data_6IY3
# 
_entry.id   6IY3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6IY3         
WWPDB D_1300008944 
EMDB  EMD-9749     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          EMD-9749 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6IY3 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, M.'   1 ? 
'Xia, X.'  2 ? 
'Liu, X.'  3 ? 
'Li, X.'   4 ? 
'Chen, Z.' 5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            567 
_citation.language                  ? 
_citation.page_first                409 
_citation.page_last                 413 
_citation.title                     'Mechanism of DNA translocation underlying chromatin remodelling by Snf2.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-019-1029-2 
_citation.pdbx_database_id_PubMed   30867599 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, M.'   1 ? 
primary 'Xia, X.'  2 ? 
primary 'Tian, Y.' 3 ? 
primary 'Jia, Q.'  4 ? 
primary 'Liu, X.'  5 ? 
primary 'Lu, Y.'   6 ? 
primary 'Li, M.'   7 ? 
primary 'Li, X.'   8 ? 
primary 'Chen, Z.' 9 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6IY3 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6IY3 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3'                            11728.729 2 ?       ? ? ? 
2 polymer     man 'Histone H4'                            10061.849 2 ?       ? ? ? 
3 polymer     man 'Histone H2A'                           12441.526 2 ?       ? ? ? 
4 polymer     man 'Histone H2B'                           11050.778 2 ?       ? ? ? 
5 polymer     syn 'DNA (147-MER)'                         44849.496 1 ?       ? ? ? 
6 polymer     syn 'DNA (147-MER)'                         45901.312 1 ?       ? ? ? 
7 polymer     man 'Transcription regulatory protein SNF2' 79113.461 1 3.6.4.- ? ? ? 
8 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"              427.201   1 ?       ? ? ? 
# 
_entity_name_com.entity_id   7 
_entity_name_com.name        
;ATP-dependent helicase SNF2,Regulatory protein GAM1,Regulatory protein SWI2,SWI/SNF complex component SNF2,Transcription factor TYE3
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAK
RVTIMPKDIQLARRIRGERA
;
;KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAK
RVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQG
RTLYGFGG
;
;AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQG
RTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;KTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVR
NDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTE
;
;KTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVR
NDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTE
;
C,G ? 
4 'polypeptide(L)'        no no 
;KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELA
KHAVSEGTKAVTKYTSAK
;
;KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELA
KHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DT)(DA)(DA)(DC)(DA)(DT)
(DT)(DC)(DA)(DC)(DC)(DT)(DC)(DT)(DT)(DG)(DT)(DG)(DT)(DG)(DT)(DT)(DT)(DG)(DT)(DG)
(DT)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DC)(DC)(DA)(DT)(DC)(DC)(DC)(DG)(DT)(DC)(DT)(DC)
(DC)(DG)(DC)(DT)(DC)(DG)(DT)(DC)(DA)(DC)(DT)(DT)(DA)(DT)(DC)(DC)(DT)(DT)(DC)(DA)
(DC)(DT)(DT)(DT)(DC)(DC)(DA)(DG)(DA)(DG)(DG)(DG)(DT)(DC)(DC)(DC)(DC)(DC)(DC)(DG)
(DC)(DA)(DG)(DA)(DC)(DC)(DC)(DC)(DG)(DG)(DC)(DG)(DA)(DC)(DC)(DC)(DT)(DC)(DA)(DG)
(DG)(DT)(DC)(DG)(DG)(DC)(DC)(DG)(DA)(DC)(DT)(DG)(DC)(DG)(DG)(DC)(DA)(DC)(DA)(DG)
(DT)(DT)(DT)(DT)(DG)(DA)(DT)
;
;ATCTGCAACAGTCCTAACATTCACCTCTTGTGTGTTTGTGTCTGTTCGCCATCCCGTCTCCGCTCGTCACTTATCCTTCA
CTTTCCAGAGGGTCCCCCCGCAGACCCCGGCGACCCTCAGGTCGGCCGACTGCGGCACAGTTTTGAT
;
J   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DC)(DT)(DG)(DT)(DG)(DC)(DC)(DG)(DC)(DA)(DG)(DT)(DC)
(DG)(DG)(DC)(DC)(DG)(DA)(DC)(DC)(DT)(DG)(DA)(DG)(DG)(DG)(DT)(DC)(DG)(DC)(DC)(DG)
(DG)(DG)(DG)(DT)(DC)(DT)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DC)(DC)(DT)(DC)
(DT)(DG)(DG)(DA)(DA)(DA)(DG)(DT)(DG)(DA)(DA)(DG)(DG)(DA)(DT)(DA)(DA)(DG)(DT)(DG)
(DA)(DC)(DG)(DA)(DG)(DC)(DG)(DG)(DA)(DG)(DA)(DC)(DG)(DG)(DG)(DA)(DT)(DG)(DG)(DC)
(DG)(DA)(DA)(DC)(DA)(DG)(DA)(DC)(DA)(DC)(DA)(DA)(DA)(DC)(DA)(DC)(DA)(DC)(DA)(DA)
(DG)(DA)(DG)(DG)(DT)(DG)(DA)(DA)(DT)(DG)(DT)(DT)(DA)(DG)(DG)(DA)(DC)(DT)(DG)(DT)
(DT)(DG)(DC)(DA)(DG)(DA)(DT)
;
;ATCAAAACTGTGCCGCAGTCGGCCGACCTGAGGGTCGCCGGGGTCTGCGGGGGGACCCTCTGGAAAGTGAAGGATAAGTG
ACGAGCGGAGACGGGATGGCGAACAGACACAAACACACAAGAGGTGAATGTTAGGACTGTTGCAGAT
;
I   ? 
7 'polypeptide(L)'        no no 
;LLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYYNVAH
RIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLS
NWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLT
LNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRP
FLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVE
DQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLF
NAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKL
DIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEE
ELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNG
;
;LLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYYNVAH
RIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLS
NWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLT
LNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRP
FLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVE
DQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLF
NAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKL
DIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEE
ELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNG
;
O   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   LYS n 
1 3   PRO n 
1 4   HIS n 
1 5   ARG n 
1 6   TYR n 
1 7   ARG n 
1 8   PRO n 
1 9   GLY n 
1 10  THR n 
1 11  VAL n 
1 12  ALA n 
1 13  LEU n 
1 14  ARG n 
1 15  GLU n 
1 16  ILE n 
1 17  ARG n 
1 18  ARG n 
1 19  TYR n 
1 20  GLN n 
1 21  LYS n 
1 22  SER n 
1 23  THR n 
1 24  GLU n 
1 25  LEU n 
1 26  LEU n 
1 27  ILE n 
1 28  ARG n 
1 29  LYS n 
1 30  LEU n 
1 31  PRO n 
1 32  PHE n 
1 33  GLN n 
1 34  ARG n 
1 35  LEU n 
1 36  VAL n 
1 37  ARG n 
1 38  GLU n 
1 39  ILE n 
1 40  ALA n 
1 41  GLN n 
1 42  ASP n 
1 43  PHE n 
1 44  LYS n 
1 45  THR n 
1 46  ASP n 
1 47  LEU n 
1 48  ARG n 
1 49  PHE n 
1 50  GLN n 
1 51  SER n 
1 52  SER n 
1 53  ALA n 
1 54  VAL n 
1 55  MET n 
1 56  ALA n 
1 57  LEU n 
1 58  GLN n 
1 59  GLU n 
1 60  ALA n 
1 61  SER n 
1 62  GLU n 
1 63  ALA n 
1 64  TYR n 
1 65  LEU n 
1 66  VAL n 
1 67  ALA n 
1 68  LEU n 
1 69  PHE n 
1 70  GLU n 
1 71  ASP n 
1 72  THR n 
1 73  ASN n 
1 74  LEU n 
1 75  ALA n 
1 76  ALA n 
1 77  ILE n 
1 78  HIS n 
1 79  ALA n 
1 80  LYS n 
1 81  ARG n 
1 82  VAL n 
1 83  THR n 
1 84  ILE n 
1 85  MET n 
1 86  PRO n 
1 87  LYS n 
1 88  ASP n 
1 89  ILE n 
1 90  GLN n 
1 91  LEU n 
1 92  ALA n 
1 93  ARG n 
1 94  ARG n 
1 95  ILE n 
1 96  ARG n 
1 97  GLY n 
1 98  GLU n 
1 99  ARG n 
1 100 ALA n 
2 1   ALA n 
2 2   LYS n 
2 3   ARG n 
2 4   HIS n 
2 5   ARG n 
2 6   LYS n 
2 7   VAL n 
2 8   LEU n 
2 9   ARG n 
2 10  ASP n 
2 11  ASN n 
2 12  ILE n 
2 13  GLN n 
2 14  GLY n 
2 15  ILE n 
2 16  THR n 
2 17  LYS n 
2 18  PRO n 
2 19  ALA n 
2 20  ILE n 
2 21  ARG n 
2 22  ARG n 
2 23  LEU n 
2 24  ALA n 
2 25  ARG n 
2 26  ARG n 
2 27  GLY n 
2 28  GLY n 
2 29  VAL n 
2 30  LYS n 
2 31  ARG n 
2 32  ILE n 
2 33  SER n 
2 34  GLY n 
2 35  LEU n 
2 36  ILE n 
2 37  TYR n 
2 38  GLU n 
2 39  GLU n 
2 40  THR n 
2 41  ARG n 
2 42  GLY n 
2 43  VAL n 
2 44  LEU n 
2 45  LYS n 
2 46  VAL n 
2 47  PHE n 
2 48  LEU n 
2 49  GLU n 
2 50  ASN n 
2 51  VAL n 
2 52  ILE n 
2 53  ARG n 
2 54  ASP n 
2 55  ALA n 
2 56  VAL n 
2 57  THR n 
2 58  TYR n 
2 59  THR n 
2 60  GLU n 
2 61  HIS n 
2 62  ALA n 
2 63  LYS n 
2 64  ARG n 
2 65  LYS n 
2 66  THR n 
2 67  VAL n 
2 68  THR n 
2 69  ALA n 
2 70  MET n 
2 71  ASP n 
2 72  VAL n 
2 73  VAL n 
2 74  TYR n 
2 75  ALA n 
2 76  LEU n 
2 77  LYS n 
2 78  ARG n 
2 79  GLN n 
2 80  GLY n 
2 81  ARG n 
2 82  THR n 
2 83  LEU n 
2 84  TYR n 
2 85  GLY n 
2 86  PHE n 
2 87  GLY n 
2 88  GLY n 
3 1   LYS n 
3 2   THR n 
3 3   ARG n 
3 4   ALA n 
3 5   LYS n 
3 6   ALA n 
3 7   LYS n 
3 8   THR n 
3 9   ARG n 
3 10  SER n 
3 11  SER n 
3 12  ARG n 
3 13  ALA n 
3 14  GLY n 
3 15  LEU n 
3 16  GLN n 
3 17  PHE n 
3 18  PRO n 
3 19  VAL n 
3 20  GLY n 
3 21  ARG n 
3 22  VAL n 
3 23  HIS n 
3 24  ARG n 
3 25  LEU n 
3 26  LEU n 
3 27  ARG n 
3 28  LYS n 
3 29  GLY n 
3 30  ASN n 
3 31  TYR n 
3 32  ALA n 
3 33  GLU n 
3 34  ARG n 
3 35  VAL n 
3 36  GLY n 
3 37  ALA n 
3 38  GLY n 
3 39  ALA n 
3 40  PRO n 
3 41  VAL n 
3 42  TYR n 
3 43  LEU n 
3 44  ALA n 
3 45  ALA n 
3 46  VAL n 
3 47  LEU n 
3 48  GLU n 
3 49  TYR n 
3 50  LEU n 
3 51  THR n 
3 52  ALA n 
3 53  GLU n 
3 54  ILE n 
3 55  LEU n 
3 56  GLU n 
3 57  LEU n 
3 58  ALA n 
3 59  GLY n 
3 60  ASN n 
3 61  ALA n 
3 62  ALA n 
3 63  ARG n 
3 64  ASP n 
3 65  ASN n 
3 66  LYS n 
3 67  LYS n 
3 68  THR n 
3 69  ARG n 
3 70  ILE n 
3 71  ILE n 
3 72  PRO n 
3 73  ARG n 
3 74  HIS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ALA n 
3 79  VAL n 
3 80  ARG n 
3 81  ASN n 
3 82  ASP n 
3 83  GLU n 
3 84  GLU n 
3 85  LEU n 
3 86  ASN n 
3 87  LYS n 
3 88  LEU n 
3 89  LEU n 
3 90  GLY n 
3 91  ARG n 
3 92  VAL n 
3 93  THR n 
3 94  ILE n 
3 95  ALA n 
3 96  GLN n 
3 97  GLY n 
3 98  GLY n 
3 99  VAL n 
3 100 LEU n 
3 101 PRO n 
3 102 ASN n 
3 103 ILE n 
3 104 GLN n 
3 105 SER n 
3 106 VAL n 
3 107 LEU n 
3 108 LEU n 
3 109 PRO n 
3 110 LYS n 
3 111 LYS n 
3 112 THR n 
3 113 GLU n 
4 1   LYS n 
4 2   ARG n 
4 3   ARG n 
4 4   LYS n 
4 5   THR n 
4 6   ARG n 
4 7   LYS n 
4 8   GLU n 
4 9   SER n 
4 10  TYR n 
4 11  ALA n 
4 12  ILE n 
4 13  TYR n 
4 14  VAL n 
4 15  TYR n 
4 16  LYS n 
4 17  VAL n 
4 18  LEU n 
4 19  LYS n 
4 20  GLN n 
4 21  VAL n 
4 22  HIS n 
4 23  PRO n 
4 24  ASP n 
4 25  THR n 
4 26  GLY n 
4 27  ILE n 
4 28  SER n 
4 29  SER n 
4 30  LYS n 
4 31  ALA n 
4 32  MET n 
4 33  SER n 
4 34  ILE n 
4 35  MET n 
4 36  ASN n 
4 37  SER n 
4 38  PHE n 
4 39  VAL n 
4 40  ASN n 
4 41  ASP n 
4 42  VAL n 
4 43  PHE n 
4 44  GLU n 
4 45  ARG n 
4 46  ILE n 
4 47  ALA n 
4 48  GLY n 
4 49  GLU n 
4 50  ALA n 
4 51  SER n 
4 52  ARG n 
4 53  LEU n 
4 54  ALA n 
4 55  HIS n 
4 56  TYR n 
4 57  ASN n 
4 58  LYS n 
4 59  ARG n 
4 60  SER n 
4 61  THR n 
4 62  ILE n 
4 63  THR n 
4 64  SER n 
4 65  ARG n 
4 66  GLU n 
4 67  ILE n 
4 68  GLN n 
4 69  THR n 
4 70  ALA n 
4 71  VAL n 
4 72  ARG n 
4 73  LEU n 
4 74  LEU n 
4 75  LEU n 
4 76  PRO n 
4 77  GLY n 
4 78  GLU n 
4 79  LEU n 
4 80  ALA n 
4 81  LYS n 
4 82  HIS n 
4 83  ALA n 
4 84  VAL n 
4 85  SER n 
4 86  GLU n 
4 87  GLY n 
4 88  THR n 
4 89  LYS n 
4 90  ALA n 
4 91  VAL n 
4 92  THR n 
4 93  LYS n 
4 94  TYR n 
4 95  THR n 
4 96  SER n 
4 97  ALA n 
4 98  LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DT  n 
5 5   DG  n 
5 6   DC  n 
5 7   DA  n 
5 8   DA  n 
5 9   DC  n 
5 10  DA  n 
5 11  DG  n 
5 12  DT  n 
5 13  DC  n 
5 14  DC  n 
5 15  DT  n 
5 16  DA  n 
5 17  DA  n 
5 18  DC  n 
5 19  DA  n 
5 20  DT  n 
5 21  DT  n 
5 22  DC  n 
5 23  DA  n 
5 24  DC  n 
5 25  DC  n 
5 26  DT  n 
5 27  DC  n 
5 28  DT  n 
5 29  DT  n 
5 30  DG  n 
5 31  DT  n 
5 32  DG  n 
5 33  DT  n 
5 34  DG  n 
5 35  DT  n 
5 36  DT  n 
5 37  DT  n 
5 38  DG  n 
5 39  DT  n 
5 40  DG  n 
5 41  DT  n 
5 42  DC  n 
5 43  DT  n 
5 44  DG  n 
5 45  DT  n 
5 46  DT  n 
5 47  DC  n 
5 48  DG  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DC  n 
5 55  DC  n 
5 56  DG  n 
5 57  DT  n 
5 58  DC  n 
5 59  DT  n 
5 60  DC  n 
5 61  DC  n 
5 62  DG  n 
5 63  DC  n 
5 64  DT  n 
5 65  DC  n 
5 66  DG  n 
5 67  DT  n 
5 68  DC  n 
5 69  DA  n 
5 70  DC  n 
5 71  DT  n 
5 72  DT  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DC  n 
5 77  DT  n 
5 78  DT  n 
5 79  DC  n 
5 80  DA  n 
5 81  DC  n 
5 82  DT  n 
5 83  DT  n 
5 84  DT  n 
5 85  DC  n 
5 86  DC  n 
5 87  DA  n 
5 88  DG  n 
5 89  DA  n 
5 90  DG  n 
5 91  DG  n 
5 92  DG  n 
5 93  DT  n 
5 94  DC  n 
5 95  DC  n 
5 96  DC  n 
5 97  DC  n 
5 98  DC  n 
5 99  DC  n 
5 100 DG  n 
5 101 DC  n 
5 102 DA  n 
5 103 DG  n 
5 104 DA  n 
5 105 DC  n 
5 106 DC  n 
5 107 DC  n 
5 108 DC  n 
5 109 DG  n 
5 110 DG  n 
5 111 DC  n 
5 112 DG  n 
5 113 DA  n 
5 114 DC  n 
5 115 DC  n 
5 116 DC  n 
5 117 DT  n 
5 118 DC  n 
5 119 DA  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DC  n 
5 124 DG  n 
5 125 DG  n 
5 126 DC  n 
5 127 DC  n 
5 128 DG  n 
5 129 DA  n 
5 130 DC  n 
5 131 DT  n 
5 132 DG  n 
5 133 DC  n 
5 134 DG  n 
5 135 DG  n 
5 136 DC  n 
5 137 DA  n 
5 138 DC  n 
5 139 DA  n 
5 140 DG  n 
5 141 DT  n 
5 142 DT  n 
5 143 DT  n 
5 144 DT  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DA  n 
6 7   DA  n 
6 8   DC  n 
6 9   DT  n 
6 10  DG  n 
6 11  DT  n 
6 12  DG  n 
6 13  DC  n 
6 14  DC  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DT  n 
6 20  DC  n 
6 21  DG  n 
6 22  DG  n 
6 23  DC  n 
6 24  DC  n 
6 25  DG  n 
6 26  DA  n 
6 27  DC  n 
6 28  DC  n 
6 29  DT  n 
6 30  DG  n 
6 31  DA  n 
6 32  DG  n 
6 33  DG  n 
6 34  DG  n 
6 35  DT  n 
6 36  DC  n 
6 37  DG  n 
6 38  DC  n 
6 39  DC  n 
6 40  DG  n 
6 41  DG  n 
6 42  DG  n 
6 43  DG  n 
6 44  DT  n 
6 45  DC  n 
6 46  DT  n 
6 47  DG  n 
6 48  DC  n 
6 49  DG  n 
6 50  DG  n 
6 51  DG  n 
6 52  DG  n 
6 53  DG  n 
6 54  DG  n 
6 55  DA  n 
6 56  DC  n 
6 57  DC  n 
6 58  DC  n 
6 59  DT  n 
6 60  DC  n 
6 61  DT  n 
6 62  DG  n 
6 63  DG  n 
6 64  DA  n 
6 65  DA  n 
6 66  DA  n 
6 67  DG  n 
6 68  DT  n 
6 69  DG  n 
6 70  DA  n 
6 71  DA  n 
6 72  DG  n 
6 73  DG  n 
6 74  DA  n 
6 75  DT  n 
6 76  DA  n 
6 77  DA  n 
6 78  DG  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DC  n 
6 83  DG  n 
6 84  DA  n 
6 85  DG  n 
6 86  DC  n 
6 87  DG  n 
6 88  DG  n 
6 89  DA  n 
6 90  DG  n 
6 91  DA  n 
6 92  DC  n 
6 93  DG  n 
6 94  DG  n 
6 95  DG  n 
6 96  DA  n 
6 97  DT  n 
6 98  DG  n 
6 99  DG  n 
6 100 DC  n 
6 101 DG  n 
6 102 DA  n 
6 103 DA  n 
6 104 DC  n 
6 105 DA  n 
6 106 DG  n 
6 107 DA  n 
6 108 DC  n 
6 109 DA  n 
6 110 DC  n 
6 111 DA  n 
6 112 DA  n 
6 113 DA  n 
6 114 DC  n 
6 115 DA  n 
6 116 DC  n 
6 117 DA  n 
6 118 DC  n 
6 119 DA  n 
6 120 DA  n 
6 121 DG  n 
6 122 DA  n 
6 123 DG  n 
6 124 DG  n 
6 125 DT  n 
6 126 DG  n 
6 127 DA  n 
6 128 DA  n 
6 129 DT  n 
6 130 DG  n 
6 131 DT  n 
6 132 DT  n 
6 133 DA  n 
6 134 DG  n 
6 135 DG  n 
6 136 DA  n 
6 137 DC  n 
6 138 DT  n 
6 139 DG  n 
6 140 DT  n 
6 141 DT  n 
6 142 DG  n 
6 143 DC  n 
6 144 DA  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
7 1   LEU n 
7 2   LEU n 
7 3   ASP n 
7 4   GLN n 
7 5   THR n 
7 6   LYS n 
7 7   ASP n 
7 8   THR n 
7 9   ARG n 
7 10  ILE n 
7 11  THR n 
7 12  HIS n 
7 13  LEU n 
7 14  LEU n 
7 15  ARG n 
7 16  GLN n 
7 17  THR n 
7 18  ASN n 
7 19  ALA n 
7 20  PHE n 
7 21  LEU n 
7 22  ASP n 
7 23  SER n 
7 24  LEU n 
7 25  THR n 
7 26  ARG n 
7 27  ALA n 
7 28  VAL n 
7 29  LYS n 
7 30  ASP n 
7 31  GLN n 
7 32  GLN n 
7 33  LYS n 
7 34  TYR n 
7 35  THR n 
7 36  LYS n 
7 37  GLU n 
7 38  MET n 
7 39  ILE n 
7 40  ASP n 
7 41  SER n 
7 42  HIS n 
7 43  ILE n 
7 44  LYS n 
7 45  GLU n 
7 46  ALA n 
7 47  SER n 
7 48  GLU n 
7 49  GLU n 
7 50  VAL n 
7 51  ASP n 
7 52  ASP n 
7 53  LEU n 
7 54  SER n 
7 55  MET n 
7 56  VAL n 
7 57  PRO n 
7 58  LYS n 
7 59  MET n 
7 60  LYS n 
7 61  ASP n 
7 62  GLU n 
7 63  GLU n 
7 64  TYR n 
7 65  ASP n 
7 66  ASP n 
7 67  ASP n 
7 68  ASP n 
7 69  ASP n 
7 70  ASN n 
7 71  SER n 
7 72  ASN n 
7 73  VAL n 
7 74  ASP n 
7 75  TYR n 
7 76  TYR n 
7 77  ASN n 
7 78  VAL n 
7 79  ALA n 
7 80  HIS n 
7 81  ARG n 
7 82  ILE n 
7 83  LYS n 
7 84  GLU n 
7 85  ASP n 
7 86  ILE n 
7 87  LYS n 
7 88  LYS n 
7 89  GLN n 
7 90  PRO n 
7 91  SER n 
7 92  ILE n 
7 93  LEU n 
7 94  VAL n 
7 95  GLY n 
7 96  GLY n 
7 97  THR n 
7 98  LEU n 
7 99  LYS n 
7 100 ASP n 
7 101 TYR n 
7 102 GLN n 
7 103 ILE n 
7 104 LYS n 
7 105 GLY n 
7 106 LEU n 
7 107 GLN n 
7 108 TRP n 
7 109 MET n 
7 110 VAL n 
7 111 SER n 
7 112 LEU n 
7 113 PHE n 
7 114 ASN n 
7 115 ASN n 
7 116 HIS n 
7 117 LEU n 
7 118 ASN n 
7 119 GLY n 
7 120 ILE n 
7 121 LEU n 
7 122 ALA n 
7 123 ASP n 
7 124 GLU n 
7 125 MET n 
7 126 GLY n 
7 127 LEU n 
7 128 GLY n 
7 129 LYS n 
7 130 THR n 
7 131 ILE n 
7 132 GLN n 
7 133 THR n 
7 134 ILE n 
7 135 SER n 
7 136 LEU n 
7 137 LEU n 
7 138 THR n 
7 139 TYR n 
7 140 LEU n 
7 141 TYR n 
7 142 GLU n 
7 143 MET n 
7 144 LYS n 
7 145 ASN n 
7 146 ILE n 
7 147 ARG n 
7 148 GLY n 
7 149 PRO n 
7 150 TYR n 
7 151 LEU n 
7 152 VAL n 
7 153 ILE n 
7 154 VAL n 
7 155 PRO n 
7 156 LEU n 
7 157 SER n 
7 158 THR n 
7 159 LEU n 
7 160 SER n 
7 161 ASN n 
7 162 TRP n 
7 163 SER n 
7 164 SER n 
7 165 GLU n 
7 166 PHE n 
7 167 ALA n 
7 168 LYS n 
7 169 TRP n 
7 170 ALA n 
7 171 PRO n 
7 172 THR n 
7 173 LEU n 
7 174 ARG n 
7 175 THR n 
7 176 ILE n 
7 177 SER n 
7 178 PHE n 
7 179 LYS n 
7 180 GLY n 
7 181 SER n 
7 182 PRO n 
7 183 ASN n 
7 184 GLU n 
7 185 ARG n 
7 186 LYS n 
7 187 ALA n 
7 188 LYS n 
7 189 GLN n 
7 190 ALA n 
7 191 LYS n 
7 192 ILE n 
7 193 ARG n 
7 194 ALA n 
7 195 GLY n 
7 196 GLU n 
7 197 PHE n 
7 198 ASP n 
7 199 VAL n 
7 200 VAL n 
7 201 LEU n 
7 202 THR n 
7 203 THR n 
7 204 PHE n 
7 205 GLU n 
7 206 TYR n 
7 207 ILE n 
7 208 ILE n 
7 209 LYS n 
7 210 GLU n 
7 211 ARG n 
7 212 ALA n 
7 213 LEU n 
7 214 LEU n 
7 215 SER n 
7 216 LYS n 
7 217 VAL n 
7 218 LYS n 
7 219 TRP n 
7 220 VAL n 
7 221 HIS n 
7 222 MET n 
7 223 ILE n 
7 224 ILE n 
7 225 ASP n 
7 226 GLU n 
7 227 GLY n 
7 228 HIS n 
7 229 ARG n 
7 230 MET n 
7 231 LYS n 
7 232 ASN n 
7 233 ALA n 
7 234 GLN n 
7 235 SER n 
7 236 LYS n 
7 237 LEU n 
7 238 SER n 
7 239 LEU n 
7 240 THR n 
7 241 LEU n 
7 242 ASN n 
7 243 THR n 
7 244 HIS n 
7 245 TYR n 
7 246 HIS n 
7 247 ALA n 
7 248 ASP n 
7 249 TYR n 
7 250 ARG n 
7 251 LEU n 
7 252 ILE n 
7 253 LEU n 
7 254 THR n 
7 255 GLY n 
7 256 THR n 
7 257 PRO n 
7 258 LEU n 
7 259 GLN n 
7 260 ASN n 
7 261 ASN n 
7 262 LEU n 
7 263 PRO n 
7 264 GLU n 
7 265 LEU n 
7 266 TRP n 
7 267 ALA n 
7 268 LEU n 
7 269 LEU n 
7 270 ASN n 
7 271 PHE n 
7 272 VAL n 
7 273 LEU n 
7 274 PRO n 
7 275 LYS n 
7 276 ILE n 
7 277 PHE n 
7 278 ASN n 
7 279 SER n 
7 280 VAL n 
7 281 LYS n 
7 282 SER n 
7 283 PHE n 
7 284 ASP n 
7 285 GLU n 
7 286 TRP n 
7 287 PHE n 
7 288 ASN n 
7 289 THR n 
7 290 PRO n 
7 291 PHE n 
7 292 ALA n 
7 293 ASN n 
7 294 THR n 
7 295 GLY n 
7 296 GLY n 
7 297 GLN n 
7 298 ASP n 
7 299 LYS n 
7 300 ILE n 
7 301 GLU n 
7 302 LEU n 
7 303 SER n 
7 304 GLU n 
7 305 GLU n 
7 306 GLU n 
7 307 THR n 
7 308 LEU n 
7 309 LEU n 
7 310 VAL n 
7 311 ILE n 
7 312 ARG n 
7 313 ARG n 
7 314 LEU n 
7 315 HIS n 
7 316 LYS n 
7 317 VAL n 
7 318 LEU n 
7 319 ARG n 
7 320 PRO n 
7 321 PHE n 
7 322 LEU n 
7 323 LEU n 
7 324 ARG n 
7 325 ARG n 
7 326 LEU n 
7 327 LYS n 
7 328 LYS n 
7 329 ASP n 
7 330 VAL n 
7 331 GLU n 
7 332 LYS n 
7 333 GLU n 
7 334 LEU n 
7 335 PRO n 
7 336 ASP n 
7 337 LYS n 
7 338 VAL n 
7 339 GLU n 
7 340 LYS n 
7 341 VAL n 
7 342 VAL n 
7 343 LYS n 
7 344 CYS n 
7 345 LYS n 
7 346 MET n 
7 347 SER n 
7 348 ALA n 
7 349 LEU n 
7 350 GLN n 
7 351 GLN n 
7 352 ILE n 
7 353 MET n 
7 354 TYR n 
7 355 GLN n 
7 356 GLN n 
7 357 MET n 
7 358 LEU n 
7 359 LYS n 
7 360 TYR n 
7 361 ARG n 
7 362 ARG n 
7 363 LEU n 
7 364 PHE n 
7 365 ILE n 
7 366 GLY n 
7 367 ASP n 
7 368 GLN n 
7 369 ASN n 
7 370 ASN n 
7 371 LYS n 
7 372 LYS n 
7 373 MET n 
7 374 VAL n 
7 375 GLY n 
7 376 LEU n 
7 377 ARG n 
7 378 GLY n 
7 379 PHE n 
7 380 ASN n 
7 381 ASN n 
7 382 GLN n 
7 383 ILE n 
7 384 MET n 
7 385 GLN n 
7 386 LEU n 
7 387 LYS n 
7 388 LYS n 
7 389 ILE n 
7 390 CYS n 
7 391 ASN n 
7 392 HIS n 
7 393 PRO n 
7 394 PHE n 
7 395 VAL n 
7 396 PHE n 
7 397 GLU n 
7 398 GLU n 
7 399 VAL n 
7 400 GLU n 
7 401 ASP n 
7 402 GLN n 
7 403 ILE n 
7 404 ASN n 
7 405 PRO n 
7 406 THR n 
7 407 ARG n 
7 408 GLU n 
7 409 THR n 
7 410 ASN n 
7 411 ASP n 
7 412 ASP n 
7 413 ILE n 
7 414 TRP n 
7 415 ARG n 
7 416 VAL n 
7 417 ALA n 
7 418 GLY n 
7 419 LYS n 
7 420 PHE n 
7 421 GLU n 
7 422 LEU n 
7 423 LEU n 
7 424 ASP n 
7 425 ARG n 
7 426 ILE n 
7 427 LEU n 
7 428 PRO n 
7 429 LYS n 
7 430 LEU n 
7 431 LYS n 
7 432 ALA n 
7 433 THR n 
7 434 GLY n 
7 435 HIS n 
7 436 ARG n 
7 437 VAL n 
7 438 LEU n 
7 439 ILE n 
7 440 PHE n 
7 441 PHE n 
7 442 GLN n 
7 443 MET n 
7 444 THR n 
7 445 GLN n 
7 446 ILE n 
7 447 MET n 
7 448 ASP n 
7 449 ILE n 
7 450 MET n 
7 451 GLU n 
7 452 ASP n 
7 453 PHE n 
7 454 LEU n 
7 455 ARG n 
7 456 TYR n 
7 457 ILE n 
7 458 ASN n 
7 459 ILE n 
7 460 LYS n 
7 461 TYR n 
7 462 LEU n 
7 463 ARG n 
7 464 LEU n 
7 465 ASP n 
7 466 GLY n 
7 467 HIS n 
7 468 THR n 
7 469 LYS n 
7 470 SER n 
7 471 ASP n 
7 472 GLU n 
7 473 ARG n 
7 474 SER n 
7 475 GLU n 
7 476 LEU n 
7 477 LEU n 
7 478 ARG n 
7 479 LEU n 
7 480 PHE n 
7 481 ASN n 
7 482 ALA n 
7 483 PRO n 
7 484 ASP n 
7 485 SER n 
7 486 GLU n 
7 487 TYR n 
7 488 LEU n 
7 489 CYS n 
7 490 PHE n 
7 491 ILE n 
7 492 LEU n 
7 493 SER n 
7 494 THR n 
7 495 ARG n 
7 496 ALA n 
7 497 GLY n 
7 498 GLY n 
7 499 LEU n 
7 500 GLY n 
7 501 LEU n 
7 502 ASN n 
7 503 LEU n 
7 504 GLN n 
7 505 THR n 
7 506 ALA n 
7 507 ASP n 
7 508 THR n 
7 509 VAL n 
7 510 ILE n 
7 511 ILE n 
7 512 PHE n 
7 513 ASP n 
7 514 THR n 
7 515 ASP n 
7 516 TRP n 
7 517 ASN n 
7 518 PRO n 
7 519 HIS n 
7 520 GLN n 
7 521 ASP n 
7 522 LEU n 
7 523 GLN n 
7 524 ALA n 
7 525 GLN n 
7 526 ASP n 
7 527 ARG n 
7 528 ALA n 
7 529 HIS n 
7 530 ARG n 
7 531 ILE n 
7 532 GLY n 
7 533 GLN n 
7 534 LYS n 
7 535 ASN n 
7 536 GLU n 
7 537 VAL n 
7 538 ARG n 
7 539 ILE n 
7 540 LEU n 
7 541 ARG n 
7 542 LEU n 
7 543 ILE n 
7 544 THR n 
7 545 THR n 
7 546 ASN n 
7 547 SER n 
7 548 VAL n 
7 549 GLU n 
7 550 GLU n 
7 551 VAL n 
7 552 ILE n 
7 553 LEU n 
7 554 GLU n 
7 555 ARG n 
7 556 ALA n 
7 557 TYR n 
7 558 LYS n 
7 559 LYS n 
7 560 LEU n 
7 561 ASP n 
7 562 ILE n 
7 563 ASP n 
7 564 GLY n 
7 565 LYS n 
7 566 VAL n 
7 567 ILE n 
7 568 GLN n 
7 569 ALA n 
7 570 GLY n 
7 571 LYS n 
7 572 PHE n 
7 573 ASP n 
7 574 ASN n 
7 575 LYS n 
7 576 SER n 
7 577 THR n 
7 578 SER n 
7 579 GLU n 
7 580 GLU n 
7 581 GLN n 
7 582 GLU n 
7 583 ALA n 
7 584 LEU n 
7 585 LEU n 
7 586 ARG n 
7 587 SER n 
7 588 LEU n 
7 589 LEU n 
7 590 ASP n 
7 591 ALA n 
7 592 GLU n 
7 593 GLU n 
7 594 GLU n 
7 595 ARG n 
7 596 ARG n 
7 597 LYS n 
7 598 LYS n 
7 599 ARG n 
7 600 GLU n 
7 601 SER n 
7 602 GLY n 
7 603 VAL n 
7 604 GLU n 
7 605 GLU n 
7 606 GLU n 
7 607 GLU n 
7 608 GLU n 
7 609 LEU n 
7 610 LYS n 
7 611 ASP n 
7 612 SER n 
7 613 GLU n 
7 614 ILE n 
7 615 ASN n 
7 616 GLU n 
7 617 ILE n 
7 618 LEU n 
7 619 ALA n 
7 620 ARG n 
7 621 ASN n 
7 622 ASP n 
7 623 GLU n 
7 624 GLU n 
7 625 MET n 
7 626 ALA n 
7 627 VAL n 
7 628 LEU n 
7 629 THR n 
7 630 ARG n 
7 631 MET n 
7 632 ASP n 
7 633 GLU n 
7 634 ASP n 
7 635 ARG n 
7 636 SER n 
7 637 LYS n 
7 638 LYS n 
7 639 GLU n 
7 640 GLU n 
7 641 GLU n 
7 642 LEU n 
7 643 GLY n 
7 644 VAL n 
7 645 LYS n 
7 646 SER n 
7 647 ARG n 
7 648 LEU n 
7 649 LEU n 
7 650 GLU n 
7 651 LYS n 
7 652 SER n 
7 653 GLU n 
7 654 LEU n 
7 655 PRO n 
7 656 ASP n 
7 657 ILE n 
7 658 TYR n 
7 659 SER n 
7 660 ARG n 
7 661 ASP n 
7 662 ILE n 
7 663 GLY n 
7 664 ALA n 
7 665 GLU n 
7 666 LEU n 
7 667 LYS n 
7 668 ARG n 
7 669 GLU n 
7 670 GLU n 
7 671 SER n 
7 672 GLU n 
7 673 SER n 
7 674 ALA n 
7 675 ALA n 
7 676 VAL n 
7 677 TYR n 
7 678 ASN n 
7 679 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 100 'African clawed frog' ? XELAEV_18002543mg                         ? ?                     ? 
? ? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562    ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 88  'African clawed frog' ? ?                                         ? ?                     ? 
? ? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562    ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 113 'African clawed frog' ? 'hist1h2aj, LOC494591, XELAEV_18003602mg' ? ?                     ? 
? ? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 885276 ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 98  'African clawed frog' ? XELAEV_18032685mg                         ? ?                     ? 
? ? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562    ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 679 
;Baker's yeast
;
? 'SNF2, GAM1, RIC1, SWI2, TYE3, YOR290C'   ? 'ATCC 204508 / S288c' ? ? ? ? 
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? ? ? ? ? ? ? 'Escherichia coli' 562    ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 147 'Mus musculus' ? 10090 ? 
6 1 sample 1 147 'Mus musculus' ? 10090 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP A0A310TTQ1_XENLA A0A310TTQ1 ? 1 
;KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAK
RVTIMPKDIQLARRIRGERA
;
37  
2 UNP H4_XENLA         P62799     ? 2 
;AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQG
RTLYGFGG
;
16  
3 UNP Q6AZJ8_XENLA     Q6AZJ8     ? 3 
;KTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVR
NDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTE
;
10  
4 UNP A0A1L8FQA5_XENLA A0A1L8FQA5 ? 4 
;KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELA
KHAVSEGTKAVTKYTSAK
;
29  
5 PDB 6IY3             6IY3       ? 5 ? 1   
6 PDB 6IY3             6IY3       ? 6 ? 1   
7 UNP SNF2_YEAST       P22082     ? 7 
;LLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYYNVAH
RIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLS
NWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLT
LNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRP
FLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVE
DQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLF
NAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKL
DIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEE
ELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNG
;
670 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6IY3 A 1 ? 100 ? A0A310TTQ1 37  ? 136  ? 36  135  
2  2 6IY3 B 1 ? 88  ? P62799     16  ? 103  ? 15  102  
3  3 6IY3 C 1 ? 113 ? Q6AZJ8     10  ? 122  ? 9   121  
4  4 6IY3 D 1 ? 98  ? A0A1L8FQA5 29  ? 126  ? 28  125  
5  1 6IY3 E 1 ? 100 ? A0A310TTQ1 37  ? 136  ? 36  135  
6  2 6IY3 F 1 ? 88  ? P62799     16  ? 103  ? 15  102  
7  3 6IY3 G 1 ? 113 ? Q6AZJ8     10  ? 122  ? 9   121  
8  4 6IY3 H 1 ? 98  ? A0A1L8FQA5 29  ? 126  ? 28  125  
9  5 6IY3 J 1 ? 147 ? 6IY3       1   ? 147  ? 1   147  
10 6 6IY3 I 1 ? 147 ? 6IY3       1   ? 147  ? 1   147  
11 7 6IY3 O 1 ? 679 ? P22082     670 ? 1348 ? 670 1348 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6IY3 ALA A 75 ? UNP A0A310TTQ1 CYS 111 conflict 110 1 
5 6IY3 ALA E 75 ? UNP A0A310TTQ1 CYS 111 conflict 110 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6IY3 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6IY3 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.009  ? 17964 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.065  ? 25490 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 22.061 ? 9890  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.059  ? 2892  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.007  ? 2375  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6IY3 
_struct.title                        'Structure of Snf2-MMTV-A nucleosome complex at shl-2 in ADP state' 
_struct.pdbx_descriptor              
'Histone H3, Histone H4, Histone H2A, Histone H2B, Transcription regulatory protein SNF2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6IY3 
_struct_keywords.text            
'complex, nucleosome, chromatin remodeling, gene regulation, STRUCTURAL PROTEIN-HYDROLASE-DNA complex, NUCLEAR PROTEIN' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/HYDROLASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 9   ? SER A 22  ? GLY A 44   SER A 57   1 ? 14 
HELX_P HELX_P2  AA2 ARG A 28  ? ASP A 42  ? ARG A 63   ASP A 77   1 ? 15 
HELX_P HELX_P3  AA3 GLN A 50  ? ALA A 79  ? GLN A 85   ALA A 114  1 ? 30 
HELX_P HELX_P4  AA4 MET A 85  ? ARG A 96  ? MET A 120  ARG A 131  1 ? 12 
HELX_P HELX_P5  AA5 ASN B 11  ? ILE B 15  ? ASN B 25   ILE B 29   5 ? 5  
HELX_P HELX_P6  AA6 THR B 16  ? GLY B 28  ? THR B 30   GLY B 42   1 ? 13 
HELX_P HELX_P7  AA7 LEU B 35  ? ALA B 62  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8  AA8 THR B 68  ? GLY B 80  ? THR B 82   GLY B 94   1 ? 13 
HELX_P HELX_P9  AA9 THR C 8   ? GLY C 14  ? THR C 16   GLY C 22   1 ? 7  
HELX_P HELX_P10 AB1 PRO C 18  ? GLY C 29  ? PRO C 26   GLY C 37   1 ? 12 
HELX_P HELX_P11 AB2 ALA C 37  ? ASN C 65  ? ALA C 45   ASN C 73   1 ? 29 
HELX_P HELX_P12 AB3 ILE C 71  ? ASP C 82  ? ILE C 79   ASP C 90   1 ? 12 
HELX_P HELX_P13 AB4 ASP C 82  ? LEU C 89  ? ASP C 90   LEU C 97   1 ? 8  
HELX_P HELX_P14 AB5 TYR D 10  ? HIS D 22  ? TYR D 37   HIS D 49   1 ? 13 
HELX_P HELX_P15 AB6 SER D 28  ? ASN D 57  ? SER D 55   ASN D 84   1 ? 30 
HELX_P HELX_P16 AB7 THR D 63  ? LEU D 75  ? THR D 90   LEU D 102  1 ? 13 
HELX_P HELX_P17 AB8 PRO D 76  ? ALA D 97  ? PRO D 103  ALA D 124  1 ? 22 
HELX_P HELX_P18 AB9 GLY E 9   ? SER E 22  ? GLY E 44   SER E 57   1 ? 14 
HELX_P HELX_P19 AC1 ARG E 28  ? ASP E 42  ? ARG E 63   ASP E 77   1 ? 15 
HELX_P HELX_P20 AC2 GLN E 50  ? ALA E 79  ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P21 AC3 MET E 85  ? ARG E 96  ? MET E 120  ARG E 131  1 ? 12 
HELX_P HELX_P22 AC4 ASN F 11  ? ILE F 15  ? ASN F 25   ILE F 29   5 ? 5  
HELX_P HELX_P23 AC5 THR F 16  ? GLY F 27  ? THR F 30   GLY F 41   1 ? 12 
HELX_P HELX_P24 AC6 LEU F 35  ? ALA F 62  ? LEU F 49   ALA F 76   1 ? 28 
HELX_P HELX_P25 AC7 THR F 68  ? GLY F 80  ? THR F 82   GLY F 94   1 ? 13 
HELX_P HELX_P26 AC8 THR G 8   ? GLY G 14  ? THR G 16   GLY G 22   1 ? 7  
HELX_P HELX_P27 AC9 PRO G 18  ? GLY G 29  ? PRO G 26   GLY G 37   1 ? 12 
HELX_P HELX_P28 AD1 GLY G 38  ? ASN G 65  ? GLY G 46   ASN G 73   1 ? 28 
HELX_P HELX_P29 AD2 ILE G 71  ? ASP G 82  ? ILE G 79   ASP G 90   1 ? 12 
HELX_P HELX_P30 AD3 ASP G 82  ? LEU G 89  ? ASP G 90   LEU G 97   1 ? 8  
HELX_P HELX_P31 AD4 TYR H 10  ? HIS H 22  ? TYR H 37   HIS H 49   1 ? 13 
HELX_P HELX_P32 AD5 SER H 29  ? ASN H 57  ? SER H 56   ASN H 84   1 ? 29 
HELX_P HELX_P33 AD6 THR H 63  ? LEU H 75  ? THR H 90   LEU H 102  1 ? 13 
HELX_P HELX_P34 AD7 PRO H 76  ? ALA H 97  ? PRO H 103  ALA H 124  1 ? 22 
HELX_P HELX_P35 AD8 LEU K 2   ? LEU K 14  ? LEU O 671  LEU O 683  1 ? 13 
HELX_P HELX_P36 AD9 ARG K 15  ? PHE K 20  ? ARG O 684  PHE O 689  1 ? 6  
HELX_P HELX_P37 AE1 TYR K 75  ? HIS K 80  ? TYR O 744  HIS O 749  1 ? 6  
HELX_P HELX_P38 AE2 LYS K 99  ? ASN K 115 ? LYS O 768  ASN O 784  1 ? 17 
HELX_P HELX_P39 AE3 GLY K 128 ? MET K 143 ? GLY O 797  MET O 812  1 ? 16 
HELX_P HELX_P40 AE4 THR K 158 ? ALA K 170 ? THR O 827  ALA O 839  1 ? 13 
HELX_P HELX_P41 AE5 SER K 181 ? ARG K 193 ? SER O 850  ARG O 862  1 ? 13 
HELX_P HELX_P42 AE6 PHE K 204 ? GLU K 210 ? PHE O 873  GLU O 879  1 ? 7  
HELX_P HELX_P43 AE7 GLU K 210 ? LYS K 216 ? GLU O 879  LYS O 885  1 ? 7  
HELX_P HELX_P44 AE8 GLU K 226 ? LYS K 231 ? GLU O 895  LYS O 900  1 ? 6  
HELX_P HELX_P45 AE9 SER K 235 ? THR K 243 ? SER O 904  THR O 912  1 ? 9  
HELX_P HELX_P46 AF1 GLU K 264 ? LEU K 269 ? GLU O 933  LEU O 938  1 ? 6  
HELX_P HELX_P47 AF2 PRO K 274 ? LYS K 281 ? PRO O 943  LYS O 950  1 ? 8  
HELX_P HELX_P48 AF3 SER K 282 ? THR K 289 ? SER O 951  THR O 958  1 ? 8  
HELX_P HELX_P49 AF4 THR K 307 ? LEU K 318 ? THR O 976  LEU O 987  1 ? 12 
HELX_P HELX_P50 AF5 ILE K 352 ? ARG K 362 ? ILE O 1021 ARG O 1031 1 ? 11 
HELX_P HELX_P51 AF6 ASN K 381 ? HIS K 392 ? ASN O 1050 HIS O 1061 1 ? 12 
HELX_P HELX_P52 AF7 VAL K 399 ? ASN K 404 ? VAL O 1068 ASN O 1073 1 ? 6  
HELX_P HELX_P53 AF8 ILE K 413 ? VAL K 416 ? ILE O 1082 VAL O 1085 5 ? 4  
HELX_P HELX_P54 AF9 ALA K 417 ? GLY K 434 ? ALA O 1086 GLY O 1103 1 ? 18 
HELX_P HELX_P55 AG1 THR K 444 ? ILE K 457 ? THR O 1113 ILE O 1126 1 ? 14 
HELX_P HELX_P56 AG2 SER K 470 ? ASN K 481 ? SER O 1139 ASN O 1150 1 ? 12 
HELX_P HELX_P57 AG3 GLN K 520 ? GLN K 525 ? GLN O 1189 GLN O 1194 1 ? 6  
HELX_P HELX_P58 AG4 GLN K 525 ? ARG K 530 ? GLN O 1194 ARG O 1199 1 ? 6  
HELX_P HELX_P59 AG5 SER K 547 ? LYS K 559 ? SER O 1216 LYS O 1228 1 ? 13 
HELX_P HELX_P60 AG6 ILE K 562 ? ASN K 574 ? ILE O 1231 ASN O 1243 1 ? 13 
HELX_P HELX_P61 AG7 GLU K 579 ? GLU K 594 ? GLU O 1248 GLU O 1263 1 ? 16 
HELX_P HELX_P62 AG8 ARG K 595 ? ARG K 599 ? ARG O 1264 ARG O 1268 5 ? 5  
HELX_P HELX_P63 AG9 LYS K 610 ? ALA K 619 ? LYS O 1279 ALA O 1288 1 ? 10 
HELX_P HELX_P64 AH1 ASN K 621 ? ARG K 635 ? ASN O 1290 ARG O 1304 1 ? 15 
HELX_P HELX_P65 AH2 ARG K 668 ? ALA K 675 ? ARG O 1337 ALA O 1344 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DA 1   N1 ? ? ? 1_555 J DT 147 N3 ? ? J DA 1   I DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? I DA 1   N6 ? ? ? 1_555 J DT 147 O4 ? ? J DA 1   I DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? I DC 3   N3 ? ? ? 1_555 J DG 145 N1 ? ? J DC 3   I DG 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? I DC 3   N4 ? ? ? 1_555 J DG 145 O6 ? ? J DC 3   I DG 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? I DC 3   O2 ? ? ? 1_555 J DG 145 N2 ? ? J DC 3   I DG 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? I DT 4   N3 ? ? ? 1_555 J DA 144 N1 ? ? J DT 4   I DA 144 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? I DT 4   O4 ? ? ? 1_555 J DA 144 N6 ? ? J DT 4   I DA 144 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? I DG 5   N2 ? ? ? 1_555 J DC 143 O2 ? ? J DG 5   I DC 143 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog9   hydrog ? ? I DC 6   N3 ? ? ? 1_555 J DG 142 N1 ? ? J DC 6   I DG 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? I DC 6   N4 ? ? ? 1_555 J DG 142 O6 ? ? J DC 6   I DG 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? I DC 6   O2 ? ? ? 1_555 J DG 142 N2 ? ? J DC 6   I DG 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? I DA 7   N1 ? ? ? 1_555 J DT 141 N3 ? ? J DA 7   I DT 141 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? I DA 7   N6 ? ? ? 1_555 J DT 141 O4 ? ? J DA 7   I DT 141 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? I DA 8   N1 ? ? ? 1_555 J DT 140 N3 ? ? J DA 8   I DT 140 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? I DA 8   N6 ? ? ? 1_555 J DT 140 O4 ? ? J DA 8   I DT 140 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? I DC 9   N3 ? ? ? 1_555 J DG 139 N1 ? ? J DC 9   I DG 139 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? I DC 9   N4 ? ? ? 1_555 J DG 139 O6 ? ? J DC 9   I DG 139 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? I DC 9   O2 ? ? ? 1_555 J DG 139 N2 ? ? J DC 9   I DG 139 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? I DA 10  N1 ? ? ? 1_555 J DT 138 N3 ? ? J DA 10  I DT 138 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? I DA 10  N6 ? ? ? 1_555 J DT 138 O4 ? ? J DA 10  I DT 138 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? I DG 11  N1 ? ? ? 1_555 J DC 137 N3 ? ? J DG 11  I DC 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? I DG 11  N2 ? ? ? 1_555 J DC 137 O2 ? ? J DG 11  I DC 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? I DG 11  O6 ? ? ? 1_555 J DC 137 N4 ? ? J DG 11  I DC 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? I DT 12  N3 ? ? ? 1_555 J DA 136 N1 ? ? J DT 12  I DA 136 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? I DT 12  O4 ? ? ? 1_555 J DA 136 N6 ? ? J DT 12  I DA 136 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? I DC 13  N3 ? ? ? 1_555 J DG 135 N2 ? ? J DC 13  I DG 135 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog27  hydrog ? ? I DC 14  N3 ? ? ? 1_555 J DG 134 N1 ? ? J DC 14  I DG 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? I DC 14  N4 ? ? ? 1_555 J DG 134 O6 ? ? J DC 14  I DG 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? I DC 14  O2 ? ? ? 1_555 J DG 134 N2 ? ? J DC 14  I DG 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? I DT 15  N3 ? ? ? 1_555 J DA 133 N1 ? ? J DT 15  I DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? I DT 15  O4 ? ? ? 1_555 J DA 133 N6 ? ? J DT 15  I DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? I DA 16  N1 ? ? ? 1_555 J DT 132 N3 ? ? J DA 16  I DT 132 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? I DA 16  N6 ? ? ? 1_555 J DT 132 O4 ? ? J DA 16  I DT 132 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? I DA 17  N1 ? ? ? 1_555 J DT 131 N3 ? ? J DA 17  I DT 131 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? I DA 17  N6 ? ? ? 1_555 J DT 131 O4 ? ? J DA 17  I DT 131 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? I DC 18  N3 ? ? ? 1_555 J DG 130 N1 ? ? J DC 18  I DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? I DC 18  N4 ? ? ? 1_555 J DG 130 O6 ? ? J DC 18  I DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? I DC 18  O2 ? ? ? 1_555 J DG 130 N2 ? ? J DC 18  I DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? I DA 19  N1 ? ? ? 1_555 J DT 129 N3 ? ? J DA 19  I DT 129 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? I DA 19  N6 ? ? ? 1_555 J DT 129 O4 ? ? J DA 19  I DT 129 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? I DT 20  N3 ? ? ? 1_555 J DA 128 N1 ? ? J DT 20  I DA 128 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog42  hydrog ? ? I DT 21  N3 ? ? ? 1_555 J DA 127 N1 ? ? J DT 21  I DA 127 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? I DT 21  O4 ? ? ? 1_555 J DA 127 N6 ? ? J DT 21  I DA 127 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? I DC 22  N3 ? ? ? 1_555 J DG 126 N2 ? ? J DC 22  I DG 126 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog45  hydrog ? ? I DA 23  N1 ? ? ? 1_555 J DG 124 N1 ? ? J DA 23  I DG 124 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog46  hydrog ? ? I DA 23  N6 ? ? ? 1_555 J DG 124 O6 ? ? J DA 23  I DG 124 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog47  hydrog ? ? I DA 23  N1 ? ? ? 1_555 J DT 125 N3 ? ? J DA 23  I DT 125 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? I DA 23  N6 ? ? ? 1_555 J DT 125 O4 ? ? J DA 23  I DT 125 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? I DC 24  N3 ? ? ? 1_555 J DG 124 N1 ? ? J DC 24  I DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? I DC 24  N4 ? ? ? 1_555 J DG 124 O6 ? ? J DC 24  I DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? I DC 24  O2 ? ? ? 1_555 J DG 124 N2 ? ? J DC 24  I DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? I DC 25  N3 ? ? ? 1_555 J DG 123 N2 ? ? J DC 25  I DG 123 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog53  hydrog ? ? I DT 26  N3 ? ? ? 1_555 J DA 122 N1 ? ? J DT 26  I DA 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? I DT 26  O4 ? ? ? 1_555 J DA 122 N6 ? ? J DT 26  I DA 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? I DC 27  N3 ? ? ? 1_555 J DG 121 N1 ? ? J DC 27  I DG 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? I DC 27  N4 ? ? ? 1_555 J DG 121 O6 ? ? J DC 27  I DG 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? I DC 27  O2 ? ? ? 1_555 J DG 121 N2 ? ? J DC 27  I DG 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? I DT 28  N3 ? ? ? 1_555 J DA 120 N1 ? ? J DT 28  I DA 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? I DT 28  O4 ? ? ? 1_555 J DA 120 N6 ? ? J DT 28  I DA 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? I DT 29  N3 ? ? ? 1_555 J DA 119 N1 ? ? J DT 29  I DA 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? I DT 29  O4 ? ? ? 1_555 J DA 119 N6 ? ? J DT 29  I DA 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? I DG 30  N1 ? ? ? 1_555 J DC 118 O2 ? ? J DG 30  I DC 118 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog63  hydrog ? ? I DT 31  N3 ? ? ? 1_555 J DA 117 N1 ? ? J DT 31  I DA 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? I DT 31  O4 ? ? ? 1_555 J DA 117 N6 ? ? J DT 31  I DA 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? I DG 32  N1 ? ? ? 1_555 J DC 116 N3 ? ? J DG 32  I DC 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? I DG 32  N2 ? ? ? 1_555 J DC 116 O2 ? ? J DG 32  I DC 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? I DG 32  O6 ? ? ? 1_555 J DC 116 N4 ? ? J DG 32  I DC 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? I DT 33  N3 ? ? ? 1_555 J DA 115 N1 ? ? J DT 33  I DA 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? I DT 33  O4 ? ? ? 1_555 J DA 115 N6 ? ? J DT 33  I DA 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? I DG 34  N1 ? ? ? 1_555 J DC 114 N3 ? ? J DG 34  I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? I DG 34  N2 ? ? ? 1_555 J DC 114 O2 ? ? J DG 34  I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? I DG 34  O6 ? ? ? 1_555 J DC 114 N4 ? ? J DG 34  I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? I DT 35  N3 ? ? ? 1_555 J DA 113 N1 ? ? J DT 35  I DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? I DT 35  O4 ? ? ? 1_555 J DA 113 N6 ? ? J DT 35  I DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? I DT 36  N3 ? ? ? 1_555 J DA 112 N1 ? ? J DT 36  I DA 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? I DT 36  O4 ? ? ? 1_555 J DA 112 N6 ? ? J DT 36  I DA 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? I DT 37  N3 ? ? ? 1_555 J DA 111 N1 ? ? J DT 37  I DA 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? I DT 37  O4 ? ? ? 1_555 J DA 111 N6 ? ? J DT 37  I DA 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? I DG 38  N1 ? ? ? 1_555 J DC 110 N3 ? ? J DG 38  I DC 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? I DG 38  N2 ? ? ? 1_555 J DC 110 O2 ? ? J DG 38  I DC 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? I DG 38  O6 ? ? ? 1_555 J DC 110 N4 ? ? J DG 38  I DC 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? I DT 39  N3 ? ? ? 1_555 J DA 109 N1 ? ? J DT 39  I DA 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? I DT 39  O4 ? ? ? 1_555 J DA 109 N6 ? ? J DT 39  I DA 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? I DG 40  N1 ? ? ? 1_555 J DC 108 N3 ? ? J DG 40  I DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? I DG 40  N2 ? ? ? 1_555 J DC 108 O2 ? ? J DG 40  I DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? I DG 40  O6 ? ? ? 1_555 J DC 108 N4 ? ? J DG 40  I DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? I DT 41  N3 ? ? ? 1_555 J DA 107 N1 ? ? J DT 41  I DA 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? I DT 41  O4 ? ? ? 1_555 J DA 107 N6 ? ? J DT 41  I DA 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? I DC 42  N3 ? ? ? 1_555 J DG 106 N2 ? ? J DC 42  I DG 106 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog90  hydrog ? ? I DT 43  N3 ? ? ? 1_555 J DA 105 N1 ? ? J DT 43  I DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? I DT 43  O4 ? ? ? 1_555 J DA 105 N6 ? ? J DT 43  I DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? I DG 44  N1 ? ? ? 1_555 J DC 104 N3 ? ? J DG 44  I DC 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? I DG 44  N2 ? ? ? 1_555 J DC 104 O2 ? ? J DG 44  I DC 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? I DG 44  O6 ? ? ? 1_555 J DC 104 N4 ? ? J DG 44  I DC 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? I DT 45  N3 ? ? ? 1_555 J DA 103 N1 ? ? J DT 45  I DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? I DT 45  O4 ? ? ? 1_555 J DA 103 N6 ? ? J DT 45  I DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? I DT 46  N3 ? ? ? 1_555 J DA 102 N1 ? ? J DT 46  I DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? I DT 46  O4 ? ? ? 1_555 J DA 102 N6 ? ? J DT 46  I DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? I DC 47  N3 ? ? ? 1_555 J DG 101 N1 ? ? J DC 47  I DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? I DC 47  N4 ? ? ? 1_555 J DG 101 O6 ? ? J DC 47  I DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? I DC 47  O2 ? ? ? 1_555 J DG 101 N2 ? ? J DC 47  I DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? I DG 48  N1 ? ? ? 1_555 J DC 100 N3 ? ? J DG 48  I DC 100 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? I DG 48  N2 ? ? ? 1_555 J DC 100 O2 ? ? J DG 48  I DC 100 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? I DG 48  O6 ? ? ? 1_555 J DC 100 N4 ? ? J DG 48  I DC 100 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? I DC 49  N3 ? ? ? 1_555 J DG 99  N1 ? ? J DC 49  I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? I DC 49  N4 ? ? ? 1_555 J DG 99  O6 ? ? J DC 49  I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? I DC 49  O2 ? ? ? 1_555 J DG 99  N2 ? ? J DC 49  I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? I DC 50  N3 ? ? ? 1_555 J DG 98  N1 ? ? J DC 50  I DG 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? I DC 50  N4 ? ? ? 1_555 J DG 98  O6 ? ? J DC 50  I DG 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? I DC 50  O2 ? ? ? 1_555 J DG 98  N2 ? ? J DC 50  I DG 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? I DA 51  N1 ? ? ? 1_555 J DT 97  N3 ? ? J DA 51  I DT 97  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? I DA 51  N6 ? ? ? 1_555 J DT 97  O4 ? ? J DA 51  I DT 97  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? I DT 52  N3 ? ? ? 1_555 J DA 96  N1 ? ? J DT 52  I DA 96  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? I DT 52  O4 ? ? ? 1_555 J DA 96  N6 ? ? J DT 52  I DA 96  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? I DC 53  N3 ? ? ? 1_555 J DG 95  N1 ? ? J DC 53  I DG 95  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? I DC 53  N4 ? ? ? 1_555 J DG 95  O6 ? ? J DC 53  I DG 95  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? I DC 53  O2 ? ? ? 1_555 J DG 95  N2 ? ? J DC 53  I DG 95  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? I DC 54  N3 ? ? ? 1_555 J DG 94  N1 ? ? J DC 54  I DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? I DC 54  N4 ? ? ? 1_555 J DG 94  O6 ? ? J DC 54  I DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? I DC 54  O2 ? ? ? 1_555 J DG 94  N2 ? ? J DC 54  I DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? I DC 55  N3 ? ? ? 1_555 J DG 93  N1 ? ? J DC 55  I DG 93  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? I DC 55  N4 ? ? ? 1_555 J DG 93  O6 ? ? J DC 55  I DG 93  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? I DC 55  O2 ? ? ? 1_555 J DG 93  N2 ? ? J DC 55  I DG 93  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? I DG 56  N1 ? ? ? 1_555 J DC 92  N3 ? ? J DG 56  I DC 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? I DG 56  N2 ? ? ? 1_555 J DC 92  O2 ? ? J DG 56  I DC 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? I DG 56  O6 ? ? ? 1_555 J DC 92  N4 ? ? J DG 56  I DC 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 91  N1 ? ? J DT 57  I DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 91  N6 ? ? J DT 57  I DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? I DC 58  N3 ? ? ? 1_555 J DG 90  N1 ? ? J DC 58  I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? I DC 58  N4 ? ? ? 1_555 J DG 90  O6 ? ? J DC 58  I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? I DC 58  O2 ? ? ? 1_555 J DG 90  N2 ? ? J DC 58  I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? I DT 59  N3 ? ? ? 1_555 J DA 89  N1 ? ? J DT 59  I DA 89  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? I DT 59  O4 ? ? ? 1_555 J DA 89  N6 ? ? J DT 59  I DA 89  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? I DC 60  N3 ? ? ? 1_555 J DG 88  N1 ? ? J DC 60  I DG 88  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? I DC 60  N4 ? ? ? 1_555 J DG 88  O6 ? ? J DC 60  I DG 88  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? I DC 60  O2 ? ? ? 1_555 J DG 88  N2 ? ? J DC 60  I DG 88  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? I DC 61  O2 ? ? ? 1_555 J DG 87  N2 ? ? J DC 61  I DG 87  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog138 hydrog ? ? I DG 62  N1 ? ? ? 1_555 J DC 86  N3 ? ? J DG 62  I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? I DG 62  N2 ? ? ? 1_555 J DC 86  O2 ? ? J DG 62  I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? I DG 62  O6 ? ? ? 1_555 J DC 86  N4 ? ? J DG 62  I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? I DC 63  N3 ? ? ? 1_555 J DG 85  N1 ? ? J DC 63  I DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? I DC 63  N4 ? ? ? 1_555 J DG 85  O6 ? ? J DC 63  I DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? I DC 63  O2 ? ? ? 1_555 J DG 85  N2 ? ? J DC 63  I DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? I DT 64  N3 ? ? ? 1_555 J DA 84  N1 ? ? J DT 64  I DA 84  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? I DT 64  O4 ? ? ? 1_555 J DA 84  N6 ? ? J DT 64  I DA 84  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? I DC 65  N3 ? ? ? 1_555 J DG 83  N1 ? ? J DC 65  I DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? I DC 65  N4 ? ? ? 1_555 J DG 83  O6 ? ? J DC 65  I DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? I DC 65  O2 ? ? ? 1_555 J DG 83  N2 ? ? J DC 65  I DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? I DG 66  N1 ? ? ? 1_555 J DC 82  N3 ? ? J DG 66  I DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? I DG 66  N2 ? ? ? 1_555 J DC 82  O2 ? ? J DG 66  I DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? I DG 66  O6 ? ? ? 1_555 J DC 82  N4 ? ? J DG 66  I DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? I DT 67  N3 ? ? ? 1_555 J DA 81  N1 ? ? J DT 67  I DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? I DT 67  O4 ? ? ? 1_555 J DA 81  N6 ? ? J DT 67  I DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? I DC 68  N3 ? ? ? 1_555 J DG 80  N1 ? ? J DC 68  I DG 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? I DC 68  N4 ? ? ? 1_555 J DG 80  O6 ? ? J DC 68  I DG 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? I DC 68  O2 ? ? ? 1_555 J DG 80  N2 ? ? J DC 68  I DG 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? I DA 69  N1 ? ? ? 1_555 J DT 79  N3 ? ? J DA 69  I DT 79  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? I DA 69  N6 ? ? ? 1_555 J DT 79  O4 ? ? J DA 69  I DT 79  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? I DC 70  N3 ? ? ? 1_555 J DG 78  N2 ? ? J DC 70  I DG 78  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog160 hydrog ? ? I DT 71  N3 ? ? ? 1_555 J DA 77  N1 ? ? J DT 71  I DA 77  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? I DT 71  O4 ? ? ? 1_555 J DA 77  N6 ? ? J DT 71  I DA 77  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? I DT 72  N3 ? ? ? 1_555 J DA 76  N1 ? ? J DT 72  I DA 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? I DT 72  O4 ? ? ? 1_555 J DA 76  N6 ? ? J DT 72  I DA 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? I DA 73  N1 ? ? ? 1_555 J DT 75  N3 ? ? J DA 73  I DT 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? I DA 73  N6 ? ? ? 1_555 J DT 75  O4 ? ? J DA 73  I DT 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166 hydrog ? ? I DT 74  N3 ? ? ? 1_555 J DA 74  N1 ? ? J DT 74  I DA 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167 hydrog ? ? I DT 74  O4 ? ? ? 1_555 J DA 74  N6 ? ? J DT 74  I DA 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? I DC 75  N3 ? ? ? 1_555 J DG 73  N1 ? ? J DC 75  I DG 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? I DC 75  N4 ? ? ? 1_555 J DG 73  O6 ? ? J DC 75  I DG 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? I DC 75  O2 ? ? ? 1_555 J DG 73  N2 ? ? J DC 75  I DG 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? I DC 76  N3 ? ? ? 1_555 J DG 72  N1 ? ? J DC 76  I DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? I DC 76  N4 ? ? ? 1_555 J DG 72  O6 ? ? J DC 76  I DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? I DC 76  O2 ? ? ? 1_555 J DG 72  N2 ? ? J DC 76  I DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? I DT 77  N3 ? ? ? 1_555 J DA 71  N1 ? ? J DT 77  I DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175 hydrog ? ? I DT 77  O4 ? ? ? 1_555 J DA 71  N6 ? ? J DT 77  I DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176 hydrog ? ? I DT 78  N3 ? ? ? 1_555 J DA 70  N1 ? ? J DT 78  I DA 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? I DT 78  O4 ? ? ? 1_555 J DA 70  N6 ? ? J DT 78  I DA 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? I DC 79  N3 ? ? ? 1_555 J DG 69  N1 ? ? J DC 79  I DG 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? I DC 79  N4 ? ? ? 1_555 J DG 69  O6 ? ? J DC 79  I DG 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? I DC 79  O2 ? ? ? 1_555 J DG 69  N2 ? ? J DC 79  I DG 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? I DA 80  N1 ? ? ? 1_555 J DT 68  N3 ? ? J DA 80  I DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182 hydrog ? ? I DA 80  N6 ? ? ? 1_555 J DT 68  O4 ? ? J DA 80  I DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183 hydrog ? ? I DC 81  N3 ? ? ? 1_555 J DG 67  N1 ? ? J DC 81  I DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? I DC 81  N4 ? ? ? 1_555 J DG 67  O6 ? ? J DC 81  I DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185 hydrog ? ? I DC 81  O2 ? ? ? 1_555 J DG 67  N2 ? ? J DC 81  I DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186 hydrog ? ? I DT 82  N3 ? ? ? 1_555 J DA 66  N1 ? ? J DT 82  I DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? I DT 82  O4 ? ? ? 1_555 J DA 66  N6 ? ? J DT 82  I DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? I DT 83  N3 ? ? ? 1_555 J DA 65  N1 ? ? J DT 83  I DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? I DT 83  O4 ? ? ? 1_555 J DA 65  N6 ? ? J DT 83  I DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? I DT 84  N3 ? ? ? 1_555 J DA 64  N1 ? ? J DT 84  I DA 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? I DT 84  O4 ? ? ? 1_555 J DA 64  N6 ? ? J DT 84  I DA 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? I DC 85  N3 ? ? ? 1_555 J DG 63  N1 ? ? J DC 85  I DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? I DC 85  N4 ? ? ? 1_555 J DG 63  O6 ? ? J DC 85  I DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? I DC 85  O2 ? ? ? 1_555 J DG 63  N2 ? ? J DC 85  I DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? I DC 86  N3 ? ? ? 1_555 J DG 62  N1 ? ? J DC 86  I DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? I DC 86  N4 ? ? ? 1_555 J DG 62  O6 ? ? J DC 86  I DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197 hydrog ? ? I DC 86  O2 ? ? ? 1_555 J DG 62  N2 ? ? J DC 86  I DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198 hydrog ? ? I DA 87  N1 ? ? ? 1_555 J DT 61  N3 ? ? J DA 87  I DT 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? I DA 87  N6 ? ? ? 1_555 J DT 61  O4 ? ? J DA 87  I DT 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200 hydrog ? ? I DG 88  N1 ? ? ? 1_555 J DC 60  N3 ? ? J DG 88  I DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201 hydrog ? ? I DG 88  N2 ? ? ? 1_555 J DC 60  O2 ? ? J DG 88  I DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? I DG 88  O6 ? ? ? 1_555 J DC 60  N4 ? ? J DG 88  I DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? I DA 89  N1 ? ? ? 1_555 J DT 59  N3 ? ? J DA 89  I DT 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? I DA 89  N6 ? ? ? 1_555 J DT 59  O4 ? ? J DA 89  I DT 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? I DG 90  N1 ? ? ? 1_555 J DC 58  N3 ? ? J DG 90  I DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? I DG 90  N2 ? ? ? 1_555 J DC 58  O2 ? ? J DG 90  I DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? I DG 90  O6 ? ? ? 1_555 J DC 58  N4 ? ? J DG 90  I DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? I DG 91  N1 ? ? ? 1_555 J DC 57  N3 ? ? J DG 91  I DC 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? I DG 91  N2 ? ? ? 1_555 J DC 57  O2 ? ? J DG 91  I DC 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210 hydrog ? ? I DG 91  O6 ? ? ? 1_555 J DC 57  N4 ? ? J DG 91  I DC 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211 hydrog ? ? I DG 92  N1 ? ? ? 1_555 J DC 56  N3 ? ? J DG 92  I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? I DG 92  N2 ? ? ? 1_555 J DC 56  O2 ? ? J DG 92  I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? I DG 92  O6 ? ? ? 1_555 J DC 56  N4 ? ? J DG 92  I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? I DT 93  N3 ? ? ? 1_555 J DA 55  N1 ? ? J DT 93  I DA 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? I DT 93  O4 ? ? ? 1_555 J DA 55  N6 ? ? J DT 93  I DA 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog216 hydrog ? ? I DC 94  N3 ? ? ? 1_555 J DG 54  N1 ? ? J DC 94  I DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? I DC 94  N4 ? ? ? 1_555 J DG 54  O6 ? ? J DC 94  I DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? I DC 94  O2 ? ? ? 1_555 J DG 54  N2 ? ? J DC 94  I DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 53  N1 ? ? J DC 95  I DG 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 53  O6 ? ? J DC 95  I DG 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 53  N2 ? ? J DC 95  I DG 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? I DC 96  N3 ? ? ? 1_555 J DG 52  N1 ? ? J DC 96  I DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? I DC 96  N4 ? ? ? 1_555 J DG 52  O6 ? ? J DC 96  I DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? I DC 96  O2 ? ? ? 1_555 J DG 52  N2 ? ? J DC 96  I DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? I DC 97  N3 ? ? ? 1_555 J DG 51  N1 ? ? J DC 97  I DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? I DC 97  N4 ? ? ? 1_555 J DG 51  O6 ? ? J DC 97  I DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? I DC 97  O2 ? ? ? 1_555 J DG 51  N2 ? ? J DC 97  I DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? I DC 98  N3 ? ? ? 1_555 J DG 50  N1 ? ? J DC 98  I DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? I DC 98  N4 ? ? ? 1_555 J DG 50  O6 ? ? J DC 98  I DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? I DC 98  O2 ? ? ? 1_555 J DG 50  N2 ? ? J DC 98  I DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? I DC 99  N3 ? ? ? 1_555 J DG 49  N1 ? ? J DC 99  I DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? I DC 99  N4 ? ? ? 1_555 J DG 49  O6 ? ? J DC 99  I DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? I DC 99  O2 ? ? ? 1_555 J DG 49  N2 ? ? J DC 99  I DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? I DG 100 N1 ? ? ? 1_555 J DC 48  N3 ? ? J DG 100 I DC 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? I DG 100 N2 ? ? ? 1_555 J DC 48  O2 ? ? J DG 100 I DC 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? I DG 100 O6 ? ? ? 1_555 J DC 48  N4 ? ? J DG 100 I DC 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? I DC 101 N3 ? ? ? 1_555 J DG 47  N1 ? ? J DC 101 I DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog238 hydrog ? ? I DC 101 N4 ? ? ? 1_555 J DG 47  O6 ? ? J DC 101 I DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog239 hydrog ? ? I DC 101 O2 ? ? ? 1_555 J DG 47  N2 ? ? J DC 101 I DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? I DA 102 N1 ? ? ? 1_555 J DT 46  N3 ? ? J DA 102 I DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? I DA 102 N6 ? ? ? 1_555 J DT 46  O4 ? ? J DA 102 I DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242 hydrog ? ? I DG 103 N1 ? ? ? 1_555 J DC 45  N3 ? ? J DG 103 I DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243 hydrog ? ? I DG 103 N2 ? ? ? 1_555 J DC 45  O2 ? ? J DG 103 I DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244 hydrog ? ? I DG 103 O6 ? ? ? 1_555 J DC 45  N4 ? ? J DG 103 I DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245 hydrog ? ? I DA 104 N1 ? ? ? 1_555 J DT 44  N3 ? ? J DA 104 I DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246 hydrog ? ? I DA 104 N6 ? ? ? 1_555 J DT 44  O4 ? ? J DA 104 I DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247 hydrog ? ? I DC 105 N3 ? ? ? 1_555 J DG 43  N1 ? ? J DC 105 I DG 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248 hydrog ? ? I DC 105 N4 ? ? ? 1_555 J DG 43  O6 ? ? J DC 105 I DG 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249 hydrog ? ? I DC 105 O2 ? ? ? 1_555 J DG 43  N2 ? ? J DC 105 I DG 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250 hydrog ? ? I DC 106 N3 ? ? ? 1_555 J DG 42  N1 ? ? J DC 106 I DG 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251 hydrog ? ? I DC 106 N4 ? ? ? 1_555 J DG 42  O6 ? ? J DC 106 I DG 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252 hydrog ? ? I DC 106 O2 ? ? ? 1_555 J DG 42  N2 ? ? J DC 106 I DG 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253 hydrog ? ? I DC 107 N3 ? ? ? 1_555 J DG 41  N1 ? ? J DC 107 I DG 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog254 hydrog ? ? I DC 107 N4 ? ? ? 1_555 J DG 41  O6 ? ? J DC 107 I DG 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog255 hydrog ? ? I DC 107 O2 ? ? ? 1_555 J DG 41  N2 ? ? J DC 107 I DG 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog256 hydrog ? ? I DC 108 N3 ? ? ? 1_555 J DG 40  N1 ? ? J DC 108 I DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257 hydrog ? ? I DC 108 N4 ? ? ? 1_555 J DG 40  O6 ? ? J DC 108 I DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258 hydrog ? ? I DC 108 O2 ? ? ? 1_555 J DG 40  N2 ? ? J DC 108 I DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259 hydrog ? ? I DG 109 N1 ? ? ? 1_555 J DC 39  N3 ? ? J DG 109 I DC 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260 hydrog ? ? I DG 109 N2 ? ? ? 1_555 J DC 39  O2 ? ? J DG 109 I DC 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261 hydrog ? ? I DG 109 O6 ? ? ? 1_555 J DC 39  N4 ? ? J DG 109 I DC 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262 hydrog ? ? I DG 110 N2 ? ? ? 1_555 J DC 38  O2 ? ? J DG 110 I DC 38  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog263 hydrog ? ? I DC 111 O2 ? ? ? 1_555 J DG 37  N2 ? ? J DC 111 I DG 37  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog264 hydrog ? ? I DG 112 N1 ? ? ? 1_555 J DC 36  N3 ? ? J DG 112 I DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265 hydrog ? ? I DG 112 N2 ? ? ? 1_555 J DC 36  O2 ? ? J DG 112 I DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266 hydrog ? ? I DG 112 O6 ? ? ? 1_555 J DC 36  N4 ? ? J DG 112 I DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267 hydrog ? ? I DA 113 N1 ? ? ? 1_555 J DT 35  N3 ? ? J DA 113 I DT 35  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog268 hydrog ? ? I DC 114 O2 ? ? ? 1_555 J DG 34  N2 ? ? J DC 114 I DG 34  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog269 hydrog ? ? I DC 115 N3 ? ? ? 1_555 J DG 33  N1 ? ? J DC 115 I DG 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270 hydrog ? ? I DC 115 N4 ? ? ? 1_555 J DG 33  O6 ? ? J DC 115 I DG 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271 hydrog ? ? I DC 115 O2 ? ? ? 1_555 J DG 33  N2 ? ? J DC 115 I DG 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272 hydrog ? ? I DC 116 N3 ? ? ? 1_555 J DG 32  N1 ? ? J DC 116 I DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273 hydrog ? ? I DC 116 N4 ? ? ? 1_555 J DG 32  O6 ? ? J DC 116 I DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog274 hydrog ? ? I DC 116 O2 ? ? ? 1_555 J DG 32  N2 ? ? J DC 116 I DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog275 hydrog ? ? I DT 117 N3 ? ? ? 1_555 J DA 31  N1 ? ? J DT 117 I DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276 hydrog ? ? I DT 117 O4 ? ? ? 1_555 J DA 31  N6 ? ? J DT 117 I DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277 hydrog ? ? I DC 118 O2 ? ? ? 1_555 J DG 30  N2 ? ? J DC 118 I DG 30  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog278 hydrog ? ? I DA 119 N1 ? ? ? 1_555 J DT 29  N3 ? ? J DA 119 I DT 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279 hydrog ? ? I DA 119 N6 ? ? ? 1_555 J DT 29  O4 ? ? J DA 119 I DT 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280 hydrog ? ? I DG 120 N1 ? ? ? 1_555 J DC 28  N3 ? ? J DG 120 I DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281 hydrog ? ? I DG 120 N2 ? ? ? 1_555 J DC 28  O2 ? ? J DG 120 I DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282 hydrog ? ? I DG 120 O6 ? ? ? 1_555 J DC 28  N4 ? ? J DG 120 I DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 27  N3 ? ? J DG 121 I DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 27  O2 ? ? J DG 121 I DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 27  N4 ? ? J DG 121 I DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286 hydrog ? ? I DT 122 N3 ? ? ? 1_555 J DA 26  N1 ? ? J DT 122 I DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287 hydrog ? ? I DT 122 O4 ? ? ? 1_555 J DA 26  N6 ? ? J DT 122 I DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288 hydrog ? ? I DC 123 O2 ? ? ? 1_555 J DG 25  N2 ? ? J DC 123 I DG 25  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog289 hydrog ? ? I DG 124 N1 ? ? ? 1_555 J DC 24  N3 ? ? J DG 124 I DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290 hydrog ? ? I DG 124 N2 ? ? ? 1_555 J DC 24  O2 ? ? J DG 124 I DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291 hydrog ? ? I DG 124 O6 ? ? ? 1_555 J DC 24  N4 ? ? J DG 124 I DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292 hydrog ? ? I DG 125 N1 ? ? ? 1_555 J DC 23  N3 ? ? J DG 125 I DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293 hydrog ? ? I DG 125 N2 ? ? ? 1_555 J DC 23  O2 ? ? J DG 125 I DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294 hydrog ? ? I DG 125 O6 ? ? ? 1_555 J DC 23  N4 ? ? J DG 125 I DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295 hydrog ? ? I DC 126 N3 ? ? ? 1_555 J DG 22  N2 ? ? J DC 126 I DG 22  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog296 hydrog ? ? I DC 127 N3 ? ? ? 1_555 J DG 21  N1 ? ? J DC 127 I DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297 hydrog ? ? I DC 127 N4 ? ? ? 1_555 J DG 21  O6 ? ? J DC 127 I DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298 hydrog ? ? I DC 127 O2 ? ? ? 1_555 J DG 21  N2 ? ? J DC 127 I DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299 hydrog ? ? I DG 128 N2 ? ? ? 1_555 J DC 20  O2 ? ? J DG 128 I DC 20  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog300 hydrog ? ? I DA 129 N1 ? ? ? 1_555 J DT 19  N3 ? ? J DA 129 I DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog301 hydrog ? ? I DA 129 N6 ? ? ? 1_555 J DT 19  O4 ? ? J DA 129 I DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302 hydrog ? ? I DC 130 O2 ? ? ? 1_555 J DG 18  N2 ? ? J DC 130 I DG 18  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog303 hydrog ? ? I DT 131 N3 ? ? ? 1_555 J DA 17  N1 ? ? J DT 131 I DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304 hydrog ? ? I DT 131 O4 ? ? ? 1_555 J DA 17  N6 ? ? J DT 131 I DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305 hydrog ? ? I DG 132 N2 ? ? ? 1_555 J DC 16  O2 ? ? J DG 132 I DC 16  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog306 hydrog ? ? I DC 133 O2 ? ? ? 1_555 J DG 15  N2 ? ? J DC 133 I DG 15  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog307 hydrog ? ? I DG 134 N2 ? ? ? 1_555 J DC 14  O2 ? ? J DG 134 I DC 14  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog308 hydrog ? ? I DG 135 N1 ? ? ? 1_555 J DC 13  N3 ? ? J DG 135 I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309 hydrog ? ? I DG 135 N2 ? ? ? 1_555 J DC 13  O2 ? ? J DG 135 I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310 hydrog ? ? I DG 135 O6 ? ? ? 1_555 J DC 13  N4 ? ? J DG 135 I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311 hydrog ? ? I DC 136 N3 ? ? ? 1_555 J DG 12  N2 ? ? J DC 136 I DG 12  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog312 hydrog ? ? I DA 137 N1 ? ? ? 1_555 J DT 11  N3 ? ? J DA 137 I DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313 hydrog ? ? I DA 137 N6 ? ? ? 1_555 J DT 11  O4 ? ? J DA 137 I DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314 hydrog ? ? I DC 138 N3 ? ? ? 1_555 J DG 10  N1 ? ? J DC 138 I DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315 hydrog ? ? I DC 138 N4 ? ? ? 1_555 J DG 10  O6 ? ? J DC 138 I DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316 hydrog ? ? I DC 138 O2 ? ? ? 1_555 J DG 10  N2 ? ? J DC 138 I DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317 hydrog ? ? I DA 139 N1 ? ? ? 1_555 J DT 9   N3 ? ? J DA 139 I DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318 hydrog ? ? I DA 139 N6 ? ? ? 1_555 J DT 9   O4 ? ? J DA 139 I DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319 hydrog ? ? I DG 140 N2 ? ? ? 1_555 J DC 8   N3 ? ? J DG 140 I DC 8   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog320 hydrog ? ? I DT 141 N3 ? ? ? 1_555 J DA 7   N1 ? ? J DT 141 I DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321 hydrog ? ? I DT 141 O4 ? ? ? 1_555 J DA 7   N6 ? ? J DT 141 I DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322 hydrog ? ? I DT 142 N3 ? ? ? 1_555 J DA 6   N1 ? ? J DT 142 I DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323 hydrog ? ? I DT 142 O4 ? ? ? 1_555 J DA 6   N6 ? ? J DT 142 I DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324 hydrog ? ? I DT 143 N3 ? ? ? 1_555 J DA 5   N1 ? ? J DT 143 I DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325 hydrog ? ? I DT 143 O4 ? ? ? 1_555 J DA 5   N6 ? ? J DT 143 I DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326 hydrog ? ? I DT 144 N3 ? ? ? 1_555 J DA 4   N1 ? ? J DT 144 I DA 4   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog327 hydrog ? ? I DG 145 N1 ? ? ? 1_555 J DC 3   N3 ? ? J DG 145 I DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328 hydrog ? ? I DG 145 N2 ? ? ? 1_555 J DC 3   O2 ? ? J DG 145 I DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329 hydrog ? ? I DG 145 O6 ? ? ? 1_555 J DC 3   N4 ? ? J DG 145 I DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330 hydrog ? ? I DA 146 N1 ? ? ? 1_555 J DT 2   N3 ? ? J DA 146 I DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331 hydrog ? ? I DA 146 N6 ? ? ? 1_555 J DT 2   O4 ? ? J DA 146 I DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332 hydrog ? ? I DT 147 N3 ? ? ? 1_555 J DA 1   N1 ? ? J DT 147 I DA 1   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           148 
_struct_mon_prot_cis.label_asym_id          K 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            817 
_struct_mon_prot_cis.auth_asym_id           O 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    149 
_struct_mon_prot_cis.pdbx_label_asym_id_2   K 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     818 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    O 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -6.53 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
AB1 2 3 ? parallel 
AB1 3 4 ? parallel 
AB2 1 2 ? parallel 
AB2 2 3 ? parallel 
AB2 3 4 ? parallel 
AB2 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 83  ? ILE A 84  ? THR A 118  ILE A 119  
AA1 2 ARG B 31  ? ILE B 32  ? ARG B 45   ILE B 46   
AA2 1 LEU B 83  ? TYR B 84  ? LEU B 97   TYR B 98   
AA2 2 THR G 93  ? ILE G 94  ? THR G 101  ILE G 102  
AA3 1 ARG C 34  ? VAL C 35  ? ARG C 42   VAL C 43   
AA3 2 THR D 61  ? ILE D 62  ? THR D 88   ILE D 89   
AA4 1 ARG C 69  ? ILE C 70  ? ARG C 77   ILE C 78   
AA4 2 GLY D 26  ? ILE D 27  ? GLY D 53   ILE D 54   
AA5 1 THR C 93  ? ILE C 94  ? THR C 101  ILE C 102  
AA5 2 LEU F 83  ? TYR F 84  ? LEU F 97   TYR F 98   
AA6 1 ARG E 48  ? PHE E 49  ? ARG E 83   PHE E 84   
AA6 2 THR F 66  ? VAL F 67  ? THR F 80   VAL F 81   
AA7 1 THR E 83  ? ILE E 84  ? THR E 118  ILE E 119  
AA7 2 ARG F 31  ? ILE F 32  ? ARG F 45   ILE F 46   
AA8 1 ARG G 69  ? ILE G 70  ? ARG G 77   ILE G 78   
AA8 2 GLY H 26  ? ILE H 27  ? GLY H 53   ILE H 54   
AA9 1 ILE K 120 ? LEU K 121 ? ILE O 789  LEU O 790  
AA9 2 ILE K 252 ? LEU K 253 ? ILE O 921  LEU O 922  
AB1 1 THR K 175 ? ILE K 176 ? THR O 844  ILE O 845  
AB1 2 VAL K 199 ? VAL K 200 ? VAL O 868  VAL O 869  
AB1 3 TYR K 150 ? ILE K 153 ? TYR O 819  ILE O 822  
AB1 4 HIS K 221 ? ILE K 224 ? HIS O 890  ILE O 893  
AB2 1 VAL K 338 ? GLU K 339 ? VAL O 1007 GLU O 1008 
AB2 2 ARG K 538 ? ARG K 541 ? ARG O 1207 ARG O 1210 
AB2 3 THR K 508 ? ILE K 511 ? THR O 1177 ILE O 1180 
AB2 4 VAL K 437 ? PHE K 440 ? VAL O 1106 PHE O 1109 
AB2 5 CYS K 489 ? ILE K 491 ? CYS O 1158 ILE O 1160 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 84  ? N ILE A 119  O ARG B 31  ? O ARG B 45   
AA2 1 2 N TYR B 84  ? N TYR B 98   O THR G 93  ? O THR G 101  
AA3 1 2 N ARG C 34  ? N ARG C 42   O ILE D 62  ? O ILE D 89   
AA4 1 2 N ILE C 70  ? N ILE C 78   O GLY D 26  ? O GLY D 53   
AA5 1 2 N THR C 93  ? N THR C 101  O TYR F 84  ? O TYR F 98   
AA6 1 2 N ARG E 48  ? N ARG E 83   O VAL F 67  ? O VAL F 81   
AA7 1 2 N ILE E 84  ? N ILE E 119  O ARG F 31  ? O ARG F 45   
AA8 1 2 N ILE G 70  ? N ILE G 78   O GLY H 26  ? O GLY H 53   
AA9 1 2 N LEU K 121 ? N LEU O 790  O ILE K 252 ? O ILE O 921  
AB1 1 2 N ILE K 176 ? N ILE O 845  O VAL K 199 ? O VAL O 868  
AB1 2 3 O VAL K 200 ? O VAL O 869  N VAL K 152 ? N VAL O 821  
AB1 3 4 N LEU K 151 ? N LEU O 820  O ILE K 223 ? O ILE O 892  
AB2 1 2 N VAL K 338 ? N VAL O 1007 O ILE K 539 ? O ILE O 1208 
AB2 2 3 O LEU K 540 ? O LEU O 1209 N VAL K 509 ? N VAL O 1178 
AB2 3 4 O THR K 508 ? O THR O 1177 N LEU K 438 ? N LEU O 1107 
AB2 4 5 N ILE K 439 ? N ILE O 1108 O PHE K 490 ? O PHE O 1159 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    O 
_struct_site.pdbx_auth_comp_id    ADP 
_struct_site.pdbx_auth_seq_id     2000 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    11 
_struct_site.details              'binding site for residue ADP O 2000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 THR K 97  ? THR O 766 . ? 1_555 ? 
