLU 823  ? OE2 ? A GLU 760 OE2 
324 1 Y 1 B LYS 824  ? CG  ? A LYS 761 CG  
325 1 Y 1 B LYS 824  ? CD  ? A LYS 761 CD  
326 1 Y 1 B LYS 824  ? CE  ? A LYS 761 CE  
327 1 Y 1 B LYS 824  ? NZ  ? A LYS 761 NZ  
328 1 Y 1 B LYS 833  ? CG  ? A LYS 770 CG  
329 1 Y 1 B LYS 833  ? CD  ? A LYS 770 CD  
330 1 Y 1 B LYS 833  ? CE  ? A LYS 770 CE  
331 1 Y 1 B LYS 833  ? NZ  ? A LYS 770 NZ  
332 1 Y 1 B ARG 837  ? CG  ? A ARG 774 CG  
333 1 Y 1 B ARG 837  ? CD  ? A ARG 774 CD  
334 1 Y 1 B ARG 837  ? NE  ? A ARG 774 NE  
335 1 Y 1 B ARG 837  ? CZ  ? A ARG 774 CZ  
336 1 Y 1 B ARG 837  ? NH1 ? A ARG 774 NH1 
337 1 Y 1 B ARG 837  ? NH2 ? A ARG 774 NH2 
338 1 Y 1 B GLU 838  ? CG  ? A GLU 775 CG  
339 1 Y 1 B GLU 838  ? CD  ? A GLU 775 CD  
340 1 Y 1 B GLU 838  ? OE1 ? A GLU 775 OE1 
341 1 Y 1 B GLU 838  ? OE2 ? A GLU 775 OE2 
342 1 Y 1 B LEU 839  ? CG  ? A LEU 776 CG  
343 1 Y 1 B LEU 839  ? CD1 ? A LEU 776 CD1 
344 1 Y 1 B LEU 839  ? CD2 ? A LEU 776 CD2 
345 1 Y 1 B LYS 840  ? CG  ? A LYS 777 CG  
346 1 Y 1 B LYS 840  ? CD  ? A LYS 777 CD  
347 1 Y 1 B LYS 840  ? CE  ? A LYS 777 CE  
348 1 Y 1 B LYS 840  ? NZ  ? A LYS 777 NZ  
349 1 Y 1 B LYS 841  ? CG  ? A LYS 778 CG  
350 1 Y 1 B LYS 841  ? CD  ? A LYS 778 CD  
351 1 Y 1 B LYS 841  ? CE  ? A LYS 778 CE  
352 1 Y 1 B LYS 841  ? NZ  ? A LYS 778 NZ  
353 1 Y 1 B ARG 843  ? CG  ? A ARG 780 CG  
354 1 Y 1 B ARG 843  ? CD  ? A ARG 780 CD  
355 1 Y 1 B ARG 843  ? NE  ? A ARG 780 NE  
356 1 Y 1 B ARG 843  ? CZ  ? A ARG 780 CZ  
357 1 Y 1 B ARG 843  ? NH1 ? A ARG 780 NH1 
358 1 Y 1 B ARG 843  ? NH2 ? A ARG 780 NH2 
359 1 Y 1 B VAL 876  ? CG1 ? A VAL 813 CG1 
360 1 Y 1 B VAL 876  ? CG2 ? A VAL 813 CG2 
361 1 Y 1 B GLU 890  ? CG  ? A GLU 827 CG  
362 1 Y 1 B GLU 890  ? CD  ? A GLU 827 CD  
363 1 Y 1 B GLU 890  ? OE1 ? A GLU 827 OE1 
364 1 Y 1 B GLU 890  ? OE2 ? A GLU 827 OE2 
365 1 Y 1 B ASN 898  ? CG  ? A ASN 835 CG  
366 1 Y 1 B ASN 898  ? OD1 ? A ASN 835 OD1 
367 1 Y 1 B ASN 898  ? ND2 ? A ASN 835 ND2 