2  AC1 11 LEU K 98  ? LEU O 767 . ? 1_555 ? 
3  AC1 11 GLN K 102 ? GLN O 771 . ? 1_555 ? 
4  AC1 11 GLU K 124 ? GLU O 793 . ? 1_555 ? 
5  AC1 11 MET K 125 ? MET O 794 . ? 1_555 ? 
6  AC1 11 GLY K 126 ? GLY O 795 . ? 1_555 ? 
7  AC1 11 LEU K 127 ? LEU O 796 . ? 1_555 ? 
8  AC1 11 GLY K 128 ? GLY O 797 . ? 1_555 ? 
9  AC1 11 LYS K 129 ? LYS O 798 . ? 1_555 ? 
10 AC1 11 THR K 130 ? THR O 799 . ? 1_555 ? 
11 AC1 11 ILE K 131 ? ILE O 800 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6IY3 
_atom_sites.fract_transf_matrix[1][1]   0.003788 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003788 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003788 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LYS A 1 1   ? 176.069 179.114 121.841 1.00 121.57 ? 36   LYS A N     1 
ATOM   2     C CA    . LYS A 1 1   ? 175.706 177.712 121.679 1.00 121.57 ? 36   LYS A CA    1 
ATOM   3     C C     . LYS A 1 1   ? 174.217 177.502 121.911 1.00 121.57 ? 36   LYS A C     1 
ATOM   4     O O     . LYS A 1 1   ? 173.474 178.455 122.134 1.00 121.57 ? 36   LYS A O     1 
ATOM   5     C CB    . LYS A 1 1   ? 176.507 176.832 122.642 1.00 121.57 ? 36   LYS A CB    1 
ATOM   6     C CG    . LYS A 1 1   ? 176.131 176.990 124.115 1.00 121.57 ? 36   LYS A CG    1 
ATOM   7     C CD    . LYS A 1 1   ? 176.963 176.068 124.994 1.00 121.57 ? 36   LYS A CD    1 
ATOM   8     C CE    . LYS A 1 1   ? 176.598 176.215 126.459 1.00 121.57 ? 36   LYS A CE    1 
ATOM   9     N NZ    . LYS A 1 1   ? 175.218 175.730 126.716 1.00 121.57 ? 36   LYS A NZ    1 
ATOM   10    N N     . LYS A 1 2   ? 173.785 176.244 121.839 1.00 112.35 ? 37   LYS A N     1 
ATOM   11    C CA    . LYS A 1 2   ? 172.437 175.846 122.231 1.00 112.35 ? 37   LYS A CA    1 
ATOM   12    C C     . LYS A 1 2   ? 172.564 174.578 123.064 1.00 112.35 ? 37   LYS A C     1 
ATOM   13    O O     . LYS A 1 2   ? 173.158 173.589 122.588 1.00 112.35 ? 37   LYS A O     1 
ATOM   14    C CB    . LYS A 1 2   ? 171.531 175.617 121.018 1.00 112.35 ? 37   LYS A CB    1 
ATOM   15    C CG    . LYS A 1 2   ? 171.231 176.869 120.199 1.00 112.35 ? 37   LYS A CG    1 
ATOM   16    C CD    . LYS A 1 2   ? 170.275 176.579 119.055 1.00 112.35 ? 37   LYS A CD    1 
ATOM   17    C CE    . LYS A 1 2   ? 170.937 175.728 117.981 1.00 112.35 ? 37   LYS A CE    1 
ATOM   18    N NZ    . LYS A 1 2   ? 172.057 176.448 117.322 1.00 112.35 ? 37   LYS A NZ    1 
ATOM   19    N N     . PRO A 1 3   ? 172.060 174.559 124.299 1.00 104.32 ? 38   PRO A N     1 
ATOM   20    C CA    . PRO A 1 3   ? 172.106 173.324 125.090 1.00 104.32 ? 38   PRO A CA    1 
ATOM   21    C C     . PRO A 1 3   ? 171.158 172.284 124.523 1.00 104.32 ? 38   PRO A C     1 
ATOM   22    O O     . PRO A 1 3   ? 170.049 172.600 124.085 1.00 104.32 ? 38   PRO A O     1 
ATOM   23    C CB    . PRO A 1 3   ? 171.676 173.779 126.489 1.00 104.32 ? 38   PRO A CB    1 
ATOM   24    C CG    . PRO A 1 3   ? 170.847 174.990 126.243 1.00 104.32 ? 38   PRO A CG    1 
ATOM   25    C CD    . PRO A 1 3   ? 171.445 175.671 125.042 1.00 104.32 ? 38   PRO A CD    1 
ATOM   26    N N     . HIS A 1 4   ? 171.614 171.037 124.513 1.00 101.05 ? 39   HIS A N     1 
ATOM   27    C CA    . HIS A 1 4   ? 170.888 169.973 123.829 1.00 101.05 ? 39   HIS A CA    1 
ATOM   28    C C     . HIS A 1 4   ? 169.696 169.558 124.671 1.00 101.05 ? 39   HIS A C     1 
ATOM   29    O O     . HIS A 1 4   ? 169.809 168.703 125.549 1.00 101.05 ? 39   HIS A O     1 
ATOM   30    C CB    . HIS A 1 4   ? 171.797 168.780 123.567 1.00 101.05 ? 39   HIS A CB    1 
ATOM   31    C CG    . HIS A 1 4   ? 171.179 167.744 122.681 1.00 101.05 ? 39   HIS A CG    1 
ATOM   32    N ND1   . HIS A 1 4   ? 170.299 166.792 123.148 1.00 101.05 ? 39   HIS A ND1   1 
ATOM   33    C CD2   . HIS A 1 4   ? 171.319 167.507 121.355 1.00 101.05 ? 39   HIS A CD2   1 
ATOM   34    C CE1   . HIS A 1 4   ? 169.916 166.020 122.147 1.00 101.05 ? 39   HIS A CE1   1 
ATOM   35    N NE2   . HIS A 1 4   ? 170.524 166.430 121.049 1.00 101.05 ? 39   HIS A NE2   1 
ATOM   36    N N     . ARG A 1 5   ? 168.542 170.160 124.410 1.00 87.50  ? 40   ARG A N     1 
ATOM   37    C CA    . ARG A 1 5   ? 167.291 169.656 124.951 1.00 87.50  ? 40   ARG A CA    1 
ATOM   38    C C     . ARG A 1 5   ? 166.824 168.530 124.046 1.00 87.50  ? 40   ARG A C     1 
ATOM   39    O O     . ARG A 1 5   ? 166.626 168.743 122.845 1.00 87.50  ? 40   ARG A O     1 
ATOM   40    C CB    . ARG A 1 5   ? 166.232 170.750 125.046 1.00 87.50  ? 40   ARG A CB    1 
ATOM   41    C CG    . ARG A 1 5   ? 166.520 171.792 126.099 1.00 87.50  ? 40   ARG A CG    1 
ATOM   42    C CD    . ARG A 1 5   ? 165.411 172.812 126.149 1.00 87.50  ? 40   ARG A CD    1 
ATOM   43    N NE    . ARG A 1 5   ? 164.157 172.207 126.583 1.00 87.50  ? 40   ARG A NE    1 
ATOM   44    C CZ    . ARG A 1 5   ? 163.770 172.125 127.849 1.00 87.50  ? 40   ARG A CZ    1 
ATOM   45    N NH1   . ARG A 1 5   ? 164.535 172.621 128.807 1.00 87.50  ? 40   ARG A NH1   1 
ATOM   46    N NH2   . ARG A 1 5   ? 162.614 171.557 128.156 1.00 87.50  ? 40   ARG A NH2   1 
ATOM   47    N N     . TYR A 1 6   ? 166.692 167.332 124.617 1.00 91.96  ? 41   TYR A N     1 
ATOM   48    C CA    . TYR A 1 6   ? 166.273 166.162 123.859 1.00 91.96  ? 41   TYR A CA    1 
ATOM   49    C C     . TYR A 1 6   ? 164.872 166.338 123.298 1.00 91.96  ? 41   TYR A C     1 
ATOM   50    O O     . TYR A 1 6   ? 164.039 167.055 123.860 1.00 91.96  ? 41   TYR A O     1 
ATOM   51    C CB    . TYR A 1 6   ? 166.314 164.903 124.726 1.00 91.96  ? 41   TYR A CB    1 
ATOM   52    C CG    . TYR A 1 6   ? 167.684 164.297 124.889 1.00 91.96  ? 41   TYR A CG    1 
ATOM   53    C CD1   . TYR A 1 6   ? 168.228 163.511 123.885 1.00 91.96  ? 41   TYR A CD1   1 
ATOM   54    C CD2   . TYR A 1 6   ? 168.424 164.487 126.043 1.00 91.96  ? 41   TYR A CD2   1 
ATOM   55    C CE1   . TYR A 1 6   ? 169.475 162.948 124.015 1.00 91.96  ? 41   TYR A CE1   1 
ATOM   56    C CE2   . TYR A 1 6   ? 169.676 163.925 126.184 1.00 91.96  ? 41   TYR A CE2   1 
ATOM   57    C CZ    . TYR A 1 6   ? 170.193 163.153 125.167 1.00 91.96  ? 41   TYR A CZ    1 
ATOM   58    O OH    . TYR A 1 6   ? 171.436 162.586 125.294 1.00 91.96  ? 41   TYR A OH    1 
ATOM   59    N N     . ARG A 1 7   ? 164.655 165.725 122.139 1.00 94.38  ? 42   ARG A N     1 
ATOM   60    C CA    . ARG A 1 7   ? 163.320 165.534 121.606 1.00 94.38  ? 42   ARG A CA    1 
ATOM   61    C C     . ARG A 1 7   ? 162.473 164.813 122.650 1.00 94.38  ? 42   ARG A C     1 
ATOM   62    O O     . ARG A 1 7   ? 162.935 163.820 123.227 1.00 94.38  ? 42   ARG A O     1 
ATOM   63    C CB    . ARG A 1 7   ? 163.397 164.709 120.321 1.00 94.38  ? 42   ARG A CB    1 
ATOM   64    C CG    . ARG A 1 7   ? 162.071 164.434 119.638 1.00 94.38  ? 42   ARG A CG    1 
ATOM   65    C CD    . ARG A 1 7   ? 161.550 165.650 118.905 1.00 94.38  ? 42   ARG A CD    1 
ATOM   66    N NE    . ARG A 1 7   ? 162.384 165.962 117.751 1.00 94.38  ? 42   ARG A NE    1 
ATOM   67    C CZ    . ARG A 1 7   ? 162.308 167.090 117.057 1.00 94.38  ? 42   ARG A CZ    1 
ATOM   68    N NH1   . ARG A 1 7   ? 161.431 168.024 117.395 1.00 94.38  ? 42   ARG A NH1   1 
ATOM   69    N NH2   . ARG A 1 7   ? 163.112 167.285 116.023 1.00 94.38  ? 42   ARG A NH2   1 
ATOM   70    N N     . PRO A 1 8   ? 161.279 165.306 122.966 1.00 77.34  ? 43   PRO A N     1 
ATOM   71    C CA    . PRO A 1 8   ? 160.496 164.700 124.050 1.00 77.34  ? 43   PRO A CA    1 
ATOM   72    C C     . PRO A 1 8   ? 159.963 163.336 123.644 1.00 77.34  ? 43   PRO A C     1 
ATOM   73    O O     . PRO A 1 8   ? 159.356 163.178 122.585 1.00 77.34  ? 43   PRO A O     1 
ATOM   74    C CB    . PRO A 1 8   ? 159.367 165.708 124.276 1.00 77.34  ? 43   PRO A CB    1 
ATOM   75    C CG    . PRO A 1 8   ? 159.257 166.435 123.000 1.00 77.34  ? 43   PRO A CG    1 
ATOM   76    C CD    . PRO A 1 8   ? 160.638 166.515 122.438 1.00 77.34  ? 43   PRO A CD    1 
ATOM   77    N N     . GLY A 1 9   ? 160.227 162.338 124.489 1.00 64.37  ? 44   GLY A N     1 
ATOM   78    C CA    . GLY A 1 9   ? 159.908 160.951 124.205 1.00 64.37  ? 44   GLY A CA    1 
ATOM   79    C C     . GLY A 1 9   ? 161.114 160.032 124.247 1.00 64.37  ? 44   GLY A C     1 
ATOM   80    O O     . GLY A 1 9   ? 160.995 158.883 124.689 1.00 64.37  ? 44   GLY A O     1 
ATOM   81    N N     . THR A 1 10  ? 162.279 160.521 123.811 1.00 65.76  ? 45   THR A N     1 
ATOM   82    C CA    . THR A 1 10  ? 163.473 159.679 123.778 1.00 65.76  ? 45   THR A CA    1 
ATOM   83    C C     . THR A 1 10  ? 163.972 159.372 125.184 1.00 65.76  ? 45   THR A C     1 
ATOM   84    O O     . THR A 1 10  ? 164.480 158.271 125.442 1.00 65.76  ? 45   THR A O     1 
ATOM   85    C CB    . THR A 1 10  ? 164.556 160.363 122.945 1.00 65.76  ? 45   THR A CB    1 
ATOM   86    O OG1   . THR A 1 10  ? 164.006 160.730 121.675 1.00 65.76  ? 45   THR A OG1   1 
ATOM   87    C CG2   . THR A 1 10  ? 165.719 159.425 122.692 1.00 65.76  ? 45   THR A CG2   1 
ATOM   88    N N     . VAL A 1 11  ? 163.788 160.309 126.114 1.00 59.24  ? 46   VAL A N     1 
ATOM   89    C CA    . VAL A 1 11  ? 164.144 160.059 127.503 1.00 59.24  ? 46   VAL A CA    1 
ATOM   90    C C     . VAL A 1 11  ? 163.204 159.027 128.111 1.00 59.24  ? 46   VAL A C     1 
ATOM   91    O O     . VAL A 1 11  ? 163.615 158.175 128.911 1.00 59.24  ? 46   VAL A O     1 
ATOM   92    C CB    . VAL A 1 11  ? 164.121 161.382 128.280 1.00 59.24  ? 46   VAL A CB    1 
ATOM   93    C CG1   . VAL A 1 11  ? 164.571 161.182 129.707 1.00 59.24  ? 46   VAL A CG1   1 
ATOM   94    C CG2   . VAL A 1 11  ? 164.979 162.402 127.580 1.00 59.24  ? 46   VAL A CG2   1 
ATOM   95    N N     . ALA A 1 12  ? 161.936 159.060 127.709 1.00 50.40  ? 47   ALA A N     1 
ATOM   96    C CA    . ALA A 1 12  ? 160.997 158.040 128.148 1.00 50.40  ? 47   ALA A CA    1 
ATOM   97    C C     . ALA A 1 12  ? 161.379 156.671 127.611 1.00 50.40  ? 47   ALA A C     1 
ATOM   98    O O     . ALA A 1 12  ? 161.285 155.671 128.329 1.00 50.40  ? 47   ALA A O     1 
ATOM   99    C CB    . ALA A 1 12  ? 159.585 158.410 127.716 1.00 50.40  ? 47   ALA A CB    1 
ATOM   100   N N     . LEU A 1 13  ? 161.867 156.608 126.373 1.00 49.11  ? 48   LEU A N     1 
ATOM   101   C CA    . LEU A 1 13  ? 162.277 155.313 125.833 1.00 49.11  ? 48   LEU A CA    1 
ATOM   102   C C     . LEU A 1 13  ? 163.544 154.784 126.497 1.00 49.11  ? 48   LEU A C     1 
ATOM   103   O O     . LEU A 1 13  ? 163.657 153.574 126.749 1.00 49.11  ? 48   LEU A O     1 
ATOM   104   C CB    . LEU A 1 13  ? 162.457 155.385 124.323 1.00 49.11  ? 48   LEU A CB    1 
ATOM   105   C CG    . LEU A 1 13  ? 161.246 154.912 123.519 1.00 49.11  ? 48   LEU A CG    1 
ATOM   106   C CD1   . LEU A 1 13  ? 160.085 155.864 123.619 1.00 49.11  ? 48   LEU A CD1   1 
ATOM   107   C CD2   . LEU A 1 13  ? 161.636 154.680 122.067 1.00 49.11  ? 48   LEU A CD2   1 
ATOM   108   N N     . ARG A 1 14  ? 164.499 155.659 126.815 1.00 60.95  ? 49   ARG A N     1 
ATOM   109   C CA    . ARG A 1 14  ? 165.678 155.147 127.506 1.00 60.95  ? 49   ARG A CA    1 
ATOM   110   C C     . ARG A 1 14  ? 165.358 154.766 128.947 1.00 60.95  ? 49   ARG A C     1 
ATOM   111   O O     . ARG A 1 14  ? 165.989 153.851 129.492 1.00 60.95  ? 49   ARG A O     1 
ATOM   112   C CB    . ARG A 1 14  ? 166.838 156.137 127.447 1.00 60.95  ? 49   ARG A CB    1 
ATOM   113   C CG    . ARG A 1 14  ? 166.659 157.388 128.249 1.00 60.95  ? 49   ARG A CG    1 
ATOM   114   C CD    . ARG A 1 14  ? 167.855 158.291 128.143 1.00 60.95  ? 49   ARG A CD    1 
ATOM   115   N NE    . ARG A 1 14  ? 168.037 158.802 126.795 1.00 60.95  ? 49   ARG A NE    1 
ATOM   116   C CZ    . ARG A 1 14  ? 169.096 159.503 126.413 1.00 60.95  ? 49   ARG A CZ    1 
ATOM   117   N NH1   . ARG A 1 14  ? 170.060 159.771 127.281 1.00 60.95  ? 49   ARG A NH1   1 
ATOM   118   N NH2   . ARG A 1 14  ? 169.193 159.933 125.165 1.00 60.95  ? 49   ARG A NH2   1 
ATOM   119   N N     . GLU A 1 15  ? 164.347 155.390 129.560 1.00 48.09  ? 50   GLU A N     1 
ATOM   120   C CA    . GLU A 1 15  ? 163.929 154.906 130.870 1.00 48.09  ? 50   GLU A CA    1 
ATOM   121   C C     . GLU A 1 15  ? 163.227 153.559 130.774 1.00 48.09  ? 50   GLU A C     1 
ATOM   122   O O     . GLU A 1 15  ? 163.393 152.720 131.664 1.00 48.09  ? 50   GLU A O     1 
ATOM   123   C CB    . GLU A 1 15  ? 163.044 155.916 131.588 1.00 48.09  ? 50   GLU A CB    1 
ATOM   124   C CG    . GLU A 1 15  ? 163.792 157.127 132.071 1.00 48.09  ? 50   GLU A CG    1 
ATOM   125   C CD    . GLU A 1 15  ? 162.950 158.004 132.969 1.00 48.09  ? 50   GLU A CD    1 
ATOM   126   O OE1   . GLU A 1 15  ? 161.764 157.680 133.170 1.00 48.09  ? 50   GLU A OE1   1 
ATOM   127   O OE2   . GLU A 1 15  ? 163.472 159.023 133.467 1.00 48.09  ? 50   GLU A OE2   1 
ATOM   128   N N     . ILE A 1 16  ? 162.443 153.328 129.712 1.00 41.08  ? 51   ILE A N     1 
ATOM   129   C CA    . ILE A 1 16  ? 161.825 152.014 129.520 1.00 41.08  ? 51   ILE A CA    1 
ATOM   130   C C     . ILE A 1 16  ? 162.893 150.945 129.371 1.00 41.08  ? 51   ILE A C     1 
ATOM   131   O O     . ILE A 1 16  ? 162.795 149.862 129.968 1.00 41.08  ? 51   ILE A O     1 
ATOM   132   C CB    . ILE A 1 16  ? 160.864 152.031 128.322 1.00 41.08  ? 51   ILE A CB    1 
ATOM   133   C CG1   . ILE A 1 16  ? 159.653 152.889 128.643 1.00 41.08  ? 51   ILE A CG1   1 
ATOM   134   C CG2   . ILE A 1 16  ? 160.383 150.649 127.983 1.00 41.08  ? 51   ILE A CG2   1 
ATOM   135   C CD1   . ILE A 1 16  ? 158.772 153.131 127.462 1.00 41.08  ? 51   ILE A CD1   1 
ATOM   136   N N     . ARG A 1 17  ? 163.979 151.272 128.672 1.00 47.37  ? 52   ARG A N     1 
ATOM   137   C CA    . ARG A 1 17  ? 165.053 150.293 128.542 1.00 47.37  ? 52   ARG A CA    1 
ATOM   138   C C     . ARG A 1 17  ? 165.766 150.041 129.867 1.00 47.37  ? 52   ARG A C     1 
ATOM   139   O O     . ARG A 1 17  ? 166.003 148.881 130.222 1.00 47.37  ? 52   ARG A O     1 
ATOM   140   C CB    . ARG A 1 17  ? 166.046 150.715 127.472 1.00 47.37  ? 52   ARG A CB    1 
ATOM   141   C CG    . ARG A 1 17  ? 165.485 150.581 126.086 1.00 47.37  ? 52   ARG A CG    1 
ATOM   142   C CD    . ARG A 1 17  ? 166.509 150.958 125.054 1.00 47.37  ? 52   ARG A CD    1 
ATOM   143   N NE    . ARG A 1 17  ? 165.947 150.891 123.716 1.00 47.37  ? 52   ARG A NE    1 
ATOM   144   C CZ    . ARG A 1 17  ? 165.321 151.904 123.133 1.00 47.37  ? 52   ARG A CZ    1 
ATOM   145   N NH1   . ARG A 1 17  ? 165.176 153.053 123.777 1.00 47.37  ? 52   ARG A NH1   1 
ATOM   146   N NH2   . ARG A 1 17  ? 164.839 151.769 121.908 1.00 47.37  ? 52   ARG A NH2   1 
ATOM   147   N N     . ARG A 1 18  ? 166.078 151.086 130.639 1.00 42.43  ? 53   ARG A N     1 
ATOM   148   C CA    . ARG A 1 18  ? 166.853 150.801 131.845 1.00 42.43  ? 53   ARG A CA    1 
ATOM   149   C C     . ARG A 1 18  ? 166.009 150.206 132.962 1.00 42.43  ? 53   ARG A C     1 
ATOM   150   O O     . ARG A 1 18  ? 166.540 149.443 133.776 1.00 42.43  ? 53   ARG A O     1 
ATOM   151   C CB    . ARG A 1 18  ? 167.581 152.039 132.359 1.00 42.43  ? 53   ARG A CB    1 
ATOM   152   C CG    . ARG A 1 18  ? 166.709 153.114 132.932 1.00 42.43  ? 53   ARG A CG    1 
ATOM   153   C CD    . ARG A 1 18  ? 167.556 154.245 133.452 1.00 42.43  ? 53   ARG A CD    1 
ATOM   154   N NE    . ARG A 1 18  ? 168.297 153.858 134.643 1.00 42.43  ? 53   ARG A NE    1 
ATOM   155   C CZ    . ARG A 1 18  ? 169.333 154.538 135.115 1.00 42.43  ? 53   ARG A CZ    1 
ATOM   156   N NH1   . ARG A 1 18  ? 169.742 155.627 134.483 1.00 42.43  ? 53   ARG A NH1   1 
ATOM   157   N NH2   . ARG A 1 18  ? 169.961 154.133 136.207 1.00 42.43  ? 53   ARG A NH2   1 
ATOM   158   N N     . TYR A 1 19  ? 164.708 150.476 133.009 1.00 36.50  ? 54   TYR A N     1 
ATOM   159   C CA    . TYR A 1 19  ? 163.897 149.819 134.022 1.00 36.50  ? 54   TYR A CA    1 
ATOM   160   C C     . TYR A 1 19  ? 163.297 148.508 133.544 1.00 36.50  ? 54   TYR A C     1 
ATOM   161   O O     . TYR A 1 19  ? 162.611 147.844 134.324 1.00 36.50  ? 54   TYR A O     1 
ATOM   162   C CB    . TYR A 1 19  ? 162.793 150.745 134.536 1.00 36.50  ? 54   TYR A CB    1 
ATOM   163   C CG    . TYR A 1 19  ? 163.351 151.919 135.286 1.00 36.50  ? 54   TYR A CG    1 
ATOM   164   C CD1   . TYR A 1 19  ? 163.879 151.766 136.546 1.00 36.50  ? 54   TYR A CD1   1 
ATOM   165   C CD2   . TYR A 1 19  ? 163.334 153.182 134.737 1.00 36.50  ? 54   TYR A CD2   1 
ATOM   166   C CE1   . TYR A 1 19  ? 164.402 152.842 137.229 1.00 36.50  ? 54   TYR A CE1   1 
ATOM   167   C CE2   . TYR A 1 19  ? 163.843 154.257 135.407 1.00 36.50  ? 54   TYR A CE2   1 
ATOM   168   C CZ    . TYR A 1 19  ? 164.376 154.085 136.648 1.00 36.50  ? 54   TYR A CZ    1 
ATOM   169   O OH    . TYR A 1 19  ? 164.888 155.172 137.305 1.00 36.50  ? 54   TYR A OH    1 
ATOM   170   N N     . GLN A 1 20  ? 163.517 148.109 132.300 1.00 35.94  ? 55   GLN A N     1 
ATOM   171   C CA    . GLN A 1 20  ? 163.312 146.703 132.014 1.00 35.94  ? 55   GLN A CA    1 
ATOM   172   C C     . GLN A 1 20  ? 164.608 145.910 132.043 1.00 35.94  ? 55   GLN A C     1 
ATOM   173   O O     . GLN A 1 20  ? 164.558 144.678 132.073 1.00 35.94  ? 55   GLN A O     1 
ATOM   174   C CB    . GLN A 1 20  ? 162.595 146.530 130.679 1.00 35.94  ? 55   GLN A CB    1 
ATOM   175   C CG    . GLN A 1 20  ? 161.119 146.824 130.765 1.00 35.94  ? 55   GLN A CG    1 
ATOM   176   C CD    . GLN A 1 20  ? 160.428 146.679 129.441 1.00 35.94  ? 55   GLN A CD    1 
ATOM   177   O OE1   . GLN A 1 20  ? 161.072 146.524 128.412 1.00 35.94  ? 55   GLN A OE1   1 
ATOM   178   N NE2   . GLN A 1 20  ? 159.106 146.695 129.460 1.00 35.94  ? 55   GLN A NE2   1 
ATOM   179   N N     . LYS A 1 21  ? 165.766 146.573 132.053 1.00 33.74  ? 56   LYS A N     1 
ATOM   180   C CA    . LYS A 1 21  ? 166.995 145.837 132.335 1.00 33.74  ? 56   LYS A CA    1 
ATOM   181   C C     . LYS A 1 21  ? 167.184 145.615 133.828 1.00 33.74  ? 56   LYS A C     1 
ATOM   182   O O     . LYS A 1 21  ? 167.579 144.526 134.249 1.00 33.74  ? 56   LYS A O     1 
ATOM   183   C CB    . LYS A 1 21  ? 168.218 146.552 131.764 1.00 33.74  ? 56   LYS A CB    1 
ATOM   184   C CG    . LYS A 1 21  ? 168.269 146.577 130.256 1.00 33.74  ? 56   LYS A CG    1 
ATOM   185   C CD    . LYS A 1 21  ? 168.260 145.179 129.683 1.00 33.74  ? 56   LYS A CD    1 
ATOM   186   C CE    . LYS A 1 21  ? 169.562 144.462 129.950 1.00 33.74  ? 56   LYS A CE    1 
ATOM   187   N NZ    . LYS A 1 21  ? 169.554 143.119 129.319 1.00 33.74  ? 56   LYS A NZ    1 
ATOM   188   N N     . SER A 1 22  ? 166.919 146.630 134.645 1.00 34.93  ? 57   SER A N     1 
ATOM   189   C CA    . SER A 1 22  ? 167.245 146.519 136.058 1.00 34.93  ? 57   SER A CA    1 
ATOM   190   C C     . SER A 1 22  ? 166.159 145.750 136.805 1.00 34.93  ? 57   SER A C     1 
ATOM   191   O O     . SER A 1 22  ? 165.148 145.335 136.237 1.00 34.93  ? 57   SER A O     1 
ATOM   192   C CB    . SER A 1 22  ? 167.437 147.895 136.670 1.00 34.93  ? 57   SER A CB    1 
ATOM   193   O OG    . SER A 1 22  ? 166.185 148.525 136.830 1.00 34.93  ? 57   SER A OG    1 
ATOM   194   N N     . THR A 1 23  ? 166.376 145.544 138.105 1.00 30.86  ? 58   THR A N     1 
ATOM   195   C CA    . THR A 1 23  ? 165.462 144.700 138.866 1.00 30.86  ? 58   THR A CA    1 
ATOM   196   C C     . THR A 1 23  ? 165.196 145.148 140.301 1.00 30.86  ? 58   THR A C     1 
ATOM   197   O O     . THR A 1 23  ? 164.639 144.357 141.068 1.00 30.86  ? 58   THR A O     1 
ATOM   198   C CB    . THR A 1 23  ? 165.998 143.278 138.884 1.00 30.86  ? 58   THR A CB    1 
ATOM   199   O OG1   . THR A 1 23  ? 165.076 142.435 139.581 1.00 30.86  ? 58   THR A OG1   1 
ATOM   200   C CG2   . THR A 1 23  ? 167.349 143.237 139.574 1.00 30.86  ? 58   THR A CG2   1 
ATOM   201   N N     . GLU A 1 24  ? 165.557 146.358 140.706 1.00 30.79  ? 59   GLU A N     1 
ATOM   202   C CA    . GLU A 1 24  ? 165.467 146.714 142.112 1.00 30.79  ? 59   GLU A CA    1 
ATOM   203   C C     . GLU A 1 24  ? 164.035 147.093 142.474 1.00 30.79  ? 59   GLU A C     1 
ATOM   204   O O     . GLU A 1 24  ? 163.113 146.984 141.666 1.00 30.79  ? 59   GLU A O     1 
ATOM   205   C CB    . GLU A 1 24  ? 166.437 147.854 142.423 1.00 30.79  ? 59   GLU A CB    1 
ATOM   206   C CG    . GLU A 1 24  ? 166.017 149.239 141.910 1.00 30.79  ? 59   GLU A CG    1 
ATOM   207   C CD    . GLU A 1 24  ? 166.400 149.512 140.471 1.00 30.79  ? 59   GLU A CD    1 
ATOM   208   O OE1   . GLU A 1 24  ? 166.721 148.554 139.744 1.00 30.79  ? 59   GLU A OE1   1 
ATOM   209   O OE2   . GLU A 1 24  ? 166.373 150.692 140.066 1.00 30.79  ? 59   GLU A OE2   1 
ATOM   210   N N     . LEU A 1 25  ? 163.842 147.533 143.712 1.00 26.77  ? 60   LEU A N     1 
ATOM   211   C CA    . LEU A 1 25  ? 162.570 148.088 144.137 1.00 26.77  ? 60   LEU A CA    1 
ATOM   212   C C     . LEU A 1 25  ? 162.528 149.574 143.832 1.00 26.77  ? 60   LEU A C     1 
ATOM   213   O O     . LEU A 1 25  ? 163.551 150.259 143.860 1.00 26.77  ? 60   LEU A O     1 
ATOM   214   C CB    . LEU A 1 25  ? 162.360 147.869 145.625 1.00 26.77  ? 60   LEU A CB    1 
ATOM   215   C CG    . LEU A 1 25  ? 162.212 146.406 145.984 1.00 26.77  ? 60   LEU A CG    1 
ATOM   216   C CD1   . LEU A 1 25  ? 162.160 146.253 147.481 1.00 26.77  ? 60   LEU A CD1   1 
ATOM   217   C CD2   . LEU A 1 25  ? 160.958 145.895 145.345 1.00 26.77  ? 60   LEU A CD2   1 
ATOM   218   N N     . LEU A 1 26  ? 161.327 150.077 143.559 1.00 28.39  ? 61   LEU A N     1 
ATOM   219   C CA    . LEU A 1 26  ? 161.194 151.434 143.066 1.00 28.39  ? 61   LEU A CA    1 
ATOM   220   C C     . LEU A 1 26  ? 160.533 152.388 144.039 1.00 28.39  ? 61   LEU A C     1 
ATOM   221   O O     . LEU A 1 26  ? 160.757 153.593 143.931 1.00 28.39  ? 61   LEU A O     1 
ATOM   222   C CB    . LEU A 1 26  ? 160.409 151.436 141.757 1.00 28.39  ? 61   LEU A CB    1 
ATOM   223   C CG    . LEU A 1 26  ? 161.107 150.566 140.724 1.00 28.39  ? 61   LEU A CG    1 
ATOM   224   C CD1   . LEU A 1 26  ? 160.289 150.526 139.475 1.00 28.39  ? 61   LEU A CD1   1 
ATOM   225   C CD2   . LEU A 1 26  ? 162.496 151.076 140.436 1.00 28.39  ? 61   LEU A CD2   1 
ATOM   226   N N     . ILE A 1 27  ? 159.744 151.903 144.975 1.00 29.69  ? 62   ILE A N     1 
ATOM   227   C CA    . ILE A 1 27  ? 159.220 152.742 146.041 1.00 29.69  ? 62   ILE A CA    1 
ATOM   228   C C     . ILE A 1 27  ? 160.207 152.679 147.190 1.00 29.69  ? 62   ILE A C     1 
ATOM   229   O O     . ILE A 1 27  ? 160.706 151.599 147.524 1.00 29.69  ? 62   ILE A O     1 
ATOM   230   C CB    . ILE A 1 27  ? 157.825 152.273 146.474 1.00 29.69  ? 62   ILE A CB    1 
ATOM   231   C CG1   . ILE A 1 27  ? 156.877 152.314 145.286 1.00 29.69  ? 62   ILE A CG1   1 
ATOM   232   C CG2   . ILE A 1 27  ? 157.289 153.147 147.564 1.00 29.69  ? 62   ILE A CG2   1 
ATOM   233   C CD1   . ILE A 1 27  ? 155.563 151.657 145.554 1.00 29.69  ? 62   ILE A CD1   1 
ATOM   234   N N     . ARG A 1 28  ? 160.517 153.825 147.782 1.00 46.22  ? 63   ARG A N     1 
ATOM   235   C CA    . ARG A 1 28  ? 161.550 153.836 148.799 1.00 46.22  ? 63   ARG A CA    1 
ATOM   236   C C     . ARG A 1 28  ? 161.046 153.244 150.110 1.00 46.22  ? 63   ARG A C     1 
ATOM   237   O O     . ARG A 1 28  ? 159.862 153.342 150.467 1.00 46.22  ? 63   ARG A O     1 
ATOM   238   C CB    . ARG A 1 28  ? 162.091 155.243 148.989 1.00 46.22  ? 63   ARG A CB    1 
ATOM   239   C CG    . ARG A 1 28  ? 162.890 155.669 147.784 1.00 46.22  ? 63   ARG A CG    1 
ATOM   240   C CD    . ARG A 1 28  ? 163.633 156.959 148.004 1.00 46.22  ? 63   ARG A CD    1 
ATOM   241   N NE    . ARG A 1 28  ? 162.715 158.036 148.348 1.00 46.22  ? 63   ARG A NE    1 
ATOM   242   C CZ    . ARG A 1 28  ? 162.022 158.745 147.463 1.00 46.22  ? 63   ARG A CZ    1 
ATOM   243   N NH1   . ARG A 1 28  ? 162.125 158.478 146.166 1.00 46.22  ? 63   ARG A NH1   1 
ATOM   244   N NH2   . ARG A 1 28  ? 161.208 159.704 147.880 1.00 46.22  ? 63   ARG A NH2   1 
ATOM   245   N N     . LYS A 1 29  ? 161.985 152.626 150.827 1.00 44.50  ? 64   LYS A N     1 
ATOM   246   C CA    . LYS A 1 29  ? 161.645 151.598 151.799 1.00 44.50  ? 64   LYS A CA    1 
ATOM   247   C C     . LYS A 1 29  ? 161.005 152.193 153.038 1.00 44.50  ? 64   LYS A C     1 
ATOM   248   O O     . LYS A 1 29  ? 159.995 151.684 153.527 1.00 44.50  ? 64   LYS A O     1 
ATOM   249   C CB    . LYS A 1 29  ? 162.894 150.810 152.164 1.00 44.50  ? 64   LYS A CB    1 
ATOM   250   C CG    . LYS A 1 29  ? 163.480 150.054 151.006 1.00 44.50  ? 64   LYS A CG    1 
ATOM   251   C CD    . LYS A 1 29  ? 164.705 149.271 151.421 1.00 44.50  ? 64   LYS A CD    1 
ATOM   252   C CE    . LYS A 1 29  ? 165.190 148.398 150.280 1.00 44.50  ? 64   LYS A CE    1 
ATOM   253   N NZ    . LYS A 1 29  ? 165.670 149.209 149.131 1.00 44.50  ? 64   LYS A NZ    1 
ATOM   254   N N     . LEU A 1 30  ? 161.564 153.267 153.550 1.00 45.31  ? 65   LEU A N     1 
ATOM   255   C CA    . LEU A 1 30  ? 160.991 153.907 154.725 1.00 45.31  ? 65   LEU A CA    1 
ATOM   256   C C     . LEU A 1 30  ? 159.646 154.598 154.466 1.00 45.31  ? 65   LEU A C     1 
ATOM   257   O O     . LEU A 1 30  ? 158.765 154.491 155.336 1.00 45.31  ? 65   LEU A O     1 
ATOM   258   C CB    . LEU A 1 30  ? 162.007 154.873 155.337 1.00 45.31  ? 65   LEU A CB    1 
ATOM   259   C CG    . LEU A 1 30  ? 161.588 155.532 156.643 1.00 45.31  ? 65   LEU A CG    1 
ATOM   260   C CD1   . LEU A 1 30  ? 161.297 154.469 157.663 1.00 45.31  ? 65   LEU A CD1   1 
ATOM   261   C CD2   . LEU A 1 30  ? 162.682 156.427 157.138 1.00 45.31  ? 65   LEU A CD2   1 
ATOM   262   N N     . PRO A 1 31  ? 159.406 155.298 153.333 1.00 44.89  ? 66   PRO A N     1 
ATOM   263   C CA    . PRO A 1 31  ? 158.034 155.770 153.091 1.00 44.89  ? 66   PRO A CA    1 
ATOM   264   C C     . PRO A 1 31  ? 157.020 154.657 152.929 1.00 44.89  ? 66   PRO A C     1 
ATOM   265   O O     . PRO A 1 31  ? 155.903 154.762 153.466 1.00 44.89  ? 66   PRO A O     1 
ATOM   266   C CB    . PRO A 1 31  ? 158.170 156.592 151.808 1.00 44.89  ? 66   PRO A CB    1 
ATOM   267   C CG    . PRO A 1 31  ? 159.510 157.058 151.819 1.00 44.89  ? 66   PRO A CG    1 
ATOM   268   C CD    . PRO A 1 31  ? 160.317 155.954 152.374 1.00 44.89  ? 66   PRO A CD    1 
ATOM   269   N N     . PHE A 1 32  ? 157.387 153.576 152.230 1.00 32.50  ? 67   PHE A N     1 
ATOM   270   C CA    . PHE A 1 32  ? 156.471 152.446 152.121 1.00 32.50  ? 67   PHE A CA    1 
ATOM   271   C C     . PHE A 1 32  ? 156.210 151.794 153.472 1.00 32.50  ? 67   PHE A C     1 
ATOM   272   O O     . PHE A 1 32  ? 155.093 151.333 153.735 1.00 32.50  ? 67   PHE A O     1 
ATOM   273   C CB    . PHE A 1 32  ? 157.020 151.417 151.153 1.00 32.50  ? 67   PHE A CB    1 
ATOM   274   C CG    . PHE A 1 32  ? 156.107 150.268 150.933 1.00 32.50  ? 67   PHE A CG    1 
ATOM   275   C CD1   . PHE A 1 32  ? 155.003 150.397 150.128 1.00 32.50  ? 67   PHE A CD1   1 
ATOM   276   C CD2   . PHE A 1 32  ? 156.348 149.057 151.540 1.00 32.50  ? 67   PHE A CD2   1 
ATOM   277   C CE1   . PHE A 1 32  ? 154.162 149.338 149.929 1.00 32.50  ? 67   PHE A CE1   1 
ATOM   278   C CE2   . PHE A 1 32  ? 155.507 148.004 151.349 1.00 32.50  ? 67   PHE A CE2   1 
ATOM   279   C CZ    . PHE A 1 32  ? 154.416 148.141 150.539 1.00 32.50  ? 67   PHE A CZ    1 
ATOM   280   N N     . GLN A 1 33  ? 157.215 151.766 154.344 1.00 35.14  ? 68   GLN A N     1 
ATOM   281   C CA    . GLN A 1 33  ? 157.038 151.172 155.659 1.00 35.14  ? 68   GLN A CA    1 
ATOM   282   C C     . GLN A 1 33  ? 156.103 152.004 156.527 1.00 35.14  ? 68   GLN A C     1 
ATOM   283   O O     . GLN A 1 33  ? 155.260 151.445 157.242 1.00 35.14  ? 68   GLN A O     1 
ATOM   284   C CB    . GLN A 1 33  ? 158.392 150.999 156.331 1.00 35.14  ? 68   GLN A CB    1 
ATOM   285   C CG    . GLN A 1 33  ? 158.313 150.345 157.670 1.00 35.14  ? 68   GLN A CG    1 
ATOM   286   C CD    . GLN A 1 33  ? 159.667 150.112 158.272 1.00 35.14  ? 68   GLN A CD    1 
ATOM   287   O OE1   . GLN A 1 33  ? 160.681 150.489 157.699 1.00 35.14  ? 68   GLN A OE1   1 
ATOM   288   N NE2   . GLN A 1 33  ? 159.697 149.473 159.432 1.00 35.14  ? 68   GLN A NE2   1 
ATOM   289   N N     . ARG A 1 34  ? 156.218 153.337 156.465 1.00 39.86  ? 69   ARG A N     1 
ATOM   290   C CA    . ARG A 1 34  ? 155.277 154.177 157.206 1.00 39.86  ? 69   ARG A CA    1 
ATOM   291   C C     . ARG A 1 34  ? 153.856 154.029 156.677 1.00 39.86  ? 69   ARG A C     1 
ATOM   292   O O     . ARG A 1 34  ? 152.894 154.049 157.463 1.00 39.86  ? 69   ARG A O     1 
ATOM   293   C CB    . ARG A 1 34  ? 155.705 155.639 157.164 1.00 39.86  ? 69   ARG A CB    1 
ATOM   294   C CG    . ARG A 1 34  ? 156.955 155.933 157.967 1.00 39.86  ? 69   ARG A CG    1 
ATOM   295   C CD    . ARG A 1 34  ? 157.068 157.411 158.292 1.00 39.86  ? 69   ARG A CD    1 
ATOM   296   N NE    . ARG A 1 34  ? 157.235 158.261 157.119 1.00 39.86  ? 69   ARG A NE    1 
ATOM   297   C CZ    . ARG A 1 34  ? 158.412 158.630 156.632 1.00 39.86  ? 69   ARG A CZ    1 
ATOM   298   N NH1   . ARG A 1 34  ? 159.523 158.223 157.221 1.00 39.86  ? 69   ARG A NH1   1 
ATOM   299   N NH2   . ARG A 1 34  ? 158.480 159.416 155.569 1.00 39.86  ? 69   ARG A NH2   1 
ATOM   300   N N     . LEU A 1 35  ? 153.719 153.806 155.366 1.00 36.45  ? 70   LEU A N     1 
ATOM   301   C CA    . LEU A 1 35  ? 152.409 153.530 154.776 1.00 36.45  ? 70   LEU A CA    1 
ATOM   302   C C     . LEU A 1 35  ? 151.793 152.249 155.323 1.00 36.45  ? 70   LEU A C     1 
ATOM   303   O O     . LEU A 1 35  ? 150.617 152.226 155.720 1.00 36.45  ? 70   LEU A O     1 
ATOM   304   C CB    . LEU A 1 35  ? 152.547 153.433 153.265 1.00 36.45  ? 70   LEU A CB    1 
ATOM   305   C CG    . LEU A 1 35  ? 151.273 153.117 152.512 1.00 36.45  ? 70   LEU A CG    1 
ATOM   306   C CD1   . LEU A 1 35  ? 150.260 154.191 152.773 1.00 36.45  ? 70   LEU A CD1   1 
ATOM   307   C CD2   . LEU A 1 35  ? 151.604 153.051 151.052 1.00 36.45  ? 70   LEU A CD2   1 
ATOM   308   N N     . VAL A 1 36  ? 152.577 151.170 155.333 1.00 29.95  ? 71   VAL A N     1 
ATOM   309   C CA    . VAL A 1 36  ? 152.087 149.875 155.789 1.00 29.95  ? 71   VAL A CA    1 
ATOM   310   C C     . VAL A 1 36  ? 151.727 149.921 157.261 1.00 29.95  ? 71   VAL A C     1 
ATOM   311   O O     . VAL A 1 36  ? 150.718 149.346 157.681 1.00 29.95  ? 71   VAL A O     1 
ATOM   312   C CB    . VAL A 1 36  ? 153.145 148.806 155.490 1.00 29.95  ? 71   VAL A CB    1 
ATOM   313   C CG1   . VAL A 1 36  ? 152.830 147.516 156.157 1.00 29.95  ? 71   VAL A CG1   1 
ATOM   314   C CG2   . VAL A 1 36  ? 153.192 148.574 154.022 1.00 29.95  ? 71   VAL A CG2   1 
ATOM   315   N N     . ARG A 1 37  ? 152.500 150.654 158.061 1.00 40.95  ? 72   ARG A N     1 
ATOM   316   C CA    . ARG A 1 37  ? 152.167 150.723 159.477 1.00 40.95  ? 72   ARG A CA    1 
ATOM   317   C C     . ARG A 1 37  ? 150.933 151.580 159.733 1.00 40.95  ? 72   ARG A C     1 
ATOM   318   O O     . ARG A 1 37  ? 150.200 151.303 160.682 1.00 40.95  ? 72   ARG A O     1 
ATOM   319   C CB    . ARG A 1 37  ? 153.364 151.215 160.284 1.00 40.95  ? 72   ARG A CB    1 
ATOM   320   C CG    . ARG A 1 37  ? 154.545 150.266 160.188 1.00 40.95  ? 72   ARG A CG    1 
ATOM   321   C CD    . ARG A 1 37  ? 155.677 150.610 161.121 1.00 40.95  ? 72   ARG A CD    1 
ATOM   322   N NE    . ARG A 1 37  ? 155.305 150.324 162.499 1.00 40.95  ? 72   ARG A NE    1 
ATOM   323   C CZ    . ARG A 1 37  ? 155.062 151.249 163.421 1.00 40.95  ? 72   ARG A CZ    1 
ATOM   324   N NH1   . ARG A 1 37  ? 155.157 152.537 163.119 1.00 40.95  ? 72   ARG A NH1   1 
ATOM   325   N NH2   . ARG A 1 37  ? 154.720 150.887 164.650 1.00 40.95  ? 72   ARG A NH2   1 
ATOM   326   N N     . GLU A 1 38  ? 150.636 152.562 158.872 1.00 44.63  ? 73   GLU A N     1 
ATOM   327   C CA    . GLU A 1 38  ? 149.329 153.224 158.949 1.00 44.63  ? 73   GLU A CA    1 
ATOM   328   C C     . GLU A 1 38  ? 148.183 152.256 158.677 1.00 44.63  ? 73   GLU A C     1 
ATOM   329   O O     . GLU A 1 38  ? 147.219 152.163 159.455 1.00 44.63  ? 73   GLU A O     1 
ATOM   330   C CB    . GLU A 1 38  ? 149.231 154.360 157.944 1.00 44.63  ? 73   GLU A CB    1 
ATOM   331   C CG    . GLU A 1 38  ? 147.840 154.960 157.955 1.00 44.63  ? 73   GLU A CG    1 
ATOM   332   C CD    . GLU A 1 38  ? 147.543 155.807 156.749 1.00 44.63  ? 73   GLU A CD    1 
ATOM   333   O OE1   . GLU A 1 38  ? 148.396 155.880 155.852 1.00 44.63  ? 73   GLU A OE1   1 
ATOM   334   O OE2   . GLU A 1 38  ? 146.440 156.383 156.682 1.00 44.63  ? 73   GLU A OE2   1 
ATOM   335   N N     . ILE A 1 39  ? 148.271 151.534 157.559 1.00 37.60  ? 74   ILE A N     1 
ATOM   336   C CA    . ILE A 1 39  ? 147.158 150.688 157.139 1.00 37.60  ? 74   ILE A CA    1 
ATOM   337   C C     . ILE A 1 39  ? 146.979 149.512 158.099 1.00 37.60  ? 74   ILE A C     1 
ATOM   338   O O     . ILE A 1 39  ? 145.862 149.025 158.298 1.00 37.60  ? 74   ILE A O     1 
ATOM   339   C CB    . ILE A 1 39  ? 147.385 150.257 155.681 1.00 37.60  ? 74   ILE A CB    1 
ATOM   340   C CG1   . ILE A 1 39  ? 147.511 151.486 154.795 1.00 37.60  ? 74   ILE A CG1   1 
ATOM   341   C CG2   . ILE A 1 39  ? 146.229 149.487 155.154 1.00 37.60  ? 74   ILE A CG2   1 
ATOM   342   C CD1   . ILE A 1 39  ? 147.941 151.170 153.396 1.00 37.60  ? 74   ILE A CD1   1 
ATOM   343   N N     . ALA A 1 40  ? 148.044 149.097 158.779 1.00 43.00  ? 75   ALA A N     1 
ATOM   344   C CA    . ALA A 1 40  ? 147.896 148.121 159.850 1.00 43.00  ? 75   ALA A CA    1 
ATOM   345   C C     . ALA A 1 40  ? 147.387 148.756 161.129 1.00 43.00  ? 75   ALA A C     1 
ATOM   346   O O     . ALA A 1 40  ? 146.711 148.088 161.915 1.00 43.00  ? 75   ALA A O     1 
ATOM   347   C CB    . ALA A 1 40  ? 149.222 147.426 160.129 1.00 43.00  ? 75   ALA A CB    1 
ATOM   348   N N     . GLN A 1 41  ? 147.685 150.036 161.353 1.00 46.98  ? 76   GLN A N     1 
ATOM   349   C CA    . GLN A 1 41  ? 147.154 150.755 162.502 1.00 46.98  ? 76   GLN A CA    1 
ATOM   350   C C     . GLN A 1 41  ? 145.645 150.934 162.408 1.00 46.98  ? 76   GLN A C     1 
ATOM   351   O O     . GLN A 1 41  ? 144.998 151.191 163.428 1.00 46.98  ? 76   GLN A O     1 
ATOM   352   C CB    . GLN A 1 41  ? 147.861 152.110 162.604 1.00 46.98  ? 76   GLN A CB    1 
ATOM   353   C CG    . GLN A 1 41  ? 147.656 152.919 163.855 1.00 46.98  ? 76   GLN A CG    1 
ATOM   354   C CD    . GLN A 1 41  ? 148.331 154.263 163.754 1.00 46.98  ? 76   GLN A CD    1 
ATOM   355   O OE1   . GLN A 1 41  ? 148.865 154.617 162.704 1.00 46.98  ? 76   GLN A OE1   1 
ATOM   356   N NE2   . GLN A 1 41  ? 148.320 155.022 164.843 1.00 46.98  ? 76   GLN A NE2   1 
ATOM   357   N N     . ASP A 1 42  ? 145.077 150.804 161.204 1.00 46.42  ? 77   ASP A N     1 
ATOM   358   C CA    . ASP A 1 42  ? 143.621 150.781 161.071 1.00 46.42  ? 77   ASP A CA    1 
ATOM   359   C C     . ASP A 1 42  ? 142.965 149.644 161.852 1.00 46.42  ? 77   ASP A C     1 
ATOM   360   O O     . ASP A 1 42  ? 141.832 149.794 162.316 1.00 46.42  ? 77   ASP A O     1 
ATOM   361   C CB    . ASP A 1 42  ? 143.215 150.669 159.602 1.00 46.42  ? 77   ASP A CB    1 
ATOM   362   C CG    . ASP A 1 42  ? 143.378 151.968 158.843 1.00 46.42  ? 77   ASP A CG    1 
ATOM   363   O OD1   . ASP A 1 42  ? 143.284 153.042 159.472 1.00 46.42  ? 77   ASP A OD1   1 
ATOM   364   O OD2   . ASP A 1 42  ? 143.576 151.915 157.610 1.00 46.42  ? 77   ASP A OD2   1 
ATOM   365   N N     . PHE A 1 43  ? 143.641 148.509 162.016 1.00 41.85  ? 78   PHE A N     1 
ATOM   366   C CA    . PHE A 1 43  ? 142.986 147.313 162.533 1.00 41.85  ? 78   PHE A CA    1 
ATOM   367   C C     . PHE A 1 43  ? 143.370 146.987 163.965 1.00 41.85  ? 78   PHE A C     1 
ATOM   368   O O     . PHE A 1 43  ? 142.531 146.531 164.744 1.00 41.85  ? 78   PHE A O     1 
ATOM   369   C CB    . PHE A 1 43  ? 143.319 146.105 161.659 1.00 41.85  ? 78   PHE A CB    1 
ATOM   370   C CG    . PHE A 1 43  ? 143.023 146.307 160.222 1.00 41.85  ? 78   PHE A CG    1 
ATOM   371   C CD1   . PHE A 1 43  ? 141.729 146.324 159.762 1.00 41.85  ? 78   PHE A CD1   1 
ATOM   372   C CD2   . PHE A 1 43  ? 144.055 146.441 159.321 1.00 41.85  ? 78   PHE A CD2   1 
ATOM   373   C CE1   . PHE A 1 43  ? 141.473 146.499 158.428 1.00 41.85  ? 78   PHE A CE1   1 
ATOM   374   C CE2   . PHE A 1 43  ? 143.807 146.606 157.994 1.00 41.85  ? 78   PHE A CE2   1 
ATOM   375   C CZ    . PHE A 1 43  ? 142.516 146.639 157.543 1.00 41.85  ? 78   PHE A CZ    1 
ATOM   376   N N     . LYS A 1 44  ? 144.631 147.177 164.322 1.00 43.97  ? 79   LYS A N     1 
ATOM   377   C CA    . LYS A 1 44  ? 145.155 146.717 165.593 1.00 43.97  ? 79   LYS A CA    1 
ATOM   378   C C     . LYS A 1 44  ? 146.254 147.686 166.002 1.00 43.97  ? 79   LYS A C     1 
ATOM   379   O O     . LYS A 1 44  ? 146.897 148.298 165.149 1.00 43.97  ? 79   LYS A O     1 
ATOM   380   C CB    . LYS A 1 44  ? 145.651 145.273 165.445 1.00 43.97  ? 79   LYS A CB    1 
ATOM   381   C CG    . LYS A 1 44  ? 146.099 144.570 166.707 1.00 43.97  ? 79   LYS A CG    1 
ATOM   382   C CD    . LYS A 1 44  ? 144.941 144.255 167.625 1.00 43.97  ? 79   LYS A CD    1 
ATOM   383   C CE    . LYS A 1 44  ? 145.380 143.330 168.749 1.00 43.97  ? 79   LYS A CE    1 
ATOM   384   N NZ    . LYS A 1 44  ? 146.380 143.961 169.655 1.00 43.97  ? 79   LYS A NZ    1 
ATOM   385   N N     . THR A 1 45  ? 146.458 147.847 167.305 1.00 49.81  ? 80   THR A N     1 
ATOM   386   C CA    . THR A 1 45  ? 147.314 148.935 167.759 1.00 49.81  ? 80   THR A CA    1 
ATOM   387   C C     . THR A 1 45  ? 148.782 148.545 167.864 1.00 49.81  ? 80   THR A C     1 
ATOM   388   O O     . THR A 1 45  ? 149.641 149.184 167.251 1.00 49.81  ? 80   THR A O     1 
ATOM   389   C CB    . THR A 1 45  ? 146.833 149.441 169.113 1.00 49.81  ? 80   THR A CB    1 
ATOM   390   O OG1   . THR A 1 45  ? 146.924 148.376 170.064 1.00 49.81  ? 80   THR A OG1   1 
ATOM   391   C CG2   . THR A 1 45  ? 145.400 149.912 169.019 1.00 49.81  ? 80   THR A CG2   1 
ATOM   392   N N     . ASP A 1 46  ? 149.093 147.508 168.633 1.00 49.72  ? 81   ASP A N     1 
ATOM   393   C CA    . ASP A 1 46  ? 150.467 147.233 169.047 1.00 49.72  ? 81   ASP A CA    1 
ATOM   394   C C     . ASP A 1 46  ? 151.152 146.210 168.158 1.00 49.72  ? 81   ASP A C     1 
ATOM   395   O O     . ASP A 1 46  ? 151.894 145.357 168.647 1.00 49.72  ? 81   ASP A O     1 
ATOM   396   C CB    . ASP A 1 46  ? 150.495 146.777 170.499 1.00 49.72  ? 81   ASP A CB    1 
ATOM   397   C CG    . ASP A 1 46  ? 150.200 147.905 171.461 1.00 49.72  ? 81   ASP A CG    1 
ATOM   398   O OD1   . ASP A 1 46  ? 150.526 149.064 171.129 1.00 49.72  ? 81   ASP A OD1   1 
ATOM   399   O OD2   . ASP A 1 46  ? 149.641 147.638 172.546 1.00 49.72  ? 81   ASP A OD2   1 
ATOM   400   N N     . LEU A 1 47  ? 150.917 146.263 166.853 1.00 42.12  ? 82   LEU A N     1 
ATOM   401   C CA    . LEU A 1 47  ? 151.495 145.284 165.951 1.00 42.12  ? 82   LEU A CA    1 
ATOM   402   C C     . LEU A 1 47  ? 152.982 145.534 165.752 1.00 42.12  ? 82   LEU A C     1 
ATOM   403   O O     . LEU A 1 47  ? 153.522 146.584 166.101 1.00 42.12  ? 82   LEU A O     1 
ATOM   404   C CB    . LEU A 1 47  ? 150.797 145.329 164.607 1.00 42.12  ? 82   LEU A CB    1 
ATOM   405   C CG    . LEU A 1 47  ? 149.336 144.947 164.673 1.00 42.12  ? 82   LEU A CG    1 
ATOM   406   C CD1   . LEU A 1 47  ? 148.749 145.200 163.327 1.00 42.12  ? 82   LEU A CD1   1 
ATOM   407   C CD2   . LEU A 1 47  ? 149.223 143.497 165.028 1.00 42.12  ? 82   LEU A CD2   1 
ATOM   408   N N     . ARG A 1 48  ? 153.650 144.534 165.193 1.00 46.13  ? 83   ARG A N     1 
ATOM   409   C CA    . ARG A 1 48  ? 155.066 144.597 164.884 1.00 46.13  ? 83   ARG A CA    1 
ATOM   410   C C     . ARG A 1 48  ? 155.259 143.960 163.520 1.00 46.13  ? 83   ARG A C     1 
ATOM   411   O O     . ARG A 1 48  ? 154.357 143.309 162.999 1.00 46.13  ? 83   ARG A O     1 
ATOM   412   C CB    . ARG A 1 48  ? 155.915 143.888 165.945 1.00 46.13  ? 83   ARG A CB    1 
ATOM   413   C CG    . ARG A 1 48  ? 155.842 144.531 167.326 1.00 46.13  ? 83   ARG A CG    1 
ATOM   414   C CD    . ARG A 1 48  ? 156.593 143.765 168.383 1.00 46.13  ? 83   ARG A CD    1 
ATOM   415   N NE    . ARG A 1 48  ? 158.030 143.947 168.296 1.00 46.13  ? 83   ARG A NE    1 
ATOM   416   C CZ    . ARG A 1 48  ? 158.900 143.228 168.991 1.00 46.13  ? 83   ARG A CZ    1 
ATOM   417   N NH1   . ARG A 1 48  ? 158.467 142.274 169.798 1.00 46.13  ? 83   ARG A NH1   1 
ATOM   418   N NH2   . ARG A 1 48  ? 160.198 143.455 168.878 1.00 46.13  ? 83   ARG A NH2   1 
ATOM   419   N N     . PHE A 1 49  ? 156.425 144.169 162.931 1.00 35.41  ? 84   PHE A N     1 
ATOM   420   C CA    . PHE A 1 49  ? 156.639 143.835 161.531 1.00 35.41  ? 84   PHE A CA    1 
ATOM   421   C C     . PHE A 1 49  ? 158.063 143.365 161.330 1.00 35.41  ? 84   PHE A C     1 
ATOM   422   O O     . PHE A 1 49  ? 159.002 144.117 161.595 1.00 35.41  ? 84   PHE A O     1 
ATOM   423   C CB    . PHE A 1 49  ? 156.362 145.044 160.642 1.00 35.41  ? 84   PHE A CB    1 
ATOM   424   C CG    . PHE A 1 49  ? 154.924 145.257 160.335 1.00 35.41  ? 84   PHE A CG    1 
ATOM   425   C CD1   . PHE A 1 49  ? 154.359 144.642 159.248 1.00 35.41  ? 84   PHE A CD1   1 
ATOM   426   C CD2   . PHE A 1 49  ? 154.142 146.064 161.122 1.00 35.41  ? 84   PHE A CD2   1 
ATOM   427   C CE1   . PHE A 1 49  ? 153.046 144.829 158.943 1.00 35.41  ? 84   PHE A CE1   1 
ATOM   428   C CE2   . PHE A 1 49  ? 152.818 146.249 160.822 1.00 35.41  ? 84   PHE A CE2   1 
ATOM   429   C CZ    . PHE A 1 49  ? 152.275 145.620 159.729 1.00 35.41  ? 84   PHE A CZ    1 
ATOM   430   N N     . GLN A 1 50  ? 158.227 142.139 160.863 1.00 33.29  ? 85   GLN A N     1 
ATOM   431   C CA    . GLN A 1 50  ? 159.522 141.744 160.352 1.00 33.29  ? 85   GLN A CA    1 
ATOM   432   C C     . GLN A 1 50  ? 159.849 142.521 159.090 1.00 33.29  ? 85   GLN A C     1 
ATOM   433   O O     . GLN A 1 50  ? 158.966 142.887 158.300 1.00 33.29  ? 85   GLN A O     1 
ATOM   434   C CB    . GLN A 1 50  ? 159.564 140.256 160.048 1.00 33.29  ? 85   GLN A CB    1 
ATOM   435   C CG    . GLN A 1 50  ? 159.495 139.397 161.266 1.00 33.29  ? 85   GLN A CG    1 
ATOM   436   C CD    . GLN A 1 50  ? 159.638 137.931 160.953 1.00 33.29  ? 85   GLN A CD    1 
ATOM   437   O OE1   . GLN A 1 50  ? 159.728 137.532 159.793 1.00 33.29  ? 85   GLN A OE1   1 
ATOM   438   N NE2   . GLN A 1 50  ? 159.671 137.113 161.993 1.00 33.29  ? 85   GLN A NE2   1 
ATOM   439   N N     . SER A 1 51  ? 161.146 142.758 158.899 1.00 37.59  ? 86   SER A N     1 
ATOM   440   C CA    . SER A 1 51  ? 161.619 143.370 157.668 1.00 37.59  ? 86   SER A CA    1 
ATOM   441   C C     . SER A 1 51  ? 161.316 142.495 156.466 1.00 37.59  ? 86   SER A C     1 
ATOM   442   O O     . SER A 1 51  ? 161.076 143.010 155.368 1.00 37.59  ? 86   SER A O     1 
ATOM   443   C CB    . SER A 1 51  ? 163.115 143.629 157.761 1.00 37.59  ? 86   SER A CB    1 
ATOM   444   O OG    . SER A 1 51  ? 163.818 142.402 157.826 1.00 37.59  ? 86   SER A OG    1 
ATOM   445   N N     . SER A 1 52  ? 161.287 141.175 156.662 1.00 33.05  ? 87   SER A N     1 
ATOM   446   C CA    . SER A 1 52  ? 160.835 140.283 155.607 1.00 33.05  ? 87   SER A CA    1 
ATOM   447   C C     . SER A 1 52  ? 159.362 140.488 155.287 1.00 33.05  ? 87   SER A C     1 
ATOM   448   O O     . SER A 1 52  ? 158.971 140.376 154.125 1.00 33.05  ? 87   SER A O     1 
ATOM   449   C CB    . SER A 1 52  ? 161.111 138.839 155.992 1.00 33.05  ? 87   SER A CB    1 
ATOM   450   O OG    . SER A 1 52  ? 160.452 138.515 157.197 1.00 33.05  ? 87   SER A OG    1 
ATOM   451   N N     . ALA A 1 53  ? 158.547 140.870 156.269 1.00 31.37  ? 88   ALA A N     1 
ATOM   452   C CA    . ALA A 1 53  ? 157.137 141.110 155.980 1.00 31.37  ? 88   ALA A CA    1 
ATOM   453   C C     . ALA A 1 53  ? 156.943 142.407 155.219 1.00 31.37  ? 88   ALA A C     1 
ATOM   454   O O     . ALA A 1 53  ? 156.157 142.459 154.261 1.00 31.37  ? 88   ALA A O     1 
ATOM   455   C CB    . ALA A 1 53  ? 156.326 141.137 157.267 1.00 31.37  ? 88   ALA A CB    1 
ATOM   456   N N     . VAL A 1 54  ? 157.654 143.459 155.622 1.00 30.06  ? 89   VAL A N     1 
ATOM   457   C CA    . VAL A 1 54  ? 157.547 144.724 154.902 1.00 30.06  ? 89   VAL A CA    1 
ATOM   458   C C     . VAL A 1 54  ? 158.086 144.595 153.481 1.00 30.06  ? 89   VAL A C     1 
ATOM   459   O O     . VAL A 1 54  ? 157.445 145.053 152.526 1.00 30.06  ? 89   VAL A O     1 
ATOM   460   C CB    . VAL A 1 54  ? 158.234 145.842 155.692 1.00 30.06  ? 89   VAL A CB    1 
ATOM   461   C CG1   . VAL A 1 54  ? 158.447 147.046 154.830 1.00 30.06  ? 89   VAL A CG1   1 
ATOM   462   C CG2   . VAL A 1 54  ? 157.342 146.233 156.833 1.00 30.06  ? 89   VAL A CG2   1 
ATOM   463   N N     . MET A 1 55  ? 159.210 143.905 153.293 1.00 35.42  ? 90   MET A N     1 
ATOM   464   C CA    . MET A 1 55  ? 159.680 143.719 151.930 1.00 35.42  ? 90   MET A CA    1 
ATOM   465   C C     . MET A 1 55  ? 158.812 142.748 151.144 1.00 35.42  ? 90   MET A C     1 
ATOM   466   O O     . MET A 1 55  ? 158.767 142.850 149.916 1.00 35.42  ? 90   MET A O     1 
ATOM   467   C CB    . MET A 1 55  ? 161.126 143.260 151.919 1.00 35.42  ? 90   MET A CB    1 
ATOM   468   C CG    . MET A 1 55  ? 162.057 144.307 152.451 1.00 35.42  ? 90   MET A CG    1 
ATOM   469   S SD    . MET A 1 55  ? 163.782 143.803 152.455 1.00 35.42  ? 90   MET A SD    1 
ATOM   470   C CE    . MET A 1 55  ? 164.147 143.897 150.705 1.00 35.42  ? 90   MET A CE    1 
ATOM   471   N N     . ALA A 1 56  ? 158.071 141.862 151.811 1.00 27.49  ? 91   ALA A N     1 
ATOM   472   C CA    . ALA A 1 56  ? 157.123 141.025 151.086 1.00 27.49  ? 91   ALA A CA    1 
ATOM   473   C C     . ALA A 1 56  ? 155.977 141.846 150.534 1.00 27.49  ? 91   ALA A C     1 
ATOM   474   O O     . ALA A 1 56  ? 155.590 141.676 149.372 1.00 27.49  ? 91   ALA A O     1 
ATOM   475   C CB    . ALA A 1 56  ? 156.595 139.921 151.989 1.00 27.49  ? 91   ALA A CB    1 
ATOM   476   N N     . LEU A 1 57  ? 155.443 142.751 151.351 1.00 21.59  ? 92   LEU A N     1 
ATOM   477   C CA    . LEU A 1 57  ? 154.427 143.677 150.865 1.00 21.59  ? 92   LEU A CA    1 
ATOM   478   C C     . LEU A 1 57  ? 154.955 144.563 149.753 1.00 21.59  ? 92   LEU A C     1 
ATOM   479   O O     . LEU A 1 57  ? 154.227 144.872 148.804 1.00 21.59  ? 92   LEU A O     1 
ATOM   480   C CB    . LEU A 1 57  ? 153.911 144.523 152.010 1.00 21.59  ? 92   LEU A CB    1 
ATOM   481   C CG    . LEU A 1 57  ? 152.965 143.713 152.853 1.00 21.59  ? 92   LEU A CG    1 
ATOM   482   C CD1   . LEU A 1 57  ? 152.671 144.406 154.126 1.00 21.59  ? 92   LEU A CD1   1 
ATOM   483   C CD2   . LEU A 1 57  ? 151.725 143.622 152.038 1.00 21.59  ? 92   LEU A CD2   1 
ATOM   484   N N     . GLN A 1 58  ? 156.225 144.949 149.828 1.00 29.13  ? 93   GLN A N     1 
ATOM   485   C CA    . GLN A 1 58  ? 156.749 145.844 148.811 1.00 29.13  ? 93   GLN A CA    1 
ATOM   486   C C     . GLN A 1 58  ? 156.934 145.127 147.486 1.00 29.13  ? 93   GLN A C     1 
ATOM   487   O O     . GLN A 1 58  ? 156.571 145.672 146.435 1.00 29.13  ? 93   GLN A O     1 
ATOM   488   C CB    . GLN A 1 58  ? 158.045 146.472 149.280 1.00 29.13  ? 93   GLN A CB    1 
ATOM   489   C CG    . GLN A 1 58  ? 158.507 147.577 148.405 1.00 29.13  ? 93   GLN A CG    1 
ATOM   490   C CD    . GLN A 1 58  ? 159.605 148.346 149.048 1.00 29.13  ? 93   GLN A CD    1 
ATOM   491   O OE1   . GLN A 1 58  ? 160.024 148.025 150.151 1.00 29.13  ? 93   GLN A OE1   1 
ATOM   492   N NE2   . GLN A 1 58  ? 160.075 149.382 148.376 1.00 29.13  ? 93   GLN A NE2   1 
ATOM   493   N N     . GLU A 1 59  ? 157.421 143.883 147.521 1.00 25.94  ? 94   GLU A N     1 
ATOM   494   C CA    . GLU A 1 59  ? 157.528 143.098 146.293 1.00 25.94  ? 94   GLU A CA    1 
ATOM   495   C C     . GLU A 1 59  ? 156.158 142.811 145.698 1.00 25.94  ? 94   GLU A C     1 
ATOM   496   O O     . GLU A 1 59  ? 155.969 142.928 144.479 1.00 25.94  ? 94   GLU A O     1 
ATOM   497   C CB    . GLU A 1 59  ? 158.255 141.784 146.547 1.00 25.94  ? 94   GLU A CB    1 
ATOM   498   C CG    . GLU A 1 59  ? 159.714 141.872 146.922 1.00 25.94  ? 94   GLU A CG    1 
ATOM   499   C CD    . GLU A 1 59  ? 160.607 142.342 145.806 1.00 25.94  ? 94   GLU A CD    1 
ATOM   500   O OE1   . GLU A 1 59  ? 160.234 142.192 144.625 1.00 25.94  ? 94   GLU A OE1   1 
ATOM   501   O OE2   . GLU A 1 59  ? 161.725 142.804 146.112 1.00 25.94  ? 94   GLU A OE2   1 
ATOM   502   N N     . ALA A 1 60  ? 155.172 142.519 146.552 1.00 24.98  ? 95   ALA A N     1 
ATOM   503   C CA    . ALA A 1 60  ? 153.847 142.172 146.061 1.00 24.98  ? 95   ALA A CA    1 
ATOM   504   C C     . ALA A 1 60  ? 153.151 143.365 145.430 1.00 24.98  ? 95   ALA A C     1 
ATOM   505   O O     . ALA A 1 60  ? 152.620 143.265 144.319 1.00 24.98  ? 95   ALA A O     1 
ATOM   506   C CB    . ALA A 1 60  ? 153.001 141.612 147.190 1.00 24.98  ? 95   ALA A CB    1 
ATOM   507   N N     . SER A 1 61  ? 153.159 144.512 146.110 1.00 26.17  ? 96   SER A N     1 
ATOM   508   C CA    . SER A 1 61  ? 152.414 145.644 145.585 1.00 26.17  ? 96   SER A CA    1 
ATOM   509   C C     . SER A 1 61  ? 153.121 146.314 144.420 1.00 26.17  ? 96   SER A C     1 
ATOM   510   O O     . SER A 1 61  ? 152.447 146.832 143.523 1.00 26.17  ? 96   SER A O     1 
ATOM   511   C CB    . SER A 1 61  ? 152.145 146.657 146.679 1.00 26.17  ? 96   SER A CB    1 
ATOM   512   O OG    . SER A 1 61  ? 153.342 147.296 147.032 1.00 26.17  ? 96   SER A OG    1 
ATOM   513   N N     . GLU A 1 62  ? 154.454 146.276 144.359 1.00 28.61  ? 97   GLU A N     1 
ATOM   514   C CA    . GLU A 1 62  ? 155.074 146.754 143.136 1.00 28.61  ? 97   GLU A CA    1 
ATOM   515   C C     . GLU A 1 62  ? 154.825 145.820 141.965 1.00 28.61  ? 97   GLU A C     1 
ATOM   516   O O     . GLU A 1 62  ? 154.667 146.300 140.838 1.00 28.61  ? 97   GLU A O     1 
ATOM   517   C CB    . GLU A 1 62  ? 156.559 146.978 143.323 1.00 28.61  ? 97   GLU A CB    1 
ATOM   518   C CG    . GLU A 1 62  ? 156.842 148.170 144.175 1.00 28.61  ? 97   GLU A CG    1 
ATOM   519   C CD    . GLU A 1 62  ? 158.298 148.562 144.140 1.00 28.61  ? 97   GLU A CD    1 
ATOM   520   O OE1   . GLU A 1 62  ? 159.086 147.834 143.507 1.00 28.61  ? 97   GLU A OE1   1 
ATOM   521   O OE2   . GLU A 1 62  ? 158.660 149.610 144.721 1.00 28.61  ? 97   GLU A OE2   1 
ATOM   522   N N     . ALA A 1 63  ? 154.739 144.506 142.192 1.00 27.19  ? 98   ALA A N     1 
ATOM   523   C CA    . ALA A 1 63  ? 154.412 143.642 141.063 1.00 27.19  ? 98   ALA A CA    1 
ATOM   524   C C     . ALA A 1 63  ? 152.974 143.834 140.601 1.00 27.19  ? 98   ALA A C     1 
ATOM   525   O O     . ALA A 1 63  ? 152.705 143.812 139.388 1.00 27.19  ? 98   ALA A O     1 
ATOM   526   C CB    . ALA A 1 63  ? 154.658 142.184 141.418 1.00 27.19  ? 98   ALA A CB    1 
ATOM   527   N N     . TYR A 1 64  ? 152.060 144.065 141.543 1.00 25.56  ? 99   TYR A N     1 
ATOM   528   C CA    . TYR A 1 64  ? 150.682 144.390 141.196 1.00 25.56  ? 99   TYR A CA    1 
ATOM   529   C C     . TYR A 1 64  ? 150.583 145.671 140.379 1.00 25.56  ? 99   TYR A C     1 
ATOM   530   O O     . TYR A 1 64  ? 149.873 145.711 139.366 1.00 25.56  ? 99   TYR A O     1 
ATOM   531   C CB    . TYR A 1 64  ? 149.843 144.514 142.455 1.00 25.56  ? 99   TYR A CB    1 
ATOM   532   C CG    . TYR A 1 64  ? 148.455 144.997 142.181 1.00 25.56  ? 99   TYR A CG    1 
ATOM   533   C CD1   . TYR A 1 64  ? 147.585 144.233 141.432 1.00 25.56  ? 99   TYR A CD1   1 
ATOM   534   C CD2   . TYR A 1 64  ? 147.999 146.186 142.707 1.00 25.56  ? 99   TYR A CD2   1 
ATOM   535   C CE1   . TYR A 1 64  ? 146.311 144.654 141.187 1.00 25.56  ? 99   TYR A CE1   1 
ATOM   536   C CE2   . TYR A 1 64  ? 146.723 146.612 142.474 1.00 25.56  ? 99   TYR A CE2   1 
ATOM   537   C CZ    . TYR A 1 64  ? 145.885 145.843 141.710 1.00 25.56  ? 99   TYR A CZ    1 
ATOM   538   O OH    . TYR A 1 64  ? 144.602 146.263 141.464 1.00 25.56  ? 99   TYR A OH    1 
ATOM   539   N N     . LEU A 1 65  ? 151.316 146.714 140.769 1.00 23.86  ? 100  LEU A N     1 
ATOM   540   C CA    . LEU A 1 65  ? 151.194 147.953 140.016 1.00 23.86  ? 100  LEU A CA    1 
ATOM   541   C C     . LEU A 1 65  ? 151.892 147.907 138.673 1.00 23.86  ? 100  LEU A C     1 
ATOM   542   O O     . LEU A 1 65  ? 151.416 148.544 137.735 1.00 23.86  ? 100  LEU A O     1 
ATOM   543   C CB    . LEU A 1 65  ? 151.699 149.132 140.827 1.00 23.86  ? 100  LEU A CB    1 
ATOM   544   C CG    . LEU A 1 65  ? 150.701 149.431 141.932 1.00 23.86  ? 100  LEU A CG    1 
ATOM   545   C CD1   . LEU A 1 65  ? 151.199 150.557 142.785 1.00 23.86  ? 100  LEU A CD1   1 
ATOM   546   C CD2   . LEU A 1 65  ? 149.368 149.782 141.344 1.00 23.86  ? 100  LEU A CD2   1 
ATOM   547   N N     . VAL A 1 66  ? 152.978 147.152 138.531 1.00 24.10  ? 101  VAL A N     1 
ATOM   548   C CA    . VAL A 1 66  ? 153.576 147.016 137.208 1.00 24.10  ? 101  VAL A CA    1 
ATOM   549   C C     . VAL A 1 66  ? 152.647 146.253 136.265 1.00 24.10  ? 101  VAL A C     1 
ATOM   550   O O     . VAL A 1 66  ? 152.487 146.634 135.095 1.00 24.10  ? 101  VAL A O     1 
ATOM   551   C CB    . VAL A 1 66  ? 154.960 146.367 137.319 1.00 24.10  ? 101  VAL A CB    1 
ATOM   552   C CG1   . VAL A 1 66  ? 155.509 146.041 135.968 1.00 24.10  ? 101  VAL A CG1   1 
ATOM   553   C CG2   . VAL A 1 66  ? 155.894 147.316 137.991 1.00 24.10  ? 101  VAL A CG2   1 
ATOM   554   N N     . ALA A 1 67  ? 151.962 145.218 136.768 1.00 30.20  ? 102  ALA A N     1 
ATOM   555   C CA    . ALA A 1 67  ? 150.995 144.510 135.927 1.00 30.20  ? 102  ALA A CA    1 
ATOM   556   C C     . ALA A 1 67  ? 149.824 145.404 135.539 1.00 30.20  ? 102  ALA A C     1 
ATOM   557   O O     . ALA A 1 67  ? 149.340 145.358 134.395 1.00 30.20  ? 102  ALA A O     1 
ATOM   558   C CB    . ALA A 1 67  ? 150.491 143.268 136.645 1.00 30.20  ? 102  ALA A CB    1 
ATOM   559   N N     . LEU A 1 68  ? 149.390 146.260 136.461 1.00 62.13  ? 103  LEU A N     1 
ATOM   560   C CA    . LEU A 1 68  ? 148.292 147.168 136.166 1.00 62.13  ? 103  LEU A CA    1 
ATOM   561   C C     . LEU A 1 68  ? 148.686 148.203 135.128 1.00 62.13  ? 103  LEU A C     1 
ATOM   562   O O     . LEU A 1 68  ? 147.875 148.557 134.271 1.00 62.13  ? 103  LEU A O     1 
ATOM   563   C CB    . LEU A 1 68  ? 147.844 147.859 137.437 1.00 62.13  ? 103  LEU A CB    1 
ATOM   564   C CG    . LEU A 1 68  ? 146.598 148.701 137.350 1.00 62.13  ? 103  LEU A CG    1 
ATOM   565   C CD1   . LEU A 1 68  ? 145.480 147.774 137.084 1.00 62.13  ? 103  LEU A CD1   1 
ATOM   566   C CD2   . LEU A 1 68  ? 146.405 149.385 138.660 1.00 62.13  ? 103  LEU A CD2   1 
ATOM   567   N N     . PHE A 1 69  ? 149.923 148.699 135.178 1.00 26.85  ? 104  PHE A N     1 
ATOM   568   C CA    . PHE A 1 69  ? 150.319 149.653 134.151 1.00 26.85  ? 104  PHE A CA    1 
ATOM   569   C C     . PHE A 1 69  ? 150.555 148.991 132.804 1.00 26.85  ? 104  PHE A C     1 
ATOM   570   O O     . PHE A 1 69  ? 150.366 149.650 131.779 1.00 26.85  ? 104  PHE A O     1 
ATOM   571   C CB    . PHE A 1 69  ? 151.537 150.470 134.573 1.00 26.85  ? 104  PHE A CB    1 
ATOM   572   C CG    . PHE A 1 69  ? 151.213 151.527 135.577 1.00 26.85  ? 104  PHE A CG    1 
ATOM   573   C CD1   . PHE A 1 69  ? 150.397 152.568 135.231 1.00 26.85  ? 104  PHE A CD1   1 
ATOM   574   C CD2   . PHE A 1 69  ? 151.762 151.514 136.836 1.00 26.85  ? 104  PHE A CD2   1 
ATOM   575   C CE1   . PHE A 1 69  ? 150.092 153.546 136.135 1.00 26.85  ? 104  PHE A CE1   1 
ATOM   576   C CE2   . PHE A 1 69  ? 151.456 152.493 137.747 1.00 26.85  ? 104  PHE A CE2   1 
ATOM   577   C CZ    . PHE A 1 69  ? 150.620 153.505 137.394 1.00 26.85  ? 104  PHE A CZ    1 
ATOM   578   N N     . GLU A 1 70  ? 150.886 147.698 132.764 1.00 29.01  ? 105  GLU A N     1 
ATOM   579   C CA    . GLU A 1 70  ? 150.935 147.019 131.467 1.00 29.01  ? 105  GLU A CA    1 
ATOM   580   C C     . GLU A 1 70  ? 149.550 146.914 130.837 1.00 29.01  ? 105  GLU A C     1 
ATOM   581   O O     . GLU A 1 70  ? 149.371 147.207 129.643 1.00 29.01  ? 105  GLU A O     1 
ATOM   582   C CB    . GLU A 1 70  ? 151.549 145.631 131.600 1.00 29.01  ? 105  GLU A CB    1 
ATOM   583   C CG    . GLU A 1 70  ? 153.030 145.616 131.870 1.00 29.01  ? 105  GLU A CG    1 
ATOM   584   C CD    . GLU A 1 70  ? 153.579 144.205 131.952 1.00 29.01  ? 105  GLU A CD    1 
ATOM   585   O OE1   . GLU A 1 70  ? 152.771 143.258 131.907 1.00 29.01  ? 105  GLU A OE1   1 
ATOM   586   O OE2   . GLU A 1 70  ? 154.812 144.040 132.064 1.00 29.01  ? 105  GLU A OE2   1 
ATOM   587   N N     . ASP A 1 71  ? 148.544 146.550 131.631 1.00 29.50  ? 106  ASP A N     1 
ATOM   588   C CA    . ASP A 1 71  ? 147.207 146.432 131.052 1.00 29.50  ? 106  ASP A CA    1 
ATOM   589   C C     . ASP A 1 71  ? 146.570 147.792 130.774 1.00 29.50  ? 106  ASP A C     1 
ATOM   590   O O     . ASP A 1 71  ? 145.784 147.934 129.825 1.00 29.50  ? 106  ASP A O     1 
ATOM   591   C CB    . ASP A 1 71  ? 146.341 145.591 131.972 1.00 29.50  ? 106  ASP A CB    1 
ATOM   592   C CG    . ASP A 1 71  ? 146.868 144.181 132.111 1.00 29.50  ? 106  ASP A CG    1 
ATOM   593   O OD1   . ASP A 1 71  ? 147.561 143.714 131.183 1.00 29.50  ? 106  ASP A OD1   1 
ATOM   594   O OD2   . ASP A 1 71  ? 146.608 143.533 133.141 1.00 29.50  ? 106  ASP A OD2   1 
ATOM   595   N N     . THR A 1 72  ? 146.931 148.806 131.555 1.00 24.44  ? 107  THR A N     1 
ATOM   596   C CA    . THR A 1 72  ? 146.540 150.174 131.250 1.00 24.44  ? 107  THR A CA    1 
ATOM   597   C C     . THR A 1 72  ? 147.150 150.661 129.941 1.00 24.44  ? 107  THR A C     1 
ATOM   598   O O     . THR A 1 72  ? 146.483 151.355 129.166 1.00 24.44  ? 107  THR A O     1 
ATOM   599   C CB    . THR A 1 72  ? 146.956 151.063 132.403 1.00 24.44  ? 107  THR A CB    1 
ATOM   600   O OG1   . THR A 1 72  ? 146.313 150.604 133.588 1.00 24.44  ? 107  THR A OG1   1 
ATOM   601   C CG2   . THR A 1 72  ? 146.567 152.458 132.170 1.00 24.44  ? 107  THR A CG2   1 
ATOM   602   N N     . ASN A 1 73  ? 148.407 150.302 129.663 1.00 24.21  ? 108  ASN A N     1 
ATOM   603   C CA    . ASN A 1 73  ? 148.993 150.672 128.380 1.00 24.21  ? 108  ASN A CA    1 
ATOM   604   C C     . ASN A 1 73  ? 148.317 149.957 127.225 1.00 24.21  ? 108  ASN A C     1 
ATOM   605   O O     . ASN A 1 73  ? 148.203 150.533 126.139 1.00 24.21  ? 108  ASN A O     1 
ATOM   606   C CB    . ASN A 1 73  ? 150.473 150.361 128.343 1.00 24.21  ? 108  ASN A CB    1 
ATOM   607   C CG    . ASN A 1 73  ? 151.167 151.060 127.225 1.00 24.21  ? 108  ASN A CG    1 
ATOM   608   O OD1   . ASN A 1 73  ? 150.613 151.954 126.601 1.00 24.21  ? 108  ASN A OD1   1 
ATOM   609   N ND2   . ASN A 1 73  ? 152.377 150.626 126.923 1.00 24.21  ? 108  ASN A ND2   1 
ATOM   610   N N     . LEU A 1 74  ? 147.863 148.717 127.432 1.00 22.21  ? 109  LEU A N     1 
ATOM   611   C CA    . LEU A 1 74  ? 147.082 148.056 126.384 1.00 22.21  ? 109  LEU A CA    1 
ATOM   612   C C     . LEU A 1 74  ? 145.783 148.792 126.094 1.00 22.21  ? 109  LEU A C     1 
ATOM   613   O O     . LEU A 1 74  ? 145.434 149.005 124.927 1.00 22.21  ? 109  LEU A O     1 
ATOM   614   C CB    . LEU A 1 74  ? 146.783 146.613 126.750 1.00 22.21  ? 109  LEU A CB    1 
ATOM   615   C CG    . LEU A 1 74  ? 148.003 145.721 126.643 1.00 22.21  ? 109  LEU A CG    1 
ATOM   616   C CD1   . LEU A 1 74  ? 147.665 144.332 127.082 1.00 22.21  ? 109  LEU A CD1   1 
ATOM   617   C CD2   . LEU A 1 74  ? 148.472 145.718 125.215 1.00 22.21  ? 109  LEU A CD2   1 
ATOM   618   N N     . ALA A 1 75  ? 145.069 149.213 127.136 1.00 23.02  ? 110  ALA A N     1 
ATOM   619   C CA    . ALA A 1 75  ? 143.829 149.953 126.901 1.00 23.02  ? 110  ALA A CA    1 
ATOM   620   C C     . ALA A 1 75  ? 144.077 151.319 126.263 1.00 23.02  ? 110  ALA A C     1 
ATOM   621   O O     . ALA A 1 75  ? 143.321 151.741 125.377 1.00 23.02  ? 110  ALA A O     1 
ATOM   622   C CB    . ALA A 1 75  ? 143.061 150.111 128.206 1.00 23.02  ? 110  ALA A CB    1 
ATOM   623   N N     . ALA A 1 76  ? 145.149 152.004 126.649 1.00 19.83  ? 111  ALA A N     1 
ATOM   624   C CA    . ALA A 1 76  ? 145.395 153.323 126.088 1.00 19.83  ? 111  ALA A CA    1 
ATOM   625   C C     . ALA A 1 76  ? 146.118 153.273 124.753 1.00 19.83  ? 111  ALA A C     1 
ATOM   626   O O     . ALA A 1 76  ? 146.344 154.320 124.151 1.00 19.83  ? 111  ALA A O     1 
ATOM   627   C CB    . ALA A 1 76  ? 146.194 154.178 127.059 1.00 19.83  ? 111  ALA A CB    1 
ATOM   628   N N     . ILE A 1 77  ? 146.542 152.100 124.296 1.00 22.08  ? 112  ILE A N     1 
ATOM   629   C CA    . ILE A 1 77  ? 146.827 151.979 122.873 1.00 22.08  ? 112  ILE A CA    1 
ATOM   630   C C     . ILE A 1 77  ? 145.553 151.617 122.132 1.00 22.08  ? 112  ILE A C     1 
ATOM   631   O O     . ILE A 1 77  ? 145.356 152.016 120.977 1.00 22.08  ? 112  ILE A O     1 
ATOM   632   C CB    . ILE A 1 77  ? 147.985 150.986 122.654 1.00 22.08  ? 112  ILE A CB    1 
ATOM   633   C CG1   . ILE A 1 77  ? 149.303 151.661 122.998 1.00 22.08  ? 112  ILE A CG1   1 
ATOM   634   C CG2   . ILE A 1 77  ? 148.069 150.440 121.245 1.00 22.08  ? 112  ILE A CG2   1 
ATOM   635   C CD1   . ILE A 1 77  ? 150.472 150.729 122.953 1.00 22.08  ? 112  ILE A CD1   1 
ATOM   636   N N     . HIS A 1 78  ? 144.632 150.929 122.807 1.00 26.38  ? 113  HIS A N     1 
ATOM   637   C CA    . HIS A 1 78  ? 143.377 150.563 122.163 1.00 26.38  ? 113  HIS A CA    1 
ATOM   638   C C     . HIS A 1 78  ? 142.495 151.769 121.883 1.00 26.38  ? 113  HIS A C     1 
ATOM   639   O O     . HIS A 1 78  ? 141.733 151.761 120.914 1.00 26.38  ? 113  HIS A O     1 
ATOM   640   C CB    . HIS A 1 78  ? 142.619 149.562 123.016 1.00 26.38  ? 113  HIS A CB    1 
ATOM   641   C CG    . HIS A 1 78  ? 141.338 149.126 122.403 1.00 26.38  ? 113  HIS A CG    1 
ATOM   642   N ND1   . HIS A 1 78  ? 141.299 148.309 121.298 1.00 26.38  ? 113  HIS A ND1   1 
ATOM   643   C CD2   . HIS A 1 78  ? 140.054 149.410 122.712 1.00 26.38  ? 113  HIS A CD2   1 
ATOM   644   C CE1   . HIS A 1 78  ? 140.043 148.099 120.957 1.00 26.38  ? 113  HIS A CE1   1 
ATOM   645   N NE2   . HIS A 1 78  ? 139.267 148.759 121.797 1.00 26.38  ? 113  HIS A NE2   1 
ATOM   646   N N     . ALA A 1 79  ? 142.593 152.823 122.685 1.00 28.05  ? 114  ALA A N     1 
ATOM   647   C CA    . ALA A 1 79  ? 141.831 154.027 122.385 1.00 28.05  ? 114  ALA A CA    1 
ATOM   648   C C     . ALA A 1 79  ? 142.563 154.970 121.441 1.00 28.05  ? 114  ALA A C     1 
ATOM   649   O O     . ALA A 1 79  ? 142.258 156.165 121.437 1.00 28.05  ? 114  ALA A O     1 
ATOM   650   C CB    . ALA A 1 79  ? 141.457 154.763 123.670 1.00 28.05  ? 114  ALA A CB    1 
ATOM   651   N N     . LYS A 1 80  ? 143.518 154.455 120.660 1.00 29.72  ? 115  LYS A N     1 
ATOM   652   C CA    . LYS A 1 80  ? 144.305 155.211 119.677 1.00 29.72  ? 115  LYS A CA    1 
ATOM   653   C C     . LYS A 1 80  ? 145.049 156.383 120.310 1.00 29.72  ? 115  LYS A C     1 
ATOM   654   O O     . LYS A 1 80  ? 145.013 157.506 119.819 1.00 29.72  ? 115  LYS A O     1 
ATOM   655   C CB    . LYS A 1 80  ? 143.434 155.678 118.508 1.00 29.72  ? 115  LYS A CB    1 
ATOM   656   C CG    . LYS A 1 80  ? 142.839 154.534 117.707 1.00 29.72  ? 115  LYS A CG    1 
ATOM   657   C CD    . LYS A 1 80  ? 143.938 153.775 116.973 1.00 29.72  ? 115  LYS A CD    1 
ATOM   658   C CE    . LYS A 1 80  ? 143.397 152.572 116.220 1.00 29.72  ? 115  LYS A CE    1 
ATOM   659   N NZ    . LYS A 1 80  ? 142.548 152.976 115.075 1.00 29.72  ? 115  LYS A NZ    1 
ATOM   660   N N     . ARG A 1 81  ? 145.726 156.113 121.421 1.00 28.19  ? 116  ARG A N     1 
ATOM   661   C CA    . ARG A 1 81  ? 146.475 157.137 122.131 1.00 28.19  ? 116  ARG A CA    1 
ATOM   662   C C     . ARG A 1 81  ? 147.823 156.590 122.558 1.00 28.19  ? 116  ARG A C     1 
ATOM   663   O O     . ARG A 1 81  ? 148.212 155.477 122.205 1.00 28.19  ? 116  ARG A O     1 
ATOM   664   C CB    . ARG A 1 81  ? 145.710 157.660 123.346 1.00 28.19  ? 116  ARG A CB    1 