368 1 Y 1 B GLN 904  ? CG  ? A GLN 841 CG  
369 1 Y 1 B GLN 904  ? CD  ? A GLN 841 CD  
370 1 Y 1 B GLN 904  ? OE1 ? A GLN 841 OE1 
371 1 Y 1 B GLN 904  ? NE2 ? A GLN 841 NE2 
372 1 Y 1 B GLN 915  ? CG  ? A GLN 852 CG  
373 1 Y 1 B GLN 915  ? CD  ? A GLN 852 CD  
374 1 Y 1 B GLN 915  ? OE1 ? A GLN 852 OE1 
375 1 Y 1 B GLN 915  ? NE2 ? A GLN 852 NE2 
376 1 Y 1 B ASN 917  ? CG  ? A ASN 854 CG  
377 1 Y 1 B ASN 917  ? OD1 ? A ASN 854 OD1 
378 1 Y 1 B ASN 917  ? ND2 ? A ASN 854 ND2 
379 1 Y 1 B SER 918  ? OG  ? A SER 855 OG  
380 1 Y 1 B SER 919  ? OG  ? A SER 856 OG  
381 1 Y 1 B GLU 920  ? CG  ? A GLU 857 CG  
382 1 Y 1 B GLU 920  ? CD  ? A GLU 857 CD  
383 1 Y 1 B GLU 920  ? OE1 ? A GLU 857 OE1 
384 1 Y 1 B GLU 920  ? OE2 ? A GLU 857 OE2 
385 1 Y 1 B MET 921  ? CG  ? A MET 858 CG  
386 1 Y 1 B MET 921  ? SD  ? A MET 858 SD  
387 1 Y 1 B MET 921  ? CE  ? A MET 858 CE  
388 1 Y 1 B LYS 923  ? CG  ? A LYS 860 CG  
389 1 Y 1 B LYS 923  ? CD  ? A LYS 860 CD  
390 1 Y 1 B LYS 923  ? CE  ? A LYS 860 CE  
391 1 Y 1 B LYS 923  ? NZ  ? A LYS 860 NZ  
392 1 Y 1 B LEU 924  ? CG  ? A LEU 861 CG  
393 1 Y 1 B LEU 924  ? CD1 ? A LEU 861 CD1 
394 1 Y 1 B LEU 924  ? CD2 ? A LEU 861 CD2 
395 1 Y 1 B GLU 926  ? CG  ? A GLU 863 CG  
396 1 Y 1 B GLU 926  ? CD  ? A GLU 863 CD  
397 1 Y 1 B GLU 926  ? OE1 ? A GLU 863 OE1 
398 1 Y 1 B GLU 926  ? OE2 ? A GLU 863 OE2 
399 1 Y 1 B GLN 927  ? CG  ? A GLN 864 CG  
400 1 Y 1 B GLN 927  ? CD  ? A GLN 864 CD  
401 1 Y 1 B GLN 927  ? OE1 ? A GLN 864 OE1 
402 1 Y 1 B GLN 927  ? NE2 ? A GLN 864 NE2 
403 1 Y 1 B LEU 928  ? CG  ? A LEU 865 CG  
404 1 Y 1 B LEU 928  ? CD1 ? A LEU 865 CD1 
405 1 Y 1 B LEU 928  ? CD2 ? A LEU 865 CD2 
406 1 Y 1 B ARG 933  ? CG  ? A ARG 870 CG  
407 1 Y 1 B ARG 933  ? CD  ? A ARG 870 CD  
408 1 Y 1 B ARG 933  ? NE  ? A ARG 870 NE  
409 1 Y 1 B ARG 933  ? CZ  ? A ARG 870 CZ  
410 1 Y 1 B ARG 933  ? NH1 ? A ARG 870 NH1 
411 1 Y 1 B ARG 933  ? NH2 ? A ARG 870 NH2 
412 1 Y 1 B GLN 936  ? CG  ? A GLN 873 CG  
413 1 Y 1 B GLN 936  ? CD  ? A GLN 873 CD  