ATOM   665   C CG    . ARG A 1 81  ? 144.633 158.611 122.972 1.00 28.19  ? 116  ARG A CG    1 
ATOM   666   C CD    . ARG A 1 81  ? 143.977 159.217 124.168 1.00 28.19  ? 116  ARG A CD    1 
ATOM   667   N NE    . ARG A 1 81  ? 143.149 158.253 124.857 1.00 28.19  ? 116  ARG A NE    1 
ATOM   668   C CZ    . ARG A 1 81  ? 143.386 157.834 126.083 1.00 28.19  ? 116  ARG A CZ    1 
ATOM   669   N NH1   . ARG A 1 81  ? 144.414 158.316 126.743 1.00 28.19  ? 116  ARG A NH1   1 
ATOM   670   N NH2   . ARG A 1 81  ? 142.587 156.950 126.652 1.00 28.19  ? 116  ARG A NH2   1 
ATOM   671   N N     . VAL A 1 82  ? 148.569 157.421 123.279 1.00 27.12  ? 117  VAL A N     1 
ATOM   672   C CA    . VAL A 1 82  ? 149.768 157.010 123.986 1.00 27.12  ? 117  VAL A CA    1 
ATOM   673   C C     . VAL A 1 82  ? 149.673 157.342 125.467 1.00 27.12  ? 117  VAL A C     1 
ATOM   674   O O     . VAL A 1 82  ? 150.025 156.524 126.323 1.00 27.12  ? 117  VAL A O     1 
ATOM   675   C CB    . VAL A 1 82  ? 151.018 157.659 123.361 1.00 27.12  ? 117  VAL A CB    1 
ATOM   676   C CG1   . VAL A 1 82  ? 152.251 157.290 124.122 1.00 27.12  ? 117  VAL A CG1   1 
ATOM   677   C CG2   . VAL A 1 82  ? 151.174 157.226 121.935 1.00 27.12  ? 117  VAL A CG2   1 
ATOM   678   N N     . THR A 1 83  ? 149.169 158.529 125.780 1.00 28.54  ? 118  THR A N     1 
ATOM   679   C CA    . THR A 1 83  ? 148.974 158.993 127.143 1.00 28.54  ? 118  THR A CA    1 
ATOM   680   C C     . THR A 1 83  ? 147.961 158.137 127.880 1.00 28.54  ? 118  THR A C     1 
ATOM   681   O O     . THR A 1 83  ? 146.830 157.988 127.426 1.00 28.54  ? 118  THR A O     1 
ATOM   682   C CB    . THR A 1 83  ? 148.482 160.433 127.094 1.00 28.54  ? 118  THR A CB    1 
ATOM   683   O OG1   . THR A 1 83  ? 149.506 161.275 126.567 1.00 28.54  ? 118  THR A OG1   1 
ATOM   684   C CG2   . THR A 1 83  ? 148.076 160.917 128.450 1.00 28.54  ? 118  THR A CG2   1 
ATOM   685   N N     . ILE A 1 84  ? 148.357 157.572 129.013 1.00 23.30  ? 119  ILE A N     1 
ATOM   686   C CA    . ILE A 1 84  ? 147.401 156.852 129.837 1.00 23.30  ? 119  ILE A CA    1 
ATOM   687   C C     . ILE A 1 84  ? 146.587 157.844 130.658 1.00 23.30  ? 119  ILE A C     1 
ATOM   688   O O     . ILE A 1 84  ? 146.983 158.981 130.863 1.00 23.30  ? 119  ILE A O     1 
ATOM   689   C CB    . ILE A 1 84  ? 148.104 155.825 130.726 1.00 23.30  ? 119  ILE A CB    1 
ATOM   690   C CG1   . ILE A 1 84  ? 148.991 156.520 131.733 1.00 23.30  ? 119  ILE A CG1   1 
ATOM   691   C CG2   . ILE A 1 84  ? 148.993 154.975 129.888 1.00 23.30  ? 119  ILE A CG2   1 
ATOM   692   C CD1   . ILE A 1 84  ? 149.529 155.605 132.765 1.00 23.30  ? 119  ILE A CD1   1 
ATOM   693   N N     . MET A 1 85  ? 145.412 157.417 131.096 1.00 22.48  ? 120  MET A N     1 
ATOM   694   C CA    . MET A 1 85  ? 144.413 158.311 131.668 1.00 22.48  ? 120  MET A CA    1 
ATOM   695   C C     . MET A 1 85  ? 143.683 157.538 132.755 1.00 22.48  ? 120  MET A C     1 
ATOM   696   O O     . MET A 1 85  ? 143.819 156.315 132.839 1.00 22.48  ? 120  MET A O     1 
ATOM   697   C CB    . MET A 1 85  ? 143.454 158.816 130.579 1.00 22.48  ? 120  MET A CB    1 
ATOM   698   C CG    . MET A 1 85  ? 144.017 159.905 129.684 1.00 22.48  ? 120  MET A CG    1 
ATOM   699   S SD    . MET A 1 85  ? 142.849 160.432 128.438 1.00 22.48  ? 120  MET A SD    1 
ATOM   700   C CE    . MET A 1 85  ? 141.663 161.247 129.487 1.00 22.48  ? 120  MET A CE    1 
ATOM   701   N N     . PRO A 1 86  ? 142.952 158.222 133.652 1.00 21.58  ? 121  PRO A N     1 
ATOM   702   C CA    . PRO A 1 86  ? 142.296 157.477 134.741 1.00 21.58  ? 121  PRO A CA    1 
ATOM   703   C C     . PRO A 1 86  ? 141.184 156.553 134.290 1.00 21.58  ? 121  PRO A C     1 
ATOM   704   O O     . PRO A 1 86  ? 140.923 155.542 134.965 1.00 21.58  ? 121  PRO A O     1 
ATOM   705   C CB    . PRO A 1 86  ? 141.740 158.579 135.638 1.00 21.58  ? 121  PRO A CB    1 
ATOM   706   C CG    . PRO A 1 86  ? 142.540 159.706 135.352 1.00 21.58  ? 121  PRO A CG    1 
ATOM   707   C CD    . PRO A 1 86  ? 142.880 159.665 133.928 1.00 21.58  ? 121  PRO A CD    1 
ATOM   708   N N     . LYS A 1 87  ? 140.533 156.848 133.166 1.00 22.38  ? 122  LYS A N     1 
ATOM   709   C CA    . LYS A 1 87  ? 139.545 155.930 132.625 1.00 22.38  ? 122  LYS A CA    1 
ATOM   710   C C     . LYS A 1 87  ? 140.164 154.614 132.184 1.00 22.38  ? 122  LYS A C     1 
ATOM   711   O O     . LYS A 1 87  ? 139.486 153.592 132.230 1.00 22.38  ? 122  LYS A O     1 
ATOM   712   C CB    . LYS A 1 87  ? 138.802 156.586 131.466 1.00 22.38  ? 122  LYS A CB    1 
ATOM   713   C CG    . LYS A 1 87  ? 139.677 156.895 130.281 1.00 22.38  ? 122  LYS A CG    1 
ATOM   714   C CD    . LYS A 1 87  ? 138.891 157.515 129.158 1.00 22.38  ? 122  LYS A CD    1 
ATOM   715   C CE    . LYS A 1 87  ? 138.590 158.955 129.441 1.00 22.38  ? 122  LYS A CE    1 
ATOM   716   N NZ    . LYS A 1 87  ? 137.985 159.589 128.244 1.00 22.38  ? 122  LYS A NZ    1 
ATOM   717   N N     . ASP A 1 88  ? 141.455 154.601 131.855 1.00 22.68  ? 123  ASP A N     1 
ATOM   718   C CA    . ASP A 1 88  ? 142.125 153.369 131.467 1.00 22.68  ? 123  ASP A CA    1 
ATOM   719   C C     . ASP A 1 88  ? 142.352 152.464 132.666 1.00 22.68  ? 123  ASP A C     1 
ATOM   720   O O     . ASP A 1 88  ? 142.137 151.251 132.581 1.00 22.68  ? 123  ASP A O     1 
ATOM   721   C CB    . ASP A 1 88  ? 143.444 153.710 130.805 1.00 22.68  ? 123  ASP A CB    1 
ATOM   722   C CG    . ASP A 1 88  ? 143.262 154.510 129.564 1.00 22.68  ? 123  ASP A CG    1 
ATOM   723   O OD1   . ASP A 1 88  ? 142.266 154.279 128.880 1.00 22.68  ? 123  ASP A OD1   1 
ATOM   724   O OD2   . ASP A 1 88  ? 144.082 155.402 129.289 1.00 22.68  ? 123  ASP A OD2   1 
ATOM   725   N N     . ILE A 1 89  ? 142.773 153.035 133.792 1.00 25.08  ? 124  ILE A N     1 
ATOM   726   C CA    . ILE A 1 89  ? 142.964 152.247 135.003 1.00 25.08  ? 124  ILE A CA    1 
ATOM   727   C C     . ILE A 1 89  ? 141.632 151.734 135.519 1.00 25.08  ? 124  ILE A C     1 
ATOM   728   O O     . ILE A 1 89  ? 141.517 150.567 135.920 1.00 25.08  ? 124  ILE A O     1 
ATOM   729   C CB    . ILE A 1 89  ? 143.704 153.084 136.057 1.00 25.08  ? 124  ILE A CB    1 
ATOM   730   C CG1   . ILE A 1 89  ? 145.148 153.295 135.647 1.00 25.08  ? 124  ILE A CG1   1 
ATOM   731   C CG2   . ILE A 1 89  ? 143.672 152.439 137.407 1.00 25.08  ? 124  ILE A CG2   1 
ATOM   732   C CD1   . ILE A 1 89  ? 145.853 154.262 136.526 1.00 25.08  ? 124  ILE A CD1   1 
ATOM   733   N N     . GLN A 1 90  ? 140.592 152.571 135.466 1.00 32.80  ? 125  GLN A N     1 
ATOM   734   C CA    . GLN A 1 90  ? 139.274 152.130 135.910 1.00 32.80  ? 125  GLN A CA    1 
ATOM   735   C C     . GLN A 1 90  ? 138.694 151.064 134.988 1.00 32.80  ? 125  GLN A C     1 
ATOM   736   O O     . GLN A 1 90  ? 138.061 150.114 135.457 1.00 32.80  ? 125  GLN A O     1 
ATOM   737   C CB    . GLN A 1 90  ? 138.351 153.330 136.006 1.00 32.80  ? 125  GLN A CB    1 
ATOM   738   C CG    . GLN A 1 90  ? 138.766 154.300 137.084 1.00 32.80  ? 125  GLN A CG    1 
ATOM   739   C CD    . GLN A 1 90  ? 138.003 155.600 137.010 1.00 32.80  ? 125  GLN A CD    1 
ATOM   740   O OE1   . GLN A 1 90  ? 137.154 155.784 136.141 1.00 32.80  ? 125  GLN A OE1   1 
ATOM   741   N NE2   . GLN A 1 90  ? 138.329 156.527 137.898 1.00 32.80  ? 125  GLN A NE2   1 
ATOM   742   N N     . LEU A 1 91  ? 138.961 151.162 133.686 1.00 27.95  ? 126  LEU A N     1 
ATOM   743   C CA    . LEU A 1 91  ? 138.547 150.115 132.764 1.00 27.95  ? 126  LEU A CA    1 
ATOM   744   C C     . LEU A 1 91  ? 139.293 148.813 133.011 1.00 27.95  ? 126  LEU A C     1 
ATOM   745   O O     . LEU A 1 91  ? 138.695 147.734 132.933 1.00 27.95  ? 126  LEU A O     1 
ATOM   746   C CB    . LEU A 1 91  ? 138.761 150.569 131.330 1.00 27.95  ? 126  LEU A CB    1 
ATOM   747   C CG    . LEU A 1 91  ? 138.469 149.523 130.272 1.00 27.95  ? 126  LEU A CG    1 
ATOM   748   C CD1   . LEU A 1 91  ? 137.025 149.149 130.375 1.00 27.95  ? 126  LEU A CD1   1 
ATOM   749   C CD2   . LEU A 1 91  ? 138.777 150.070 128.920 1.00 27.95  ? 126  LEU A CD2   1 
ATOM   750   N N     . ALA A 1 92  ? 140.592 148.881 133.296 1.00 27.82  ? 127  ALA A N     1 
ATOM   751   C CA    . ALA A 1 92  ? 141.338 147.646 133.508 1.00 27.82  ? 127  ALA A CA    1 
ATOM   752   C C     . ALA A 1 92  ? 140.907 146.948 134.790 1.00 27.82  ? 127  ALA A C     1 
ATOM   753   O O     . ALA A 1 92  ? 140.748 145.722 134.810 1.00 27.82  ? 127  ALA A O     1 
ATOM   754   C CB    . ALA A 1 92  ? 142.830 147.925 133.532 1.00 27.82  ? 127  ALA A CB    1 
ATOM   755   N N     . ARG A 1 93  ? 140.638 147.713 135.847 1.00 30.69  ? 128  ARG A N     1 
ATOM   756   C CA    . ARG A 1 93  ? 140.099 147.103 137.058 1.00 30.69  ? 128  ARG A CA    1 
ATOM   757   C C     . ARG A 1 93  ? 138.634 146.717 136.935 1.00 30.69  ? 128  ARG A C     1 
ATOM   758   O O     . ARG A 1 93  ? 138.131 146.001 137.800 1.00 30.69  ? 128  ARG A O     1 
ATOM   759   C CB    . ARG A 1 93  ? 140.276 148.040 138.242 1.00 30.69  ? 128  ARG A CB    1 
ATOM   760   C CG    . ARG A 1 93  ? 141.706 148.215 138.649 1.00 30.69  ? 128  ARG A CG    1 
ATOM   761   C CD    . ARG A 1 93  ? 141.859 149.257 139.726 1.00 30.69  ? 128  ARG A CD    1 
ATOM   762   N NE    . ARG A 1 93  ? 141.222 148.877 140.974 1.00 30.69  ? 128  ARG A NE    1 
ATOM   763   C CZ    . ARG A 1 93  ? 140.168 149.496 141.486 1.00 30.69  ? 128  ARG A CZ    1 
ATOM   764   N NH1   . ARG A 1 93  ? 139.646 150.535 140.858 1.00 30.69  ? 128  ARG A NH1   1 
ATOM   765   N NH2   . ARG A 1 93  ? 139.650 149.090 142.632 1.00 30.69  ? 128  ARG A NH2   1 
ATOM   766   N N     . ARG A 1 94  ? 137.936 147.194 135.912 1.00 43.36  ? 129  ARG A N     1 
ATOM   767   C CA    . ARG A 1 94  ? 136.565 146.778 135.657 1.00 43.36  ? 129  ARG A CA    1 
ATOM   768   C C     . ARG A 1 94  ? 136.487 145.497 134.839 1.00 43.36  ? 129  ARG A C     1 
ATOM   769   O O     . ARG A 1 94  ? 135.614 144.661 135.079 1.00 43.36  ? 129  ARG A O     1 
ATOM   770   C CB    . ARG A 1 94  ? 135.833 147.917 134.952 1.00 43.36  ? 129  ARG A CB    1 
ATOM   771   C CG    . ARG A 1 94  ? 134.450 147.616 134.483 1.00 43.36  ? 129  ARG A CG    1 
ATOM   772   C CD    . ARG A 1 94  ? 133.521 147.279 135.613 1.00 43.36  ? 129  ARG A CD    1 
ATOM   773   N NE    . ARG A 1 94  ? 132.183 147.006 135.099 1.00 43.36  ? 129  ARG A NE    1 
ATOM   774   C CZ    . ARG A 1 94  ? 131.786 145.827 134.625 1.00 43.36  ? 129  ARG A CZ    1 
ATOM   775   N NH1   . ARG A 1 94  ? 132.622 144.797 134.595 1.00 43.36  ? 129  ARG A NH1   1 
ATOM   776   N NH2   . ARG A 1 94  ? 130.548 145.680 134.172 1.00 43.36  ? 129  ARG A NH2   1 
ATOM   777   N N     . ILE A 1 95  ? 137.389 145.326 133.879 1.00 62.13  ? 130  ILE A N     1 
ATOM   778   C CA    . ILE A 1 95  ? 137.432 144.088 133.111 1.00 62.13  ? 130  ILE A CA    1 
ATOM   779   C C     . ILE A 1 95  ? 137.984 142.956 133.959 1.00 62.13  ? 130  ILE A C     1 
ATOM   780   O O     . ILE A 1 95  ? 137.444 141.846 133.958 1.00 62.13  ? 130  ILE A O     1 
ATOM   781   C CB    . ILE A 1 95  ? 138.255 144.286 131.832 1.00 62.13  ? 130  ILE A CB    1 
ATOM   782   C CG1   . ILE A 1 95  ? 137.490 145.176 130.867 1.00 62.13  ? 130  ILE A CG1   1 
ATOM   783   C CG2   . ILE A 1 95  ? 138.555 142.993 131.172 1.00 62.13  ? 130  ILE A CG2   1 
ATOM   784   C CD1   . ILE A 1 95  ? 138.293 145.549 129.670 1.00 62.13  ? 130  ILE A CD1   1 
ATOM   785   N N     . ARG A 1 96  ? 139.050 143.227 134.715 1.00 37.84  ? 131  ARG A N     1 
ATOM   786   C CA    . ARG A 1 96  ? 139.678 142.181 135.515 1.00 37.84  ? 131  ARG A CA    1 
ATOM   787   C C     . ARG A 1 96  ? 138.778 141.709 136.649 1.00 37.84  ? 131  ARG A C     1 
ATOM   788   O O     . ARG A 1 96  ? 138.787 140.525 136.994 1.00 37.84  ? 131  ARG A O     1 
ATOM   789   C CB    . ARG A 1 96  ? 140.995 142.694 136.058 1.00 37.84  ? 131  ARG A CB    1 
ATOM   790   C CG    . ARG A 1 96  ? 141.803 141.684 136.780 1.00 37.84  ? 131  ARG A CG    1 
ATOM   791   C CD    . ARG A 1 96  ? 143.068 142.332 137.248 1.00 37.84  ? 131  ARG A CD    1 
ATOM   792   N NE    . ARG A 1 96  ? 143.875 142.762 136.123 1.00 37.84  ? 131  ARG A NE    1 
ATOM   793   C CZ    . ARG A 1 96  ? 144.943 143.526 136.256 1.00 37.84  ? 131  ARG A CZ    1 
ATOM   794   N NH1   . ARG A 1 96  ? 145.312 143.925 137.459 1.00 37.84  ? 131  ARG A NH1   1 
ATOM   795   N NH2   . ARG A 1 96  ? 145.633 143.885 135.197 1.00 37.84  ? 131  ARG A NH2   1 
ATOM   796   N N     . GLY A 1 97  ? 137.988 142.605 137.224 1.00 43.75  ? 132  GLY A N     1 
ATOM   797   C CA    . GLY A 1 97  ? 136.949 142.195 138.143 1.00 43.75  ? 132  GLY A CA    1 
ATOM   798   C C     . GLY A 1 97  ? 137.083 142.738 139.544 1.00 43.75  ? 132  GLY A C     1 
ATOM   799   O O     . GLY A 1 97  ? 136.384 142.291 140.452 1.00 43.75  ? 132  GLY A O     1 
ATOM   800   N N     . GLU A 1 98  ? 137.951 143.725 139.730 1.00 42.21  ? 133  GLU A N     1 
ATOM   801   C CA    . GLU A 1 98  ? 138.230 144.213 141.070 1.00 42.21  ? 133  GLU A CA    1 
ATOM   802   C C     . GLU A 1 98  ? 137.235 145.273 141.516 1.00 42.21  ? 133  GLU A C     1 
ATOM   803   O O     . GLU A 1 98  ? 137.026 145.452 142.720 1.00 42.21  ? 133  GLU A O     1 
ATOM   804   C CB    . GLU A 1 98  ? 139.642 144.782 141.122 1.00 42.21  ? 133  GLU A CB    1 
ATOM   805   C CG    . GLU A 1 98  ? 140.710 143.791 140.737 1.00 42.21  ? 133  GLU A CG    1 
ATOM   806   C CD    . GLU A 1 98  ? 142.085 144.402 140.750 1.00 42.21  ? 133  GLU A CD    1 
ATOM   807   O OE1   . GLU A 1 98  ? 142.196 145.610 141.042 1.00 42.21  ? 133  GLU A OE1   1 
ATOM   808   O OE2   . GLU A 1 98  ? 143.056 143.689 140.439 1.00 42.21  ? 133  GLU A OE2   1 
ATOM   809   N N     . ARG A 1 99  ? 136.642 146.004 140.574 1.00 56.86  ? 134  ARG A N     1 
ATOM   810   C CA    . ARG A 1 99  ? 135.729 147.099 140.884 1.00 56.86  ? 134  ARG A CA    1 
ATOM   811   C C     . ARG A 1 99  ? 134.265 146.680 140.792 1.00 56.86  ? 134  ARG A C     1 
ATOM   812   O O     . ARG A 1 99  ? 133.546 146.675 141.796 1.00 56.86  ? 134  ARG A O     1 
ATOM   813   C CB    . ARG A 1 99  ? 135.997 148.271 139.931 1.00 56.86  ? 134  ARG A CB    1 
ATOM   814   C CG    . ARG A 1 99  ? 135.212 149.522 140.242 1.00 56.86  ? 134  ARG A CG    1 
ATOM   815   C CD    . ARG A 1 99  ? 135.489 150.607 139.227 1.00 56.86  ? 134  ARG A CD    1 
ATOM   816   N NE    . ARG A 1 99  ? 134.726 151.816 139.520 1.00 56.86  ? 134  ARG A NE    1 
ATOM   817   C CZ    . ARG A 1 99  ? 134.706 152.897 138.747 1.00 56.86  ? 134  ARG A CZ    1 
ATOM   818   N NH1   . ARG A 1 99  ? 135.393 152.918 137.613 1.00 56.86  ? 134  ARG A NH1   1 
ATOM   819   N NH2   . ARG A 1 99  ? 133.988 153.954 139.100 1.00 56.86  ? 134  ARG A NH2   1 
ATOM   820   N N     . ALA A 1 100 ? 133.812 146.318 139.597 1.00 64.44  ? 135  ALA A N     1 
ATOM   821   C CA    . ALA A 1 100 ? 132.410 145.999 139.370 1.00 64.44  ? 135  ALA A CA    1 
ATOM   822   C C     . ALA A 1 100 ? 132.252 144.893 138.332 1.00 64.44  ? 135  ALA A C     1 
ATOM   823   O O     . ALA A 1 100 ? 131.211 144.244 138.252 1.00 64.44  ? 135  ALA A O     1 
ATOM   824   C CB    . ALA A 1 100 ? 131.654 147.237 138.933 1.00 64.44  ? 135  ALA A CB    1 
ATOM   825   O OXT   . ALA A 1 100 ? 133.159 144.622 137.546 1.00 64.44  ? 135  ALA A OXT   1 
ATOM   826   N N     . LYS B 2 6   ? 155.421 163.124 157.745 1.00 99.53  ? 20   LYS B N     1 
ATOM   827   C CA    . LYS B 2 6   ? 155.788 163.840 158.961 1.00 99.53  ? 20   LYS B CA    1 
ATOM   828   C C     . LYS B 2 6   ? 154.835 163.552 160.127 1.00 99.53  ? 20   LYS B C     1 
ATOM   829   O O     . LYS B 2 6   ? 155.238 162.973 161.136 1.00 99.53  ? 20   LYS B O     1 
ATOM   830   C CB    . LYS B 2 6   ? 155.836 165.350 158.697 1.00 99.53  ? 20   LYS B CB    1 
ATOM   831   C CG    . LYS B 2 6   ? 156.906 165.795 157.709 1.00 99.53  ? 20   LYS B CG    1 
ATOM   832   C CD    . LYS B 2 6   ? 156.967 167.314 157.608 1.00 99.53  ? 20   LYS B CD    1 
ATOM   833   C CE    . LYS B 2 6   ? 155.751 167.883 156.903 1.00 99.53  ? 20   LYS B CE    1 
ATOM   834   N NZ    . LYS B 2 6   ? 155.725 167.527 155.463 1.00 99.53  ? 20   LYS B NZ    1 
ATOM   835   N N     . VAL B 2 7   ? 153.575 163.973 159.987 1.00 97.34  ? 21   VAL B N     1 
ATOM   836   C CA    . VAL B 2 7   ? 152.587 163.919 161.064 1.00 97.34  ? 21   VAL B CA    1 
ATOM   837   C C     . VAL B 2 7   ? 151.427 162.983 160.715 1.00 97.34  ? 21   VAL B C     1 
ATOM   838   O O     . VAL B 2 7   ? 150.265 163.295 161.026 1.00 97.34  ? 21   VAL B O     1 
ATOM   839   C CB    . VAL B 2 7   ? 152.071 165.335 161.420 1.00 97.34  ? 21   VAL B CB    1 
ATOM   840   C CG1   . VAL B 2 7   ? 151.604 165.446 162.895 1.00 97.34  ? 21   VAL B CG1   1 
ATOM   841   C CG2   . VAL B 2 7   ? 153.097 166.415 161.097 1.00 97.34  ? 21   VAL B CG2   1 
ATOM   842   N N     . LEU B 2 8   ? 151.702 161.889 159.996 1.00 89.18  ? 22   LEU B N     1 
ATOM   843   C CA    . LEU B 2 8   ? 150.743 160.994 159.338 1.00 89.18  ? 22   LEU B CA    1 
ATOM   844   C C     . LEU B 2 8   ? 149.877 161.712 158.306 1.00 89.18  ? 22   LEU B C     1 
ATOM   845   O O     . LEU B 2 8   ? 148.801 161.214 157.945 1.00 89.18  ? 22   LEU B O     1 
ATOM   846   C CB    . LEU B 2 8   ? 149.840 160.227 160.320 1.00 89.18  ? 22   LEU B CB    1 
ATOM   847   C CG    . LEU B 2 8   ? 150.425 159.126 161.213 1.00 89.18  ? 22   LEU B CG    1 
ATOM   848   C CD1   . LEU B 2 8   ? 149.368 158.592 162.168 1.00 89.18  ? 22   LEU B CD1   1 
ATOM   849   C CD2   . LEU B 2 8   ? 150.993 157.990 160.395 1.00 89.18  ? 22   LEU B CD2   1 
ATOM   850   N N     . ARG B 2 9   ? 150.315 162.875 157.822 1.00 83.90  ? 23   ARG B N     1 
ATOM   851   C CA    . ARG B 2 9   ? 149.659 163.525 156.696 1.00 83.90  ? 23   ARG B CA    1 
ATOM   852   C C     . ARG B 2 9   ? 150.127 162.919 155.385 1.00 83.90  ? 23   ARG B C     1 
ATOM   853   O O     . ARG B 2 9   ? 149.317 162.545 154.530 1.00 83.90  ? 23   ARG B O     1 
ATOM   854   C CB    . ARG B 2 9   ? 149.961 165.023 156.719 1.00 83.90  ? 23   ARG B CB    1 
ATOM   855   C CG    . ARG B 2 9   ? 149.332 165.825 155.596 1.00 83.90  ? 23   ARG B CG    1 
ATOM   856   C CD    . ARG B 2 9   ? 149.745 167.285 155.698 1.00 83.90  ? 23   ARG B CD    1 
ATOM   857   N NE    . ARG B 2 9   ? 149.184 168.103 154.627 1.00 83.90  ? 23   ARG B NE    1 
ATOM   858   C CZ    . ARG B 2 9   ? 149.412 169.405 154.489 1.00 83.90  ? 23   ARG B CZ    1 
ATOM   859   N NH1   . ARG B 2 9   ? 150.198 170.034 155.351 1.00 83.90  ? 23   ARG B NH1   1 
ATOM   860   N NH2   . ARG B 2 9   ? 148.861 170.079 153.488 1.00 83.90  ? 23   ARG B NH2   1 
ATOM   861   N N     . ASP B 2 10  ? 151.442 162.800 155.224 1.00 76.40  ? 24   ASP B N     1 
ATOM   862   C CA    . ASP B 2 10  ? 152.066 162.446 153.955 1.00 76.40  ? 24   ASP B CA    1 
ATOM   863   C C     . ASP B 2 10  ? 152.407 160.966 153.877 1.00 76.40  ? 24   ASP B C     1 
ATOM   864   O O     . ASP B 2 10  ? 153.444 160.600 153.315 1.00 76.40  ? 24   ASP B O     1 
ATOM   865   C CB    . ASP B 2 10  ? 153.312 163.299 153.727 1.00 76.40  ? 24   ASP B CB    1 
ATOM   866   C CG    . ASP B 2 10  ? 152.986 164.761 153.476 1.00 76.40  ? 24   ASP B CG    1 
ATOM   867   O OD1   . ASP B 2 10  ? 151.883 165.057 152.973 1.00 76.40  ? 24   ASP B OD1   1 
ATOM   868   O OD2   . ASP B 2 10  ? 153.842 165.617 153.775 1.00 76.40  ? 24   ASP B OD2   1 
ATOM   869   N N     . ASN B 2 11  ? 151.551 160.095 154.419 1.00 60.25  ? 25   ASN B N     1 
ATOM   870   C CA    . ASN B 2 11  ? 151.811 158.662 154.345 1.00 60.25  ? 25   ASN B CA    1 
ATOM   871   C C     . ASN B 2 11  ? 151.701 158.162 152.917 1.00 60.25  ? 25   ASN B C     1 
ATOM   872   O O     . ASN B 2 11  ? 152.697 157.753 152.313 1.00 60.25  ? 25   ASN B O     1 
ATOM   873   C CB    . ASN B 2 11  ? 150.833 157.898 155.218 1.00 60.25  ? 25   ASN B CB    1 
ATOM   874   C CG    . ASN B 2 11  ? 150.892 158.311 156.640 1.00 60.25  ? 25   ASN B CG    1 
ATOM   875   O OD1   . ASN B 2 11  ? 149.881 158.669 157.223 1.00 60.25  ? 25   ASN B OD1   1 
ATOM   876   N ND2   . ASN B 2 11  ? 152.085 158.304 157.210 1.00 60.25  ? 25   ASN B ND2   1 
ATOM   877   N N     . ILE B 2 12  ? 150.493 158.206 152.353 1.00 46.74  ? 26   ILE B N     1 
ATOM   878   C CA    . ILE B 2 12  ? 150.317 157.770 150.978 1.00 46.74  ? 26   ILE B CA    1 
ATOM   879   C C     . ILE B 2 12  ? 150.907 158.794 150.028 1.00 46.74  ? 26   ILE B C     1 
ATOM   880   O O     . ILE B 2 12  ? 151.323 158.444 148.922 1.00 46.74  ? 26   ILE B O     1 
ATOM   881   C CB    . ILE B 2 12  ? 148.828 157.472 150.709 1.00 46.74  ? 26   ILE B CB    1 
ATOM   882   C CG1   . ILE B 2 12  ? 148.627 156.792 149.360 1.00 46.74  ? 26   ILE B CG1   1 
ATOM   883   C CG2   . ILE B 2 12  ? 147.992 158.719 150.807 1.00 46.74  ? 26   ILE B CG2   1 
ATOM   884   C CD1   . ILE B 2 12  ? 149.270 155.450 149.279 1.00 46.74  ? 26   ILE B CD1   1 
ATOM   885   N N     . GLN B 2 13  ? 151.044 160.044 150.472 1.00 50.73  ? 27   GLN B N     1 
ATOM   886   C CA    . GLN B 2 13  ? 151.757 161.041 149.691 1.00 50.73  ? 27   GLN B CA    1 
ATOM   887   C C     . GLN B 2 13  ? 153.248 160.752 149.624 1.00 50.73  ? 27   GLN B C     1 
ATOM   888   O O     . GLN B 2 13  ? 153.930 161.295 148.752 1.00 50.73  ? 27   GLN B O     1 
ATOM   889   C CB    . GLN B 2 13  ? 151.523 162.425 150.282 1.00 50.73  ? 27   GLN B CB    1 
ATOM   890   C CG    . GLN B 2 13  ? 150.068 162.852 150.300 1.00 50.73  ? 27   GLN B CG    1 
ATOM   891   C CD    . GLN B 2 13  ? 149.480 162.965 148.912 1.00 50.73  ? 27   GLN B CD    1 
ATOM   892   O OE1   . GLN B 2 13  ? 148.598 162.193 148.533 1.00 50.73  ? 27   GLN B OE1   1 
ATOM   893   N NE2   . GLN B 2 13  ? 149.974 163.926 148.138 1.00 50.73  ? 27   GLN B NE2   1 
ATOM   894   N N     . GLY B 2 14  ? 153.765 159.913 150.521 1.00 47.44  ? 28   GLY B N     1 
ATOM   895   C CA    . GLY B 2 14  ? 155.121 159.415 150.412 1.00 47.44  ? 28   GLY B CA    1 
ATOM   896   C C     . GLY B 2 14  ? 155.353 158.467 149.252 1.00 47.44  ? 28   GLY B C     1 
ATOM   897   O O     . GLY B 2 14  ? 156.511 158.195 148.926 1.00 47.44  ? 28   GLY B O     1 
ATOM   898   N N     . ILE B 2 15  ? 154.291 157.944 148.645 1.00 38.90  ? 29   ILE B N     1 
ATOM   899   C CA    . ILE B 2 15  ? 154.406 157.278 147.357 1.00 38.90  ? 29   ILE B CA    1 
ATOM   900   C C     . ILE B 2 15  ? 154.601 158.387 146.342 1.00 38.90  ? 29   ILE B C     1 
ATOM   901   O O     . ILE B 2 15  ? 153.639 159.037 145.927 1.00 38.90  ? 29   ILE B O     1 
ATOM   902   C CB    . ILE B 2 15  ? 153.159 156.447 147.031 1.00 38.90  ? 29   ILE B CB    1 
ATOM   903   C CG1   . ILE B 2 15  ? 152.875 155.474 148.158 1.00 38.90  ? 29   ILE B CG1   1 
ATOM   904   C CG2   . ILE B 2 15  ? 153.334 155.710 145.732 1.00 38.90  ? 29   ILE B CG2   1 
ATOM   905   C CD1   . ILE B 2 15  ? 153.979 154.518 148.396 1.00 38.90  ? 29   ILE B CD1   1 
ATOM   906   N N     . THR B 2 16  ? 155.838 158.624 145.944 1.00 38.79  ? 30   THR B N     1 
ATOM   907   C CA    . THR B 2 16  ? 156.118 159.878 145.277 1.00 38.79  ? 30   THR B CA    1 
ATOM   908   C C     . THR B 2 16  ? 155.757 159.825 143.802 1.00 38.79  ? 30   THR B C     1 
ATOM   909   O O     . THR B 2 16  ? 155.615 158.757 143.199 1.00 38.79  ? 30   THR B O     1 
ATOM   910   C CB    . THR B 2 16  ? 157.586 160.243 145.414 1.00 38.79  ? 30   THR B CB    1 
ATOM   911   O OG1   . THR B 2 16  ? 158.378 159.275 144.721 1.00 38.79  ? 30   THR B OG1   1 
ATOM   912   C CG2   . THR B 2 16  ? 157.986 160.248 146.863 1.00 38.79  ? 30   THR B CG2   1 
ATOM   913   N N     . LYS B 2 17  ? 155.599 161.019 143.239 1.00 33.09  ? 31   LYS B N     1 
ATOM   914   C CA    . LYS B 2 17  ? 155.369 161.181 141.807 1.00 33.09  ? 31   LYS B CA    1 
ATOM   915   C C     . LYS B 2 17  ? 156.444 160.547 140.932 1.00 33.09  ? 31   LYS B C     1 
ATOM   916   O O     . LYS B 2 17  ? 156.073 159.820 139.993 1.00 33.09  ? 31   LYS B O     1 
ATOM   917   C CB    . LYS B 2 17  ? 155.172 162.672 141.517 1.00 33.09  ? 31   LYS B CB    1 
ATOM   918   C CG    . LYS B 2 17  ? 154.885 163.075 140.094 1.00 33.09  ? 31   LYS B CG    1 
ATOM   919   C CD    . LYS B 2 17  ? 154.647 164.584 140.081 1.00 33.09  ? 31   LYS B CD    1 
ATOM   920   C CE    . LYS B 2 17  ? 154.395 165.134 138.700 1.00 33.09  ? 31   LYS B CE    1 
ATOM   921   N NZ    . LYS B 2 17  ? 155.615 165.049 137.860 1.00 33.09  ? 31   LYS B NZ    1 
ATOM   922   N N     . PRO B 2 18  ? 157.755 160.708 141.169 1.00 31.48  ? 32   PRO B N     1 
ATOM   923   C CA    . PRO B 2 18  ? 158.683 159.989 140.294 1.00 31.48  ? 32   PRO B CA    1 
ATOM   924   C C     . PRO B 2 18  ? 158.731 158.499 140.547 1.00 31.48  ? 32   PRO B C     1 
ATOM   925   O O     . PRO B 2 18  ? 159.073 157.764 139.623 1.00 31.48  ? 32   PRO B O     1 
ATOM   926   C CB    . PRO B 2 18  ? 160.029 160.652 140.580 1.00 31.48  ? 32   PRO B CB    1 
ATOM   927   C CG    . PRO B 2 18  ? 159.915 161.125 141.900 1.00 31.48  ? 32   PRO B CG    1 
ATOM   928   C CD    . PRO B 2 18  ? 158.522 161.587 142.069 1.00 31.48  ? 32   PRO B CD    1 
ATOM   929   N N     . ALA B 2 19  ? 158.376 158.013 141.736 1.00 25.16  ? 33   ALA B N     1 
ATOM   930   C CA    . ALA B 2 19  ? 158.336 156.567 141.930 1.00 25.16  ? 33   ALA B CA    1 
ATOM   931   C C     . ALA B 2 19  ? 157.168 155.947 141.179 1.00 25.16  ? 33   ALA B C     1 
ATOM   932   O O     . ALA B 2 19  ? 157.291 154.850 140.621 1.00 25.16  ? 33   ALA B O     1 
ATOM   933   C CB    . ALA B 2 19  ? 158.259 156.227 143.412 1.00 25.16  ? 33   ALA B CB    1 
ATOM   934   N N     . ILE B 2 20  ? 156.039 156.657 141.121 1.00 22.87  ? 34   ILE B N     1 
ATOM   935   C CA    . ILE B 2 20  ? 154.938 156.227 140.263 1.00 22.87  ? 34   ILE B CA    1 
ATOM   936   C C     . ILE B 2 20  ? 155.359 156.275 138.803 1.00 22.87  ? 34   ILE B C     1 
ATOM   937   O O     . ILE B 2 20  ? 155.005 155.395 138.007 1.00 22.87  ? 34   ILE B O     1 
ATOM   938   C CB    . ILE B 2 20  ? 153.696 157.090 140.537 1.00 22.87  ? 34   ILE B CB    1 
ATOM   939   C CG1   . ILE B 2 20  ? 153.207 156.842 141.955 1.00 22.87  ? 34   ILE B CG1   1 
ATOM   940   C CG2   . ILE B 2 20  ? 152.592 156.762 139.608 1.00 22.87  ? 34   ILE B CG2   1 
ATOM   941   C CD1   . ILE B 2 20  ? 152.125 157.772 142.404 1.00 22.87  ? 34   ILE B CD1   1 
ATOM   942   N N     . ARG B 2 21  ? 156.183 157.257 138.445 1.00 29.26  ? 35   ARG B N     1 
ATOM   943   C CA    . ARG B 2 21  ? 156.691 157.303 137.079 1.00 29.26  ? 35   ARG B CA    1 
ATOM   944   C C     . ARG B 2 21  ? 157.632 156.146 136.780 1.00 29.26  ? 35   ARG B C     1 
ATOM   945   O O     . ARG B 2 21  ? 157.603 155.609 135.679 1.00 29.26  ? 35   ARG B O     1 
ATOM   946   C CB    . ARG B 2 21  ? 157.378 158.632 136.803 1.00 29.26  ? 35   ARG B CB    1 
ATOM   947   C CG    . ARG B 2 21  ? 156.418 159.777 136.746 1.00 29.26  ? 35   ARG B CG    1 
ATOM   948   C CD    . ARG B 2 21  ? 157.112 161.099 136.601 1.00 29.26  ? 35   ARG B CD    1 
ATOM   949   N NE    . ARG B 2 21  ? 157.694 161.262 135.284 1.00 29.26  ? 35   ARG B NE    1 
ATOM   950   C CZ    . ARG B 2 21  ? 157.038 161.784 134.258 1.00 29.26  ? 35   ARG B CZ    1 
ATOM   951   N NH1   . ARG B 2 21  ? 155.788 162.186 134.410 1.00 29.26  ? 35   ARG B NH1   1 
ATOM   952   N NH2   . ARG B 2 21  ? 157.628 161.909 133.082 1.00 29.26  ? 35   ARG B NH2   1 
ATOM   953   N N     . ARG B 2 22  ? 158.445 155.724 137.744 1.00 25.42  ? 36   ARG B N     1 
ATOM   954   C CA    . ARG B 2 22  ? 159.358 154.614 137.489 1.00 25.42  ? 36   ARG B CA    1 
ATOM   955   C C     . ARG B 2 22  ? 158.602 153.296 137.374 1.00 25.42  ? 36   ARG B C     1 
ATOM   956   O O     . ARG B 2 22  ? 158.958 152.443 136.552 1.00 25.42  ? 36   ARG B O     1 
ATOM   957   C CB    . ARG B 2 22  ? 160.418 154.533 138.585 1.00 25.42  ? 36   ARG B CB    1 
ATOM   958   C CG    . ARG B 2 22  ? 161.347 155.744 138.637 1.00 25.42  ? 36   ARG B CG    1 
ATOM   959   C CD    . ARG B 2 22  ? 162.556 155.552 139.530 1.00 25.42  ? 36   ARG B CD    1 
ATOM   960   N NE    . ARG B 2 22  ? 162.224 155.197 140.901 1.00 25.42  ? 36   ARG B NE    1 
ATOM   961   C CZ    . ARG B 2 22  ? 161.972 156.075 141.858 1.00 25.42  ? 36   ARG B CZ    1 
ATOM   962   N NH1   . ARG B 2 22  ? 162.001 157.366 141.589 1.00 25.42  ? 36   ARG B NH1   1 
ATOM   963   N NH2   . ARG B 2 22  ? 161.682 155.669 143.081 1.00 25.42  ? 36   ARG B NH2   1 
ATOM   964   N N     . LEU B 2 23  ? 157.540 153.123 138.169 1.00 23.46  ? 37   LEU B N     1 
ATOM   965   C CA    . LEU B 2 23  ? 156.669 151.962 137.985 1.00 23.46  ? 37   LEU B CA    1 
ATOM   966   C C     . LEU B 2 23  ? 156.003 151.985 136.620 1.00 23.46  ? 37   LEU B C     1 
ATOM   967   O O     . LEU B 2 23  ? 155.878 150.948 135.964 1.00 23.46  ? 37   LEU B O     1 
ATOM   968   C CB    . LEU B 2 23  ? 155.592 151.919 139.054 1.00 23.46  ? 37   LEU B CB    1 
ATOM   969   C CG    . LEU B 2 23  ? 155.993 151.716 140.491 1.00 23.46  ? 37   LEU B CG    1 
ATOM   970   C CD1   . LEU B 2 23  ? 154.776 151.802 141.378 1.00 23.46  ? 37   LEU B CD1   1 
ATOM   971   C CD2   . LEU B 2 23  ? 156.660 150.379 140.589 1.00 23.46  ? 37   LEU B CD2   1 
ATOM   972   N N     . ALA B 2 24  ? 155.593 153.163 136.163 1.00 24.91  ? 38   ALA B N     1 
ATOM   973   C CA    . ALA B 2 24  ? 154.962 153.236 134.856 1.00 24.91  ? 38   ALA B CA    1 
ATOM   974   C C     . ALA B 2 24  ? 155.959 153.018 133.729 1.00 24.91  ? 38   ALA B C     1 
ATOM   975   O O     . ALA B 2 24  ? 155.580 152.506 132.673 1.00 24.91  ? 38   ALA B O     1 
ATOM   976   C CB    . ALA B 2 24  ? 154.267 154.575 134.688 1.00 24.91  ? 38   ALA B CB    1 
ATOM   977   N N     . ARG B 2 25  ? 157.224 153.396 133.919 1.00 28.62  ? 39   ARG B N     1 
ATOM   978   C CA    . ARG B 2 25  ? 158.208 153.100 132.888 1.00 28.62  ? 39   ARG B CA    1 
ATOM   979   C C     . ARG B 2 25  ? 158.536 151.627 132.865 1.00 28.62  ? 39   ARG B C     1 
ATOM   980   O O     . ARG B 2 25  ? 158.879 151.093 131.809 1.00 28.62  ? 39   ARG B O     1 
ATOM   981   C CB    . ARG B 2 25  ? 159.503 153.874 133.070 1.00 28.62  ? 39   ARG B CB    1 
ATOM   982   C CG    . ARG B 2 25  ? 159.369 155.352 133.093 1.00 28.62  ? 39   ARG B CG    1 
ATOM   983   C CD    . ARG B 2 25  ? 158.660 155.908 131.912 1.00 28.62  ? 39   ARG B CD    1 
ATOM   984   N NE    . ARG B 2 25  ? 158.752 157.356 131.976 1.00 28.62  ? 39   ARG B NE    1 
ATOM   985   C CZ    . ARG B 2 25  ? 158.133 158.181 131.149 1.00 28.62  ? 39   ARG B CZ    1 
ATOM   986   N NH1   . ARG B 2 25  ? 157.361 157.693 130.195 1.00 28.62  ? 39   ARG B NH1   1 
ATOM   987   N NH2   . ARG B 2 25  ? 158.282 159.488 131.282 1.00 28.62  ? 39   ARG B NH2   1 
ATOM   988   N N     . ARG B 2 26  ? 158.462 150.960 134.009 1.00 22.84  ? 40   ARG B N     1 
ATOM   989   C CA    . ARG B 2 26  ? 158.623 149.518 133.975 1.00 22.84  ? 40   ARG B CA    1 
ATOM   990   C C     . ARG B 2 26  ? 157.426 148.864 133.313 1.00 22.84  ? 40   ARG B C     1 
ATOM   991   O O     . ARG B 2 26  ? 157.569 147.842 132.639 1.00 22.84  ? 40   ARG B O     1 
ATOM   992   C CB    . ARG B 2 26  ? 158.846 148.986 135.383 1.00 22.84  ? 40   ARG B CB    1 
ATOM   993   C CG    . ARG B 2 26  ? 159.225 147.536 135.410 1.00 22.84  ? 40   ARG B CG    1 
ATOM   994   C CD    . ARG B 2 26  ? 159.634 147.053 136.770 1.00 22.84  ? 40   ARG B CD    1 
ATOM   995   N NE    . ARG B 2 26  ? 160.909 147.618 137.172 1.00 22.84  ? 40   ARG B NE    1 
ATOM   996   C CZ    . ARG B 2 26  ? 161.459 147.412 138.356 1.00 22.84  ? 40   ARG B CZ    1 
ATOM   997   N NH1   . ARG B 2 26  ? 160.847 146.647 139.243 1.00 22.84  ? 40   ARG B NH1   1 
ATOM   998   N NH2   . ARG B 2 26  ? 162.624 147.962 138.650 1.00 22.84  ? 40   ARG B NH2   1 
ATOM   999   N N     . GLY B 2 27  ? 156.253 149.469 133.441 1.00 26.83  ? 41   GLY B N     1 
ATOM   1000  C CA    . GLY B 2 27  ? 155.083 148.948 132.768 1.00 26.83  ? 41   GLY B CA    1 
ATOM   1001  C C     . GLY B 2 27  ? 155.073 149.151 131.272 1.00 26.83  ? 41   GLY B C     1 
ATOM   1002  O O     . GLY B 2 27  ? 154.271 148.512 130.587 1.00 26.83  ? 41   GLY B O     1 
ATOM   1003  N N     . GLY B 2 28  ? 155.928 150.016 130.751 1.00 27.02  ? 42   GLY B N     1 
ATOM   1004  C CA    . GLY B 2 28  ? 156.004 150.267 129.329 1.00 27.02  ? 42   GLY B CA    1 
ATOM   1005  C C     . GLY B 2 28  ? 155.415 151.583 128.909 1.00 27.02  ? 42   GLY B C     1 
ATOM   1006  O O     . GLY B 2 28  ? 155.562 151.960 127.743 1.00 27.02  ? 42   GLY B O     1 
ATOM   1007  N N     . VAL B 2 29  ? 154.767 152.291 129.833 1.00 27.91  ? 43   VAL B N     1 
ATOM   1008  C CA    . VAL B 2 29  ? 154.046 153.516 129.525 1.00 27.91  ? 43   VAL B CA    1 
ATOM   1009  C C     . VAL B 2 29  ? 154.999 154.608 129.072 1.00 27.91  ? 43   VAL B C     1 
ATOM   1010  O O     . VAL B 2 29  ? 156.006 154.893 129.728 1.00 27.91  ? 43   VAL B O     1 
ATOM   1011  C CB    . VAL B 2 29  ? 153.252 153.947 130.761 1.00 27.91  ? 43   VAL B CB    1 
ATOM   1012  C CG1   . VAL B 2 29  ? 152.656 155.288 130.567 1.00 27.91  ? 43   VAL B CG1   1 
ATOM   1013  C CG2   . VAL B 2 29  ? 152.183 152.955 131.024 1.00 27.91  ? 43   VAL B CG2   1 
ATOM   1014  N N     . LYS B 2 30  ? 154.689 155.222 127.937 1.00 36.27  ? 44   LYS B N     1 
ATOM   1015  C CA    . LYS B 2 30  ? 155.536 156.277 127.411 1.00 36.27  ? 44   LYS B CA    1 
ATOM   1016  C C     . LYS B 2 30  ? 155.143 157.655 127.928 1.00 36.27  ? 44   LYS B C     1 
ATOM   1017  O O     . LYS B 2 30  ? 156.016 158.506 128.114 1.00 36.27  ? 44   LYS B O     1 
ATOM   1018  C CB    . LYS B 2 30  ? 155.495 156.243 125.884 1.00 36.27  ? 44   LYS B CB    1 
ATOM   1019  C CG    . LYS B 2 30  ? 156.398 157.227 125.192 1.00 36.27  ? 44   LYS B CG    1 
ATOM   1020  C CD    . LYS B 2 30  ? 156.355 157.038 123.695 1.00 36.27  ? 44   LYS B CD    1 
ATOM   1021  C CE    . LYS B 2 30  ? 157.193 158.083 122.981 1.00 36.27  ? 44   LYS B CE    1 
ATOM   1022  N NZ    . LYS B 2 30  ? 157.186 157.873 121.507 1.00 36.27  ? 44   LYS B NZ    1 
ATOM   1023  N N     . ARG B 2 31  ? 153.870 157.895 128.217 1.00 34.79  ? 45   ARG B N     1 
ATOM   1024  C CA    . ARG B 2 31  ? 153.451 159.229 128.618 1.00 34.79  ? 45   ARG B CA    1 
ATOM   1025  C C     . ARG B 2 31  ? 152.277 159.143 129.576 1.00 34.79  ? 45   ARG B C     1 
ATOM   1026  O O     . ARG B 2 31  ? 151.358 158.359 129.363 1.00 34.79  ? 45   ARG B O     1 
ATOM   1027  C CB    . ARG B 2 31  ? 153.114 160.050 127.381 1.00 34.79  ? 45   ARG B CB    1 
ATOM   1028  C CG    . ARG B 2 31  ? 152.616 161.415 127.671 1.00 34.79  ? 45   ARG B CG    1 
ATOM   1029  C CD    . ARG B 2 31  ? 152.624 162.262 126.446 1.00 34.79  ? 45   ARG B CD    1 
ATOM   1030  N NE    . ARG B 2 31  ? 151.940 163.514 126.707 1.00 34.79  ? 45   ARG B NE    1 
ATOM   1031  C CZ    . ARG B 2 31  ? 151.948 164.534 125.871 1.00 34.79  ? 45   ARG B CZ    1 
ATOM   1032  N NH1   . ARG B 2 31  ? 152.634 164.448 124.749 1.00 34.79  ? 45   ARG B NH1   1 
ATOM   1033  N NH2   . ARG B 2 31  ? 151.300 165.643 126.170 1.00 34.79  ? 45   ARG B NH2   1 
ATOM   1034  N N     . ILE B 2 32  ? 152.322 159.939 130.637 1.00 26.34  ? 46   ILE B N     1 
ATOM   1035  C CA    . ILE B 2 32  ? 151.472 159.772 131.806 1.00 26.34  ? 46   ILE B CA    1 
ATOM   1036  C C     . ILE B 2 32  ? 150.655 161.038 132.017 1.00 26.34  ? 46   ILE B C     1 
ATOM   1037  O O     . ILE B 2 32  ? 151.181 162.144 131.893 1.00 26.34  ? 46   ILE B O     1 
ATOM   1038  C CB    . ILE B 2 32  ? 152.338 159.481 133.045 1.00 26.34  ? 46   ILE B CB    1 
ATOM   1039  C CG1   . ILE B 2 32  ? 153.230 158.280 132.797 1.00 26.34  ? 46   ILE B CG1   1 
ATOM   1040  C CG2   . ILE B 2 32  ? 151.507 159.165 134.248 1.00 26.34  ? 46   ILE B CG2   1 
ATOM   1041  C CD1   . ILE B 2 32  ? 154.335 158.183 133.784 1.00 26.34  ? 46   ILE B CD1   1 
ATOM   1042  N N     . SER B 2 33  ? 149.390 160.880 132.384 1.00 24.84  ? 47   SER B N     1 
ATOM   1043  C CA    . SER B 2 33  ? 148.528 161.997 132.743 1.00 24.84  ? 47   SER B CA    1 
ATOM   1044  C C     . SER B 2 33  ? 148.894 162.555 134.110 1.00 24.84  ? 47   SER B C     1 
ATOM   1045  O O     . SER B 2 33  ? 149.914 162.220 134.712 1.00 24.84  ? 47   SER B O     1 
ATOM   1046  C CB    . SER B 2 33  ? 147.073 161.565 132.743 1.00 24.84  ? 47   SER B CB    1 
ATOM   1047  O OG    . SER B 2 33  ? 146.255 162.564 133.302 1.00 24.84  ? 47   SER B OG    1 
ATOM   1048  N N     . GLY B 2 34  ? 148.041 163.437 134.615 1.00 28.11  ? 48   GLY B N     1 
ATOM   1049  C CA    . GLY B 2 34  ? 148.286 164.079 135.884 1.00 28.11  ? 48   GLY B CA    1 
ATOM   1050  C C     . GLY B 2 34  ? 147.406 163.547 136.985 1.00 28.11  ? 48   GLY B C     1 
ATOM   1051  O O     . GLY B 2 34  ? 147.593 163.886 138.152 1.00 28.11  ? 48   GLY B O     1 
ATOM   1052  N N     . LEU B 2 35  ? 146.448 162.700 136.630 1.00 22.97  ? 49   LEU B N     1 
ATOM   1053  C CA    . LEU B 2 35  ? 145.573 162.086 137.612 1.00 22.97  ? 49   LEU B CA    1 
ATOM   1054  C C     . LEU B 2 35  ? 145.806 160.590 137.767 1.00 22.97  ? 49   LEU B C     1 
ATOM   1055  O O     . LEU B 2 35  ? 145.224 159.977 138.676 1.00 22.97  ? 49   LEU B O     1 
ATOM   1056  C CB    . LEU B 2 35  ? 144.117 162.357 137.241 1.00 22.97  ? 49   LEU B CB    1 
ATOM   1057  C CG    . LEU B 2 35  ? 143.797 163.838 137.294 1.00 22.97  ? 49   LEU B CG    1 
ATOM   1058  C CD1   . LEU B 2 35  ? 142.437 164.109 136.705 1.00 22.97  ? 49   LEU B CD1   1 
ATOM   1059  C CD2   . LEU B 2 35  ? 143.844 164.280 138.733 1.00 22.97  ? 49   LEU B CD2   1 
ATOM   1060  N N     . ILE B 2 36  ? 146.652 160.007 136.909 1.00 22.42  ? 50   ILE B N     1 
ATOM   1061  C CA    . ILE B 2 36  ? 147.236 158.683 137.113 1.00 22.42  ? 50   ILE B CA    1 
ATOM   1062  C C     . ILE B 2 36  ? 147.874 158.588 138.482 1.00 22.42  ? 50   ILE B C     1 
ATOM   1063  O O     . ILE B 2 36  ? 147.776 157.562 139.158 1.00 22.42  ? 50   ILE B O     1 
ATOM   1064  C CB    . ILE B 2 36  ? 148.267 158.410 136.009 1.00 22.42  ? 50   ILE B CB    1 
ATOM   1065  C CG1   . ILE B 2 36  ? 147.595 158.395 134.660 1.00 22.42  ? 50   ILE B CG1   1 
ATOM   1066  C CG2   . ILE B 2 36  ? 148.990 157.107 136.210 1.00 22.42  ? 50   ILE B CG2   1 
ATOM   1067  C CD1   . ILE B 2 36  ? 146.636 157.272 134.508 1.00 22.42  ? 50   ILE B CD1   1 
ATOM   1068  N N     . TYR B 2 37  ? 148.495 159.679 138.926 1.00 27.50  ? 51   TYR B N     1 
ATOM   1069  C CA    . TYR B 2 37  ? 149.201 159.711 140.197 1.00 27.50  ? 51   TYR B CA    1 
ATOM   1070  C C     . TYR B 2 37  ? 148.250 159.485 141.363 1.00 27.50  ? 51   TYR B C     1 
ATOM   1071  O O     . TYR B 2 37  ? 148.454 158.576 142.180 1.00 27.50  ? 51   TYR B O     1 
ATOM   1072  C CB    . TYR B 2 37  ? 149.917 161.048 140.315 1.00 27.50  ? 51   TYR B CB    1 
ATOM   1073  C CG    . TYR B 2 37  ? 150.977 161.214 139.267 1.00 27.50  ? 51   TYR B CG    1 
ATOM   1074  C CD1   . TYR B 2 37  ? 151.657 160.122 138.761 1.00 27.50  ? 51   TYR B CD1   1 
ATOM   1075  C CD2   . TYR B 2 37  ? 151.229 162.446 138.712 1.00 27.50  ? 51   TYR B CD2   1 
ATOM   1076  C CE1   . TYR B 2 37  ? 152.600 160.260 137.787 1.00 27.50  ? 51   TYR B CE1   1 
ATOM   1077  C CE2   . TYR B 2 37  ? 152.162 162.591 137.727 1.00 27.50  ? 51   TYR B CE2   1 
ATOM   1078  C CZ    . TYR B 2 37  ? 152.850 161.495 137.276 1.00 27.50  ? 51   TYR B CZ    1 
ATOM   1079  O OH    . TYR B 2 37  ? 153.790 161.641 136.290 1.00 27.50  ? 51   TYR B OH    1 
ATOM   1080  N N     . GLU B 2 38  ? 147.156 160.234 141.403 1.00 27.83  ? 52   GLU B N     1 
ATOM   1081  C CA    . GLU B 2 38  ? 146.232 160.088 142.515 1.00 27.83  ? 52   GLU B CA    1 
ATOM   1082  C C     . GLU B 2 38  ? 145.421 158.807 142.421 1.00 27.83  ? 52   GLU B C     1 
ATOM   1083  O O     . GLU B 2 38  ? 145.143 158.172 143.447 1.00 27.83  ? 52   GLU B O     1 
ATOM   1084  C CB    . GLU B 2 38  ? 145.300 161.284 142.576 1.00 27.83  ? 52   GLU B CB    1 
ATOM   1085  C CG    . GLU B 2 38  ? 144.489 161.323 143.831 1.00 27.83  ? 52   GLU B CG    1 
ATOM   1086  C CD    . GLU B 2 38  ? 145.340 161.602 145.048 1.00 27.83  ? 52   GLU B CD    1 
ATOM   1087  O OE1   . GLU B 2 38  ? 146.374 162.296 144.917 1.00 27.83  ? 52   GLU B OE1   1 
ATOM   1088  O OE2   . GLU B 2 38  ? 144.982 161.123 146.141 1.00 27.83  ? 52   GLU B OE2   1 
ATOM   1089  N N     . GLU B 2 39  ? 145.081 158.383 141.207 1.00 25.85  ? 53   GLU B N     1 
ATOM   1090  C CA    . GLU B 2 39  ? 144.339 157.137 141.073 1.00 25.85  ? 53   GLU B CA    1 
ATOM   1091  C C     . GLU B 2 39  ? 145.192 155.933 141.455 1.00 25.85  ? 53   GLU B C     1 
ATOM   1092  O O     . GLU B 2 39  ? 144.698 155.008 142.104 1.00 25.85  ? 53   GLU B O     1 
ATOM   1093  C CB    . GLU B 2 39  ? 143.802 157.001 139.654 1.00 25.85  ? 53   GLU B CB    1 
ATOM   1094  C CG    . GLU B 2 39  ? 143.018 155.732 139.414 1.00 25.85  ? 53   GLU B CG    1 
ATOM   1095  C CD    . GLU B 2 39  ? 141.748 155.650 140.239 1.00 25.85  ? 53   GLU B CD    1 
ATOM   1096  O OE1   . GLU B 2 39  ? 141.160 156.704 140.564 1.00 25.85  ? 53   GLU B OE1   1 
ATOM   1097  O OE2   . GLU B 2 39  ? 141.331 154.521 140.570 1.00 25.85  ? 53   GLU B OE2   1 
ATOM   1098  N N     . THR B 2 40  ? 146.481 155.950 141.108 1.00 23.79  ? 54   THR B N     1 
ATOM   1099  C CA    . THR B 2 40  ? 147.391 154.880 141.489 1.00 23.79  ? 54   THR B CA    1 
ATOM   1100  C C     . THR B 2 40  ? 147.624 154.861 142.991 1.00 23.79  ? 54   THR B C     1 
ATOM   1101  O O     . THR B 2 40  ? 147.713 153.782 143.587 1.00 23.79  ? 54   THR B O     1 
ATOM   1102  C CB    . THR B 2 40  ? 148.690 155.048 140.715 1.00 23.79  ? 54   THR B CB    1 
ATOM   1103  O OG1   . THR B 2 40  ? 148.412 154.895 139.326 1.00 23.79  ? 54   THR B OG1   1 
ATOM   1104  C CG2   . THR B 2 40  ? 149.699 154.029 141.095 1.00 23.79  ? 54   THR B CG2   1 
ATOM   1105  N N     . ARG B 2 41  ? 147.659 156.037 143.624 1.00 27.38  ? 55   ARG B N     1 
ATOM   1106  C CA    . ARG B 2 41  ? 147.683 156.093 145.084 1.00 27.38  ? 55   ARG B CA    1 
ATOM   1107  C C     . ARG B 2 41  ? 146.445 155.448 145.701 1.00 27.38  ? 55   ARG B C     1 
ATOM   1108  O O     . ARG B 2 41  ? 146.554 154.678 146.666 1.00 27.38  ? 55   ARG B O     1 
ATOM   1109  C CB    . ARG B 2 41  ? 147.805 157.539 145.548 1.00 27.38  ? 55   ARG B CB    1 
ATOM   1110  C CG    . ARG B 2 41  ? 149.171 158.173 145.378 1.00 27.38  ? 55   ARG B CG    1 
ATOM   1111  C CD    . ARG B 2 41  ? 149.111 159.598 145.875 1.00 27.38  ? 55   ARG B CD    1 
ATOM   1112  N NE    . ARG B 2 41  ? 150.422 160.214 146.010 1.00 27.38  ? 55   ARG B NE    1 
ATOM   1113  C CZ    . ARG B 2 41  ? 151.039 160.886 145.052 1.00 27.38  ? 55   ARG B CZ    1 
ATOM   1114  N NH1   . ARG B 2 41  ? 150.476 161.018 143.867 1.00 27.38  ? 55   ARG B NH1   1 
ATOM   1115  N NH2   . ARG B 2 41  ? 152.228 161.414 145.277 1.00 27.38  ? 55   ARG B NH2   1 
ATOM   1116  N N     . GLY B 2 42  ? 145.269 155.707 145.131 1.00 22.08  ? 56   GLY B N     1 
ATOM   1117  C CA    . GLY B 2 42  ? 144.058 155.076 145.644 1.00 22.08  ? 56   GLY B CA    1 
ATOM   1118  C C     . GLY B 2 42  ? 144.025 153.568 145.441 1.00 22.08  ? 56   GLY B C     1 
ATOM   1119  O O     . GLY B 2 42  ? 143.604 152.816 146.334 1.00 22.08  ? 56   GLY B O     1 
ATOM   1120  N N     . VAL B 2 43  ? 144.494 153.109 144.279 1.00 21.83  ? 57   VAL B N     1 
ATOM   1121  C CA    . VAL B 2 43  ? 144.543 151.682 143.965 1.00 21.83  ? 57   VAL B CA    1 
ATOM   1122  C C     . VAL B 2 43  ? 145.475 150.946 144.920 1.00 21.83  ? 57   VAL B C     1 
ATOM   1123  O O     . VAL B 2 43  ? 145.130 149.888 145.473 1.00 21.83  ? 57   VAL B O     1 
ATOM   1124  C CB    . VAL B 2 43  ? 144.970 151.493 142.503 1.00 21.83  ? 57   VAL B CB    1 
ATOM   1125  C CG1   . VAL B 2 43  ? 145.322 150.081 142.237 1.00 21.83  ? 57   VAL B CG1   1 
ATOM   1126  C CG2   . VAL B 2 43  ? 143.840 151.872 141.609 1.00 21.83  ? 57   VAL B CG2   1 
ATOM   1127  N N     . LEU B 2 44  ? 146.659 151.517 145.147 1.00 16.07  ? 58   LEU B N     1 
ATOM   1128  C CA    . LEU B 2 44  ? 147.639 150.921 146.045 1.00 16.07  ? 58   LEU B CA    1 
ATOM   1129  C C     . LEU B 2 44  ? 147.122 150.853 147.467 1.00 16.07  ? 58   LEU B C     1 
ATOM   1130  O O     . LEU B 2 44  ? 147.347 149.859 148.167 1.00 16.07  ? 58   LEU B O     1 
ATOM   1131  C CB    . LEU B 2 44  ? 148.920 151.736 145.994 1.00 16.07  ? 58   LEU B CB    1 
ATOM   1132  C CG    . LEU B 2 44  ? 150.071 151.256 146.844 1.00 16.07  ? 58   LEU B CG    1 
ATOM   1133  C CD1   . LEU B 2 44  ? 150.441 149.898 146.391 1.00 16.07  ? 58   LEU B CD1   1 
ATOM   1134  C CD2   . LEU B 2 44  ? 151.232 152.192 146.680 1.00 16.07  ? 58   LEU B CD2   1 
ATOM   1135  N N     . LYS B 2 45  ? 146.401 151.889 147.902 1.00 19.52  ? 59   LYS B N     1 
ATOM   1136  C CA    . LYS B 2 45  ? 145.876 151.868 149.260 1.00 19.52  ? 59   LYS B CA    1 
ATOM   1137  C C     . LYS B 2 45  ? 144.803 150.802 149.440 1.00 19.52  ? 59   LYS B C     1 
ATOM   1138  O O     . LYS B 2 45  ? 144.771 150.129 150.475 1.00 19.52  ? 59   LYS B O     1 
ATOM   1139  C CB    . LYS B 2 45  ? 145.329 153.230 149.651 1.00 19.52  ? 59   LYS B CB    1 
ATOM   1140  C CG    . LYS B 2 45  ? 144.924 153.268 151.098 1.00 19.52  ? 59   LYS B CG    1 
ATOM   1141  C CD    . LYS B 2 45  ? 144.360 154.589 151.517 1.00 19.52  ? 59   LYS B CD    1 
ATOM   1142  C CE    . LYS B 2 45  ? 144.006 154.553 152.981 1.00 19.52  ? 59   LYS B CE    1 
ATOM   1143  N NZ    . LYS B 2 45  ? 142.880 153.619 153.214 1.00 19.52  ? 59   LYS B NZ    1 
ATOM   1144  N N     . VAL B 2 46  ? 143.936 150.603 148.445 1.00 21.15  ? 60   VAL B N     1 
ATOM   1145  C CA    . VAL B 2 46  ? 142.904 149.575 148.600 1.00 21.15  ? 60   VAL B CA    1 
ATOM   1146  C C     . VAL B 2 46  ? 143.516 148.174 148.605 1.00 21.15  ? 60   VAL B C     1 
ATOM   1147  O O     . VAL B 2 46  ? 143.134 147.316 149.425 1.00 21.15  ? 60   VAL B O     1 
ATOM   1148  C CB    . VAL B 2 46  ? 141.837 149.734 147.510 1.00 21.15  ? 60   VAL B CB    1 
ATOM   1149  C CG1   . VAL B 2 46  ? 140.838 148.621 147.578 1.00 21.15  ? 60   VAL B CG1   1 
ATOM   1150  C CG2   . VAL B 2 46  ? 141.133 151.048 147.688 1.00 21.15  ? 60   VAL B CG2   1 
ATOM   1151  N N     . PHE B 2 47  ? 144.509 147.937 147.737 1.00 14.69  ? 61   PHE B N     1 
ATOM   1152  C CA    . PHE B 2 47  ? 145.176 146.635 147.715 1.00 14.69  ? 61   PHE B CA    1 
ATOM   1153  C C     . PHE B 2 47  ? 145.894 146.338 149.024 1.00 14.69  ? 61   PHE B C     1 
ATOM   1154  O O     . PHE B 2 47  ? 145.814 145.214 149.547 1.00 14.69  ? 61   PHE B O     1 
ATOM   1155  C CB    . PHE B 2 47  ? 146.151 146.564 146.550 1.00 14.69  ? 61   PHE B CB    1 
ATOM   1156  C CG    . PHE B 2 47  ? 146.960 145.316 146.525 1.00 14.69  ? 61   PHE B CG    1 
ATOM   1157  C CD1   . PHE B 2 47  ? 146.358 144.102 146.332 1.00 14.69  ? 61   PHE B CD1   1 
ATOM   1158  C CD2   . PHE B 2 47  ? 148.328 145.362 146.645 1.00 14.69  ? 61   PHE B CD2   1 
ATOM   1159  C CE1   . PHE B 2 47  ? 147.102 142.954 146.298 1.00 14.69  ? 61   PHE B CE1   1 
ATOM   1160  C CE2   . PHE B 2 47  ? 149.076 144.218 146.606 1.00 14.69  ? 61   PHE B CE2   1 
ATOM   1161  C CZ    . PHE B 2 47  ? 148.461 143.017 146.434 1.00 14.69  ? 61   PHE B CZ    1 
ATOM   1162  N N     . LEU B 2 48  ? 146.554 147.338 149.602 1.00 25.43  ? 62   LEU B N     1 
ATOM   1163  C CA    . LEU B 2 48  ? 147.206 147.076 150.873 1.00 25.43  ? 62   LEU B CA    1 
ATOM   1164  C C     . LEU B 2 48  ? 146.220 146.946 152.015 1.00 25.43  ? 62   LEU B C     1 
ATOM   1165  O O     . LEU B 2 48  ? 146.527 146.230 152.970 1.00 25.43  ? 62   LEU B O     1 
ATOM   1166  C CB    . LEU B 2 48  ? 148.226 148.146 151.207 1.00 25.43  ? 62   LEU B CB    1 
ATOM   1167  C CG    . LEU B 2 48  ? 149.435 148.050 150.308 1.00 25.43  ? 62   LEU B CG    1 
ATOM   1168  C CD1   . LEU B 2 48  ? 150.382 149.175 150.601 1.00 25.43  ? 62   LEU B CD1   1 
ATOM   1169  C CD2   . LEU B 2 48  ? 150.110 146.726 150.493 1.00 25.43  ? 62   LEU B CD2   1 
ATOM   1170  N N     . GLU B 2 49  ? 145.058 147.620 151.960 1.00 26.89  ? 63   GLU B N     1 
ATOM   1171  C CA    . GLU B 2 49  ? 144.046 147.382 152.990 1.00 26.89  ? 63   GLU B CA    1 
ATOM   1172  C C     . GLU B 2 49  ? 143.612 145.933 152.992 1.00 26.89  ? 63   GLU B C     1 
ATOM   1173  O O     . GLU B 2 49  ? 143.524 145.316 154.058 1.00 26.89  ? 63   GLU B O     1 
ATOM   1174  C CB    . GLU B 2 49  ? 142.809 148.253 152.817 1.00 26.89  ? 63   GLU B CB    1 
ATOM   1175  C CG    . GLU B 2 49  ? 142.937 149.709 153.154 1.00 26.89  ? 63   GLU B CG    1 
ATOM   1176  C CD    . GLU B 2 49  ? 141.586 150.423 153.115 1.00 26.89  ? 63   GLU B CD    1 
ATOM   1177  O OE1   . GLU B 2 49  ? 140.566 149.762 152.828 1.00 26.89  ? 63   GLU B OE1   1 
ATOM   1178  O OE2   . GLU B 2 49  ? 141.541 151.647 153.349 1.00 26.89  ? 63   GLU B OE2   1 
ATOM   1179  N N     . ASN B 2 50  ? 143.403 145.355 151.804 1.00 25.18  ? 64   ASN B N     1 
ATOM   1180  C CA    . ASN B 2 50  ? 142.977 143.955 151.734 1.00 25.18  ? 64   ASN B CA    1 
ATOM   1181  C C     . ASN B 2 50  ? 144.050 143.004 152.257 1.00 25.18  ? 64   ASN B C     1 
ATOM   1182  O O     . ASN B 2 50  ? 143.766 142.131 153.096 1.00 25.18  ? 64   ASN B O     1 
ATOM   1183  C CB    . ASN B 2 50  ? 142.598 143.582 150.309 1.00 25.18  ? 64   ASN B CB    1 
ATOM   1184  C CG    . ASN B 2 50  ? 141.276 144.145 149.905 1.00 25.18  ? 64   ASN B CG    1 
ATOM   1185  O OD1   . ASN B 2 50  ? 140.351 144.201 150.705 1.00 25.18  ? 64   ASN B OD1   1 
ATOM   1186  N ND2   . ASN B 2 50  ? 141.164 144.553 148.655 1.00 25.18  ? 64   ASN B ND2   1 
ATOM   1187  N N     . VAL B 2 51  ? 145.297 143.186 151.808 1.00 16.64  ? 65   VAL B N     1 
ATOM   1188  C CA    . VAL B 2 51  ? 146.340 142.240 152.195 1.00 16.64  ? 65   VAL B CA    1 
ATOM   1189  C C     . VAL B 2 51  ? 146.666 142.359 153.680 1.00 16.64  ? 65   VAL B C     1 
ATOM   1190  O O     . VAL B 2 51  ? 146.780 141.343 154.378 1.00 16.64  ? 65   VAL B O     1 
ATOM   1191  C CB    . VAL B 2 51  ? 147.589 142.413 151.323 1.00 16.64  ? 65   VAL B CB    1 
ATOM   1192  C CG1   . VAL B 2 51  ? 148.649 141.432 151.730 1.00 16.64  ? 65   VAL B CG1   1 
ATOM   1193  C CG2   . VAL B 2 51  ? 147.230 142.167 149.903 1.00 16.64  ? 65   VAL B CG2   1 
ATOM   1194  N N     . ILE B 2 52  ? 146.763 143.579 154.207 1.00 23.18  ? 66   ILE B N     1 
ATOM   1195  C CA    . ILE B 2 52  ? 147.092 143.719 155.616 1.00 23.18  ? 66   ILE B CA    1 
ATOM   1196  C C     . ILE B 2 52  ? 145.913 143.339 156.504 1.00 23.18  ? 66   ILE B C     1 
ATOM   1197  O O     . ILE B 2 52  ? 146.128 142.857 157.621 1.00 23.18  ? 66   ILE B O     1 
ATOM   1198  C CB    . ILE B 2 52  ? 147.642 145.134 155.831 1.00 23.18  ? 66   ILE B CB    1 
ATOM   1199  C CG1   . ILE B 2 52  ? 148.933 145.273 155.052 1.00 23.18  ? 66   ILE B CG1   1 
ATOM   1200  C CG2   . ILE B 2 52  ? 147.984 145.390 157.248 1.00 23.18  ? 66   ILE B CG2   1 
ATOM   1201  C CD1   . ILE B 2 52  ? 149.393 146.670 154.950 1.00 23.18  ? 66   ILE B CD1   1 
ATOM   1202  N N     . ARG B 2 53  ? 144.679 143.404 155.998 1.00 25.31  ? 67   ARG B N     1 
ATOM   1203  C CA    . ARG B 2 53  ? 143.552 142.852 156.744 1.00 25.31  ? 67   ARG B CA    1 
ATOM   1204  C C     . ARG B 2 53  ? 143.653 141.340 156.892 1.00 25.31  ? 67   ARG B C     1 
ATOM   1205  O O     . ARG B 2 53  ? 143.442 140.804 157.989 1.00 25.31  ? 67   ARG B O     1 
ATOM   1206  C CB    . ARG B 2 53  ? 142.255 143.220 156.048 1.00 25.31  ? 67   ARG B CB    1 
ATOM   1207  C CG    . ARG B 2 53  ? 141.031 142.693 156.711 1.00 25.31  ? 67   ARG B CG    1 
ATOM   1208  C CD    . ARG B 2 53  ? 139.825 143.220 155.980 1.00 25.31  ? 67   ARG B CD    1 
ATOM   1209  N NE    . ARG B 2 53  ? 139.684 144.659 156.158 1.00 25.31  ? 67   ARG B NE    1 
ATOM   1210  C CZ    . ARG B 2 53  ? 138.826 145.406 155.477 1.00 25.31  ? 67   ARG B CZ    1 
ATOM   1211  N NH1   . ARG B 2 53  ? 138.047 144.847 154.566 1.00 25.31  ? 67   ARG B NH1   1 
ATOM   1212  N NH2   . ARG B 2 53  ? 138.754 146.709 155.695 1.00 25.31  ? 67   ARG B NH2   1 
ATOM   1213  N N     . ASP B 2 54  ? 144.000 140.636 155.812 1.00 22.52  ? 68   ASP B N     1 
ATOM   1214  C CA    . ASP B 2 54  ? 144.143 139.185 155.941 1.00 22.52  ? 68   ASP B CA    1 
ATOM   1215  C C     . ASP B 2 54  ? 145.353 138.789 156.793 1.00 22.52  ? 68   ASP B C     1 
ATOM   1216  O O     . ASP B 2 54  ? 145.273 137.826 157.570 1.00 22.52  ? 68   ASP B O     1 
ATOM   1217  C CB    . ASP B 2 54  ? 144.209 138.543 154.567 1.00 22.52  ? 68   ASP B CB    1 
ATOM   1218  C CG    . ASP B 2 54  ? 142.884 138.585 153.860 1.00 22.52  ? 68   ASP B CG    1 
ATOM   1219  O OD1   . ASP B 2 54  ? 141.864 138.630 154.563 1.00 22.52  ? 68   ASP B OD1   1 
ATOM   1220  O OD2   . ASP B 2 54  ? 142.850 138.566 152.612 1.00 22.52  ? 68   ASP B OD2   1 
ATOM   1221  N N     . ALA B 2 55  ? 146.448 139.549 156.723 1.00 16.80  ? 69   ALA B N     1 
ATOM   1222  C CA    . ALA B 2 55  ? 147.617 139.207 157.528 1.00 16.80  ? 69   ALA B CA    1 
ATOM   1223  C C     . ALA B 2 55  ? 147.375 139.464 159.008 1.00 16.80  ? 69   ALA B C     1 
ATOM   1224  O O     . ALA B 2 55  ? 147.801 138.671 159.856 1.00 16.80  ? 69   ALA B O     1 
ATOM   1225  C CB    . ALA B 2 55  ? 148.832 139.983 157.053 1.00 16.80  ? 69   ALA B CB    1 
ATOM   1226  N N     . VAL B 2 56  ? 146.656 140.536 159.343 1.00 17.51  ? 70   VAL B N     1 
ATOM   1227  C CA    . VAL B 2 56  ? 146.309 140.776 160.737 1.00 17.51  ? 70   VAL B CA    1 
ATOM   1228  C C     . VAL B 2 56  ? 145.289 139.753 161.218 1.00 17.51  ? 70   VAL B C     1 
ATOM   1229  O O     . VAL B 2 56  ? 145.295 139.381 162.393 1.00 17.51  ? 70   VAL B O     1 
ATOM   1230  C CB    . VAL B 2 56  ? 145.842 142.235 160.897 1.00 17.51  ? 70   VAL B CB    1 
ATOM   1231  C CG1   . VAL B 2 56  ? 145.220 142.515 162.237 1.00 17.51  ? 70   VAL B CG1   1 
ATOM   1232  C CG2   . VAL B 2 56  ? 147.019 143.127 160.758 1.00 17.51  ? 70   VAL B CG2   1 
ATOM   1233  N N     . THR B 2 57  ? 144.462 139.208 160.322 1.00 22.35  ? 71   THR B N     1 
ATOM   1234  C CA    . THR B 2 57  ? 143.560 138.133 160.737 1.00 22.35  ? 71   THR B CA    1 
ATOM   1235  C C     . THR B 2 57  ? 144.316 136.863 161.111 1.00 22.35  ? 71   THR B C     1 
ATOM   1236  O O     . THR B 2 57  ? 144.011 136.240 162.137 1.00 22.35  ? 71   THR B O     1 
ATOM   1237  C CB    . THR B 2 57  ? 142.548 137.851 159.635 1.00 22.35  ? 71   THR B CB    1 
ATOM   1238  O OG1   . THR B 2 57  ? 141.776 139.031 159.401 1.00 22.35  ? 71   THR B OG1   1 
ATOM   1239  C CG2   . THR B 2 57  ? 141.615 136.757 160.039 1.00 22.35  ? 71   THR B CG2   1 
ATOM   1240  N N     . TYR B 2 58  ? 145.339 136.490 160.336 1.00 18.30  ? 72   TYR B N     1 
ATOM   1241  C CA    . TYR B 2 58  ? 146.149 135.336 160.742 1.00 18.30  ? 72   TYR B CA    1 
ATOM   1242  C C     . TYR B 2 58  ? 146.924 135.610 162.027 1.00 18.30  ? 72   TYR B C     1 
ATOM   1243  O O     . TYR B 2 58  ? 147.044 134.725 162.883 1.00 18.30  ? 72   TYR B O     1 
ATOM   1244  C CB    . TYR B 2 58  ? 147.126 134.911 159.652 1.00 18.30  ? 72   TYR B CB    1 
ATOM   1245  C CG    . TYR B 2 58  ? 146.499 134.358 158.419 1.00 18.30  ? 72   TYR B CG    1 
ATOM   1246  C CD1   . TYR B 2 58  ? 145.868 133.148 158.444 1.00 18.30  ? 72   TYR B CD1   1 
ATOM   1247  C CD2   . TYR B 2 58  ? 146.617 134.999 157.214 1.00 18.30  ? 72   TYR B CD2   1 
ATOM   1248  C CE1   . TYR B 2 58  ? 145.301 132.624 157.316 1.00 18.30  ? 72   TYR B CE1   1 
ATOM   1249  C CE2   . TYR B 2 58  ? 146.066 134.488 156.083 1.00 18.30  ? 72   TYR B CE2   1 
ATOM   1250  C CZ    . TYR B 2 58  ? 145.406 133.297 156.142 1.00 18.30  ? 72   TYR B CZ    1 
ATOM   1251  O OH    . TYR B 2 58  ? 144.846 132.758 155.014 1.00 18.30  ? 72   TYR B OH    1 
ATOM   1252  N N     . THR B 2 59  ? 147.441 136.829 162.186 1.00 26.23  ? 73   THR B N     1 
ATOM   1253  C CA    . THR B 2 59  ? 148.218 137.148 163.379 1.00 26.23  ? 73   THR B CA    1 
ATOM   1254  C C     . THR B 2 59  ? 147.348 137.178 164.630 1.00 26.23  ? 73   THR B C     1 
ATOM   1255  O O     . THR B 2 59  ? 147.771 136.709 165.691 1.00 26.23  ? 73   THR B O     1 
ATOM   1256  C CB    . THR B 2 59  ? 148.943 138.466 163.151 1.00 26.23  ? 73   THR B CB    1 
ATOM   1257  O OG1   . THR B 2 59  ? 149.884 138.282 162.093 1.00 26.23  ? 73   THR B OG1   1 
ATOM   1258  C CG2   . THR B 2 59  ? 149.679 138.926 164.375 1.00 26.23  ? 73   THR B CG2   1 
ATOM   1259  N N     . GLU B 2 60  ? 146.115 137.673 164.519 1.00 26.69  ? 74   GLU B N     1 
ATOM   1260  C CA    . GLU B 2 60  ? 145.170 137.563 165.623 1.00 26.69  ? 74   GLU B CA    1 
ATOM   1261  C C     . GLU B 2 60  ? 144.829 136.115 165.907 1.00 26.69  ? 74   GLU B C     1 
ATOM   1262  O O     . GLU B 2 60  ? 144.624 135.740 167.064 1.00 26.69  ? 74   GLU B O     1 
ATOM   1263  C CB    . GLU B 2 60  ? 143.877 138.319 165.325 1.00 26.69  ? 74   GLU B CB    1 
ATOM   1264  C CG    . GLU B 2 60  ? 143.944 139.823 165.342 1.00 26.69  ? 74   GLU B CG    1 
ATOM   1265  C CD    . GLU B 2 60  ? 142.594 140.445 165.028 1.00 26.69  ? 74   GLU B CD    1 
ATOM   1266  O OE1   . GLU B 2 60  ? 141.641 139.692 164.742 1.00 26.69  ? 74   GLU B OE1   1 
ATOM   1267  O OE2   . GLU B 2 60  ? 142.485 141.687 165.052 1.00 26.69  ? 74   GLU B OE2   1 
ATOM   1268  N N     . HIS B 2 61  ? 144.735 135.290 164.864 1.00 25.59  ? 75   HIS B N     1 
ATOM   1269  C CA    . HIS B 2 61  ? 144.349 133.906 165.088 1.00 25.59  ? 75   HIS B CA    1 
ATOM   1270  C C     . HIS B 2 61  ? 145.430 133.118 165.800 1.00 25.59  ? 75   HIS B C     1 
ATOM   1271  O O     . HIS B 2 61  ? 145.120 132.259 166.630 1.00 25.59  ? 75   HIS B O     1 
ATOM   1272  C CB    . HIS B 2 61  ? 143.999 133.218 163.781 1.00 25.59  ? 75   HIS B CB    1 
ATOM   1273  C CG    . HIS B 2 61  ? 143.770 131.754 163.937 1.00 25.59  ? 75   HIS B CG    1 
ATOM   1274  N ND1   . HIS B 2 61  ? 142.690 131.239 164.618 1.00 25.59  ? 75   HIS B ND1   1 
ATOM   1275  C CD2   . HIS B 2 61  ? 144.503 130.693 163.537 1.00 25.59  ? 75   HIS B CD2   1 
ATOM   1276  C CE1   . HIS B 2 61  ? 142.760 129.921 164.617 1.00 25.59  ? 75   HIS B CE1   1 
ATOM   1277  N NE2   . HIS B 2 61  ? 143.850 129.564 163.964 1.00 25.59  ? 75   HIS B NE2   1 
ATOM   1278  N N     . ALA B 2 62  ? 146.693 133.401 165.525 1.00 27.68  ? 76   ALA B N     1 
ATOM   1279  C CA    . ALA B 2 62  ? 147.722 132.615 166.187 1.00 27.68  ? 76   ALA B CA    1 
ATOM   1280  C C     . ALA B 2 62  ? 148.061 133.121 167.577 1.00 27.68  ? 76   ALA B C     1 
ATOM   1281  O O     . ALA B 2 62  ? 148.965 132.556 168.200 1.00 27.68  ? 76   ALA B O     1 
ATOM   1282  C CB    . ALA B 2 62  ? 148.988 132.564 165.335 1.00 27.68  ? 76   ALA B CB    1 
ATOM   1283  N N     . LYS B 2 63  ? 147.355 134.145 168.065 1.00 33.81  ? 77   LYS B N     1 
ATOM   1284  C CA    . LYS B 2 63  ? 147.564 134.773 169.371 1.00 33.81  ? 77   LYS B CA    1 
ATOM   1285  C C     . LYS B 2 63  ? 149.009 135.251 169.525 1.00 33.81  ? 77   LYS B C     1 
ATOM   1286  O O     . LYS B 2 63  ? 149.786 134.762 170.342 1.00 33.81  ? 77   LYS B O     1 
ATOM   1287  C CB    . LYS B 2 63  ? 147.151 133.844 170.514 1.00 33.81  ? 77   LYS B CB    1 
ATOM   1288  C CG    . LYS B 2 63  ? 145.663 133.713 170.649 1.00 33.81  ? 77   LYS B CG    1 
ATOM   1289  C CD    . LYS B 2 63  ? 145.306 132.812 171.798 1.00 33.81  ? 77   LYS B CD    1 
ATOM   1290  C CE    . LYS B 2 63  ? 143.828 132.895 172.084 1.00 33.81  ? 77   LYS B CE    1 
ATOM   1291  N NZ    . LYS B 2 63  ? 143.051 132.399 170.936 1.00 33.81  ? 77   LYS B NZ    1 
ATOM   1292  N N     . ARG B 2 64  ? 149.338 136.220 168.687 1.00 40.40  ? 78   ARG B N     1 
ATOM   1293  C CA    . ARG B 2 64  ? 150.677 136.768 168.627 1.00 40.40  ? 78   ARG B CA    1 
ATOM   1294  C C     . ARG B 2 64  ? 150.564 138.201 168.144 1.00 40.40  ? 78   ARG B C     1 
ATOM   1295  O O     . ARG B 2 64  ? 149.501 138.650 167.719 1.00 40.40  ? 78   ARG B O     1 
ATOM   1296  C CB    . ARG B 2 64  ? 151.556 135.940 167.706 1.00 40.40  ? 78   ARG B CB    1 
ATOM   1297  C CG    . ARG B 2 64  ? 151.138 136.060 166.282 1.00 40.40  ? 78   ARG B CG    1 
ATOM   1298  C CD    . ARG B 2 64  ? 151.758 134.992 165.456 1.00 40.40  ? 78   ARG B CD    1 
ATOM   1299  N NE    . ARG B 2 64  ? 153.199 135.074 165.432 1.00 40.40  ? 78   ARG B NE    1 
ATOM   1300  C CZ    . ARG B 2 64  ? 153.963 134.055 165.083 1.00 40.40  ? 78   ARG B CZ    1 
ATOM   1301  N NH1   . ARG B 2 64  ? 153.397 132.904 164.756 1.00 40.40  ? 78   ARG B NH1   1 
ATOM   1302  N NH2   . ARG B 2 64  ? 155.279 134.179 165.077 1.00 40.40  ? 78   ARG B NH2   1 
ATOM   1303  N N     . LYS B 2 65  ? 151.676 138.925 168.218 1.00 47.17  ? 79   LYS B N     1 
ATOM   1304  C CA    . LYS B 2 65  ? 151.673 140.357 167.969 1.00 47.17  ? 79   LYS B CA    1 
ATOM   1305  C C     . LYS B 2 65  ? 152.768 140.750 166.996 1.00 47.17  ? 79   LYS B C     1 
ATOM   1306  O O     . LYS B 2 65  ? 153.346 141.826 167.114 1.00 47.17  ? 79   LYS B O     1 
ATOM   1307  C CB    . LYS B 2 65  ? 151.828 141.120 169.280 1.00 47.17  ? 79   LYS B CB    1 
ATOM   1308  C CG    . LYS B 2 65  ? 150.610 141.038 170.177 1.00 47.17  ? 79   LYS B CG    1 
ATOM   1309  C CD    . LYS B 2 65  ? 150.955 141.409 171.598 1.00 47.17  ? 79   LYS B CD    1 
ATOM   1310  C CE    . LYS B 2 65  ? 151.327 142.866 171.718 1.00 47.17  ? 79   LYS B CE    1 
ATOM   1311  N NZ    . LYS B 2 65  ? 151.607 143.229 173.132 1.00 47.17  ? 79   LYS B NZ    1 
ATOM   1312  N N     . THR B 2 66  ? 153.071 139.889 166.032 1.00 40.46  ? 80   THR B N     1 
ATOM   1313  C CA    . THR B 2 66  ? 154.110 140.175 165.051 1.00 40.46  ? 80   THR B CA    1 
ATOM   1314  C C     . THR B 2 66  ? 153.659 139.637 163.707 1.00 40.46  ? 80   THR B C     1 
ATOM   1315  O O     . THR B 2 66  ? 153.623 138.424 163.502 1.00 40.46  ? 80   THR B O     1 
ATOM   1316  C CB    . THR B 2 66  ? 155.440 139.564 165.460 1.00 40.46  ? 80   THR B CB    1 
ATOM   1317  O OG1   . THR B 2 66  ? 155.817 140.075 166.740 1.00 40.46  ? 80   THR B OG1   1 
ATOM   1318  C CG2   . THR B 2 66  ? 156.503 139.930 164.469 1.00 40.46  ? 80   THR B CG2   1 
ATOM   1319  N N     . VAL B 2 67  ? 153.311 140.536 162.799 1.00 30.92  ? 81   VAL B N     1 
ATOM   1320  C CA    . VAL B 2 67  ? 152.922 140.154 161.452 1.00 30.92  ? 81   VAL B CA    1 
ATOM   1321  C C     . VAL B 2 67  ? 154.172 139.786 160.667 1.00 30.92  ? 81   VAL B C     1 
ATOM   1322  O O     . VAL B 2 67  ? 155.007 140.642 160.367 1.00 30.92  ? 81   VAL B O     1 
ATOM   1323  C CB    . VAL B 2 67  ? 152.149 141.298 160.795 1.00 30.92  ? 81   VAL B CB    1 
ATOM   1324  C CG1   . VAL B 2 67  ? 151.885 141.021 159.354 1.00 30.92  ? 81   VAL B CG1   1 
ATOM   1325  C CG2   . VAL B 2 67  ? 150.863 141.500 161.526 1.00 30.92  ? 81   VAL B CG2   1 
ATOM   1326  N N     . THR B 2 68  ? 154.309 138.516 160.331 1.00 28.32  ? 82   THR B N     1 
ATOM   1327  C CA    . THR B 2 68  ? 155.542 137.997 159.770 1.00 28.32  ? 82   THR B CA    1 
ATOM   1328  C C     . THR B 2 68  ? 155.380 137.666 158.297 1.00 28.32  ? 82   THR B C     1 
ATOM   1329  O O     . THR B 2 68  ? 154.299 137.803 157.703 1.00 28.32  ? 82   THR B O     1 
ATOM   1330  C CB    . THR B 2 68  ? 155.995 136.763 160.536 1.00 28.32  ? 82   THR B CB    1 
ATOM   1331  O OG1   . THR B 2 68  ? 154.979 135.759 160.468 1.00 28.32  ? 82   THR B OG1   1 
ATOM   1332  C CG2   . THR B 2 68  ? 156.244 137.110 161.967 1.00 28.32  ? 82   THR B CG2   1 
ATOM   1333  N N     . ALA B 2 69  ? 156.485 137.200 157.719 1.00 28.54  ? 83   ALA B N     1 
ATOM   1334  C CA    . ALA B 2 69  ? 156.543 136.985 156.285 1.00 28.54  ? 83   ALA B CA    1 
ATOM   1335  C C     . ALA B 2 69  ? 155.645 135.844 155.863 1.00 28.54  ? 83   ALA B C     1 
ATOM   1336  O O     . ALA B 2 69  ? 155.028 135.911 154.800 1.00 28.54  ? 83   ALA B O     1 