414 1 Y 1 B GLN 936  ? OE1 ? A GLN 873 OE1 
415 1 Y 1 B GLN 936  ? NE2 ? A GLN 873 NE2 
416 1 Y 1 B GLU 937  ? CG  ? A GLU 874 CG  
417 1 Y 1 B GLU 937  ? CD  ? A GLU 874 CD  
418 1 Y 1 B GLU 937  ? OE1 ? A GLU 874 OE1 
419 1 Y 1 B GLU 937  ? OE2 ? A GLU 874 OE2 
420 1 Y 1 B LYS 940  ? CG  ? A LYS 877 CG  
421 1 Y 1 B LYS 940  ? CD  ? A LYS 877 CD  
422 1 Y 1 B LYS 940  ? CE  ? A LYS 877 CE  
423 1 Y 1 B LYS 940  ? NZ  ? A LYS 877 NZ  
424 1 Y 1 B ARG 941  ? CG  ? A ARG 878 CG  
425 1 Y 1 B ARG 941  ? CD  ? A ARG 878 CD  
426 1 Y 1 B ARG 941  ? NE  ? A ARG 878 NE  
427 1 Y 1 B ARG 941  ? CZ  ? A ARG 878 CZ  
428 1 Y 1 B ARG 941  ? NH1 ? A ARG 878 NH1 
429 1 Y 1 B ARG 941  ? NH2 ? A ARG 878 NH2 
430 1 Y 1 B LYS 944  ? CG  ? A LYS 881 CG  
431 1 Y 1 B LYS 944  ? CD  ? A LYS 881 CD  
432 1 Y 1 B LYS 944  ? CE  ? A LYS 881 CE  
433 1 Y 1 B LYS 944  ? NZ  ? A LYS 881 NZ  
434 1 Y 1 B LYS 950  ? CG  ? A LYS 887 CG  
435 1 Y 1 B LYS 950  ? CD  ? A LYS 887 CD  
436 1 Y 1 B LYS 950  ? CE  ? A LYS 887 CE  
437 1 Y 1 B LYS 950  ? NZ  ? A LYS 887 NZ  
438 1 Y 1 B GLU 952  ? CG  ? A GLU 889 CG  
439 1 Y 1 B GLU 952  ? CD  ? A GLU 889 CD  
440 1 Y 1 B GLU 952  ? OE1 ? A GLU 889 OE1 
441 1 Y 1 B GLU 952  ? OE2 ? A GLU 889 OE2 
442 1 Y 1 B GLU 955  ? CG  ? A GLU 892 CG  
443 1 Y 1 B GLU 955  ? CD  ? A GLU 892 CD  
444 1 Y 1 B GLU 955  ? OE1 ? A GLU 892 OE1 
445 1 Y 1 B GLU 955  ? OE2 ? A GLU 892 OE2 
446 1 Y 1 B GLU 956  ? CG  ? A GLU 893 CG  
447 1 Y 1 B GLU 956  ? CD  ? A GLU 893 CD  
448 1 Y 1 B GLU 956  ? OE1 ? A GLU 893 OE1 
449 1 Y 1 B GLU 956  ? OE2 ? A GLU 893 OE2 
450 1 Y 1 B LEU 959  ? CG  ? A LEU 896 CG  
451 1 Y 1 B LEU 959  ? CD1 ? A LEU 896 CD1 
452 1 Y 1 B LEU 959  ? CD2 ? A LEU 896 CD2 
453 1 Y 1 B LEU 966  ? CG  ? A LEU 903 CG  
454 1 Y 1 B LEU 966  ? CD1 ? A LEU 903 CD1 
455 1 Y 1 B LEU 966  ? CD2 ? A LEU 903 CD2 
456 1 Y 1 B TYR 971  ? CG  ? A TYR 908 CG  
457 1 Y 1 B TYR 971  ? CD1 ? A TYR 908 CD1 
458 1 Y 1 B TYR 971  ? CD2 ? A TYR 908 CD2 