ATOM   1337  C CB    . ALA B 2 69  ? 157.973 136.709 155.849 1.00 28.54  ? 83   ALA B CB    1 
ATOM   1338  N N     . MET B 2 70  ? 155.523 134.804 156.688 1.00 27.82  ? 84   MET B N     1 
ATOM   1339  C CA    . MET B 2 70  ? 154.644 133.709 156.300 1.00 27.82  ? 84   MET B CA    1 
ATOM   1340  C C     . MET B 2 70  ? 153.187 134.102 156.400 1.00 27.82  ? 84   MET B C     1 
ATOM   1341  O O     . MET B 2 70  ? 152.362 133.599 155.633 1.00 27.82  ? 84   MET B O     1 
ATOM   1342  C CB    . MET B 2 70  ? 154.901 132.471 157.141 1.00 27.82  ? 84   MET B CB    1 
ATOM   1343  C CG    . MET B 2 70  ? 156.258 131.913 156.916 1.00 27.82  ? 84   MET B CG    1 
ATOM   1344  S SD    . MET B 2 70  ? 156.575 131.727 155.158 1.00 27.82  ? 84   MET B SD    1 
ATOM   1345  C CE    . MET B 2 70  ? 155.426 130.438 154.711 1.00 27.82  ? 84   MET B CE    1 
ATOM   1346  N N     . ASP B 2 71  ? 152.860 135.014 157.306 1.00 25.56  ? 85   ASP B N     1 
ATOM   1347  C CA    . ASP B 2 71  ? 151.502 135.522 157.375 1.00 25.56  ? 85   ASP B CA    1 
ATOM   1348  C C     . ASP B 2 71  ? 151.166 136.317 156.131 1.00 25.56  ? 85   ASP B C     1 
ATOM   1349  O O     . ASP B 2 71  ? 150.083 136.158 155.558 1.00 25.56  ? 85   ASP B O     1 
ATOM   1350  C CB    . ASP B 2 71  ? 151.339 136.383 158.612 1.00 25.56  ? 85   ASP B CB    1 
ATOM   1351  C CG    . ASP B 2 71  ? 151.651 135.634 159.865 1.00 25.56  ? 85   ASP B CG    1 
ATOM   1352  O OD1   . ASP B 2 71  ? 151.539 134.396 159.849 1.00 25.56  ? 85   ASP B OD1   1 
ATOM   1353  O OD2   . ASP B 2 71  ? 152.004 136.270 160.873 1.00 25.56  ? 85   ASP B OD2   1 
ATOM   1354  N N     . VAL B 2 72  ? 152.107 137.136 155.673 1.00 21.88  ? 86   VAL B N     1 
ATOM   1355  C CA    . VAL B 2 72  ? 151.906 137.877 154.433 1.00 21.88  ? 86   VAL B CA    1 
ATOM   1356  C C     . VAL B 2 72  ? 151.797 136.933 153.235 1.00 21.88  ? 86   VAL B C     1 
ATOM   1357  O O     . VAL B 2 72  ? 150.947 137.129 152.362 1.00 21.88  ? 86   VAL B O     1 
ATOM   1358  C CB    . VAL B 2 72  ? 153.034 138.905 154.264 1.00 21.88  ? 86   VAL B CB    1 
ATOM   1359  C CG1   . VAL B 2 72  ? 152.979 139.555 152.920 1.00 21.88  ? 86   VAL B CG1   1 
ATOM   1360  C CG2   . VAL B 2 72  ? 152.899 139.959 155.315 1.00 21.88  ? 86   VAL B CG2   1 
ATOM   1361  N N     . VAL B 2 73  ? 152.609 135.872 153.195 1.00 20.41  ? 87   VAL B N     1 
ATOM   1362  C CA    . VAL B 2 73  ? 152.570 134.957 152.052 1.00 20.41  ? 87   VAL B CA    1 
ATOM   1363  C C     . VAL B 2 73  ? 151.274 134.153 152.040 1.00 20.41  ? 87   VAL B C     1 
ATOM   1364  O O     . VAL B 2 73  ? 150.684 133.932 150.981 1.00 20.41  ? 87   VAL B O     1 
ATOM   1365  C CB    . VAL B 2 73  ? 153.817 134.057 152.038 1.00 20.41  ? 87   VAL B CB    1 
ATOM   1366  C CG1   . VAL B 2 73  ? 153.719 132.978 150.987 1.00 20.41  ? 87   VAL B CG1   1 
ATOM   1367  C CG2   . VAL B 2 73  ? 155.021 134.875 151.736 1.00 20.41  ? 87   VAL B CG2   1 
ATOM   1368  N N     . TYR B 2 74  ? 150.768 133.760 153.211 1.00 23.27  ? 88   TYR B N     1 
ATOM   1369  C CA    . TYR B 2 74  ? 149.492 133.050 153.247 1.00 23.27  ? 88   TYR B CA    1 
ATOM   1370  C C     . TYR B 2 74  ? 148.334 133.968 152.903 1.00 23.27  ? 88   TYR B C     1 
ATOM   1371  O O     . TYR B 2 74  ? 147.374 133.534 152.250 1.00 23.27  ? 88   TYR B O     1 
ATOM   1372  C CB    . TYR B 2 74  ? 149.271 132.426 154.617 1.00 23.27  ? 88   TYR B CB    1 
ATOM   1373  C CG    . TYR B 2 74  ? 150.215 131.302 154.940 1.00 23.27  ? 88   TYR B CG    1 
ATOM   1374  C CD1   . TYR B 2 74  ? 150.813 130.565 153.937 1.00 23.27  ? 88   TYR B CD1   1 
ATOM   1375  C CD2   . TYR B 2 74  ? 150.541 131.009 156.250 1.00 23.27  ? 88   TYR B CD2   1 
ATOM   1376  C CE1   . TYR B 2 74  ? 151.690 129.545 154.228 1.00 23.27  ? 88   TYR B CE1   1 
ATOM   1377  C CE2   . TYR B 2 74  ? 151.415 129.999 156.553 1.00 23.27  ? 88   TYR B CE2   1 
ATOM   1378  C CZ    . TYR B 2 74  ? 151.988 129.270 155.536 1.00 23.27  ? 88   TYR B CZ    1 
ATOM   1379  O OH    . TYR B 2 74  ? 152.867 128.255 155.823 1.00 23.27  ? 88   TYR B OH    1 
ATOM   1380  N N     . ALA B 2 75  ? 148.431 135.243 153.279 1.00 20.54  ? 89   ALA B N     1 
ATOM   1381  C CA    . ALA B 2 75  ? 147.403 136.205 152.912 1.00 20.54  ? 89   ALA B CA    1 
ATOM   1382  C C     . ALA B 2 75  ? 147.380 136.435 151.412 1.00 20.54  ? 89   ALA B C     1 
ATOM   1383  O O     . ALA B 2 75  ? 146.312 136.442 150.790 1.00 20.54  ? 89   ALA B O     1 
ATOM   1384  C CB    . ALA B 2 75  ? 147.643 137.514 153.636 1.00 20.54  ? 89   ALA B CB    1 
ATOM   1385  N N     . LEU B 2 76  ? 148.555 136.604 150.814 1.00 17.16  ? 90   LEU B N     1 
ATOM   1386  C CA    . LEU B 2 76  ? 148.649 136.767 149.370 1.00 17.16  ? 90   LEU B CA    1 
ATOM   1387  C C     . LEU B 2 76  ? 148.248 135.505 148.632 1.00 17.16  ? 90   LEU B C     1 
ATOM   1388  O O     . LEU B 2 76  ? 147.682 135.592 147.542 1.00 17.16  ? 90   LEU B O     1 
ATOM   1389  C CB    . LEU B 2 76  ? 150.061 137.164 148.985 1.00 17.16  ? 90   LEU B CB    1 
ATOM   1390  C CG    . LEU B 2 76  ? 150.499 138.554 149.389 1.00 17.16  ? 90   LEU B CG    1 
ATOM   1391  C CD1   . LEU B 2 76  ? 151.958 138.669 149.169 1.00 17.16  ? 90   LEU B CD1   1 
ATOM   1392  C CD2   . LEU B 2 76  ? 149.773 139.565 148.585 1.00 17.16  ? 90   LEU B CD2   1 
ATOM   1393  N N     . LYS B 2 77  ? 148.514 134.331 149.206 1.00 21.81  ? 91   LYS B N     1 
ATOM   1394  C CA    . LYS B 2 77  ? 148.160 133.091 148.531 1.00 21.81  ? 91   LYS B CA    1 
ATOM   1395  C C     . LYS B 2 77  ? 146.660 132.897 148.507 1.00 21.81  ? 91   LYS B C     1 
ATOM   1396  O O     . LYS B 2 77  ? 146.104 132.471 147.491 1.00 21.81  ? 91   LYS B O     1 
ATOM   1397  C CB    . LYS B 2 77  ? 148.825 131.894 149.200 1.00 21.81  ? 91   LYS B CB    1 
ATOM   1398  C CG    . LYS B 2 77  ? 148.559 130.593 148.466 1.00 21.81  ? 91   LYS B CG    1 
ATOM   1399  C CD    . LYS B 2 77  ? 149.300 129.421 149.063 1.00 21.81  ? 91   LYS B CD    1 
ATOM   1400  C CE    . LYS B 2 77  ? 148.630 128.942 150.327 1.00 21.81  ? 91   LYS B CE    1 
ATOM   1401  N NZ    . LYS B 2 77  ? 149.245 127.685 150.833 1.00 21.81  ? 91   LYS B NZ    1 
ATOM   1402  N N     . ARG B 2 78  ? 145.978 133.225 149.595 1.00 20.14  ? 92   ARG B N     1 
ATOM   1403  C CA    . ARG B 2 78  ? 144.534 133.126 149.493 1.00 20.14  ? 92   ARG B CA    1 
ATOM   1404  C C     . ARG B 2 78  ? 143.930 134.292 148.742 1.00 20.14  ? 92   ARG B C     1 
ATOM   1405  O O     . ARG B 2 78  ? 142.765 134.212 148.351 1.00 20.14  ? 92   ARG B O     1 
ATOM   1406  C CB    . ARG B 2 78  ? 143.867 133.032 150.854 1.00 20.14  ? 92   ARG B CB    1 
ATOM   1407  C CG    . ARG B 2 78  ? 143.850 134.284 151.647 1.00 20.14  ? 92   ARG B CG    1 
ATOM   1408  C CD    . ARG B 2 78  ? 142.813 134.075 152.694 1.00 20.14  ? 92   ARG B CD    1 
ATOM   1409  N NE    . ARG B 2 78  ? 141.568 133.797 152.002 1.00 20.14  ? 92   ARG B NE    1 
ATOM   1410  C CZ    . ARG B 2 78  ? 140.752 134.733 151.545 1.00 20.14  ? 92   ARG B CZ    1 
ATOM   1411  N NH1   . ARG B 2 78  ? 141.032 136.014 151.727 1.00 20.14  ? 92   ARG B NH1   1 
ATOM   1412  N NH2   . ARG B 2 78  ? 139.649 134.388 150.906 1.00 20.14  ? 92   ARG B NH2   1 
ATOM   1413  N N     . GLN B 2 79  ? 144.684 135.367 148.537 1.00 22.79  ? 93   GLN B N     1 
ATOM   1414  C CA    . GLN B 2 79  ? 144.186 136.445 147.700 1.00 22.79  ? 93   GLN B CA    1 
ATOM   1415  C C     . GLN B 2 79  ? 144.113 136.016 146.245 1.00 22.79  ? 93   GLN B C     1 
ATOM   1416  O O     . GLN B 2 79  ? 143.232 136.465 145.510 1.00 22.79  ? 93   GLN B O     1 
ATOM   1417  C CB    . GLN B 2 79  ? 145.100 137.652 147.832 1.00 22.79  ? 93   GLN B CB    1 
ATOM   1418  C CG    . GLN B 2 79  ? 144.498 138.905 147.340 1.00 22.79  ? 93   GLN B CG    1 
ATOM   1419  C CD    . GLN B 2 79  ? 143.364 139.301 148.219 1.00 22.79  ? 93   GLN B CD    1 
ATOM   1420  O OE1   . GLN B 2 79  ? 142.201 139.139 147.864 1.00 22.79  ? 93   GLN B OE1   1 
ATOM   1421  N NE2   . GLN B 2 79  ? 143.688 139.806 149.397 1.00 22.79  ? 93   GLN B NE2   1 
ATOM   1422  N N     . GLY B 2 80  ? 145.023 135.147 145.819 1.00 21.01  ? 94   GLY B N     1 
ATOM   1423  C CA    . GLY B 2 80  ? 145.157 134.750 144.430 1.00 21.01  ? 94   GLY B CA    1 
ATOM   1424  C C     . GLY B 2 80  ? 146.497 135.085 143.820 1.00 21.01  ? 94   GLY B C     1 
ATOM   1425  O O     . GLY B 2 80  ? 146.798 134.603 142.723 1.00 21.01  ? 94   GLY B O     1 
ATOM   1426  N N     . ARG B 2 81  ? 147.303 135.905 144.482 1.00 25.24  ? 95   ARG B N     1 
ATOM   1427  C CA    . ARG B 2 81  ? 148.618 136.330 144.014 1.00 25.24  ? 95   ARG B CA    1 
ATOM   1428  C C     . ARG B 2 81  ? 149.663 135.582 144.830 1.00 25.24  ? 95   ARG B C     1 
ATOM   1429  O O     . ARG B 2 81  ? 149.989 135.999 145.938 1.00 25.24  ? 95   ARG B O     1 
ATOM   1430  C CB    . ARG B 2 81  ? 148.792 137.830 144.227 1.00 25.24  ? 95   ARG B CB    1 
ATOM   1431  C CG    . ARG B 2 81  ? 147.796 138.745 143.564 1.00 25.24  ? 95   ARG B CG    1 
ATOM   1432  C CD    . ARG B 2 81  ? 148.136 138.934 142.117 1.00 25.24  ? 95   ARG B CD    1 
ATOM   1433  N NE    . ARG B 2 81  ? 147.302 139.944 141.485 1.00 25.24  ? 95   ARG B NE    1 
ATOM   1434  C CZ    . ARG B 2 81  ? 147.440 140.329 140.222 1.00 25.24  ? 95   ARG B CZ    1 
ATOM   1435  N NH1   . ARG B 2 81  ? 148.389 139.796 139.462 1.00 25.24  ? 95   ARG B NH1   1 
ATOM   1436  N NH2   . ARG B 2 81  ? 146.641 141.259 139.719 1.00 25.24  ? 95   ARG B NH2   1 
ATOM   1437  N N     . THR B 2 82  ? 150.208 134.495 144.294 1.00 23.20  ? 96   THR B N     1 
ATOM   1438  C CA    . THR B 2 82  ? 151.186 133.723 145.050 1.00 23.20  ? 96   THR B CA    1 
ATOM   1439  C C     . THR B 2 82  ? 152.496 134.496 145.112 1.00 23.20  ? 96   THR B C     1 
ATOM   1440  O O     . THR B 2 82  ? 152.814 135.269 144.210 1.00 23.20  ? 96   THR B O     1 
ATOM   1441  C CB    . THR B 2 82  ? 151.405 132.369 144.386 1.00 23.20  ? 96   THR B CB    1 
ATOM   1442  O OG1   . THR B 2 82  ? 150.141 131.834 143.994 1.00 23.20  ? 96   THR B OG1   1 
ATOM   1443  C CG2   . THR B 2 82  ? 151.998 131.388 145.351 1.00 23.20  ? 96   THR B CG2   1 
ATOM   1444  N N     . LEU B 2 83  ? 153.252 134.317 146.193 1.00 21.49  ? 97   LEU B N     1 
ATOM   1445  C CA    . LEU B 2 83  ? 154.522 135.020 146.361 1.00 21.49  ? 97   LEU B CA    1 
ATOM   1446  C C     . LEU B 2 83  ? 155.647 134.018 146.587 1.00 21.49  ? 97   LEU B C     1 
ATOM   1447  O O     . LEU B 2 83  ? 155.771 133.474 147.685 1.00 21.49  ? 97   LEU B O     1 
ATOM   1448  C CB    . LEU B 2 83  ? 154.444 136.005 147.513 1.00 21.49  ? 97   LEU B CB    1 
ATOM   1449  C CG    . LEU B 2 83  ? 155.705 136.834 147.661 1.00 21.49  ? 97   LEU B CG    1 
ATOM   1450  C CD1   . LEU B 2 83  ? 155.912 137.614 146.403 1.00 21.49  ? 97   LEU B CD1   1 
ATOM   1451  C CD2   . LEU B 2 83  ? 155.568 137.767 148.812 1.00 21.49  ? 97   LEU B CD2   1 
ATOM   1452  N N     . TYR B 2 84  ? 156.478 133.782 145.573 1.00 23.77  ? 98   TYR B N     1 
ATOM   1453  C CA    . TYR B 2 84  ? 157.632 132.913 145.741 1.00 23.77  ? 98   TYR B CA    1 
ATOM   1454  C C     . TYR B 2 84  ? 158.811 133.700 146.277 1.00 23.77  ? 98   TYR B C     1 
ATOM   1455  O O     . TYR B 2 84  ? 159.056 134.830 145.857 1.00 23.77  ? 98   TYR B O     1 
ATOM   1456  C CB    . TYR B 2 84  ? 158.068 132.254 144.437 1.00 23.77  ? 98   TYR B CB    1 
ATOM   1457  C CG    . TYR B 2 84  ? 157.183 131.172 143.901 1.00 23.77  ? 98   TYR B CG    1 
ATOM   1458  C CD1   . TYR B 2 84  ? 156.069 130.744 144.589 1.00 23.77  ? 98   TYR B CD1   1 
ATOM   1459  C CD2   . TYR B 2 84  ? 157.524 130.519 142.734 1.00 23.77  ? 98   TYR B CD2   1 
ATOM   1460  C CE1   . TYR B 2 84  ? 155.288 129.748 144.098 1.00 23.77  ? 98   TYR B CE1   1 
ATOM   1461  C CE2   . TYR B 2 84  ? 156.757 129.514 142.245 1.00 23.77  ? 98   TYR B CE2   1 
ATOM   1462  C CZ    . TYR B 2 84  ? 155.631 129.142 142.923 1.00 23.77  ? 98   TYR B CZ    1 
ATOM   1463  O OH    . TYR B 2 84  ? 154.844 128.132 142.434 1.00 23.77  ? 98   TYR B OH    1 
ATOM   1464  N N     . GLY B 2 85  ? 159.554 133.092 147.190 1.00 27.69  ? 99   GLY B N     1 
ATOM   1465  C CA    . GLY B 2 85  ? 160.860 133.591 147.559 1.00 27.69  ? 99   GLY B CA    1 
ATOM   1466  C C     . GLY B 2 85  ? 160.967 134.199 148.932 1.00 27.69  ? 99   GLY B C     1 
ATOM   1467  O O     . GLY B 2 85  ? 162.052 134.656 149.294 1.00 27.69  ? 99   GLY B O     1 
ATOM   1468  N N     . PHE B 2 86  ? 159.897 134.220 149.718 1.00 30.02  ? 100  PHE B N     1 
ATOM   1469  C CA    . PHE B 2 86  ? 159.961 134.776 151.060 1.00 30.02  ? 100  PHE B CA    1 
ATOM   1470  C C     . PHE B 2 86  ? 159.600 133.768 152.130 1.00 30.02  ? 100  PHE B C     1 
ATOM   1471  O O     . PHE B 2 86  ? 159.283 134.158 153.256 1.00 30.02  ? 100  PHE B O     1 
ATOM   1472  C CB    . PHE B 2 86  ? 159.084 136.017 151.146 1.00 30.02  ? 100  PHE B CB    1 
ATOM   1473  C CG    . PHE B 2 86  ? 159.739 137.224 150.585 1.00 30.02  ? 100  PHE B CG    1 
ATOM   1474  C CD1   . PHE B 2 86  ? 161.105 137.366 150.661 1.00 30.02  ? 100  PHE B CD1   1 
ATOM   1475  C CD2   . PHE B 2 86  ? 159.019 138.172 149.913 1.00 30.02  ? 100  PHE B CD2   1 
ATOM   1476  C CE1   . PHE B 2 86  ? 161.733 138.466 150.138 1.00 30.02  ? 100  PHE B CE1   1 
ATOM   1477  C CE2   . PHE B 2 86  ? 159.646 139.263 149.367 1.00 30.02  ? 100  PHE B CE2   1 
ATOM   1478  C CZ    . PHE B 2 86  ? 161.000 139.415 149.485 1.00 30.02  ? 100  PHE B CZ    1 
ATOM   1479  N N     . GLY B 2 87  ? 159.674 132.486 151.816 1.00 43.79  ? 101  GLY B N     1 
ATOM   1480  C CA    . GLY B 2 87  ? 159.378 131.449 152.774 1.00 43.79  ? 101  GLY B CA    1 
ATOM   1481  C C     . GLY B 2 87  ? 158.804 130.240 152.073 1.00 43.79  ? 101  GLY B C     1 
ATOM   1482  O O     . GLY B 2 87  ? 158.055 130.380 151.103 1.00 43.79  ? 101  GLY B O     1 
ATOM   1483  N N     . GLY B 2 88  ? 159.158 129.050 152.538 1.00 50.93  ? 102  GLY B N     1 
ATOM   1484  C CA    . GLY B 2 88  ? 158.659 127.832 151.935 1.00 50.93  ? 102  GLY B CA    1 
ATOM   1485  C C     . GLY B 2 88  ? 157.218 127.545 152.295 1.00 50.93  ? 102  GLY B C     1 
ATOM   1486  O O     . GLY B 2 88  ? 156.296 128.124 151.726 1.00 50.93  ? 102  GLY B O     1 
ATOM   1487  O OXT   . GLY B 2 88  ? 156.937 126.728 153.169 1.00 50.93  ? 102  GLY B OXT   1 
ATOM   1488  N N     . ARG C 3 3   ? 119.813 106.761 179.577 1.00 109.18 ? 11   ARG C N     1 
ATOM   1489  C CA    . ARG C 3 3   ? 119.071 106.482 178.353 1.00 109.18 ? 11   ARG C CA    1 
ATOM   1490  C C     . ARG C 3 3   ? 117.659 107.036 178.415 1.00 109.18 ? 11   ARG C C     1 
ATOM   1491  O O     . ARG C 3 3   ? 116.686 106.299 178.272 1.00 109.18 ? 11   ARG C O     1 
ATOM   1492  C CB    . ARG C 3 3   ? 119.026 104.980 178.079 1.00 109.18 ? 11   ARG C CB    1 
ATOM   1493  C CG    . ARG C 3 3   ? 120.381 104.362 177.779 1.00 109.18 ? 11   ARG C CG    1 
ATOM   1494  C CD    . ARG C 3 3   ? 120.960 104.952 176.502 1.00 109.18 ? 11   ARG C CD    1 
ATOM   1495  N NE    . ARG C 3 3   ? 120.069 104.776 175.362 1.00 109.18 ? 11   ARG C NE    1 
ATOM   1496  C CZ    . ARG C 3 3   ? 120.080 103.717 174.563 1.00 109.18 ? 11   ARG C CZ    1 
ATOM   1497  N NH1   . ARG C 3 3   ? 120.945 102.736 174.774 1.00 109.18 ? 11   ARG C NH1   1 
ATOM   1498  N NH2   . ARG C 3 3   ? 119.228 103.645 173.551 1.00 109.18 ? 11   ARG C NH2   1 
ATOM   1499  N N     . ALA C 3 4   ? 117.559 108.341 178.631 1.00 101.38 ? 12   ALA C N     1 
ATOM   1500  C CA    . ALA C 3 4   ? 116.284 109.039 178.638 1.00 101.38 ? 12   ALA C CA    1 
ATOM   1501  C C     . ALA C 3 4   ? 115.963 109.486 177.215 1.00 101.38 ? 12   ALA C C     1 
ATOM   1502  O O     . ALA C 3 4   ? 116.542 108.988 176.245 1.00 101.38 ? 12   ALA C O     1 
ATOM   1503  C CB    . ALA C 3 4   ? 116.320 110.207 179.619 1.00 101.38 ? 12   ALA C CB    1 
ATOM   1504  N N     . LYS C 3 5   ? 115.008 110.402 177.068 1.00 85.83  ? 13   LYS C N     1 
ATOM   1505  C CA    . LYS C 3 5   ? 114.747 110.981 175.761 1.00 85.83  ? 13   LYS C CA    1 
ATOM   1506  C C     . LYS C 3 5   ? 115.939 111.823 175.322 1.00 85.83  ? 13   LYS C C     1 
ATOM   1507  O O     . LYS C 3 5   ? 116.719 112.319 176.139 1.00 85.83  ? 13   LYS C O     1 
ATOM   1508  C CB    . LYS C 3 5   ? 113.475 111.828 175.773 1.00 85.83  ? 13   LYS C CB    1 
ATOM   1509  C CG    . LYS C 3 5   ? 113.580 113.119 176.564 1.00 85.83  ? 13   LYS C CG    1 
ATOM   1510  C CD    . LYS C 3 5   ? 112.297 113.924 176.484 1.00 85.83  ? 13   LYS C CD    1 
ATOM   1511  C CE    . LYS C 3 5   ? 112.410 115.198 177.290 1.00 85.83  ? 13   LYS C CE    1 
ATOM   1512  N NZ    . LYS C 3 5   ? 113.427 116.116 176.711 1.00 85.83  ? 13   LYS C NZ    1 
ATOM   1513  N N     . ALA C 3 6   ? 116.089 111.955 174.012 1.00 76.61  ? 14   ALA C N     1 
ATOM   1514  C CA    . ALA C 3 6   ? 117.309 112.480 173.419 1.00 76.61  ? 14   ALA C CA    1 
ATOM   1515  C C     . ALA C 3 6   ? 116.957 113.653 172.522 1.00 76.61  ? 14   ALA C C     1 
ATOM   1516  O O     . ALA C 3 6   ? 116.409 113.461 171.432 1.00 76.61  ? 14   ALA C O     1 
ATOM   1517  C CB    . ALA C 3 6   ? 118.034 111.393 172.634 1.00 76.61  ? 14   ALA C CB    1 
ATOM   1518  N N     . LYS C 3 7   ? 117.247 114.861 172.988 1.00 69.62  ? 15   LYS C N     1 
ATOM   1519  C CA    . LYS C 3 7   ? 117.209 116.013 172.107 1.00 69.62  ? 15   LYS C CA    1 
ATOM   1520  C C     . LYS C 3 7   ? 118.306 115.884 171.066 1.00 69.62  ? 15   LYS C C     1 
ATOM   1521  O O     . LYS C 3 7   ? 119.418 115.445 171.369 1.00 69.62  ? 15   LYS C O     1 
ATOM   1522  C CB    . LYS C 3 7   ? 117.397 117.305 172.896 1.00 69.62  ? 15   LYS C CB    1 
ATOM   1523  C CG    . LYS C 3 7   ? 116.253 117.672 173.811 1.00 69.62  ? 15   LYS C CG    1 
ATOM   1524  C CD    . LYS C 3 7   ? 115.058 118.148 173.005 1.00 69.62  ? 15   LYS C CD    1 
ATOM   1525  C CE    . LYS C 3 7   ? 113.925 118.597 173.910 1.00 69.62  ? 15   LYS C CE    1 
ATOM   1526  N NZ    . LYS C 3 7   ? 114.282 119.833 174.660 1.00 69.62  ? 15   LYS C NZ    1 
ATOM   1527  N N     . THR C 3 8   ? 117.984 116.236 169.830 1.00 60.16  ? 16   THR C N     1 
ATOM   1528  C CA    . THR C 3 8   ? 119.026 116.345 168.829 1.00 60.16  ? 16   THR C CA    1 
ATOM   1529  C C     . THR C 3 8   ? 119.914 117.537 169.151 1.00 60.16  ? 16   THR C C     1 
ATOM   1530  O O     . THR C 3 8   ? 119.504 118.478 169.839 1.00 60.16  ? 16   THR C O     1 
ATOM   1531  C CB    . THR C 3 8   ? 118.431 116.494 167.436 1.00 60.16  ? 16   THR C CB    1 
ATOM   1532  O OG1   . THR C 3 8   ? 117.589 117.649 167.406 1.00 60.16  ? 16   THR C OG1   1 
ATOM   1533  C CG2   . THR C 3 8   ? 117.618 115.274 167.070 1.00 60.16  ? 16   THR C CG2   1 
ATOM   1534  N N     . ARG C 3 9   ? 121.151 117.476 168.659 1.00 52.98  ? 17   ARG C N     1 
ATOM   1535  C CA    . ARG C 3 9   ? 122.135 118.500 168.983 1.00 52.98  ? 17   ARG C CA    1 
ATOM   1536  C C     . ARG C 3 9   ? 121.773 119.832 168.339 1.00 52.98  ? 17   ARG C C     1 
ATOM   1537  O O     . ARG C 3 9   ? 122.053 120.895 168.907 1.00 52.98  ? 17   ARG C O     1 
ATOM   1538  C CB    . ARG C 3 9   ? 123.515 118.021 168.545 1.00 52.98  ? 17   ARG C CB    1 
ATOM   1539  C CG    . ARG C 3 9   ? 124.642 118.751 169.201 1.00 52.98  ? 17   ARG C CG    1 
ATOM   1540  C CD    . ARG C 3 9   ? 126.023 118.277 168.757 1.00 52.98  ? 17   ARG C CD    1 
ATOM   1541  N NE    . ARG C 3 9   ? 126.269 116.864 169.004 1.00 52.98  ? 17   ARG C NE    1 
ATOM   1542  C CZ    . ARG C 3 9   ? 126.550 115.985 168.050 1.00 52.98  ? 17   ARG C CZ    1 
ATOM   1543  N NH1   . ARG C 3 9   ? 126.633 116.375 166.789 1.00 52.98  ? 17   ARG C NH1   1 
ATOM   1544  N NH2   . ARG C 3 9   ? 126.756 114.716 168.355 1.00 52.98  ? 17   ARG C NH2   1 
ATOM   1545  N N     . SER C 3 10  ? 121.093 119.784 167.193 1.00 46.04  ? 18   SER C N     1 
ATOM   1546  C CA    . SER C 3 10  ? 120.538 120.985 166.580 1.00 46.04  ? 18   SER C CA    1 
ATOM   1547  C C     . SER C 3 10  ? 119.480 121.622 167.471 1.00 46.04  ? 18   SER C C     1 
ATOM   1548  O O     . SER C 3 10  ? 119.465 122.843 167.664 1.00 46.04  ? 18   SER C O     1 
ATOM   1549  C CB    . SER C 3 10  ? 119.940 120.634 165.221 1.00 46.04  ? 18   SER C CB    1 
ATOM   1550  O OG    . SER C 3 10  ? 120.925 120.130 164.345 1.00 46.04  ? 18   SER C OG    1 
ATOM   1551  N N     . SER C 3 11  ? 118.584 120.804 168.021 1.00 47.73  ? 19   SER C N     1 
ATOM   1552  C CA    . SER C 3 11  ? 117.528 121.322 168.881 1.00 47.73  ? 19   SER C CA    1 
ATOM   1553  C C     . SER C 3 11  ? 118.079 121.841 170.195 1.00 47.73  ? 19   SER C C     1 
ATOM   1554  O O     . SER C 3 11  ? 117.485 122.740 170.795 1.00 47.73  ? 19   SER C O     1 
ATOM   1555  C CB    . SER C 3 11  ? 116.496 120.236 169.146 1.00 47.73  ? 19   SER C CB    1 
ATOM   1556  O OG    . SER C 3 11  ? 117.082 119.181 169.886 1.00 47.73  ? 19   SER C OG    1 
ATOM   1557  N N     . ARG C 3 12  ? 119.197 121.285 170.661 1.00 53.02  ? 20   ARG C N     1 
ATOM   1558  C CA    . ARG C 3 12  ? 119.880 121.876 171.805 1.00 53.02  ? 20   ARG C CA    1 
ATOM   1559  C C     . ARG C 3 12  ? 120.449 123.238 171.448 1.00 53.02  ? 20   ARG C C     1 
ATOM   1560  O O     . ARG C 3 12  ? 120.277 124.209 172.191 1.00 53.02  ? 20   ARG C O     1 
ATOM   1561  C CB    . ARG C 3 12  ? 120.997 120.963 172.301 1.00 53.02  ? 20   ARG C CB    1 
ATOM   1562  C CG    . ARG C 3 12  ? 120.534 119.672 172.918 1.00 53.02  ? 20   ARG C CG    1 
ATOM   1563  C CD    . ARG C 3 12  ? 121.718 118.922 173.480 1.00 53.02  ? 20   ARG C CD    1 
ATOM   1564  N NE    . ARG C 3 12  ? 121.348 117.631 174.043 1.00 53.02  ? 20   ARG C NE    1 
ATOM   1565  C CZ    . ARG C 3 12  ? 120.933 117.457 175.293 1.00 53.02  ? 20   ARG C CZ    1 
ATOM   1566  N NH1   . ARG C 3 12  ? 120.827 118.496 176.108 1.00 53.02  ? 20   ARG C NH1   1 
ATOM   1567  N NH2   . ARG C 3 12  ? 120.617 116.245 175.728 1.00 53.02  ? 20   ARG C NH2   1 
ATOM   1568  N N     . ALA C 3 13  ? 121.117 123.334 170.303 1.00 43.86  ? 21   ALA C N     1 
ATOM   1569  C CA    . ALA C 3 13  ? 121.790 124.570 169.929 1.00 43.86  ? 21   ALA C CA    1 
ATOM   1570  C C     . ALA C 3 13  ? 120.854 125.630 169.374 1.00 43.86  ? 21   ALA C C     1 
ATOM   1571  O O     . ALA C 3 13  ? 121.312 126.737 169.086 1.00 43.86  ? 21   ALA C O     1 
ATOM   1572  C CB    . ALA C 3 13  ? 122.884 124.281 168.905 1.00 43.86  ? 21   ALA C CB    1 
ATOM   1573  N N     . GLY C 3 14  ? 119.575 125.328 169.200 1.00 36.52  ? 22   GLY C N     1 
ATOM   1574  C CA    . GLY C 3 14  ? 118.646 126.340 168.736 1.00 36.52  ? 22   GLY C CA    1 
ATOM   1575  C C     . GLY C 3 14  ? 118.772 126.645 167.265 1.00 36.52  ? 22   GLY C C     1 
ATOM   1576  O O     . GLY C 3 14  ? 118.641 127.804 166.860 1.00 36.52  ? 22   GLY C O     1 
ATOM   1577  N N     . LEU C 3 15  ? 119.023 125.632 166.447 1.00 32.05  ? 23   LEU C N     1 
ATOM   1578  C CA    . LEU C 3 15  ? 119.294 125.825 165.037 1.00 32.05  ? 23   LEU C CA    1 
ATOM   1579  C C     . LEU C 3 15  ? 118.319 125.002 164.220 1.00 32.05  ? 23   LEU C C     1 
ATOM   1580  O O     . LEU C 3 15  ? 117.439 124.322 164.751 1.00 32.05  ? 23   LEU C O     1 
ATOM   1581  C CB    . LEU C 3 15  ? 120.725 125.421 164.682 1.00 32.05  ? 23   LEU C CB    1 
ATOM   1582  C CG    . LEU C 3 15  ? 121.864 126.165 165.356 1.00 32.05  ? 23   LEU C CG    1 
ATOM   1583  C CD1   . LEU C 3 15  ? 123.158 125.565 164.884 1.00 32.05  ? 23   LEU C CD1   1 
ATOM   1584  C CD2   . LEU C 3 15  ? 121.819 127.645 165.069 1.00 32.05  ? 23   LEU C CD2   1 
ATOM   1585  N N     . GLN C 3 16  ? 118.496 125.057 162.913 1.00 31.00  ? 24   GLN C N     1 
ATOM   1586  C CA    . GLN C 3 16  ? 117.700 124.262 162.001 1.00 31.00  ? 24   GLN C CA    1 
ATOM   1587  C C     . GLN C 3 16  ? 118.532 123.307 161.176 1.00 31.00  ? 24   GLN C C     1 
ATOM   1588  O O     . GLN C 3 16  ? 118.074 122.201 160.897 1.00 31.00  ? 24   GLN C O     1 
ATOM   1589  C CB    . GLN C 3 16  ? 116.911 125.173 161.058 1.00 31.00  ? 24   GLN C CB    1 
ATOM   1590  C CG    . GLN C 3 16  ? 116.053 126.179 161.788 1.00 31.00  ? 24   GLN C CG    1 
ATOM   1591  C CD    . GLN C 3 16  ? 115.016 125.537 162.679 1.00 31.00  ? 24   GLN C CD    1 
ATOM   1592  O OE1   . GLN C 3 16  ? 114.398 124.539 162.320 1.00 31.00  ? 24   GLN C OE1   1 
ATOM   1593  N NE2   . GLN C 3 16  ? 114.827 126.104 163.858 1.00 31.00  ? 24   GLN C NE2   1 
ATOM   1594  N N     . PHE C 3 17  ? 119.741 123.699 160.794 1.00 27.58  ? 25   PHE C N     1 
ATOM   1595  C CA    . PHE C 3 17  ? 120.627 122.837 160.036 1.00 27.58  ? 25   PHE C CA    1 
ATOM   1596  C C     . PHE C 3 17  ? 121.159 121.690 160.893 1.00 27.58  ? 25   PHE C C     1 
ATOM   1597  O O     . PHE C 3 17  ? 121.377 121.850 162.093 1.00 27.58  ? 25   PHE C O     1 
ATOM   1598  C CB    . PHE C 3 17  ? 121.768 123.661 159.477 1.00 27.58  ? 25   PHE C CB    1 
ATOM   1599  C CG    . PHE C 3 17  ? 121.435 124.309 158.200 1.00 27.58  ? 25   PHE C CG    1 
ATOM   1600  C CD1   . PHE C 3 17  ? 121.657 123.648 157.016 1.00 27.58  ? 25   PHE C CD1   1 
ATOM   1601  C CD2   . PHE C 3 17  ? 120.841 125.546 158.169 1.00 27.58  ? 25   PHE C CD2   1 
ATOM   1602  C CE1   . PHE C 3 17  ? 121.346 124.225 155.821 1.00 27.58  ? 25   PHE C CE1   1 
ATOM   1603  C CE2   . PHE C 3 17  ? 120.514 126.122 156.968 1.00 27.58  ? 25   PHE C CE2   1 
ATOM   1604  C CZ    . PHE C 3 17  ? 120.772 125.464 155.792 1.00 27.58  ? 25   PHE C CZ    1 
ATOM   1605  N N     . PRO C 3 18  ? 121.351 120.517 160.305 1.00 30.77  ? 26   PRO C N     1 
ATOM   1606  C CA    . PRO C 3 18  ? 121.631 119.322 161.105 1.00 30.77  ? 26   PRO C CA    1 
ATOM   1607  C C     . PRO C 3 18  ? 123.061 119.311 161.615 1.00 30.77  ? 26   PRO C C     1 
ATOM   1608  O O     . PRO C 3 18  ? 124.015 119.098 160.857 1.00 30.77  ? 26   PRO C O     1 
ATOM   1609  C CB    . PRO C 3 18  ? 121.360 118.180 160.121 1.00 30.77  ? 26   PRO C CB    1 
ATOM   1610  C CG    . PRO C 3 18  ? 121.598 118.775 158.807 1.00 30.77  ? 26   PRO C CG    1 
ATOM   1611  C CD    . PRO C 3 18  ? 121.192 120.188 158.880 1.00 30.77  ? 26   PRO C CD    1 
ATOM   1612  N N     . VAL C 3 19  ? 123.210 119.541 162.917 1.00 31.01  ? 27   VAL C N     1 
ATOM   1613  C CA    . VAL C 3 19  ? 124.527 119.663 163.524 1.00 31.01  ? 27   VAL C CA    1 
ATOM   1614  C C     . VAL C 3 19  ? 125.271 118.340 163.458 1.00 31.01  ? 27   VAL C C     1 
ATOM   1615  O O     . VAL C 3 19  ? 126.466 118.300 163.153 1.00 31.01  ? 27   VAL C O     1 
ATOM   1616  C CB    . VAL C 3 19  ? 124.380 120.176 164.960 1.00 31.01  ? 27   VAL C CB    1 
ATOM   1617  C CG1   . VAL C 3 19  ? 125.689 120.175 165.637 1.00 31.01  ? 27   VAL C CG1   1 
ATOM   1618  C CG2   . VAL C 3 19  ? 123.858 121.575 164.928 1.00 31.01  ? 27   VAL C CG2   1 
ATOM   1619  N N     . GLY C 3 20  ? 124.558 117.231 163.645 1.00 38.01  ? 28   GLY C N     1 
ATOM   1620  C CA    . GLY C 3 20  ? 125.187 115.930 163.509 1.00 38.01  ? 28   GLY C CA    1 
ATOM   1621  C C     . GLY C 3 20  ? 125.618 115.607 162.093 1.00 38.01  ? 28   GLY C C     1 
ATOM   1622  O O     . GLY C 3 20  ? 126.651 114.962 161.889 1.00 38.01  ? 28   GLY C O     1 
ATOM   1623  N N     . ARG C 3 21  ? 124.870 116.082 161.098 1.00 35.46  ? 29   ARG C N     1 
ATOM   1624  C CA    . ARG C 3 21  ? 125.251 115.827 159.715 1.00 35.46  ? 29   ARG C CA    1 
ATOM   1625  C C     . ARG C 3 21  ? 126.455 116.657 159.310 1.00 35.46  ? 29   ARG C C     1 
ATOM   1626  O O     . ARG C 3 21  ? 127.356 116.157 158.628 1.00 35.46  ? 29   ARG C O     1 
ATOM   1627  C CB    . ARG C 3 21  ? 124.078 116.097 158.787 1.00 35.46  ? 29   ARG C CB    1 
ATOM   1628  C CG    . ARG C 3 21  ? 124.406 116.004 157.326 1.00 35.46  ? 29   ARG C CG    1 
ATOM   1629  C CD    . ARG C 3 21  ? 123.166 116.089 156.495 1.00 35.46  ? 29   ARG C CD    1 
ATOM   1630  N NE    . ARG C 3 21  ? 122.371 114.887 156.679 1.00 35.46  ? 29   ARG C NE    1 
ATOM   1631  C CZ    . ARG C 3 21  ? 121.150 114.728 156.200 1.00 35.46  ? 29   ARG C CZ    1 
ATOM   1632  N NH1   . ARG C 3 21  ? 120.581 115.698 155.509 1.00 35.46  ? 29   ARG C NH1   1 
ATOM   1633  N NH2   . ARG C 3 21  ? 120.497 113.598 156.416 1.00 35.46  ? 29   ARG C NH2   1 
ATOM   1634  N N     . VAL C 3 22  ? 126.505 117.917 159.739 1.00 32.13  ? 30   VAL C N     1 
ATOM   1635  C CA    . VAL C 3 22  ? 127.696 118.718 159.489 1.00 32.13  ? 30   VAL C CA    1 
ATOM   1636  C C     . VAL C 3 22  ? 128.891 118.153 160.244 1.00 32.13  ? 30   VAL C C     1 
ATOM   1637  O O     . VAL C 3 22  ? 130.014 118.149 159.722 1.00 32.13  ? 30   VAL C O     1 
ATOM   1638  C CB    . VAL C 3 22  ? 127.382 120.181 159.824 1.00 32.13  ? 30   VAL C CB    1 
ATOM   1639  C CG1   . VAL C 3 22  ? 128.601 121.013 159.859 1.00 32.13  ? 30   VAL C CG1   1 
ATOM   1640  C CG2   . VAL C 3 22  ? 126.500 120.723 158.757 1.00 32.13  ? 30   VAL C CG2   1 
ATOM   1641  N N     . HIS C 3 23  ? 128.655 117.560 161.415 1.00 33.63  ? 31   HIS C N     1 
ATOM   1642  C CA    . HIS C 3 23  ? 129.741 116.932 162.155 1.00 33.63  ? 31   HIS C CA    1 
ATOM   1643  C C     . HIS C 3 23  ? 130.281 115.708 161.434 1.00 33.63  ? 31   HIS C C     1 
ATOM   1644  O O     . HIS C 3 23  ? 131.498 115.539 161.343 1.00 33.63  ? 31   HIS C O     1 
ATOM   1645  C CB    . HIS C 3 23  ? 129.288 116.547 163.553 1.00 33.63  ? 31   HIS C CB    1 
ATOM   1646  C CG    . HIS C 3 23  ? 130.408 116.121 164.445 1.00 33.63  ? 31   HIS C CG    1 
ATOM   1647  N ND1   . HIS C 3 23  ? 130.895 114.834 164.466 1.00 33.63  ? 31   HIS C ND1   1 
ATOM   1648  C CD2   . HIS C 3 23  ? 131.129 116.812 165.355 1.00 33.63  ? 31   HIS C CD2   1 
ATOM   1649  C CE1   . HIS C 3 23  ? 131.877 114.754 165.344 1.00 33.63  ? 31   HIS C CE1   1 
ATOM   1650  N NE2   . HIS C 3 23  ? 132.036 115.941 165.900 1.00 33.63  ? 31   HIS C NE2   1 
ATOM   1651  N N     . ARG C 3 24  ? 129.413 114.852 160.896 1.00 37.51  ? 32   ARG C N     1 
ATOM   1652  C CA    . ARG C 3 24  ? 129.965 113.694 160.199 1.00 37.51  ? 32   ARG C CA    1 
ATOM   1653  C C     . ARG C 3 24  ? 130.544 114.052 158.838 1.00 37.51  ? 32   ARG C C     1 
ATOM   1654  O O     . ARG C 3 24  ? 131.462 113.369 158.379 1.00 37.51  ? 32   ARG C O     1 
ATOM   1655  C CB    . ARG C 3 24  ? 128.944 112.572 160.034 1.00 37.51  ? 32   ARG C CB    1 
ATOM   1656  C CG    . ARG C 3 24  ? 127.747 112.909 159.193 1.00 37.51  ? 32   ARG C CG    1 
ATOM   1657  C CD    . ARG C 3 24  ? 126.927 111.679 158.915 1.00 37.51  ? 32   ARG C CD    1 
ATOM   1658  N NE    . ARG C 3 24  ? 127.561 110.835 157.918 1.00 37.51  ? 32   ARG C NE    1 
ATOM   1659  C CZ    . ARG C 3 24  ? 127.360 110.968 156.614 1.00 37.51  ? 32   ARG C CZ    1 
ATOM   1660  N NH1   . ARG C 3 24  ? 126.531 111.898 156.163 1.00 37.51  ? 32   ARG C NH1   1 
ATOM   1661  N NH2   . ARG C 3 24  ? 127.978 110.167 155.761 1.00 37.51  ? 32   ARG C NH2   1 
ATOM   1662  N N     . LEU C 3 25  ? 130.066 115.119 158.192 1.00 33.10  ? 33   LEU C N     1 
ATOM   1663  C CA    . LEU C 3 25  ? 130.692 115.530 156.938 1.00 33.10  ? 33   LEU C CA    1 
ATOM   1664  C C     . LEU C 3 25  ? 132.076 116.115 157.172 1.00 33.10  ? 33   LEU C C     1 
ATOM   1665  O O     . LEU C 3 25  ? 133.005 115.835 156.401 1.00 33.10  ? 33   LEU C O     1 
ATOM   1666  C CB    . LEU C 3 25  ? 129.807 116.511 156.180 1.00 33.10  ? 33   LEU C CB    1 
ATOM   1667  C CG    . LEU C 3 25  ? 128.919 115.909 155.092 1.00 33.10  ? 33   LEU C CG    1 
ATOM   1668  C CD1   . LEU C 3 25  ? 127.865 114.992 155.634 1.00 33.10  ? 33   LEU C CD1   1 
ATOM   1669  C CD2   . LEU C 3 25  ? 128.263 116.998 154.287 1.00 33.10  ? 33   LEU C CD2   1 
ATOM   1670  N N     . LEU C 3 26  ? 132.245 116.894 158.244 1.00 29.89  ? 34   LEU C N     1 
ATOM   1671  C CA    . LEU C 3 26  ? 133.588 117.305 158.636 1.00 29.89  ? 34   LEU C CA    1 
ATOM   1672  C C     . LEU C 3 26  ? 134.438 116.107 159.015 1.00 29.89  ? 34   LEU C C     1 
ATOM   1673  O O     . LEU C 3 26  ? 135.615 116.030 158.654 1.00 29.89  ? 34   LEU C O     1 
ATOM   1674  C CB    . LEU C 3 26  ? 133.545 118.271 159.814 1.00 29.89  ? 34   LEU C CB    1 
ATOM   1675  C CG    . LEU C 3 26  ? 133.145 119.723 159.688 1.00 29.89  ? 34   LEU C CG    1 
ATOM   1676  C CD1   . LEU C 3 26  ? 133.137 120.291 161.066 1.00 29.89  ? 34   LEU C CD1   1 
ATOM   1677  C CD2   . LEU C 3 26  ? 134.152 120.420 158.853 1.00 29.89  ? 34   LEU C CD2   1 
ATOM   1678  N N     . ARG C 3 27  ? 133.844 115.150 159.714 1.00 44.14  ? 35   ARG C N     1 
ATOM   1679  C CA    . ARG C 3 27  ? 134.591 114.060 160.310 1.00 44.14  ? 35   ARG C CA    1 
ATOM   1680  C C     . ARG C 3 27  ? 135.068 113.057 159.272 1.00 44.14  ? 35   ARG C C     1 
ATOM   1681  O O     . ARG C 3 27  ? 136.112 112.428 159.462 1.00 44.14  ? 35   ARG C O     1 
ATOM   1682  C CB    . ARG C 3 27  ? 133.700 113.406 161.361 1.00 44.14  ? 35   ARG C CB    1 
ATOM   1683  C CG    . ARG C 3 27  ? 134.315 112.375 162.249 1.00 44.14  ? 35   ARG C CG    1 
ATOM   1684  C CD    . ARG C 3 27  ? 133.248 111.956 163.236 1.00 44.14  ? 35   ARG C CD    1 
ATOM   1685  N NE    . ARG C 3 27  ? 133.676 110.859 164.083 1.00 44.14  ? 35   ARG C NE    1 
ATOM   1686  C CZ    . ARG C 3 27  ? 134.338 111.025 165.220 1.00 44.14  ? 35   ARG C CZ    1 
ATOM   1687  N NH1   . ARG C 3 27  ? 134.634 112.246 165.630 1.00 44.14  ? 35   ARG C NH1   1 
ATOM   1688  N NH2   . ARG C 3 27  ? 134.701 109.977 165.944 1.00 44.14  ? 35   ARG C NH2   1 
ATOM   1689  N N     . LYS C 3 28  ? 134.348 112.907 158.164 1.00 35.53  ? 36   LYS C N     1 
ATOM   1690  C CA    . LYS C 3 28  ? 134.790 111.986 157.131 1.00 35.53  ? 36   LYS C CA    1 
ATOM   1691  C C     . LYS C 3 28  ? 135.406 112.680 155.930 1.00 35.53  ? 36   LYS C C     1 
ATOM   1692  O O     . LYS C 3 28  ? 135.964 111.998 155.072 1.00 35.53  ? 36   LYS C O     1 
ATOM   1693  C CB    . LYS C 3 28  ? 133.640 111.104 156.638 1.00 35.53  ? 36   LYS C CB    1 
ATOM   1694  C CG    . LYS C 3 28  ? 132.716 111.779 155.647 1.00 35.53  ? 36   LYS C CG    1 
ATOM   1695  C CD    . LYS C 3 28  ? 131.650 110.808 155.172 1.00 35.53  ? 36   LYS C CD    1 
ATOM   1696  C CE    . LYS C 3 28  ? 130.741 111.426 154.125 1.00 35.53  ? 36   LYS C CE    1 
ATOM   1697  N NZ    . LYS C 3 28  ? 131.450 111.686 152.843 1.00 35.53  ? 36   LYS C NZ    1 
ATOM   1698  N N     . GLY C 3 29  ? 135.329 114.005 155.839 1.00 33.16  ? 37   GLY C N     1 
ATOM   1699  C CA    . GLY C 3 29  ? 135.968 114.638 154.701 1.00 33.16  ? 37   GLY C CA    1 
ATOM   1700  C C     . GLY C 3 29  ? 137.480 114.753 154.764 1.00 33.16  ? 37   GLY C C     1 
ATOM   1701  O O     . GLY C 3 29  ? 138.081 115.131 153.754 1.00 33.16  ? 37   GLY C O     1 
ATOM   1702  N N     . ASN C 3 30  ? 138.096 114.411 155.901 1.00 33.33  ? 38   ASN C N     1 
ATOM   1703  C CA    . ASN C 3 30  ? 139.523 114.616 156.181 1.00 33.33  ? 38   ASN C CA    1 
ATOM   1704  C C     . ASN C 3 30  ? 139.913 116.084 156.002 1.00 33.33  ? 38   ASN C C     1 
ATOM   1705  O O     . ASN C 3 30  ? 140.629 116.477 155.082 1.00 33.33  ? 38   ASN C O     1 
ATOM   1706  C CB    . ASN C 3 30  ? 140.420 113.689 155.356 1.00 33.33  ? 38   ASN C CB    1 
ATOM   1707  C CG    . ASN C 3 30  ? 140.493 112.301 155.932 1.00 33.33  ? 38   ASN C CG    1 
ATOM   1708  O OD1   . ASN C 3 30  ? 139.983 111.345 155.354 1.00 33.33  ? 38   ASN C OD1   1 
ATOM   1709  N ND2   . ASN C 3 30  ? 141.152 112.176 157.079 1.00 33.33  ? 38   ASN C ND2   1 
ATOM   1710  N N     . TYR C 3 31  ? 139.378 116.886 156.914 1.00 27.26  ? 39   TYR C N     1 
ATOM   1711  C CA    . TYR C 3 31  ? 139.763 118.277 157.043 1.00 27.26  ? 39   TYR C CA    1 
ATOM   1712  C C     . TYR C 3 31  ? 140.714 118.507 158.203 1.00 27.26  ? 39   TYR C C     1 
ATOM   1713  O O     . TYR C 3 31  ? 141.434 119.506 158.198 1.00 27.26  ? 39   TYR C O     1 
ATOM   1714  C CB    . TYR C 3 31  ? 138.516 119.140 157.211 1.00 27.26  ? 39   TYR C CB    1 
ATOM   1715  C CG    . TYR C 3 31  ? 137.604 119.108 156.016 1.00 27.26  ? 39   TYR C CG    1 
ATOM   1716  C CD1   . TYR C 3 31  ? 137.822 119.935 154.931 1.00 27.26  ? 39   TYR C CD1   1 
ATOM   1717  C CD2   . TYR C 3 31  ? 136.534 118.241 155.969 1.00 27.26  ? 39   TYR C CD2   1 
ATOM   1718  C CE1   . TYR C 3 31  ? 136.991 119.899 153.840 1.00 27.26  ? 39   TYR C CE1   1 
ATOM   1719  C CE2   . TYR C 3 31  ? 135.708 118.200 154.888 1.00 27.26  ? 39   TYR C CE2   1 
ATOM   1720  C CZ    . TYR C 3 31  ? 135.936 119.023 153.832 1.00 27.26  ? 39   TYR C CZ    1 
ATOM   1721  O OH    . TYR C 3 31  ? 135.089 118.962 152.759 1.00 27.26  ? 39   TYR C OH    1 
ATOM   1722  N N     . ALA C 3 32  ? 140.737 117.600 159.176 1.00 30.21  ? 40   ALA C N     1 
ATOM   1723  C CA    . ALA C 3 32  ? 141.716 117.577 160.253 1.00 30.21  ? 40   ALA C CA    1 
ATOM   1724  C C     . ALA C 3 32  ? 141.633 116.221 160.930 1.00 30.21  ? 40   ALA C C     1 
ATOM   1725  O O     . ALA C 3 32  ? 140.759 115.408 160.626 1.00 30.21  ? 40   ALA C O     1 
ATOM   1726  C CB    . ALA C 3 32  ? 141.485 118.676 161.282 1.00 30.21  ? 40   ALA C CB    1 
ATOM   1727  N N     . GLU C 3 33  ? 142.559 115.987 161.861 1.00 39.08  ? 41   GLU C N     1 
ATOM   1728  C CA    . GLU C 3 33  ? 142.484 114.781 162.672 1.00 39.08  ? 41   GLU C CA    1 
ATOM   1729  C C     . GLU C 3 33  ? 141.286 114.827 163.602 1.00 39.08  ? 41   GLU C C     1 
ATOM   1730  O O     . GLU C 3 33  ? 140.464 113.908 163.620 1.00 39.08  ? 41   GLU C O     1 
ATOM   1731  C CB    . GLU C 3 33  ? 143.753 114.599 163.495 1.00 39.08  ? 41   GLU C CB    1 
ATOM   1732  C CG    . GLU C 3 33  ? 144.975 114.178 162.723 1.00 39.08  ? 41   GLU C CG    1 
ATOM   1733  C CD    . GLU C 3 33  ? 146.146 113.861 163.643 1.00 39.08  ? 41   GLU C CD    1 
ATOM   1734  O OE1   . GLU C 3 33  ? 146.032 114.096 164.863 1.00 39.08  ? 41   GLU C OE1   1 
ATOM   1735  O OE2   . GLU C 3 33  ? 147.179 113.362 163.151 1.00 39.08  ? 41   GLU C OE2   1 
ATOM   1736  N N     . ARG C 3 34  ? 141.172 115.891 164.377 1.00 40.77  ? 42   ARG C N     1 
ATOM   1737  C CA    . ARG C 3 34  ? 140.189 115.992 165.440 1.00 40.77  ? 42   ARG C CA    1 
ATOM   1738  C C     . ARG C 3 34  ? 139.191 117.080 165.104 1.00 40.77  ? 42   ARG C C     1 
ATOM   1739  O O     . ARG C 3 34  ? 139.562 118.246 164.985 1.00 40.77  ? 42   ARG C O     1 
ATOM   1740  C CB    . ARG C 3 34  ? 140.877 116.304 166.762 1.00 40.77  ? 42   ARG C CB    1 
ATOM   1741  C CG    . ARG C 3 34  ? 141.666 115.164 167.324 1.00 40.77  ? 42   ARG C CG    1 
ATOM   1742  C CD    . ARG C 3 34  ? 142.384 115.612 168.565 1.00 40.77  ? 42   ARG C CD    1 
ATOM   1743  N NE    . ARG C 3 34  ? 143.083 114.501 169.170 1.00 40.77  ? 42   ARG C NE    1 
ATOM   1744  C CZ    . ARG C 3 34  ? 142.542 113.725 170.095 1.00 40.77  ? 42   ARG C CZ    1 
ATOM   1745  N NH1   . ARG C 3 34  ? 141.314 113.969 170.514 1.00 40.77  ? 42   ARG C NH1   1 
ATOM   1746  N NH2   . ARG C 3 34  ? 143.226 112.718 170.608 1.00 40.77  ? 42   ARG C NH2   1 
ATOM   1747  N N     . VAL C 3 35  ? 137.939 116.715 164.970 1.00 34.05  ? 43   VAL C N     1 
ATOM   1748  C CA    . VAL C 3 35  ? 136.890 117.706 164.825 1.00 34.05  ? 43   VAL C CA    1 
ATOM   1749  C C     . VAL C 3 35  ? 136.360 118.024 166.209 1.00 34.05  ? 43   VAL C C     1 
ATOM   1750  O O     . VAL C 3 35  ? 136.042 117.119 166.982 1.00 34.05  ? 43   VAL C O     1 
ATOM   1751  C CB    . VAL C 3 35  ? 135.779 117.207 163.896 1.00 34.05  ? 43   VAL C CB    1 
ATOM   1752  C CG1   . VAL C 3 35  ? 134.658 118.214 163.822 1.00 34.05  ? 43   VAL C CG1   1 
ATOM   1753  C CG2   . VAL C 3 35  ? 136.345 116.952 162.527 1.00 34.05  ? 43   VAL C CG2   1 
ATOM   1754  N N     . GLY C 3 36  ? 136.281 119.307 166.527 1.00 28.41  ? 44   GLY C N     1 
ATOM   1755  C CA    . GLY C 3 36  ? 135.960 119.738 167.863 1.00 28.41  ? 44   GLY C CA    1 
ATOM   1756  C C     . GLY C 3 36  ? 134.499 119.534 168.204 1.00 28.41  ? 44   GLY C C     1 
ATOM   1757  O O     . GLY C 3 36  ? 133.738 118.857 167.514 1.00 28.41  ? 44   GLY C O     1 
ATOM   1758  N N     . ALA C 3 37  ? 134.108 120.131 169.320 1.00 29.22  ? 45   ALA C N     1 
ATOM   1759  C CA    . ALA C 3 37  ? 132.714 120.085 169.725 1.00 29.22  ? 45   ALA C CA    1 
ATOM   1760  C C     . ALA C 3 37  ? 131.958 121.305 169.244 1.00 29.22  ? 45   ALA C C     1 
ATOM   1761  O O     . ALA C 3 37  ? 130.832 121.182 168.760 1.00 29.22  ? 45   ALA C O     1 
ATOM   1762  C CB    . ALA C 3 37  ? 132.598 119.974 171.243 1.00 29.22  ? 45   ALA C CB    1 
ATOM   1763  N N     . GLY C 3 38  ? 132.558 122.483 169.360 1.00 27.52  ? 46   GLY C N     1 
ATOM   1764  C CA    . GLY C 3 38  ? 131.922 123.685 168.876 1.00 27.52  ? 46   GLY C CA    1 
ATOM   1765  C C     . GLY C 3 38  ? 131.928 123.839 167.380 1.00 27.52  ? 46   GLY C C     1 
ATOM   1766  O O     . GLY C 3 38  ? 131.236 124.720 166.864 1.00 27.52  ? 46   GLY C O     1 
ATOM   1767  N N     . ALA C 3 39  ? 132.677 122.987 166.675 1.00 26.66  ? 47   ALA C N     1 
ATOM   1768  C CA    . ALA C 3 39  ? 132.851 123.166 165.235 1.00 26.66  ? 47   ALA C CA    1 
ATOM   1769  C C     . ALA C 3 39  ? 131.576 122.952 164.427 1.00 26.66  ? 47   ALA C C     1 
ATOM   1770  O O     . ALA C 3 39  ? 131.245 123.843 163.623 1.00 26.66  ? 47   ALA C O     1 
ATOM   1771  C CB    . ALA C 3 39  ? 134.001 122.294 164.737 1.00 26.66  ? 47   ALA C CB    1 
ATOM   1772  N N     . PRO C 3 40  ? 130.810 121.855 164.566 1.00 28.09  ? 48   PRO C N     1 
ATOM   1773  C CA    . PRO C 3 40  ? 129.621 121.761 163.718 1.00 28.09  ? 48   PRO C CA    1 
ATOM   1774  C C     . PRO C 3 40  ? 128.523 122.707 164.147 1.00 28.09  ? 48   PRO C C     1 
ATOM   1775  O O     . PRO C 3 40  ? 127.768 123.160 163.284 1.00 28.09  ? 48   PRO C O     1 
ATOM   1776  C CB    . PRO C 3 40  ? 129.202 120.299 163.853 1.00 28.09  ? 48   PRO C CB    1 
ATOM   1777  C CG    . PRO C 3 40  ? 129.599 119.947 165.164 1.00 28.09  ? 48   PRO C CG    1 
ATOM   1778  C CD    . PRO C 3 40  ? 130.887 120.653 165.419 1.00 28.09  ? 48   PRO C CD    1 
ATOM   1779  N N     . VAL C 3 41  ? 128.455 123.065 165.431 1.00 27.19  ? 49   VAL C N     1 
ATOM   1780  C CA    . VAL C 3 41  ? 127.467 124.034 165.891 1.00 27.19  ? 49   VAL C CA    1 
ATOM   1781  C C     . VAL C 3 41  ? 127.745 125.406 165.293 1.00 27.19  ? 49   VAL C C     1 
ATOM   1782  O O     . VAL C 3 41  ? 126.843 126.055 164.744 1.00 27.19  ? 49   VAL C O     1 
ATOM   1783  C CB    . VAL C 3 41  ? 127.442 124.081 167.425 1.00 27.19  ? 49   VAL C CB    1 
ATOM   1784  C CG1   . VAL C 3 41  ? 126.575 125.203 167.892 1.00 27.19  ? 49   VAL C CG1   1 
ATOM   1785  C CG2   . VAL C 3 41  ? 126.911 122.793 167.965 1.00 27.19  ? 49   VAL C CG2   1 
ATOM   1786  N N     . TYR C 3 42  ? 129.004 125.840 165.343 1.00 20.54  ? 50   TYR C N     1 
ATOM   1787  C CA    . TYR C 3 42  ? 129.361 127.150 164.822 1.00 20.54  ? 50   TYR C CA    1 
ATOM   1788  C C     . TYR C 3 42  ? 129.182 127.199 163.317 1.00 20.54  ? 50   TYR C C     1 
ATOM   1789  O O     . TYR C 3 42  ? 128.672 128.188 162.769 1.00 20.54  ? 50   TYR C O     1 
ATOM   1790  C CB    . TYR C 3 42  ? 130.804 127.451 165.166 1.00 20.54  ? 50   TYR C CB    1 
ATOM   1791  C CG    . TYR C 3 42  ? 131.204 128.886 165.071 1.00 20.54  ? 50   TYR C CG    1 
ATOM   1792  C CD1   . TYR C 3 42  ? 131.131 129.701 166.174 1.00 20.54  ? 50   TYR C CD1   1 
ATOM   1793  C CD2   . TYR C 3 42  ? 131.644 129.430 163.884 1.00 20.54  ? 50   TYR C CD2   1 
ATOM   1794  C CE1   . TYR C 3 42  ? 131.517 130.997 166.109 1.00 20.54  ? 50   TYR C CE1   1 
ATOM   1795  C CE2   . TYR C 3 42  ? 132.014 130.733 163.807 1.00 20.54  ? 50   TYR C CE2   1 
ATOM   1796  C CZ    . TYR C 3 42  ? 131.948 131.511 164.925 1.00 20.54  ? 50   TYR C CZ    1 
ATOM   1797  O OH    . TYR C 3 42  ? 132.318 132.821 164.863 1.00 20.54  ? 50   TYR C OH    1 
ATOM   1798  N N     . LEU C 3 43  ? 129.548 126.123 162.638 1.00 21.91  ? 51   LEU C N     1 
ATOM   1799  C CA    . LEU C 3 43  ? 129.454 126.137 161.193 1.00 21.91  ? 51   LEU C CA    1 
ATOM   1800  C C     . LEU C 3 43  ? 128.017 126.003 160.714 1.00 21.91  ? 51   LEU C C     1 
ATOM   1801  O O     . LEU C 3 43  ? 127.650 126.622 159.712 1.00 21.91  ? 51   LEU C O     1 
ATOM   1802  C CB    . LEU C 3 43  ? 130.350 125.044 160.637 1.00 21.91  ? 51   LEU C CB    1 
ATOM   1803  C CG    . LEU C 3 43  ? 130.455 124.865 159.146 1.00 21.91  ? 51   LEU C CG    1 
ATOM   1804  C CD1   . LEU C 3 43  ? 130.833 126.144 158.535 1.00 21.91  ? 51   LEU C CD1   1 
ATOM   1805  C CD2   . LEU C 3 43  ? 131.543 123.892 158.920 1.00 21.91  ? 51   LEU C CD2   1 
ATOM   1806  N N     . ALA C 3 44  ? 127.177 125.264 161.436 1.00 21.82  ? 52   ALA C N     1 
ATOM   1807  C CA    . ALA C 3 44  ? 125.767 125.201 161.088 1.00 21.82  ? 52   ALA C CA    1 
ATOM   1808  C C     . ALA C 3 44  ? 125.074 126.525 161.333 1.00 21.82  ? 52   ALA C C     1 
ATOM   1809  O O     . ALA C 3 44  ? 124.155 126.882 160.592 1.00 21.82  ? 52   ALA C O     1 
ATOM   1810  C CB    . ALA C 3 44  ? 125.088 124.096 161.881 1.00 21.82  ? 52   ALA C CB    1 
ATOM   1811  N N     . ALA C 3 45  ? 125.505 127.277 162.347 1.00 26.72  ? 53   ALA C N     1 
ATOM   1812  C CA    . ALA C 3 45  ? 124.953 128.614 162.533 1.00 26.72  ? 53   ALA C CA    1 
ATOM   1813  C C     . ALA C 3 45  ? 125.338 129.545 161.390 1.00 26.72  ? 53   ALA C C     1 
ATOM   1814  O O     . ALA C 3 45  ? 124.505 130.333 160.921 1.00 26.72  ? 53   ALA C O     1 
ATOM   1815  C CB    . ALA C 3 45  ? 125.410 129.193 163.866 1.00 26.72  ? 53   ALA C CB    1 
ATOM   1816  N N     . VAL C 3 46  ? 126.585 129.460 160.920 1.00 23.91  ? 54   VAL C N     1 
ATOM   1817  C CA    . VAL C 3 46  ? 127.003 130.282 159.781 1.00 23.91  ? 54   VAL C CA    1 
ATOM   1818  C C     . VAL C 3 46  ? 126.219 129.916 158.520 1.00 23.91  ? 54   VAL C C     1 
ATOM   1819  O O     . VAL C 3 46  ? 125.778 130.798 157.764 1.00 23.91  ? 54   VAL C O     1 
ATOM   1820  C CB    . VAL C 3 46  ? 128.518 130.143 159.578 1.00 23.91  ? 54   VAL C CB    1 
ATOM   1821  C CG1   . VAL C 3 46  ? 128.966 130.798 158.309 1.00 23.91  ? 54   VAL C CG1   1 
ATOM   1822  C CG2   . VAL C 3 46  ? 129.230 130.752 160.738 1.00 23.91  ? 54   VAL C CG2   1 
ATOM   1823  N N     . LEU C 3 47  ? 125.985 128.619 158.303 1.00 22.28  ? 55   LEU C N     1 
ATOM   1824  C CA    . LEU C 3 47  ? 125.243 128.191 157.120 1.00 22.28  ? 55   LEU C CA    1 
ATOM   1825  C C     . LEU C 3 47  ? 123.780 128.594 157.198 1.00 22.28  ? 55   LEU C C     1 
ATOM   1826  O O     . LEU C 3 47  ? 123.179 128.955 156.179 1.00 22.28  ? 55   LEU C O     1 
ATOM   1827  C CB    . LEU C 3 47  ? 125.357 126.690 156.939 1.00 22.28  ? 55   LEU C CB    1 
ATOM   1828  C CG    . LEU C 3 47  ? 126.762 126.235 156.602 1.00 22.28  ? 55   LEU C CG    1 
ATOM   1829  C CD1   . LEU C 3 47  ? 126.805 124.741 156.456 1.00 22.28  ? 55   LEU C CD1   1 
ATOM   1830  C CD2   . LEU C 3 47  ? 127.233 126.909 155.359 1.00 22.28  ? 55   LEU C CD2   1 
ATOM   1831  N N     . GLU C 3 48  ? 123.197 128.560 158.399 1.00 26.98  ? 56   GLU C N     1 
ATOM   1832  C CA    . GLU C 3 48  ? 121.829 129.031 158.574 1.00 26.98  ? 56   GLU C CA    1 
ATOM   1833  C C     . GLU C 3 48  ? 121.716 130.520 158.314 1.00 26.98  ? 56   GLU C C     1 
ATOM   1834  O O     . GLU C 3 48  ? 120.739 130.974 157.710 1.00 26.98  ? 56   GLU C O     1 
ATOM   1835  C CB    . GLU C 3 48  ? 121.337 128.685 159.971 1.00 26.98  ? 56   GLU C CB    1 
ATOM   1836  C CG    . GLU C 3 48  ? 119.962 129.224 160.276 1.00 26.98  ? 56   GLU C CG    1 
ATOM   1837  C CD    . GLU C 3 48  ? 119.440 128.794 161.620 1.00 26.98  ? 56   GLU C CD    1 
ATOM   1838  O OE1   . GLU C 3 48  ? 120.109 127.986 162.285 1.00 26.98  ? 56   GLU C OE1   1 
ATOM   1839  O OE2   . GLU C 3 48  ? 118.368 129.283 162.027 1.00 26.98  ? 56   GLU C OE2   1 
ATOM   1840  N N     . TYR C 3 49  ? 122.730 131.286 158.708 1.00 28.62  ? 57   TYR C N     1 
ATOM   1841  C CA    . TYR C 3 49  ? 122.691 132.716 158.440 1.00 28.62  ? 57   TYR C CA    1 
ATOM   1842  C C     . TYR C 3 49  ? 122.772 133.016 156.951 1.00 28.62  ? 57   TYR C C     1 
ATOM   1843  O O     . TYR C 3 49  ? 122.031 133.869 156.444 1.00 28.62  ? 57   TYR C O     1 
ATOM   1844  C CB    . TYR C 3 49  ? 123.813 133.433 159.169 1.00 28.62  ? 57   TYR C CB    1 
ATOM   1845  C CG    . TYR C 3 49  ? 123.782 134.887 158.860 1.00 28.62  ? 57   TYR C CG    1 
ATOM   1846  C CD1   . TYR C 3 49  ? 122.740 135.668 159.309 1.00 28.62  ? 57   TYR C CD1   1 
ATOM   1847  C CD2   . TYR C 3 49  ? 124.778 135.483 158.120 1.00 28.62  ? 57   TYR C CD2   1 
ATOM   1848  C CE1   . TYR C 3 49  ? 122.687 137.002 159.023 1.00 28.62  ? 57   TYR C CE1   1 
ATOM   1849  C CE2   . TYR C 3 49  ? 124.734 136.817 157.829 1.00 28.62  ? 57   TYR C CE2   1 
ATOM   1850  C CZ    . TYR C 3 49  ? 123.690 137.575 158.284 1.00 28.62  ? 57   TYR C CZ    1 
ATOM   1851  O OH    . TYR C 3 49  ? 123.642 138.919 157.999 1.00 28.62  ? 57   TYR C OH    1 
ATOM   1852  N N     . LEU C 3 50  ? 123.631 132.300 156.228 1.00 25.60  ? 58   LEU C N     1 
ATOM   1853  C CA    . LEU C 3 50  ? 123.759 132.583 154.801 1.00 25.60  ? 58   LEU C CA    1 
ATOM   1854  C C     . LEU C 3 50  ? 122.526 132.140 154.021 1.00 25.60  ? 58   LEU C C     1 
ATOM   1855  O O     . LEU C 3 50  ? 122.076 132.851 153.105 1.00 25.60  ? 58   LEU C O     1 
ATOM   1856  C CB    . LEU C 3 50  ? 125.016 131.932 154.252 1.00 25.60  ? 58   LEU C CB    1 
ATOM   1857  C CG    . LEU C 3 50  ? 126.237 132.623 154.826 1.00 25.60  ? 58   LEU C CG    1 
ATOM   1858  C CD1   . LEU C 3 50  ? 127.451 131.928 154.364 1.00 25.60  ? 58   LEU C CD1   1 
ATOM   1859  C CD2   . LEU C 3 50  ? 126.268 134.049 154.386 1.00 25.60  ? 58   LEU C CD2   1 
ATOM   1860  N N     . THR C 3 51  ? 121.947 130.992 154.384 1.00 25.85  ? 59   THR C N     1 
ATOM   1861  C CA    . THR C 3 51  ? 120.722 130.567 153.724 1.00 25.85  ? 59   THR C CA    1 
ATOM   1862  C C     . THR C 3 51  ? 119.571 131.500 154.058 1.00 25.85  ? 59   THR C C     1 
ATOM   1863  O O     . THR C 3 51  ? 118.742 131.786 153.184 1.00 25.85  ? 59   THR C O     1 
ATOM   1864  C CB    . THR C 3 51  ? 120.389 129.135 154.116 1.00 25.85  ? 59   THR C CB    1 
ATOM   1865  O OG1   . THR C 3 51  ? 121.514 128.306 153.826 1.00 25.85  ? 59   THR C OG1   1 
ATOM   1866  C CG2   . THR C 3 51  ? 119.246 128.621 153.307 1.00 25.85  ? 59   THR C CG2   1 
ATOM   1867  N N     . ALA C 3 52  ? 119.547 132.039 155.282 1.00 29.04  ? 60   ALA C N     1 
ATOM   1868  C CA    . ALA C 3 52  ? 118.521 133.004 155.651 1.00 29.04  ? 60   ALA C CA    1 
ATOM   1869  C C     . ALA C 3 52  ? 118.623 134.265 154.816 1.00 29.04  ? 60   ALA C C     1 
ATOM   1870  O O     . ALA C 3 52  ? 117.607 134.777 154.336 1.00 29.04  ? 60   ALA C O     1 
ATOM   1871  C CB    . ALA C 3 52  ? 118.627 133.341 157.133 1.00 29.04  ? 60   ALA C CB    1 
ATOM   1872  N N     . GLU C 3 53  ? 119.845 134.737 154.571 1.00 31.11  ? 61   GLU C N     1 
ATOM   1873  C CA    . GLU C 3 53  ? 120.004 135.993 153.847 1.00 31.11  ? 61   GLU C CA    1 
ATOM   1874  C C     . GLU C 3 53  ? 119.635 135.840 152.372 1.00 31.11  ? 61   GLU C C     1 
ATOM   1875  O O     . GLU C 3 53  ? 118.915 136.690 151.810 1.00 31.11  ? 61   GLU C O     1 
ATOM   1876  C CB    . GLU C 3 53  ? 121.432 136.494 154.008 1.00 31.11  ? 61   GLU C CB    1 
ATOM   1877  C CG    . GLU C 3 53  ? 121.627 137.915 153.574 1.00 31.11  ? 61   GLU C CG    1 
ATOM   1878  C CD    . GLU C 3 53  ? 120.943 138.904 154.503 1.00 31.11  ? 61   GLU C CD    1 
ATOM   1879  O OE1   . GLU C 3 53  ? 120.768 138.583 155.698 1.00 31.11  ? 61   GLU C OE1   1 
ATOM   1880  O OE2   . GLU C 3 53  ? 120.578 140.005 154.041 1.00 31.11  ? 61   GLU C OE2   1 
ATOM   1881  N N     . ILE C 3 54  ? 120.068 134.734 151.752 1.00 25.26  ? 62   ILE C N     1 
ATOM   1882  C CA    . ILE C 3 54  ? 119.726 134.477 150.353 1.00 25.26  ? 62   ILE C CA    1 
ATOM   1883  C C     . ILE C 3 54  ? 118.223 134.328 150.178 1.00 25.26  ? 62   ILE C C     1 
ATOM   1884  O O     . ILE C 3 54  ? 117.630 134.929 149.275 1.00 25.26  ? 62   ILE C O     1 
ATOM   1885  C CB    . ILE C 3 54  ? 120.452 133.229 149.833 1.00 25.26  ? 62   ILE C CB    1 
ATOM   1886  C CG1   . ILE C 3 54  ? 121.945 133.463 149.798 1.00 25.26  ? 62   ILE C CG1   1 
ATOM   1887  C CG2   . ILE C 3 54  ? 119.988 132.893 148.438 1.00 25.26  ? 62   ILE C CG2   1 
ATOM   1888  C CD1   . ILE C 3 54  ? 122.331 134.500 148.810 1.00 25.26  ? 62   ILE C CD1   1 
ATOM   1889  N N     . LEU C 3 55  ? 117.583 133.519 151.025 1.00 27.34  ? 63   LEU C N     1 
ATOM   1890  C CA    . LEU C 3 55  ? 116.158 133.284 150.837 1.00 27.34  ? 63   LEU C CA    1 
ATOM   1891  C C     . LEU C 3 55  ? 115.325 134.509 151.182 1.00 27.34  ? 63   LEU C C     1 
ATOM   1892  O O     . LEU C 3 55  ? 114.261 134.698 150.591 1.00 27.34  ? 63   LEU C O     1 
ATOM   1893  C CB    . LEU C 3 55  ? 115.708 132.084 151.656 1.00 27.34  ? 63   LEU C CB    1 
ATOM   1894  C CG    . LEU C 3 55  ? 116.324 130.773 151.185 1.00 27.34  ? 63   LEU C CG    1 
ATOM   1895  C CD1   . LEU C 3 55  ? 115.882 129.628 152.043 1.00 27.34  ? 63   LEU C CD1   1 
ATOM   1896  C CD2   . LEU C 3 55  ? 116.005 130.504 149.748 1.00 27.34  ? 63   LEU C CD2   1 
ATOM   1897  N N     . GLU C 3 56  ? 115.815 135.377 152.073 1.00 35.40  ? 64   GLU C N     1 
ATOM   1898  C CA    . GLU C 3 56  ? 115.139 136.642 152.357 1.00 35.40  ? 64   GLU C CA    1 
ATOM   1899  C C     . GLU C 3 56  ? 115.091 137.530 151.123 1.00 35.40  ? 64   GLU C C     1 
ATOM   1900  O O     . GLU C 3 56  ? 114.020 138.011 150.719 1.00 35.40  ? 64   GLU C O     1 
ATOM   1901  C CB    . GLU C 3 56  ? 115.882 137.365 153.474 1.00 35.40  ? 64   GLU C CB    1 
ATOM   1902  C CG    . GLU C 3 56  ? 115.255 138.648 153.967 1.00 35.40  ? 64   GLU C CG    1 
ATOM   1903  C CD    . GLU C 3 56  ? 114.110 138.407 154.921 1.00 35.40  ? 64   GLU C CD    1 
ATOM   1904  O OE1   . GLU C 3 56  ? 114.089 137.328 155.545 1.00 35.40  ? 64   GLU C OE1   1 
ATOM   1905  O OE2   . GLU C 3 56  ? 113.251 139.301 155.073 1.00 35.40  ? 64   GLU C OE2   1 
ATOM   1906  N N     . LEU C 3 57  ? 116.252 137.743 150.496 1.00 30.14  ? 65   LEU C N     1 
ATOM   1907  C CA    . LEU C 3 57  ? 116.288 138.621 149.327 1.00 30.14  ? 65   LEU C CA    1 
ATOM   1908  C C     . LEU C 3 57  ? 115.588 138.002 148.118 1.00 30.14  ? 65   LEU C C     1 
ATOM   1909  O O     . LEU C 3 57  ? 114.923 138.711 147.349 1.00 30.14  ? 65   LEU C O     1 
ATOM   1910  C CB    . LEU C 3 57  ? 117.730 138.972 149.005 1.00 30.14  ? 65   LEU C CB    1 
ATOM   1911  C CG    . LEU C 3 57  ? 118.364 139.870 150.056 1.00 30.14  ? 65   LEU C CG    1 
ATOM   1912  C CD1   . LEU C 3 57  ? 119.841 139.987 149.818 1.00 30.14  ? 65   LEU C CD1   1 
ATOM   1913  C CD2   . LEU C 3 57  ? 117.719 141.228 149.985 1.00 30.14  ? 65   LEU C CD2   1 
ATOM   1914  N N     . ALA C 3 58  ? 115.688 136.681 147.954 1.00 30.08  ? 66   ALA C N     1 
ATOM   1915  C CA    . ALA C 3 58  ? 114.985 136.025 146.859 1.00 30.08  ? 66   ALA C CA    1 
ATOM   1916  C C     . ALA C 3 58  ? 113.483 136.043 147.066 1.00 30.08  ? 66   ALA C C     1 
ATOM   1917  O O     . ALA C 3 58  ? 112.738 136.141 146.091 1.00 30.08  ? 66   ALA C O     1 
ATOM   1918  C CB    . ALA C 3 58  ? 115.466 134.591 146.696 1.00 30.08  ? 66   ALA C CB    1 
ATOM   1919  N N     . GLY C 3 59  ? 113.020 135.990 148.315 1.00 33.21  ? 67   GLY C N     1 
ATOM   1920  C CA    . GLY C 3 59  ? 111.596 136.126 148.567 1.00 33.21  ? 67   GLY C CA    1 
ATOM   1921  C C     . GLY C 3 59  ? 111.082 137.519 148.265 1.00 33.21  ? 67   GLY C C     1 
ATOM   1922  O O     . GLY C 3 59  ? 109.972 137.677 147.744 1.00 33.21  ? 67   GLY C O     1 
ATOM   1923  N N     . ASN C 3 60  ? 111.890 138.545 148.564 1.00 36.61  ? 68   ASN C N     1 
ATOM   1924  C CA    . ASN C 3 60  ? 111.485 139.906 148.210 1.00 36.61  ? 68   ASN C CA    1 
ATOM   1925  C C     . ASN C 3 60  ? 111.393 140.095 146.702 1.00 36.61  ? 68   ASN C C     1 
ATOM   1926  O O     . ASN C 3 60  ? 110.425 140.682 146.205 1.00 36.61  ? 68   ASN C O     1 
ATOM   1927  C CB    . ASN C 3 60  ? 112.439 140.939 148.802 1.00 36.61  ? 68   ASN C CB    1 
ATOM   1928  C CG    . ASN C 3 60  ? 112.235 141.139 150.281 1.00 36.61  ? 68   ASN C CG    1 
ATOM   1929  O OD1   . ASN C 3 60  ? 111.109 141.149 150.768 1.00 36.61  ? 68   ASN C OD1   1 
ATOM   1930  N ND2   . ASN C 3 60  ? 113.327 141.321 151.004 1.00 36.61  ? 68   ASN C ND2   1 
ATOM   1931  N N     . ALA C 3 61  ? 112.370 139.584 145.951 1.00 35.67  ? 69   ALA C N     1 
ATOM   1932  C CA    . ALA C 3 61  ? 112.287 139.735 144.498 1.00 35.67  ? 69   ALA C CA    1 
ATOM   1933  C C     . ALA C 3 61  ? 111.199 138.853 143.890 1.00 35.67  ? 69   ALA C C     1 
ATOM   1934  O O     . ALA C 3 61  ? 110.624 139.210 142.852 1.00 35.67  ? 69   ALA C O     1 
ATOM   1935  C CB    . ALA C 3 61  ? 113.636 139.442 143.855 1.00 35.67  ? 69   ALA C CB    1 
ATOM   1936  N N     . ALA C 3 62  ? 110.878 137.729 144.532 1.00 37.47  ? 70   ALA C N     1 
ATOM   1937  C CA    . ALA C 3 62  ? 109.762 136.911 144.078 1.00 37.47  ? 70   ALA C CA    1 
ATOM   1938  C C     . ALA C 3 62  ? 108.437 137.624 144.274 1.00 37.47  ? 70   ALA C C     1 
ATOM   1939  O O     . ALA C 3 62  ? 107.543 137.514 143.429 1.00 37.47  ? 70   ALA C O     1 
ATOM   1940  C CB    . ALA C 3 62  ? 109.747 135.584 144.820 1.00 37.47  ? 70   ALA C CB    1 
ATOM   1941  N N     . ARG C 3 63  ? 108.281 138.342 145.389 1.00 45.65  ? 71   ARG C N     1 
ATOM   1942  C CA    . ARG C 3 63  ? 107.093 139.176 145.546 1.00 45.65  ? 71   ARG C CA    1 
ATOM   1943  C C     . ARG C 3 63  ? 107.079 140.303 144.522 1.00 45.65  ? 71   ARG C C     1 
ATOM   1944  O O     . ARG C 3 63  ? 106.023 140.644 143.979 1.00 45.65  ? 71   ARG C O     1 
ATOM   1945  C CB    . ARG C 3 63  ? 107.014 139.754 146.955 1.00 45.65  ? 71   ARG C CB    1 
ATOM   1946  C CG    . ARG C 3 63  ? 105.720 140.489 147.204 1.00 45.65  ? 71   ARG C CG    1 
ATOM   1947  C CD    . ARG C 3 63  ? 105.647 141.139 148.566 1.00 45.65  ? 71   ARG C CD    1 
ATOM   1948  N NE    . ARG C 3 63  ? 105.694 140.170 149.649 1.00 45.65  ? 71   ARG C NE    1 
ATOM   1949  C CZ    . ARG C 3 63  ? 106.649 140.139 150.568 1.00 45.65  ? 71   ARG C CZ    1 
ATOM   1950  N NH1   . ARG C 3 63  ? 107.624 141.038 150.541 1.00 45.65  ? 71   ARG C NH1   1 
ATOM   1951  N NH2   . ARG C 3 63  ? 106.619 139.221 151.523 1.00 45.65  ? 71   ARG C NH2   1 
ATOM   1952  N N     . ASP C 3 64  ? 108.250 140.870 144.219 1.00 46.23  ? 72   ASP C N     1 
ATOM   1953  C CA    . ASP C 3 64  ? 108.294 142.012 143.316 1.00 46.23  ? 72   ASP C CA    1 
ATOM   1954  C C     . ASP C 3 64  ? 108.023 141.643 141.866 1.00 46.23  ? 72   ASP C C     1 
ATOM   1955  O O     . ASP C 3 64  ? 107.587 142.508 141.105 1.00 46.23  ? 72   ASP C O     1 
ATOM   1956  C CB    . ASP C 3 64  ? 109.634 142.730 143.424 1.00 46.23  ? 72   ASP C CB    1 
ATOM   1957  C CG    . ASP C 3 64  ? 109.813 143.414 144.764 1.00 46.23  ? 72   ASP C CG    1 
ATOM   1958  O OD1   . ASP C 3 64  ? 108.792 143.699 145.424 1.00 46.23  ? 72   ASP C OD1   1 
ATOM   1959  O OD2   . ASP C 3 64  ? 110.968 143.686 145.153 1.00 46.23  ? 72   ASP C OD2   1 
ATOM   1960  N N     . ASN C 3 65  ? 108.253 140.398 141.454 1.00 48.41  ? 73   ASN C N     1 
ATOM   1961  C CA    . ASN C 3 65  ? 107.733 139.965 140.161 1.00 48.41  ? 73   ASN C CA    1 
ATOM   1962  C C     . ASN C 3 65  ? 106.364 139.305 140.264 1.00 48.41  ? 73   ASN C C     1 
ATOM   1963  O O     . ASN C 3 65  ? 105.985 138.562 139.351 1.00 48.41  ? 73   ASN C O     1 
ATOM   1964  C CB    . ASN C 3 65  ? 108.708 139.028 139.450 1.00 48.41  ? 73   ASN C CB    1 
ATOM   1965  C CG    . ASN C 3 65  ? 109.882 139.759 138.846 1.00 48.41  ? 73   ASN C CG    1 
ATOM   1966  O OD1   . ASN C 3 65  ? 111.033 139.514 139.195 1.00 48.41  ? 73   ASN C OD1   1 
ATOM   1967  N ND2   . ASN C 3 65  ? 109.593 140.674 137.936 1.00 48.41  ? 73   ASN C ND2   1 
ATOM   1968  N N     . LYS C 3 66  ? 105.640 139.545 141.363 1.00 58.26  ? 74   LYS C N     1 
ATOM   1969  C CA    . LYS C 3 66  ? 104.234 139.159 141.548 1.00 58.26  ? 74   LYS C CA    1 
ATOM   1970  C C     . LYS C 3 66  ? 104.001 137.652 141.470 1.00 58.26  ? 74   LYS C C     1 
ATOM   1971  O O     . LYS C 3 66  ? 102.925 137.210 141.072 1.00 58.26  ? 74   LYS C O     1 
ATOM   1972  C CB    . LYS C 3 66  ? 103.314 139.883 140.561 1.00 58.26  ? 74   LYS C CB    1 
ATOM   1973  C CG    . LYS C 3 66  ? 103.271 141.386 140.749 1.00 58.26  ? 74   LYS C CG    1 
ATOM   1974  C CD    . LYS C 3 66  ? 102.590 141.749 142.061 1.00 58.26  ? 74   LYS C CD    1 
ATOM   1975  C CE    . LYS C 3 66  ? 102.528 143.253 142.269 1.00 58.26  ? 74   LYS C CE    1 
ATOM   1976  N NZ    . LYS C 3 66  ? 101.610 143.901 141.296 1.00 58.26  ? 74   LYS C NZ    1 
ATOM   1977  N N     . LYS C 3 67  ? 104.984 136.849 141.861 1.00 64.12  ? 75   LYS C N     1 
ATOM   1978  C CA    . LYS C 3 67  ? 104.818 135.408 141.950 1.00 64.12  ? 75   LYS C CA    1 
ATOM   1979  C C     . LYS C 3 67  ? 104.968 134.956 143.395 1.00 64.12  ? 75   LYS C C     1 
ATOM   1980  O O     . LYS C 3 67  ? 105.465 135.691 144.249 1.00 64.12  ? 75   LYS C O     1 
ATOM   1981  C CB    . LYS C 3 67  ? 105.835 134.677 141.078 1.00 64.12  ? 75   LYS C CB    1 
ATOM   1982  C CG    . LYS C 3 67  ? 105.759 135.021 139.610 1.00 64.12  ? 75   LYS C CG    1 
ATOM   1983  C CD    . LYS C 3 67  ? 104.447 134.561 139.017 1.00 64.12  ? 75   LYS C CD    1 
ATOM   1984  C CE    . LYS C 3 67  ? 104.446 134.685 137.505 1.00 64.12  ? 75   LYS C CE    1 
ATOM   1985  N NZ    . LYS C 3 67  ? 104.440 136.102 137.069 1.00 64.12  ? 75   LYS C NZ    1 
ATOM   1986  N N     . THR C 3 68  ? 104.528 133.733 143.669 1.00 66.80  ? 76   THR C N     1 
ATOM   1987  C CA    . THR C 3 68  ? 104.647 133.154 145.000 1.00 66.80  ? 76   THR C CA    1 
ATOM   1988  C C     . THR C 3 68  ? 105.546 131.927 145.004 1.00 66.80  ? 76   THR C C     1 
ATOM   1989  O O     . THR C 3 68  ? 105.305 130.981 145.754 1.00 66.80  ? 76   THR C O     1 
ATOM   1990  C CB    . THR C 3 68  ? 103.276 132.788 145.555 1.00 66.80  ? 76   THR C CB    1 
ATOM   1991  O OG1   . THR C 3 68  ? 102.673 131.805 144.710 1.00 66.80  ? 76   THR C OG1   1 
ATOM   1992  C CG2   . THR C 3 68  ? 102.380 134.011 145.613 1.00 66.80  ? 76   THR C CG2   1 
ATOM   1993  N N     . ARG C 3 69  ? 106.578 131.918 144.164 1.00 54.88  ? 77   ARG C N     1 
ATOM   1994  C CA    . ARG C 3 69  ? 107.444 130.754 144.047 1.00 54.88  ? 77   ARG C CA    1 
ATOM   1995  C C     . ARG C 3 69  ? 108.819 131.212 143.600 1.00 54.88  ? 77   ARG C C     1 
ATOM   1996  O O     . ARG C 3 69  ? 108.931 131.969 142.635 1.00 54.88  ? 77   ARG C O     1 
ATOM   1997  C CB    . ARG C 3 69  ? 106.867 129.750 143.057 1.00 54.88  ? 77   ARG C CB    1 
ATOM   1998  C CG    . ARG C 3 69  ? 107.537 128.422 143.110 1.00 54.88  ? 77   ARG C CG    1 
ATOM   1999  C CD    . ARG C 3 69  ? 106.859 127.441 142.189 1.00 54.88  ? 77   ARG C CD    1 
ATOM   2000  N NE    . ARG C 3 69  ? 105.443 127.309 142.505 1.00 54.88  ? 77   ARG C NE    1 
ATOM   2001  C CZ    . ARG C 3 69  ? 104.953 126.567 143.491 1.00 54.88  ? 77   ARG C CZ    1 
ATOM   2002  N NH1   . ARG C 3 69  ? 105.761 125.887 144.281 1.00 54.88  ? 77   ARG C NH1   1 
ATOM   2003  N NH2   . ARG C 3 69  ? 103.648 126.514 143.696 1.00 54.88  ? 77   ARG C NH2   1 
ATOM   2004  N N     . ILE C 3 70  ? 109.854 130.743 144.282 1.00 33.54  ? 78   ILE C N     1 
ATOM   2005  C CA    . ILE C 3 70  ? 111.198 131.279 144.117 1.00 33.54  ? 78   ILE C CA    1 
ATOM   2006  C C     . ILE C 3 70  ? 111.924 130.481 143.048 1.00 33.54  ? 78   ILE C C     1 
ATOM   2007  O O     . ILE C 3 70  ? 112.067 129.262 143.164 1.00 33.54  ? 78   ILE C O     1 
ATOM   2008  C CB    . ILE C 3 70  ? 111.964 131.247 145.441 1.00 33.54  ? 78   ILE C CB    1 
ATOM   2009  C CG1   . ILE C 3 70  ? 111.226 132.079 146.477 1.00 33.54  ? 78   ILE C CG1   1 
ATOM   2010  C CG2   . ILE C 3 70  ? 113.299 131.836 145.265 1.00 33.54  ? 78   ILE C CG2   1 
ATOM   2011  C CD1   . ILE C 3 70  ? 111.822 131.995 147.843 1.00 33.54  ? 78   ILE C CD1   1 
ATOM   2012  N N     . ILE C 3 71  ? 112.378 131.160 142.003 1.00 28.98  ? 79   ILE C N     1 
ATOM   2013  C CA    . ILE C 3 71  ? 112.935 130.501 140.825 1.00 28.98  ? 79   ILE C CA    1 
ATOM   2014  C C     . ILE C 3 71  ? 114.399 130.918 140.662 1.00 28.98  ? 79   ILE C C     1 
ATOM   2015  O O     . ILE C 3 71  ? 114.855 131.827 141.382 1.00 28.98  ? 79   ILE C O     1 
ATOM   2016  C CB    . ILE C 3 71  ? 112.061 130.810 139.594 1.00 28.98  ? 79   ILE C CB    1 
ATOM   2017  C CG1   . ILE C 3 71  ? 111.994 132.302 139.306 1.00 28.98  ? 79   ILE C CG1   1 
ATOM   2018  C CG2   . ILE C 3 71  ? 110.678 130.246 139.772 1.00 28.98  ? 79   ILE C CG2   1 
ATOM   2019  C CD1   . ILE C 3 71  ? 111.319 132.603 137.982 1.00 28.98  ? 79   ILE C CD1   1 
ATOM   2020  N N     . PRO C 3 72  ? 115.193 130.262 139.797 1.00 23.21  ? 80   PRO C N     1 
ATOM   2021  C CA    . PRO C 3 72  ? 116.592 130.681 139.627 1.00 23.21  ? 80   PRO C CA    1 
ATOM   2022  C C     . PRO C 3 72  ? 116.797 132.111 139.176 1.00 23.21  ? 80   PRO C C     1 
ATOM   2023  O O     . PRO C 3 72  ? 117.813 132.712 139.539 1.00 23.21  ? 80   PRO C O     1 
ATOM   2024  C CB    . PRO C 3 72  ? 117.108 129.705 138.566 1.00 23.21  ? 80   PRO C CB    1 
ATOM   2025  C CG    . PRO C 3 72  ? 116.343 128.530 138.768 1.00 23.21  ? 80   PRO C CG    1 
ATOM   2026  C CD    . PRO C 3 72  ? 114.990 128.942 139.171 1.00 23.21  ? 80   PRO C CD    1 
ATOM   2027  N N     . ARG C 3 73  ? 115.879 132.669 138.394 1.00 26.30  ? 81   ARG C N     1 
ATOM   2028  C CA    . ARG C 3 73  ? 115.944 134.085 138.055 1.00 26.30  ? 81   ARG C CA    1 
ATOM   2029  C C     . ARG C 3 73  ? 115.839 134.950 139.297 1.00 26.30  ? 81   ARG C C     1 
ATOM   2030  O O     . ARG C 3 73  ? 116.533 135.966 139.419 1.00 26.30  ? 81   ARG C O     1 
ATOM   2031  C CB    . ARG C 3 73  ? 114.826 134.422 137.082 1.00 26.30  ? 81   ARG C CB    1 
ATOM   2032  C CG    . ARG C 3 73  ? 114.724 135.864 136.723 1.00 26.30  ? 81   ARG C CG    1 
ATOM   2033  C CD    . ARG C 3 73  ? 115.925 136.326 135.966 1.00 26.30  ? 81   ARG C CD    1 
ATOM   2034  N NE    . ARG C 3 73  ? 115.716 137.685 135.510 1.00 26.30  ? 81   ARG C NE    1 
ATOM   2035  C CZ    . ARG C 3 73  ? 116.632 138.415 134.899 1.00 26.30  ? 81   ARG C CZ    1 
ATOM   2036  N NH1   . ARG C 3 73  ? 117.835 137.914 134.667 1.00 26.30  ? 81   ARG C NH1   1 
ATOM   2037  N NH2   . ARG C 3 73  ? 116.341 139.644 134.518 1.00 26.30  ? 81   ARG C NH2   1 
ATOM   2038  N N     . HIS C 3 74  ? 114.993 134.546 140.242 1.00 27.87  ? 82   HIS C N     1 
ATOM   2039  C CA    . HIS C 3 74  ? 114.855 135.288 141.485 1.00 27.87  ? 82   HIS C CA    1 
ATOM   2040  C C     . HIS C 3 74  ? 116.123 135.217 142.318 1.00 27.87  ? 82   HIS C C     1 
ATOM   2041  O O     . HIS C 3 74  ? 116.552 136.231 142.886 1.00 27.87  ? 82   HIS C O     1 
ATOM   2042  C CB    . HIS C 3 74  ? 113.668 134.752 142.261 1.00 27.87  ? 82   HIS C CB    1 
ATOM   2043  C CG    . HIS C 3 74  ? 112.366 135.016 141.589 1.00 27.87  ? 82   HIS C CG    1 
ATOM   2044  N ND1   . HIS C 3 74  ? 111.196 134.395 141.956 1.00 27.87  ? 82   HIS C ND1   1 
ATOM   2045  C CD2   . HIS C 3 74  ? 112.046 135.863 140.587 1.00 27.87  ? 82   HIS C CD2   1 
ATOM   2046  C CE1   . HIS C 3 74  ? 110.213 134.832 141.193 1.00 27.87  ? 82   HIS C CE1   1 
ATOM   2047  N NE2   . HIS C 3 74  ? 110.701 135.727 140.356 1.00 27.87  ? 82   HIS C NE2   1 
ATOM   2048  N N     . LEU C 3 75  ? 116.763 134.045 142.368 1.00 23.83  ? 83   LEU C N     1 
ATOM   2049  C CA    . LEU C 3 75  ? 118.039 133.984 143.078 1.00 23.83  ? 83   LEU C CA    1 
ATOM   2050  C C     . LEU C 3 75  ? 119.131 134.771 142.371 1.00 23.83  ? 83   LEU C C     1 
ATOM   2051  O O     . LEU C 3 75  ? 119.985 135.355 143.040 1.00 23.83  ? 83   LEU C O     1 
ATOM   2052  C CB    . LEU C 3 75  ? 118.523 132.555 143.272 1.00 23.83  ? 83   LEU C CB    1 
ATOM   2053  C CG    . LEU C 3 75  ? 117.977 131.748 144.432 1.00 23.83  ? 83   LEU C CG    1 
ATOM   2054  C CD1   . LEU C 3 75  ? 116.688 131.152 144.070 1.00 23.83  ? 83   LEU C CD1   1 
ATOM   2055  C CD2   . LEU C 3 75  ? 118.938 130.666 144.751 1.00 23.83  ? 83   LEU C CD2   1 
ATOM   2056  N N     . GLN C 3 76  ? 119.125 134.795 141.035 1.00 23.20  ? 84   GLN C N     1 
ATOM   2057  C CA    . GLN C 3 76  ? 120.104 135.583 140.288 1.00 23.20  ? 84   GLN C CA    1 
ATOM   2058  C C     . GLN C 3 76  ? 119.961 137.066 140.589 1.00 23.20  ? 84   GLN C C     1 
ATOM   2059  O O     . GLN C 3 76  ? 120.959 137.760 140.812 1.00 23.20  ? 84   GLN C O     1 
ATOM   2060  C CB    . GLN C 3 76  ? 119.936 135.335 138.795 1.00 23.20  ? 84   GLN C CB    1 
ATOM   2061  C CG    . GLN C 3 76  ? 120.894 136.088 137.915 1.00 23.20  ? 84   GLN C CG    1 
ATOM   2062  C CD    . GLN C 3 76  ? 122.291 135.532 137.930 1.00 23.20  ? 84   GLN C CD    1 
ATOM   2063  O OE1   . GLN C 3 76  ? 123.167 136.048 138.597 1.00 23.20  ? 84   GLN C OE1   1 
ATOM   2064  N NE2   . GLN C 3 76  ? 122.515 134.491 137.153 1.00 23.20  ? 84   GLN C NE2   1 
ATOM   2065  N N     . LEU C 3 77  ? 118.722 137.555 140.656 1.00 25.44  ? 85   LEU C N     1 
ATOM   2066  C CA    . LEU C 3 77  ? 118.505 138.966 140.954 1.00 25.44  ? 85   LEU C CA    1 
ATOM   2067  C C     . LEU C 3 77  ? 118.866 139.296 142.394 1.00 25.44  ? 85   LEU C C     1 
ATOM   2068  O O     . LEU C 3 77  ? 119.456 140.348 142.656 1.00 25.44  ? 85   LEU C O     1 
ATOM   2069  C CB    . LEU C 3 77  ? 117.059 139.361 140.673 1.00 25.44  ? 85   LEU C CB    1 
ATOM   2070  C CG    . LEU C 3 77  ? 116.603 139.267 139.221 1.00 25.44  ? 85   LEU C CG    1 
ATOM   2071  C CD1   . LEU C 3 77  ? 115.147 139.666 139.065 1.00 25.44  ? 85   LEU C CD1   1 
ATOM   2072  C CD2   . LEU C 3 77  ? 117.492 140.101 138.342 1.00 25.44  ? 85   LEU C CD2   1 
ATOM   2073  N N     . ALA C 3 78  ? 118.566 138.398 143.335 1.00 26.18  ? 86   ALA C N     1 
ATOM   2074  C CA    . ALA C 3 78  ? 118.889 138.668 144.735 1.00 26.18  ? 86   ALA C CA    1 
ATOM   2075  C C     . ALA C 3 78  ? 120.391 138.648 144.979 1.00 26.18  ? 86   ALA C C     1 
ATOM   2076  O O     . ALA C 3 78  ? 120.937 139.540 145.648 1.00 26.18  ? 86   ALA C O     1 
ATOM   2077  C CB    . ALA C 3 78  ? 118.200 137.649 145.632 1.00 26.18  ? 86   ALA C CB    1 
ATOM   2078  N N     . VAL C 3 79  ? 121.076 137.664 144.400 1.00 27.16  ? 87   VAL C N     1 
ATOM   2079  C CA    . VAL C 3 79  ? 122.512 137.529 144.570 1.00 27.16  ? 87   VAL C CA    1 
ATOM   2080  C C     . VAL C 3 79  ? 123.254 138.674 143.895 1.00 27.16  ? 87   VAL C C     1 
ATOM   2081  O O     . VAL C 3 79  ? 124.166 139.263 144.485 1.00 27.16  ? 87   VAL C O     1 
ATOM   2082  C CB    . VAL C 3 79  ? 122.952 136.153 144.055 1.00 27.16  ? 87   VAL C CB    1 
ATOM   2083  C CG1   . VAL C 3 79  ? 124.418 136.098 143.904 1.00 27.16  ? 87   VAL C CG1   1 
ATOM   2084  C CG2   . VAL C 3 79  ? 122.559 135.111 145.059 1.00 27.16  ? 87   VAL C CG2   1 
ATOM   2085  N N     . ARG C 3 80  ? 122.861 139.058 142.687 1.00 26.78  ? 88   ARG C N     1 
ATOM   2086  C CA    . ARG C 3 80  ? 123.581 140.149 142.053 1.00 26.78  ? 88   ARG C CA    1 
ATOM   2087  C C     . ARG C 3 80  ? 123.051 141.529 142.431 1.00 26.78  ? 88   ARG C C     1 
ATOM   2088  O O     . ARG C 3 80  ? 123.598 142.525 141.957 1.00 26.78  ? 88   ARG C O     1 
ATOM   2089  C CB    . ARG C 3 80  ? 123.557 139.988 140.540 1.00 26.78  ? 88   ARG C CB    1 
ATOM   2090  C CG    . ARG C 3 80  ? 124.209 138.720 140.043 1.00 26.78  ? 88   ARG C CG    1 
ATOM   2091  C CD    . ARG C 3 80  ? 125.718 138.707 140.202 1.00 26.78  ? 88   ARG C CD    1 
ATOM   2092  N NE    . ARG C 3 80  ? 126.327 137.586 139.487 1.00 26.78  ? 88   ARG C NE    1 
ATOM   2093  C CZ    . ARG C 3 80  ? 126.671 136.421 140.023 1.00 26.78  ? 88   ARG C CZ    1 
ATOM   2094  N NH1   . ARG C 3 80  ? 126.509 136.193 141.308 1.00 26.78  ? 88   ARG C NH1   1 
ATOM   2095  N NH2   . ARG C 3 80  ? 127.208 135.485 139.265 1.00 26.78  ? 88   ARG C NH2   1 
ATOM   2096  N N     . ASN C 3 81  ? 122.017 141.631 143.266 1.00 31.15  ? 89   ASN C N     1 
ATOM   2097  C CA    . ASN C 3 81  ? 121.606 142.929 143.779 1.00 31.15  ? 89   ASN C CA    1 
ATOM   2098  C C     . ASN C 3 81  ? 121.926 143.146 145.245 1.00 31.15  ? 89   ASN C C     1 
ATOM   2099  O O     . ASN C 3 81  ? 121.670 144.238 145.758 1.00 31.15  ? 89   ASN C O     1 
ATOM   2100  C CB    . ASN C 3 81  ? 120.116 143.156 143.554 1.00 31.15  ? 89   ASN C CB    1 
ATOM   2101  C CG    . ASN C 3 81  ? 119.818 143.537 142.146 1.00 31.15  ? 89   ASN C CG    1 
ATOM   2102  O OD1   . ASN C 3 81  ? 120.576 144.270 141.528 1.00 31.15  ? 89   ASN C OD1   1 
ATOM   2103  N ND2   . ASN C 3 81  ? 118.704 143.056 141.622 1.00 31.15  ? 89   ASN C ND2   1 
ATOM   2104  N N     . ASP C 3 82  ? 122.453 142.155 145.945 1.00 40.51  ? 90   ASP C N     1 
ATOM   2105  C CA    . ASP C 3 82  ? 123.153 142.444 147.188 1.00 40.51  ? 90   ASP C CA    1 
ATOM   2106  C C     . ASP C 3 82  ? 124.638 142.535 146.880 1.00 40.51  ? 90   ASP C C     1 
ATOM   2107  O O     . ASP C 3 82  ? 125.189 141.648 146.227 1.00 40.51  ? 90   ASP C O     1 
ATOM   2108  C CB    . ASP C 3 82  ? 122.889 141.388 148.254 1.00 40.51  ? 90   ASP C CB    1 
ATOM   2109  C CG    . ASP C 3 82  ? 123.504 141.750 149.594 1.00 40.51  ? 90   ASP C CG    1 
ATOM   2110  O OD1   . ASP C 3 82  ? 123.019 142.706 150.233 1.00 40.51  ? 90   ASP C OD1   1 
ATOM   2111  O OD2   . ASP C 3 82  ? 124.460 141.072 150.018 1.00 40.51  ? 90   ASP C OD2   1 
ATOM   2112  N N     . GLU C 3 83  ? 125.285 143.601 147.354 1.00 47.24  ? 91   GLU C N     1 
ATOM   2113  C CA    . GLU C 3 83  ? 126.650 143.878 146.917 1.00 47.24  ? 91   GLU C CA    1 
ATOM   2114  C C     . GLU C 3 83  ? 127.653 142.929 147.560 1.00 47.24  ? 91   GLU C C     1 
ATOM   2115  O O     . GLU C 3 83  ? 128.595 142.468 146.902 1.00 47.24  ? 91   GLU C O     1 
ATOM   2116  C CB    . GLU C 3 83  ? 127.005 145.327 147.225 1.00 47.24  ? 91   GLU C CB    1 
ATOM   2117  C CG    . GLU C 3 83  ? 128.335 145.767 146.657 1.00 47.24  ? 91   GLU C CG    1 
ATOM   2118  C CD    . GLU C 3 83  ? 128.599 147.236 146.903 1.00 47.24  ? 91   GLU C CD    1 
ATOM   2119  O OE1   . GLU C 3 83  ? 127.751 147.885 147.551 1.00 47.24  ? 91   GLU C OE1   1 
ATOM   2120  O OE2   . GLU C 3 83  ? 129.641 147.746 146.446 1.00 47.24  ? 91   GLU C OE2   1 
ATOM   2121  N N     . GLU C 3 84  ? 127.459 142.597 148.834 1.00 41.98  ? 92   GLU C N     1 
ATOM   2122  C CA    . GLU C 3 84  ? 128.373 141.663 149.472 1.00 41.98  ? 92   GLU C CA    1 
ATOM   2123  C C     . GLU C 3 84  ? 128.185 140.245 148.957 1.00 41.98  ? 92   GLU C C     1 
ATOM   2124  O O     . GLU C 3 84  ? 129.151 139.482 148.883 1.00 41.98  ? 92   GLU C O     1 
ATOM   2125  C CB    . GLU C 3 84  ? 128.209 141.738 150.979 1.00 41.98  ? 92   GLU C CB    1 
ATOM   2126  C CG    . GLU C 3 84  ? 128.735 143.050 151.520 1.00 41.98  ? 92   GLU C CG    1 
ATOM   2127  C CD    . GLU C 3 84  ? 128.645 143.160 153.023 1.00 41.98  ? 92   GLU C CD    1 
ATOM   2128  O OE1   . GLU C 3 84  ? 128.025 142.277 153.649 1.00 41.98  ? 92   GLU C OE1   1 
ATOM   2129  O OE2   . GLU C 3 84  ? 129.212 144.122 153.582 1.00 41.98  ? 92   GLU C OE2   1 
ATOM   2130  N N     . LEU C 3 85  ? 126.975 139.892 148.539 1.00 32.44  ? 93   LEU C N     1 
ATOM   2131  C CA    . LEU C 3 85  ? 126.787 138.615 147.868 1.00 32.44  ? 93   LEU C CA    1 
ATOM   2132  C C     . LEU C 3 85  ? 127.357 138.627 146.463 1.00 32.44  ? 93   LEU C C     1 
ATOM   2133  O O     . LEU C 3 85  ? 127.783 137.584 145.967 1.00 32.44  ? 93   LEU C O     1 
ATOM   2134  C CB    . LEU C 3 85  ? 125.313 138.268 147.852 1.00 32.44  ? 93   LEU C CB    1 
ATOM   2135  C CG    . LEU C 3 85  ? 124.920 137.860 149.254 1.00 32.44  ? 93   LEU C CG    1 
ATOM   2136  C CD1   . LEU C 3 85  ? 123.444 137.921 149.408 1.00 32.44  ? 93   LEU C CD1   1 
ATOM   2137  C CD2   . LEU C 3 85  ? 125.412 136.459 149.450 1.00 32.44  ? 93   LEU C CD2   1 
ATOM   2138  N N     . ASN C 3 86  ? 127.376 139.787 145.811 1.00 35.51  ? 94   ASN C N     1 
ATOM   2139  C CA    . ASN C 3 86  ? 128.070 139.896 144.537 1.00 35.51  ? 94   ASN C CA    1 
ATOM   2140  C C     . ASN C 3 86  ? 129.564 139.692 144.714 1.00 35.51  ? 94   ASN C C     1 
ATOM   2141  O O     . ASN C 3 86  ? 130.222 139.134 143.835 1.00 35.51  ? 94   ASN C O     1 
ATOM   2142  C CB    . ASN C 3 86  ? 127.806 141.259 143.913 1.00 35.51  ? 94   ASN C CB    1 
ATOM   2143  C CG    . ASN C 3 86  ? 128.153 141.307 142.453 1.00 35.51  ? 94   ASN C CG    1 
ATOM   2144  O OD1   . ASN C 3 86  ? 128.525 140.304 141.853 1.00 35.51  ? 94   ASN C OD1   1 
ATOM   2145  N ND2   . ASN C 3 86  ? 128.045 142.489 141.866 1.00 35.51  ? 94   ASN C ND2   1 
ATOM   2146  N N     . LYS C 3 87  ? 130.108 140.124 145.848 1.00 36.23  ? 95   LYS C N     1 
ATOM   2147  C CA    . LYS C 3 87  ? 131.534 139.930 146.084 1.00 36.23  ? 95   LYS C CA    1 
ATOM   2148  C C     . LYS C 3 87  ? 131.847 138.492 146.484 1.00 36.23  ? 95   LYS C C     1 
ATOM   2149  O O     . LYS C 3 87  ? 132.863 137.938 146.060 1.00 36.23  ? 95   LYS C O     1 
ATOM   2150  C CB    . LYS C 3 87  ? 132.027 140.913 147.142 1.00 36.23  ? 95   LYS C CB    1 
ATOM   2151  C CG    . LYS C 3 87  ? 133.514 140.842 147.399 1.00 36.23  ? 95   LYS C CG    1 
ATOM   2152  C CD    . LYS C 3 87  ? 133.981 141.955 148.310 1.00 36.23  ? 95   LYS C CD    1 
ATOM   2153  C CE    . LYS C 3 87  ? 135.432 141.739 148.737 1.00 36.23  ? 95   LYS C CE    1 
ATOM   2154  N NZ    . LYS C 3 87  ? 136.380 141.806 147.595 1.00 36.23  ? 95   LYS C NZ    1 
ATOM   2155  N N     . LEU C 3 88  ? 130.980 137.865 147.279 1.00 30.62  ? 96   LEU C N     1 
ATOM   2156  C CA    . LEU C 3 88  ? 131.230 136.491 147.708 1.00 30.62  ? 96   LEU C CA    1 
ATOM   2157  C C     . LEU C 3 88  ? 131.001 135.498 146.581 1.00 30.62  ? 96   LEU C C     1 
ATOM   2158  O O     . LEU C 3 88  ? 131.864 134.663 146.295 1.00 30.62  ? 96   LEU C O     1 
ATOM   2159  C CB    . LEU C 3 88  ? 130.345 136.137 148.892 1.00 30.62  ? 96   LEU C CB    1 
ATOM   2160  C CG    . LEU C 3 88  ? 130.422 134.689 149.345 1.00 30.62  ? 96   LEU C CG    1 
ATOM   2161  C CD1   . LEU C 3 88  ? 131.792 134.371 149.854 1.00 30.62  ? 96   LEU C CD1   1 
ATOM   2162  C CD2   . LEU C 3 88  ? 129.385 134.470 150.417 1.00 30.62  ? 96   LEU C CD2   1 
ATOM   2163  N N     . LEU C 3 89  ? 129.839 135.560 145.938 1.00 28.96  ? 97   LEU C N     1 
ATOM   2164  C CA    . LEU C 3 89  ? 129.470 134.621 144.888 1.00 28.96  ? 97   LEU C CA    1 
ATOM   2165  C C     . LEU C 3 89  ? 129.895 135.081 143.505 1.00 28.96  ? 97   LEU C C     1 
ATOM   2166  O O     . LEU C 3 89  ? 129.254 134.715 142.517 1.00 28.96  ? 97   LEU C O     1 
ATOM   2167  C CB    . LEU C 3 89  ? 127.966 134.376 144.914 1.00 28.96  ? 97   LEU C CB    1 
ATOM   2168  C CG    . LEU C 3 89  ? 127.467 133.595 146.116 1.00 28.96  ? 97   LEU C CG    1 
ATOM   2169  C CD1   . LEU C 3 89  ? 125.977 133.453 146.057 1.00 28.96  ? 97   LEU C CD1   1 
ATOM   2170  C CD2   . LEU C 3 89  ? 128.109 132.246 146.134 1.00 28.96  ? 97   LEU C CD2   1 
ATOM   2171  N N     . GLY C 3 90  ? 130.965 135.867 143.405 1.00 31.74  ? 98   GLY C N     1 
ATOM   2172  C CA    . GLY C 3 90  ? 131.341 136.519 142.167 1.00 31.74  ? 98   GLY C CA    1 
ATOM   2173  C C     . GLY C 3 90  ? 131.895 135.626 141.090 1.00 31.74  ? 98   GLY C C     1 
ATOM   2174  O O     . GLY C 3 90  ? 132.059 136.084 139.958 1.00 31.74  ? 98   GLY C O     1 
ATOM   2175  N N     . ARG C 3 91  ? 132.191 134.370 141.401 1.00 29.88  ? 99   ARG C N     1 
ATOM   2176  C CA    . ARG C 3 91  ? 132.639 133.418 140.398 1.00 29.88  ? 99   ARG C CA    1 
ATOM   2177  C C     . ARG C 3 91  ? 131.536 132.491 139.922 1.00 29.88  ? 99   ARG C C     1 
ATOM   2178  O O     . ARG C 3 91  ? 131.695 131.841 138.886 1.00 29.88  ? 99   ARG C O     1 
ATOM   2179  C CB    . ARG C 3 91  ? 133.801 132.587 140.949 1.00 29.88  ? 99   ARG C CB    1 
ATOM   2180  C CG    . ARG C 3 91  ? 135.056 133.390 141.085 1.00 29.88  ? 99   ARG C CG    1 
ATOM   2181  C CD    . ARG C 3 91  ? 135.524 133.727 139.689 1.00 29.88  ? 99   ARG C CD    1 
ATOM   2182  N NE    . ARG C 3 91  ? 136.695 134.590 139.651 1.00 29.88  ? 99   ARG C NE    1 
ATOM   2183  C CZ    . ARG C 3 91  ? 137.217 135.063 138.525 1.00 29.88  ? 99   ARG C CZ    1 
ATOM   2184  N NH1   . ARG C 3 91  ? 136.670 134.742 137.360 1.00 29.88  ? 99   ARG C NH1   1 
ATOM   2185  N NH2   . ARG C 3 91  ? 138.280 135.852 138.558 1.00 29.88  ? 99   ARG C NH2   1 
ATOM   2186  N N     . VAL C 3 92  ? 130.421 132.461 140.624 1.00 23.11  ? 100  VAL C N     1 
ATOM   2187  C CA    . VAL C 3 92  ? 129.411 131.431 140.453 1.00 23.11  ? 100  VAL C CA    1 
ATOM   2188  C C     . VAL C 3 92  ? 128.530 131.746 139.256 1.00 23.11  ? 100  VAL C C     1 
ATOM   2189  O O     . VAL C 3 92  ? 128.038 132.866 139.105 1.00 23.11  ? 100  VAL C O     1 
ATOM   2190  C CB    . VAL C 3 92  ? 128.581 131.315 141.733 1.00 23.11  ? 100  VAL C CB    1 
ATOM   2191  C CG1   . VAL C 3 92  ? 127.373 130.491 141.507 1.00 23.11  ? 100  VAL C CG1   1 
ATOM   2192  C CG2   . VAL C 3 92  ? 129.422 130.716 142.824 1.00 23.11  ? 100  VAL C CG2   1 
ATOM   2193  N N     . THR C 3 93  ? 128.328 130.754 138.400 1.00 19.62  ? 101  THR C N     1 
ATOM   2194  C CA    . THR C 3 93  ? 127.261 130.792 137.417 1.00 19.62  ? 101  THR C CA    1 
ATOM   2195  C C     . THR C 3 93  ? 126.041 130.086 137.990 1.00 19.62  ? 101  THR C C     1 
ATOM   2196  O O     . THR C 3 93  ? 126.106 128.897 138.306 1.00 19.62  ? 101  THR C O     1 
ATOM   2197  C CB    . THR C 3 93  ? 127.690 130.111 136.125 1.00 19.62  ? 101  THR C CB    1 
ATOM   2198  O OG1   . THR C 3 93  ? 128.797 130.812 135.555 1.00 19.62  ? 101  THR C OG1   1 
ATOM   2199  C CG2   . THR C 3 93  ? 126.541 130.102 135.168 1.00 19.62  ? 101  THR C CG2   1 
ATOM   2200  N N     . ILE C 3 94  ? 124.939 130.802 138.124 1.00 18.46  ? 102  ILE C N     1 
ATOM   2201  C CA    . ILE C 3 94  ? 123.676 130.192 138.506 1.00 18.46  ? 102  ILE C CA    1 
ATOM   2202  C C     . ILE C 3 94  ? 122.962 129.748 137.239 1.00 18.46  ? 102  ILE C C     1 
ATOM   2203  O O     . ILE C 3 94  ? 122.841 130.524 136.288 1.00 18.46  ? 102  ILE C O     1 
ATOM   2204  C CB    . ILE C 3 94  ? 122.819 131.167 139.323 1.00 18.46  ? 102  ILE C CB    1 
ATOM   2205  C CG1   . ILE C 3 94  ? 123.494 131.467 140.650 1.00 18.46  ? 102  ILE C CG1   1 
ATOM   2206  C CG2   . ILE C 3 94  ? 121.460 130.609 139.594 1.00 18.46  ? 102  ILE C CG2   1 
ATOM   2207  C CD1   . ILE C 3 94  ? 122.797 132.526 141.438 1.00 18.46  ? 102  ILE C CD1   1 
ATOM   2208  N N     . ALA C 3 95  ? 122.522 128.492 137.212 1.00 22.78  ? 103  ALA C N     1 
ATOM   2209  C CA    . ALA C 3 95  ? 121.850 127.947 136.041 1.00 22.78  ? 103  ALA C CA    1 
ATOM   2210  C C     . ALA C 3 95  ? 120.484 128.583 135.847 1.00 22.78  ? 103  ALA C C     1 
ATOM   2211  O O     . ALA C 3 95  ? 119.808 128.944 136.811 1.00 22.78  ? 103  ALA C O     1 
ATOM   2212  C CB    . ALA C 3 95  ? 121.687 126.441 136.173 1.00 22.78  ? 103  ALA C CB    1 
ATOM   2213  N N     . GLN C 3 96  ? 120.095 128.713 134.572 1.00 25.29  ? 104  GLN C N     1 
ATOM   2214  C CA    . GLN C 3 96  ? 118.878 129.407 134.132 1.00 25.29  ? 104  GLN C CA    1 
ATOM   2215  C C     . GLN C 3 96  ? 118.822 130.827 134.680 1.00 25.29  ? 104  GLN C C     1 
ATOM   2216  O O     . GLN C 3 96  ? 117.765 131.338 135.038 1.00 25.29  ? 104  GLN C O     1 
ATOM   2217  C CB    . GLN C 3 96  ? 117.622 128.624 134.508 1.00 25.29  ? 104  GLN C CB    1 
ATOM   2218  C CG    . GLN C 3 96  ? 117.545 127.265 133.860 1.00 25.29  ? 104  GLN C CG    1 
ATOM   2219  C CD    . GLN C 3 96  ? 117.373 127.351 132.365 1.00 25.29  ? 104  GLN C CD    1 
ATOM   2220  O OE1   . GLN C 3 96  ? 116.628 128.188 131.867 1.00 25.29  ? 104  GLN C OE1   1 
ATOM   2221  N NE2   . GLN C 3 96  ? 118.064 126.486 131.637 1.00 25.29  ? 104  GLN C NE2   1 
ATOM   2222  N N     . GLY C 3 97  ? 119.976 131.471 134.741 1.00 22.81  ? 105  GLY C N     1 
ATOM   2223  C CA    . GLY C 3 97  ? 120.088 132.695 135.494 1.00 22.81  ? 105  GLY C CA    1 
ATOM   2224  C C     . GLY C 3 97  ? 119.591 133.920 134.774 1.00 22.81  ? 105  GLY C C     1 
ATOM   2225  O O     . GLY C 3 97  ? 118.671 134.585 135.244 1.00 22.81  ? 105  GLY C O     1 
ATOM   2226  N N     . GLY C 3 98  ? 120.184 134.236 133.641 1.00 26.90  ? 106  GLY C N     1 
ATOM   2227  C CA    . GLY C 3 98  ? 119.978 135.537 133.054 1.00 26.90  ? 106  GLY C CA    1 
ATOM   2228  C C     . GLY C 3 98  ? 120.854 136.554 133.742 1.00 26.90  ? 106  GLY C C     1 
ATOM   2229  O O     . GLY C 3 98  ? 121.599 136.255 134.673 1.00 26.90  ? 106  GLY C O     1 
ATOM   2230  N N     . VAL C 3 99  ? 120.769 137.789 133.277 1.00 28.97  ? 107  VAL C N     1 
ATOM   2231  C CA    . VAL C 3 99  ? 121.633 138.819 133.831 1.00 28.97  ? 107  VAL C CA    1 
ATOM   2232  C C     . VAL C 3 99  ? 120.793 139.854 134.555 1.00 28.97  ? 107  VAL C C     1 
ATOM   2233  O O     . VAL C 3 99  ? 119.562 139.775 134.554 1.00 28.97  ? 107  VAL C O     1 
ATOM   2234  C CB    . VAL C 3 99  ? 122.475 139.469 132.728 1.00 28.97  ? 107  VAL C CB    1 
ATOM   2235  C CG1   . VAL C 3 99  ? 123.380 138.455 132.129 1.00 28.97  ? 107  VAL C CG1   1 
ATOM   2236  C CG2   . VAL C 3 99  ? 121.570 140.014 131.673 1.00 28.97  ? 107  VAL C CG2   1 
ATOM   2237  N N     . LEU C 3 100 ? 121.442 140.807 135.197 1.00 36.42  ? 108  LEU C N     1 
ATOM   2238  C CA    . LEU C 3 100 ? 120.725 141.986 135.644 1.00 36.42  ? 108  LEU C CA    1 
ATOM   2239  C C     . LEU C 3 100 ? 120.335 142.809 134.429 1.00 36.42  ? 108  LEU C C     1 
ATOM   2240  O O     . LEU C 3 100 ? 121.169 143.021 133.543 1.00 36.42  ? 108  LEU C O     1 
ATOM   2241  C CB    . LEU C 3 100 ? 121.565 142.834 136.581 1.00 36.42  ? 108  LEU C CB    1 
ATOM   2242  C CG    . LEU C 3 100 ? 121.767 142.382 138.012 1.00 36.42  ? 108  LEU C CG    1 
ATOM   2243  C CD1   . LEU C 3 100 ? 122.757 143.308 138.673 1.00 36.42  ? 108  LEU C CD1   1 
ATOM   2244  C CD2   . LEU C 3 100 ? 120.443 142.435 138.720 1.00 36.42  ? 108  LEU C CD2   1 
ATOM   2245  N N     . PRO C 3 101 ? 119.103 143.267 134.335 1.00 42.27  ? 109  PRO C N     1 
ATOM   2246  C CA    . PRO C 3 101 ? 118.733 144.114 133.199 1.00 42.27  ? 109  PRO C CA    1 
ATOM   2247  C C     . PRO C 3 101 ? 119.353 145.495 133.306 1.00 42.27  ? 109  PRO C C     1 
ATOM   2248  O O     . PRO C 3 101 ? 118.913 146.328 134.100 1.00 42.27  ? 109  PRO C O     1 
ATOM   2249  C CB    . PRO C 3 101 ? 117.205 144.157 133.281 1.00 42.27  ? 109  PRO C CB    1 
ATOM   2250  C CG    . PRO C 3 101 ? 116.894 143.850 134.702 1.00 42.27  ? 109  PRO C CG    1 
ATOM   2251  C CD    . PRO C 3 101 ? 117.946 142.907 135.166 1.00 42.27  ? 109  PRO C CD    1 
ATOM   2252  N N     . ASN C 3 102 ? 120.379 145.751 132.499 1.00 51.86  ? 110  ASN C N     1 
ATOM   2253  C CA    . ASN C 3 102 ? 121.198 146.942 132.693 1.00 51.86  ? 110  ASN C CA    1 
ATOM   2254  C C     . ASN C 3 102 ? 121.861 147.313 131.377 1.00 51.86  ? 110  ASN C C     1 
ATOM   2255  O O     . ASN C 3 102 ? 122.688 146.552 130.868 1.00 51.86  ? 110  ASN C O     1 
ATOM   2256  C CB    . ASN C 3 102 ? 122.238 146.681 133.766 1.00 51.86  ? 110  ASN C CB    1 
ATOM   2257  C CG    . ASN C 3 102 ? 122.846 147.945 134.298 1.00 51.86  ? 110  ASN C CG    1 
ATOM   2258  O OD1   . ASN C 3 102 ? 122.492 149.043 133.876 1.00 51.86  ? 110  ASN C OD1   1 
ATOM   2259  N ND2   . ASN C 3 102 ? 123.767 147.804 135.240 1.00 51.86  ? 110  ASN C ND2   1 
ATOM   2260  N N     . ILE C 3 103 ? 121.517 148.481 130.840 1.00 56.71  ? 111  ILE C N     1 
ATOM   2261  C CA    . ILE C 3 103 ? 122.042 148.963 129.569 1.00 56.71  ? 111  ILE C CA    1 
ATOM   2262  C C     . ILE C 3 103 ? 122.865 150.214 129.851 1.00 56.71  ? 111  ILE C C     1 
ATOM   2263  O O     . ILE C 3 103 ? 122.540 150.994 130.751 1.00 56.71  ? 111  ILE C O     1 
ATOM   2264  C CB    . ILE C 3 103 ? 120.903 149.276 128.576 1.00 56.71  ? 111  ILE C CB    1 
ATOM   2265  C CG1   . ILE C 3 103 ? 119.892 148.142 128.537 1.00 56.71  ? 111  ILE C CG1   1 
ATOM   2266  C CG2   . ILE C 3 103 ? 121.429 149.406 127.168 1.00 56.71  ? 111  ILE C CG2   1 
ATOM   2267  C CD1   . ILE C 3 103 ? 118.616 148.535 127.850 1.00 56.71  ? 111  ILE C CD1   1 
ATOM   2268  N N     . GLN C 3 104 ? 123.939 150.399 129.090 1.00 63.92  ? 112  GLN C N     1 
ATOM   2269  C CA    . GLN C 3 104 ? 124.765 151.587 129.229 1.00 63.92  ? 112  GLN C CA    1 
ATOM   2270  C C     . GLN C 3 104 ? 124.031 152.832 128.739 1.00 63.92  ? 112  GLN C C     1 
ATOM   2271  O O     . GLN C 3 104 ? 123.072 152.765 127.969 1.00 63.92  ? 112  GLN C O     1 
ATOM   2272  C CB    . GLN C 3 104 ? 126.068 151.415 128.459 1.00 63.92  ? 112  GLN C CB    1 
ATOM   2273  C CG    . GLN C 3 104 ? 126.955 150.346 129.045 1.00 63.92  ? 112  GLN C CG    1 
ATOM   2274  C CD    . GLN C 3 104 ? 127.528 150.751 130.381 1.00 63.92  ? 112  GLN C CD    1 
ATOM   2275  O OE1   . GLN C 3 104 ? 127.926 151.900 130.573 1.00 63.92  ? 112  GLN C OE1   1 
ATOM   2276  N NE2   . GLN C 3 104 ? 127.565 149.813 131.322 1.00 63.92  ? 112  GLN C NE2   1 
ATOM   2277  N N     . SER C 3 105 ? 124.503 153.984 129.203 1.00 65.98  ? 113  SER C N     1 
ATOM   2278  C CA    . SER C 3 105 ? 123.890 155.264 128.884 1.00 65.98  ? 113  SER C CA    1 
ATOM   2279  C C     . SER C 3 105 ? 124.435 155.891 127.611 1.00 65.98  ? 113  SER C C     1 
ATOM   2280  O O     . SER C 3 105 ? 123.888 156.898 127.151 1.00 65.98  ? 113  SER C O     1 
ATOM   2281  C CB    . SER C 3 105 ? 124.079 156.239 130.047 1.00 65.98  ? 113  SER C CB    1 
ATOM   2282  O OG    . SER C 3 105 ? 125.450 156.536 130.237 1.00 65.98  ? 113  SER C OG    1 
ATOM   2283  N N     . VAL C 3 106 ? 125.505 155.340 127.043 1.00 60.73  ? 114  VAL C N     1 
ATOM   2284  C CA    . VAL C 3 106 ? 125.951 155.791 125.732 1.00 60.73  ? 114  VAL C CA    1 
ATOM   2285  C C     . VAL C 3 106 ? 125.082 155.171 124.645 1.00 60.73  ? 114  VAL C C     1 
ATOM   2286  O O     . VAL C 3 106 ? 124.754 155.828 123.651 1.00 60.73  ? 114  VAL C O     1 
ATOM   2287  C CB    . VAL C 3 106 ? 127.437 155.445 125.545 1.00 60.73  ? 114  VAL C CB    1 
ATOM   2288  C CG1   . VAL C 3 106 ? 127.962 155.943 124.210 1.00 60.73  ? 114  VAL C CG1   1 
ATOM   2289  C CG2   . VAL C 3 106 ? 128.247 155.986 126.696 1.00 60.73  ? 114  VAL C CG2   1 
ATOM   2290  N N     . LEU C 3 107 ? 124.666 153.918 124.831 1.00 56.74  ? 115  LEU C N     1 
ATOM   2291  C CA    . LEU C 3 107 ? 123.865 153.222 123.837 1.00 56.74  ? 115  LEU C CA    1 
ATOM   2292  C C     . LEU C 3 107 ? 122.419 153.682 123.823 1.00 56.74  ? 115  LEU C C     1 
ATOM   2293  O O     . LEU C 3 107 ? 121.731 153.472 122.820 1.00 56.74  ? 115  LEU C O     1 
ATOM   2294  C CB    . LEU C 3 107 ? 123.912 151.717 124.077 1.00 56.74  ? 115  LEU C CB    1 
ATOM   2295  C CG    . LEU C 3 107 ? 125.308 151.109 124.025 1.00 56.74  ? 115  LEU C CG    1 
ATOM   2296  C CD1   . LEU C 3 107 ? 125.233 149.634 124.270 1.00 56.74  ? 115  LEU C CD1   1 
ATOM   2297  C CD2   . LEU C 3 107 ? 125.987 151.403 122.713 1.00 56.74  ? 115  LEU C CD2   1 
ATOM   2298  N N     . LEU C 3 108 ? 121.940 154.281 124.908 1.00 71.19  ? 116  LEU C N     1 
ATOM   2299  C CA    . LEU C 3 108 ? 120.615 154.871 124.908 1.00 71.19  ? 116  LEU C CA    1 
ATOM   2300  C C     . LEU C 3 108 ? 120.586 156.078 123.973 1.00 71.19  ? 116  LEU C C     1 
ATOM   2301  O O     . LEU C 3 108 ? 121.591 156.777 123.825 1.00 71.19  ? 116  LEU C O     1 
ATOM   2302  C CB    . LEU C 3 108 ? 120.217 155.291 126.319 1.00 71.19  ? 116  LEU C CB    1 
ATOM   2303  C CG    . LEU C 3 108 ? 119.937 154.147 127.284 1.00 71.19  ? 116  LEU C CG    1 
ATOM   2304  C CD1   . LEU C 3 108 ? 119.699 154.678 128.675 1.00 71.19  ? 116  LEU C CD1   1 
ATOM   2305  C CD2   . LEU C 3 108 ? 118.736 153.357 126.807 1.00 71.19  ? 116  LEU C CD2   1 
ATOM   2306  N N     . PRO C 3 109 ? 119.453 156.333 123.321 1.00 84.79  ? 117  PRO C N     1 
ATOM   2307  C CA    . PRO C 3 109 ? 119.391 157.421 122.342 1.00 84.79  ? 117  PRO C CA    1 
ATOM   2308  C C     . PRO C 3 109 ? 119.445 158.788 123.006 1.00 84.79  ? 117  PRO C C     1 
ATOM   2309  O O     . PRO C 3 109 ? 119.400 158.937 124.228 1.00 84.79  ? 117  PRO C O     1 
ATOM   2310  C CB    . PRO C 3 109 ? 118.041 157.203 121.655 1.00 84.79  ? 117  PRO C CB    1 
ATOM   2311  C CG    . PRO C 3 109 ? 117.693 155.790 121.929 1.00 84.79  ? 117  PRO C CG    1 
ATOM   2312  C CD    . PRO C 3 109 ? 118.229 155.519 123.291 1.00 84.79  ? 117  PRO C CD    1 
ATOM   2313  N N     . LYS C 3 110 ? 119.535 159.807 122.162 1.00 91.13  ? 118  LYS C N     1 
ATOM   2314  C CA    . LYS C 3 110 ? 119.589 161.177 122.636 1.00 91.13  ? 118  LYS C CA    1 
ATOM   2315  C C     . LYS C 3 110 ? 118.182 161.695 122.922 1.00 91.13  ? 118  LYS C C     1 
ATOM   2316  O O     . LYS C 3 110 ? 117.184 160.988 122.770 1.00 91.13  ? 118  LYS C O     1 
ATOM   2317  C CB    . LYS C 3 110 ? 120.303 162.051 121.611 1.00 91.13  ? 118  LYS C CB    1 
ATOM   2318  C CG    . LYS C 3 110 ? 121.743 161.662 121.389 1.00 91.13  ? 118  LYS C CG    1 
ATOM   2319  C CD    . LYS C 3 110 ? 122.403 162.572 120.379 1.00 91.13  ? 118  LYS C CD    1 
ATOM   2320  C CE    . LYS C 3 110 ? 121.880 162.289 118.989 1.00 91.13  ? 118  LYS C CE    1 
ATOM   2321  N NZ    . LYS C 3 110 ? 122.270 160.929 118.540 1.00 91.13  ? 118  LYS C NZ    1 
ATOM   2322  N N     . LYS C 3 111 ? 118.107 162.950 123.358 1.00 96.38  ? 119  LYS C N     1 
ATOM   2323  C CA    . LYS C 3 111 ? 116.841 163.650 123.512 1.00 96.38  ? 119  LYS C CA    1 
ATOM   2324  C C     . LYS C 3 111 ? 116.508 164.491 122.285 1.00 96.38  ? 119  LYS C C     1 
ATOM   2325  O O     . LYS C 3 111 ? 115.339 164.831 122.068 1.00 96.38  ? 119  LYS C O     1 
ATOM   2326  C CB    . LYS C 3 111 ? 116.892 164.527 124.774 1.00 96.38  ? 119  LYS C CB    1 
ATOM   2327  C CG    . LYS C 3 111 ? 115.569 165.154 125.222 1.00 96.38  ? 119  LYS C CG    1 
ATOM   2328  C CD    . LYS C 3 111 ? 115.725 165.912 126.524 1.00 96.38  ? 119  LYS C CD    1 
ATOM   2329  C CE    . LYS C 3 111 ? 116.520 167.191 126.313 1.00 96.38  ? 119  LYS C CE    1 
ATOM   2330  N NZ    . LYS C 3 111 ? 115.765 168.179 125.493 1.00 96.38  ? 119  LYS C NZ    1 
ATOM   2331  N N     . THR C 3 112 ? 117.506 164.803 121.462 1.00 107.26 ? 120  THR C N     1 
ATOM   2332  C CA    . THR C 3 112 ? 117.306 165.581 120.247 1.00 107.26 ? 120  THR C CA    1 
ATOM   2333  C C     . THR C 3 112 ? 116.909 164.672 119.083 1.00 107.26 ? 120  THR C C     1 
ATOM   2334  O O     . THR C 3 112 ? 117.603 163.695 118.774 1.00 107.26 ? 120  THR C O     1 
ATOM   2335  C CB    . THR C 3 112 ? 118.558 166.411 119.932 1.00 107.26 ? 120  THR C CB    1 
ATOM   2336  O OG1   . THR C 3 112 ? 118.433 167.029 118.644 1.00 107.26 ? 120  THR C OG1   1 
ATOM   2337  C CG2   . THR C 3 112 ? 119.853 165.600 120.035 1.00 107.26 ? 120  THR C CG2   1 
ATOM   2338  N N     . GLU C 3 113 ? 115.761 164.971 118.477 1.00 117.70 ? 121  GLU C N     1 
ATOM   2339  C CA    . GLU C 3 113 ? 115.310 164.327 117.244 1.00 117.70 ? 121  GLU C CA    1 
ATOM   2340  C C     . GLU C 3 113 ? 114.306 165.219 116.517 1.00 117.70 ? 121  GLU C C     1 
ATOM   2341  O O     . GLU C 3 113 ? 113.681 166.090 117.122 1.00 117.70 ? 121  GLU C O     1 
ATOM   2342  C CB    . GLU C 3 113 ? 114.678 162.952 117.510 1.00 117.70 ? 121  GLU C CB    1 
ATOM   2343  C CG    . GLU C 3 113 ? 113.363 162.986 118.274 1.00 117.70 ? 121  GLU C CG    1 
ATOM   2344  C CD    . GLU C 3 113 ? 113.539 162.748 119.758 1.00 117.70 ? 121  GLU C CD    1 
ATOM   2345  O OE1   . GLU C 3 113 ? 114.692 162.748 120.227 1.00 117.70 ? 121  GLU C OE1   1 
ATOM   2346  O OE2   . GLU C 3 113 ? 112.519 162.561 120.453 1.00 117.70 ? 121  GLU C OE2   1 
ATOM   2347  N N     . LYS D 4 1   ? 111.475 97.535  143.886 1.00 107.23 ? 28   LYS D N     1 
ATOM   2348  C CA    . LYS D 4 1   ? 111.771 97.067  145.233 1.00 107.23 ? 28   LYS D CA    1 
ATOM   2349  C C     . LYS D 4 1   ? 113.256 97.347  145.462 1.00 107.23 ? 28   LYS D C     1 
ATOM   2350  O O     . LYS D 4 1   ? 113.850 96.954  146.467 1.00 107.23 ? 28   LYS D O     1 
ATOM   2351  C CB    . LYS D 4 1   ? 111.419 95.575  145.378 1.00 107.23 ? 28   LYS D CB    1 
ATOM   2352  C CG    . LYS D 4 1   ? 111.298 95.053  146.818 1.00 107.23 ? 28   LYS D CG    1 
ATOM   2353  C CD    . LYS D 4 1   ? 110.743 93.637  146.880 1.00 107.23 ? 28   LYS D CD    1 
ATOM   2354  C CE    . LYS D 4 1   ? 111.792 92.607  146.523 1.00 107.23 ? 28   LYS D CE    1 
ATOM   2355  N NZ    . LYS D 4 1   ? 112.834 92.506  147.585 1.00 107.23 ? 28   LYS D NZ    1 
ATOM   2356  N N     . ARG D 4 2   ? 113.836 98.078  144.510 1.00 125.33 ? 29   ARG D N     1 
ATOM   2357  C CA    . ARG D 4 2   ? 115.275 98.290  144.463 1.00 125.33 ? 29   ARG D CA    1 
ATOM   2358  C C     . ARG D 4 2   ? 115.780 99.236  145.540 1.00 125.33 ? 29   ARG D C     1 
ATOM   2359  O O     . ARG D 4 2   ? 116.976 99.182  145.860 1.00 125.33 ? 29   ARG D O     1 
ATOM   2360  C CB    . ARG D 4 2   ? 115.686 98.816  143.081 1.00 125.33 ? 29   ARG D CB    1 
ATOM   2361  C CG    . ARG D 4 2   ? 115.222 100.227 142.759 1.00 125.33 ? 29   ARG D CG    1 
ATOM   2362  C CD    . ARG D 4 2   ? 115.556 100.585 141.320 1.00 125.33 ? 29   ARG D CD    1 
ATOM   2363  N NE    . ARG D 4 2   ? 116.993 100.556 141.048 1.00 125.33 ? 29   ARG D NE    1 
ATOM   2364  C CZ    . ARG D 4 2   ? 117.827 101.568 141.271 1.00 125.33 ? 29   ARG D CZ    1 
ATOM   2365  N NH1   . ARG D 4 2   ? 117.377 102.705 141.777 1.00 125.33 ? 29   ARG D NH1   1 
ATOM   2366  N NH2   . ARG D 4 2   ? 119.116 101.440 140.986 1.00 125.33 ? 29   ARG D NH2   1 
ATOM   2367  N N     . ARG D 4 3   ? 114.897 100.079 146.096 1.00 133.33 ? 30   ARG D N     1 
ATOM   2368  C CA    . ARG D 4 3   ? 115.183 100.994 147.206 1.00 133.33 ? 30   ARG D CA    1 
ATOM   2369  C C     . ARG D 4 3   ? 116.335 101.939 146.848 1.00 133.33 ? 30   ARG D C     1 
ATOM   2370  O O     . ARG D 4 3   ? 117.484 101.722 147.247 1.00 133.33 ? 30   ARG D O     1 
ATOM   2371  C CB    . ARG D 4 3   ? 115.458 100.234 148.510 1.00 133.33 ? 30   ARG D CB    1 
ATOM   2372  C CG    . ARG D 4 3   ? 115.488 101.135 149.730 1.00 133.33 ? 30   ARG D CG    1 
ATOM   2373  C CD    . ARG D 4 3   ? 115.735 100.363 151.013 1.00 133.33 ? 30   ARG D CD    1 
ATOM   2374  N NE    . ARG D 4 3   ? 114.685 99.388  151.298 1.00 133.33 ? 30   ARG D NE    1 
ATOM   2375  C CZ    . ARG D 4 3   ? 113.501 99.681  151.830 1.00 133.33 ? 30   ARG D CZ    1 
ATOM   2376  N NH1   . ARG D 4 3   ? 113.182 100.931 152.136 1.00 133.33 ? 30   ARG D NH1   1 
ATOM   2377  N NH2   . ARG D 4 3   ? 112.630 98.712  152.060 1.00 133.33 ? 30   ARG D NH2   1 
ATOM   2378  N N     . LYS D 4 4   ? 116.000 102.884 145.955 1.00 120.76 ? 31   LYS D N     1 
ATOM   2379  C CA    . LYS D 4 4   ? 116.894 103.917 145.418 1.00 120.76 ? 31   LYS D CA    1 
ATOM   2380  C C     . LYS D 4 4   ? 117.807 104.500 146.486 1.00 120.76 ? 31   LYS D C     1 
ATOM   2381  O O     . LYS D 4 4   ? 117.340 104.990 147.518 1.00 120.76 ? 31   LYS D O     1 
ATOM   2382  C CB    . LYS D 4 4   ? 116.067 105.045 144.790 1.00 120.76 ? 31   LYS D CB    1 
ATOM   2383  C CG    . LYS D 4 4   ? 115.314 104.667 143.534 1.00 120.76 ? 31   LYS D CG    1 
ATOM   2384  C CD    . LYS D 4 4   ? 114.430 105.808 143.061 1.00 120.76 ? 31   LYS D CD    1 
ATOM   2385  C CE    . LYS D 4 4   ? 115.230 106.961 142.491 1.00 120.76 ? 31   LYS D CE    1 
ATOM   2386  N NZ    . LYS D 4 4   ? 115.861 106.623 141.187 1.00 120.76 ? 31   LYS D NZ    1 
ATOM   2387  N N     . THR D 4 5   ? 119.112 104.391 146.238 1.00 107.34 ? 32   THR D N     1 
ATOM   2388  C CA    . THR D 4 5   ? 120.120 104.600 147.267 1.00 107.34 ? 32   THR D CA    1 
ATOM   2389  C C     . THR D 4 5   ? 120.131 106.056 147.708 1.00 107.34 ? 32   THR D C     1 
ATOM   2390  O O     . THR D 4 5   ? 120.054 106.969 146.882 1.00 107.34 ? 32   THR D O     1 
ATOM   2391  C CB    . THR D 4 5   ? 121.491 104.181 146.739 1.00 107.34 ? 32   THR D CB    1 
ATOM   2392  O OG1   . THR D 4 5   ? 121.417 102.836 146.253 1.00 107.34 ? 32   THR D OG1   1 
ATOM   2393  C CG2   . THR D 4 5   ? 122.536 104.229 147.843 1.00 107.34 ? 32   THR D CG2   1 
ATOM   2394  N N     . ARG D 4 6   ? 120.176 106.261 149.022 1.00 92.36  ? 33   ARG D N     1 
ATOM   2395  C CA    . ARG D 4 6   ? 119.916 107.568 149.606 1.00 92.36  ? 33   ARG D CA    1 
ATOM   2396  C C     . ARG D 4 6   ? 121.035 108.543 149.276 1.00 92.36  ? 33   ARG D C     1 
ATOM   2397  O O     . ARG D 4 6   ? 122.206 108.276 149.558 1.00 92.36  ? 33   ARG D O     1 
ATOM   2398  C CB    . ARG D 4 6   ? 119.766 107.451 151.117 1.00 92.36  ? 33   ARG D CB    1 
ATOM   2399  C CG    . ARG D 4 6   ? 118.587 106.641 151.592 1.00 92.36  ? 33   ARG D CG    1 
ATOM   2400  C CD    . ARG D 4 6   ? 118.425 106.842 153.083 1.00 92.36  ? 33   ARG D CD    1 
ATOM   2401  N NE    . ARG D 4 6   ? 117.342 106.050 153.650 1.00 92.36  ? 33   ARG D NE    1 
ATOM   2402  C CZ    . ARG D 4 6   ? 116.938 106.144 154.913 1.00 92.36  ? 33   ARG D CZ    1 
ATOM   2403  N NH1   . ARG D 4 6   ? 117.505 107.020 155.728 1.00 92.36  ? 33   ARG D NH1   1 
ATOM   2404  N NH2   . ARG D 4 6   ? 115.949 105.382 155.355 1.00 92.36  ? 33   ARG D NH2   1 
ATOM   2405  N N     . LYS D 4 7   ? 120.672 109.666 148.671 1.00 70.06  ? 34   LYS D N     1 
ATOM   2406  C CA    . LYS D 4 7   ? 121.548 110.820 148.566 1.00 70.06  ? 34   LYS D CA    1 
ATOM   2407  C C     . LYS D 4 7   ? 120.991 111.896 149.478 1.00 70.06  ? 34   LYS D C     1 
ATOM   2408  O O     . LYS D 4 7   ? 119.870 112.367 149.268 1.00 70.06  ? 34   LYS D O     1 
ATOM   2409  C CB    . LYS D 4 7   ? 121.645 111.333 147.134 1.00 70.06  ? 34   LYS D CB    1 
ATOM   2410  C CG    . LYS D 4 7   ? 122.609 112.491 147.025 1.00 70.06  ? 34   LYS D CG    1 
ATOM   2411  C CD    . LYS D 4 7   ? 122.741 113.016 145.618 1.00 70.06  ? 34   LYS D CD    1 
ATOM   2412  C CE    . LYS D 4 7   ? 123.770 114.132 145.570 1.00 70.06  ? 34   LYS D CE    1 
ATOM   2413  N NZ    . LYS D 4 7   ? 123.318 115.316 146.354 1.00 70.06  ? 34   LYS D NZ    1 
ATOM   2414  N N     . GLU D 4 8   ? 121.760 112.277 150.485 1.00 64.02  ? 35   GLU D N     1 
ATOM   2415  C CA    . GLU D 4 8   ? 121.268 113.124 151.561 1.00 64.02  ? 35   GLU D CA    1 
ATOM   2416  C C     . GLU D 4 8   ? 121.684 114.566 151.297 1.00 64.02  ? 35   GLU D C     1 
ATOM   2417  O O     . GLU D 4 8   ? 122.863 114.912 151.413 1.00 64.02  ? 35   GLU D O     1 
ATOM   2418  C CB    . GLU D 4 8   ? 121.780 112.608 152.901 1.00 64.02  ? 35   GLU D CB    1 
ATOM   2419  C CG    . GLU D 4 8   ? 121.217 111.227 153.202 1.00 64.02  ? 35   GLU D CG    1 
ATOM   2420  C CD    . GLU D 4 8   ? 121.713 110.621 154.496 1.00 64.02  ? 35   GLU D CD    1 
ATOM   2421  O OE1   . GLU D 4 8   ? 122.582 111.227 155.157 1.00 64.02  ? 35   GLU D OE1   1 
ATOM   2422  O OE2   . GLU D 4 8   ? 121.237 109.522 154.843 1.00 64.02  ? 35   GLU D OE2   1 
ATOM   2423  N N     . SER D 4 9   ? 120.707 115.398 150.944 1.00 44.96  ? 36   SER D N     1 
ATOM   2424  C CA    . SER D 4 9   ? 120.877 116.805 150.625 1.00 44.96  ? 36   SER D CA    1 
ATOM   2425  C C     . SER D 4 9   ? 120.346 117.666 151.762 1.00 44.96  ? 36   SER D C     1 
ATOM   2426  O O     . SER D 4 9   ? 119.882 117.170 152.787 1.00 44.96  ? 36   SER D O     1 
ATOM   2427  C CB    . SER D 4 9   ? 120.149 117.144 149.334 1.00 44.96  ? 36   SER D CB    1 
ATOM   2428  O OG    . SER D 4 9   ? 118.752 117.045 149.523 1.00 44.96  ? 36   SER D OG    1 
ATOM   2429  N N     . TYR D 4 10  ? 120.411 118.981 151.564 1.00 31.61  ? 37   TYR D N     1 
ATOM   2430  C CA    . TYR D 4 10  ? 119.951 119.953 152.544 1.00 31.61  ? 37   TYR D CA    1 
ATOM   2431  C C     . TYR D 4 10  ? 118.602 120.543 152.165 1.00 31.61  ? 37   TYR D C     1 
ATOM   2432  O O     . TYR D 4 10  ? 118.289 121.681 152.545 1.00 31.61  ? 37   TYR D O     1 
ATOM   2433  C CB    . TYR D 4 10  ? 120.974 121.067 152.700 1.00 31.61  ? 37   TYR D CB    1 
ATOM   2434  C CG    . TYR D 4 10  ? 122.318 120.624 153.199 1.00 31.61  ? 37   TYR D CG    1 
ATOM   2435  C CD1   . TYR D 4 10  ? 122.559 120.454 154.549 1.00 31.61  ? 37   TYR D CD1   1 
ATOM   2436  C CD2   . TYR D 4 10  ? 123.352 120.396 152.317 1.00 31.61  ? 37   TYR D CD2   1 
ATOM   2437  C CE1   . TYR D 4 10  ? 123.792 120.074 155.000 1.00 31.61  ? 37   TYR D CE1   1 
ATOM   2438  C CE2   . TYR D 4 10  ? 124.577 120.017 152.758 1.00 31.61  ? 37   TYR D CE2   1 
ATOM   2439  C CZ    . TYR D 4 10  ? 124.793 119.858 154.098 1.00 31.61  ? 37   TYR D CZ    1 
ATOM   2440  O OH    . TYR D 4 10  ? 126.032 119.469 154.523 1.00 31.61  ? 37   TYR D OH    1 
ATOM   2441  N N     . ALA D 4 11  ? 117.799 119.778 151.428 1.00 33.22  ? 38   ALA D N     1 
ATOM   2442  C CA    . ALA D 4 11  ? 116.587 120.315 150.825 1.00 33.22  ? 38   ALA D CA    1 
ATOM   2443  C C     . ALA D 4 11  ? 115.543 120.654 151.872 1.00 33.22  ? 38   ALA D C     1 
ATOM   2444  O O     . ALA D 4 11  ? 114.965 121.749 151.847 1.00 33.22  ? 38   ALA D O     1 
ATOM   2445  C CB    . ALA D 4 11  ? 116.026 119.326 149.812 1.00 33.22  ? 38   ALA D CB    1 
ATOM   2446  N N     . ILE D 4 12  ? 115.314 119.751 152.824 1.00 37.25  ? 39   ILE D N     1 
ATOM   2447  C CA    . ILE D 4 12  ? 114.288 120.011 153.812 1.00 37.25  ? 39   ILE D CA    1 
ATOM   2448  C C     . ILE D 4 12  ? 114.721 121.089 154.789 1.00 37.25  ? 39   ILE D C     1 
ATOM   2449  O O     . ILE D 4 12  ? 113.874 121.805 155.329 1.00 37.25  ? 39   ILE D O     1 
ATOM   2450  C CB    . ILE D 4 12  ? 113.897 118.707 154.522 1.00 37.25  ? 39   ILE D CB    1 
ATOM   2451  C CG1   . ILE D 4 12  ? 115.090 118.096 155.229 1.00 37.25  ? 39   ILE D CG1   1 
ATOM   2452  C CG2   . ILE D 4 12  ? 113.369 117.710 153.526 1.00 37.25  ? 39   ILE D CG2   1 
ATOM   2453  C CD1   . ILE D 4 12  ? 114.721 116.921 156.076 1.00 37.25  ? 39   ILE D CD1   1 
ATOM   2454  N N     . TYR D 4 13  ? 116.020 121.302 154.955 1.00 32.71  ? 40   TYR D N     1 
ATOM   2455  C CA    . TYR D 4 13  ? 116.443 122.348 155.868 1.00 32.71  ? 40   TYR D CA    1 
ATOM   2456  C C     . TYR D 4 13  ? 116.347 123.722 155.223 1.00 32.71  ? 40   TYR D C     1 
ATOM   2457  O O     . TYR D 4 13  ? 115.978 124.694 155.895 1.00 32.71  ? 40   TYR D O     1 
ATOM   2458  C CB    . TYR D 4 13  ? 117.852 122.061 156.344 1.00 32.71  ? 40   TYR D CB    1 
ATOM   2459  C CG    . TYR D 4 13  ? 117.950 120.717 156.999 1.00 32.71  ? 40   TYR D CG    1 
ATOM   2460  C CD1   . TYR D 4 13  ? 117.443 120.508 158.264 1.00 32.71  ? 40   TYR D CD1   1 
ATOM   2461  C CD2   . TYR D 4 13  ? 118.554 119.659 156.352 1.00 32.71  ? 40   TYR D CD2   1 
ATOM   2462  C CE1   . TYR D 4 13  ? 117.526 119.282 158.867 1.00 32.71  ? 40   TYR D CE1   1 
ATOM   2463  C CE2   . TYR D 4 13  ? 118.638 118.427 156.943 1.00 32.71  ? 40   TYR D CE2   1 
ATOM   2464  C CZ    . TYR D 4 13  ? 118.129 118.246 158.205 1.00 32.71  ? 40   TYR D CZ    1 
ATOM   2465  O OH    . TYR D 4 13  ? 118.214 117.018 158.808 1.00 32.71  ? 40   TYR D OH    1 
ATOM   2466  N N     . VAL D 4 14  ? 116.675 123.818 153.929 1.00 27.82  ? 41   VAL D N     1 
ATOM   2467  C CA    . VAL D 4 14  ? 116.432 125.055 153.187 1.00 27.82  ? 41   VAL D CA    1 
ATOM   2468  C C     . VAL D 4 14  ? 114.951 125.384 153.182 1.00 27.82  ? 41   VAL D C     1 
ATOM   2469  O O     . VAL D 4 14  ? 114.558 126.533 153.412 1.00 27.82  ? 41   VAL D O     1 
ATOM   2470  C CB    . VAL D 4 14  ? 116.987 124.935 151.757 1.00 27.82  ? 41   VAL D CB    1 
ATOM   2471  C CG1   . VAL D 4 14  ? 116.537 126.083 150.904 1.00 27.82  ? 41   VAL D CG1   1 
ATOM   2472  C CG2   . VAL D 4 14  ? 118.485 124.905 151.789 1.00 27.82  ? 41   VAL D CG2   1 
ATOM   2473  N N     . TYR D 4 15  ? 114.107 124.369 152.999 1.00 37.18  ? 42   TYR D N     1 
ATOM   2474  C CA    . TYR D 4 15  ? 112.667 124.593 153.007 1.00 37.18  ? 42   TYR D CA    1 
ATOM   2475  C C     . TYR D 4 15  ? 112.158 125.018 154.382 1.00 37.18  ? 42   TYR D C     1 
ATOM   2476  O O     . TYR D 4 15  ? 111.251 125.850 154.477 1.00 37.18  ? 42   TYR D O     1 
ATOM   2477  C CB    . TYR D 4 15  ? 111.973 123.327 152.532 1.00 37.18  ? 42   TYR D CB    1 
ATOM   2478  C CG    . TYR D 4 15  ? 110.486 123.430 152.418 1.00 37.18  ? 42   TYR D CG    1 
ATOM   2479  C CD1   . TYR D 4 15  ? 109.899 124.088 151.356 1.00 37.18  ? 42   TYR D CD1   1 
ATOM   2480  C CD2   . TYR D 4 15  ? 109.668 122.845 153.366 1.00 37.18  ? 42   TYR D CD2   1 
ATOM   2481  C CE1   . TYR D 4 15  ? 108.537 124.173 151.247 1.00 37.18  ? 42   TYR D CE1   1 
ATOM   2482  C CE2   . TYR D 4 15  ? 108.305 122.924 153.270 1.00 37.18  ? 42   TYR D CE2   1 
ATOM   2483  C CZ    . TYR D 4 15  ? 107.744 123.589 152.208 1.00 37.18  ? 42   TYR D CZ    1 
ATOM   2484  O OH    . TYR D 4 15  ? 106.375 123.657 152.113 1.00 37.18  ? 42   TYR D OH    1 
ATOM   2485  N N     . LYS D 4 16  ? 112.758 124.503 155.451 1.00 30.14  ? 43   LYS D N     1 
ATOM   2486  C CA    . LYS D 4 16  ? 112.318 124.862 156.794 1.00 30.14  ? 43   LYS D CA    1 
ATOM   2487  C C     . LYS D 4 16  ? 112.726 126.286 157.156 1.00 30.14  ? 43   LYS D C     1 
ATOM   2488  O O     . LYS D 4 16  ? 111.939 127.038 157.746 1.00 30.14  ? 43   LYS D O     1 
ATOM   2489  C CB    . LYS D 4 16  ? 112.899 123.860 157.778 1.00 30.14  ? 43   LYS D CB    1 
ATOM   2490  C CG    . LYS D 4 16  ? 112.317 123.888 159.150 1.00 30.14  ? 43   LYS D CG    1 
ATOM   2491  C CD    . LYS D 4 16  ? 112.932 122.766 159.963 1.00 30.14  ? 43   LYS D CD    1 
ATOM   2492  C CE    . LYS D 4 16  ? 112.075 121.509 159.928 1.00 30.14  ? 43   LYS D CE    1 
ATOM   2493  N NZ    . LYS D 4 16  ? 112.185 120.730 158.654 1.00 30.14  ? 43   LYS D NZ    1 
ATOM   2494  N N     . VAL D 4 17  ? 113.945 126.685 156.794 1.00 30.63  ? 44   VAL D N     1 
ATOM   2495  C CA    . VAL D 4 17  ? 114.361 128.065 157.032 1.00 30.63  ? 44   VAL D CA    1 
ATOM   2496  C C     . VAL D 4 17  ? 113.574 129.025 156.138 1.00 30.63  ? 44   VAL D C     1 
ATOM   2497  O O     . VAL D 4 17  ? 113.274 130.162 156.538 1.00 30.63  ? 44   VAL D O     1 
ATOM   2498  C CB    . VAL D 4 17  ? 115.884 128.170 156.840 1.00 30.63  ? 44   VAL D CB    1 
ATOM   2499  C CG1   . VAL D 4 17  ? 116.371 129.581 156.982 1.00 30.63  ? 44   VAL D CG1   1 
ATOM   2500  C CG2   . VAL D 4 17  ? 116.574 127.309 157.855 1.00 30.63  ? 44   VAL D CG2   1 
ATOM   2501  N N     . LEU D 4 18  ? 113.162 128.566 154.955 1.00 32.17  ? 45   LEU D N     1 
ATOM   2502  C CA    . LEU D 4 18  ? 112.276 129.365 154.118 1.00 32.17  ? 45   LEU D CA    1 
ATOM   2503  C C     . LEU D 4 18  ? 110.916 129.554 154.770 1.00 32.17  ? 45   LEU D C     1 
ATOM   2504  O O     . LEU D 4 18  ? 110.374 130.662 154.771 1.00 32.17  ? 45   LEU D O     1 
ATOM   2505  C CB    . LEU D 4 18  ? 112.114 128.711 152.756 1.00 32.17  ? 45   LEU D CB    1 
ATOM   2506  C CG    . LEU D 4 18  ? 111.257 129.521 151.805 1.00 32.17  ? 45   LEU D CG    1 
ATOM   2507  C CD1   . LEU D 4 18  ? 111.967 130.812 151.538 1.00 32.17  ? 45   LEU D CD1   1 
ATOM   2508  C CD2   . LEU D 4 18  ? 111.030 128.774 150.532 1.00 32.17  ? 45   LEU D CD2   1 
ATOM   2509  N N     . LYS D 4 19  ? 110.365 128.500 155.368 1.00 39.86  ? 46   LYS D N     1 
ATOM   2510  C CA    . LYS D 4 19  ? 109.109 128.658 156.091 1.00 39.86  ? 46   LYS D CA    1 
ATOM   2511  C C     . LYS D 4 19  ? 109.267 129.392 157.413 1.00 39.86  ? 46   LYS D C     1 
ATOM   2512  O O     . LYS D 4 19  ? 108.256 129.669 158.063 1.00 39.86  ? 46   LYS D O     1 
ATOM   2513  C CB    . LYS D 4 19  ? 108.456 127.304 156.341 1.00 39.86  ? 46   LYS D CB    1 
ATOM   2514  C CG    . LYS D 4 19  ? 107.994 126.621 155.076 1.00 39.86  ? 46   LYS D CG    1 
ATOM   2515  C CD    . LYS D 4 19  ? 106.836 127.381 154.473 1.00 39.86  ? 46   LYS D CD    1 
ATOM   2516  C CE    . LYS D 4 19  ? 106.323 126.706 153.228 1.00 39.86  ? 46   LYS D CE    1 
ATOM   2517  N NZ    . LYS D 4 19  ? 105.187 127.446 152.625 1.00 39.86  ? 46   LYS D NZ    1 
ATOM   2518  N N     . GLN D 4 20  ? 110.494 129.657 157.860 1.00 36.56  ? 47   GLN D N     1 
ATOM   2519  C CA    . GLN D 4 20  ? 110.657 130.645 158.925 1.00 36.56  ? 47   GLN D CA    1 
ATOM   2520  C C     . GLN D 4 20  ? 110.638 132.069 158.386 1.00 36.56  ? 47   GLN D C     1 
ATOM   2521  O O     . GLN D 4 20  ? 109.913 132.922 158.904 1.00 36.56  ? 47   GLN D O     1 
ATOM   2522  C CB    . GLN D 4 20  ? 111.945 130.421 159.706 1.00 36.56  ? 47   GLN D CB    1 
ATOM   2523  C CG    . GLN D 4 20  ? 111.908 129.260 160.647 1.00 36.56  ? 47   GLN D CG    1 
ATOM   2524  C CD    . GLN D 4 20  ? 113.157 129.191 161.475 1.00 36.56  ? 47   GLN D CD    1 
ATOM   2525  O OE1   . GLN D 4 20  ? 114.080 129.982 161.284 1.00 36.56  ? 47   GLN D OE1   1 
ATOM   2526  N NE2   . GLN D 4 20  ? 113.196 128.257 162.412 1.00 36.56  ? 47   GLN D NE2   1 
ATOM   2527  N N     . VAL D 4 21  ? 111.428 132.352 157.351 1.00 38.02  ? 48   VAL D N     1 
ATOM   2528  C CA    . VAL D 4 21  ? 111.599 133.751 156.956 1.00 38.02  ? 48   VAL D CA    1 
ATOM   2529  C C     . VAL D 4 21  ? 110.476 134.266 156.065 1.00 38.02  ? 48   VAL D C     1 
ATOM   2530  O O     . VAL D 4 21  ? 110.317 135.482 155.932 1.00 38.02  ? 48   VAL D O     1 
ATOM   2531  C CB    . VAL D 4 21  ? 112.946 133.988 156.256 1.00 38.02  ? 48   VAL D CB    1 
ATOM   2532  C CG1   . VAL D 4 21  ? 114.074 133.657 157.193 1.00 38.02  ? 48   VAL D CG1   1 
ATOM   2533  C CG2   . VAL D 4 21  ? 113.046 133.171 154.998 1.00 38.02  ? 48   VAL D CG2   1 
ATOM   2534  N N     . HIS D 4 22  ? 109.702 133.389 155.447 1.00 40.08  ? 49   HIS D N     1 
ATOM   2535  C CA    . HIS D 4 22  ? 108.523 133.781 154.688 1.00 40.08  ? 49   HIS D CA    1 
ATOM   2536  C C     . HIS D 4 22  ? 107.456 132.727 154.914 1.00 40.08  ? 49   HIS D C     1 
ATOM   2537  O O     . HIS D 4 22  ? 107.575 131.610 154.400 1.00 40.08  ? 49   HIS D O     1 
ATOM   2538  C CB    . HIS D 4 22  ? 108.828 133.919 153.202 1.00 40.08  ? 49   HIS D CB    1 
ATOM   2539  C CG    . HIS D 4 22  ? 109.683 135.095 152.870 1.00 40.08  ? 49   HIS D CG    1 
ATOM   2540  N ND1   . HIS D 4 22  ? 109.200 136.384 152.865 1.00 40.08  ? 49   HIS D ND1   1 
ATOM   2541  C CD2   . HIS D 4 22  ? 110.985 135.180 152.518 1.00 40.08  ? 49   HIS D CD2   1 
ATOM   2542  C CE1   . HIS D 4 22  ? 110.169 137.215 152.527 1.00 40.08  ? 49   HIS D CE1   1 
ATOM   2543  N NE2   . HIS D 4 22  ? 111.263 136.509 152.310 1.00 40.08  ? 49   HIS D NE2   1 
ATOM   2544  N N     . PRO D 4 23  ? 106.405 133.040 155.673 1.00 47.30  ? 50   PRO D N     1 
ATOM   2545  C CA    . PRO D 4 23  ? 105.506 131.985 156.162 1.00 47.30  ? 50   PRO D CA    1 
ATOM   2546  C C     . PRO D 4 23  ? 104.640 131.343 155.092 1.00 47.30  ? 50   PRO D C     1 
ATOM   2547  O O     . PRO D 4 23  ? 104.066 130.279 155.350 1.00 47.30  ? 50   PRO D O     1 
ATOM   2548  C CB    . PRO D 4 23  ? 104.642 132.718 157.195 1.00 47.30  ? 50   PRO D CB    1 
ATOM   2549  C CG    . PRO D 4 23  ? 105.435 133.925 157.564 1.00 47.30  ? 50   PRO D CG    1 
ATOM   2550  C CD    . PRO D 4 23  ? 106.131 134.333 156.316 1.00 47.30  ? 50   PRO D CD    1 
ATOM   2551  N N     . ASP D 4 24  ? 104.533 131.930 153.908 1.00 48.26  ? 51   ASP D N     1 
ATOM   2552  C CA    . ASP D 4 24  ? 103.596 131.449 152.905 1.00 48.26  ? 51   ASP D CA    1 
ATOM   2553  C C     . ASP D 4 24  ? 104.213 131.489 151.515 1.00 48.26  ? 51   ASP D C     1 
ATOM   2554  O O     . ASP D 4 24  ? 103.595 131.956 150.554 1.00 48.26  ? 51   ASP D O     1 
ATOM   2555  C CB    . ASP D 4 24  ? 102.304 132.250 152.970 1.00 48.26  ? 51   ASP D CB    1 
ATOM   2556  C CG    . ASP D 4 24  ? 102.555 133.736 152.999 1.00 48.26  ? 51   ASP D CG    1 
ATOM   2557  O OD1   . ASP D 4 24  ? 103.736 134.135 153.036 1.00 48.26  ? 51   ASP D OD1   1 
ATOM   2558  O OD2   . ASP D 4 24  ? 101.576 134.507 153.004 1.00 48.26  ? 51   ASP D OD2   1 
ATOM   2559  N N     . THR D 4 25  ? 105.439 130.999 151.389 1.00 38.96  ? 52   THR D N     1 
ATOM   2560  C CA    . THR D 4 25  ? 106.179 131.039 150.140 1.00 38.96  ? 52   THR D CA    1 
ATOM   2561  C C     . THR D 4 25  ? 106.685 129.642 149.816 1.00 38.96  ? 52   THR D C     1 
ATOM   2562  O O     . THR D 4 25  ? 107.139 128.919 150.703 1.00 38.96  ? 52   THR D O     1 
ATOM   2563  C CB    . THR D 4 25  ? 107.340 132.030 150.242 1.00 38.96  ? 52   THR D CB    1 
ATOM   2564  O OG1   . THR D 4 25  ? 106.827 133.323 150.568 1.00 38.96  ? 52   THR D OG1   1 
ATOM   2565  C CG2   . THR D 4 25  ? 108.090 132.140 148.939 1.00 38.96  ? 52   THR D CG2   1 
ATOM   2566  N N     . GLY D 4 26  ? 106.556 129.244 148.553 1.00 41.47  ? 53   GLY D N     1 
ATOM   2567  C CA    . GLY D 4 26  ? 107.075 127.984 148.081 1.00 41.47  ? 53   GLY D CA    1 
ATOM   2568  C C     . GLY D 4 26  ? 108.334 128.206 147.267 1.00 41.47  ? 53   GLY D C     1 
ATOM   2569  O O     . GLY D 4 26  ? 108.659 129.319 146.869 1.00 41.47  ? 53   GLY D O     1 
ATOM   2570  N N     . ILE D 4 27  ? 109.036 127.112 147.011 1.00 32.90  ? 54   ILE D N     1 
ATOM   2571  C CA    . ILE D 4 27  ? 110.330 127.152 146.351 1.00 32.90  ? 54   ILE D CA    1 
ATOM   2572  C C     . ILE D 4 27  ? 110.333 126.153 145.207 1.00 32.90  ? 54   ILE D C     1 
ATOM   2573  O O     . ILE D 4 27  ? 109.873 125.019 145.363 1.00 32.90  ? 54   ILE D O     1 
ATOM   2574  C CB    . ILE D 4 27  ? 111.466 126.886 147.355 1.00 32.90  ? 54   ILE D CB    1 
ATOM   2575  C CG1   . ILE D 4 27  ? 112.818 126.824 146.666 1.00 32.90  ? 54   ILE D CG1   1 
ATOM   2576  C CG2   . ILE D 4 27  ? 111.172 125.700 148.232 1.00 32.90  ? 54   ILE D CG2   1 
ATOM   2577  C CD1   . ILE D 4 27  ? 113.948 126.902 147.629 1.00 32.90  ? 54   ILE D CD1   1 
ATOM   2578  N N     . SER D 4 28  ? 110.790 126.592 144.043 1.00 30.95  ? 55   SER D N     1 
ATOM   2579  C CA    . SER D 4 28  ? 110.834 125.699 142.905 1.00 30.95  ? 55   SER D CA    1 
ATOM   2580  C C     . SER D 4 28  ? 111.959 124.695 143.081 1.00 30.95  ? 55   SER D C     1 
ATOM   2581  O O     . SER D 4 28  ? 112.878 124.896 143.872 1.00 30.95  ? 55   SER D O     1 
ATOM   2582  C CB    . SER D 4 28  ? 111.021 126.484 141.618 1.00 30.95  ? 55   SER D CB    1 
ATOM   2583  O OG    . SER D 4 28  ? 111.090 125.603 140.517 1.00 30.95  ? 55   SER D OG    1 
ATOM   2584  N N     . SER D 4 29  ? 111.865 123.593 142.343 1.00 30.32  ? 56   SER D N     1 
ATOM   2585  C CA    . SER D 4 29  ? 112.764 122.473 142.579 1.00 30.32  ? 56   SER D CA    1 
ATOM   2586  C C     . SER D 4 29  ? 114.177 122.779 142.125 1.00 30.32  ? 56   SER D C     1 
ATOM   2587  O O     . SER D 4 29  ? 115.145 122.375 142.781 1.00 30.32  ? 56   SER D O     1 
ATOM   2588  C CB    . SER D 4 29  ? 112.264 121.227 141.872 1.00 30.32  ? 56   SER D CB    1 
ATOM   2589  O OG    . SER D 4 29  ? 113.224 120.198 142.007 1.00 30.32  ? 56   SER D OG    1 
ATOM   2590  N N     . LYS D 4 30  ? 114.326 123.494 141.013 1.00 29.60  ? 57   LYS D N     1 
ATOM   2591  C CA    . LYS D 4 30  ? 115.677 123.809 140.581 1.00 29.60  ? 57   LYS D CA    1 
ATOM   2592  C C     . LYS D 4 30  ? 116.293 124.873 141.478 1.00 29.60  ? 57   LYS D C     1 
ATOM   2593  O O     . LYS D 4 30  ? 117.506 124.857 141.704 1.00 29.60  ? 57   LYS D O     1 
ATOM   2594  C CB    . LYS D 4 30  ? 115.692 124.225 139.114 1.00 29.60  ? 57   LYS D CB    1 
ATOM   2595  C CG    . LYS D 4 30  ? 117.097 124.221 138.520 1.00 29.60  ? 57   LYS D CG    1 
ATOM   2596  C CD    . LYS D 4 30  ? 117.138 124.671 137.064 1.00 29.60  ? 57   LYS D CD    1 
ATOM   2597  C CE    . LYS D 4 30  ? 116.655 123.594 136.116 1.00 29.60  ? 57   LYS D CE    1 
ATOM   2598  N NZ    . LYS D 4 30  ? 116.808 124.016 134.698 1.00 29.60  ? 57   LYS D NZ    1 
ATOM   2599  N N     . ALA D 4 31  ? 115.473 125.742 142.067 1.00 24.87  ? 58   ALA D N     1 
ATOM   2600  C CA    . ALA D 4 31  ? 115.994 126.662 143.069 1.00 24.87  ? 58   ALA D CA    1 
ATOM   2601  C C     . ALA D 4 31  ? 116.379 125.938 144.344 1.00 24.87  ? 58   ALA D C     1 
ATOM   2602  O O     . ALA D 4 31  ? 117.324 126.349 145.024 1.00 24.87  ? 58   ALA D O     1 
ATOM   2603  C CB    . ALA D 4 31  ? 114.973 127.742 143.381 1.00 24.87  ? 58   ALA D CB    1 
ATOM   2604  N N     . MET D 4 32  ? 115.689 124.849 144.672 1.00 24.10  ? 59   MET D N     1 
ATOM   2605  C CA    . MET D 4 32  ? 116.118 124.030 145.797 1.00 24.10  ? 59   MET D CA    1 
ATOM   2606  C C     . MET D 4 32  ? 117.449 123.360 145.506 1.00 24.10  ? 59   MET D C     1 
ATOM   2607  O O     . MET D 4 32  ? 118.310 123.277 146.387 1.00 24.10  ? 59   MET D O     1 
ATOM   2608  C CB    . MET D 4 32  ? 115.059 122.988 146.127 1.00 24.10  ? 59   MET D CB    1 
ATOM   2609  C CG    . MET D 4 32  ? 115.436 122.137 147.286 1.00 24.10  ? 59   MET D CG    1 
ATOM   2610  S SD    . MET D 4 32  ? 115.687 123.158 148.725 1.00 24.10  ? 59   MET D SD    1 
ATOM   2611  C CE    . MET D 4 32  ? 113.994 123.479 149.174 1.00 24.10  ? 59   MET D CE    1 
ATOM   2612  N N     . SER D 4 33  ? 117.650 122.915 144.269 1.00 22.99  ? 60   SER D N     1 
ATOM   2613  C CA    . SER D 4 33  ? 118.943 122.346 143.907 1.00 22.99  ? 60   SER D CA    1 
ATOM   2614  C C     . SER D 4 33  ? 120.059 123.384 143.929 1.00 22.99  ? 60   SER D C     1 
ATOM   2615  O O     . SER D 4 33  ? 121.192 123.065 144.311 1.00 22.99  ? 60   SER D O     1 
ATOM   2616  C CB    . SER D 4 33  ? 118.872 121.702 142.537 1.00 22.99  ? 60   SER D CB    1 
ATOM   2617  O OG    . SER D 4 33  ? 120.157 121.254 142.174 1.00 22.99  ? 60   SER D OG    1 
ATOM   2618  N N     . ILE D 4 34  ? 119.757 124.626 143.557 1.00 21.52  ? 61   ILE D N     1 
ATOM   2619  C CA    . ILE D 4 34  ? 120.762 125.683 143.609 1.00 21.52  ? 61   ILE D CA    1 
ATOM   2620  C C     . ILE D 4 34  ? 121.131 126.013 145.049 1.00 21.52  ? 61   ILE D C     1 
ATOM   2621  O O     . ILE D 4 34  ? 122.311 126.168 145.373 1.00 21.52  ? 61   ILE D O     1 
ATOM   2622  C CB    . ILE D 4 34  ? 120.273 126.921 142.845 1.00 21.52  ? 61   ILE D CB    1 
ATOM   2623  C CG1   . ILE D 4 34  ? 120.179 126.612 141.369 1.00 21.52  ? 61   ILE D CG1   1 
ATOM   2624  C CG2   . ILE D 4 34  ? 121.234 128.059 142.990 1.00 21.52  ? 61   ILE D CG2   1 
ATOM   2625  C CD1   . ILE D 4 34  ? 119.473 127.656 140.611 1.00 21.52  ? 61   ILE D CD1   1 
ATOM   2626  N N     . MET D 4 35  ? 120.142 126.095 145.944 1.00 19.06  ? 62   MET D N     1 
ATOM   2627  C CA    . MET D 4 35  ? 120.471 126.354 147.345 1.00 19.06  ? 62   MET D CA    1 
ATOM   2628  C C     . MET D 4 35  ? 121.202 125.181 147.986 1.00 19.06  ? 62   MET D C     1 
ATOM   2629  O O     . MET D 4 35  ? 122.041 125.388 148.870 1.00 19.06  ? 62   MET D O     1 
ATOM   2630  C CB    . MET D 4 35  ? 119.220 126.698 148.136 1.00 19.06  ? 62   MET D CB    1 
ATOM   2631  C CG    . MET D 4 35  ? 118.669 128.027 147.757 1.00 19.06  ? 62   MET D CG    1 
ATOM   2632  S SD    . MET D 4 35  ? 119.959 129.247 147.932 1.00 19.06  ? 62   MET D SD    1 
ATOM   2633  C CE    . MET D 4 35  ? 120.092 129.312 149.701 1.00 19.06  ? 62   MET D CE    1 
ATOM   2634  N N     . ASN D 4 36  ? 120.923 123.961 147.533 1.00 22.74  ? 63   ASN D N     1 
ATOM   2635  C CA    . ASN D 4 36  ? 121.683 122.794 147.963 1.00 22.74  ? 63   ASN D CA    1 
ATOM   2636  C C     . ASN D 4 36  ? 123.154 122.918 147.587 1.00 22.74  ? 63   ASN D C     1 
ATOM   2637  O O     . ASN D 4 36  ? 124.043 122.699 148.424 1.00 22.74  ? 63   ASN D O     1 
ATOM   2638  C CB    . ASN D 4 36  ? 121.088 121.554 147.320 1.00 22.74  ? 63   ASN D CB    1 
ATOM   2639  C CG    . ASN D 4 36  ? 121.680 120.289 147.833 1.00 22.74  ? 63   ASN D CG    1 
ATOM   2640  O OD1   . ASN D 4 36  ? 122.393 120.267 148.831 1.00 22.74  ? 63   ASN D OD1   1 
ATOM   2641  N ND2   . ASN D 4 36  ? 121.450 119.218 147.101 1.00 22.74  ? 63   ASN D ND2   1 
ATOM   2642  N N     . SER D 4 37  ? 123.430 123.250 146.322 1.00 20.24  ? 64   SER D N     1 
ATOM   2643  C CA    . SER D 4 37  ? 124.819 123.411 145.902 1.00 20.24  ? 64   SER D CA    1 
ATOM   2644  C C     . SER D 4 37  ? 125.478 124.589 146.588 1.00 20.24  ? 64   SER D C     1 
ATOM   2645  O O     . SER D 4 37  ? 126.680 124.548 146.851 1.00 20.24  ? 64   SER D O     1 
ATOM   2646  C CB    . SER D 4 37  ? 124.920 123.583 144.398 1.00 20.24  ? 64   SER D CB    1 
ATOM   2647  O OG    . SER D 4 37  ? 124.526 122.403 143.744 1.00 20.24  ? 64   SER D OG    1 
ATOM   2648  N N     . PHE D 4 38  ? 124.706 125.619 146.916 1.00 27.82  ? 65   PHE D N     1 
ATOM   2649  C CA    . PHE D 4 38  ? 125.241 126.762 147.643 1.00 27.82  ? 65   PHE D CA    1 
ATOM   2650  C C     . PHE D 4 38  ? 125.697 126.380 149.041 1.00 27.82  ? 65   PHE D C     1 
ATOM   2651  O O     . PHE D 4 38  ? 126.779 126.790 149.479 1.00 27.82  ? 65   PHE D O     1 
ATOM   2652  C CB    . PHE D 4 38  ? 124.181 127.849 147.703 1.00 27.82  ? 65   PHE D CB    1 
ATOM   2653  C CG    . PHE D 4 38  ? 124.575 129.025 148.500 1.00 27.82  ? 65   PHE D CG    1 
ATOM   2654  C CD1   . PHE D 4 38  ? 125.527 129.891 148.033 1.00 27.82  ? 65   PHE D CD1   1 
ATOM   2655  C CD2   . PHE D 4 38  ? 123.970 129.280 149.709 1.00 27.82  ? 65   PHE D CD2   1 
ATOM   2656  C CE1   . PHE D 4 38  ? 125.887 130.982 148.771 1.00 27.82  ? 65   PHE D CE1   1 
ATOM   2657  C CE2   . PHE D 4 38  ? 124.316 130.373 150.447 1.00 27.82  ? 65   PHE D CE2   1 
ATOM   2658  C CZ    . PHE D 4 38  ? 125.281 131.223 149.979 1.00 27.82  ? 65   PHE D CZ    1 
ATOM   2659  N N     . VAL D 4 39  ? 124.899 125.580 149.748 1.00 15.56  ? 66   VAL D N     1 
ATOM   2660  C CA    . VAL D 4 39  ? 125.273 125.179 151.100 1.00 15.56  ? 66   VAL D CA    1 
ATOM   2661  C C     . VAL D 4 39  ? 126.473 124.244 151.074 1.00 15.56  ? 66   VAL D C     1 
ATOM   2662  O O     . VAL D 4 39  ? 127.390 124.387 151.889 1.00 15.56  ? 66   VAL D O     1 
ATOM   2663  C CB    . VAL D 4 39  ? 124.067 124.554 151.809 1.00 15.56  ? 66   VAL D CB    1 
ATOM   2664  C CG1   . VAL D 4 39  ? 124.448 123.989 153.140 1.00 15.56  ? 66   VAL D CG1   1 
ATOM   2665  C CG2   . VAL D 4 39  ? 123.031 125.603 152.003 1.00 15.56  ? 66   VAL D CG2   1 
ATOM   2666  N N     . ASN D 4 40  ? 126.524 123.315 150.112 1.00 22.69  ? 67   ASN D N     1 
ATOM   2667  C CA    . ASN D 4 40  ? 127.715 122.470 149.999 1.00 22.69  ? 67   ASN D CA    1 
ATOM   2668  C C     . ASN D 4 40  ? 128.952 123.256 149.595 1.00 22.69  ? 67   ASN D C     1 
ATOM   2669  O O     . ASN D 4 40  ? 130.050 122.958 150.075 1.00 22.69  ? 67   ASN D O     1 
ATOM   2670  C CB    . ASN D 4 40  ? 127.494 121.341 149.008 1.00 22.69  ? 67   ASN D CB    1 
ATOM   2671  C CG    . ASN D 4 40  ? 126.587 120.278 149.548 1.00 22.69  ? 67   ASN D CG    1 
ATOM   2672  O OD1   . ASN D 4 40  ? 125.495 120.053 149.039 1.00 22.69  ? 67   ASN D OD1   1 
ATOM   2673  N ND2   . ASN D 4 40  ? 127.034 119.611 150.598 1.00 22.69  ? 67   ASN D ND2   1 
ATOM   2674  N N     . ASP D 4 41  ? 128.791 124.297 148.785 1.00 25.06  ? 68   ASP D N     1 
ATOM   2675  C CA    . ASP D 4 41  ? 129.939 125.077 148.349 1.00 25.06  ? 68   ASP D CA    1 
ATOM   2676  C C     . ASP D 4 41  ? 130.503 125.909 149.490 1.00 25.06  ? 68   ASP D C     1 
ATOM   2677  O O     . ASP D 4 41  ? 131.721 125.943 149.703 1.00 25.06  ? 68   ASP D O     1 
ATOM   2678  C CB    . ASP D 4 41  ? 129.531 125.977 147.201 1.00 25.06  ? 68   ASP D CB    1 
ATOM   2679  C CG    . ASP D 4 41  ? 130.708 126.531 146.463 1.00 25.06  ? 68   ASP D CG    1 
ATOM   2680  O OD1   . ASP D 4 41  ? 131.839 126.090 146.730 1.00 25.06  ? 68   ASP D OD1   1 