459 1 Y 1 B TYR 971  ? CE1 ? A TYR 908 CE1 
460 1 Y 1 B TYR 971  ? CE2 ? A TYR 908 CE2 
461 1 Y 1 B TYR 971  ? CZ  ? A TYR 908 CZ  
462 1 Y 1 B TYR 971  ? OH  ? A TYR 908 OH  
463 1 Y 1 B HIS 981  ? CG  ? A HIS 918 CG  
464 1 Y 1 B HIS 981  ? ND1 ? A HIS 918 ND1 
465 1 Y 1 B HIS 981  ? CD2 ? A HIS 918 CD2 
466 1 Y 1 B HIS 981  ? CE1 ? A HIS 918 CE1 
467 1 Y 1 B HIS 981  ? NE2 ? A HIS 918 NE2 
468 1 Y 1 B LYS 984  ? CG  ? A LYS 921 CG  
469 1 Y 1 B LYS 984  ? CD  ? A LYS 921 CD  
470 1 Y 1 B LYS 984  ? CE  ? A LYS 921 CE  
471 1 Y 1 B LYS 984  ? NZ  ? A LYS 921 NZ  
472 1 Y 1 B ARG 998  ? CG  ? A ARG 935 CG  
473 1 Y 1 B ARG 998  ? CD  ? A ARG 935 CD  
474 1 Y 1 B ARG 998  ? NE  ? A ARG 935 NE  
475 1 Y 1 B ARG 998  ? CZ  ? A ARG 935 CZ  
476 1 Y 1 B ARG 998  ? NH1 ? A ARG 935 NH1 
477 1 Y 1 B ARG 998  ? NH2 ? A ARG 935 NH2 
478 1 Y 1 B ARG 1005 ? CG  ? A ARG 942 CG  
479 1 Y 1 B ARG 1005 ? CD  ? A ARG 942 CD  
480 1 Y 1 B ARG 1005 ? NE  ? A ARG 942 NE  
481 1 Y 1 B ARG 1005 ? CZ  ? A ARG 942 CZ  
482 1 Y 1 B ARG 1005 ? NH1 ? A ARG 942 NH1 
483 1 Y 1 B ARG 1005 ? NH2 ? A ARG 942 NH2 
484 1 Y 1 B LYS 1012 ? CG  ? A LYS 949 CG  
485 1 Y 1 B LYS 1012 ? CD  ? A LYS 949 CD  
486 1 Y 1 B LYS 1012 ? CE  ? A LYS 949 CE  
487 1 Y 1 B LYS 1012 ? NZ  ? A LYS 949 NZ  
488 1 Y 1 B ASN 1016 ? CG  ? A ASN 953 CG  
489 1 Y 1 B ASN 1016 ? OD1 ? A ASN 953 OD1 
490 1 Y 1 B ASN 1016 ? ND2 ? A ASN 953 ND2 
491 1 Y 1 B GLU 1018 ? CG  ? A GLU 955 CG  
492 1 Y 1 B GLU 1018 ? CD  ? A GLU 955 CD  
493 1 Y 1 B GLU 1018 ? OE1 ? A GLU 955 OE1 
494 1 Y 1 B GLU 1018 ? OE2 ? A GLU 955 OE2 
495 1 Y 1 B GLU 1020 ? CG  ? A GLU 957 CG  
496 1 Y 1 B GLU 1020 ? CD  ? A GLU 957 CD  
497 1 Y 1 B GLU 1020 ? OE1 ? A GLU 957 OE1 
498 1 Y 1 B GLU 1020 ? OE2 ? A GLU 957 OE2 
499 1 Y 1 B LEU 1040 ? CG  ? A LEU 977 CG  
500 1 Y 1 B LEU 1040 ? CD1 ? A LEU 977 CD1 
501 1 Y 1 B LEU 1040 ? CD2 ? A LEU 977 CD2 
502 1 Y 1 B TYR 1041 ? CG  ? A TYR 978 CG  
503 1 Y 1 B TYR 1041 ? CD1 ? A TYR 978 CD1 
504 1 Y 1 B TYR 1041 ? CD2 ? A TYR 978 CD2 
505 1 Y 1 B TYR 1041 ? CE1 ? A TYR 978 CE1 
506 1 Y 1 B TYR 1041 ? CE2 ? A TYR 978 CE2 
507 1 Y 1 B TYR 1041 ? CZ  ? A TYR 978 CZ  
508 1 Y 1 B TYR 1041 ? OH  ? A TYR 978 OH  
509 1 Y 1 A LYS 177  ? CG  ? B LYS 16  CG  
510 1 Y 1 A LYS 177  ? CD  ? B LYS 16  CD  
511 1 Y 1 A LYS 177  ? CE  ? B LYS 16  CE  
512 1 Y 1 A LYS 177  ? NZ  ? B LYS 16  NZ  
513 1 Y 1 A ASN 198  ? CG  ? B ASN 37  CG  
514 1 Y 1 A ASN 198  ? OD1 ? B ASN 37  OD1 
515 1 Y 1 A ASN 198  ? ND2 ? B ASN 37  ND2 
516 1 Y 1 A GLU 207  ? CG  ? B GLU 46  CG  
517 1 Y 1 A GLU 207  ? CD  ? B GLU 46  CD  
518 1 Y 1 A GLU 207  ? OE1 ? B GLU 46  OE1 
519 1 Y 1 A GLU 207  ? OE2 ? B GLU 46  OE2 
520 1 Y 1 A ARG 217  ? CG  ? B ARG 56  CG  
521 1 Y 1 A ARG 217  ? CD  ? B ARG 56  CD  
522 1 Y 1 A ARG 217  ? NE  ? B ARG 56  NE  
523 1 Y 1 A ARG 217  ? CZ  ? B ARG 56  CZ  
524 1 Y 1 A ARG 217  ? NH1 ? B ARG 56  NH1 
525 1 Y 1 A ARG 217  ? NH2 ? B ARG 56  NH2 
526 1 Y 1 A GLN 219  ? CG  ? B GLN 58  CG  
527 1 Y 1 A GLN 219  ? CD  ? B GLN 58  CD  
528 1 Y 1 A GLN 219  ? OE1 ? B GLN 58  OE1 
529 1 Y 1 A GLN 219  ? NE2 ? B GLN 58  NE2 
530 1 Y 1 A ARG 222  ? NE  ? B ARG 61  NE  
531 1 Y 1 A ARG 222  ? CZ  ? B ARG 61  CZ  
532 1 Y 1 A ARG 222  ? NH1 ? B ARG 61  NH1 
533 1 Y 1 A ARG 222  ? NH2 ? B ARG 61  NH2 
534 1 Y 1 A ILE 234  ? CG1 ? B ILE 73  CG1 
535 1 Y 1 A ILE 234  ? CG2 ? B ILE 73  CG2 
536 1 Y 1 A ILE 234  ? CD1 ? B ILE 73  CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B GLY 64  ? A GLY 1   
2  1 Y 1 B ALA 65  ? A ALA 2   
3  1 Y 1 B MET 66  ? A MET 3   
4  1 Y 1 B ASP 67  ? A ASP 4   
5  1 Y 1 B PRO 68  ? A PRO 5   
6  1 Y 1 B GLU 69  ? A GLU 6   
7  1 Y 1 B PHE 70  ? A PHE 7   
8  1 Y 1 B THR 71  ? A THR 8   
9  1 Y 1 B ASP 72  ? A ASP 9   
10 1 Y 1 B GLU 73  ? A GLU 10  
11 1 Y 1 B PRO 74  ? A PRO 11  
12 1 Y 1 B ILE 75  ? A ILE 12  
13 1 Y 1 B PHE 76  ? A PHE 13  
14 1 Y 1 B GLY 77  ? A GLY 14  
15 1 Y 1 B LYS 78  ? A LYS 15  