ATOM   2681  O OD2   . ASP D 4 41  ? 130.510 127.433 145.629 1.00 25.06  ? 68   ASP D OD2   1 
ATOM   2682  N N     . VAL D 4 42  ? 129.629 126.585 150.237 1.00 20.27  ? 69   VAL D N     1 
ATOM   2683  C CA    . VAL D 4 42  ? 130.102 127.398 151.349 1.00 20.27  ? 69   VAL D CA    1 
ATOM   2684  C C     . VAL D 4 42  ? 130.654 126.528 152.469 1.00 20.27  ? 69   VAL D C     1 
ATOM   2685  O O     . VAL D 4 42  ? 131.660 126.886 153.103 1.00 20.27  ? 69   VAL D O     1 
ATOM   2686  C CB    . VAL D 4 42  ? 128.964 128.309 151.810 1.00 20.27  ? 69   VAL D CB    1 
ATOM   2687  C CG1   . VAL D 4 42  ? 129.327 129.048 153.044 1.00 20.27  ? 69   VAL D CG1   1 
ATOM   2688  C CG2   . VAL D 4 42  ? 128.666 129.295 150.724 1.00 20.27  ? 69   VAL D CG2   1 
ATOM   2689  N N     . PHE D 4 43  ? 130.063 125.350 152.687 1.00 20.97  ? 70   PHE D N     1 
ATOM   2690  C CA    . PHE D 4 43  ? 130.626 124.409 153.642 1.00 20.97  ? 70   PHE D CA    1 
ATOM   2691  C C     . PHE D 4 43  ? 132.010 123.947 153.233 1.00 20.97  ? 70   PHE D C     1 
ATOM   2692  O O     . PHE D 4 43  ? 132.905 123.871 154.078 1.00 20.97  ? 70   PHE D O     1 
ATOM   2693  C CB    . PHE D 4 43  ? 129.708 123.211 153.815 1.00 20.97  ? 70   PHE D CB    1 
ATOM   2694  C CG    . PHE D 4 43  ? 130.341 122.092 154.552 1.00 20.97  ? 70   PHE D CG    1 
ATOM   2695  C CD1   . PHE D 4 43  ? 130.623 122.209 155.886 1.00 20.97  ? 70   PHE D CD1   1 
ATOM   2696  C CD2   . PHE D 4 43  ? 130.641 120.911 153.911 1.00 20.97  ? 70   PHE D CD2   1 
ATOM   2697  C CE1   . PHE D 4 43  ? 131.211 121.180 156.564 1.00 20.97  ? 70   PHE D CE1   1 
ATOM   2698  C CE2   . PHE D 4 43  ? 131.227 119.880 154.586 1.00 20.97  ? 70   PHE D CE2   1 
ATOM   2699  C CZ    . PHE D 4 43  ? 131.514 120.014 155.914 1.00 20.97  ? 70   PHE D CZ    1 
ATOM   2700  N N     . GLU D 4 44  ? 132.223 123.664 151.948 1.00 24.92  ? 71   GLU D N     1 
ATOM   2701  C CA    . GLU D 4 44  ? 133.542 123.180 151.565 1.00 24.92  ? 71   GLU D CA    1 
ATOM   2702  C C     . GLU D 4 44  ? 134.591 124.278 151.611 1.00 24.92  ? 71   GLU D C     1 
ATOM   2703  O O     . GLU D 4 44  ? 135.733 124.003 151.990 1.00 24.92  ? 71   GLU D O     1 
ATOM   2704  C CB    . GLU D 4 44  ? 133.511 122.534 150.190 1.00 24.92  ? 71   GLU D CB    1 
ATOM   2705  C CG    . GLU D 4 44  ? 132.848 121.172 150.198 1.00 24.92  ? 71   GLU D CG    1 
ATOM   2706  C CD    . GLU D 4 44  ? 132.885 120.487 148.852 1.00 24.92  ? 71   GLU D CD    1 
ATOM   2707  O OE1   . GLU D 4 44  ? 133.374 121.101 147.882 1.00 24.92  ? 71   GLU D OE1   1 
ATOM   2708  O OE2   . GLU D 4 44  ? 132.412 119.336 148.760 1.00 24.92  ? 71   GLU D OE2   1 
ATOM   2709  N N     . ARG D 4 45  ? 134.215 125.522 151.298 1.00 20.49  ? 72   ARG D N     1 
ATOM   2710  C CA    . ARG D 4 45  ? 135.148 126.638 151.451 1.00 20.49  ? 72   ARG D CA    1 
ATOM   2711  C C     . ARG D 4 45  ? 135.559 126.835 152.905 1.00 20.49  ? 72   ARG D C     1 
ATOM   2712  O O     . ARG D 4 45  ? 136.752 126.941 153.211 1.00 20.49  ? 72   ARG D O     1 
ATOM   2713  C CB    . ARG D 4 45  ? 134.536 127.928 150.925 1.00 20.49  ? 72   ARG D CB    1 
ATOM   2714  C CG    . ARG D 4 45  ? 134.404 128.044 149.443 1.00 20.49  ? 72   ARG D CG    1 
ATOM   2715  C CD    . ARG D 4 45  ? 133.736 129.365 149.149 1.00 20.49  ? 72   ARG D CD    1 
ATOM   2716  N NE    . ARG D 4 45  ? 133.449 129.552 147.740 1.00 20.49  ? 72   ARG D NE    1 
ATOM   2717  C CZ    . ARG D 4 45  ? 132.771 130.586 147.265 1.00 20.49  ? 72   ARG D CZ    1 
ATOM   2718  N NH1   . ARG D 4 45  ? 132.314 131.505 148.095 1.00 20.49  ? 72   ARG D NH1   1 
ATOM   2719  N NH2   . ARG D 4 45  ? 132.538 130.694 145.969 1.00 20.49  ? 72   ARG D NH2   1 
ATOM   2720  N N     . ILE D 4 46  ? 134.582 126.876 153.815 1.00 19.00  ? 73   ILE D N     1 
ATOM   2721  C CA    . ILE D 4 46  ? 134.896 127.202 155.202 1.00 19.00  ? 73   ILE D CA    1 
ATOM   2722  C C     . ILE D 4 46  ? 135.649 126.056 155.873 1.00 19.00  ? 73   ILE D C     1 
ATOM   2723  O O     . ILE D 4 46  ? 136.607 126.282 156.629 1.00 19.00  ? 73   ILE D O     1 
ATOM   2724  C CB    . ILE D 4 46  ? 133.616 127.594 155.955 1.00 19.00  ? 73   ILE D CB    1 
ATOM   2725  C CG1   . ILE D 4 46  ? 133.066 128.883 155.381 1.00 19.00  ? 73   ILE D CG1   1 
ATOM   2726  C CG2   . ILE D 4 46  ? 133.898 127.865 157.385 1.00 19.00  ? 73   ILE D CG2   1 
ATOM   2727  C CD1   . ILE D 4 46  ? 131.737 129.262 155.946 1.00 19.00  ? 73   ILE D CD1   1 
ATOM   2728  N N     . ALA D 4 47  ? 135.293 124.813 155.551 1.00 22.55  ? 74   ALA D N     1 
ATOM   2729  C CA    . ALA D 4 47  ? 136.039 123.693 156.102 1.00 22.55  ? 74   ALA D CA    1 
ATOM   2730  C C     . ALA D 4 47  ? 137.448 123.619 155.534 1.00 22.55  ? 74   ALA D C     1 
ATOM   2731  O O     . ALA D 4 47  ? 138.386 123.264 156.252 1.00 22.55  ? 74   ALA D O     1 
ATOM   2732  C CB    . ALA D 4 47  ? 135.298 122.392 155.846 1.00 22.55  ? 74   ALA D CB    1 
ATOM   2733  N N     . GLY D 4 48  ? 137.633 123.978 154.260 1.00 26.59  ? 75   GLY D N     1 
ATOM   2734  C CA    . GLY D 4 48  ? 138.972 123.973 153.701 1.00 26.59  ? 75   GLY D CA    1 
ATOM   2735  C C     . GLY D 4 48  ? 139.860 125.043 154.291 1.00 26.59  ? 75   GLY D C     1 
ATOM   2736  O O     . GLY D 4 48  ? 141.057 124.818 154.502 1.00 26.59  ? 75   GLY D O     1 
ATOM   2737  N N     . GLU D 4 49  ? 139.288 126.204 154.593 1.00 23.14  ? 76   GLU D N     1 
ATOM   2738  C CA    . GLU D 4 49  ? 140.072 127.244 155.242 1.00 23.14  ? 76   GLU D CA    1 
ATOM   2739  C C     . GLU D 4 49  ? 140.455 126.852 156.662 1.00 23.14  ? 76   GLU D C     1 
ATOM   2740  O O     . GLU D 4 49  ? 141.582 127.124 157.105 1.00 23.14  ? 76   GLU D O     1 
ATOM   2741  C CB    . GLU D 4 49  ? 139.304 128.552 155.235 1.00 23.14  ? 76   GLU D CB    1 
ATOM   2742  C CG    . GLU D 4 49  ? 140.072 129.673 155.821 1.00 23.14  ? 76   GLU D CG    1 
ATOM   2743  C CD    . GLU D 4 49  ? 141.278 130.033 154.995 1.00 23.14  ? 76   GLU D CD    1 
ATOM   2744  O OE1   . GLU D 4 49  ? 141.222 129.891 153.758 1.00 23.14  ? 76   GLU D OE1   1 
ATOM   2745  O OE2   . GLU D 4 49  ? 142.294 130.451 155.584 1.00 23.14  ? 76   GLU D OE2   1 
ATOM   2746  N N     . ALA D 4 50  ? 139.558 126.173 157.379 1.00 21.12  ? 77   ALA D N     1 
ATOM   2747  C CA    . ALA D 4 50  ? 139.936 125.676 158.698 1.00 21.12  ? 77   ALA D CA    1 
ATOM   2748  C C     . ALA D 4 50  ? 140.983 124.572 158.613 1.00 21.12  ? 77   ALA D C     1 
ATOM   2749  O O     . ALA D 4 50  ? 141.807 124.441 159.522 1.00 21.12  ? 77   ALA D O     1 
ATOM   2750  C CB    . ALA D 4 50  ? 138.711 125.184 159.454 1.00 21.12  ? 77   ALA D CB    1 
ATOM   2751  N N     . SER D 4 51  ? 140.982 123.794 157.532 1.00 22.48  ? 78   SER D N     1 
ATOM   2752  C CA    . SER D 4 51  ? 142.041 122.815 157.311 1.00 22.48  ? 78   SER D CA    1 
ATOM   2753  C C     . SER D 4 51  ? 143.394 123.487 157.143 1.00 22.48  ? 78   SER D C     1 
ATOM   2754  O O     . SER D 4 51  ? 144.396 123.054 157.730 1.00 22.48  ? 78   SER D O     1 
ATOM   2755  C CB    . SER D 4 51  ? 141.723 121.982 156.082 1.00 22.48  ? 78   SER D CB    1 
ATOM   2756  O OG    . SER D 4 51  ? 142.809 121.137 155.781 1.00 22.48  ? 78   SER D OG    1 
ATOM   2757  N N     . ARG D 4 52  ? 143.437 124.553 156.344 1.00 25.81  ? 79   ARG D N     1 
ATOM   2758  C CA    . ARG D 4 52  ? 144.692 125.268 156.131 1.00 25.81  ? 79   ARG D CA    1 
ATOM   2759  C C     . ARG D 4 52  ? 145.188 125.918 157.412 1.00 25.81  ? 79   ARG D C     1 
ATOM   2760  O O     . ARG D 4 52  ? 146.390 125.914 157.683 1.00 25.81  ? 79   ARG D O     1 
ATOM   2761  C CB    . ARG D 4 52  ? 144.521 126.308 155.035 1.00 25.81  ? 79   ARG D CB    1 
ATOM   2762  C CG    . ARG D 4 52  ? 144.338 125.702 153.672 1.00 25.81  ? 79   ARG D CG    1 
ATOM   2763  C CD    . ARG D 4 52  ? 143.983 126.764 152.668 1.00 25.81  ? 79   ARG D CD    1 
ATOM   2764  N NE    . ARG D 4 52  ? 143.818 126.204 151.335 1.00 25.81  ? 79   ARG D NE    1 
ATOM   2765  C CZ    . ARG D 4 52  ? 142.687 125.674 150.880 1.00 25.81  ? 79   ARG D CZ    1 
ATOM   2766  N NH1   . ARG D 4 52  ? 141.620 125.612 151.658 1.00 25.81  ? 79   ARG D NH1   1 
ATOM   2767  N NH2   . ARG D 4 52  ? 142.627 125.195 149.647 1.00 25.81  ? 79   ARG D NH2   1 
ATOM   2768  N N     . LEU D 4 53  ? 144.282 126.443 158.237 1.00 22.35  ? 80   LEU D N     1 
ATOM   2769  C CA    . LEU D 4 53  ? 144.745 127.029 159.494 1.00 22.35  ? 80   LEU D CA    1 
ATOM   2770  C C     . LEU D 4 53  ? 145.190 125.984 160.505 1.00 22.35  ? 80   LEU D C     1 
ATOM   2771  O O     . LEU D 4 53  ? 146.106 126.247 161.296 1.00 22.35  ? 80   LEU D O     1 
ATOM   2772  C CB    . LEU D 4 53  ? 143.669 127.908 160.092 1.00 22.35  ? 80   LEU D CB    1 
ATOM   2773  C CG    . LEU D 4 53  ? 143.655 129.248 159.401 1.00 22.35  ? 80   LEU D CG    1 
ATOM   2774  C CD1   . LEU D 4 53  ? 142.478 130.035 159.837 1.00 22.35  ? 80   LEU D CD1   1 
ATOM   2775  C CD2   . LEU D 4 53  ? 144.910 129.945 159.786 1.00 22.35  ? 80   LEU D CD2   1 
ATOM   2776  N N     . ALA D 4 54  ? 144.562 124.811 160.501 1.00 27.22  ? 81   ALA D N     1 
ATOM   2777  C CA    . ALA D 4 54  ? 145.037 123.726 161.345 1.00 27.22  ? 81   ALA D CA    1 
ATOM   2778  C C     . ALA D 4 54  ? 146.436 123.295 160.948 1.00 27.22  ? 81   ALA D C     1 
ATOM   2779  O O     . ALA D 4 54  ? 147.254 122.965 161.810 1.00 27.22  ? 81   ALA D O     1 
ATOM   2780  C CB    . ALA D 4 54  ? 144.081 122.543 161.270 1.00 27.22  ? 81   ALA D CB    1 
ATOM   2781  N N     . HIS D 4 55  ? 146.737 123.298 159.649 1.00 32.27  ? 82   HIS D N     1 
ATOM   2782  C CA    . HIS D 4 55  ? 148.118 123.040 159.255 1.00 32.27  ? 82   HIS D CA    1 
ATOM   2783  C C     . HIS D 4 55  ? 149.041 124.181 159.655 1.00 32.27  ? 82   HIS D C     1 
ATOM   2784  O O     . HIS D 4 55  ? 150.171 123.938 160.083 1.00 32.27  ? 82   HIS D O     1 
ATOM   2785  C CB    . HIS D 4 55  ? 148.240 122.804 157.758 1.00 32.27  ? 82   HIS D CB    1 
ATOM   2786  C CG    . HIS D 4 55  ? 147.748 121.470 157.310 1.00 32.27  ? 82   HIS D CG    1 
ATOM   2787  N ND1   . HIS D 4 55  ? 146.468 121.265 156.845 1.00 32.27  ? 82   HIS D ND1   1 
ATOM   2788  C CD2   . HIS D 4 55  ? 148.363 120.268 157.259 1.00 32.27  ? 82   HIS D CD2   1 
ATOM   2789  C CE1   . HIS D 4 55  ? 146.317 119.995 156.520 1.00 32.27  ? 82   HIS D CE1   1 
ATOM   2790  N NE2   . HIS D 4 55  ? 147.453 119.367 156.762 1.00 32.27  ? 82   HIS D NE2   1 
ATOM   2791  N N     . TYR D 4 56  ? 148.590 125.427 159.517 1.00 28.73  ? 83   TYR D N     1 
ATOM   2792  C CA    . TYR D 4 56  ? 149.515 126.544 159.661 1.00 28.73  ? 83   TYR D CA    1 
ATOM   2793  C C     . TYR D 4 56  ? 149.895 126.798 161.102 1.00 28.73  ? 83   TYR D C     1 
ATOM   2794  O O     . TYR D 4 56  ? 151.014 127.238 161.364 1.00 28.73  ? 83   TYR D O     1 
ATOM   2795  C CB    . TYR D 4 56  ? 148.937 127.828 159.082 1.00 28.73  ? 83   TYR D CB    1 
ATOM   2796  C CG    . TYR D 4 56  ? 148.813 127.854 157.582 1.00 28.73  ? 83   TYR D CG    1 
ATOM   2797  C CD1   . TYR D 4 56  ? 149.488 126.942 156.786 1.00 28.73  ? 83   TYR D CD1   1 
ATOM   2798  C CD2   . TYR D 4 56  ? 147.990 128.783 156.962 1.00 28.73  ? 83   TYR D CD2   1 
ATOM   2799  C CE1   . TYR D 4 56  ? 149.361 126.965 155.418 1.00 28.73  ? 83   TYR D CE1   1 
ATOM   2800  C CE2   . TYR D 4 56  ? 147.859 128.816 155.596 1.00 28.73  ? 83   TYR D CE2   1 
ATOM   2801  C CZ    . TYR D 4 56  ? 148.548 127.907 154.830 1.00 28.73  ? 83   TYR D CZ    1 
ATOM   2802  O OH    . TYR D 4 56  ? 148.418 127.934 153.466 1.00 28.73  ? 83   TYR D OH    1 
ATOM   2803  N N     . ASN D 4 57  ? 149.006 126.534 162.047 1.00 29.80  ? 84   ASN D N     1 
ATOM   2804  C CA    . ASN D 4 57  ? 149.404 126.766 163.427 1.00 29.80  ? 84   ASN D CA    1 
ATOM   2805  C C     . ASN D 4 57  ? 150.185 125.611 164.029 1.00 29.80  ? 84   ASN D C     1 
ATOM   2806  O O     . ASN D 4 57  ? 150.530 125.694 165.212 1.00 29.80  ? 84   ASN D O     1 
ATOM   2807  C CB    . ASN D 4 57  ? 148.193 127.047 164.303 1.00 29.80  ? 84   ASN D CB    1 
ATOM   2808  C CG    . ASN D 4 57  ? 147.432 128.247 163.849 1.00 29.80  ? 84   ASN D CG    1 
ATOM   2809  O OD1   . ASN D 4 57  ? 146.248 128.158 163.546 1.00 29.80  ? 84   ASN D OD1   1 
ATOM   2810  N ND2   . ASN D 4 57  ? 148.110 129.379 163.761 1.00 29.80  ? 84   ASN D ND2   1 
ATOM   2811  N N     . LYS D 4 58  ? 150.477 124.573 163.244 1.00 37.68  ? 85   LYS D N     1 
ATOM   2812  C CA    . LYS D 4 58  ? 151.037 123.305 163.706 1.00 37.68  ? 85   LYS D CA    1 
ATOM   2813  C C     . LYS D 4 58  ? 150.188 122.733 164.836 1.00 37.68  ? 85   LYS D C     1 
ATOM   2814  O O     . LYS D 4 58  ? 150.605 122.613 165.985 1.00 37.68  ? 85   LYS D O     1 
ATOM   2815  C CB    . LYS D 4 58  ? 152.505 123.450 164.110 1.00 37.68  ? 85   LYS D CB    1 
ATOM   2816  C CG    . LYS D 4 58  ? 153.420 123.739 162.942 1.00 37.68  ? 85   LYS D CG    1 
ATOM   2817  C CD    . LYS D 4 58  ? 154.869 123.826 163.379 1.00 37.68  ? 85   LYS D CD    1 
ATOM   2818  C CE    . LYS D 4 58  ? 155.776 124.129 162.198 1.00 37.68  ? 85   LYS D CE    1 
ATOM   2819  N NZ    . LYS D 4 58  ? 157.204 124.213 162.606 1.00 37.68  ? 85   LYS D NZ    1 
ATOM   2820  N N     . ARG D 4 59  ? 148.954 122.416 164.474 1.00 41.93  ? 86   ARG D N     1 
ATOM   2821  C CA    . ARG D 4 59  ? 147.961 121.906 165.395 1.00 41.93  ? 86   ARG D CA    1 
ATOM   2822  C C     . ARG D 4 59  ? 147.195 120.837 164.631 1.00 41.93  ? 86   ARG D C     1 
ATOM   2823  O O     . ARG D 4 59  ? 147.463 120.597 163.455 1.00 41.93  ? 86   ARG D O     1 
ATOM   2824  C CB    . ARG D 4 59  ? 147.082 123.054 165.890 1.00 41.93  ? 86   ARG D CB    1 
ATOM   2825  C CG    . ARG D 4 59  ? 146.353 122.840 167.177 1.00 41.93  ? 86   ARG D CG    1 
ATOM   2826  C CD    . ARG D 4 59  ? 145.573 124.085 167.534 1.00 41.93  ? 86   ARG D CD    1 
ATOM   2827  N NE    . ARG D 4 59  ? 146.457 125.224 167.756 1.00 41.93  ? 86   ARG D NE    1 
ATOM   2828  C CZ    . ARG D 4 59  ? 147.026 125.516 168.919 1.00 41.93  ? 86   ARG D CZ    1 
ATOM   2829  N NH1   . ARG D 4 59  ? 146.800 124.762 169.981 1.00 41.93  ? 86   ARG D NH1   1 
ATOM   2830  N NH2   . ARG D 4 59  ? 147.817 126.572 169.022 1.00 41.93  ? 86   ARG D NH2   1 
ATOM   2831  N N     . SER D 4 60  ? 146.269 120.159 165.293 1.00 42.68  ? 87   SER D N     1 
ATOM   2832  C CA    . SER D 4 60  ? 145.598 119.039 164.650 1.00 42.68  ? 87   SER D CA    1 
ATOM   2833  C C     . SER D 4 60  ? 144.119 118.988 164.990 1.00 42.68  ? 87   SER D C     1 
ATOM   2834  O O     . SER D 4 60  ? 143.544 117.907 165.082 1.00 42.68  ? 87   SER D O     1 
ATOM   2835  C CB    . SER D 4 60  ? 146.277 117.727 165.030 1.00 42.68  ? 87   SER D CB    1 
ATOM   2836  O OG    . SER D 4 60  ? 146.197 117.515 166.426 1.00 42.68  ? 87   SER D OG    1 
ATOM   2837  N N     . THR D 4 61  ? 143.480 120.139 165.180 1.00 35.90  ? 88   THR D N     1 
ATOM   2838  C CA    . THR D 4 61  ? 142.106 120.143 165.659 1.00 35.90  ? 88   THR D CA    1 
ATOM   2839  C C     . THR D 4 61  ? 141.344 121.325 165.077 1.00 35.90  ? 88   THR D C     1 
ATOM   2840  O O     . THR D 4 61  ? 141.768 122.469 165.239 1.00 35.90  ? 88   THR D O     1 
ATOM   2841  C CB    . THR D 4 61  ? 142.064 120.207 167.188 1.00 35.90  ? 88   THR D CB    1 
ATOM   2842  O OG1   . THR D 4 61  ? 142.858 119.157 167.745 1.00 35.90  ? 88   THR D OG1   1 
ATOM   2843  C CG2   . THR D 4 61  ? 140.670 120.010 167.666 1.00 35.90  ? 88   THR D CG2   1 
ATOM   2844  N N     . ILE D 4 62  ? 140.227 121.052 164.411 1.00 26.95  ? 89   ILE D N     1 
ATOM   2845  C CA    . ILE D 4 62  ? 139.304 122.103 163.997 1.00 26.95  ? 89   ILE D CA    1 
ATOM   2846  C C     . ILE D 4 62  ? 138.404 122.451 165.170 1.00 26.95  ? 89   ILE D C     1 
ATOM   2847  O O     . ILE D 4 62  ? 137.617 121.617 165.624 1.00 26.95  ? 89   ILE D O     1 
ATOM   2848  C CB    . ILE D 4 62  ? 138.467 121.663 162.796 1.00 26.95  ? 89   ILE D CB    1 
ATOM   2849  C CG1   . ILE D 4 62  ? 139.324 121.567 161.569 1.00 26.95  ? 89   ILE D CG1   1 
ATOM   2850  C CG2   . ILE D 4 62  ? 137.376 122.655 162.523 1.00 26.95  ? 89   ILE D CG2   1 
ATOM   2851  C CD1   . ILE D 4 62  ? 138.600 120.962 160.443 1.00 26.95  ? 89   ILE D CD1   1 
ATOM   2852  N N     . THR D 4 63  ? 138.501 123.670 165.662 1.00 27.24  ? 90   THR D N     1 
ATOM   2853  C CA    . THR D 4 63  ? 137.612 124.064 166.737 1.00 27.24  ? 90   THR D CA    1 
ATOM   2854  C C     . THR D 4 63  ? 136.763 125.248 166.317 1.00 27.24  ? 90   THR D C     1 
ATOM   2855  O O     . THR D 4 63  ? 136.773 125.687 165.155 1.00 27.24  ? 90   THR D O     1 
ATOM   2856  C CB    . THR D 4 63  ? 138.375 124.421 168.009 1.00 27.24  ? 90   THR D CB    1 
ATOM   2857  O OG1   . THR D 4 63  ? 139.247 125.521 167.745 1.00 27.24  ? 90   THR D OG1   1 
ATOM   2858  C CG2   . THR D 4 63  ? 139.170 123.267 168.510 1.00 27.24  ? 90   THR D CG2   1 
ATOM   2859  N N     . SER D 4 64  ? 136.036 125.769 167.307 1.00 26.97  ? 91   SER D N     1 
ATOM   2860  C CA    . SER D 4 64  ? 135.205 126.942 167.107 1.00 26.97  ? 91   SER D CA    1 
ATOM   2861  C C     . SER D 4 64  ? 136.029 128.137 166.671 1.00 26.97  ? 91   SER D C     1 
ATOM   2862  O O     . SER D 4 64  ? 135.583 128.933 165.842 1.00 26.97  ? 91   SER D O     1 
ATOM   2863  C CB    . SER D 4 64  ? 134.461 127.270 168.388 1.00 26.97  ? 91   SER D CB    1 
ATOM   2864  O OG    . SER D 4 64  ? 133.745 128.473 168.225 1.00 26.97  ? 91   SER D OG    1 
ATOM   2865  N N     . ARG D 4 65  ? 137.252 128.259 167.181 1.00 29.28  ? 92   ARG D N     1 
ATOM   2866  C CA    . ARG D 4 65  ? 138.045 129.422 166.822 1.00 29.28  ? 92   ARG D CA    1 
ATOM   2867  C C     . ARG D 4 65  ? 138.577 129.321 165.400 1.00 29.28  ? 92   ARG D C     1 
ATOM   2868  O O     . ARG D 4 65  ? 138.656 130.337 164.702 1.00 29.28  ? 92   ARG D O     1 
ATOM   2869  C CB    . ARG D 4 65  ? 139.173 129.619 167.824 1.00 29.28  ? 92   ARG D CB    1 
ATOM   2870  C CG    . ARG D 4 65  ? 139.853 130.963 167.668 1.00 29.28  ? 92   ARG D CG    1 
ATOM   2871  C CD    . ARG D 4 65  ? 140.791 131.273 168.799 1.00 29.28  ? 92   ARG D CD    1 
ATOM   2872  N NE    . ARG D 4 65  ? 141.908 130.344 168.851 1.00 29.28  ? 92   ARG D NE    1 
ATOM   2873  C CZ    . ARG D 4 65  ? 142.105 129.473 169.833 1.00 29.28  ? 92   ARG D CZ    1 
ATOM   2874  N NH1   . ARG D 4 65  ? 141.258 129.417 170.852 1.00 29.28  ? 92   ARG D NH1   1 
ATOM   2875  N NH2   . ARG D 4 65  ? 143.149 128.661 169.799 1.00 29.28  ? 92   ARG D NH2   1 
ATOM   2876  N N     . GLU D 4 66  ? 138.889 128.114 164.924 1.00 28.76  ? 93   GLU D N     1 
ATOM   2877  C CA    . GLU D 4 66  ? 139.295 127.992 163.529 1.00 28.76  ? 93   GLU D CA    1 
ATOM   2878  C C     . GLU D 4 66  ? 138.132 128.203 162.577 1.00 28.76  ? 93   GLU D C     1 
ATOM   2879  O O     . GLU D 4 66  ? 138.328 128.756 161.488 1.00 28.76  ? 93   GLU D O     1 
ATOM   2880  C CB    . GLU D 4 66  ? 139.938 126.646 163.258 1.00 28.76  ? 93   GLU D CB    1 
ATOM   2881  C CG    . GLU D 4 66  ? 141.353 126.543 163.734 1.00 28.76  ? 93   GLU D CG    1 
ATOM   2882  C CD    . GLU D 4 66  ? 141.456 126.132 165.175 1.00 28.76  ? 93   GLU D CD    1 
ATOM   2883  O OE1   . GLU D 4 66  ? 140.404 125.893 165.797 1.00 28.76  ? 93   GLU D OE1   1 
ATOM   2884  O OE2   . GLU D 4 66  ? 142.591 126.026 165.685 1.00 28.76  ? 93   GLU D OE2   1 
ATOM   2885  N N     . ILE D 4 67  ? 136.914 127.824 162.973 1.00 18.90  ? 94   ILE D N     1 
ATOM   2886  C CA    . ILE D 4 67  ? 135.791 128.173 162.109 1.00 18.90  ? 94   ILE D CA    1 
ATOM   2887  C C     . ILE D 4 67  ? 135.536 129.674 162.150 1.00 18.90  ? 94   ILE D C     1 
ATOM   2888  O O     . ILE D 4 67  ? 135.175 130.272 161.128 1.00 18.90  ? 94   ILE D O     1 
ATOM   2889  C CB    . ILE D 4 67  ? 134.534 127.372 162.469 1.00 18.90  ? 94   ILE D CB    1 
ATOM   2890  C CG1   . ILE D 4 67  ? 134.828 125.886 162.428 1.00 18.90  ? 94   ILE D CG1   1 
ATOM   2891  C CG2   . ILE D 4 67  ? 133.451 127.600 161.454 1.00 18.90  ? 94   ILE D CG2   1 
ATOM   2892  C CD1   . ILE D 4 67  ? 135.259 125.395 161.078 1.00 18.90  ? 94   ILE D CD1   1 
ATOM   2893  N N     . GLN D 4 68  ? 135.788 130.318 163.292 1.00 26.88  ? 95   GLN D N     1 
ATOM   2894  C CA    . GLN D 4 68  ? 135.601 131.763 163.390 1.00 26.88  ? 95   GLN D CA    1 
ATOM   2895  C C     . GLN D 4 68  ? 136.587 132.513 162.508 1.00 26.88  ? 95   GLN D C     1 
ATOM   2896  O O     . GLN D 4 68  ? 136.222 133.488 161.835 1.00 26.88  ? 95   GLN D O     1 
ATOM   2897  C CB    . GLN D 4 68  ? 135.733 132.196 164.841 1.00 26.88  ? 95   GLN D CB    1 
ATOM   2898  C CG    . GLN D 4 68  ? 135.491 133.649 165.056 1.00 26.88  ? 95   GLN D CG    1 
ATOM   2899  C CD    . GLN D 4 68  ? 135.357 133.991 166.518 1.00 26.88  ? 95   GLN D CD    1 
ATOM   2900  O OE1   . GLN D 4 68  ? 135.456 133.124 167.379 1.00 26.88  ? 95   GLN D OE1   1 
ATOM   2901  N NE2   . GLN D 4 68  ? 135.122 135.261 166.808 1.00 26.88  ? 95   GLN D NE2   1 
ATOM   2902  N N     . THR D 4 69  ? 137.821 132.032 162.443 1.00 17.22  ? 96   THR D N     1 
ATOM   2903  C CA    . THR D 4 69  ? 138.789 132.678 161.574 1.00 17.22  ? 96   THR D CA    1 
ATOM   2904  C C     . THR D 4 69  ? 138.518 132.375 160.106 1.00 17.22  ? 96   THR D C     1 
ATOM   2905  O O     . THR D 4 69  ? 138.755 133.237 159.249 1.00 17.22  ? 96   THR D O     1 
ATOM   2906  C CB    . THR D 4 69  ? 140.191 132.253 161.970 1.00 17.22  ? 96   THR D CB    1 
ATOM   2907  O OG1   . THR D 4 69  ? 140.332 132.416 163.381 1.00 17.22  ? 96   THR D OG1   1 
ATOM   2908  C CG2   . THR D 4 69  ? 141.195 133.163 161.329 1.00 17.22  ? 96   THR D CG2   1 
ATOM   2909  N N     . ALA D 4 70  ? 137.966 131.198 159.794 1.00 19.55  ? 97   ALA D N     1 
ATOM   2910  C CA    . ALA D 4 70  ? 137.589 130.923 158.410 1.00 19.55  ? 97   ALA D CA    1 
ATOM   2911  C C     . ALA D 4 70  ? 136.448 131.823 157.951 1.00 19.55  ? 97   ALA D C     1 
ATOM   2912  O O     . ALA D 4 70  ? 136.427 132.269 156.794 1.00 19.55  ? 97   ALA D O     1 
ATOM   2913  C CB    . ALA D 4 70  ? 137.218 129.458 158.256 1.00 19.55  ? 97   ALA D CB    1 
ATOM   2914  N N     . VAL D 4 71  ? 135.511 132.117 158.853 1.00 18.39  ? 98   VAL D N     1 
ATOM   2915  C CA    . VAL D 4 71  ? 134.436 133.063 158.558 1.00 18.39  ? 98   VAL D CA    1 
ATOM   2916  C C     . VAL D 4 71  ? 134.992 134.452 158.302 1.00 18.39  ? 98   VAL D C     1 
ATOM   2917  O O     . VAL D 4 71  ? 134.664 135.091 157.294 1.00 18.39  ? 98   VAL D O     1 
ATOM   2918  C CB    . VAL D 4 71  ? 133.420 133.079 159.705 1.00 18.39  ? 98   VAL D CB    1 
ATOM   2919  C CG1   . VAL D 4 71  ? 132.484 134.222 159.552 1.00 18.39  ? 98   VAL D CG1   1 
ATOM   2920  C CG2   . VAL D 4 71  ? 132.655 131.807 159.688 1.00 18.39  ? 98   VAL D CG2   1 
ATOM   2921  N N     . ARG D 4 72  ? 135.860 134.933 159.196 1.00 20.71  ? 99   ARG D N     1 
ATOM   2922  C CA    . ARG D 4 72  ? 136.418 136.268 159.012 1.00 20.71  ? 99   ARG D CA    1 
ATOM   2923  C C     . ARG D 4 72  ? 137.320 136.388 157.792 1.00 20.71  ? 99   ARG D C     1 
ATOM   2924  O O     . ARG D 4 72  ? 137.502 137.501 157.296 1.00 20.71  ? 99   ARG D O     1 
ATOM   2925  C CB    . ARG D 4 72  ? 137.185 136.708 160.250 1.00 20.71  ? 99   ARG D CB    1 
ATOM   2926  C CG    . ARG D 4 72  ? 136.291 137.159 161.369 1.00 20.71  ? 99   ARG D CG    1 
ATOM   2927  C CD    . ARG D 4 72  ? 137.092 137.487 162.592 1.00 20.71  ? 99   ARG D CD    1 
ATOM   2928  N NE    . ARG D 4 72  ? 136.233 137.958 163.672 1.00 20.71  ? 99   ARG D NE    1 
ATOM   2929  C CZ    . ARG D 4 72  ? 136.648 138.146 164.919 1.00 20.71  ? 99   ARG D CZ    1 
ATOM   2930  N NH1   . ARG D 4 72  ? 137.903 137.878 165.244 1.00 20.71  ? 99   ARG D NH1   1 
ATOM   2931  N NH2   . ARG D 4 72  ? 135.809 138.578 165.848 1.00 20.71  ? 99   ARG D NH2   1 
ATOM   2932  N N     . LEU D 4 73  ? 137.868 135.288 157.282 1.00 23.17  ? 100  LEU D N     1 
ATOM   2933  C CA    . LEU D 4 73  ? 138.638 135.404 156.049 1.00 23.17  ? 100  LEU D CA    1 
ATOM   2934  C C     . LEU D 4 73  ? 137.797 135.294 154.788 1.00 23.17  ? 100  LEU D C     1 
ATOM   2935  O O     . LEU D 4 73  ? 138.102 135.967 153.801 1.00 23.17  ? 100  LEU D O     1 
ATOM   2936  C CB    . LEU D 4 73  ? 139.736 134.356 155.998 1.00 23.17  ? 100  LEU D CB    1 
ATOM   2937  C CG    . LEU D 4 73  ? 140.875 134.648 156.948 1.00 23.17  ? 100  LEU D CG    1 
ATOM   2938  C CD1   . LEU D 4 73  ? 141.807 133.481 156.985 1.00 23.17  ? 100  LEU D CD1   1 
ATOM   2939  C CD2   . LEU D 4 73  ? 141.576 135.859 156.423 1.00 23.17  ? 100  LEU D CD2   1 
ATOM   2940  N N     . LEU D 4 74  ? 136.760 134.459 154.767 1.00 24.93  ? 101  LEU D N     1 
ATOM   2941  C CA    . LEU D 4 74  ? 136.029 134.335 153.512 1.00 24.93  ? 101  LEU D CA    1 
ATOM   2942  C C     . LEU D 4 74  ? 134.918 135.359 153.365 1.00 24.93  ? 101  LEU D C     1 
ATOM   2943  O O     . LEU D 4 74  ? 134.767 135.943 152.290 1.00 24.93  ? 101  LEU D O     1 
ATOM   2944  C CB    . LEU D 4 74  ? 135.444 132.938 153.365 1.00 24.93  ? 101  LEU D CB    1 
ATOM   2945  C CG    . LEU D 4 74  ? 136.499 131.853 153.265 1.00 24.93  ? 101  LEU D CG    1 
ATOM   2946  C CD1   . LEU D 4 74  ? 135.838 130.502 153.242 1.00 24.93  ? 101  LEU D CD1   1 
ATOM   2947  C CD2   . LEU D 4 74  ? 137.351 132.051 152.037 1.00 24.93  ? 101  LEU D CD2   1 
ATOM   2948  N N     . LEU D 4 75  ? 134.131 135.593 154.403 1.00 25.59  ? 102  LEU D N     1 
ATOM   2949  C CA    . LEU D 4 75  ? 132.960 136.432 154.219 1.00 25.59  ? 102  LEU D CA    1 
ATOM   2950  C C     . LEU D 4 75  ? 133.362 137.901 154.230 1.00 25.59  ? 102  LEU D C     1 
ATOM   2951  O O     . LEU D 4 75  ? 134.167 138.308 155.069 1.00 25.59  ? 102  LEU D O     1 
ATOM   2952  C CB    . LEU D 4 75  ? 131.940 136.159 155.306 1.00 25.59  ? 102  LEU D CB    1 
ATOM   2953  C CG    . LEU D 4 75  ? 131.389 134.744 155.301 1.00 25.59  ? 102  LEU D CG    1 
ATOM   2954  C CD1   . LEU D 4 75  ? 130.442 134.578 156.431 1.00 25.59  ? 102  LEU D CD1   1 
ATOM   2955  C CD2   . LEU D 4 75  ? 130.689 134.492 154.018 1.00 25.59  ? 102  LEU D CD2   1 
ATOM   2956  N N     . PRO D 4 76  ? 132.856 138.713 153.307 1.00 30.49  ? 103  PRO D N     1 
ATOM   2957  C CA    . PRO D 4 76  ? 133.133 140.148 153.367 1.00 30.49  ? 103  PRO D CA    1 
ATOM   2958  C C     . PRO D 4 76  ? 132.346 140.803 154.488 1.00 30.49  ? 103  PRO D C     1 
ATOM   2959  O O     . PRO D 4 76  ? 131.362 140.249 154.979 1.00 30.49  ? 103  PRO D O     1 
ATOM   2960  C CB    . PRO D 4 76  ? 132.656 140.655 152.004 1.00 30.49  ? 103  PRO D CB    1 
ATOM   2961  C CG    . PRO D 4 76  ? 132.576 139.461 151.159 1.00 30.49  ? 103  PRO D CG    1 
ATOM   2962  C CD    . PRO D 4 76  ? 132.174 138.356 152.058 1.00 30.49  ? 103  PRO D CD    1 
ATOM   2963  N N     . GLY D 4 77  ? 132.866 141.938 154.960 1.00 32.48  ? 104  GLY D N     1 
ATOM   2964  C CA    . GLY D 4 77  ? 132.136 142.991 155.657 1.00 32.48  ? 104  GLY D CA    1 
ATOM   2965  C C     . GLY D 4 77  ? 131.000 142.691 156.617 1.00 32.48  ? 104  GLY D C     1 
ATOM   2966  O O     . GLY D 4 77  ? 131.184 142.072 157.673 1.00 32.48  ? 104  GLY D O     1 
ATOM   2967  N N     . GLU D 4 78  ? 129.808 143.145 156.223 1.00 36.04  ? 105  GLU D N     1 
ATOM   2968  C CA    . GLU D 4 78  ? 128.624 143.056 157.070 1.00 36.04  ? 105  GLU D CA    1 
ATOM   2969  C C     . GLU D 4 78  ? 128.177 141.609 157.253 1.00 36.04  ? 105  GLU D C     1 
ATOM   2970  O O     . GLU D 4 78  ? 127.721 141.230 158.342 1.00 36.04  ? 105  GLU D O     1 
ATOM   2971  C CB    . GLU D 4 78  ? 127.509 143.897 156.452 1.00 36.04  ? 105  GLU D CB    1 
ATOM   2972  C CG    . GLU D 4 78  ? 126.242 144.081 157.274 1.00 36.04  ? 105  GLU D CG    1 
ATOM   2973  C CD    . GLU D 4 78  ? 126.412 145.043 158.439 1.00 36.04  ? 105  GLU D CD    1 
ATOM   2974  O OE1   . GLU D 4 78  ? 127.330 145.891 158.384 1.00 36.04  ? 105  GLU D OE1   1 
ATOM   2975  O OE2   . GLU D 4 78  ? 125.608 144.975 159.392 1.00 36.04  ? 105  GLU D OE2   1 
ATOM   2976  N N     . LEU D 4 79  ? 128.315 140.789 156.204 1.00 31.28  ? 106  LEU D N     1 
ATOM   2977  C CA    . LEU D 4 79  ? 128.027 139.363 156.315 1.00 31.28  ? 106  LEU D CA    1 
ATOM   2978  C C     . LEU D 4 79  ? 128.919 138.693 157.344 1.00 31.28  ? 106  LEU D C     1 
ATOM   2979  O O     . LEU D 4 79  ? 128.445 137.891 158.153 1.00 31.28  ? 106  LEU D O     1 
ATOM   2980  C CB    . LEU D 4 79  ? 128.215 138.677 154.972 1.00 31.28  ? 106  LEU D CB    1 
ATOM   2981  C CG    . LEU D 4 79  ? 127.242 139.006 153.870 1.00 31.28  ? 106  LEU D CG    1 
ATOM   2982  C CD1   . LEU D 4 79  ? 127.746 138.387 152.600 1.00 31.28  ? 106  LEU D CD1   1 
ATOM   2983  C CD2   . LEU D 4 79  ? 125.904 138.452 154.246 1.00 31.28  ? 106  LEU D CD2   1 
ATOM   2984  N N     . ALA D 4 80  ? 130.208 139.024 157.337 1.00 30.22  ? 107  ALA D N     1 
ATOM   2985  C CA    . ALA D 4 80  ? 131.135 138.425 158.286 1.00 30.22  ? 107  ALA D CA    1 
ATOM   2986  C C     . ALA D 4 80  ? 130.842 138.870 159.703 1.00 30.22  ? 107  ALA D C     1 
ATOM   2987  O O     . ALA D 4 80  ? 130.917 138.060 160.632 1.00 30.22  ? 107  ALA D O     1 
ATOM   2988  C CB    . ALA D 4 80  ? 132.568 138.773 157.916 1.00 30.22  ? 107  ALA D CB    1 
ATOM   2989  N N     . LYS D 4 81  ? 130.511 140.153 159.878 1.00 36.39  ? 108  LYS D N     1 
ATOM   2990  C CA    . LYS D 4 81  ? 130.127 140.679 161.188 1.00 36.39  ? 108  LYS D CA    1 
ATOM   2991  C C     . LYS D 4 81  ? 128.942 139.921 161.767 1.00 36.39  ? 108  LYS D C     1 
ATOM   2992  O O     . LYS D 4 81  ? 129.003 139.403 162.894 1.00 36.39  ? 108  LYS D O     1 
ATOM   2993  C CB    . LYS D 4 81  ? 129.767 142.156 161.075 1.00 36.39  ? 108  LYS D CB    1 
ATOM   2994  C CG    . LYS D 4 81  ? 130.925 143.078 160.810 1.00 36.39  ? 108  LYS D CG    1 
ATOM   2995  C CD    . LYS D 4 81  ? 130.423 144.488 160.536 1.00 36.39  ? 108  LYS D CD    1 
ATOM   2996  C CE    . LYS D 4 81  ? 129.885 145.148 161.792 1.00 36.39  ? 108  LYS D CE    1 
ATOM   2997  N NZ    . LYS D 4 81  ? 130.983 145.454 162.748 1.00 36.39  ? 108  LYS D NZ    1 
ATOM   2998  N N     . HIS D 4 82  ? 127.865 139.807 160.991 1.00 36.63  ? 109  HIS D N     1 
ATOM   2999  C CA    . HIS D 4 82  ? 126.685 139.152 161.530 1.00 36.63  ? 109  HIS D CA    1 
ATOM   3000  C C     . HIS D 4 82  ? 126.869 137.649 161.656 1.00 36.63  ? 109  HIS D C     1 
ATOM   3001  O O     . HIS D 4 82  ? 126.286 137.043 162.556 1.00 36.63  ? 109  HIS D O     1 
ATOM   3002  C CB    . HIS D 4 82  ? 125.466 139.465 160.683 1.00 36.63  ? 109  HIS D CB    1 
ATOM   3003  C CG    . HIS D 4 82  ? 125.091 140.907 160.692 1.00 36.63  ? 109  HIS D CG    1 
ATOM   3004  N ND1   . HIS D 4 82  ? 124.620 141.543 161.818 1.00 36.63  ? 109  HIS D ND1   1 
ATOM   3005  C CD2   . HIS D 4 82  ? 125.072 141.828 159.704 1.00 36.63  ? 109  HIS D CD2   1 
ATOM   3006  C CE1   . HIS D 4 82  ? 124.360 142.805 161.533 1.00 36.63  ? 109  HIS D CE1   1 
ATOM   3007  N NE2   . HIS D 4 82  ? 124.622 143.003 160.255 1.00 36.63  ? 109  HIS D NE2   1 
ATOM   3008  N N     . ALA D 4 83  ? 127.709 137.036 160.818 1.00 31.40  ? 110  ALA D N     1 
ATOM   3009  C CA    . ALA D 4 83  ? 127.900 135.595 160.918 1.00 31.40  ? 110  ALA D CA    1 
ATOM   3010  C C     . ALA D 4 83  ? 128.738 135.224 162.131 1.00 31.40  ? 110  ALA D C     1 
ATOM   3011  O O     . ALA D 4 83  ? 128.448 134.226 162.796 1.00 31.40  ? 110  ALA D O     1 
ATOM   3012  C CB    . ALA D 4 83  ? 128.534 135.059 159.643 1.00 31.40  ? 110  ALA D CB    1 
ATOM   3013  N N     . VAL D 4 84  ? 129.758 136.025 162.444 1.00 31.63  ? 111  VAL D N     1 
ATOM   3014  C CA    . VAL D 4 84  ? 130.503 135.841 163.685 1.00 31.63  ? 111  VAL D CA    1 
ATOM   3015  C C     . VAL D 4 84  ? 129.598 136.048 164.896 1.00 31.63  ? 111  VAL D C     1 
ATOM   3016  O O     . VAL D 4 84  ? 129.667 135.287 165.873 1.00 31.63  ? 111  VAL D O     1 
ATOM   3017  C CB    . VAL D 4 84  ? 131.725 136.774 163.695 1.00 31.63  ? 111  VAL D CB    1 
ATOM   3018  C CG1   . VAL D 4 84  ? 132.369 136.825 165.051 1.00 31.63  ? 111  VAL D CG1   1 
ATOM   3019  C CG2   . VAL D 4 84  ? 132.726 136.278 162.696 1.00 31.63  ? 111  VAL D CG2   1 
ATOM   3020  N N     . SER D 4 85  ? 128.694 137.037 164.827 1.00 38.28  ? 112  SER D N     1 
ATOM   3021  C CA    . SER D 4 85  ? 127.745 137.250 165.922 1.00 38.28  ? 112  SER D CA    1 
ATOM   3022  C C     . SER D 4 85  ? 126.814 136.053 166.109 1.00 38.28  ? 112  SER D C     1 
ATOM   3023  O O     . SER D 4 85  ? 126.622 135.575 167.237 1.00 38.28  ? 112  SER D O     1 
ATOM   3024  C CB    . SER D 4 85  ? 126.929 138.511 165.670 1.00 38.28  ? 112  SER D CB    1 
ATOM   3025  O OG    . SER D 4 85  ? 125.974 138.690 166.696 1.00 38.28  ? 112  SER D OG    1 
ATOM   3026  N N     . GLU D 4 86  ? 126.252 135.548 165.004 1.00 36.76  ? 113  GLU D N     1 
ATOM   3027  C CA    . GLU D 4 86  ? 125.362 134.389 165.039 1.00 36.76  ? 113  GLU D CA    1 
ATOM   3028  C C     . GLU D 4 86  ? 126.064 133.163 165.591 1.00 36.76  ? 113  GLU D C     1 
ATOM   3029  O O     . GLU D 4 86  ? 125.504 132.425 166.410 1.00 36.76  ? 113  GLU D O     1 
ATOM   3030  C CB    . GLU D 4 86  ? 124.841 134.089 163.637 1.00 36.76  ? 113  GLU D CB    1 
ATOM   3031  C CG    . GLU D 4 86  ? 123.777 135.025 163.132 1.00 36.76  ? 113  GLU D CG    1 
ATOM   3032  C CD    . GLU D 4 86  ? 122.430 134.747 163.743 1.00 36.76  ? 113  GLU D CD    1 
ATOM   3033  O OE1   . GLU D 4 86  ? 122.140 133.561 164.010 1.00 36.76  ? 113  GLU D OE1   1 
ATOM   3034  O OE2   . GLU D 4 86  ? 121.660 135.708 163.950 1.00 36.76  ? 113  GLU D OE2   1 
ATOM   3035  N N     . GLY D 4 87  ? 127.307 132.949 165.171 1.00 32.49  ? 114  GLY D N     1 
ATOM   3036  C CA    . GLY D 4 87  ? 128.032 131.778 165.624 1.00 32.49  ? 114  GLY D CA    1 
ATOM   3037  C C     . GLY D 4 87  ? 128.368 131.822 167.100 1.00 32.49  ? 114  GLY D C     1 
ATOM   3038  O O     . GLY D 4 87  ? 128.220 130.818 167.803 1.00 32.49  ? 114  GLY D O     1 
ATOM   3039  N N     . THR D 4 88  ? 128.846 132.974 167.583 1.00 36.46  ? 115  THR D N     1 
ATOM   3040  C CA    . THR D 4 88  ? 129.177 133.088 168.999 1.00 36.46  ? 115  THR D CA    1 
ATOM   3041  C C     . THR D 4 88  ? 127.937 132.940 169.865 1.00 36.46  ? 115  THR D C     1 
ATOM   3042  O O     . THR D 4 88  ? 127.982 132.284 170.917 1.00 36.46  ? 115  THR D O     1 
ATOM   3043  C CB    . THR D 4 88  ? 129.867 134.417 169.281 1.00 36.46  ? 115  THR D CB    1 
ATOM   3044  O OG1   . THR D 4 88  ? 129.066 135.487 168.771 1.00 36.46  ? 115  THR D OG1   1 
ATOM   3045  C CG2   . THR D 4 88  ? 131.244 134.453 168.660 1.00 36.46  ? 115  THR D CG2   1 
ATOM   3046  N N     . LYS D 4 89  ? 126.810 133.485 169.400 1.00 38.21  ? 116  LYS D N     1 
ATOM   3047  C CA    . LYS D 4 89  ? 125.540 133.311 170.093 1.00 38.21  ? 116  LYS D CA    1 
ATOM   3048  C C     . LYS D 4 89  ? 125.147 131.843 170.167 1.00 38.21  ? 116  LYS D C     1 
ATOM   3049  O O     . LYS D 4 89  ? 124.779 131.342 171.236 1.00 38.21  ? 116  LYS D O     1 
ATOM   3050  C CB    . LYS D 4 89  ? 124.467 134.112 169.367 1.00 38.21  ? 116  LYS D CB    1 
ATOM   3051  C CG    . LYS D 4 89  ? 123.135 134.180 170.050 1.00 38.21  ? 116  LYS D CG    1 
ATOM   3052  C CD    . LYS D 4 89  ? 122.164 134.884 169.130 1.00 38.21  ? 116  LYS D CD    1 
ATOM   3053  C CE    . LYS D 4 89  ? 122.531 136.352 168.989 1.00 38.21  ? 116  LYS D CE    1 
ATOM   3054  N NZ    . LYS D 4 89  ? 121.554 137.094 168.148 1.00 38.21  ? 116  LYS D NZ    1 
ATOM   3055  N N     . ALA D 4 90  ? 125.264 131.126 169.046 1.00 39.57  ? 117  ALA D N     1 
ATOM   3056  C CA    . ALA D 4 90  ? 124.803 129.742 169.008 1.00 39.57  ? 117  ALA D CA    1 
ATOM   3057  C C     . ALA D 4 90  ? 125.700 128.826 169.823 1.00 39.57  ? 117  ALA D C     1 
ATOM   3058  O O     . ALA D 4 90  ? 125.215 127.897 170.471 1.00 39.57  ? 117  ALA D O     1 
ATOM   3059  C CB    . ALA D 4 90  ? 124.719 129.256 167.566 1.00 39.57  ? 117  ALA D CB    1 
ATOM   3060  N N     . VAL D 4 91  ? 127.005 129.091 169.841 1.00 39.41  ? 118  VAL D N     1 
ATOM   3061  C CA    . VAL D 4 91  ? 127.908 128.227 170.593 1.00 39.41  ? 118  VAL D CA    1 
ATOM   3062  C C     . VAL D 4 91  ? 127.776 128.477 172.089 1.00 39.41  ? 118  VAL D C     1 
ATOM   3063  O O     . VAL D 4 91  ? 127.769 127.530 172.883 1.00 39.41  ? 118  VAL D O     1 
ATOM   3064  C CB    . VAL D 4 91  ? 129.349 128.408 170.096 1.00 39.41  ? 118  VAL D CB    1 
ATOM   3065  C CG1   . VAL D 4 91  ? 130.336 127.699 170.985 1.00 39.41  ? 118  VAL D CG1   1 
ATOM   3066  C CG2   . VAL D 4 91  ? 129.455 127.848 168.716 1.00 39.41  ? 118  VAL D CG2   1 
ATOM   3067  N N     . THR D 4 92  ? 127.625 129.741 172.506 1.00 50.63  ? 119  THR D N     1 
ATOM   3068  C CA    . THR D 4 92  ? 127.406 129.984 173.930 1.00 50.63  ? 119  THR D CA    1 
ATOM   3069  C C     . THR D 4 92  ? 126.037 129.499 174.387 1.00 50.63  ? 119  THR D C     1 
ATOM   3070  O O     . THR D 4 92  ? 125.886 129.106 175.548 1.00 50.63  ? 119  THR D O     1 
ATOM   3071  C CB    . THR D 4 92  ? 127.576 131.460 174.263 1.00 50.63  ? 119  THR D CB    1 
ATOM   3072  O OG1   . THR D 4 92  ? 126.709 132.242 173.436 1.00 50.63  ? 119  THR D OG1   1 
ATOM   3073  C CG2   . THR D 4 92  ? 129.019 131.891 174.073 1.00 50.63  ? 119  THR D CG2   1 
ATOM   3074  N N     . LYS D 4 93  ? 125.044 129.476 173.499 1.00 49.18  ? 120  LYS D N     1 
ATOM   3075  C CA    . LYS D 4 93  ? 123.762 128.899 173.885 1.00 49.18  ? 120  LYS D CA    1 
ATOM   3076  C C     . LYS D 4 93  ? 123.848 127.383 173.982 1.00 49.18  ? 120  LYS D C     1 
ATOM   3077  O O     . LYS D 4 93  ? 123.260 126.780 174.884 1.00 49.18  ? 120  LYS D O     1 
ATOM   3078  C CB    . LYS D 4 93  ? 122.681 129.302 172.889 1.00 49.18  ? 120  LYS D CB    1 
ATOM   3079  C CG    . LYS D 4 93  ? 121.289 128.862 173.295 1.00 49.18  ? 120  LYS D CG    1 
ATOM   3080  C CD    . LYS D 4 93  ? 120.237 129.298 172.297 1.00 49.18  ? 120  LYS D CD    1 
ATOM   3081  C CE    . LYS D 4 93  ? 118.844 129.023 172.837 1.00 49.18  ? 120  LYS D CE    1 
ATOM   3082  N NZ    . LYS D 4 93  ? 118.586 127.572 173.009 1.00 49.18  ? 120  LYS D NZ    1 
ATOM   3083  N N     . TYR D 4 94  ? 124.560 126.752 173.048 1.00 51.04  ? 121  TYR D N     1 
ATOM   3084  C CA    . TYR D 4 94  ? 124.714 125.302 173.069 1.00 51.04  ? 121  TYR D CA    1 
ATOM   3085  C C     . TYR D 4 94  ? 125.519 124.841 174.270 1.00 51.04  ? 121  TYR D C     1 
ATOM   3086  O O     . TYR D 4 94  ? 125.194 123.825 174.891 1.00 51.04  ? 121  TYR D O     1 
ATOM   3087  C CB    . TYR D 4 94  ? 125.373 124.839 171.773 1.00 51.04  ? 121  TYR D CB    1 
ATOM   3088  C CG    . TYR D 4 94  ? 125.800 123.397 171.766 1.00 51.04  ? 121  TYR D CG    1 
ATOM   3089  C CD1   . TYR D 4 94  ? 124.870 122.388 171.779 1.00 51.04  ? 121  TYR D CD1   1 
ATOM   3090  C CD2   . TYR D 4 94  ? 127.140 123.055 171.705 1.00 51.04  ? 121  TYR D CD2   1 
ATOM   3091  C CE1   . TYR D 4 94  ? 125.255 121.079 171.769 1.00 51.04  ? 121  TYR D CE1   1 
ATOM   3092  C CE2   . TYR D 4 94  ? 127.537 121.748 171.685 1.00 51.04  ? 121  TYR D CE2   1 
ATOM   3093  C CZ    . TYR D 4 94  ? 126.589 120.762 171.714 1.00 51.04  ? 121  TYR D CZ    1 
ATOM   3094  O OH    . TYR D 4 94  ? 126.964 119.441 171.698 1.00 51.04  ? 121  TYR D OH    1 
ATOM   3095  N N     . THR D 4 95  ? 126.569 125.573 174.617 1.00 57.04  ? 122  THR D N     1 
ATOM   3096  C CA    . THR D 4 95  ? 127.409 125.169 175.733 1.00 57.04  ? 122  THR D CA    1 
ATOM   3097  C C     . THR D 4 95  ? 126.743 125.488 177.063 1.00 57.04  ? 122  THR D C     1 
ATOM   3098  O O     . THR D 4 95  ? 126.721 124.649 177.970 1.00 57.04  ? 122  THR D O     1 
ATOM   3099  C CB    . THR D 4 95  ? 128.772 125.849 175.628 1.00 57.04  ? 122  THR D CB    1 
ATOM   3100  O OG1   . THR D 4 95  ? 129.393 125.466 174.396 1.00 57.04  ? 122  THR D OG1   1 
ATOM   3101  C CG2   . THR D 4 95  ? 129.668 125.445 176.780 1.00 57.04  ? 122  THR D CG2   1 
ATOM   3102  N N     . SER D 4 96  ? 126.177 126.689 177.188 1.00 62.80  ? 123  SER D N     1 
ATOM   3103  C CA    . SER D 4 96  ? 125.577 127.103 178.449 1.00 62.80  ? 123  SER D CA    1 
ATOM   3104  C C     . SER D 4 96  ? 124.297 126.330 178.726 1.00 62.80  ? 123  SER D C     1 
ATOM   3105  O O     . SER D 4 96  ? 124.212 125.567 179.694 1.00 62.80  ? 123  SER D O     1 
ATOM   3106  C CB    . SER D 4 96  ? 125.309 128.607 178.422 1.00 62.80  ? 123  SER D CB    1 
ATOM   3107  O OG    . SER D 4 96  ? 126.519 129.336 178.323 1.00 62.80  ? 123  SER D OG    1 
ATOM   3108  N N     . ALA D 4 97  ? 123.300 126.483 177.863 1.00 68.00  ? 124  ALA D N     1 
ATOM   3109  C CA    . ALA D 4 97  ? 122.043 125.760 178.015 1.00 68.00  ? 124  ALA D CA    1 
ATOM   3110  C C     . ALA D 4 97  ? 122.240 124.332 177.513 1.00 68.00  ? 124  ALA D C     1 
ATOM   3111  O O     . ALA D 4 97  ? 121.842 123.969 176.404 1.00 68.00  ? 124  ALA D O     1 
ATOM   3112  C CB    . ALA D 4 97  ? 120.923 126.474 177.271 1.00 68.00  ? 124  ALA D CB    1 
ATOM   3113  N N     . LYS D 4 98  ? 122.873 123.520 178.364 1.00 69.77  ? 125  LYS D N     1 
ATOM   3114  C CA    . LYS D 4 98  ? 123.133 122.086 178.154 1.00 69.77  ? 125  LYS D CA    1 
ATOM   3115  C C     . LYS D 4 98  ? 123.885 121.749 176.864 1.00 69.77  ? 125  LYS D C     1 
ATOM   3116  O O     . LYS D 4 98  ? 125.112 121.660 176.857 1.00 69.77  ? 125  LYS D O     1 
ATOM   3117  C CB    . LYS D 4 98  ? 121.822 121.293 178.198 1.00 69.77  ? 125  LYS D CB    1 
ATOM   3118  C CG    . LYS D 4 98  ? 121.173 121.257 179.568 1.00 69.77  ? 125  LYS D CG    1 
ATOM   3119  C CD    . LYS D 4 98  ? 119.867 120.490 179.535 1.00 69.77  ? 125  LYS D CD    1 
ATOM   3120  C CE    . LYS D 4 98  ? 120.105 118.997 179.402 1.00 69.77  ? 125  LYS D CE    1 
ATOM   3121  N NZ    . LYS D 4 98  ? 120.703 118.426 180.639 1.00 69.77  ? 125  LYS D NZ    1 
ATOM   3122  O OXT   . LYS D 4 98  ? 123.288 121.543 175.807 1.00 69.77  ? 125  LYS D OXT   1 
ATOM   3123  N N     . LYS E 1 2   ? 104.860 155.636 103.768 1.00 116.29 ? 37   LYS E N     1 
ATOM   3124  C CA    . LYS E 1 2   ? 103.804 154.658 104.037 1.00 116.29 ? 37   LYS E CA    1 
ATOM   3125  C C     . LYS E 1 2   ? 104.236 153.364 104.794 1.00 116.29 ? 37   LYS E C     1 
ATOM   3126  O O     . LYS E 1 2   ? 103.510 152.953 105.701 1.00 116.29 ? 37   LYS E O     1 
ATOM   3127  C CB    . LYS E 1 2   ? 103.087 154.297 102.726 1.00 116.29 ? 37   LYS E CB    1 
ATOM   3128  C CG    . LYS E 1 2   ? 101.849 153.440 102.898 1.00 116.29 ? 37   LYS E CG    1 
ATOM   3129  C CD    . LYS E 1 2   ? 101.252 153.094 101.552 1.00 116.29 ? 37   LYS E CD    1 
ATOM   3130  C CE    . LYS E 1 2   ? 100.654 154.318 100.891 1.00 116.29 ? 37   LYS E CE    1 
ATOM   3131  N NZ    . LYS E 1 2   ? 99.468  154.813 101.636 1.00 116.29 ? 37   LYS E NZ    1 
ATOM   3132  N N     . PRO E 1 3   ? 105.370 152.714 104.474 1.00 114.17 ? 38   PRO E N     1 
ATOM   3133  C CA    . PRO E 1 3   ? 105.786 151.593 105.331 1.00 114.17 ? 38   PRO E CA    1 
ATOM   3134  C C     . PRO E 1 3   ? 106.365 152.099 106.645 1.00 114.17 ? 38   PRO E C     1 
ATOM   3135  O O     . PRO E 1 3   ? 107.149 153.050 106.672 1.00 114.17 ? 38   PRO E O     1 
ATOM   3136  C CB    . PRO E 1 3   ? 106.843 150.865 104.494 1.00 114.17 ? 38   PRO E CB    1 
ATOM   3137  C CG    . PRO E 1 3   ? 107.389 151.885 103.624 1.00 114.17 ? 38   PRO E CG    1 
ATOM   3138  C CD    . PRO E 1 3   ? 106.256 152.791 103.287 1.00 114.17 ? 38   PRO E CD    1 
ATOM   3139  N N     . HIS E 1 4   ? 105.963 151.457 107.742 1.00 111.58 ? 39   HIS E N     1 
ATOM   3140  C CA    . HIS E 1 4   ? 106.366 151.873 109.083 1.00 111.58 ? 39   HIS E CA    1 
ATOM   3141  C C     . HIS E 1 4   ? 107.678 151.183 109.443 1.00 111.58 ? 39   HIS E C     1 
ATOM   3142  O O     . HIS E 1 4   ? 107.727 150.220 110.209 1.00 111.58 ? 39   HIS E O     1 
ATOM   3143  C CB    . HIS E 1 4   ? 105.261 151.559 110.080 1.00 111.58 ? 39   HIS E CB    1 
ATOM   3144  C CG    . HIS E 1 4   ? 105.524 152.063 111.463 1.00 111.58 ? 39   HIS E CG    1 
ATOM   3145  N ND1   . HIS E 1 4   ? 106.159 151.304 112.421 1.00 111.58 ? 39   HIS E ND1   1 
ATOM   3146  C CD2   . HIS E 1 4   ? 105.236 153.247 112.050 1.00 111.58 ? 39   HIS E CD2   1 
ATOM   3147  C CE1   . HIS E 1 4   ? 106.246 151.999 113.541 1.00 111.58 ? 39   HIS E CE1   1 
ATOM   3148  N NE2   . HIS E 1 4   ? 105.694 153.181 113.342 1.00 111.58 ? 39   HIS E NE2   1 
ATOM   3149  N N     . ARG E 1 5   ? 108.763 151.692 108.865 1.00 93.80  ? 40   ARG E N     1 
ATOM   3150  C CA    . ARG E 1 5   ? 110.100 151.192 109.151 1.00 93.80  ? 40   ARG E CA    1 
ATOM   3151  C C     . ARG E 1 5   ? 110.685 151.961 110.320 1.00 93.80  ? 40   ARG E C     1 
ATOM   3152  O O     . ARG E 1 5   ? 110.611 153.192 110.357 1.00 93.80  ? 40   ARG E O     1 
ATOM   3153  C CB    . ARG E 1 5   ? 111.016 151.336 107.939 1.00 93.80  ? 40   ARG E CB    1 
ATOM   3154  C CG    . ARG E 1 5   ? 110.686 150.425 106.786 1.00 93.80  ? 40   ARG E CG    1 
ATOM   3155  C CD    . ARG E 1 5   ? 111.577 150.728 105.594 1.00 93.80  ? 40   ARG E CD    1 
ATOM   3156  N NE    . ARG E 1 5   ? 112.985 150.429 105.840 1.00 93.80  ? 40   ARG E NE    1 
ATOM   3157  C CZ    . ARG E 1 5   ? 113.559 149.260 105.572 1.00 93.80  ? 40   ARG E CZ    1 
ATOM   3158  N NH1   . ARG E 1 5   ? 112.847 148.276 105.044 1.00 93.80  ? 40   ARG E NH1   1 
ATOM   3159  N NH2   . ARG E 1 5   ? 114.848 149.077 105.821 1.00 93.80  ? 40   ARG E NH2   1 
ATOM   3160  N N     . TYR E 1 6   ? 111.263 151.238 111.270 1.00 92.63  ? 41   TYR E N     1 
ATOM   3161  C CA    . TYR E 1 6   ? 111.936 151.884 112.383 1.00 92.63  ? 41   TYR E CA    1 
ATOM   3162  C C     . TYR E 1 6   ? 113.252 152.496 111.929 1.00 92.63  ? 41   TYR E C     1 
ATOM   3163  O O     . TYR E 1 6   ? 113.928 151.963 111.045 1.00 92.63  ? 41   TYR E O     1 
ATOM   3164  C CB    . TYR E 1 6   ? 112.189 150.880 113.499 1.00 92.63  ? 41   TYR E CB    1 
ATOM   3165  C CG    . TYR E 1 6   ? 110.934 150.427 114.182 1.00 92.63  ? 41   TYR E CG    1 
ATOM   3166  C CD1   . TYR E 1 6   ? 110.325 151.220 115.136 1.00 92.63  ? 41   TYR E CD1   1 
ATOM   3167  C CD2   . TYR E 1 6   ? 110.358 149.206 113.877 1.00 92.63  ? 41   TYR E CD2   1 
ATOM   3168  C CE1   . TYR E 1 6   ? 109.179 150.816 115.768 1.00 92.63  ? 41   TYR E CE1   1 
ATOM   3169  C CE2   . TYR E 1 6   ? 109.209 148.791 114.507 1.00 92.63  ? 41   TYR E CE2   1 
ATOM   3170  C CZ    . TYR E 1 6   ? 108.624 149.604 115.450 1.00 92.63  ? 41   TYR E CZ    1 
ATOM   3171  O OH    . TYR E 1 6   ? 107.479 149.207 116.090 1.00 92.63  ? 41   TYR E OH    1 
ATOM   3172  N N     . ARG E 1 7   ? 113.593 153.641 112.515 1.00 101.37 ? 42   ARG E N     1 
ATOM   3173  C CA    . ARG E 1 7   ? 114.951 154.142 112.397 1.00 101.37 ? 42   ARG E CA    1 
ATOM   3174  C C     . ARG E 1 7   ? 115.892 153.137 113.052 1.00 101.37 ? 42   ARG E C     1 
ATOM   3175  O O     . ARG E 1 7   ? 115.532 152.543 114.074 1.00 101.37 ? 42   ARG E O     1 
ATOM   3176  C CB    . ARG E 1 7   ? 115.090 155.517 113.057 1.00 101.37 ? 42   ARG E CB    1 
ATOM   3177  C CG    . ARG E 1 7   ? 114.357 156.633 112.332 1.00 101.37 ? 42   ARG E CG    1 
ATOM   3178  C CD    . ARG E 1 7   ? 114.602 158.008 112.964 1.00 101.37 ? 42   ARG E CD    1 
ATOM   3179  N NE    . ARG E 1 7   ? 113.960 158.192 114.267 1.00 101.37 ? 42   ARG E NE    1 
ATOM   3180  C CZ    . ARG E 1 7   ? 114.115 159.274 115.031 1.00 101.37 ? 42   ARG E CZ    1 
ATOM   3181  N NH1   . ARG E 1 7   ? 114.889 160.271 114.631 1.00 101.37 ? 42   ARG E NH1   1 
ATOM   3182  N NH2   . ARG E 1 7   ? 113.493 159.365 116.197 1.00 101.37 ? 42   ARG E NH2   1 
ATOM   3183  N N     . PRO E 1 8   ? 117.073 152.894 112.476 1.00 74.96  ? 43   PRO E N     1 
ATOM   3184  C CA    . PRO E 1 8   ? 117.890 151.750 112.908 1.00 74.96  ? 43   PRO E CA    1 
ATOM   3185  C C     . PRO E 1 8   ? 118.439 151.923 114.316 1.00 74.96  ? 43   PRO E C     1 
ATOM   3186  O O     . PRO E 1 8   ? 119.026 152.952 114.652 1.00 74.96  ? 43   PRO E O     1 
ATOM   3187  C CB    . PRO E 1 8   ? 119.011 151.707 111.867 1.00 74.96  ? 43   PRO E CB    1 
ATOM   3188  C CG    . PRO E 1 8   ? 119.079 153.066 111.330 1.00 74.96  ? 43   PRO E CG    1 
ATOM   3189  C CD    . PRO E 1 8   ? 117.682 153.590 111.335 1.00 74.96  ? 43   PRO E CD    1 
ATOM   3190  N N     . GLY E 1 9   ? 118.206 150.912 115.144 1.00 61.64  ? 44   GLY E N     1 
ATOM   3191  C CA    . GLY E 1 9   ? 118.579 150.964 116.538 1.00 61.64  ? 44   GLY E CA    1 
ATOM   3192  C C     . GLY E 1 9   ? 117.463 150.537 117.468 1.00 61.64  ? 44   GLY E C     1 
ATOM   3193  O O     . GLY E 1 9   ? 117.724 149.918 118.502 1.00 61.64  ? 44   GLY E O     1 
ATOM   3194  N N     . THR E 1 10  ? 116.216 150.845 117.115 1.00 58.25  ? 45   THR E N     1 
ATOM   3195  C CA    . THR E 1 10  ? 115.109 150.605 118.033 1.00 58.25  ? 45   THR E CA    1 
ATOM   3196  C C     . THR E 1 10  ? 114.775 149.125 118.130 1.00 58.25  ? 45   THR E C     1 
ATOM   3197  O O     . THR E 1 10  ? 114.399 148.641 119.208 1.00 58.25  ? 45   THR E O     1 
ATOM   3198  C CB    . THR E 1 10  ? 113.888 151.403 117.590 1.00 58.25  ? 45   THR E CB    1 
ATOM   3199  O OG1   . THR E 1 10  ? 114.288 152.749 117.328 1.00 58.25  ? 45   THR E OG1   1 
ATOM   3200  C CG2   . THR E 1 10  ? 112.852 151.444 118.695 1.00 58.25  ? 45   THR E CG2   1 
ATOM   3201  N N     . VAL E 1 11  ? 114.935 148.397 117.026 1.00 50.47  ? 46   VAL E N     1 
ATOM   3202  C CA    . VAL E 1 11  ? 114.817 146.945 117.057 1.00 50.47  ? 46   VAL E CA    1 
ATOM   3203  C C     . VAL E 1 11  ? 115.886 146.351 117.958 1.00 50.47  ? 46   VAL E C     1 
ATOM   3204  O O     . VAL E 1 11  ? 115.622 145.426 118.732 1.00 50.47  ? 46   VAL E O     1 
ATOM   3205  C CB    . VAL E 1 11  ? 114.904 146.384 115.630 1.00 50.47  ? 46   VAL E CB    1 
ATOM   3206  C CG1   . VAL E 1 11  ? 114.843 144.878 115.638 1.00 50.47  ? 46   VAL E CG1   1 
ATOM   3207  C CG2   . VAL E 1 11  ? 113.797 146.951 114.780 1.00 50.47  ? 46   VAL E CG2   1 
ATOM   3208  N N     . ALA E 1 12  ? 117.095 146.913 117.913 1.00 49.70  ? 47   ALA E N     1 
ATOM   3209  C CA    . ALA E 1 12  ? 118.167 146.454 118.786 1.00 49.70  ? 47   ALA E CA    1 
ATOM   3210  C C     . ALA E 1 12  ? 117.842 146.712 120.248 1.00 49.70  ? 47   ALA E C     1 
ATOM   3211  O O     . ALA E 1 12  ? 118.091 145.857 121.099 1.00 49.70  ? 47   ALA E O     1 
ATOM   3212  C CB    . ALA E 1 12  ? 119.476 147.131 118.405 1.00 49.70  ? 47   ALA E CB    1 
ATOM   3213  N N     . LEU E 1 13  ? 117.247 147.864 120.554 1.00 47.91  ? 48   LEU E N     1 
ATOM   3214  C CA    . LEU E 1 13  ? 116.920 148.164 121.946 1.00 47.91  ? 48   LEU E CA    1 
ATOM   3215  C C     . LEU E 1 13  ? 115.781 147.301 122.471 1.00 47.91  ? 48   LEU E C     1 
ATOM   3216  O O     . LEU E 1 13  ? 115.815 146.866 123.632 1.00 47.91  ? 48   LEU E O     1 
ATOM   3217  C CB    . LEU E 1 13  ? 116.582 149.639 122.118 1.00 47.91  ? 48   LEU E CB    1 
ATOM   3218  C CG    . LEU E 1 13  ? 117.732 150.519 122.599 1.00 47.91  ? 48   LEU E CG    1 
ATOM   3219  C CD1   . LEU E 1 13  ? 118.797 150.650 121.556 1.00 47.91  ? 48   LEU E CD1   1 
ATOM   3220  C CD2   . LEU E 1 13  ? 117.231 151.883 122.989 1.00 47.91  ? 48   LEU E CD2   1 
ATOM   3221  N N     . ARG E 1 14  ? 114.776 147.015 121.644 1.00 56.76  ? 49   ARG E N     1 
ATOM   3222  C CA    . ARG E 1 14  ? 113.722 146.142 122.145 1.00 56.76  ? 49   ARG E CA    1 
ATOM   3223  C C     . ARG E 1 14  ? 114.195 144.697 122.234 1.00 56.76  ? 49   ARG E C     1 
ATOM   3224  O O     . ARG E 1 14  ? 113.742 143.961 123.120 1.00 56.76  ? 49   ARG E O     1 
ATOM   3225  C CB    . ARG E 1 14  ? 112.460 146.258 121.300 1.00 56.76  ? 49   ARG E CB    1 
ATOM   3226  C CG    . ARG E 1 14  ? 112.623 145.827 119.878 1.00 56.76  ? 49   ARG E CG    1 
ATOM   3227  C CD    . ARG E 1 14  ? 111.358 145.982 119.092 1.00 56.76  ? 49   ARG E CD    1 
ATOM   3228  N NE    . ARG E 1 14  ? 110.904 147.360 119.104 1.00 56.76  ? 49   ARG E NE    1 
ATOM   3229  C CZ    . ARG E 1 14  ? 109.833 147.770 118.451 1.00 56.76  ? 49   ARG E CZ    1 
ATOM   3230  N NH1   . ARG E 1 14  ? 109.169 146.904 117.710 1.00 56.76  ? 49   ARG E NH1   1 
ATOM   3231  N NH2   . ARG E 1 14  ? 109.455 149.036 118.506 1.00 56.76  ? 49   ARG E NH2   1 
ATOM   3232  N N     . GLU E 1 15  ? 115.149 144.290 121.383 1.00 48.70  ? 50   GLU E N     1 
ATOM   3233  C CA    . GLU E 1 15  ? 115.750 142.970 121.542 1.00 48.70  ? 50   GLU E CA    1 
ATOM   3234  C C     . GLU E 1 15  ? 116.552 142.884 122.824 1.00 48.70  ? 50   GLU E C     1 
ATOM   3235  O O     . GLU E 1 15  ? 116.483 141.871 123.523 1.00 48.70  ? 50   GLU E O     1 
ATOM   3236  C CB    . GLU E 1 15  ? 116.648 142.617 120.364 1.00 48.70  ? 50   GLU E CB    1 
ATOM   3237  C CG    . GLU E 1 15  ? 115.942 142.230 119.098 1.00 48.70  ? 50   GLU E CG    1 
ATOM   3238  C CD    . GLU E 1 15  ? 116.919 141.841 118.010 1.00 48.70  ? 50   GLU E CD    1 
ATOM   3239  O OE1   . GLU E 1 15  ? 118.140 141.948 118.245 1.00 48.70  ? 50   GLU E OE1   1 
ATOM   3240  O OE2   . GLU E 1 15  ? 116.472 141.434 116.919 1.00 48.70  ? 50   GLU E OE2   1 
ATOM   3241  N N     . ILE E 1 16  ? 117.330 143.928 123.129 1.00 41.28  ? 51   ILE E N     1 
ATOM   3242  C CA    . ILE E 1 16  ? 118.116 143.965 124.357 1.00 41.28  ? 51   ILE E CA    1 
ATOM   3243  C C     . ILE E 1 16  ? 117.218 143.847 125.573 1.00 41.28  ? 51   ILE E C     1 
ATOM   3244  O O     . ILE E 1 16  ? 117.493 143.058 126.486 1.00 41.28  ? 51   ILE E O     1 
ATOM   3245  C CB    . ILE E 1 16  ? 118.974 145.242 124.415 1.00 41.28  ? 51   ILE E CB    1 
ATOM   3246  C CG1   . ILE E 1 16  ? 120.170 145.141 123.491 1.00 41.28  ? 51   ILE E CG1   1 
ATOM   3247  C CG2   . ILE E 1 16  ? 119.490 145.492 125.792 1.00 41.28  ? 51   ILE E CG2   1 
ATOM   3248  C CD1   . ILE E 1 16  ? 120.943 146.426 123.392 1.00 41.28  ? 51   ILE E CD1   1 
ATOM   3249  N N     . ARG E 1 17  ? 116.088 144.553 125.566 1.00 47.20  ? 52   ARG E N     1 
ATOM   3250  C CA    . ARG E 1 17  ? 115.189 144.461 126.711 1.00 47.20  ? 52   ARG E CA    1 
ATOM   3251  C C     . ARG E 1 17  ? 114.535 143.090 126.816 1.00 47.20  ? 52   ARG E C     1 
ATOM   3252  O O     . ARG E 1 17  ? 114.453 142.532 127.917 1.00 47.20  ? 52   ARG E O     1 
ATOM   3253  C CB    . ARG E 1 17  ? 114.136 145.554 126.653 1.00 47.20  ? 52   ARG E CB    1 
ATOM   3254  C CG    . ARG E 1 17  ? 114.706 146.919 126.894 1.00 47.20  ? 52   ARG E CG    1 
ATOM   3255  C CD    . ARG E 1 17  ? 113.628 147.970 126.851 1.00 47.20  ? 52   ARG E CD    1 
ATOM   3256  N NE    . ARG E 1 17  ? 114.182 149.298 127.062 1.00 47.20  ? 52   ARG E NE    1 
ATOM   3257  C CZ    . ARG E 1 17  ? 114.657 150.057 126.084 1.00 47.20  ? 52   ARG E CZ    1 
ATOM   3258  N NH1   . ARG E 1 17  ? 114.647 149.605 124.841 1.00 47.20  ? 52   ARG E NH1   1 
ATOM   3259  N NH2   . ARG E 1 17  ? 115.147 151.258 126.347 1.00 47.20  ? 52   ARG E NH2   1 
ATOM   3260  N N     . ARG E 1 18  ? 114.119 142.490 125.693 1.00 43.92  ? 53   ARG E N     1 
ATOM   3261  C CA    . ARG E 1 18  ? 113.444 141.204 125.845 1.00 43.92  ? 53   ARG E CA    1 
ATOM   3262  C C     . ARG E 1 18  ? 114.406 140.060 126.158 1.00 43.92  ? 53   ARG E C     1 
ATOM   3263  O O     . ARG E 1 18  ? 114.045 139.164 126.928 1.00 43.92  ? 53   ARG E O     1 
ATOM   3264  C CB    . ARG E 1 18  ? 112.594 140.870 124.623 1.00 43.92  ? 53   ARG E CB    1 
ATOM   3265  C CG    . ARG E 1 18  ? 113.332 140.686 123.339 1.00 43.92  ? 53   ARG E CG    1 
ATOM   3266  C CD    . ARG E 1 18  ? 112.364 140.231 122.277 1.00 43.92  ? 53   ARG E CD    1 
ATOM   3267  N NE    . ARG E 1 18  ? 111.919 138.875 122.554 1.00 43.92  ? 53   ARG E NE    1 
ATOM   3268  C CZ    . ARG E 1 18  ? 110.813 138.344 122.055 1.00 43.92  ? 53   ARG E CZ    1 
ATOM   3269  N NH1   . ARG E 1 18  ? 110.033 139.068 121.266 1.00 43.92  ? 53   ARG E NH1   1 
ATOM   3270  N NH2   . ARG E 1 18  ? 110.480 137.098 122.359 1.00 43.92  ? 53   ARG E NH2   1 
ATOM   3271  N N     . TYR E 1 19  ? 115.639 140.081 125.647 1.00 38.72  ? 54   TYR E N     1 
ATOM   3272  C CA    . TYR E 1 19  ? 116.545 138.999 126.003 1.00 38.72  ? 54   TYR E CA    1 
ATOM   3273  C C     . TYR E 1 19  ? 117.230 139.213 127.340 1.00 38.72  ? 54   TYR E C     1 
ATOM   3274  O O     . TYR E 1 19  ? 117.728 138.242 127.912 1.00 38.72  ? 54   TYR E O     1 
ATOM   3275  C CB    . TYR E 1 19  ? 117.607 138.766 124.937 1.00 38.72  ? 54   TYR E CB    1 
ATOM   3276  C CG    . TYR E 1 19  ? 117.016 138.283 123.661 1.00 38.72  ? 54   TYR E CG    1 
ATOM   3277  C CD1   . TYR E 1 19  ? 116.373 137.065 123.606 1.00 38.72  ? 54   TYR E CD1   1 
ATOM   3278  C CD2   . TYR E 1 19  ? 117.147 139.005 122.500 1.00 38.72  ? 54   TYR E CD2   1 
ATOM   3279  C CE1   . TYR E 1 19  ? 115.830 136.609 122.441 1.00 38.72  ? 54   TYR E CE1   1 
ATOM   3280  C CE2   . TYR E 1 19  ? 116.604 138.564 121.330 1.00 38.72  ? 54   TYR E CE2   1 
ATOM   3281  C CZ    . TYR E 1 19  ? 115.951 137.364 121.304 1.00 38.72  ? 54   TYR E CZ    1 
ATOM   3282  O OH    . TYR E 1 19  ? 115.413 136.919 120.125 1.00 38.72  ? 54   TYR E OH    1 
ATOM   3283  N N     . GLN E 1 20  ? 117.273 140.436 127.868 1.00 36.81  ? 55   GLN E N     1 
ATOM   3284  C CA    . GLN E 1 20  ? 117.659 140.556 129.265 1.00 36.81  ? 55   GLN E CA    1 
ATOM   3285  C C     . GLN E 1 20  ? 116.516 140.180 130.190 1.00 36.81  ? 55   GLN E C     1 
ATOM   3286  O O     . GLN E 1 20  ? 116.757 139.743 131.316 1.00 36.81  ? 55   GLN E O     1 
ATOM   3287  C CB    . GLN E 1 20  ? 118.156 141.962 129.573 1.00 36.81  ? 55   GLN E CB    1 
ATOM   3288  C CG    . GLN E 1 20  ? 119.553 142.235 129.103 1.00 36.81  ? 55   GLN E CG    1 
ATOM   3289  C CD    . GLN E 1 20  ? 120.001 143.621 129.433 1.00 36.81  ? 55   GLN E CD    1 
ATOM   3290  O OE1   . GLN E 1 20  ? 119.218 144.430 129.910 1.00 36.81  ? 55   GLN E OE1   1 
ATOM   3291  N NE2   . GLN E 1 20  ? 121.270 143.902 129.210 1.00 36.81  ? 55   GLN E NE2   1 
ATOM   3292  N N     . LYS E 1 21  ? 115.272 140.336 129.743 1.00 43.45  ? 56   LYS E N     1 
ATOM   3293  C CA    . LYS E 1 21  ? 114.168 139.989 130.624 1.00 43.45  ? 56   LYS E CA    1 
ATOM   3294  C C     . LYS E 1 21  ? 113.945 138.487 130.682 1.00 43.45  ? 56   LYS E C     1 
ATOM   3295  O O     . LYS E 1 21  ? 113.683 137.940 131.757 1.00 43.45  ? 56   LYS E O     1 
ATOM   3296  C CB    . LYS E 1 21  ? 112.897 140.702 130.174 1.00 43.45  ? 56   LYS E CB    1 
ATOM   3297  C CG    . LYS E 1 21  ? 111.709 140.496 131.094 1.00 43.45  ? 56   LYS E CG    1 
ATOM   3298  C CD    . LYS E 1 21  ? 110.504 141.252 130.593 1.00 43.45  ? 56   LYS E CD    1 
ATOM   3299  C CE    . LYS E 1 21  ? 110.682 142.740 130.824 1.00 43.45  ? 56   LYS E CE    1 
ATOM   3300  N NZ    . LYS E 1 21  ? 109.458 143.500 130.466 1.00 43.45  ? 56   LYS E NZ    1 
ATOM   3301  N N     . SER E 1 22  ? 114.049 137.799 129.553 1.00 41.26  ? 57   SER E N     1 
ATOM   3302  C CA    . SER E 1 22  ? 113.824 136.365 129.596 1.00 41.26  ? 57   SER E CA    1 
ATOM   3303  C C     . SER E 1 22  ? 115.081 135.646 130.079 1.00 41.26  ? 57   SER E C     1 
ATOM   3304  O O     . SER E 1 22  ? 116.113 136.257 130.355 1.00 41.26  ? 57   SER E O     1 
ATOM   3305  C CB    . SER E 1 22  ? 113.403 135.850 128.230 1.00 41.26  ? 57   SER E CB    1 
ATOM   3306  O OG    . SER E 1 22  ? 114.494 135.880 127.332 1.00 41.26  ? 57   SER E OG    1 
ATOM   3307  N N     . THR E 1 23  ? 114.985 134.319 130.196 1.00 31.36  ? 58   THR E N     1 
ATOM   3308  C CA    . THR E 1 23  ? 116.102 133.556 130.736 1.00 31.36  ? 58   THR E CA    1 
ATOM   3309  C C     . THR E 1 23  ? 116.320 132.198 130.074 1.00 31.36  ? 58   THR E C     1 
ATOM   3310  O O     . THR E 1 23  ? 116.959 131.329 130.675 1.00 31.36  ? 58   THR E O     1 
ATOM   3311  C CB    . THR E 1 23  ? 115.915 133.356 132.228 1.00 31.36  ? 58   THR E CB    1 
ATOM   3312  O OG1   . THR E 1 23  ? 116.997 132.577 132.743 1.00 31.36  ? 58   THR E OG1   1 
ATOM   3313  C CG2   . THR E 1 23  ? 114.605 132.660 132.511 1.00 31.36  ? 58   THR E CG2   1 
ATOM   3314  N N     . GLU E 1 24  ? 115.853 131.993 128.848 1.00 34.21  ? 59   GLU E N     1 
ATOM   3315  C CA    . GLU E 1 24  ? 116.001 130.693 128.214 1.00 34.21  ? 59   GLU E CA    1 
ATOM   3316  C C     . GLU E 1 24  ? 117.426 130.515 127.705 1.00 34.21  ? 59   GLU E C     1 
ATOM   3317  O O     . GLU E 1 24  ? 118.275 131.396 127.832 1.00 34.21  ? 59   GLU E O     1 
ATOM   3318  C CB    . GLU E 1 24  ? 115.004 130.532 127.069 1.00 34.21  ? 59   GLU E CB    1 
ATOM   3319  C CG    . GLU E 1 24  ? 115.367 131.266 125.771 1.00 34.21  ? 59   GLU E CG    1 
ATOM   3320  C CD    . GLU E 1 24  ? 114.847 132.681 125.708 1.00 34.21  ? 59   GLU E CD    1 
ATOM   3321  O OE1   . GLU E 1 24  ? 114.451 133.209 126.756 1.00 34.21  ? 59   GLU E OE1   1 
ATOM   3322  O OE2   . GLU E 1 24  ? 114.833 133.265 124.607 1.00 34.21  ? 59   GLU E OE2   1 
ATOM   3323  N N     . LEU E 1 25  ? 117.701 129.354 127.122 1.00 31.04  ? 60   LEU E N     1 
ATOM   3324  C CA    . LEU E 1 25  ? 118.973 129.129 126.461 1.00 31.04  ? 60   LEU E CA    1 
ATOM   3325  C C     . LEU E 1 25  ? 118.867 129.595 125.021 1.00 31.04  ? 60   LEU E C     1 
ATOM   3326  O O     . LEU E 1 25  ? 117.857 129.364 124.354 1.00 31.04  ? 60   LEU E O     1 
ATOM   3327  C CB    . LEU E 1 25  ? 119.366 127.657 126.512 1.00 31.04  ? 60   LEU E CB    1 
ATOM   3328  C CG    . LEU E 1 25  ? 119.462 127.097 127.925 1.00 31.04  ? 60   LEU E CG    1 
ATOM   3329  C CD1   . LEU E 1 25  ? 119.919 125.654 127.904 1.00 31.04  ? 60   LEU E CD1   1 
ATOM   3330  C CD2   . LEU E 1 25  ? 120.363 127.950 128.767 1.00 31.04  ? 60   LEU E CD2   1 
ATOM   3331  N N     . LEU E 1 26  ? 119.912 130.258 124.543 1.00 30.93  ? 61   LEU E N     1 
ATOM   3332  C CA    . LEU E 1 26  ? 119.799 131.000 123.305 1.00 30.93  ? 61   LEU E CA    1 
ATOM   3333  C C     . LEU E 1 26  ? 120.388 130.281 122.109 1.00 30.93  ? 61   LEU E C     1 
ATOM   3334  O O     . LEU E 1 26  ? 120.163 130.722 120.981 1.00 30.93  ? 61   LEU E O     1 
ATOM   3335  C CB    . LEU E 1 26  ? 120.465 132.363 123.448 1.00 30.93  ? 61   LEU E CB    1 
ATOM   3336  C CG    . LEU E 1 26  ? 119.896 133.217 124.569 1.00 30.93  ? 61   LEU E CG    1 
ATOM   3337  C CD1   . LEU E 1 26  ? 120.586 134.545 124.618 1.00 30.93  ? 61   LEU E CD1   1 
ATOM   3338  C CD2   . LEU E 1 26  ? 118.416 133.397 124.390 1.00 30.93  ? 61   LEU E CD2   1 
ATOM   3339  N N     . ILE E 1 27  ? 121.131 129.208 122.313 1.00 28.44  ? 62   ILE E N     1 
ATOM   3340  C CA    . ILE E 1 27  ? 121.689 128.438 121.211 1.00 28.44  ? 62   ILE E CA    1 
ATOM   3341  C C     . ILE E 1 27  ? 120.881 127.159 121.072 1.00 28.44  ? 62   ILE E C     1 
ATOM   3342  O O     . ILE E 1 27  ? 120.432 126.588 122.072 1.00 28.44  ? 62   ILE E O     1 
ATOM   3343  C CB    . ILE E 1 27  ? 123.180 128.149 121.441 1.00 28.44  ? 62   ILE E CB    1 
ATOM   3344  C CG1   . ILE E 1 27  ? 123.912 129.451 121.696 1.00 28.44  ? 62   ILE E CG1   1 
ATOM   3345  C CG2   . ILE E 1 27  ? 123.810 127.598 120.209 1.00 28.44  ? 62   ILE E CG2   1 
ATOM   3346  C CD1   . ILE E 1 27  ? 125.322 129.261 122.166 1.00 28.44  ? 62   ILE E CD1   1 
ATOM   3347  N N     . ARG E 1 28  ? 120.665 126.725 119.833 1.00 38.52  ? 63   ARG E N     1 
ATOM   3348  C CA    . ARG E 1 28  ? 119.797 125.589 119.578 1.00 38.52  ? 63   ARG E CA    1 
ATOM   3349  C C     . ARG E 1 28  ? 120.460 124.304 120.050 1.00 38.52  ? 63   ARG E C     1 
ATOM   3350  O O     . ARG E 1 28  ? 121.648 124.065 119.778 1.00 38.52  ? 63   ARG E O     1 
ATOM   3351  C CB    . ARG E 1 28  ? 119.458 125.501 118.096 1.00 38.52  ? 63   ARG E CB    1 
ATOM   3352  C CG    . ARG E 1 28  ? 118.942 126.800 117.482 1.00 38.52  ? 63   ARG E CG    1 
ATOM   3353  C CD    . ARG E 1 28  ? 117.725 127.400 118.193 1.00 38.52  ? 63   ARG E CD    1 
ATOM   3354  N NE    . ARG E 1 28  ? 116.586 126.498 118.287 1.00 38.52  ? 63   ARG E NE    1 
ATOM   3355  C CZ    . ARG E 1 28  ? 115.696 126.307 117.320 1.00 38.52  ? 63   ARG E CZ    1 
ATOM   3356  N NH1   . ARG E 1 28  ? 115.821 126.937 116.163 1.00 38.52  ? 63   ARG E NH1   1 
ATOM   3357  N NH2   . ARG E 1 28  ? 114.688 125.466 117.504 1.00 38.52  ? 63   ARG E NH2   1 
ATOM   3358  N N     . LYS E 1 29  ? 119.675 123.484 120.755 1.00 35.97  ? 64   LYS E N     1 
ATOM   3359  C CA    . LYS E 1 29  ? 120.215 122.381 121.541 1.00 35.97  ? 64   LYS E CA    1 
ATOM   3360  C C     . LYS E 1 29  ? 120.882 121.332 120.670 1.00 35.97  ? 64   LYS E C     1 
ATOM   3361  O O     . LYS E 1 29  ? 121.942 120.811 121.022 1.00 35.97  ? 64   LYS E O     1 
ATOM   3362  C CB    . LYS E 1 29  ? 119.108 121.741 122.370 1.00 35.97  ? 64   LYS E CB    1 
ATOM   3363  C CG    . LYS E 1 29  ? 118.561 122.629 123.454 1.00 35.97  ? 64   LYS E CG    1 
ATOM   3364  C CD    . LYS E 1 29  ? 117.463 121.910 124.205 1.00 35.97  ? 64   LYS E CD    1 
ATOM   3365  C CE    . LYS E 1 29  ? 116.985 122.723 125.387 1.00 35.97  ? 64   LYS E CE    1 
ATOM   3366  N NZ    . LYS E 1 29  ? 116.310 123.973 124.963 1.00 35.97  ? 64   LYS E NZ    1 
ATOM   3367  N N     . LEU E 1 30  ? 120.307 121.037 119.530 1.00 34.40  ? 65   LEU E N     1 
ATOM   3368  C CA    . LEU E 1 30  ? 120.871 119.967 118.725 1.00 34.40  ? 65   LEU E CA    1 
ATOM   3369  C C     . LEU E 1 30  ? 122.158 120.357 117.988 1.00 34.40  ? 65   LEU E C     1 
ATOM   3370  O O     . LEU E 1 30  ? 123.074 119.525 117.939 1.00 34.40  ? 65   LEU E O     1 
ATOM   3371  C CB    . LEU E 1 30  ? 119.819 119.437 117.755 1.00 34.40  ? 65   LEU E CB    1 
ATOM   3372  C CG    . LEU E 1 30  ? 120.155 118.091 117.151 1.00 34.40  ? 65   LEU E CG    1 
ATOM   3373  C CD1   . LEU E 1 30  ? 120.234 117.069 118.259 1.00 34.40  ? 65   LEU E CD1   1 
ATOM   3374  C CD2   . LEU E 1 30  ? 119.103 117.689 116.142 1.00 34.40  ? 65   LEU E CD2   1 
ATOM   3375  N N     . PRO E 1 31  ? 122.326 121.570 117.432 1.00 35.17  ? 66   PRO E N     1 
ATOM   3376  C CA    . PRO E 1 31  ? 123.665 121.916 116.939 1.00 35.17  ? 66   PRO E CA    1 
ATOM   3377  C C     . PRO E 1 31  ? 124.681 122.115 118.037 1.00 35.17  ? 66   PRO E C     1 
ATOM   3378  O O     . PRO E 1 31  ? 125.861 121.811 117.809 1.00 35.17  ? 66   PRO E O     1 
ATOM   3379  C CB    . PRO E 1 31  ? 123.439 123.209 116.157 1.00 35.17  ? 66   PRO E CB    1 
ATOM   3380  C CG    . PRO E 1 31  ? 122.081 123.162 115.769 1.00 35.17  ? 66   PRO E CG    1 
ATOM   3381  C CD    . PRO E 1 31  ? 121.357 122.545 116.903 1.00 35.17  ? 66   PRO E CD    1 
ATOM   3382  N N     . PHE E 1 32  ? 124.275 122.587 119.222 1.00 28.98  ? 67   PHE E N     1 
ATOM   3383  C CA    . PHE E 1 32  ? 125.245 122.647 120.311 1.00 28.98  ? 67   PHE E CA    1 
ATOM   3384  C C     . PHE E 1 32  ? 125.699 121.255 120.729 1.00 28.98  ? 67   PHE E C     1 
ATOM   3385  O O     . PHE E 1 32  ? 126.884 121.043 121.019 1.00 28.98  ? 67   PHE E O     1 
ATOM   3386  C CB    . PHE E 1 32  ? 124.677 123.377 121.513 1.00 28.98  ? 67   PHE E CB    1 
ATOM   3387  C CG    . PHE E 1 32  ? 125.658 123.521 122.611 1.00 28.98  ? 67   PHE E CG    1 
ATOM   3388  C CD1   . PHE E 1 32  ? 126.676 124.437 122.507 1.00 28.98  ? 67   PHE E CD1   1 
ATOM   3389  C CD2   . PHE E 1 32  ? 125.601 122.720 123.724 1.00 28.98  ? 67   PHE E CD2   1 
ATOM   3390  C CE1   . PHE E 1 32  ? 127.605 124.568 123.498 1.00 28.98  ? 67   PHE E CE1   1 
ATOM   3391  C CE2   . PHE E 1 32  ? 126.541 122.837 124.708 1.00 28.98  ? 67   PHE E CE2   1 
ATOM   3392  C CZ    . PHE E 1 32  ? 127.532 123.775 124.604 1.00 28.98  ? 67   PHE E CZ    1 
ATOM   3393  N N     . GLN E 1 33  ? 124.779 120.295 120.752 1.00 29.18  ? 68   GLN E N     1 
ATOM   3394  C CA    . GLN E 1 33  ? 125.141 118.930 121.107 1.00 29.18  ? 68   GLN E CA    1 
ATOM   3395  C C     . GLN E 1 33  ? 126.016 118.292 120.044 1.00 29.18  ? 68   GLN E C     1 
ATOM   3396  O O     . GLN E 1 33  ? 126.944 117.541 120.373 1.00 29.18  ? 68   GLN E O     1 
ATOM   3397  C CB    . GLN E 1 33  ? 123.880 118.110 121.330 1.00 29.18  ? 68   GLN E CB    1 
ATOM   3398  C CG    . GLN E 1 33  ? 124.121 116.670 121.652 1.00 29.18  ? 68   GLN E CG    1 
ATOM   3399  C CD    . GLN E 1 33  ? 122.853 115.940 121.984 1.00 29.18  ? 68   GLN E CD    1 
ATOM   3400  O OE1   . GLN E 1 33  ? 121.775 116.519 121.970 1.00 29.18  ? 68   GLN E OE1   1 
ATOM   3401  N NE2   . GLN E 1 33  ? 122.972 114.658 122.289 1.00 29.18  ? 68   GLN E NE2   1 
ATOM   3402  N N     . ARG E 1 34  ? 125.769 118.600 118.770 1.00 34.15  ? 69   ARG E N     1 
ATOM   3403  C CA    . ARG E 1 34  ? 126.659 118.090 117.733 1.00 34.15  ? 69   ARG E CA    1 
ATOM   3404  C C     . ARG E 1 34  ? 128.053 118.687 117.838 1.00 34.15  ? 69   ARG E C     1 
ATOM   3405  O O     . ARG E 1 34  ? 129.040 117.974 117.619 1.00 34.15  ? 69   ARG E O     1 
ATOM   3406  C CB    . ARG E 1 34  ? 126.079 118.343 116.353 1.00 34.15  ? 69   ARG E CB    1 
ATOM   3407  C CG    . ARG E 1 34  ? 124.940 117.423 116.014 1.00 34.15  ? 69   ARG E CG    1 
ATOM   3408  C CD    . ARG E 1 34  ? 124.686 117.419 114.524 1.00 34.15  ? 69   ARG E CD    1 
ATOM   3409  N NE    . ARG E 1 34  ? 124.195 118.700 114.048 1.00 34.15  ? 69   ARG E NE    1 
ATOM   3410  C CZ    . ARG E 1 34  ? 122.910 118.997 113.971 1.00 34.15  ? 69   ARG E CZ    1 
ATOM   3411  N NH1   . ARG E 1 34  ? 122.008 118.099 114.331 1.00 34.15  ? 69   ARG E NH1   1 
ATOM   3412  N NH2   . ARG E 1 34  ? 122.531 120.183 113.528 1.00 34.15  ? 69   ARG E NH2   1 
ATOM   3413  N N     . LEU E 1 35  ? 128.157 119.957 118.240 1.00 32.85  ? 70   LEU E N     1 
ATOM   3414  C CA    . LEU E 1 35  ? 129.472 120.558 118.447 1.00 32.85  ? 70   LEU E CA    1 
ATOM   3415  C C     . LEU E 1 35  ? 130.212 119.916 119.611 1.00 32.85  ? 70   LEU E C     1 
ATOM   3416  O O     . LEU E 1 35  ? 131.413 119.632 119.508 1.00 32.85  ? 70   LEU E O     1 
ATOM   3417  C CB    . LEU E 1 35  ? 129.338 122.055 118.684 1.00 32.85  ? 70   LEU E CB    1 
ATOM   3418  C CG    . LEU E 1 35  ? 130.665 122.778 118.875 1.00 32.85  ? 70   LEU E CG    1 
ATOM   3419  C CD1   . LEU E 1 35  ? 131.537 122.642 117.651 1.00 32.85  ? 70   LEU E CD1   1 
ATOM   3420  C CD2   . LEU E 1 35  ? 130.412 124.226 119.174 1.00 32.85  ? 70   LEU E CD2   1 
ATOM   3421  N N     . VAL E 1 36  ? 129.508 119.672 120.717 1.00 27.32  ? 71   VAL E N     1 
ATOM   3422  C CA    . VAL E 1 36  ? 130.133 119.063 121.889 1.00 27.32  ? 71   VAL E CA    1 
ATOM   3423  C C     . VAL E 1 36  ? 130.598 117.650 121.590 1.00 27.32  ? 71   VAL E C     1 
ATOM   3424  O O     . VAL E 1 36  ? 131.703 117.256 121.977 1.00 27.32  ? 71   VAL E O     1 
ATOM   3425  C CB    . VAL E 1 36  ? 129.156 119.108 123.067 1.00 27.32  ? 71   VAL E CB    1 
ATOM   3426  C CG1   . VAL E 1 36  ? 129.626 118.278 124.196 1.00 27.32  ? 71   VAL E CG1   1 
ATOM   3427  C CG2   . VAL E 1 36  ? 129.046 120.510 123.544 1.00 27.32  ? 71   VAL E CG2   1 
ATOM   3428  N N     . ARG E 1 37  ? 129.793 116.877 120.864 1.00 33.81  ? 72   ARG E N     1 
ATOM   3429  C CA    . ARG E 1 37  ? 130.209 115.517 120.547 1.00 33.81  ? 72   ARG E CA    1 
ATOM   3430  C C     . ARG E 1 37  ? 131.355 115.485 119.542 1.00 33.81  ? 72   ARG E C     1 
ATOM   3431  O O     . ARG E 1 37  ? 132.205 114.593 119.615 1.00 33.81  ? 72   ARG E O     1 
ATOM   3432  C CB    . ARG E 1 37  ? 129.012 114.714 120.060 1.00 33.81  ? 72   ARG E CB    1 
ATOM   3433  C CG    . ARG E 1 37  ? 127.988 114.464 121.162 1.00 33.81  ? 72   ARG E CG    1 
ATOM   3434  C CD    . ARG E 1 37  ? 126.850 113.588 120.691 1.00 33.81  ? 72   ARG E CD    1 
ATOM   3435  N NE    . ARG E 1 37  ? 127.340 112.264 120.340 1.00 33.81  ? 72   ARG E NE    1 
ATOM   3436  C CZ    . ARG E 1 37  ? 127.399 111.802 119.098 1.00 33.81  ? 72   ARG E CZ    1 
ATOM   3437  N NH1   . ARG E 1 37  ? 126.988 112.563 118.094 1.00 33.81  ? 72   ARG E NH1   1 
ATOM   3438  N NH2   . ARG E 1 37  ? 127.870 110.587 118.859 1.00 33.81  ? 72   ARG E NH2   1 
ATOM   3439  N N     . GLU E 1 38  ? 131.433 116.475 118.652 1.00 39.52  ? 73   GLU E N     1 
ATOM   3440  C CA    . GLU E 1 38  ? 132.607 116.632 117.795 1.00 39.52  ? 73   GLU E CA    1 
ATOM   3441  C C     . GLU E 1 38  ? 133.875 116.876 118.604 1.00 39.52  ? 73   GLU E C     1 
ATOM   3442  O O     . GLU E 1 38  ? 134.901 116.200 118.409 1.00 39.52  ? 73   GLU E O     1 
ATOM   3443  C CB    . GLU E 1 38  ? 132.383 117.804 116.860 1.00 39.52  ? 73   GLU E CB    1 
ATOM   3444  C CG    . GLU E 1 38  ? 133.539 118.106 115.969 1.00 39.52  ? 73   GLU E CG    1 
ATOM   3445  C CD    . GLU E 1 38  ? 133.341 119.414 115.242 1.00 39.52  ? 73   GLU E CD    1 
ATOM   3446  O OE1   . GLU E 1 38  ? 132.349 120.097 115.544 1.00 39.52  ? 73   GLU E OE1   1 
ATOM   3447  O OE2   . GLU E 1 38  ? 134.168 119.766 114.377 1.00 39.52  ? 73   GLU E OE2   1 
ATOM   3448  N N     . ILE E 1 39  ? 133.826 117.857 119.508 1.00 33.84  ? 74   ILE E N     1 
ATOM   3449  C CA    . ILE E 1 39  ? 135.019 118.233 120.264 1.00 33.84  ? 74   ILE E CA    1 
ATOM   3450  C C     . ILE E 1 39  ? 135.434 117.116 121.215 1.00 33.84  ? 74   ILE E C     1 
ATOM   3451  O O     . ILE E 1 39  ? 136.628 116.876 121.418 1.00 33.84  ? 74   ILE E O     1 
ATOM   3452  C CB    . ILE E 1 39  ? 134.788 119.572 120.987 1.00 33.84  ? 74   ILE E CB    1 
ATOM   3453  C CG1   . ILE E 1 39  ? 134.617 120.675 119.960 1.00 33.84  ? 74   ILE E CG1   1 
ATOM   3454  C CG2   . ILE E 1 39  ? 135.971 119.968 121.791 1.00 33.84  ? 74   ILE E CG2   1 
ATOM   3455  C CD1   . ILE E 1 39  ? 134.267 122.002 120.545 1.00 33.84  ? 74   ILE E CD1   1 
ATOM   3456  N N     . ALA E 1 40  ? 134.474 116.361 121.744 1.00 34.65  ? 75   ALA E N     1 
ATOM   3457  C CA    . ALA E 1 40  ? 134.830 115.187 122.528 1.00 34.65  ? 75   ALA E CA    1 
ATOM   3458  C C     . ALA E 1 40  ? 135.407 114.084 121.657 1.00 34.65  ? 75   ALA E C     1 
ATOM   3459  O O     . ALA E 1 40  ? 136.243 113.311 122.126 1.00 34.65  ? 75   ALA E O     1 
ATOM   3460  C CB    . ALA E 1 40  ? 133.620 114.671 123.288 1.00 34.65  ? 75   ALA E CB    1 
ATOM   3461  N N     . GLN E 1 41  ? 134.988 113.994 120.396 1.00 38.64  ? 76   GLN E N     1 
ATOM   3462  C CA    . GLN E 1 41  ? 135.591 113.019 119.497 1.00 38.64  ? 76   GLN E CA    1 
ATOM   3463  C C     . GLN E 1 41  ? 137.030 113.374 119.158 1.00 38.64  ? 76   GLN E C     1 
ATOM   3464  O O     . GLN E 1 41  ? 137.816 112.482 118.829 1.00 38.64  ? 76   GLN E O     1 
ATOM   3465  C CB    . GLN E 1 41  ? 134.738 112.895 118.230 1.00 38.64  ? 76   GLN E CB    1 
ATOM   3466  C CG    . GLN E 1 41  ? 135.134 111.806 117.259 1.00 38.64  ? 76   GLN E CG    1 
ATOM   3467  C CD    . GLN E 1 41  ? 134.178 111.703 116.099 1.00 38.64  ? 76   GLN E CD    1 
ATOM   3468  O OE1   . GLN E 1 41  ? 133.193 112.432 116.026 1.00 38.64  ? 76   GLN E OE1   1 
ATOM   3469  N NE2   . GLN E 1 41  ? 134.468 110.799 115.173 1.00 38.64  ? 76   GLN E NE2   1 
ATOM   3470  N N     . ASP E 1 42  ? 137.415 114.642 119.286 1.00 41.23  ? 77   ASP E N     1 
ATOM   3471  C CA    . ASP E 1 42  ? 138.829 114.955 119.085 1.00 41.23  ? 77   ASP E CA    1 
ATOM   3472  C C     . ASP E 1 42  ? 139.757 114.442 120.197 1.00 41.23  ? 77   ASP E C     1 
ATOM   3473  O O     . ASP E 1 42  ? 140.975 114.567 120.049 1.00 41.23  ? 77   ASP E O     1 
ATOM   3474  C CB    . ASP E 1 42  ? 139.016 116.464 118.928 1.00 41.23  ? 77   ASP E CB    1 
ATOM   3475  C CG    . ASP E 1 42  ? 138.396 116.997 117.653 1.00 41.23  ? 77   ASP E CG    1 
ATOM   3476  O OD1   . ASP E 1 42  ? 138.276 116.223 116.683 1.00 41.23  ? 77   ASP E OD1   1 
ATOM   3477  O OD2   . ASP E 1 42  ? 138.037 118.193 117.616 1.00 41.23  ? 77   ASP E OD2   1 
ATOM   3478  N N     . PHE E 1 43  ? 139.239 113.876 121.296 1.00 34.52  ? 78   PHE E N     1 
ATOM   3479  C CA    . PHE E 1 43  ? 140.081 113.319 122.355 1.00 34.52  ? 78   PHE E CA    1 
ATOM   3480  C C     . PHE E 1 43  ? 139.969 111.804 122.437 1.00 34.52  ? 78   PHE E C     1 
ATOM   3481  O O     . PHE E 1 43  ? 140.957 111.097 122.236 1.00 34.52  ? 78   PHE E O     1 
ATOM   3482  C CB    . PHE E 1 43  ? 139.734 113.886 123.743 1.00 34.52  ? 78   PHE E CB    1 
ATOM   3483  C CG    . PHE E 1 43  ? 139.879 115.357 123.859 1.00 34.52  ? 78   PHE E CG    1 
ATOM   3484  C CD1   . PHE E 1 43  ? 141.119 115.943 123.952 1.00 34.52  ? 78   PHE E CD1   1 
ATOM   3485  C CD2   . PHE E 1 43  ? 138.761 116.154 123.911 1.00 34.52  ? 78   PHE E CD2   1 
ATOM   3486  C CE1   . PHE E 1 43  ? 141.235 117.304 124.063 1.00 34.52  ? 78   PHE E CE1   1 
ATOM   3487  C CE2   . PHE E 1 43  ? 138.872 117.506 124.020 1.00 34.52  ? 78   PHE E CE2   1 
ATOM   3488  C CZ    . PHE E 1 43  ? 140.106 118.081 124.095 1.00 34.52  ? 78   PHE E CZ    1 
ATOM   3489  N N     . LYS E 1 44  ? 138.780 111.285 122.724 1.00 46.45  ? 79   LYS E N     1 
ATOM   3490  C CA    . LYS E 1 44  ? 138.586 109.867 122.996 1.00 46.45  ? 79   LYS E CA    1 
ATOM   3491  C C     . LYS E 1 44  ? 137.380 109.397 122.201 1.00 46.45  ? 79   LYS E C     1 
ATOM   3492  O O     . LYS E 1 44  ? 136.244 109.757 122.516 1.00 46.45  ? 79   LYS E O     1 
ATOM   3493  C CB    . LYS E 1 44  ? 138.398 109.619 124.487 1.00 46.45  ? 79   LYS E CB    1 
ATOM   3494  C CG    . LYS E 1 44  ? 138.134 108.177 124.823 1.00 46.45  ? 79   LYS E CG    1 
ATOM   3495  C CD    . LYS E 1 44  ? 139.328 107.317 124.477 1.00 46.45  ? 79   LYS E CD    1 
ATOM   3496  C CE    . LYS E 1 44  ? 139.123 105.885 124.936 1.00 46.45  ? 79   LYS E CE    1 
ATOM   3497  N NZ    . LYS E 1 44  ? 138.046 105.204 124.177 1.00 46.45  ? 79   LYS E NZ    1 
ATOM   3498  N N     . THR E 1 45  ? 137.625 108.552 121.208 1.00 64.44  ? 80   THR E N     1 
ATOM   3499  C CA    . THR E 1 45  ? 136.715 108.330 120.094 1.00 64.44  ? 80   THR E CA    1 
ATOM   3500  C C     . THR E 1 45  ? 135.532 107.433 120.424 1.00 64.44  ? 80   THR E C     1 
ATOM   3501  O O     . THR E 1 45  ? 134.853 106.983 119.497 1.00 64.44  ? 80   THR E O     1 
ATOM   3502  C CB    . THR E 1 45  ? 137.482 107.721 118.922 1.00 64.44  ? 80   THR E CB    1 
ATOM   3503  O OG1   . THR E 1 45  ? 137.997 106.443 119.313 1.00 64.44  ? 80   THR E OG1   1 
ATOM   3504  C CG2   . THR E 1 45  ? 138.642 108.612 118.523 1.00 64.44  ? 80   THR E CG2   1 
ATOM   3505  N N     . ASP E 1 46  ? 135.255 107.155 121.690 1.00 64.06  ? 81   ASP E N     1 
ATOM   3506  C CA    . ASP E 1 46  ? 134.230 106.189 122.034 1.00 64.06  ? 81   ASP E CA    1 
ATOM   3507  C C     . ASP E 1 46  ? 133.083 106.761 122.841 1.00 64.06  ? 81   ASP E C     1 
ATOM   3508  O O     . ASP E 1 46  ? 132.119 106.034 123.094 1.00 64.06  ? 81   ASP E O     1 
ATOM   3509  C CB    . ASP E 1 46  ? 134.842 105.038 122.836 1.00 64.06  ? 81   ASP E CB    1 
ATOM   3510  C CG    . ASP E 1 46  ? 135.833 104.240 122.036 1.00 64.06  ? 81   ASP E CG    1 
ATOM   3511  O OD1   . ASP E 1 46  ? 135.691 104.188 120.798 1.00 64.06  ? 81   ASP E OD1   1 
ATOM   3512  O OD2   . ASP E 1 46  ? 136.758 103.666 122.645 1.00 64.06  ? 81   ASP E OD2   1 
ATOM   3513  N N     . LEU E 1 47  ? 133.142 108.030 123.225 1.00 45.59  ? 82   LEU E N     1 
ATOM   3514  C CA    . LEU E 1 47  ? 132.489 108.473 124.446 1.00 45.59  ? 82   LEU E CA    1 
ATOM   3515  C C     . LEU E 1 47  ? 130.977 108.585 124.301 1.00 45.59  ? 82   LEU E C     1 
ATOM   3516  O O     . LEU E 1 47  ? 130.387 108.348 123.247 1.00 45.59  ? 82   LEU E O     1 
ATOM   3517  C CB    . LEU E 1 47  ? 133.060 109.808 124.888 1.00 45.59  ? 82   LEU E CB    1 
ATOM   3518  C CG    . LEU E 1 47  ? 134.487 109.715 125.380 1.00 45.59  ? 82   LEU E CG    1 
ATOM   3519  C CD1   . LEU E 1 47  ? 134.970 111.097 125.576 1.00 45.59  ? 82   LEU E CD1   1 
ATOM   3520  C CD2   . LEU E 1 47  ? 134.530 108.959 126.682 1.00 45.59  ? 82   LEU E CD2   1 
ATOM   3521  N N     . ARG E 1 48  ? 130.362 108.960 125.416 1.00 47.12  ? 83   ARG E N     1 
ATOM   3522  C CA    . ARG E 1 48  ? 128.926 109.015 125.609 1.00 47.12  ? 83   ARG E CA    1 
ATOM   3523  C C     . ARG E 1 48  ? 128.650 110.103 126.627 1.00 47.12  ? 83   ARG E C     1 
ATOM   3524  O O     . ARG E 1 48  ? 129.464 110.329 127.520 1.00 47.12  ? 83   ARG E O     1 
ATOM   3525  C CB    . ARG E 1 48  ? 128.381 107.698 126.152 1.00 47.12  ? 83   ARG E CB    1 
ATOM   3526  C CG    . ARG E 1 48  ? 128.363 106.508 125.227 1.00 47.12  ? 83   ARG E CG    1 
ATOM   3527  C CD    . ARG E 1 48  ? 127.918 105.348 126.055 1.00 47.12  ? 83   ARG E CD    1 
ATOM   3528  N NE    . ARG E 1 48  ? 126.654 105.690 126.681 1.00 47.12  ? 83   ARG E NE    1 
ATOM   3529  C CZ    . ARG E 1 48  ? 126.130 105.044 127.706 1.00 47.12  ? 83   ARG E CZ    1 
ATOM   3530  N NH1   . ARG E 1 48  ? 126.765 104.013 128.227 1.00 47.12  ? 83   ARG E NH1   1 
ATOM   3531  N NH2   . ARG E 1 48  ? 124.977 105.440 128.217 1.00 47.12  ? 83   ARG E NH2   1 
ATOM   3532  N N     . PHE E 1 49  ? 127.503 110.748 126.517 1.00 30.24  ? 84   PHE E N     1 
ATOM   3533  C CA    . PHE E 1 49  ? 127.148 111.838 127.405 1.00 30.24  ? 84   PHE E CA    1 
ATOM   3534  C C     . PHE E 1 49  ? 125.846 111.538 128.118 1.00 30.24  ? 84   PHE E C     1 
ATOM   3535  O O     . PHE E 1 49  ? 125.154 110.573 127.809 1.00 30.24  ? 84   PHE E O     1 
ATOM   3536  C CB    . PHE E 1 49  ? 127.017 113.140 126.634 1.00 30.24  ? 84   PHE E CB    1 
ATOM   3537  C CG    . PHE E 1 49  ? 128.320 113.704 126.196 1.00 30.24  ? 84   PHE E CG    1 
ATOM   3538  C CD1   . PHE E 1 49  ? 129.031 114.547 127.024 1.00 30.24  ? 84   PHE E CD1   1 
ATOM   3539  C CD2   . PHE E 1 49  ? 128.855 113.369 124.973 1.00 30.24  ? 84   PHE E CD2   1 
ATOM   3540  C CE1   . PHE E 1 49  ? 130.236 115.058 126.639 1.00 30.24  ? 84   PHE E CE1   1 
ATOM   3541  C CE2   . PHE E 1 49  ? 130.063 113.884 124.579 1.00 30.24  ? 84   PHE E CE2   1 
ATOM   3542  C CZ    . PHE E 1 49  ? 130.750 114.735 125.417 1.00 30.24  ? 84   PHE E CZ    1 
ATOM   3543  N N     . GLN E 1 50  ? 125.540 112.357 129.103 1.00 28.68  ? 85   GLN E N     1 
ATOM   3544  C CA    . GLN E 1 50  ? 124.186 112.478 129.598 1.00 28.68  ? 85   GLN E CA    1 
ATOM   3545  C C     . GLN E 1 50  ? 123.603 113.817 129.176 1.00 28.68  ? 85   GLN E C     1 
ATOM   3546  O O     . GLN E 1 50  ? 124.325 114.786 128.905 1.00 28.68  ? 85   GLN E O     1 
ATOM   3547  C CB    . GLN E 1 50  ? 124.130 112.347 131.113 1.00 28.68  ? 85   GLN E CB    1 
ATOM   3548  C CG    . GLN E 1 50  ? 124.315 110.961 131.639 1.00 28.68  ? 85   GLN E CG    1 
ATOM   3549  C CD    . GLN E 1 50  ? 124.206 110.928 133.141 1.00 28.68  ? 85   GLN E CD    1 
ATOM   3550  O OE1   . GLN E 1 50  ? 124.078 111.968 133.784 1.00 28.68  ? 85   GLN E OE1   1 
ATOM   3551  N NE2   . GLN E 1 50  ? 124.246 109.735 133.712 1.00 28.68  ? 85   GLN E NE2   1 
ATOM   3552  N N     . SER E 1 51  ? 122.270 113.850 129.123 1.00 31.20  ? 86   SER E N     1 
ATOM   3553  C CA    . SER E 1 51  ? 121.556 115.049 128.707 1.00 31.20  ? 86   SER E CA    1 
ATOM   3554  C C     . SER E 1 51  ? 121.817 116.198 129.662 1.00 31.20  ? 86   SER E C     1 
ATOM   3555  O O     . SER E 1 51  ? 121.938 117.355 129.241 1.00 31.20  ? 86   SER E O     1 
ATOM   3556  C CB    . SER E 1 51  ? 120.065 114.765 128.638 1.00 31.20  ? 86   SER E CB    1 
ATOM   3557  O OG    . SER E 1 51  ? 119.557 114.538 129.939 1.00 31.20  ? 86   SER E OG    1 
ATOM   3558  N N     . SER E 1 52  ? 121.949 115.889 130.950 1.00 27.60  ? 87   SER E N     1 
ATOM   3559  C CA    . SER E 1 52  ? 122.362 116.896 131.908 1.00 27.60  ? 87   SER E CA    1 
ATOM   3560  C C     . SER E 1 52  ? 123.800 117.341 131.692 1.00 27.60  ? 87   SER E C     1 
ATOM   3561  O O     . SER E 1 52  ? 124.119 118.483 132.010 1.00 27.60  ? 87   SER E O     1 
ATOM   3562  C CB    . SER E 1 52  ? 122.159 116.382 133.328 1.00 27.60  ? 87   SER E CB    1 
ATOM   3563  O OG    . SER E 1 52  ? 122.940 115.238 133.567 1.00 27.60  ? 87   SER E OG    1 
ATOM   3564  N N     . ALA E 1 53  ? 124.657 116.519 131.085 1.00 25.67  ? 88   ALA E N     1 
ATOM   3565  C CA    . ALA E 1 53  ? 126.004 117.010 130.819 1.00 25.67  ? 88   ALA E CA    1 
ATOM   3566  C C     . ALA E 1 53  ? 126.036 117.950 129.627 1.00 25.67  ? 88   ALA E C     1 
ATOM   3567  O O     . ALA E 1 53  ? 126.773 118.946 129.637 1.00 25.67  ? 88   ALA E O     1 
ATOM   3568  C CB    . ALA E 1 53  ? 126.961 115.855 130.595 1.00 25.67  ? 88   ALA E CB    1 
ATOM   3569  N N     . VAL E 1 54  ? 125.233 117.668 128.603 1.00 27.30  ? 89   VAL E N     1 
ATOM   3570  C CA    . VAL E 1 54  ? 125.138 118.601 127.481 1.00 27.30  ? 89   VAL E CA    1 
ATOM   3571  C C     . VAL E 1 54  ? 124.498 119.916 127.918 1.00 27.30  ? 89   VAL E C     1 
ATOM   3572  O O     . VAL E 1 54  ? 124.977 120.998 127.557 1.00 27.30  ? 89   VAL E O     1 
ATOM   3573  C CB    . VAL E 1 54  ? 124.385 117.946 126.315 1.00 27.30  ? 89   VAL E CB    1 
ATOM   3574  C CG1   . VAL E 1 54  ? 124.030 118.956 125.270 1.00 27.30  ? 89   VAL E CG1   1 
ATOM   3575  C CG2   . VAL E 1 54  ? 125.265 116.907 125.682 1.00 27.30  ? 89   VAL E CG2   1 
ATOM   3576  N N     . MET E 1 55  ? 123.460 119.859 128.754 1.00 30.74  ? 90   MET E N     1 
ATOM   3577  C CA    . MET E 1 55  ? 122.894 121.100 129.272 1.00 30.74  ? 90   MET E CA    1 
ATOM   3578  C C     . MET E 1 55  ? 123.819 121.793 130.265 1.00 30.74  ? 90   MET E C     1 
ATOM   3579  O O     . MET E 1 55  ? 123.754 123.021 130.386 1.00 30.74  ? 90   MET E O     1 
ATOM   3580  C CB    . MET E 1 55  ? 121.537 120.833 129.901 1.00 30.74  ? 90   MET E CB    1 
ATOM   3581  C CG    . MET E 1 55  ? 120.515 120.398 128.885 1.00 30.74  ? 90   MET E CG    1 
ATOM   3582  S SD    . MET E 1 55  ? 118.910 119.973 129.582 1.00 30.74  ? 90   MET E SD    1 
ATOM   3583  C CE    . MET E 1 55  ? 118.288 121.587 130.045 1.00 30.74  ? 90   MET E CE    1 
ATOM   3584  N N     . ALA E 1 56  ? 124.716 121.056 130.921 1.00 21.37  ? 91   ALA E N     1 
ATOM   3585  C CA    . ALA E 1 56  ? 125.724 121.686 131.762 1.00 21.37  ? 91   ALA E CA    1 
ATOM   3586  C C     . ALA E 1 56  ? 126.685 122.507 130.927 1.00 21.37  ? 91   ALA E C     1 
ATOM   3587  O O     . ALA E 1 56  ? 126.958 123.671 131.241 1.00 21.37  ? 91   ALA E O     1 
ATOM   3588  C CB    . ALA E 1 56  ? 126.487 120.637 132.556 1.00 21.37  ? 91   ALA E CB    1 
ATOM   3589  N N     . LEU E 1 57  ? 127.193 121.917 129.847 1.00 22.84  ? 92   LEU E N     1 
ATOM   3590  C CA    . LEU E 1 57  ? 128.069 122.667 128.957 1.00 22.84  ? 92   LEU E CA    1 
ATOM   3591  C C     . LEU E 1 57  ? 127.356 123.823 128.279 1.00 22.84  ? 92   LEU E C     1 
ATOM   3592  O O     . LEU E 1 57  ? 127.982 124.853 128.020 1.00 22.84  ? 92   LEU E O     1 
ATOM   3593  C CB    . LEU E 1 57  ? 128.674 121.755 127.908 1.00 22.84  ? 92   LEU E CB    1 
ATOM   3594  C CG    . LEU E 1 57  ? 129.791 120.924 128.481 1.00 22.84  ? 92   LEU E CG    1 
ATOM   3595  C CD1   . LEU E 1 57  ? 130.274 119.937 127.482 1.00 22.84  ? 92   LEU E CD1   1 
ATOM   3596  C CD2   . LEU E 1 57  ? 130.881 121.866 128.800 1.00 22.84  ? 92   LEU E CD2   1 
ATOM   3597  N N     . GLN E 1 58  ? 126.056 123.701 128.026 1.00 28.61  ? 93   GLN E N     1 
ATOM   3598  C CA    . GLN E 1 58  ? 125.366 124.806 127.380 1.00 28.61  ? 93   GLN E CA    1 
ATOM   3599  C C     . GLN E 1 58  ? 125.161 125.960 128.339 1.00 28.61  ? 93   GLN E C     1 
ATOM   3600  O O     . GLN E 1 58  ? 125.338 127.117 127.946 1.00 28.61  ? 93   GLN E O     1 
ATOM   3601  C CB    . GLN E 1 58  ? 124.043 124.346 126.796 1.00 28.61  ? 93   GLN E CB    1 
ATOM   3602  C CG    . GLN E 1 58  ? 123.444 125.362 125.878 1.00 28.61  ? 93   GLN E CG    1 
ATOM   3603  C CD    . GLN E 1 58  ? 122.232 124.837 125.175 1.00 28.61  ? 93   GLN E CD    1 
ATOM   3604  O OE1   . GLN E 1 58  ? 121.778 123.731 125.447 1.00 28.61  ? 93   GLN E OE1   1 
ATOM   3605  N NE2   . GLN E 1 58  ? 121.708 125.613 124.241 1.00 28.61  ? 93   GLN E NE2   1 
ATOM   3606  N N     . GLU E 1 59  ? 124.819 125.669 129.601 1.00 26.67  ? 94   GLU E N     1 
ATOM   3607  C CA    . GLU E 1 59  ? 124.749 126.726 130.608 1.00 26.67  ? 94   GLU E CA    1 
ATOM   3608  C C     . GLU E 1 59  ? 126.087 127.417 130.780 1.00 26.67  ? 94   GLU E C     1 
ATOM   3609  O O     . GLU E 1 59  ? 126.152 128.653 130.809 1.00 26.67  ? 94   GLU E O     1 
ATOM   3610  C CB    . GLU E 1 59  ? 124.310 126.173 131.954 1.00 26.67  ? 94   GLU E CB    1 
ATOM   3611  C CG    . GLU E 1 59  ? 122.882 125.739 132.059 1.00 26.67  ? 94   GLU E CG    1 
ATOM   3612  C CD    . GLU E 1 59  ? 121.926 126.894 132.056 1.00 26.67  ? 94   GLU E CD    1 
ATOM   3613  O OE1   . GLU E 1 59  ? 122.338 128.013 132.424 1.00 26.67  ? 94   GLU E OE1   1 
ATOM   3614  O OE2   . GLU E 1 59  ? 120.741 126.671 131.743 1.00 26.67  ? 94   GLU E OE2   1 
ATOM   3615  N N     . ALA E 1 60  ? 127.168 126.637 130.840 1.00 27.49  ? 95   ALA E N     1 
ATOM   3616  C CA    . ALA E 1 60  ? 128.485 127.213 131.083 1.00 27.49  ? 95   ALA E CA    1 
ATOM   3617  C C     . ALA E 1 60  ? 128.941 128.078 129.920 1.00 27.49  ? 95   ALA E C     1 
ATOM   3618  O O     . ALA E 1 60  ? 129.397 129.208 130.125 1.00 27.49  ? 95   ALA E O     1 
ATOM   3619  C CB    . ALA E 1 60  ? 129.499 126.112 131.346 1.00 27.49  ? 95   ALA E CB    1 
ATOM   3620  N N     . SER E 1 61  ? 128.778 127.591 128.690 1.00 30.48  ? 96   SER E N     1 
ATOM   3621  C CA    . SER E 1 61  ? 129.251 128.357 127.550 1.00 30.48  ? 96   SER E CA    1 
ATOM   3622  C C     . SER E 1 61  ? 128.383 129.569 127.269 1.00 30.48  ? 96   SER E C     1 
ATOM   3623  O O     . SER E 1 61  ? 128.909 130.605 126.850 1.00 30.48  ? 96   SER E O     1 
ATOM   3624  C CB    . SER E 1 61  ? 129.298 127.501 126.305 1.00 30.48  ? 96   SER E CB    1 
ATOM   3625  O OG    . SER E 1 61  ? 127.980 127.265 125.880 1.00 30.48  ? 96   SER E OG    1 
ATOM   3626  N N     . GLU E 1 62  ? 127.076 129.495 127.515 1.00 32.75  ? 97   GLU E N     1 
ATOM   3627  C CA    . GLU E 1 62  ? 126.275 130.680 127.264 1.00 32.75  ? 97   GLU E CA    1 
ATOM   3628  C C     . GLU E 1 62  ? 126.523 131.749 128.312 1.00 32.75  ? 97   GLU E C     1 
ATOM   3629  O O     . GLU E 1 62  ? 126.610 132.930 127.967 1.00 32.75  ? 97   GLU E O     1 
ATOM   3630  C CB    . GLU E 1 62  ? 124.800 130.331 127.169 1.00 32.75  ? 97   GLU E CB    1 
ATOM   3631  C CG    . GLU E 1 62  ? 124.494 129.549 125.912 1.00 32.75  ? 97   GLU E CG    1 
ATOM   3632  C CD    . GLU E 1 62  ? 123.032 129.258 125.760 1.00 32.75  ? 97   GLU E CD    1 
ATOM   3633  O OE1   . GLU E 1 62  ? 122.275 129.583 126.690 1.00 32.75  ? 97   GLU E OE1   1 
ATOM   3634  O OE2   . GLU E 1 62  ? 122.632 128.709 124.714 1.00 32.75  ? 97   GLU E OE2   1 
ATOM   3635  N N     . ALA E 1 63  ? 126.713 131.369 129.579 1.00 29.54  ? 98   ALA E N     1 
ATOM   3636  C CA    . ALA E 1 63  ? 127.014 132.402 130.563 1.00 29.54  ? 98   ALA E CA    1 
ATOM   3637  C C     . ALA E 1 63  ? 128.414 132.974 130.379 1.00 29.54  ? 98   ALA E C     1 
ATOM   3638  O O     . ALA E 1 63  ? 128.627 134.175 130.613 1.00 29.54  ? 98   ALA E O     1 
ATOM   3639  C CB    . ALA E 1 63  ? 126.845 131.868 131.970 1.00 29.54  ? 98   ALA E CB    1 
ATOM   3640  N N     . TYR E 1 64  ? 129.357 132.163 129.888 1.00 36.54  ? 99   TYR E N     1 
ATOM   3641  C CA    . TYR E 1 64  ? 130.681 132.690 129.580 1.00 36.54  ? 99   TYR E CA    1 
ATOM   3642  C C     . TYR E 1 64  ? 130.651 133.674 128.424 1.00 36.54  ? 99   TYR E C     1 
ATOM   3643  O O     . TYR E 1 64  ? 131.264 134.747 128.511 1.00 36.54  ? 99   TYR E O     1 
ATOM   3644  C CB    . TYR E 1 64  ? 131.641 131.559 129.281 1.00 36.54  ? 99   TYR E CB    1 
ATOM   3645  C CG    . TYR E 1 64  ? 132.947 132.024 128.726 1.00 36.54  ? 99   TYR E CG    1 
ATOM   3646  C CD1   . TYR E 1 64  ? 133.824 132.752 129.499 1.00 36.54  ? 99   TYR E CD1   1 
ATOM   3647  C CD2   . TYR E 1 64  ? 133.316 131.706 127.438 1.00 36.54  ? 99   TYR E CD2   1 
ATOM   3648  C CE1   . TYR E 1 64  ? 135.026 133.171 128.995 1.00 36.54  ? 99   TYR E CE1   1 
ATOM   3649  C CE2   . TYR E 1 64  ? 134.515 132.103 126.926 1.00 36.54  ? 99   TYR E CE2   1 
ATOM   3650  C CZ    . TYR E 1 64  ? 135.360 132.836 127.710 1.00 36.54  ? 99   TYR E CZ    1 
ATOM   3651  O OH    . TYR E 1 64  ? 136.563 133.238 127.185 1.00 36.54  ? 99   TYR E OH    1 
ATOM   3652  N N     . LEU E 1 65  ? 129.937 133.349 127.345 1.00 62.13  ? 100  LEU E N     1 
ATOM   3653  C CA    . LEU E 1 65  ? 129.874 134.290 126.235 1.00 62.13  ? 100  LEU E CA    1 
ATOM   3654  C C     . LEU E 1 65  ? 129.121 135.554 126.589 1.00 62.13  ? 100  LEU E C     1 
ATOM   3655  O O     . LEU E 1 65  ? 129.466 136.620 126.084 1.00 62.13  ? 100  LEU E O     1 
ATOM   3656  C CB    . LEU E 1 65  ? 129.255 133.641 125.016 1.00 62.13  ? 100  LEU E CB    1 
ATOM   3657  C CG    . LEU E 1 65  ? 130.200 132.660 124.361 1.00 62.13  ? 100  LEU E CG    1 
ATOM   3658  C CD1   . LEU E 1 65  ? 129.510 131.995 123.208 1.00 62.13  ? 100  LEU E CD1   1 
ATOM   3659  C CD2   . LEU E 1 65  ? 131.411 133.397 123.899 1.00 62.13  ? 100  LEU E CD2   1 
ATOM   3660  N N     . VAL E 1 66  ? 128.125 135.469 127.465 1.00 35.29  ? 101  VAL E N     1 
ATOM   3661  C CA    . VAL E 1 66  ? 127.425 136.670 127.904 1.00 35.29  ? 101  VAL E CA    1 
ATOM   3662  C C     . VAL E 1 66  ? 128.360 137.600 128.673 1.00 35.29  ? 101  VAL E C     1 
ATOM   3663  O O     . VAL E 1 66  ? 128.396 138.817 128.421 1.00 35.29  ? 101  VAL E O     1 
ATOM   3664  C CB    . VAL E 1 66  ? 126.197 136.276 128.727 1.00 35.29  ? 101  VAL E CB    1 
ATOM   3665  C CG1   . VAL E 1 66  ? 125.688 137.436 129.474 1.00 35.29  ? 101  VAL E CG1   1 
ATOM   3666  C CG2   . VAL E 1 66  ? 125.132 135.831 127.807 1.00 35.29  ? 101  VAL E CG2   1 
ATOM   3667  N N     . ALA E 1 67  ? 129.164 137.045 129.589 1.00 36.92  ? 102  ALA E N     1 
ATOM   3668  C CA    . ALA E 1 67  ? 130.121 137.882 130.316 1.00 36.92  ? 102  ALA E CA    1 
ATOM   3669  C C     . ALA E 1 67  ? 131.179 138.471 129.387 1.00 36.92  ? 102  ALA E C     1 
ATOM   3670  O O     . ALA E 1 67  ? 131.571 139.642 129.538 1.00 36.92  ? 102  ALA E O     1 
ATOM   3671  C CB    . ALA E 1 67  ? 130.782 137.084 131.431 1.00 36.92  ? 102  ALA E CB    1 
ATOM   3672  N N     . LEU E 1 68  ? 131.619 137.692 128.394 1.00 62.13  ? 103  LEU E N     1 
ATOM   3673  C CA    . LEU E 1 68  ? 132.602 138.197 127.443 1.00 62.13  ? 103  LEU E CA    1 
ATOM   3674  C C     . LEU E 1 68  ? 132.041 139.329 126.598 1.00 62.13  ? 103  LEU E C     1 
ATOM   3675  O O     . LEU E 1 68  ? 132.736 140.314 126.334 1.00 62.13  ? 103  LEU E O     1 
ATOM   3676  C CB    . LEU E 1 68  ? 133.088 137.075 126.543 1.00 62.13  ? 103  LEU E CB    1 
ATOM   3677  C CG    . LEU E 1 68  ? 134.152 137.459 125.533 1.00 62.13  ? 103  LEU E CG    1 
ATOM   3678  C CD1   . LEU E 1 68  ? 135.333 137.888 126.314 1.00 62.13  ? 103  LEU E CD1   1 
ATOM   3679  C CD2   . LEU E 1 68  ? 134.504 136.320 124.618 1.00 62.13  ? 103  LEU E CD2   1 
ATOM   3680  N N     . PHE E 1 69  ? 130.782 139.222 126.179 1.00 35.09  ? 104  PHE E N     1 
ATOM   3681  C CA    . PHE E 1 69  ? 130.201 140.290 125.376 1.00 35.09  ? 104  PHE E CA    1 
ATOM   3682  C C     . PHE E 1 69  ? 129.925 141.540 126.190 1.00 35.09  ? 104  PHE E C     1 
ATOM   3683  O O     . PHE E 1 69  ? 129.990 142.644 125.638 1.00 35.09  ? 104  PHE E O     1 
ATOM   3684  C CB    . PHE E 1 69  ? 128.930 139.831 124.692 1.00 35.09  ? 104  PHE E CB    1 
ATOM   3685  C CG    . PHE E 1 69  ? 129.155 139.179 123.373 1.00 35.09  ? 104  PHE E CG    1 
ATOM   3686  C CD1   . PHE E 1 69  ? 129.312 139.944 122.255 1.00 35.09  ? 104  PHE E CD1   1 
ATOM   3687  C CD2   . PHE E 1 69  ? 129.173 137.818 123.237 1.00 35.09  ? 104  PHE E CD2   1 
ATOM   3688  C CE1   . PHE E 1 69  ? 129.490 139.362 121.036 1.00 35.09  ? 104  PHE E CE1   1 
ATOM   3689  C CE2   . PHE E 1 69  ? 129.362 137.235 122.024 1.00 35.09  ? 104  PHE E CE2   1 
ATOM   3690  C CZ    . PHE E 1 69  ? 129.519 138.008 120.927 1.00 35.09  ? 104  PHE E CZ    1 
ATOM   3691  N N     . GLU E 1 70  ? 129.655 141.410 127.494 1.00 37.09  ? 105  GLU E N     1 
ATOM   3692  C CA    . GLU E 1 70  ? 129.605 142.607 128.337 1.00 37.09  ? 105  GLU E CA    1 
ATOM   3693  C C     . GLU E 1 70  ? 130.948 143.330 128.367 1.00 37.09  ? 105  GLU E C     1 
ATOM   3694  O O     . GLU E 1 70  ? 131.009 144.556 128.185 1.00 37.09  ? 105  GLU E O     1 
ATOM   3695  C CB    . GLU E 1 70  ? 129.189 142.271 129.761 1.00 37.09  ? 105  GLU E CB    1 
ATOM   3696  C CG    . GLU E 1 70  ? 127.738 141.938 129.930 1.00 37.09  ? 105  GLU E CG    1 
ATOM   3697  C CD    . GLU E 1 70  ? 127.381 141.652 131.375 1.00 37.09  ? 105  GLU E CD    1 
ATOM   3698  O OE1   . GLU E 1 70  ? 128.304 141.613 132.213 1.00 37.09  ? 105  GLU E OE1   1 
ATOM   3699  O OE2   . GLU E 1 70  ? 126.182 141.465 131.674 1.00 37.09  ? 105  GLU E OE2   1 
ATOM   3700  N N     . ASP E 1 71  ? 132.041 142.589 128.588 1.00 34.41  ? 106  ASP E N     1 
ATOM   3701  C CA    . ASP E 1 71  ? 133.331 143.279 128.665 1.00 34.41  ? 106  ASP E CA    1 
ATOM   3702  C C     . ASP E 1 71  ? 133.785 143.793 127.303 1.00 34.41  ? 106  ASP E C     1 
ATOM   3703  O O     . ASP E 1 71  ? 134.490 144.810 127.221 1.00 34.41  ? 106  ASP E O     1 
ATOM   3704  C CB    . ASP E 1 71  ? 134.389 142.377 129.271 1.00 34.41  ? 106  ASP E CB    1 
ATOM   3705  C CG    . ASP E 1 71  ? 134.077 142.021 130.695 1.00 34.41  ? 106  ASP E CG    1 
ATOM   3706  O OD1   . ASP E 1 71  ? 133.298 142.759 131.324 1.00 34.41  ? 106  ASP E OD1   1 
ATOM   3707  O OD2   . ASP E 1 71  ? 134.622 141.025 131.201 1.00 34.41  ? 106  ASP E OD2   1 
ATOM   3708  N N     . THR E 1 72  ? 133.354 143.135 126.230 1.00 27.58  ? 107  THR E N     1 
ATOM   3709  C CA    . THR E 1 72  ? 133.610 143.646 124.894 1.00 27.58  ? 107  THR E CA    1 
ATOM   3710  C C     . THR E 1 72  ? 132.868 144.945 124.656 1.00 27.58  ? 107  THR E C     1 
ATOM   3711  O O     . THR E 1 72  ? 133.397 145.862 124.020 1.00 27.58  ? 107  THR E O     1 
ATOM   3712  C CB    . THR E 1 72  ? 133.200 142.601 123.875 1.00 27.58  ? 107  THR E CB    1 
ATOM   3713  O OG1   . THR E 1 72  ? 133.915 141.397 124.136 1.00 27.58  ? 107  THR E OG1   1 
ATOM   3714  C CG2   . THR E 1 72  ? 133.524 143.049 122.494 1.00 27.58  ? 107  THR E CG2   1 
ATOM   3715  N N     . ASN E 1 73  ? 131.659 145.059 125.198 1.00 31.73  ? 108  ASN E N     1 
ATOM   3716  C CA    . ASN E 1 73  ? 130.924 146.298 125.031 1.00 31.73  ? 108  ASN E CA    1 
ATOM   3717  C C     . ASN E 1 73  ? 131.554 147.428 125.821 1.00 31.73  ? 108  ASN E C     1 
ATOM   3718  O O     . ASN E 1 73  ? 131.521 148.576 125.374 1.00 31.73  ? 108  ASN E O     1 
ATOM   3719  C CB    . ASN E 1 73  ? 129.486 146.121 125.456 1.00 31.73  ? 108  ASN E CB    1 
ATOM   3720  C CG    . ASN E 1 73  ? 128.603 147.135 124.847 1.00 31.73  ? 108  ASN E CG    1 
ATOM   3721  O OD1   . ASN E 1 73  ? 129.037 147.913 124.007 1.00 31.73  ? 108  ASN E OD1   1 
ATOM   3722  N ND2   . ASN E 1 73  ? 127.354 147.159 125.268 1.00 31.73  ? 108  ASN E ND2   1 
ATOM   3723  N N     . LEU E 1 74  ? 132.147 147.123 126.979 1.00 23.40  ? 109  LEU E N     1 
ATOM   3724  C CA    . LEU E 1 74  ? 132.871 148.161 127.715 1.00 23.40  ? 109  LEU E CA    1 
ATOM   3725  C C     . LEU E 1 74  ? 134.094 148.647 126.951 1.00 23.40  ? 109  LEU E C     1 
ATOM   3726  O O     . LEU E 1 74  ? 134.340 149.856 126.875 1.00 23.40  ? 109  LEU E O     1 
ATOM   3727  C CB    . LEU E 1 74  ? 133.289 147.664 129.088 1.00 23.40  ? 109  LEU E CB    1 
ATOM   3728  C CG    . LEU E 1 74  ? 132.127 147.434 130.030 1.00 23.40  ? 109  LEU E CG    1 
ATOM   3729  C CD1   . LEU E 1 74  ? 132.643 146.786 131.286 1.00 23.40  ? 109  LEU E CD1   1 
ATOM   3730  C CD2   . LEU E 1 74  ? 131.450 148.742 130.334 1.00 23.40  ? 109  LEU E CD2   1 
ATOM   3731  N N     . ALA E 1 75  ? 134.867 147.725 126.376 1.00 24.91  ? 110  ALA E N     1 
ATOM   3732  C CA    . ALA E 1 75  ? 136.033 148.147 125.603 1.00 24.91  ? 110  ALA E CA    1 
ATOM   3733  C C     . ALA E 1 75  ? 135.638 148.932 124.352 1.00 24.91  ? 110  ALA E C     1 
ATOM   3734  O O     . ALA E 1 75  ? 136.297 149.921 124.001 1.00 24.91  ? 110  ALA E O     1 
ATOM   3735  C CB    . ALA E 1 75  ? 136.888 146.936 125.245 1.00 24.91  ? 110  ALA E CB    1 
ATOM   3736  N N     . ALA E 1 76  ? 134.537 148.553 123.709 1.00 25.83  ? 111  ALA E N     1 
ATOM   3737  C CA    . ALA E 1 76  ? 134.088 149.252 122.515 1.00 25.83  ? 111  ALA E CA    1 
ATOM   3738  C C     . ALA E 1 76  ? 133.434 150.588 122.810 1.00 25.83  ? 111  ALA E C     1 
ATOM   3739  O O     . ALA E 1 76  ? 133.425 151.455 121.938 1.00 25.83  ? 111  ALA E O     1 
ATOM   3740  C CB    . ALA E 1 76  ? 133.104 148.393 121.736 1.00 25.83  ? 111  ALA E CB    1 
ATOM   3741  N N     . ILE E 1 77  ? 132.851 150.769 123.989 1.00 25.01  ? 112  ILE E N     1 
ATOM   3742  C CA    . ILE E 1 77  ? 132.444 152.108 124.390 1.00 25.01  ? 112  ILE E CA    1 
ATOM   3743  C C     . ILE E 1 77  ? 133.666 152.969 124.646 1.00 25.01  ? 112  ILE E C     1 
ATOM   3744  O O     . ILE E 1 77  ? 133.736 154.122 124.208 1.00 25.01  ? 112  ILE E O     1 
ATOM   3745  C CB    . ILE E 1 77  ? 131.531 152.050 125.623 1.00 25.01  ? 112  ILE E CB    1 
ATOM   3746  C CG1   . ILE E 1 77  ? 130.136 151.615 125.232 1.00 25.01  ? 112  ILE E CG1   1 
ATOM   3747  C CG2   . ILE E 1 77  ? 131.467 153.374 126.340 1.00 25.01  ? 112  ILE E CG2   1 
ATOM   3748  C CD1   . ILE E 1 77  ? 129.249 151.430 126.404 1.00 25.01  ? 112  ILE E CD1   1 
ATOM   3749  N N     . HIS E 1 78  ? 134.665 152.401 125.327 1.00 24.87  ? 113  HIS E N     1 
ATOM   3750  C CA    . HIS E 1 78  ? 135.868 153.148 125.677 1.00 24.87  ? 113  HIS E CA    1 
ATOM   3751  C C     . HIS E 1 78  ? 136.666 153.588 124.458 1.00 24.87  ? 113  HIS E C     1 
ATOM   3752  O O     . HIS E 1 78  ? 137.316 154.636 124.492 1.00 24.87  ? 113  HIS E O     1 
ATOM   3753  C CB    . HIS E 1 78  ? 136.742 152.310 126.597 1.00 24.87  ? 113  HIS E CB    1 
ATOM   3754  C CG    . HIS E 1 78  ? 138.079 152.910 126.842 1.00 24.87  ? 113  HIS E CG    1 
ATOM   3755  N ND1   . HIS E 1 78  ? 138.251 154.046 127.594 1.00 24.87  ? 113  HIS E ND1   1 
ATOM   3756  C CD2   . HIS E 1 78  ? 139.306 152.548 126.411 1.00 24.87  ? 113  HIS E CD2   1 
ATOM   3757  C CE1   . HIS E 1 78  ? 139.531 154.359 127.619 1.00 24.87  ? 113  HIS E CE1   1 
ATOM   3758  N NE2   . HIS E 1 78  ? 140.193 153.463 126.912 1.00 24.87  ? 113  HIS E NE2   1 
ATOM   3759  N N     . ALA E 1 79  ? 136.580 152.866 123.353 1.00 26.65  ? 114  ALA E N     1 
ATOM   3760  C CA    . ALA E 1 79  ? 137.242 153.355 122.150 1.00 26.65  ? 114  ALA E CA    1 
ATOM   3761  C C     . ALA E 1 79  ? 136.418 154.386 121.372 1.00 26.65  ? 114  ALA E C     1 
ATOM   3762  O O     . ALA E 1 79  ? 136.687 154.556 120.178 1.00 26.65  ? 114  ALA E O     1 
ATOM   3763  C CB    . ALA E 1 79  ? 137.599 152.192 121.230 1.00 26.65  ? 114  ALA E CB    1 
ATOM   3764  N N     . LYS E 1 80  ? 135.438 155.038 122.015 1.00 26.39  ? 115  LYS E N     1 
ATOM   3765  C CA    . LYS E 1 80  ? 134.532 156.032 121.418 1.00 26.39  ? 115  LYS E CA    1 
ATOM   3766  C C     . LYS E 1 80  ? 133.719 155.472 120.256 1.00 26.39  ? 115  LYS E C     1 
ATOM   3767  O O     . LYS E 1 80  ? 133.352 156.202 119.339 1.00 26.39  ? 115  LYS E O     1 
ATOM   3768  C CB    . LYS E 1 80  ? 135.274 157.297 120.978 1.00 26.39  ? 115  LYS E CB    1 
ATOM   3769  C CG    . LYS E 1 80  ? 135.782 158.164 122.098 1.00 26.39  ? 115  LYS E CG    1 
ATOM   3770  C CD    . LYS E 1 80  ? 134.620 158.848 122.785 1.00 26.39  ? 115  LYS E CD    1 
ATOM   3771  C CE    . LYS E 1 80  ? 135.095 159.807 123.860 1.00 26.39  ? 115  LYS E CE    1 
ATOM   3772  N NZ    . LYS E 1 80  ? 135.815 160.974 123.279 1.00 26.39  ? 115  LYS E NZ    1 
ATOM   3773  N N     . ARG E 1 81  ? 133.415 154.187 120.287 1.00 33.01  ? 116  ARG E N     1 
ATOM   3774  C CA    . ARG E 1 81  ? 132.611 153.537 119.271 1.00 33.01  ? 116  ARG E CA    1 
ATOM   3775  C C     . ARG E 1 81  ? 131.305 153.047 119.867 1.00 33.01  ? 116  ARG E C     1 
ATOM   3776  O O     . ARG E 1 81  ? 131.011 153.240 121.042 1.00 33.01  ? 116  ARG E O     1 
ATOM   3777  C CB    . ARG E 1 81  ? 133.363 152.372 118.632 1.00 33.01  ? 116  ARG E CB    1 
ATOM   3778  C CG    . ARG E 1 81  ? 134.351 152.812 117.598 1.00 33.01  ? 116  ARG E CG    1 
ATOM   3779  C CD    . ARG E 1 81  ? 134.992 151.652 116.895 1.00 33.01  ? 116  ARG E CD    1 
ATOM   3780  N NE    . ARG E 1 81  ? 136.022 151.017 117.696 1.00 33.01  ? 116  ARG E NE    1 
ATOM   3781  C CZ    . ARG E 1 81  ? 135.937 149.785 118.167 1.00 33.01  ? 116  ARG E CZ    1 
ATOM   3782  N NH1   . ARG E 1 81  ? 134.867 149.058 117.909 1.00 33.01  ? 116  ARG E NH1   1 
ATOM   3783  N NH2   . ARG E 1 81  ? 136.921 149.278 118.891 1.00 33.01  ? 116  ARG E NH2   1 
ATOM   3784  N N     . VAL E 1 82  ? 130.502 152.438 119.000 1.00 43.49  ? 117  VAL E N     1 
ATOM   3785  C CA    . VAL E 1 82  ? 129.345 151.652 119.392 1.00 43.49  ? 117  VAL E CA    1 
ATOM   3786  C C     . VAL E 1 82  ? 129.465 150.221 118.894 1.00 43.49  ? 117  VAL E C     1 
ATOM   3787  O O     . VAL E 1 82  ? 129.215 149.271 119.642 1.00 43.49  ? 117  VAL E O     1 
ATOM   3788  C CB    . VAL E 1 82  ? 128.052 152.305 118.871 1.00 43.49  ? 117  VAL E CB    1 
ATOM   3789  C CG1   . VAL E 1 82  ? 126.870 151.417 119.073 1.00 43.49  ? 117  VAL E CG1   1 
ATOM   3790  C CG2   . VAL E 1 82  ? 127.823 153.613 119.581 1.00 43.49  ? 117  VAL E CG2   1 
ATOM   3791  N N     . THR E 1 83  ? 129.916 150.055 117.657 1.00 50.12  ? 118  THR E N     1 
ATOM   3792  C CA    . THR E 1 83  ? 130.139 148.752 117.052 1.00 50.12  ? 118  THR E CA    1 
ATOM   3793  C C     . THR E 1 83  ? 131.272 148.009 117.737 1.00 50.12  ? 118  THR E C     1 
ATOM   3794  O O     . THR E 1 83  ? 132.407 148.485 117.744 1.00 50.12  ? 118  THR E O     1 
ATOM   3795  C CB    . THR E 1 83  ? 130.473 148.940 115.582 1.00 50.12  ? 118  THR E CB    1 
ATOM   3796  O OG1   . THR E 1 83  ? 129.347 149.508 114.912 1.00 50.12  ? 118  THR E OG1   1 
ATOM   3797  C CG2   . THR E 1 83  ? 130.797 147.624 114.951 1.00 50.12  ? 118  THR E CG2   1 
ATOM   3798  N N     . ILE E 1 84  ? 130.990 146.841 118.280 1.00 62.13  ? 119  ILE E N     1 
ATOM   3799  C CA    . ILE E 1 84  ? 132.062 146.028 118.835 1.00 62.13  ? 119  ILE E CA    1 
ATOM   3800  C C     . ILE E 1 84  ? 132.815 145.349 117.698 1.00 62.13  ? 119  ILE E C     1 
ATOM   3801  O O     . ILE E 1 84  ? 132.271 145.126 116.622 1.00 62.13  ? 119  ILE E O     1 
ATOM   3802  C CB    . ILE E 1 84  ? 131.495 145.021 119.845 1.00 62.13  ? 119  ILE E CB    1 
ATOM   3803  C CG1   . ILE E 1 84  ? 130.668 143.954 119.167 1.00 62.13  ? 119  ILE E CG1   1 
ATOM   3804  C CG2   . ILE E 1 84  ? 130.569 145.729 120.752 1.00 62.13  ? 119  ILE E CG2   1 
ATOM   3805  C CD1   . ILE E 1 84  ? 130.328 142.842 120.087 1.00 62.13  ? 119  ILE E CD1   1 
ATOM   3806  N N     . MET E 1 85  ? 134.098 145.074 117.903 1.00 34.76  ? 120  MET E N     1 
ATOM   3807  C CA    . MET E 1 85  ? 134.971 144.619 116.825 1.00 34.76  ? 120  MET E CA    1 
ATOM   3808  C C     . MET E 1 85  ? 135.901 143.507 117.321 1.00 34.76  ? 120  MET E C     1 
ATOM   3809  O O     . MET E 1 85  ? 135.960 143.259 118.539 1.00 34.76  ? 120  MET E O     1 
ATOM   3810  C CB    . MET E 1 85  ? 135.752 145.817 116.269 1.00 34.76  ? 120  MET E CB    1 
ATOM   3811  C CG    . MET E 1 85  ? 134.935 146.755 115.400 1.00 34.76  ? 120  MET E CG    1 
ATOM   3812  S SD    . MET E 1 85  ? 135.896 148.146 114.801 1.00 34.76  ? 120  MET E SD    1 
ATOM   3813  C CE    . MET E 1 85  ? 136.970 147.322 113.632 1.00 34.76  ? 120  MET E CE    1 
ATOM   3814  N N     . PRO E 1 86  ? 136.603 142.781 116.432 1.00 28.80  ? 121  PRO E N     1 
ATOM   3815  C CA    . PRO E 1 86  ? 137.547 141.763 116.920 1.00 28.80  ? 121  PRO E CA    1 
ATOM   3816  C C     . PRO E 1 86  ? 138.665 142.288 117.794 1.00 28.80  ? 121  PRO E C     1 
ATOM   3817  O O     . PRO E 1 86  ? 139.144 141.549 118.660 1.00 28.80  ? 121  PRO E O     1 
ATOM   3818  C CB    . PRO E 1 86  ? 138.109 141.166 115.631 1.00 28.80  ? 121  PRO E CB    1 
ATOM   3819  C CG    . PRO E 1 86  ? 137.066 141.328 114.696 1.00 28.80  ? 121  PRO E CG    1 
ATOM   3820  C CD    . PRO E 1 86  ? 136.385 142.611 114.988 1.00 28.80  ? 121  PRO E CD    1 
ATOM   3821  N N     . LYS E 1 87  ? 139.093 143.533 117.618 1.00 32.00  ? 122  LYS E N     1 
ATOM   3822  C CA    . LYS E 1 87  ? 140.098 144.057 118.528 1.00 32.00  ? 122  LYS E CA    1 
ATOM   3823  C C     . LYS E 1 87  ? 139.519 144.297 119.913 1.00 32.00  ? 122  LYS E C     1 
ATOM   3824  O O     . LYS E 1 87  ? 140.237 144.168 120.904 1.00 32.00  ? 122  LYS E O     1 
ATOM   3825  C CB    . LYS E 1 87  ? 140.720 145.324 117.950 1.00 32.00  ? 122  LYS E CB    1 
ATOM   3826  C CG    . LYS E 1 87  ? 139.762 146.462 117.760 1.00 32.00  ? 122  LYS E CG    1 
ATOM   3827  C CD    . LYS E 1 87  ? 140.456 147.660 117.180 1.00 32.00  ? 122  LYS E CD    1 
ATOM   3828  C CE    . LYS E 1 87  ? 140.795 147.412 115.738 1.00 32.00  ? 122  LYS E CE    1 
ATOM   3829  N NZ    . LYS E 1 87  ? 141.345 148.628 115.108 1.00 32.00  ? 122  LYS E NZ    1 
ATOM   3830  N N     . ASP E 1 88  ? 138.217 144.559 120.008 1.00 29.40  ? 123  ASP E N     1 
ATOM   3831  C CA    . ASP E 1 88  ? 137.572 144.649 121.311 1.00 29.40  ? 123  ASP E CA    1 
ATOM   3832  C C     . ASP E 1 88  ? 137.491 143.289 121.985 1.00 29.40  ? 123  ASP E C     1 
ATOM   3833  O O     . ASP E 1 88  ? 137.735 143.183 123.195 1.00 29.40  ? 123  ASP E O     1 
ATOM   3834  C CB    . ASP E 1 88  ? 136.192 145.262 121.156 1.00 29.40  ? 123  ASP E CB    1 
ATOM   3835  C CG    . ASP E 1 88  ? 136.259 146.730 120.838 1.00 29.40  ? 123  ASP E CG    1 
ATOM   3836  O OD1   . ASP E 1 88  ? 137.099 147.415 121.443 1.00 29.40  ? 123  ASP E OD1   1 
ATOM   3837  O OD2   . ASP E 1 88  ? 135.534 147.190 119.937 1.00 29.40  ? 123  ASP E OD2   1 
ATOM   3838  N N     . ILE E 1 89  ? 137.186 142.231 121.225 1.00 25.90  ? 124  ILE E N     1 
ATOM   3839  C CA    . ILE E 1 89  ? 137.174 140.900 121.839 1.00 25.90  ? 124  ILE E CA    1 
ATOM   3840  C C     . ILE E 1 89  ? 138.574 140.480 122.271 1.00 25.90  ? 124  ILE E C     1 
ATOM   3841  O O     . ILE E 1 89  ? 138.764 139.972 123.386 1.00 25.90  ? 124  ILE E O     1 
ATOM   3842  C CB    . ILE E 1 89  ? 136.534 139.860 120.907 1.00 25.90  ? 124  ILE E CB    1 
ATOM   3843  C CG1   . ILE E 1 89  ? 135.034 140.065 120.837 1.00 25.90  ? 124  ILE E CG1   1 
ATOM   3844  C CG2   . ILE E 1 89  ? 136.783 138.462 121.388 1.00 25.90  ? 124  ILE E CG2   1 
ATOM   3845  C CD1   . ILE E 1 89  ? 134.364 139.145 119.879 1.00 25.90  ? 124  ILE E CD1   1 
ATOM   3846  N N     . GLN E 1 90  ? 139.578 140.719 121.424 1.00 27.58  ? 125  GLN E N     1 
ATOM   3847  C CA    . GLN E 1 90  ? 140.947 140.369 121.786 1.00 27.58  ? 125  GLN E CA    1 
ATOM   3848  C C     . GLN E 1 90  ? 141.447 141.182 122.969 1.00 27.58  ? 125  GLN E C     1 
ATOM   3849  O O     . GLN E 1 90  ? 142.198 140.663 123.799 1.00 27.58  ? 125  GLN E O     1 
ATOM   3850  C CB    . GLN E 1 90  ? 141.873 140.565 120.597 1.00 27.58  ? 125  GLN E CB    1 
ATOM   3851  C CG    . GLN E 1 90  ? 141.631 139.605 119.473 1.00 27.58  ? 125  GLN E CG    1 
ATOM   3852  C CD    . GLN E 1 90  ? 142.540 139.874 118.304 1.00 27.58  ? 125  GLN E CD    1 
ATOM   3853  O OE1   . GLN E 1 90  ? 143.317 140.823 118.319 1.00 27.58  ? 125  GLN E OE1   1 
ATOM   3854  N NE2   . GLN E 1 90  ? 142.447 139.043 117.277 1.00 27.58  ? 125  GLN E NE2   1 
ATOM   3855  N N     . LEU E 1 91  ? 141.004 142.430 123.101 1.00 28.00  ? 126  LEU E N     1 
ATOM   3856  C CA    . LEU E 1 91  ? 141.405 143.214 124.257 1.00 28.00  ? 126  LEU E CA    1 
ATOM   3857  C C     . LEU E 1 91  ? 140.771 142.695 125.537 1.00 28.00  ? 126  LEU E C     1 
ATOM   3858  O O     . LEU E 1 91  ? 141.439 142.639 126.575 1.00 28.00  ? 126  LEU E O     1 
ATOM   3859  C CB    . LEU E 1 91  ? 141.048 144.677 124.056 1.00 28.00  ? 126  LEU E CB    1 
ATOM   3860  C CG    . LEU E 1 91  ? 141.486 145.522 125.241 1.00 28.00  ? 126  LEU E CG    1 
ATOM   3861  C CD1   . LEU E 1 91  ? 142.982 145.480 125.281 1.00 28.00  ? 126  LEU E CD1   1 
ATOM   3862  C CD2   . LEU E 1 91  ? 140.973 146.923 125.177 1.00 28.00  ? 126  LEU E CD2   1 
ATOM   3863  N N     . ALA E 1 92  ? 139.487 142.323 125.492 1.00 28.89  ? 127  ALA E N     1 
ATOM   3864  C CA    . ALA E 1 92  ? 138.852 141.774 126.691 1.00 28.89  ? 127  ALA E CA    1 
ATOM   3865  C C     . ALA E 1 92  ? 139.511 140.476 127.117 1.00 28.89  ? 127  ALA E C     1 
ATOM   3866  O O     . ALA E 1 92  ? 139.777 140.266 128.306 1.00 28.89  ? 127  ALA E O     1 
ATOM   3867  C CB    . ALA E 1 92  ? 137.366 141.546 126.466 1.00 28.89  ? 127  ALA E CB    1 
ATOM   3868  N N     . ARG E 1 93  ? 139.848 139.624 126.164 1.00 33.51  ? 128  ARG E N     1 
ATOM   3869  C CA    . ARG E 1 93  ? 140.489 138.369 126.510 1.00 33.51  ? 128  ARG E CA    1 
ATOM   3870  C C     . ARG E 1 93  ? 141.988 138.491 126.704 1.00 33.51  ? 128  ARG E C     1 
ATOM   3871  O O     . ARG E 1 93  ? 142.637 137.479 126.961 1.00 33.51  ? 128  ARG E O     1 
ATOM   3872  C CB    . ARG E 1 93  ? 140.200 137.316 125.449 1.00 33.51  ? 128  ARG E CB    1 
ATOM   3873  C CG    . ARG E 1 93  ? 138.763 136.937 125.391 1.00 33.51  ? 128  ARG E CG    1 
ATOM   3874  C CD    . ARG E 1 93  ? 138.523 135.916 124.334 1.00 33.51  ? 128  ARG E CD    1 
ATOM   3875  N NE    . ARG E 1 93  ? 139.128 134.638 124.666 1.00 33.51  ? 128  ARG E NE    1 
ATOM   3876  C CZ    . ARG E 1 93  ? 140.150 134.114 124.009 1.00 33.51  ? 128  ARG E CZ    1 
ATOM   3877  N NH1   . ARG E 1 93  ? 140.687 134.765 122.990 1.00 33.51  ? 128  ARG E NH1   1 
ATOM   3878  N NH2   . ARG E 1 93  ? 140.638 132.942 124.372 1.00 33.51  ? 128  ARG E NH2   1 
ATOM   3879  N N     . ARG E 1 94  ? 142.572 139.672 126.554 1.00 41.93  ? 129  ARG E N     1 
ATOM   3880  C CA    . ARG E 1 94  ? 143.937 139.818 127.037 1.00 41.93  ? 129  ARG E CA    1 
ATOM   3881  C C     . ARG E 1 94  ? 144.017 140.511 128.388 1.00 41.93  ? 129  ARG E C     1 
ATOM   3882  O O     . ARG E 1 94  ? 144.768 140.060 129.254 1.00 41.93  ? 129  ARG E O     1 
ATOM   3883  C CB    . ARG E 1 94  ? 144.806 140.558 126.024 1.00 41.93  ? 129  ARG E CB    1 
ATOM   3884  C CG    . ARG E 1 94  ? 146.227 140.626 126.482 1.00 41.93  ? 129  ARG E CG    1 
ATOM   3885  C CD    . ARG E 1 94  ? 147.206 141.037 125.431 1.00 41.93  ? 129  ARG E CD    1 
ATOM   3886  N NE    . ARG E 1 94  ? 148.529 141.067 126.039 1.00 41.93  ? 129  ARG E NE    1 
ATOM   3887  C CZ    . ARG E 1 94  ? 149.661 141.229 125.372 1.00 41.93  ? 129  ARG E CZ    1 
ATOM   3888  N NH1   . ARG E 1 94  ? 149.640 141.357 124.055 1.00 41.93  ? 129  ARG E NH1   1 
ATOM   3889  N NH2   . ARG E 1 94  ? 150.813 141.243 126.024 1.00 41.93  ? 129  ARG E NH2   1 
ATOM   3890  N N     . ILE E 1 95  ? 143.248 141.578 128.603 1.00 62.13  ? 130  ILE E N     1 
ATOM   3891  C CA    . ILE E 1 95  ? 143.219 142.232 129.909 1.00 62.13  ? 130  ILE E CA    1 
ATOM   3892  C C     . ILE E 1 95  ? 142.639 141.303 130.966 1.00 62.13  ? 130  ILE E C     1 
ATOM   3893  O O     . ILE E 1 95  ? 143.108 141.278 132.110 1.00 62.13  ? 130  ILE E O     1 
ATOM   3894  C CB    . ILE E 1 95  ? 142.455 143.565 129.823 1.00 62.13  ? 130  ILE E CB    1 
ATOM   3895  C CG1   . ILE E 1 95  ? 143.298 144.605 129.115 1.00 62.13  ? 130  ILE E CG1   1 
ATOM   3896  C CG2   . ILE E 1 95  ? 142.098 144.112 131.162 1.00 62.13  ? 130  ILE E CG2   1 
ATOM   3897  C CD1   . ILE E 1 95  ? 142.581 145.905 128.922 1.00 62.13  ? 130  ILE E CD1   1 
ATOM   3898  N N     . ARG E 1 96  ? 141.664 140.475 130.594 1.00 42.79  ? 131  ARG E N     1 
ATOM   3899  C CA    . ARG E 1 96  ? 141.183 139.481 131.546 1.00 42.79  ? 131  ARG E CA    1 
ATOM   3900  C C     . ARG E 1 96  ? 142.238 138.415 131.793 1.00 42.79  ? 131  ARG E C     1 
ATOM   3901  O O     . ARG E 1 96  ? 142.356 137.887 132.902 1.00 42.79  ? 131  ARG E O     1 
ATOM   3902  C CB    . ARG E 1 96  ? 139.904 138.839 131.038 1.00 42.79  ? 131  ARG E CB    1 
ATOM   3903  C CG    . ARG E 1 96  ? 139.241 138.010 132.077 1.00 42.79  ? 131  ARG E CG    1 
ATOM   3904  C CD    . ARG E 1 96  ? 138.026 137.371 131.524 1.00 42.79  ? 131  ARG E CD    1 
ATOM   3905  N NE    . ARG E 1 96  ? 137.013 138.341 131.167 1.00 42.79  ? 131  ARG E NE    1 
ATOM   3906  C CZ    . ARG E 1 96  ? 135.899 138.006 130.542 1.00 42.79  ? 131  ARG E CZ    1 
ATOM   3907  N NH1   . ARG E 1 96  ? 135.685 136.740 130.223 1.00 42.79  ? 131  ARG E NH1   1 
ATOM   3908  N NH2   . ARG E 1 96  ? 135.003 138.923 130.240 1.00 42.79  ? 131  ARG E NH2   1 
ATOM   3909  N N     . GLY E 1 97  ? 143.029 138.110 130.779 1.00 45.96  ? 132  GLY E N     1 
ATOM   3910  C CA    . GLY E 1 97  ? 144.125 137.195 130.931 1.00 45.96  ? 132  GLY E CA    1 
ATOM   3911  C C     . GLY E 1 97  ? 143.796 135.763 130.630 1.00 45.96  ? 132  GLY E C     1 
ATOM   3912  O O     . GLY E 1 97  ? 144.390 134.874 131.241 1.00 45.96  ? 132  GLY E O     1 
ATOM   3913  N N     . GLU E 1 98  ? 142.847 135.507 129.736 1.00 43.21  ? 133  GLU E N     1 
ATOM   3914  C CA    . GLU E 1 98  ? 142.572 134.138 129.333 1.00 43.21  ? 133  GLU E CA    1 
ATOM   3915  C C     . GLU E 1 98  ? 143.493 133.699 128.208 1.00 43.21  ? 133  GLU E C     1 
ATOM   3916  O O     . GLU E 1 98  ? 143.753 132.504 128.056 1.00 43.21  ? 133  GLU E O     1 
ATOM   3917  C CB    . GLU E 1 98  ? 141.112 133.996 128.912 1.00 43.21  ? 133  GLU E CB    1 
ATOM   3918  C CG    . GLU E 1 98  ? 140.129 134.329 130.013 1.00 43.21  ? 133  GLU E CG    1 
ATOM   3919  C CD    . GLU E 1 98  ? 138.693 134.103 129.605 1.00 43.21  ? 133  GLU E CD    1 
ATOM   3920  O OE1   . GLU E 1 98  ? 138.455 133.720 128.442 1.00 43.21  ? 133  GLU E OE1   1 
ATOM   3921  O OE2   . GLU E 1 98  ? 137.798 134.310 130.444 1.00 43.21  ? 133  GLU E OE2   1 
ATOM   3922  N N     . ARG E 1 99  ? 143.997 134.642 127.420 1.00 48.93  ? 134  ARG E N     1 
ATOM   3923  C CA    . ARG E 1 99  ? 144.967 134.322 126.381 1.00 48.93  ? 134  ARG E CA    1 
ATOM   3924  C C     . ARG E 1 99  ? 146.396 134.459 126.893 1.00 48.93  ? 134  ARG E C     1 
ATOM   3925  O O     . ARG E 1 99  ? 147.159 133.488 126.895 1.00 48.93  ? 134  ARG E O     1 
ATOM   3926  C CB    . ARG E 1 99  ? 144.750 135.220 125.158 1.00 48.93  ? 134  ARG E CB    1 
ATOM   3927  C CG    . ARG E 1 99  ? 145.771 135.011 124.058 1.00 48.93  ? 134  ARG E CG    1 
ATOM   3928  C CD    . ARG E 1 99  ? 145.697 133.594 123.514 1.00 48.93  ? 134  ARG E CD    1 
ATOM   3929  N NE    . ARG E 1 99  ? 144.440 133.343 122.824 1.00 48.93  ? 134  ARG E NE    1 
ATOM   3930  C CZ    . ARG E 1 99  ? 143.982 132.132 122.533 1.00 48.93  ? 134  ARG E CZ    1 
ATOM   3931  N NH1   . ARG E 1 99  ? 144.679 131.064 122.889 1.00 48.93  ? 134  ARG E NH1   1 
ATOM   3932  N NH2   . ARG E 1 99  ? 142.826 131.990 121.898 1.00 48.93  ? 134  ARG E NH2   1 
ATOM   3933  N N     . ALA E 1 100 ? 146.765 135.655 127.334 1.00 55.84  ? 135  ALA E N     1 
ATOM   3934  C CA    . ALA E 1 100 ? 148.138 135.935 127.731 1.00 55.84  ? 135  ALA E CA    1 
ATOM   3935  C C     . ALA E 1 100 ? 148.177 136.902 128.905 1.00 55.84  ? 135  ALA E C     1 
ATOM   3936  O O     . ALA E 1 100 ? 149.247 137.269 129.386 1.00 55.84  ? 135  ALA E O     1 
ATOM   3937  C CB    . ALA E 1 100 ? 148.927 136.495 126.550 1.00 55.84  ? 135  ALA E CB    1 
ATOM   3938  O OXT   . ALA E 1 100 ? 147.137 137.335 129.394 1.00 55.84  ? 135  ALA E OXT   1 
ATOM   3939  N N     . ALA F 2 1   ? 132.162 112.119 94.124  1.00 104.82 ? 15   ALA F N     1 
ATOM   3940  C CA    . ALA F 2 1   ? 130.926 112.666 93.579  1.00 104.82 ? 15   ALA F CA    1 
ATOM   3941  C C     . ALA F 2 1   ? 130.097 113.328 94.676  1.00 104.82 ? 15   ALA F C     1 
ATOM   3942  O O     . ALA F 2 1   ? 130.617 114.105 95.475  1.00 104.82 ? 15   ALA F O     1 
ATOM   3943  C CB    . ALA F 2 1   ? 130.122 111.572 92.884  1.00 104.82 ? 15   ALA F CB    1 
ATOM   3944  N N     . LYS F 2 2   ? 128.803 113.018 94.706  1.00 107.65 ? 16   LYS F N     1 
ATOM   3945  C CA    . LYS F 2 2   ? 127.896 113.514 95.730  1.00 107.65 ? 16   LYS F CA    1 
ATOM   3946  C C     . LYS F 2 2   ? 127.863 112.625 96.966  1.00 107.65 ? 16   LYS F C     1 
ATOM   3947  O O     . LYS F 2 2   ? 127.021 112.836 97.844  1.00 107.65 ? 16   LYS F O     1 
ATOM   3948  C CB    . LYS F 2 2   ? 126.485 113.651 95.158  1.00 107.65 ? 16   LYS F CB    1 
ATOM   3949  C CG    . LYS F 2 2   ? 126.342 114.735 94.106  1.00 107.65 ? 16   LYS F CG    1 
ATOM   3950  C CD    . LYS F 2 2   ? 124.906 114.831 93.620  1.00 107.65 ? 16   LYS F CD    1 
ATOM   3951  C CE    . LYS F 2 2   ? 124.745 115.900 92.557  1.00 107.65 ? 16   LYS F CE    1 
ATOM   3952  N NZ    . LYS F 2 2   ? 123.341 115.968 92.080  1.00 107.65 ? 16   LYS F NZ    1 
ATOM   3953  N N     . ARG F 2 3   ? 128.757 111.644 97.053  1.00 108.12 ? 17   ARG F N     1 
ATOM   3954  C CA    . ARG F 2 3   ? 128.785 110.700 98.158  1.00 108.12 ? 17   ARG F CA    1 
ATOM   3955  C C     . ARG F 2 3   ? 129.583 111.192 99.354  1.00 108.12 ? 17   ARG F C     1 
ATOM   3956  O O     . ARG F 2 3   ? 129.546 110.550 100.409 1.00 108.12 ? 17   ARG F O     1 
ATOM   3957  C CB    . ARG F 2 3   ? 129.372 109.365 97.687  1.00 108.12 ? 17   ARG F CB    1 
ATOM   3958  C CG    . ARG F 2 3   ? 130.823 109.451 97.229  1.00 108.12 ? 17   ARG F CG    1 
ATOM   3959  C CD    . ARG F 2 3   ? 131.340 108.097 96.760  1.00 108.12 ? 17   ARG F CD    1 
ATOM   3960  N NE    . ARG F 2 3   ? 132.757 108.128 96.401  1.00 108.12 ? 17   ARG F NE    1 
ATOM   3961  C CZ    . ARG F 2 3   ? 133.220 108.392 95.183  1.00 108.12 ? 17   ARG F CZ    1 
ATOM   3962  N NH1   . ARG F 2 3   ? 132.383 108.642 94.187  1.00 108.12 ? 17   ARG F NH1   1 
ATOM   3963  N NH2   . ARG F 2 3   ? 134.526 108.396 94.958  1.00 108.12 ? 17   ARG F NH2   1 
ATOM   3964  N N     . HIS F 2 4   ? 130.288 112.308 99.226  1.00 116.22 ? 18   HIS F N     1 
ATOM   3965  C CA    . HIS F 2 4   ? 131.292 112.678 100.209 1.00 116.22 ? 18   HIS F CA    1 
ATOM   3966  C C     . HIS F 2 4   ? 130.679 113.399 101.407 1.00 116.22 ? 18   HIS F C     1 
ATOM   3967  O O     . HIS F 2 4   ? 129.608 114.007 101.329 1.00 116.22 ? 18   HIS F O     1 
ATOM   3968  C CB    . HIS F 2 4   ? 132.353 113.570 99.572  1.00 116.22 ? 18   HIS F CB    1 
ATOM   3969  C CG    . HIS F 2 4   ? 133.136 112.895 98.494  1.00 116.22 ? 18   HIS F CG    1 
ATOM   3970  N ND1   . HIS F 2 4   ? 134.162 112.016 98.760  1.00 116.22 ? 18   HIS F ND1   1 
ATOM   3971  C CD2   . HIS F 2 4   ? 133.031 112.956 97.146  1.00 116.22 ? 18   HIS F CD2   1 
ATOM   3972  C CE1   . HIS F 2 4   ? 134.666 111.575 97.621  1.00 116.22 ? 18   HIS F CE1   1 
ATOM   3973  N NE2   . HIS F 2 4   ? 133.995 112.127 96.627  1.00 116.22 ? 18   HIS F NE2   1 
ATOM   3974  N N     . ARG F 2 5   ? 131.388 113.312 102.532 1.00 120.34 ? 19   ARG F N     1 
ATOM   3975  C CA    . ARG F 2 5   ? 131.160 114.183 103.675 1.00 120.34 ? 19   ARG F CA    1 
ATOM   3976  C C     . ARG F 2 5   ? 131.940 115.482 103.571 1.00 120.34 ? 19   ARG F C     1 
ATOM   3977  O O     . ARG F 2 5   ? 131.756 116.370 104.411 1.00 120.34 ? 19   ARG F O     1 
ATOM   3978  C CB    . ARG F 2 5   ? 131.532 113.473 104.979 1.00 120.34 ? 19   ARG F CB    1 
ATOM   3979  C CG    . ARG F 2 5   ? 130.650 112.288 105.304 1.00 120.34 ? 19   ARG F CG    1 
ATOM   3980  C CD    . ARG F 2 5   ? 129.240 112.748 105.600 1.00 120.34 ? 19   ARG F CD    1 
ATOM   3981  N NE    . ARG F 2 5   ? 128.390 111.646 106.025 1.00 120.34 ? 19   ARG F NE    1 
ATOM   3982  C CZ    . ARG F 2 5   ? 127.700 110.879 105.192 1.00 120.34 ? 19   ARG F CZ    1 
ATOM   3983  N NH1   . ARG F 2 5   ? 127.767 111.090 103.884 1.00 120.34 ? 19   ARG F NH1   1 
ATOM   3984  N NH2   . ARG F 2 5   ? 126.948 109.898 105.666 1.00 120.34 ? 19   ARG F NH2   1 
ATOM   3985  N N     . LYS F 2 6   ? 132.819 115.600 102.571 1.00 121.00 ? 20   LYS F N     1 
ATOM   3986  C CA    . LYS F 2 6   ? 133.428 116.887 102.265 1.00 121.00 ? 20   LYS F CA    1 
ATOM   3987  C C     . LYS F 2 6   ? 132.393 117.856 101.711 1.00 121.00 ? 20   LYS F C     1 
ATOM   3988  O O     . LYS F 2 6   ? 132.459 119.061 101.986 1.00 121.00 ? 20   LYS F O     1 
ATOM   3989  C CB    . LYS F 2 6   ? 134.582 116.696 101.276 1.00 121.00 ? 20   LYS F CB    1 
ATOM   3990  C CG    . LYS F 2 6   ? 135.407 117.946 101.013 1.00 121.00 ? 20   LYS F CG    1 
ATOM   3991  C CD    . LYS F 2 6   ? 136.611 117.637 100.141 1.00 121.00 ? 20   LYS F CD    1 
ATOM   3992  C CE    . LYS F 2 6   ? 136.209 117.435 98.692  1.00 121.00 ? 20   LYS F CE    1 
ATOM   3993  N NZ    . LYS F 2 6   ? 135.792 118.704 98.039  1.00 121.00 ? 20   LYS F NZ    1 
ATOM   3994  N N     . VAL F 2 7   ? 131.430 117.352 100.943 1.00 120.39 ? 21   VAL F N     1 
ATOM   3995  C CA    . VAL F 2 7   ? 130.290 118.169 100.497 1.00 120.39 ? 21   VAL F CA    1 
ATOM   3996  C C     . VAL F 2 7   ? 129.202 118.007 101.556 1.00 120.39 ? 21   VAL F C     1 
ATOM   3997  O O     . VAL F 2 7   ? 128.205 117.300 101.392 1.00 120.39 ? 21   VAL F O     1 
ATOM   3998  C CB    . VAL F 2 7   ? 129.838 117.807 99.075  1.00 120.39 ? 21   VAL F CB    1 
ATOM   3999  C CG1   . VAL F 2 7   ? 130.799 118.413 98.071  1.00 120.39 ? 21   VAL F CG1   1 
ATOM   4000  C CG2   . VAL F 2 7   ? 129.837 116.286 98.857  1.00 120.39 ? 21   VAL F CG2   1 
ATOM   4001  N N     . LEU F 2 8   ? 129.375 118.746 102.651 1.00 108.26 ? 22   LEU F N     1 
ATOM   4002  C CA    . LEU F 2 8   ? 128.473 118.818 103.795 1.00 108.26 ? 22   LEU F CA    1 
ATOM   4003  C C     . LEU F 2 8   ? 128.972 119.944 104.688 1.00 108.26 ? 22   LEU F C     1 
ATOM   4004  O O     . LEU F 2 8   ? 130.177 120.208 104.751 1.00 108.26 ? 22   LEU F O     1 
ATOM   4005  C CB    . LEU F 2 8   ? 128.410 117.487 104.568 1.00 108.26 ? 22   LEU F CB    1 
ATOM   4006  C CG    . LEU F 2 8   ? 127.310 117.270 105.610 1.00 108.26 ? 22   LEU F CG    1 
ATOM   4007  C CD1   . LEU F 2 8   ? 126.860 115.833 105.553 1.00 108.26 ? 22   LEU F CD1   1 
ATOM   4008  C CD2   . LEU F 2 8   ? 127.803 117.574 107.008 1.00 108.26 ? 22   LEU F CD2   1 
ATOM   4009  N N     . ARG F 2 9   ? 128.039 120.607 105.369 1.00 88.88  ? 23   ARG F N     1 
ATOM   4010  C CA    . ARG F 2 9   ? 128.373 121.785 106.162 1.00 88.88  ? 23   ARG F CA    1 
ATOM   4011  C C     . ARG F 2 9   ? 128.973 121.358 107.498 1.00 88.88  ? 23   ARG F C     1 
ATOM   4012  O O     . ARG F 2 9   ? 128.369 120.563 108.225 1.00 88.88  ? 23   ARG F O     1 
ATOM   4013  C CB    . ARG F 2 9   ? 127.135 122.650 106.383 1.00 88.88  ? 23   ARG F CB    1 
ATOM   4014  C CG    . ARG F 2 9   ? 127.469 124.000 106.964 1.00 88.88  ? 23   ARG F CG    1 
ATOM   4015  C CD    . ARG F 2 9   ? 126.243 124.834 107.226 1.00 88.88  ? 23   ARG F CD    1 
ATOM   4016  N NE    . ARG F 2 9   ? 125.472 124.309 108.342 1.00 88.88  ? 23   ARG F NE    1 
ATOM   4017  C CZ    . ARG F 2 9   ? 124.328 124.833 108.763 1.00 88.88  ? 23   ARG F CZ    1 
ATOM   4018  N NH1   . ARG F 2 9   ? 123.836 125.906 108.166 1.00 88.88  ? 23   ARG F NH1   1 
ATOM   4019  N NH2   . ARG F 2 9   ? 123.689 124.298 109.792 1.00 88.88  ? 23   ARG F NH2   1 
ATOM   4020  N N     . ASP F 2 10  ? 130.149 121.897 107.829 1.00 77.78  ? 24   ASP F N     1 
ATOM   4021  C CA    . ASP F 2 10  ? 130.810 121.528 109.071 1.00 77.78  ? 24   ASP F CA    1 
ATOM   4022  C C     . ASP F 2 10  ? 130.069 122.108 110.273 1.00 77.78  ? 24   ASP F C     1 
ATOM   4023  O O     . ASP F 2 10  ? 129.161 122.934 110.152 1.00 77.78  ? 24   ASP F O     1 