16 1 Y 1 B LYS 79  ? A LYS 16  
17 1 Y 1 B PRO 80  ? A PRO 17  
18 1 Y 1 B ARG 81  ? A ARG 18  
19 1 Y 1 B ILE 82  ? A ILE 19  
20 1 Y 1 B GLU 83  ? A GLU 20  
21 1 Y 1 B GLU 84  ? A GLU 21  
22 1 Y 1 B SER 85  ? A SER 22  
23 1 Y 1 B ILE 86  ? A ILE 23  
24 1 Y 1 B THR 87  ? A THR 24  
25 1 Y 1 B GLU 88  ? A GLU 25  
26 1 Y 1 B ASP 89  ? A ASP 26  
27 1 Y 1 B LEU 90  ? A LEU 27  
28 1 Y 1 B SER 91  ? A SER 28  
29 1 Y 1 B LEU 92  ? A LEU 29  
30 1 Y 1 B ALA 93  ? A ALA 30  
31 1 Y 1 B ASP 94  ? A ASP 31  
32 1 Y 1 B LEU 95  ? A LEU 32  
33 1 Y 1 B MET 96  ? A MET 33  
34 1 Y 1 B PRO 97  ? A PRO 34  
35 1 Y 1 B LEU 356 ? A LEU 293 
36 1 Y 1 B ALA 357 ? A ALA 294 
37 1 Y 1 B LYS 358 ? A LYS 295 
38 1 Y 1 B GLY 359 ? A GLY 296 
39 1 Y 1 B ASP 360 ? A ASP 297 
40 1 Y 1 B GLN 361 ? A GLN 298 
41 1 Y 1 B LYS 362 ? A LYS 299 
42 1 Y 1 B GLY 363 ? A GLY 300 
43 1 Y 1 B ARG 364 ? A ARG 301 
44 1 Y 1 B LYS 365 ? A LYS 302 
45 1 Y 1 B GLY 366 ? A GLY 303 
46 1 Y 1 B GLY 367 ? A GLY 304 
47 1 Y 1 B THR 368 ? A THR 305 
48 1 Y 1 B LYS 369 ? A LYS 306 
49 1 Y 1 B GLY 370 ? A GLY 307 
50 1 Y 1 B PRO 371 ? A PRO 308 
51 1 Y 1 A GLY 208 ? B GLY 47  
52 1 Y 1 A THR 209 ? B THR 48  
53 1 Y 1 A SER 210 ? B SER 49  
54 1 Y 1 A ASP 235 ? B ASP 74  
55 1 Y 1 A GLY 236 ? B GLY 75  
56 1 Y 1 A VAL 237 ? B VAL 76  
57 1 Y 1 A ALA 238 ? B ALA 77  
58 1 Y 1 A ILE 239 ? B ILE 78  
59 1 Y 1 A SER 240 ? B SER 79  
60 1 Y 1 A PRO 246 ? B PRO 85  
61 1 Y 1 A SER 247 ? B SER 86  
62 1 Y 1 A SER 248 ? B SER 87  
63 1 Y 1 A LEU 259 ? B LEU 98  
64 1 Y 1 A GLU 260 ? B GLU 99  
65 1 Y 1 A ASP 261 ? B ASP 100 
66 1 Y 1 A ALA 262 ? B ALA 101 
67 1 Y 1 A ALA 263 ? B ALA 102 
68 1 Y 1 A PRO 264 ? B PRO 103 
69 1 Y 1 A VAL 265 ? B VAL 104 
70 1 Y 1 A THR 266 ? B THR 105 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CHLORIDE ION'              CL  
4 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
5 water                       HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#