ATOM   4024  C CB    . ASP F 2 10  ? 132.279 121.960 109.074 1.00 77.78  ? 24   ASP F CB    1 
ATOM   4025  C CG    . ASP F 2 10  ? 132.465 123.431 108.783 1.00 77.78  ? 24   ASP F CG    1 
ATOM   4026  O OD1   . ASP F 2 10  ? 131.481 124.099 108.417 1.00 77.78  ? 24   ASP F OD1   1 
ATOM   4027  O OD2   . ASP F 2 10  ? 133.604 123.925 108.924 1.00 77.78  ? 24   ASP F OD2   1 
ATOM   4028  N N     . ASN F 2 11  ? 130.499 121.672 111.452 1.00 53.44  ? 25   ASN F N     1 
ATOM   4029  C CA    . ASN F 2 11  ? 129.632 121.608 112.614 1.00 53.44  ? 25   ASN F CA    1 
ATOM   4030  C C     . ASN F 2 11  ? 129.745 122.823 113.523 1.00 53.44  ? 25   ASN F C     1 
ATOM   4031  O O     . ASN F 2 11  ? 128.832 123.071 114.316 1.00 53.44  ? 25   ASN F O     1 
ATOM   4032  C CB    . ASN F 2 11  ? 129.965 120.333 113.386 1.00 53.44  ? 25   ASN F CB    1 
ATOM   4033  C CG    . ASN F 2 11  ? 128.825 119.834 114.202 1.00 53.44  ? 25   ASN F CG    1 
ATOM   4034  O OD1   . ASN F 2 11  ? 127.759 120.444 114.252 1.00 53.44  ? 25   ASN F OD1   1 
ATOM   4035  N ND2   . ASN F 2 11  ? 129.024 118.683 114.826 1.00 53.44  ? 25   ASN F ND2   1 
ATOM   4036  N N     . ILE F 2 12  ? 130.836 123.586 113.424 1.00 46.68  ? 26   ILE F N     1 
ATOM   4037  C CA    . ILE F 2 12  ? 130.949 124.836 114.164 1.00 46.68  ? 26   ILE F CA    1 
ATOM   4038  C C     . ILE F 2 12  ? 130.044 125.902 113.567 1.00 46.68  ? 26   ILE F C     1 
ATOM   4039  O O     . ILE F 2 12  ? 129.590 126.800 114.281 1.00 46.68  ? 26   ILE F O     1 
ATOM   4040  C CB    . ILE F 2 12  ? 132.430 125.271 114.222 1.00 46.68  ? 26   ILE F CB    1 
ATOM   4041  C CG1   . ILE F 2 12  ? 132.639 126.493 115.118 1.00 46.68  ? 26   ILE F CG1   1 
ATOM   4042  C CG2   . ILE F 2 12  ? 132.984 125.501 112.838 1.00 46.68  ? 26   ILE F CG2   1 
ATOM   4043  C CD1   . ILE F 2 12  ? 132.278 126.265 116.548 1.00 46.68  ? 26   ILE F CD1   1 
ATOM   4044  N N     . GLN F 2 13  ? 129.693 125.782 112.287 1.00 45.97  ? 27   GLN F N     1 
ATOM   4045  C CA    . GLN F 2 13  ? 128.793 126.740 111.664 1.00 45.97  ? 27   GLN F CA    1 
ATOM   4046  C C     . GLN F 2 13  ? 127.359 126.604 112.148 1.00 45.97  ? 27   GLN F C     1 
ATOM   4047  O O     . GLN F 2 13  ? 126.545 127.481 111.856 1.00 45.97  ? 27   GLN F O     1 
ATOM   4048  C CB    . GLN F 2 13  ? 128.839 126.577 110.152 1.00 45.97  ? 27   GLN F CB    1 
ATOM   4049  C CG    . GLN F 2 13  ? 130.192 126.862 109.539 1.00 45.97  ? 27   GLN F CG    1 
ATOM   4050  C CD    . GLN F 2 13  ? 130.580 128.314 109.605 1.00 45.97  ? 27   GLN F CD    1 
ATOM   4051  O OE1   . GLN F 2 13  ? 131.452 128.704 110.380 1.00 45.97  ? 27   GLN F OE1   1 
ATOM   4052  N NE2   . GLN F 2 13  ? 129.949 129.127 108.772 1.00 45.97  ? 27   GLN F NE2   1 
ATOM   4053  N N     . GLY F 2 14  ? 127.028 125.536 112.876 1.00 43.86  ? 28   GLY F N     1 
ATOM   4054  C CA    . GLY F 2 14  ? 125.707 125.402 113.459 1.00 43.86  ? 28   GLY F CA    1 
ATOM   4055  C C     . GLY F 2 14  ? 125.432 126.370 114.586 1.00 43.86  ? 28   GLY F C     1 
ATOM   4056  O O     . GLY F 2 14  ? 124.271 126.549 114.964 1.00 43.86  ? 28   GLY F O     1 
ATOM   4057  N N     . ILE F 2 15  ? 126.466 126.992 115.138 1.00 38.19  ? 29   ILE F N     1 
ATOM   4058  C CA    . ILE F 2 15  ? 126.239 128.113 116.032 1.00 38.19  ? 29   ILE F CA    1 
ATOM   4059  C C     . ILE F 2 15  ? 125.880 129.280 115.129 1.00 38.19  ? 29   ILE F C     1 
ATOM   4060  O O     . ILE F 2 15  ? 126.757 129.992 114.628 1.00 38.19  ? 29   ILE F O     1 
ATOM   4061  C CB    . ILE F 2 15  ? 127.470 128.418 116.892 1.00 38.19  ? 29   ILE F CB    1 
ATOM   4062  C CG1   . ILE F 2 15  ? 127.928 127.149 117.594 1.00 38.19  ? 29   ILE F CG1   1 
ATOM   4063  C CG2   . ILE F 2 15  ? 127.140 129.486 117.899 1.00 38.19  ? 29   ILE F CG2   1 
ATOM   4064  C CD1   . ILE F 2 15  ? 126.890 126.552 118.473 1.00 38.19  ? 29   ILE F CD1   1 
ATOM   4065  N N     . THR F 2 16  ? 124.584 129.469 114.914 1.00 36.87  ? 30   THR F N     1 
ATOM   4066  C CA    . THR F 2 16  ? 124.105 130.299 113.828 1.00 36.87  ? 30   THR F CA    1 
ATOM   4067  C C     . THR F 2 16  ? 124.310 131.772 114.128 1.00 36.87  ? 30   THR F C     1 
ATOM   4068  O O     . THR F 2 16  ? 124.497 132.186 115.271 1.00 36.87  ? 30   THR F O     1 
ATOM   4069  C CB    . THR F 2 16  ? 122.634 130.020 113.578 1.00 36.87  ? 30   THR F CB    1 
ATOM   4070  O OG1   . THR F 2 16  ? 121.923 130.181 114.806 1.00 36.87  ? 30   THR F OG1   1 
ATOM   4071  C CG2   . THR F 2 16  ? 122.450 128.615 113.093 1.00 36.87  ? 30   THR F CG2   1 
ATOM   4072  N N     . LYS F 2 17  ? 124.291 132.551 113.075 1.00 31.99  ? 31   LYS F N     1 
ATOM   4073  C CA    . LYS F 2 17  ? 124.516 133.984 113.085 1.00 31.99  ? 31   LYS F CA    1 
ATOM   4074  C C     . LYS F 2 17  ? 123.495 134.729 113.946 1.00 31.99  ? 31   LYS F C     1 
ATOM   4075  O O     . LYS F 2 17  ? 123.920 135.543 114.776 1.00 31.99  ? 31   LYS F O     1 
ATOM   4076  C CB    . LYS F 2 17  ? 124.566 134.473 111.635 1.00 31.99  ? 31   LYS F CB    1 
ATOM   4077  C CG    . LYS F 2 17  ? 124.812 135.927 111.391 1.00 31.99  ? 31   LYS F CG    1 
ATOM   4078  C CD    . LYS F 2 17  ? 124.900 136.118 109.884 1.00 31.99  ? 31   LYS F CD    1 
ATOM   4079  C CE    . LYS F 2 17  ? 125.122 137.555 109.481 1.00 31.99  ? 31   LYS F CE    1 
ATOM   4080  N NZ    . LYS F 2 17  ? 123.928 138.383 109.776 1.00 31.99  ? 31   LYS F NZ    1 
ATOM   4081  N N     . PRO F 2 18  ? 122.180 134.474 113.878 1.00 34.58  ? 32   PRO F N     1 
ATOM   4082  C CA    . PRO F 2 18  ? 121.317 135.095 114.882 1.00 34.58  ? 32   PRO F CA    1 
ATOM   4083  C C     . PRO F 2 18  ? 121.472 134.535 116.275 1.00 34.58  ? 32   PRO F C     1 
ATOM   4084  O O     . PRO F 2 18  ? 121.079 135.221 117.212 1.00 34.58  ? 32   PRO F O     1 
ATOM   4085  C CB    . PRO F 2 18  ? 119.907 134.853 114.346 1.00 34.58  ? 32   PRO F CB    1 
ATOM   4086  C CG    . PRO F 2 18  ? 120.016 133.735 113.524 1.00 34.58  ? 32   PRO F CG    1 
ATOM   4087  C CD    . PRO F 2 18  ? 121.334 133.813 112.869 1.00 34.58  ? 32   PRO F CD    1 
ATOM   4088  N N     . ALA F 2 19  ? 122.070 133.361 116.474 1.00 31.47  ? 33   ALA F N     1 
ATOM   4089  C CA    . ALA F 2 19  ? 122.264 132.884 117.841 1.00 31.47  ? 33   ALA F CA    1 
ATOM   4090  C C     . ALA F 2 19  ? 123.354 133.677 118.550 1.00 31.47  ? 33   ALA F C     1 
ATOM   4091  O O     . ALA F 2 19  ? 123.188 134.093 119.703 1.00 31.47  ? 33   ALA F O     1 
ATOM   4092  C CB    . ALA F 2 19  ? 122.594 131.397 117.843 1.00 31.47  ? 33   ALA F CB    1 
ATOM   4093  N N     . ILE F 2 20  ? 124.473 133.905 117.862 1.00 27.38  ? 34   ILE F N     1 
ATOM   4094  C CA    . ILE F 2 20  ? 125.521 134.786 118.365 1.00 27.38  ? 34   ILE F CA    1 
ATOM   4095  C C     . ILE F 2 20  ? 124.991 136.198 118.535 1.00 27.38  ? 34   ILE F C     1 
ATOM   4096  O O     . ILE F 2 20  ? 125.292 136.878 119.526 1.00 27.38  ? 34   ILE F O     1 
ATOM   4097  C CB    . ILE F 2 20  ? 126.718 134.749 117.405 1.00 27.38  ? 34   ILE F CB    1 
ATOM   4098  C CG1   . ILE F 2 20  ? 127.354 133.373 117.411 1.00 27.38  ? 34   ILE F CG1   1 
ATOM   4099  C CG2   . ILE F 2 20  ? 127.731 135.778 117.750 1.00 27.38  ? 34   ILE F CG2   1 
ATOM   4100  C CD1   . ILE F 2 20  ? 128.333 133.181 116.294 1.00 27.38  ? 34   ILE F CD1   1 
ATOM   4101  N N     . ARG F 2 21  ? 124.167 136.650 117.584 1.00 33.42  ? 35   ARG F N     1 
ATOM   4102  C CA    . ARG F 2 21  ? 123.595 137.986 117.682 1.00 33.42  ? 35   ARG F CA    1 
ATOM   4103  C C     . ARG F 2 21  ? 122.671 138.103 118.890 1.00 33.42  ? 35   ARG F C     1 
ATOM   4104  O O     . ARG F 2 21  ? 122.700 139.114 119.590 1.00 33.42  ? 35   ARG F O     1 
ATOM   4105  C CB    . ARG F 2 21  ? 122.875 138.330 116.380 1.00 33.42  ? 35   ARG F CB    1 
ATOM   4106  C CG    . ARG F 2 21  ? 122.442 139.756 116.236 1.00 33.42  ? 35   ARG F CG    1 
ATOM   4107  C CD    . ARG F 2 21  ? 121.886 140.000 114.850 1.00 33.42  ? 35   ARG F CD    1 
ATOM   4108  N NE    . ARG F 2 21  ? 120.731 139.150 114.598 1.00 33.42  ? 35   ARG F NE    1 
ATOM   4109  C CZ    . ARG F 2 21  ? 119.489 139.435 114.973 1.00 33.42  ? 35   ARG F CZ    1 
ATOM   4110  N NH1   . ARG F 2 21  ? 119.223 140.563 115.615 1.00 33.42  ? 35   ARG F NH1   1 
ATOM   4111  N NH2   . ARG F 2 21  ? 118.508 138.588 114.703 1.00 33.42  ? 35   ARG F NH2   1 
ATOM   4112  N N     . ARG F 2 22  ? 121.930 137.043 119.217 1.00 31.96  ? 36   ARG F N     1 
ATOM   4113  C CA    . ARG F 2 22  ? 121.065 137.067 120.396 1.00 31.96  ? 36   ARG F CA    1 
ATOM   4114  C C     . ARG F 2 22  ? 121.855 137.039 121.693 1.00 31.96  ? 36   ARG F C     1 
ATOM   4115  O O     . ARG F 2 22  ? 121.441 137.654 122.684 1.00 31.96  ? 36   ARG F O     1 
ATOM   4116  C CB    . ARG F 2 22  ? 120.108 135.885 120.406 1.00 31.96  ? 36   ARG F CB    1 
ATOM   4117  C CG    . ARG F 2 22  ? 118.929 135.955 119.487 1.00 31.96  ? 36   ARG F CG    1 
ATOM   4118  C CD    . ARG F 2 22  ? 117.961 134.870 119.886 1.00 31.96  ? 36   ARG F CD    1 
ATOM   4119  N NE    . ARG F 2 22  ? 118.564 133.549 119.826 1.00 31.96  ? 36   ARG F NE    1 
ATOM   4120  C CZ    . ARG F 2 22  ? 118.546 132.789 118.745 1.00 31.96  ? 36   ARG F CZ    1 
ATOM   4121  N NH1   . ARG F 2 22  ? 117.950 133.224 117.649 1.00 31.96  ? 36   ARG F NH1   1 
ATOM   4122  N NH2   . ARG F 2 22  ? 119.108 131.596 118.761 1.00 31.96  ? 36   ARG F NH2   1 
ATOM   4123  N N     . LEU F 2 23  ? 122.945 136.264 121.734 1.00 29.42  ? 37   LEU F N     1 
ATOM   4124  C CA    . LEU F 2 23  ? 123.828 136.304 122.900 1.00 29.42  ? 37   LEU F CA    1 
ATOM   4125  C C     . LEU F 2 23  ? 124.375 137.702 123.121 1.00 29.42  ? 37   LEU F C     1 
ATOM   4126  O O     . LEU F 2 23  ? 124.433 138.181 124.258 1.00 29.42  ? 37   LEU F O     1 
ATOM   4127  C CB    . LEU F 2 23  ? 124.982 135.323 122.750 1.00 29.42  ? 37   LEU F CB    1 
ATOM   4128  C CG    . LEU F 2 23  ? 124.631 133.857 122.870 1.00 29.42  ? 37   LEU F CG    1 
ATOM   4129  C CD1   . LEU F 2 23  ? 125.847 133.039 122.605 1.00 29.42  ? 37   LEU F CD1   1 
ATOM   4130  C CD2   . LEU F 2 23  ? 124.142 133.612 124.252 1.00 29.42  ? 37   LEU F CD2   1 
ATOM   4131  N N     . ALA F 2 24  ? 124.745 138.383 122.044 1.00 35.43  ? 38   ALA F N     1 
ATOM   4132  C CA    . ALA F 2 24  ? 125.229 139.745 122.182 1.00 35.43  ? 38   ALA F CA    1 
ATOM   4133  C C     . ALA F 2 24  ? 124.129 140.707 122.605 1.00 35.43  ? 38   ALA F C     1 
ATOM   4134  O O     . ALA F 2 24  ? 124.415 141.685 123.298 1.00 35.43  ? 38   ALA F O     1 
ATOM   4135  C CB    . ALA F 2 24  ? 125.852 140.199 120.878 1.00 35.43  ? 38   ALA F CB    1 
ATOM   4136  N N     . ARG F 2 25  ? 122.880 140.469 122.194 1.00 62.13  ? 39   ARG F N     1 
ATOM   4137  C CA    . ARG F 2 25  ? 121.803 141.342 122.661 1.00 62.13  ? 39   ARG F CA    1 
ATOM   4138  C C     . ARG F 2 25  ? 121.528 141.150 124.137 1.00 62.13  ? 39   ARG F C     1 
ATOM   4139  O O     . ARG F 2 25  ? 121.199 142.117 124.825 1.00 62.13  ? 39   ARG F O     1 
ATOM   4140  C CB    . ARG F 2 25  ? 120.507 141.124 121.903 1.00 62.13  ? 39   ARG F CB    1 
ATOM   4141  C CG    . ARG F 2 25  ? 120.605 141.332 120.445 1.00 62.13  ? 39   ARG F CG    1 
ATOM   4142  C CD    . ARG F 2 25  ? 121.077 142.692 120.100 1.00 62.13  ? 39   ARG F CD    1 
ATOM   4143  N NE    . ARG F 2 25  ? 121.067 142.843 118.658 1.00 62.13  ? 39   ARG F NE    1 
ATOM   4144  C CZ    . ARG F 2 25  ? 121.494 143.922 118.030 1.00 62.13  ? 39   ARG F CZ    1 
ATOM   4145  N NH1   . ARG F 2 25  ? 121.966 144.930 118.730 1.00 62.13  ? 39   ARG F NH1   1 
ATOM   4146  N NH2   . ARG F 2 25  ? 121.454 143.990 116.712 1.00 62.13  ? 39   ARG F NH2   1 
ATOM   4147  N N     . ARG F 2 26  ? 121.633 139.920 124.639 1.00 32.24  ? 40   ARG F N     1 
ATOM   4148  C CA    . ARG F 2 26  ? 121.591 139.742 126.086 1.00 32.24  ? 40   ARG F CA    1 
ATOM   4149  C C     . ARG F 2 26  ? 122.788 140.397 126.756 1.00 32.24  ? 40   ARG F C     1 
ATOM   4150  O O     . ARG F 2 26  ? 122.657 140.962 127.845 1.00 32.24  ? 40   ARG F O     1 
ATOM   4151  C CB    . ARG F 2 26  ? 121.530 138.265 126.450 1.00 32.24  ? 40   ARG F CB    1 
ATOM   4152  C CG    . ARG F 2 26  ? 121.513 138.008 127.926 1.00 32.24  ? 40   ARG F CG    1 
ATOM   4153  C CD    . ARG F 2 26  ? 121.380 136.567 128.232 1.00 32.24  ? 40   ARG F CD    1 
ATOM   4154  N NE    . ARG F 2 26  ? 120.044 136.099 127.936 1.00 32.24  ? 40   ARG F NE    1 
ATOM   4155  C CZ    . ARG F 2 26  ? 119.678 134.834 128.014 1.00 32.24  ? 40   ARG F CZ    1 
ATOM   4156  N NH1   . ARG F 2 26  ? 120.551 133.919 128.389 1.00 32.24  ? 40   ARG F NH1   1 
ATOM   4157  N NH2   . ARG F 2 26  ? 118.439 134.489 127.721 1.00 32.24  ? 40   ARG F NH2   1 
ATOM   4158  N N     . GLY F 2 27  ? 123.939 140.407 126.093 1.00 33.01  ? 41   GLY F N     1 
ATOM   4159  C CA    . GLY F 2 27  ? 125.113 141.031 126.676 1.00 33.01  ? 41   GLY F CA    1 
ATOM   4160  C C     . GLY F 2 27  ? 125.062 142.540 126.767 1.00 33.01  ? 41   GLY F C     1 
ATOM   4161  O O     . GLY F 2 27  ? 125.923 143.124 127.428 1.00 33.01  ? 41   GLY F O     1 
ATOM   4162  N N     . GLY F 2 28  ? 124.080 143.180 126.149 1.00 36.54  ? 42   GLY F N     1 
ATOM   4163  C CA    . GLY F 2 28  ? 123.963 144.618 126.172 1.00 36.54  ? 42   GLY F CA    1 
ATOM   4164  C C     . GLY F 2 28  ? 124.398 145.302 124.899 1.00 36.54  ? 42   GLY F C     1 
ATOM   4165  O O     . GLY F 2 28  ? 124.181 146.509 124.765 1.00 36.54  ? 42   GLY F O     1 
ATOM   4166  N N     . VAL F 2 29  ? 124.994 144.563 123.965 1.00 34.31  ? 43   VAL F N     1 
ATOM   4167  C CA    . VAL F 2 29  ? 125.593 145.149 122.775 1.00 34.31  ? 43   VAL F CA    1 
ATOM   4168  C C     . VAL F 2 29  ? 124.514 145.712 121.864 1.00 34.31  ? 43   VAL F C     1 
ATOM   4169  O O     . VAL F 2 29  ? 123.543 145.031 121.527 1.00 34.31  ? 43   VAL F O     1 
ATOM   4170  C CB    . VAL F 2 29  ? 126.445 144.100 122.053 1.00 34.31  ? 43   VAL F CB    1 
ATOM   4171  C CG1   . VAL F 2 29  ? 126.940 144.634 120.750 1.00 34.31  ? 43   VAL F CG1   1 
ATOM   4172  C CG2   . VAL F 2 29  ? 127.602 143.742 122.901 1.00 34.31  ? 43   VAL F CG2   1 
ATOM   4173  N N     . LYS F 2 30  ? 124.673 146.972 121.475 1.00 42.60  ? 44   LYS F N     1 
ATOM   4174  C CA    . LYS F 2 30  ? 123.713 147.624 120.601 1.00 42.60  ? 44   LYS F CA    1 
ATOM   4175  C C     . LYS F 2 30  ? 123.997 147.378 119.137 1.00 42.60  ? 44   LYS F C     1 
ATOM   4176  O O     . LYS F 2 30  ? 123.060 147.212 118.354 1.00 42.60  ? 44   LYS F O     1 
ATOM   4177  C CB    . LYS F 2 30  ? 123.695 149.127 120.858 1.00 42.60  ? 44   LYS F CB    1 
ATOM   4178  C CG    . LYS F 2 30  ? 122.639 149.871 120.078 1.00 42.60  ? 44   LYS F CG    1 
ATOM   4179  C CD    . LYS F 2 30  ? 122.599 151.330 120.446 1.00 42.60  ? 44   LYS F CD    1 
ATOM   4180  C CE    . LYS F 2 30  ? 121.572 152.080 119.622 1.00 42.60  ? 44   LYS F CE    1 
ATOM   4181  N NZ    . LYS F 2 30  ? 121.487 153.502 120.017 1.00 42.60  ? 44   LYS F NZ    1 
ATOM   4182  N N     . ARG F 2 31  ? 125.255 147.312 118.740 1.00 62.13  ? 45   ARG F N     1 
ATOM   4183  C CA    . ARG F 2 31  ? 125.538 147.154 117.327 1.00 62.13  ? 45   ARG F CA    1 
ATOM   4184  C C     . ARG F 2 31  ? 126.765 146.284 117.155 1.00 62.13  ? 45   ARG F C     1 
ATOM   4185  O O     . ARG F 2 31  ? 127.773 146.506 117.818 1.00 62.13  ? 45   ARG F O     1 
ATOM   4186  C CB    . ARG F 2 31  ? 125.721 148.516 116.673 1.00 62.13  ? 45   ARG F CB    1 
ATOM   4187  C CG    . ARG F 2 31  ? 126.177 148.442 115.263 1.00 62.13  ? 45   ARG F CG    1 
ATOM   4188  C CD    . ARG F 2 31  ? 126.072 149.758 114.559 1.00 62.13  ? 45   ARG F CD    1 
ATOM   4189  N NE    . ARG F 2 31  ? 126.732 149.642 113.273 1.00 62.13  ? 45   ARG F NE    1 
ATOM   4190  C CZ    . ARG F 2 31  ? 126.653 150.545 112.315 1.00 62.13  ? 45   ARG F CZ    1 
ATOM   4191  N NH1   . ARG F 2 31  ? 125.904 151.616 112.486 1.00 62.13  ? 45   ARG F NH1   1 
ATOM   4192  N NH2   . ARG F 2 31  ? 127.296 150.359 111.177 1.00 62.13  ? 45   ARG F NH2   1 
ATOM   4193  N N     . ILE F 2 32  ? 126.673 145.301 116.268 1.00 62.13  ? 46   ILE F N     1 
ATOM   4194  C CA    . ILE F 2 32  ? 127.649 144.230 116.134 1.00 62.13  ? 46   ILE F CA    1 
ATOM   4195  C C     . ILE F 2 32  ? 128.343 144.401 114.797 1.00 62.13  ? 46   ILE F C     1 
ATOM   4196  O O     . ILE F 2 32  ? 127.729 144.878 113.841 1.00 62.13  ? 46   ILE F O     1 
ATOM   4197  C CB    . ILE F 2 32  ? 126.937 142.868 116.226 1.00 62.13  ? 46   ILE F CB    1 
ATOM   4198  C CG1   . ILE F 2 32  ? 126.193 142.784 117.537 1.00 62.13  ? 46   ILE F CG1   1 
ATOM   4199  C CG2   . ILE F 2 32  ? 127.894 141.724 116.215 1.00 62.13  ? 46   ILE F CG2   1 
ATOM   4200  C CD1   . ILE F 2 32  ? 125.242 141.689 117.568 1.00 62.13  ? 46   ILE F CD1   1 
ATOM   4201  N N     . SER F 2 33  ? 129.619 144.044 114.723 1.00 62.13  ? 47   SER F N     1 
ATOM   4202  C CA    . SER F 2 33  ? 130.284 144.024 113.434 1.00 62.13  ? 47   SER F CA    1 
ATOM   4203  C C     . SER F 2 33  ? 129.933 142.759 112.673 1.00 62.13  ? 47   SER F C     1 
ATOM   4204  O O     . SER F 2 33  ? 129.058 141.986 113.056 1.00 62.13  ? 47   SER F O     1 
ATOM   4205  C CB    . SER F 2 33  ? 131.790 144.106 113.577 1.00 62.13  ? 47   SER F CB    1 
ATOM   4206  O OG    . SER F 2 33  ? 132.388 143.976 112.306 1.00 62.13  ? 47   SER F OG    1 
ATOM   4207  N N     . GLY F 2 34  ? 130.629 142.551 111.571 1.00 46.26  ? 48   GLY F N     1 
ATOM   4208  C CA    . GLY F 2 34  ? 130.445 141.358 110.787 1.00 46.26  ? 48   GLY F CA    1 
ATOM   4209  C C     . GLY F 2 34  ? 131.500 140.320 111.013 1.00 46.26  ? 48   GLY F C     1 
ATOM   4210  O O     . GLY F 2 34  ? 131.447 139.244 110.415 1.00 46.26  ? 48   GLY F O     1 
ATOM   4211  N N     . LEU F 2 35  ? 132.469 140.617 111.871 1.00 31.97  ? 49   LEU F N     1 
ATOM   4212  C CA    . LEU F 2 35  ? 133.574 139.717 112.138 1.00 31.97  ? 49   LEU F CA    1 
ATOM   4213  C C     . LEU F 2 35  ? 133.529 139.170 113.552 1.00 31.97  ? 49   LEU F C     1 
ATOM   4214  O O     . LEU F 2 35  ? 134.269 138.224 113.869 1.00 31.97  ? 49   LEU F O     1 
ATOM   4215  C CB    . LEU F 2 35  ? 134.889 140.453 111.899 1.00 31.97  ? 49   LEU F CB    1 
ATOM   4216  C CG    . LEU F 2 35  ? 134.899 141.123 110.526 1.00 31.97  ? 49   LEU F CG    1 
ATOM   4217  C CD1   . LEU F 2 35  ? 136.118 141.987 110.342 1.00 31.97  ? 49   LEU F CD1   1 
ATOM   4218  C CD2   . LEU F 2 35  ? 134.804 140.093 109.428 1.00 31.97  ? 49   LEU F CD2   1 
ATOM   4219  N N     . ILE F 2 36  ? 132.665 139.749 114.388 1.00 29.97  ? 50   ILE F N     1 
ATOM   4220  C CA    . ILE F 2 36  ? 132.339 139.241 115.716 1.00 29.97  ? 50   ILE F CA    1 
ATOM   4221  C C     . ILE F 2 36  ? 131.901 137.790 115.657 1.00 29.97  ? 50   ILE F C     1 
ATOM   4222  O O     . ILE F 2 36  ? 132.215 136.996 116.547 1.00 29.97  ? 50   ILE F O     1 
ATOM   4223  C CB    . ILE F 2 36  ? 131.254 140.133 116.331 1.00 29.97  ? 50   ILE F CB    1 
ATOM   4224  C CG1   . ILE F 2 36  ? 131.810 141.528 116.509 1.00 29.97  ? 50   ILE F CG1   1 
ATOM   4225  C CG2   . ILE F 2 36  ? 130.768 139.633 117.651 1.00 29.97  ? 50   ILE F CG2   1 
ATOM   4226  C CD1   . ILE F 2 36  ? 132.970 141.570 117.440 1.00 29.97  ? 50   ILE F CD1   1 
ATOM   4227  N N     . TYR F 2 37  ? 131.201 137.417 114.588 1.00 29.88  ? 51   TYR F N     1 
ATOM   4228  C CA    . TYR F 2 37  ? 130.660 136.072 114.445 1.00 29.88  ? 51   TYR F CA    1 
ATOM   4229  C C     . TYR F 2 37  ? 131.773 135.040 114.331 1.00 29.88  ? 51   TYR F C     1 
ATOM   4230  O O     . TYR F 2 37  ? 131.798 134.052 115.076 1.00 29.88  ? 51   TYR F O     1 
ATOM   4231  C CB    . TYR F 2 37  ? 129.766 136.043 113.215 1.00 29.88  ? 51   TYR F CB    1 
ATOM   4232  C CG    . TYR F 2 37  ? 128.597 136.990 113.306 1.00 29.88  ? 51   TYR F CG    1 
ATOM   4233  C CD1   . TYR F 2 37  ? 128.004 137.277 114.515 1.00 29.88  ? 51   TYR F CD1   1 
ATOM   4234  C CD2   . TYR F 2 37  ? 128.150 137.658 112.187 1.00 29.88  ? 51   TYR F CD2   1 
ATOM   4235  C CE1   . TYR F 2 37  ? 126.958 138.153 114.598 1.00 29.88  ? 51   TYR F CE1   1 
ATOM   4236  C CE2   . TYR F 2 37  ? 127.118 138.548 112.264 1.00 29.88  ? 51   TYR F CE2   1 
ATOM   4237  C CZ    . TYR F 2 37  ? 126.524 138.783 113.471 1.00 29.88  ? 51   TYR F CZ    1 
ATOM   4238  O OH    . TYR F 2 37  ? 125.479 139.669 113.553 1.00 29.88  ? 51   TYR F OH    1 
ATOM   4239  N N     . GLU F 2 38  ? 132.736 135.292 113.447 1.00 32.06  ? 52   GLU F N     1 
ATOM   4240  C CA    . GLU F 2 38  ? 133.857 134.379 113.280 1.00 32.06  ? 52   GLU F CA    1 
ATOM   4241  C C     . GLU F 2 38  ? 134.745 134.349 114.515 1.00 32.06  ? 52   GLU F C     1 
ATOM   4242  O O     . GLU F 2 38  ? 135.169 133.266 114.958 1.00 32.06  ? 52   GLU F O     1 
ATOM   4243  C CB    . GLU F 2 38  ? 134.670 134.785 112.057 1.00 32.06  ? 52   GLU F CB    1 
ATOM   4244  C CG    . GLU F 2 38  ? 135.841 133.887 111.754 1.00 32.06  ? 52   GLU F CG    1 
ATOM   4245  C CD    . GLU F 2 38  ? 135.409 132.549 111.220 1.00 32.06  ? 52   GLU F CD    1 
ATOM   4246  O OE1   . GLU F 2 38  ? 134.332 132.487 110.594 1.00 32.06  ? 52   GLU F OE1   1 
ATOM   4247  O OE2   . GLU F 2 38  ? 136.139 131.558 111.425 1.00 32.06  ? 52   GLU F OE2   1 
ATOM   4248  N N     . GLU F 2 39  ? 135.018 135.523 115.094 1.00 30.85  ? 53   GLU F N     1 
ATOM   4249  C CA    . GLU F 2 39  ? 135.863 135.571 116.282 1.00 30.85  ? 53   GLU F CA    1 
ATOM   4250  C C     . GLU F 2 39  ? 135.212 134.856 117.460 1.00 30.85  ? 53   GLU F C     1 
ATOM   4251  O O     . GLU F 2 39  ? 135.883 134.133 118.207 1.00 30.85  ? 53   GLU F O     1 
ATOM   4252  C CB    . GLU F 2 39  ? 136.173 137.018 116.638 1.00 30.85  ? 53   GLU F CB    1 
ATOM   4253  C CG    . GLU F 2 39  ? 137.035 137.171 117.859 1.00 30.85  ? 53   GLU F CG    1 
ATOM   4254  C CD    . GLU F 2 39  ? 138.430 136.645 117.661 1.00 30.85  ? 53   GLU F CD    1 
ATOM   4255  O OE1   . GLU F 2 39  ? 138.943 136.719 116.527 1.00 30.85  ? 53   GLU F OE1   1 
ATOM   4256  O OE2   . GLU F 2 39  ? 139.013 136.141 118.643 1.00 30.85  ? 53   GLU F OE2   1 
ATOM   4257  N N     . THR F 2 40  ? 133.895 134.980 117.596 1.00 28.20  ? 54   THR F N     1 
ATOM   4258  C CA    . THR F 2 40  ? 133.192 134.346 118.696 1.00 28.20  ? 54   THR F CA    1 
ATOM   4259  C C     . THR F 2 40  ? 133.115 132.844 118.505 1.00 28.20  ? 54   THR F C     1 
ATOM   4260  O O     . THR F 2 40  ? 133.158 132.097 119.484 1.00 28.20  ? 54   THR F O     1 
ATOM   4261  C CB    . THR F 2 40  ? 131.802 134.947 118.807 1.00 28.20  ? 54   THR F CB    1 
ATOM   4262  O OG1   . THR F 2 40  ? 131.930 136.364 118.884 1.00 28.20  ? 54   THR F OG1   1 
ATOM   4263  C CG2   . THR F 2 40  ? 131.094 134.485 120.052 1.00 28.20  ? 54   THR F CG2   1 
ATOM   4264  N N     . ARG F 2 41  ? 133.030 132.379 117.257 1.00 32.23  ? 55   ARG F N     1 
ATOM   4265  C CA    . ARG F 2 41  ? 133.064 130.938 117.039 1.00 32.23  ? 55   ARG F CA    1 
ATOM   4266  C C     . ARG F 2 41  ? 134.426 130.360 117.402 1.00 32.23  ? 55   ARG F C     1 
ATOM   4267  O O     . ARG F 2 41  ? 134.503 129.273 117.990 1.00 32.23  ? 55   ARG F O     1 
ATOM   4268  C CB    . ARG F 2 41  ? 132.691 130.599 115.597 1.00 32.23  ? 55   ARG F CB    1 
ATOM   4269  C CG    . ARG F 2 41  ? 131.226 130.851 115.252 1.00 32.23  ? 55   ARG F CG    1 
ATOM   4270  C CD    . ARG F 2 41  ? 130.885 130.363 113.856 1.00 32.23  ? 55   ARG F CD    1 
ATOM   4271  N NE    . ARG F 2 41  ? 129.503 130.637 113.477 1.00 32.23  ? 55   ARG F NE    1 
ATOM   4272  C CZ    . ARG F 2 41  ? 129.142 131.612 112.656 1.00 32.23  ? 55   ARG F CZ    1 
ATOM   4273  N NH1   . ARG F 2 41  ? 130.066 132.373 112.103 1.00 32.23  ? 55   ARG F NH1   1 
ATOM   4274  N NH2   . ARG F 2 41  ? 127.866 131.803 112.360 1.00 32.23  ? 55   ARG F NH2   1 
ATOM   4275  N N     . GLY F 2 42  ? 135.502 131.099 117.123 1.00 29.96  ? 56   GLY F N     1 
ATOM   4276  C CA    . GLY F 2 42  ? 136.819 130.653 117.571 1.00 29.96  ? 56   GLY F CA    1 
ATOM   4277  C C     . GLY F 2 42  ? 136.957 130.621 119.085 1.00 29.96  ? 56   GLY F C     1 
ATOM   4278  O O     . GLY F 2 42  ? 137.500 129.663 119.657 1.00 29.96  ? 56   GLY F O     1 
ATOM   4279  N N     . VAL F 2 43  ? 136.427 131.646 119.756 1.00 27.85  ? 57   VAL F N     1 
ATOM   4280  C CA    . VAL F 2 43  ? 136.506 131.731 121.212 1.00 27.85  ? 57   VAL F CA    1 
ATOM   4281  C C     . VAL F 2 43  ? 135.701 130.618 121.876 1.00 27.85  ? 57   VAL F C     1 
ATOM   4282  O O     . VAL F 2 43  ? 136.170 129.975 122.830 1.00 27.85  ? 57   VAL F O     1 
ATOM   4283  C CB    . VAL F 2 43  ? 136.049 133.124 121.657 1.00 27.85  ? 57   VAL F CB    1 
ATOM   4284  C CG1   . VAL F 2 43  ? 135.841 133.163 123.124 1.00 27.85  ? 57   VAL F CG1   1 
ATOM   4285  C CG2   . VAL F 2 43  ? 137.105 134.122 121.288 1.00 27.85  ? 57   VAL F CG2   1 
ATOM   4286  N N     . LEU F 2 44  ? 134.496 130.352 121.365 1.00 28.86  ? 58   LEU F N     1 
ATOM   4287  C CA    . LEU F 2 44  ? 133.672 129.262 121.879 1.00 28.86  ? 58   LEU F CA    1 
ATOM   4288  C C     . LEU F 2 44  ? 134.329 127.909 121.660 1.00 28.86  ? 58   LEU F C     1 
ATOM   4289  O O     . LEU F 2 44  ? 134.256 127.034 122.534 1.00 28.86  ? 58   LEU F O     1 
ATOM   4290  C CB    . LEU F 2 44  ? 132.303 129.286 121.216 1.00 28.86  ? 58   LEU F CB    1 
ATOM   4291  C CG    . LEU F 2 44  ? 131.382 128.139 121.599 1.00 28.86  ? 58   LEU F CG    1 
ATOM   4292  C CD1   . LEU F 2 44  ? 131.045 128.227 123.066 1.00 28.86  ? 58   LEU F CD1   1 
ATOM   4293  C CD2   . LEU F 2 44  ? 130.140 128.120 120.745 1.00 28.86  ? 58   LEU F CD2   1 
ATOM   4294  N N     . LYS F 2 45  ? 134.999 127.731 120.516 1.00 32.33  ? 59   LYS F N     1 
ATOM   4295  C CA    . LYS F 2 45  ? 135.711 126.485 120.255 1.00 32.33  ? 59   LYS F CA    1 
ATOM   4296  C C     . LYS F 2 45  ? 136.801 126.229 121.286 1.00 32.33  ? 59   LYS F C     1 
ATOM   4297  O O     . LYS F 2 45  ? 136.880 125.132 121.850 1.00 32.33  ? 59   LYS F O     1 
ATOM   4298  C CB    . LYS F 2 45  ? 136.299 126.508 118.855 1.00 32.33  ? 59   LYS F CB    1 
ATOM   4299  C CG    . LYS F 2 45  ? 137.075 125.265 118.517 1.00 32.33  ? 59   LYS F CG    1 
ATOM   4300  C CD    . LYS F 2 45  ? 137.550 125.308 117.078 1.00 32.33  ? 59   LYS F CD    1 
ATOM   4301  C CE    . LYS F 2 45  ? 138.293 124.046 116.706 1.00 32.33  ? 59   LYS F CE    1 
ATOM   4302  N NZ    . LYS F 2 45  ? 139.565 123.956 117.461 1.00 32.33  ? 59   LYS F NZ    1 
ATOM   4303  N N     . VAL F 2 46  ? 137.608 127.247 121.592 1.00 38.49  ? 60   VAL F N     1 
ATOM   4304  C CA    . VAL F 2 46  ? 138.698 127.058 122.555 1.00 38.49  ? 60   VAL F CA    1 
ATOM   4305  C C     . VAL F 2 46  ? 138.164 126.804 123.963 1.00 38.49  ? 60   VAL F C     1 
ATOM   4306  O O     . VAL F 2 46  ? 138.676 125.933 124.690 1.00 38.49  ? 60   VAL F O     1 
ATOM   4307  C CB    . VAL F 2 46  ? 139.641 128.266 122.511 1.00 38.49  ? 60   VAL F CB    1 
ATOM   4308  C CG1   . VAL F 2 46  ? 140.668 128.192 123.597 1.00 38.49  ? 60   VAL F CG1   1 
ATOM   4309  C CG2   . VAL F 2 46  ? 140.318 128.311 121.168 1.00 38.49  ? 60   VAL F CG2   1 
ATOM   4310  N N     . PHE F 2 47  ? 137.110 127.522 124.355 1.00 62.13  ? 61   PHE F N     1 
ATOM   4311  C CA    . PHE F 2 47  ? 136.541 127.323 125.685 1.00 62.13  ? 61   PHE F CA    1 
ATOM   4312  C C     . PHE F 2 47  ? 135.952 125.930 125.870 1.00 62.13  ? 61   PHE F C     1 
ATOM   4313  O O     . PHE F 2 47  ? 136.185 125.280 126.906 1.00 62.13  ? 61   PHE F O     1 
ATOM   4314  C CB    . PHE F 2 47  ? 135.483 128.367 125.951 1.00 62.13  ? 61   PHE F CB    1 
ATOM   4315  C CG    . PHE F 2 47  ? 134.718 128.130 127.194 1.00 62.13  ? 61   PHE F CG    1 
ATOM   4316  C CD1   . PHE F 2 47  ? 135.320 128.252 128.417 1.00 62.13  ? 61   PHE F CD1   1 
ATOM   4317  C CD2   . PHE F 2 47  ? 133.385 127.823 127.144 1.00 62.13  ? 61   PHE F CD2   1 
ATOM   4318  C CE1   . PHE F 2 47  ? 134.611 128.049 129.564 1.00 62.13  ? 61   PHE F CE1   1 
ATOM   4319  C CE2   . PHE F 2 47  ? 132.678 127.617 128.284 1.00 62.13  ? 61   PHE F CE2   1 
ATOM   4320  C CZ    . PHE F 2 47  ? 133.288 127.738 129.495 1.00 62.13  ? 61   PHE F CZ    1 
ATOM   4321  N N     . LEU F 2 48  ? 135.197 125.447 124.884 1.00 33.51  ? 62   LEU F N     1 
ATOM   4322  C CA    . LEU F 2 48  ? 134.667 124.096 124.999 1.00 33.51  ? 62   LEU F CA    1 
ATOM   4323  C C     . LEU F 2 48  ? 135.761 123.047 124.942 1.00 33.51  ? 62   LEU F C     1 
ATOM   4324  O O     . LEU F 2 48  ? 135.611 121.996 125.570 1.00 33.51  ? 62   LEU F O     1 
ATOM   4325  C CB    . LEU F 2 48  ? 133.636 123.813 123.918 1.00 33.51  ? 62   LEU F CB    1 
ATOM   4326  C CG    . LEU F 2 48  ? 132.276 124.450 124.091 1.00 33.51  ? 62   LEU F CG    1 
ATOM   4327  C CD1   . LEU F 2 48  ? 131.405 124.078 122.935 1.00 33.51  ? 62   LEU F CD1   1 
ATOM   4328  C CD2   . LEU F 2 48  ? 131.690 124.000 125.383 1.00 33.51  ? 62   LEU F CD2   1 
ATOM   4329  N N     . GLU F 2 49  ? 136.863 123.313 124.225 1.00 36.48  ? 63   GLU F N     1 
ATOM   4330  C CA    . GLU F 2 49  ? 137.975 122.369 124.237 1.00 36.48  ? 63   GLU F CA    1 
ATOM   4331  C C     . GLU F 2 49  ? 138.561 122.212 125.628 1.00 36.48  ? 63   GLU F C     1 
ATOM   4332  O O     . GLU F 2 49  ? 138.796 121.085 126.076 1.00 36.48  ? 63   GLU F O     1 
ATOM   4333  C CB    . GLU F 2 49  ? 139.073 122.776 123.269 1.00 36.48  ? 63   GLU F CB    1 
ATOM   4334  C CG    . GLU F 2 49  ? 138.772 122.522 121.834 1.00 36.48  ? 63   GLU F CG    1 
ATOM   4335  C CD    . GLU F 2 49  ? 139.986 122.734 120.965 1.00 36.48  ? 63   GLU F CD    1 
ATOM   4336  O OE1   . GLU F 2 49  ? 141.048 123.081 121.515 1.00 36.48  ? 63   GLU F OE1   1 
ATOM   4337  O OE2   . GLU F 2 49  ? 139.882 122.572 119.733 1.00 36.48  ? 63   GLU F OE2   1 
ATOM   4338  N N     . ASN F 2 50  ? 138.771 123.324 126.338 1.00 32.20  ? 64   ASN F N     1 
ATOM   4339  C CA    . ASN F 2 50  ? 139.345 123.232 127.683 1.00 32.20  ? 64   ASN F CA    1 
ATOM   4340  C C     . ASN F 2 50  ? 138.418 122.497 128.644 1.00 32.20  ? 64   ASN F C     1 
ATOM   4341  O O     . ASN F 2 50  ? 138.857 121.595 129.381 1.00 32.20  ? 64   ASN F O     1 
ATOM   4342  C CB    . ASN F 2 50  ? 139.669 124.615 128.233 1.00 32.20  ? 64   ASN F CB    1 
ATOM   4343  C CG    . ASN F 2 50  ? 140.891 125.212 127.613 1.00 32.20  ? 64   ASN F CG    1 
ATOM   4344  O OD1   . ASN F 2 50  ? 141.835 124.505 127.288 1.00 32.20  ? 64   ASN F OD1   1 
ATOM   4345  N ND2   . ASN F 2 50  ? 140.909 126.530 127.490 1.00 32.20  ? 64   ASN F ND2   1 
ATOM   4346  N N     . VAL F 2 51  ? 137.120 122.823 128.613 1.00 22.95  ? 65   VAL F N     1 
ATOM   4347  C CA    . VAL F 2 51  ? 136.214 122.209 129.584 1.00 22.95  ? 65   VAL F CA    1 
ATOM   4348  C C     . VAL F 2 51  ? 136.020 120.725 129.290 1.00 22.95  ? 65   VAL F C     1 
ATOM   4349  O O     . VAL F 2 51  ? 136.036 119.890 130.206 1.00 22.95  ? 65   VAL F O     1 
ATOM   4350  C CB    . VAL F 2 51  ? 134.876 122.957 129.636 1.00 22.95  ? 65   VAL F CB    1 
ATOM   4351  C CG1   . VAL F 2 51  ? 134.013 122.375 130.695 1.00 22.95  ? 65   VAL F CG1   1 
ATOM   4352  C CG2   . VAL F 2 51  ? 135.117 124.395 129.960 1.00 22.95  ? 65   VAL F CG2   1 
ATOM   4353  N N     . ILE F 2 52  ? 135.917 120.355 128.011 1.00 24.82  ? 66   ILE F N     1 
ATOM   4354  C CA    . ILE F 2 52  ? 135.705 118.952 127.681 1.00 24.82  ? 66   ILE F CA    1 
ATOM   4355  C C     . ILE F 2 52  ? 136.969 118.137 127.893 1.00 24.82  ? 66   ILE F C     1 
ATOM   4356  O O     . ILE F 2 52  ? 136.885 116.977 128.302 1.00 24.82  ? 66   ILE F O     1 
ATOM   4357  C CB    . ILE F 2 52  ? 135.135 118.854 126.257 1.00 24.82  ? 66   ILE F CB    1 
ATOM   4358  C CG1   . ILE F 2 52  ? 133.719 119.391 126.279 1.00 24.82  ? 66   ILE F CG1   1 
ATOM   4359  C CG2   . ILE F 2 52  ? 135.083 117.449 125.734 1.00 24.82  ? 66   ILE F CG2   1 
ATOM   4360  C CD1   . ILE F 2 52  ? 133.129 119.576 124.933 1.00 24.82  ? 66   ILE F CD1   1 
ATOM   4361  N N     . ARG F 2 53  ? 138.153 118.731 127.713 1.00 26.04  ? 67   ARG F N     1 
ATOM   4362  C CA    . ARG F 2 53  ? 139.386 118.007 128.016 1.00 26.04  ? 67   ARG F CA    1 
ATOM   4363  C C     . ARG F 2 53  ? 139.493 117.684 129.496 1.00 26.04  ? 67   ARG F C     1 
ATOM   4364  O O     . ARG F 2 53  ? 139.872 116.567 129.867 1.00 26.04  ? 67   ARG F O     1 
ATOM   4365  C CB    . ARG F 2 53  ? 140.590 118.827 127.595 1.00 26.04  ? 67   ARG F CB    1 
ATOM   4366  C CG    . ARG F 2 53  ? 141.902 118.141 127.796 1.00 26.04  ? 67   ARG F CG    1 
ATOM   4367  C CD    . ARG F 2 53  ? 142.981 119.133 127.495 1.00 26.04  ? 67   ARG F CD    1 
ATOM   4368  N NE    . ARG F 2 53  ? 142.960 119.573 126.107 1.00 26.04  ? 67   ARG F NE    1 
ATOM   4369  C CZ    . ARG F 2 53  ? 143.571 120.671 125.681 1.00 26.04  ? 67   ARG F CZ    1 
ATOM   4370  N NH1   . ARG F 2 53  ? 144.209 121.438 126.547 1.00 26.04  ? 67   ARG F NH1   1 
ATOM   4371  N NH2   . ARG F 2 53  ? 143.522 121.022 124.403 1.00 26.04  ? 67   ARG F NH2   1 
ATOM   4372  N N     . ASP F 2 54  ? 139.109 118.631 130.356 1.00 23.62  ? 68   ASP F N     1 
ATOM   4373  C CA    . ASP F 2 54  ? 139.164 118.326 131.782 1.00 23.62  ? 68   ASP F CA    1 
ATOM   4374  C C     . ASP F 2 54  ? 138.081 117.330 132.197 1.00 23.62  ? 68   ASP F C     1 
ATOM   4375  O O     . ASP F 2 54  ? 138.335 116.464 133.048 1.00 23.62  ? 68   ASP F O     1 
ATOM   4376  C CB    . ASP F 2 54  ? 139.068 119.607 132.593 1.00 23.62  ? 68   ASP F CB    1 
ATOM   4377  C CG    . ASP F 2 54  ? 140.262 120.508 132.391 1.00 23.62  ? 68   ASP F CG    1 
ATOM   4378  O OD1   . ASP F 2 54  ? 141.355 119.984 132.100 1.00 23.62  ? 68   ASP F OD1   1 
ATOM   4379  O OD2   . ASP F 2 54  ? 140.111 121.740 132.519 1.00 23.62  ? 68   ASP F OD2   1 
ATOM   4380  N N     . ALA F 2 55  ? 136.896 117.390 131.582 1.00 23.52  ? 69   ALA F N     1 
ATOM   4381  C CA    . ALA F 2 55  ? 135.847 116.427 131.921 1.00 23.52  ? 69   ALA F CA    1 
ATOM   4382  C C     . ALA F 2 55  ? 136.191 115.022 131.450 1.00 23.52  ? 69   ALA F C     1 
ATOM   4383  O O     . ALA F 2 55  ? 135.901 114.042 132.140 1.00 23.52  ? 69   ALA F O     1 
ATOM   4384  C CB    . ALA F 2 55  ? 134.517 116.861 131.326 1.00 23.52  ? 69   ALA F CB    1 
ATOM   4385  N N     . VAL F 2 56  ? 136.835 114.902 130.292 1.00 17.88  ? 70   VAL F N     1 
ATOM   4386  C CA    . VAL F 2 56  ? 137.232 113.587 129.811 1.00 17.88  ? 70   VAL F CA    1 
ATOM   4387  C C     . VAL F 2 56  ? 138.412 113.059 130.615 1.00 17.88  ? 70   VAL F C     1 
ATOM   4388  O O     . VAL F 2 56  ? 138.539 111.846 130.803 1.00 17.88  ? 70   VAL F O     1 
ATOM   4389  C CB    . VAL F 2 56  ? 137.495 113.659 128.294 1.00 17.88  ? 70   VAL F CB    1 
ATOM   4390  C CG1   . VAL F 2 56  ? 138.095 112.395 127.739 1.00 17.88  ? 70   VAL F CG1   1 
ATOM   4391  C CG2   . VAL F 2 56  ? 136.202 113.898 127.594 1.00 17.88  ? 70   VAL F CG2   1 
ATOM   4392  N N     . THR F 2 57  ? 139.247 113.939 131.175 1.00 25.00  ? 71   THR F N     1 
ATOM   4393  C CA    . THR F 2 57  ? 140.285 113.460 132.085 1.00 25.00  ? 71   THR F CA    1 
ATOM   4394  C C     . THR F 2 57  ? 139.689 112.865 133.355 1.00 25.00  ? 71   THR F C     1 
ATOM   4395  O O     . THR F 2 57  ? 140.097 111.774 133.773 1.00 25.00  ? 71   THR F O     1 
ATOM   4396  C CB    . THR F 2 57  ? 141.254 114.580 132.424 1.00 25.00  ? 71   THR F CB    1 
ATOM   4397  O OG1   . THR F 2 57  ? 141.868 115.043 131.220 1.00 25.00  ? 71   THR F OG1   1 
ATOM   4398  C CG2   . THR F 2 57  ? 142.329 114.071 133.340 1.00 25.00  ? 71   THR F CG2   1 
ATOM   4399  N N     . TYR F 2 58  ? 138.686 113.533 133.942 1.00 18.58  ? 72   TYR F N     1 
ATOM   4400  C CA    . TYR F 2 58  ? 137.943 112.940 135.061 1.00 18.58  ? 72   TYR F CA    1 
ATOM   4401  C C     . TYR F 2 58  ? 137.292 111.612 134.693 1.00 18.58  ? 72   TYR F C     1 
ATOM   4402  O O     . TYR F 2 58  ? 137.358 110.639 135.462 1.00 18.58  ? 72   TYR F O     1 
ATOM   4403  C CB    . TYR F 2 58  ? 136.862 113.888 135.551 1.00 18.58  ? 72   TYR F CB    1 
ATOM   4404  C CG    . TYR F 2 58  ? 137.309 114.912 136.530 1.00 18.58  ? 72   TYR F CG    1 
ATOM   4405  C CD1   . TYR F 2 58  ? 137.301 114.637 137.872 1.00 18.58  ? 72   TYR F CD1   1 
ATOM   4406  C CD2   . TYR F 2 58  ? 137.739 116.147 136.119 1.00 18.58  ? 72   TYR F CD2   1 
ATOM   4407  C CE1   . TYR F 2 58  ? 137.703 115.568 138.781 1.00 18.58  ? 72   TYR F CE1   1 
ATOM   4408  C CE2   . TYR F 2 58  ? 138.158 117.083 137.018 1.00 18.58  ? 72   TYR F CE2   1 
ATOM   4409  C CZ    . TYR F 2 58  ? 138.140 116.785 138.346 1.00 18.58  ? 72   TYR F CZ    1 
ATOM   4410  O OH    . TYR F 2 58  ? 138.553 117.730 139.255 1.00 18.58  ? 72   TYR F OH    1 
ATOM   4411  N N     . THR F 2 59  ? 136.663 111.553 133.522 1.00 25.00  ? 73   THR F N     1 
ATOM   4412  C CA    . THR F 2 59  ? 135.932 110.357 133.122 1.00 25.00  ? 73   THR F CA    1 
ATOM   4413  C C     . THR F 2 59  ? 136.865 109.178 132.879 1.00 25.00  ? 73   THR F C     1 
ATOM   4414  O O     . THR F 2 59  ? 136.644 108.088 133.416 1.00 25.00  ? 73   THR F O     1 
ATOM   4415  C CB    . THR F 2 59  ? 135.105 110.661 131.885 1.00 25.00  ? 73   THR F CB    1 
ATOM   4416  O OG1   . THR F 2 59  ? 134.054 111.559 132.237 1.00 25.00  ? 73   THR F OG1   1 
ATOM   4417  C CG2   . THR F 2 59  ? 134.517 109.420 131.320 1.00 25.00  ? 73   THR F CG2   1 
ATOM   4418  N N     . GLU F 2 60  ? 137.930 109.378 132.103 1.00 28.58  ? 74   GLU F N     1 
ATOM   4419  C CA    . GLU F 2 60  ? 138.911 108.317 131.911 1.00 28.58  ? 74   GLU F CA    1 
ATOM   4420  C C     . GLU F 2 60  ? 139.648 107.943 133.181 1.00 28.58  ? 74   GLU F C     1 
ATOM   4421  O O     . GLU F 2 60  ? 140.163 106.826 133.259 1.00 28.58  ? 74   GLU F O     1 
ATOM   4422  C CB    . GLU F 2 60  ? 139.962 108.687 130.878 1.00 28.58  ? 74   GLU F CB    1 
ATOM   4423  C CG    . GLU F 2 60  ? 139.534 108.584 129.451 1.00 28.58  ? 74   GLU F CG    1 
ATOM   4424  C CD    . GLU F 2 60  ? 140.676 108.902 128.515 1.00 28.58  ? 74   GLU F CD    1 
ATOM   4425  O OE1   . GLU F 2 60  ? 141.733 109.346 129.009 1.00 28.58  ? 74   GLU F OE1   1 
ATOM   4426  O OE2   . GLU F 2 60  ? 140.526 108.699 127.294 1.00 28.58  ? 74   GLU F OE2   1 
ATOM   4427  N N     . HIS F 2 61  ? 139.737 108.833 134.168 1.00 24.66  ? 75   HIS F N     1 
ATOM   4428  C CA    . HIS F 2 61  ? 140.238 108.366 135.452 1.00 24.66  ? 75   HIS F CA    1 
ATOM   4429  C C     . HIS F 2 61  ? 139.262 107.427 136.122 1.00 24.66  ? 75   HIS F C     1 
ATOM   4430  O O     . HIS F 2 61  ? 139.665 106.401 136.676 1.00 24.66  ? 75   HIS F O     1 
ATOM   4431  C CB    . HIS F 2 61  ? 140.521 109.503 136.406 1.00 24.66  ? 75   HIS F CB    1 
ATOM   4432  C CG    . HIS F 2 61  ? 140.787 109.021 137.791 1.00 24.66  ? 75   HIS F CG    1 
ATOM   4433  N ND1   . HIS F 2 61  ? 141.945 108.367 138.136 1.00 24.66  ? 75   HIS F ND1   1 
ATOM   4434  C CD2   . HIS F 2 61  ? 140.010 109.019 138.897 1.00 24.66  ? 75   HIS F CD2   1 
ATOM   4435  C CE1   . HIS F 2 61  ? 141.890 108.024 139.409 1.00 24.66  ? 75   HIS F CE1   1 
ATOM   4436  N NE2   . HIS F 2 61  ? 140.722 108.401 139.892 1.00 24.66  ? 75   HIS F NE2   1 
ATOM   4437  N N     . ALA F 2 62  ? 137.981 107.752 136.097 1.00 26.05  ? 76   ALA F N     1 
ATOM   4438  C CA    . ALA F 2 62  ? 137.067 106.965 136.910 1.00 26.05  ? 76   ALA F CA    1 
ATOM   4439  C C     . ALA F 2 62  ? 136.691 105.625 136.288 1.00 26.05  ? 76   ALA F C     1 
ATOM   4440  O O     . ALA F 2 62  ? 135.818 104.954 136.843 1.00 26.05  ? 76   ALA F O     1 
ATOM   4441  C CB    . ALA F 2 62  ? 135.807 107.773 137.204 1.00 26.05  ? 76   ALA F CB    1 
ATOM   4442  N N     . LYS F 2 63  ? 137.337 105.234 135.185 1.00 29.66  ? 77   LYS F N     1 
ATOM   4443  C CA    . LYS F 2 63  ? 137.106 103.990 134.449 1.00 29.66  ? 77   LYS F CA    1 
ATOM   4444  C C     . LYS F 2 63  ? 135.642 103.865 134.028 1.00 29.66  ? 77   LYS F C     1 
ATOM   4445  O O     . LYS F 2 63  ? 134.898 103.000 134.484 1.00 29.66  ? 77   LYS F O     1 
ATOM   4446  C CB    . LYS F 2 63  ? 137.539 102.757 135.246 1.00 29.66  ? 77   LYS F CB    1 
ATOM   4447  C CG    . LYS F 2 63  ? 139.017 102.636 135.470 1.00 29.66  ? 77   LYS F CG    1 
ATOM   4448  C CD    . LYS F 2 63  ? 139.313 101.295 136.095 1.00 29.66  ? 77   LYS F CD    1 
ATOM   4449  C CE    . LYS F 2 63  ? 140.792 101.073 136.282 1.00 29.66  ? 77   LYS F CE    1 
ATOM   4450  N NZ    . LYS F 2 63  ? 141.306 101.931 137.365 1.00 29.66  ? 77   LYS F NZ    1 
ATOM   4451  N N     . ARG F 2 64  ? 135.253 104.773 133.148 1.00 35.70  ? 78   ARG F N     1 
ATOM   4452  C CA    . ARG F 2 64  ? 133.887 104.825 132.670 1.00 35.70  ? 78   ARG F CA    1 
ATOM   4453  C C     . ARG F 2 64  ? 133.910 105.514 131.322 1.00 35.70  ? 78   ARG F C     1 
ATOM   4454  O O     . ARG F 2 64  ? 134.906 106.124 130.942 1.00 35.70  ? 78   ARG F O     1 
ATOM   4455  C CB    . ARG F 2 64  ? 133.000 105.553 133.667 1.00 35.70  ? 78   ARG F CB    1 
ATOM   4456  C CG    . ARG F 2 64  ? 133.411 106.967 133.842 1.00 35.70  ? 78   ARG F CG    1 
ATOM   4457  C CD    . ARG F 2 64  ? 132.800 107.595 135.060 1.00 35.70  ? 78   ARG F CD    1 
ATOM   4458  N NE    . ARG F 2 64  ? 131.365 107.740 134.992 1.00 35.70  ? 78   ARG F NE    1 
ATOM   4459  C CZ    . ARG F 2 64  ? 130.628 108.003 136.056 1.00 35.70  ? 78   ARG F CZ    1 
ATOM   4460  N NH1   . ARG F 2 64  ? 131.213 108.133 137.234 1.00 35.70  ? 78   ARG F NH1   1 
ATOM   4461  N NH2   . ARG F 2 64  ? 129.317 108.123 135.952 1.00 35.70  ? 78   ARG F NH2   1 
ATOM   4462  N N     . LYS F 2 65  ? 132.822 105.371 130.584 1.00 48.30  ? 79   LYS F N     1 
ATOM   4463  C CA    . LYS F 2 65  ? 132.712 105.939 129.253 1.00 48.30  ? 79   LYS F CA    1 
ATOM   4464  C C     . LYS F 2 65  ? 131.719 107.079 129.194 1.00 48.30  ? 79   LYS F C     1 
ATOM   4465  O O     . LYS F 2 65  ? 131.572 107.701 128.139 1.00 48.30  ? 79   LYS F O     1 
ATOM   4466  C CB    . LYS F 2 65  ? 132.296 104.865 128.249 1.00 48.30  ? 79   LYS F CB    1 
ATOM   4467  C CG    . LYS F 2 65  ? 133.374 103.866 127.919 1.00 48.30  ? 79   LYS F CG    1 
ATOM   4468  C CD    . LYS F 2 65  ? 132.782 102.698 127.152 1.00 48.30  ? 79   LYS F CD    1 
ATOM   4469  C CE    . LYS F 2 65  ? 132.296 103.123 125.779 1.00 48.30  ? 79   LYS F CE    1 
ATOM   4470  N NZ    . LYS F 2 65  ? 131.753 101.973 125.007 1.00 48.30  ? 79   LYS F NZ    1 
ATOM   4471  N N     . THR F 2 66  ? 131.043 107.371 130.290 1.00 42.67  ? 80   THR F N     1 
ATOM   4472  C CA    . THR F 2 66  ? 129.902 108.269 130.300 1.00 42.67  ? 80   THR F CA    1 
ATOM   4473  C C     . THR F 2 66  ? 130.300 109.555 131.003 1.00 42.67  ? 80   THR F C     1 
ATOM   4474  O O     . THR F 2 66  ? 130.393 109.598 132.231 1.00 42.67  ? 80   THR F O     1 
ATOM   4475  C CB    . THR F 2 66  ? 128.727 107.607 130.988 1.00 42.67  ? 80   THR F CB    1 
ATOM   4476  O OG1   . THR F 2 66  ? 128.443 106.371 130.333 1.00 42.67  ? 80   THR F OG1   1 
ATOM   4477  C CG2   . THR F 2 66  ? 127.522 108.477 130.895 1.00 42.67  ? 80   THR F CG2   1 
ATOM   4478  N N     . VAL F 2 67  ? 130.565 110.590 130.211 1.00 30.24  ? 81   VAL F N     1 
ATOM   4479  C CA    . VAL F 2 67  ? 130.689 111.938 130.738 1.00 30.24  ? 81   VAL F CA    1 
ATOM   4480  C C     . VAL F 2 67  ? 129.378 112.332 131.387 1.00 30.24  ? 81   VAL F C     1 
ATOM   4481  O O     . VAL F 2 67  ? 128.321 112.233 130.765 1.00 30.24  ? 81   VAL F O     1 
ATOM   4482  C CB    . VAL F 2 67  ? 131.041 112.890 129.596 1.00 30.24  ? 81   VAL F CB    1 
ATOM   4483  C CG1   . VAL F 2 67  ? 131.126 114.291 130.101 1.00 30.24  ? 81   VAL F CG1   1 
ATOM   4484  C CG2   . VAL F 2 67  ? 132.316 112.445 128.945 1.00 30.24  ? 81   VAL F CG2   1 
ATOM   4485  N N     . THR F 2 68  ? 129.424 112.760 132.636 1.00 26.60  ? 82   THR F N     1 
ATOM   4486  C CA    . THR F 2 68  ? 128.189 113.072 133.338 1.00 26.60  ? 82   THR F CA    1 
ATOM   4487  C C     . THR F 2 68  ? 128.154 114.527 133.776 1.00 26.60  ? 82   THR F C     1 
ATOM   4488  O O     . THR F 2 68  ? 129.088 115.315 133.542 1.00 26.60  ? 82   THR F O     1 
ATOM   4489  C CB    . THR F 2 68  ? 127.994 112.183 134.563 1.00 26.60  ? 82   THR F CB    1 
ATOM   4490  O OG1   . THR F 2 68  ? 129.080 112.377 135.470 1.00 26.60  ? 82   THR F OG1   1 
ATOM   4491  C CG2   . THR F 2 68  ? 127.938 110.743 134.173 1.00 26.60  ? 82   THR F CG2   1 
ATOM   4492  N N     . ALA F 2 69  ? 127.043 114.847 134.443 1.00 24.47  ? 83   ALA F N     1 
ATOM   4493  C CA    . ALA F 2 69  ? 126.823 116.182 134.969 1.00 24.47  ? 83   ALA F CA    1 
ATOM   4494  C C     . ALA F 2 69  ? 127.890 116.543 135.980 1.00 24.47  ? 83   ALA F C     1 
ATOM   4495  O O     . ALA F 2 69  ? 128.461 117.633 135.923 1.00 24.47  ? 83   ALA F O     1 
ATOM   4496  C CB    . ALA F 2 69  ? 125.444 116.266 135.610 1.00 24.47  ? 83   ALA F CB    1 
ATOM   4497  N N     . MET F 2 70  ? 128.203 115.618 136.884 1.00 27.26  ? 84   MET F N     1 
ATOM   4498  C CA    . MET F 2 70  ? 129.194 115.895 137.913 1.00 27.26  ? 84   MET F CA    1 
ATOM   4499  C C     . MET F 2 70  ? 130.591 116.001 137.343 1.00 27.26  ? 84   MET F C     1 
ATOM   4500  O O     . MET F 2 70  ? 131.411 116.746 137.879 1.00 27.26  ? 84   MET F O     1 
ATOM   4501  C CB    . MET F 2 70  ? 129.171 114.811 138.974 1.00 27.26  ? 84   MET F CB    1 
ATOM   4502  C CG    . MET F 2 70  ? 127.869 114.749 139.691 1.00 27.26  ? 84   MET F CG    1 
ATOM   4503  S SD    . MET F 2 70  ? 127.500 116.377 140.319 1.00 27.26  ? 84   MET F SD    1 
ATOM   4504  C CE    . MET F 2 70  ? 128.732 116.540 141.592 1.00 27.26  ? 84   MET F CE    1 
ATOM   4505  N N     . ASP F 2 71  ? 130.884 115.276 136.266 1.00 24.22  ? 85   ASP F N     1 
ATOM   4506  C CA    . ASP F 2 71  ? 132.196 115.416 135.657 1.00 24.22  ? 85   ASP F CA    1 
ATOM   4507  C C     . ASP F 2 71  ? 132.368 116.786 135.028 1.00 24.22  ? 85   ASP F C     1 
ATOM   4508  O O     . ASP F 2 71  ? 133.425 117.417 135.179 1.00 24.22  ? 85   ASP F O     1 
ATOM   4509  C CB    . ASP F 2 71  ? 132.421 114.324 134.628 1.00 24.22  ? 85   ASP F CB    1 
ATOM   4510  C CG    . ASP F 2 71  ? 132.688 112.989 135.266 1.00 24.22  ? 85   ASP F CG    1 
ATOM   4511  O OD1   . ASP F 2 71  ? 133.175 112.988 136.411 1.00 24.22  ? 85   ASP F OD1   1 
ATOM   4512  O OD2   . ASP F 2 71  ? 132.435 111.941 134.632 1.00 24.22  ? 85   ASP F OD2   1 
ATOM   4513  N N     . VAL F 2 72  ? 131.329 117.295 134.369 1.00 18.93  ? 86   VAL F N     1 
ATOM   4514  C CA    . VAL F 2 72  ? 131.481 118.633 133.812 1.00 18.93  ? 86   VAL F CA    1 
ATOM   4515  C C     . VAL F 2 72  ? 131.473 119.688 134.914 1.00 18.93  ? 86   VAL F C     1 
ATOM   4516  O O     . VAL F 2 72  ? 132.211 120.674 134.831 1.00 18.93  ? 86   VAL F O     1 
ATOM   4517  C CB    . VAL F 2 72  ? 130.408 118.874 132.748 1.00 18.93  ? 86   VAL F CB    1 
ATOM   4518  C CG1   . VAL F 2 72  ? 130.500 120.248 132.187 1.00 18.93  ? 86   VAL F CG1   1 
ATOM   4519  C CG2   . VAL F 2 72  ? 130.591 117.895 131.639 1.00 18.93  ? 86   VAL F CG2   1 
ATOM   4520  N N     . VAL F 2 73  ? 130.725 119.464 135.997 1.00 18.84  ? 87   VAL F N     1 
ATOM   4521  C CA    . VAL F 2 73  ? 130.722 120.417 137.105 1.00 18.84  ? 87   VAL F CA    1 
ATOM   4522  C C     . VAL F 2 73  ? 132.079 120.450 137.808 1.00 18.84  ? 87   VAL F C     1 
ATOM   4523  O O     . VAL F 2 73  ? 132.559 121.521 138.193 1.00 18.84  ? 87   VAL F O     1 
ATOM   4524  C CB    . VAL F 2 73  ? 129.562 120.108 138.066 1.00 18.84  ? 87   VAL F CB    1 
ATOM   4525  C CG1   . VAL F 2 73  ? 129.643 120.928 139.321 1.00 18.84  ? 87   VAL F CG1   1 
ATOM   4526  C CG2   . VAL F 2 73  ? 128.283 120.459 137.402 1.00 18.84  ? 87   VAL F CG2   1 
ATOM   4527  N N     . TYR F 2 74  ? 132.762 119.312 137.905 1.00 22.10  ? 88   TYR F N     1 
ATOM   4528  C CA    . TYR F 2 74  ? 134.089 119.314 138.515 1.00 22.10  ? 88   TYR F CA    1 
ATOM   4529  C C     . TYR F 2 74  ? 135.116 119.972 137.610 1.00 22.10  ? 88   TYR F C     1 
ATOM   4530  O O     . TYR F 2 74  ? 136.020 120.674 138.092 1.00 22.10  ? 88   TYR F O     1 
ATOM   4531  C CB    . TYR F 2 74  ? 134.503 117.892 138.846 1.00 22.10  ? 88   TYR F CB    1 
ATOM   4532  C CG    . TYR F 2 74  ? 133.725 117.309 139.988 1.00 22.10  ? 88   TYR F CG    1 
ATOM   4533  C CD1   . TYR F 2 74  ? 133.159 118.123 140.947 1.00 22.10  ? 88   TYR F CD1   1 
ATOM   4534  C CD2   . TYR F 2 74  ? 133.521 115.949 140.081 1.00 22.10  ? 88   TYR F CD2   1 
ATOM   4535  C CE1   . TYR F 2 74  ? 132.436 117.597 141.981 1.00 22.10  ? 88   TYR F CE1   1 
ATOM   4536  C CE2   . TYR F 2 74  ? 132.802 115.411 141.109 1.00 22.10  ? 88   TYR F CE2   1 
ATOM   4537  C CZ    . TYR F 2 74  ? 132.259 116.238 142.057 1.00 22.10  ? 88   TYR F CZ    1 
ATOM   4538  O OH    . TYR F 2 74  ? 131.535 115.704 143.095 1.00 22.10  ? 88   TYR F OH    1 
ATOM   4539  N N     . ALA F 2 75  ? 134.993 119.765 136.296 1.00 18.80  ? 89   ALA F N     1 
ATOM   4540  C CA    . ALA F 2 75  ? 135.907 120.425 135.374 1.00 18.80  ? 89   ALA F CA    1 
ATOM   4541  C C     . ALA F 2 75  ? 135.702 121.929 135.373 1.00 18.80  ? 89   ALA F C     1 
ATOM   4542  O O     . ALA F 2 75  ? 136.666 122.693 135.272 1.00 18.80  ? 89   ALA F O     1 
ATOM   4543  C CB    . ALA F 2 75  ? 135.717 119.874 133.976 1.00 18.80  ? 89   ALA F CB    1 
ATOM   4544  N N     . LEU F 2 76  ? 134.460 122.369 135.531 1.00 15.79  ? 90   LEU F N     1 
ATOM   4545  C CA    . LEU F 2 76  ? 134.195 123.792 135.651 1.00 15.79  ? 90   LEU F CA    1 
ATOM   4546  C C     . LEU F 2 76  ? 134.638 124.333 136.994 1.00 15.79  ? 90   LEU F C     1 
ATOM   4547  O O     . LEU F 2 76  ? 134.977 125.514 137.093 1.00 15.79  ? 90   LEU F O     1 
ATOM   4548  C CB    . LEU F 2 76  ? 132.714 124.072 135.455 1.00 15.79  ? 90   LEU F CB    1 
ATOM   4549  C CG    . LEU F 2 76  ? 132.083 123.930 134.085 1.00 15.79  ? 90   LEU F CG    1 
ATOM   4550  C CD1   . LEU F 2 76  ? 130.610 124.076 134.252 1.00 15.79  ? 90   LEU F CD1   1 
ATOM   4551  C CD2   . LEU F 2 76  ? 132.606 124.979 133.167 1.00 15.79  ? 90   LEU F CD2   1 
ATOM   4552  N N     . LYS F 2 77  ? 134.619 123.512 138.041 1.00 19.83  ? 91   LYS F N     1 
ATOM   4553  C CA    . LYS F 2 77  ? 135.008 124.029 139.342 1.00 19.83  ? 91   LYS F CA    1 
ATOM   4554  C C     . LYS F 2 77  ? 136.505 124.259 139.400 1.00 19.83  ? 91   LYS F C     1 
ATOM   4555  O O     . LYS F 2 77  ? 136.962 125.245 139.985 1.00 19.83  ? 91   LYS F O     1 
ATOM   4556  C CB    . LYS F 2 77  ? 134.578 123.093 140.466 1.00 19.83  ? 91   LYS F CB    1 
ATOM   4557  C CG    . LYS F 2 77  ? 134.716 123.763 141.820 1.00 19.83  ? 91   LYS F CG    1 
ATOM   4558  C CD    . LYS F 2 77  ? 134.242 122.918 142.986 1.00 19.83  ? 91   LYS F CD    1 
ATOM   4559  C CE    . LYS F 2 77  ? 135.297 121.925 143.426 1.00 19.83  ? 91   LYS F CE    1 
ATOM   4560  N NZ    . LYS F 2 77  ? 134.899 121.227 144.686 1.00 19.83  ? 91   LYS F NZ    1 
ATOM   4561  N N     . ARG F 2 78  ? 137.288 123.394 138.773 1.00 22.69  ? 92   ARG F N     1 
ATOM   4562  C CA    . ARG F 2 78  ? 138.704 123.726 138.725 1.00 22.69  ? 92   ARG F CA    1 
ATOM   4563  C C     . ARG F 2 78  ? 139.057 124.608 137.545 1.00 22.69  ? 92   ARG F C     1 
ATOM   4564  O O     . ARG F 2 78  ? 140.211 125.021 137.425 1.00 22.69  ? 92   ARG F O     1 
ATOM   4565  C CB    . ARG F 2 78  ? 139.587 122.487 138.677 1.00 22.69  ? 92   ARG F CB    1 
ATOM   4566  C CG    . ARG F 2 78  ? 139.539 121.758 137.383 1.00 22.69  ? 92   ARG F CG    1 
ATOM   4567  C CD    . ARG F 2 78  ? 140.634 120.746 137.361 1.00 22.69  ? 92   ARG F CD    1 
ATOM   4568  N NE    . ARG F 2 78  ? 141.913 121.436 137.422 1.00 22.69  ? 92   ARG F NE    1 
ATOM   4569  C CZ    . ARG F 2 78  ? 142.536 121.942 136.366 1.00 22.69  ? 92   ARG F CZ    1 
ATOM   4570  N NH1   . ARG F 2 78  ? 142.005 121.825 135.159 1.00 22.69  ? 92   ARG F NH1   1 
ATOM   4571  N NH2   . ARG F 2 78  ? 143.691 122.562 136.520 1.00 22.69  ? 92   ARG F NH2   1 
ATOM   4572  N N     . GLN F 2 79  ? 138.108 124.888 136.662 1.00 25.47  ? 93   GLN F N     1 
ATOM   4573  C CA    . GLN F 2 79  ? 138.342 125.912 135.657 1.00 25.47  ? 93   GLN F CA    1 
ATOM   4574  C C     . GLN F 2 79  ? 138.368 127.299 136.279 1.00 25.47  ? 93   GLN F C     1 
ATOM   4575  O O     . GLN F 2 79  ? 139.108 128.172 135.825 1.00 25.47  ? 93   GLN F O     1 
ATOM   4576  C CB    . GLN F 2 79  ? 137.246 125.825 134.601 1.00 25.47  ? 93   GLN F CB    1 
ATOM   4577  C CG    . GLN F 2 79  ? 137.429 126.718 133.430 1.00 25.47  ? 93   GLN F CG    1 
ATOM   4578  C CD    . GLN F 2 79  ? 138.666 126.365 132.688 1.00 25.47  ? 93   GLN F CD    1 
ATOM   4579  O OE1   . GLN F 2 79  ? 139.669 127.058 132.776 1.00 25.47  ? 93   GLN F OE1   1 
ATOM   4580  N NE2   . GLN F 2 79  ? 138.619 125.265 131.960 1.00 25.47  ? 93   GLN F NE2   1 
ATOM   4581  N N     . GLY F 2 80  ? 137.584 127.507 137.331 1.00 23.16  ? 94   GLY F N     1 
ATOM   4582  C CA    . GLY F 2 80  ? 137.345 128.813 137.906 1.00 23.16  ? 94   GLY F CA    1 
ATOM   4583  C C     . GLY F 2 80  ? 135.871 129.143 137.819 1.00 23.16  ? 94   GLY F C     1 
ATOM   4584  O O     . GLY F 2 80  ? 135.256 129.583 138.789 1.00 23.16  ? 94   GLY F O     1 
ATOM   4585  N N     . ARG F 2 81  ? 135.286 128.858 136.661 1.00 24.19  ? 95   ARG F N     1 
ATOM   4586  C CA    . ARG F 2 81  ? 133.882 129.129 136.369 1.00 24.19  ? 95   ARG F CA    1 
ATOM   4587  C C     . ARG F 2 81  ? 133.014 128.108 137.101 1.00 24.19  ? 95   ARG F C     1 
ATOM   4588  O O     . ARG F 2 81  ? 132.578 127.109 136.535 1.00 24.19  ? 95   ARG F O     1 
ATOM   4589  C CB    . ARG F 2 81  ? 133.647 129.043 134.865 1.00 24.19  ? 95   ARG F CB    1 
ATOM   4590  C CG    . ARG F 2 81  ? 134.529 129.937 134.013 1.00 24.19  ? 95   ARG F CG    1 
ATOM   4591  C CD    . ARG F 2 81  ? 134.083 131.373 134.109 1.00 24.19  ? 95   ARG F CD    1 
ATOM   4592  N NE    . ARG F 2 81  ? 134.878 132.267 133.277 1.00 24.19  ? 95   ARG F NE    1 
ATOM   4593  C CZ    . ARG F 2 81  ? 134.675 133.578 133.193 1.00 24.19  ? 95   ARG F CZ    1 
ATOM   4594  N NH1   . ARG F 2 81  ? 133.691 134.143 133.878 1.00 24.19  ? 95   ARG F NH1   1 
ATOM   4595  N NH2   . ARG F 2 81  ? 135.443 134.326 132.415 1.00 24.19  ? 95   ARG F NH2   1 
ATOM   4596  N N     . THR F 2 82  ? 132.743 128.369 138.375 1.00 20.68  ? 96   THR F N     1 
ATOM   4597  C CA    . THR F 2 82  ? 131.911 127.469 139.165 1.00 20.68  ? 96   THR F CA    1 
ATOM   4598  C C     . THR F 2 82  ? 130.460 127.526 138.696 1.00 20.68  ? 96   THR F C     1 
ATOM   4599  O O     . THR F 2 82  ? 129.938 128.599 138.394 1.00 20.68  ? 96   THR F O     1 
ATOM   4600  C CB    . THR F 2 82  ? 131.998 127.854 140.637 1.00 20.68  ? 96   THR F CB    1 
ATOM   4601  O OG1   . THR F 2 82  ? 133.372 127.991 141.001 1.00 20.68  ? 96   THR F OG1   1 
ATOM   4602  C CG2   . THR F 2 82  ? 131.409 126.776 141.502 1.00 20.68  ? 96   THR F CG2   1 
ATOM   4603  N N     . LEU F 2 83  ? 129.805 126.368 138.626 1.00 20.40  ? 97   LEU F N     1 
ATOM   4604  C CA    . LEU F 2 83  ? 128.421 126.254 138.179 1.00 20.40  ? 97   LEU F CA    1 
ATOM   4605  C C     . LEU F 2 83  ? 127.562 125.658 139.280 1.00 20.40  ? 97   LEU F C     1 
ATOM   4606  O O     . LEU F 2 83  ? 127.955 124.681 139.916 1.00 20.40  ? 97   LEU F O     1 
ATOM   4607  C CB    . LEU F 2 83  ? 128.312 125.372 136.940 1.00 20.40  ? 97   LEU F CB    1 
ATOM   4608  C CG    . LEU F 2 83  ? 126.934 125.177 136.325 1.00 20.40  ? 97   LEU F CG    1 
ATOM   4609  C CD1   . LEU F 2 83  ? 126.473 126.460 135.774 1.00 20.40  ? 97   LEU F CD1   1 
ATOM   4610  C CD2   . LEU F 2 83  ? 126.963 124.129 135.255 1.00 20.40  ? 97   LEU F CD2   1 
ATOM   4611  N N     . TYR F 2 84  ? 126.388 126.241 139.503 1.00 16.05  ? 98   TYR F N     1 
ATOM   4612  C CA    . TYR F 2 84  ? 125.440 125.705 140.465 1.00 16.05  ? 98   TYR F CA    1 
ATOM   4613  C C     . TYR F 2 84  ? 124.224 125.121 139.777 1.00 16.05  ? 98   TYR F C     1 
ATOM   4614  O O     . TYR F 2 84  ? 123.837 125.540 138.686 1.00 16.05  ? 98   TYR F O     1 
ATOM   4615  C CB    . TYR F 2 84  ? 124.929 126.753 141.442 1.00 16.05  ? 98   TYR F CB    1 
ATOM   4616  C CG    . TYR F 2 84  ? 125.887 127.211 142.483 1.00 16.05  ? 98   TYR F CG    1 
ATOM   4617  C CD1   . TYR F 2 84  ? 127.135 126.647 142.605 1.00 16.05  ? 98   TYR F CD1   1 
ATOM   4618  C CD2   . TYR F 2 84  ? 125.509 128.163 143.398 1.00 16.05  ? 98   TYR F CD2   1 
ATOM   4619  C CE1   . TYR F 2 84  ? 128.004 127.063 143.571 1.00 16.05  ? 98   TYR F CE1   1 
ATOM   4620  C CE2   . TYR F 2 84  ? 126.366 128.583 144.361 1.00 16.05  ? 98   TYR F CE2   1 
ATOM   4621  C CZ    . TYR F 2 84  ? 127.612 128.035 144.437 1.00 16.05  ? 98   TYR F CZ    1 
ATOM   4622  O OH    . TYR F 2 84  ? 128.470 128.461 145.407 1.00 16.05  ? 98   TYR F OH    1 
ATOM   4623  N N     . GLY F 2 85  ? 123.607 124.165 140.447 1.00 22.20  ? 99   GLY F N     1 
ATOM   4624  C CA    . GLY F 2 85  ? 122.330 123.658 140.016 1.00 22.20  ? 99   GLY F CA    1 
ATOM   4625  C C     . GLY F 2 85  ? 122.355 122.197 139.649 1.00 22.20  ? 99   GLY F C     1 
ATOM   4626  O O     . GLY F 2 85  ? 121.459 121.438 140.020 1.00 22.20  ? 99   GLY F O     1 
ATOM   4627  N N     . PHE F 2 86  ? 123.385 121.783 138.935 1.00 22.71  ? 100  PHE F N     1 
ATOM   4628  C CA    . PHE F 2 86  ? 123.390 120.477 138.306 1.00 22.71  ? 100  PHE F CA    1 
ATOM   4629  C C     . PHE F 2 86  ? 124.010 119.398 139.169 1.00 22.71  ? 100  PHE F C     1 
ATOM   4630  O O     . PHE F 2 86  ? 124.136 118.260 138.714 1.00 22.71  ? 100  PHE F O     1 
ATOM   4631  C CB    . PHE F 2 86  ? 124.102 120.582 136.964 1.00 22.71  ? 100  PHE F CB    1 
ATOM   4632  C CG    . PHE F 2 86  ? 123.316 121.338 135.948 1.00 22.71  ? 100  PHE F CG    1 
ATOM   4633  C CD1   . PHE F 2 86  ? 121.945 121.393 136.035 1.00 22.71  ? 100  PHE F CD1   1 
ATOM   4634  C CD2   . PHE F 2 86  ? 123.936 122.040 134.950 1.00 22.71  ? 100  PHE F CD2   1 
ATOM   4635  C CE1   . PHE F 2 86  ? 121.202 122.093 135.116 1.00 22.71  ? 100  PHE F CE1   1 
ATOM   4636  C CE2   . PHE F 2 86  ? 123.190 122.753 134.037 1.00 22.71  ? 100  PHE F CE2   1 
ATOM   4637  C CZ    . PHE F 2 86  ? 121.829 122.774 134.120 1.00 22.71  ? 100  PHE F CZ    1 
ATOM   4638  N N     . GLY F 2 87  ? 124.368 119.712 140.405 1.00 28.17  ? 101  GLY F N     1 
ATOM   4639  C CA    . GLY F 2 87  ? 124.909 118.702 141.286 1.00 28.17  ? 101  GLY F CA    1 
ATOM   4640  C C     . GLY F 2 87  ? 125.599 119.268 142.505 1.00 28.17  ? 101  GLY F C     1 
ATOM   4641  O O     . GLY F 2 87  ? 126.182 120.353 142.448 1.00 28.17  ? 101  GLY F O     1 
ATOM   4642  N N     . GLY F 2 88  ? 125.547 118.530 143.609 1.00 30.31  ? 102  GLY F N     1 
ATOM   4643  C CA    . GLY F 2 88  ? 126.079 118.977 144.885 1.00 30.31  ? 102  GLY F CA    1 
ATOM   4644  C C     . GLY F 2 88  ? 127.581 119.158 144.959 1.00 30.31  ? 102  GLY F C     1 
ATOM   4645  O O     . GLY F 2 88  ? 128.316 118.770 144.055 1.00 30.31  ? 102  GLY F O     1 
ATOM   4646  O OXT   . GLY F 2 88  ? 128.102 119.713 145.927 1.00 30.31  ? 102  GLY F OXT   1 
ATOM   4647  N N     . LYS G 3 1   ? 171.202 87.764  162.094 1.00 116.86 ? 9    LYS G N     1 
ATOM   4648  C CA    . LYS G 3 1   ? 171.924 89.029  162.054 1.00 116.86 ? 9    LYS G CA    1 
ATOM   4649  C C     . LYS G 3 1   ? 170.995 90.199  161.786 1.00 116.86 ? 9    LYS G C     1 
ATOM   4650  O O     . LYS G 3 1   ? 169.872 90.018  161.309 1.00 116.86 ? 9    LYS G O     1 
ATOM   4651  C CB    . LYS G 3 1   ? 173.013 88.996  160.983 1.00 116.86 ? 9    LYS G CB    1 
ATOM   4652  C CG    . LYS G 3 1   ? 174.123 88.004  161.251 1.00 116.86 ? 9    LYS G CG    1 
ATOM   4653  C CD    . LYS G 3 1   ? 174.867 88.378  162.519 1.00 116.86 ? 9    LYS G CD    1 
ATOM   4654  C CE    . LYS G 3 1   ? 175.652 89.667  162.341 1.00 116.86 ? 9    LYS G CE    1 
ATOM   4655  N NZ    . LYS G 3 1   ? 176.430 90.019  163.562 1.00 116.86 ? 9    LYS G NZ    1 
ATOM   4656  N N     . THR G 3 2   ? 171.467 91.401  162.107 1.00 115.24 ? 10   THR G N     1 
ATOM   4657  C CA    . THR G 3 2   ? 170.797 92.617  161.665 1.00 115.24 ? 10   THR G CA    1 
ATOM   4658  C C     . THR G 3 2   ? 170.929 92.703  160.151 1.00 115.24 ? 10   THR G C     1 
ATOM   4659  O O     . THR G 3 2   ? 172.046 92.754  159.625 1.00 115.24 ? 10   THR G O     1 
ATOM   4660  C CB    . THR G 3 2   ? 171.403 93.843  162.341 1.00 115.24 ? 10   THR G CB    1 
ATOM   4661  O OG1   . THR G 3 2   ? 172.773 93.981  161.947 1.00 115.24 ? 10   THR G OG1   1 
ATOM   4662  C CG2   . THR G 3 2   ? 171.342 93.700  163.850 1.00 115.24 ? 10   THR G CG2   1 
ATOM   4663  N N     . ARG G 3 3   ? 169.798 92.672  159.452 1.00 111.45 ? 11   ARG G N     1 
ATOM   4664  C CA    . ARG G 3 3   ? 169.800 92.683  157.999 1.00 111.45 ? 11   ARG G CA    1 
ATOM   4665  C C     . ARG G 3 3   ? 170.274 94.046  157.495 1.00 111.45 ? 11   ARG G C     1 
ATOM   4666  O O     . ARG G 3 3   ? 170.123 95.067  158.171 1.00 111.45 ? 11   ARG G O     1 
ATOM   4667  C CB    . ARG G 3 3   ? 168.400 92.334  157.483 1.00 111.45 ? 11   ARG G CB    1 
ATOM   4668  C CG    . ARG G 3 3   ? 168.251 92.151  155.979 1.00 111.45 ? 11   ARG G CG    1 
ATOM   4669  C CD    . ARG G 3 3   ? 169.130 91.017  155.483 1.00 111.45 ? 11   ARG G CD    1 
ATOM   4670  N NE    . ARG G 3 3   ? 168.757 89.729  156.061 1.00 111.45 ? 11   ARG G NE    1 
ATOM   4671  C CZ    . ARG G 3 3   ? 169.519 88.640  156.011 1.00 111.45 ? 11   ARG G CZ    1 
ATOM   4672  N NH1   . ARG G 3 3   ? 169.103 87.508  156.561 1.00 111.45 ? 11   ARG G NH1   1 
ATOM   4673  N NH2   . ARG G 3 3   ? 170.703 88.684  155.416 1.00 111.45 ? 11   ARG G NH2   1 
ATOM   4674  N N     . ALA G 3 4   ? 170.880 94.045  156.305 1.00 107.27 ? 12   ALA G N     1 
ATOM   4675  C CA    . ALA G 3 4   ? 171.613 95.197  155.782 1.00 107.27 ? 12   ALA G CA    1 
ATOM   4676  C C     . ALA G 3 4   ? 170.640 96.316  155.450 1.00 107.27 ? 12   ALA G C     1 
ATOM   4677  O O     . ALA G 3 4   ? 170.084 96.374  154.352 1.00 107.27 ? 12   ALA G O     1 
ATOM   4678  C CB    . ALA G 3 4   ? 172.422 94.801  154.553 1.00 107.27 ? 12   ALA G CB    1 
ATOM   4679  N N     . LYS G 3 5   ? 170.437 97.212  156.414 1.00 113.49 ? 13   LYS G N     1 
ATOM   4680  C CA    . LYS G 3 5   ? 169.591 98.387  156.234 1.00 113.49 ? 13   LYS G CA    1 
ATOM   4681  C C     . LYS G 3 5   ? 170.313 99.350  155.307 1.00 113.49 ? 13   LYS G C     1 
ATOM   4682  O O     . LYS G 3 5   ? 171.254 100.038 155.709 1.00 113.49 ? 13   LYS G O     1 
ATOM   4683  C CB    . LYS G 3 5   ? 169.269 99.044  157.572 1.00 113.49 ? 13   LYS G CB    1 
ATOM   4684  C CG    . LYS G 3 5   ? 168.325 98.251  158.455 1.00 113.49 ? 13   LYS G CG    1 
ATOM   4685  C CD    . LYS G 3 5   ? 167.956 99.033  159.704 1.00 113.49 ? 13   LYS G CD    1 
ATOM   4686  C CE    . LYS G 3 5   ? 167.016 98.229  160.582 1.00 113.49 ? 13   LYS G CE    1 
ATOM   4687  N NZ    . LYS G 3 5   ? 166.605 98.961  161.808 1.00 113.49 ? 13   LYS G NZ    1 
ATOM   4688  N N     . ALA G 3 6   ? 169.875 99.386  154.058 1.00 89.24  ? 14   ALA G N     1 
ATOM   4689  C CA    . ALA G 3 6   ? 170.403 100.302 153.062 1.00 89.24  ? 14   ALA G CA    1 
ATOM   4690  C C     . ALA G 3 6   ? 169.317 100.500 152.019 1.00 89.24  ? 14   ALA G C     1 
ATOM   4691  O O     . ALA G 3 6   ? 168.161 100.119 152.235 1.00 89.24  ? 14   ALA G O     1 
ATOM   4692  C CB    . ALA G 3 6   ? 171.702 99.765  152.450 1.00 89.24  ? 14   ALA G CB    1 
ATOM   4693  N N     . LYS G 3 7   ? 169.702 101.098 150.887 1.00 76.58  ? 15   LYS G N     1 
ATOM   4694  C CA    . LYS G 3 7   ? 168.896 101.204 149.669 1.00 76.58  ? 15   LYS G CA    1 
ATOM   4695  C C     . LYS G 3 7   ? 167.584 101.948 149.936 1.00 76.58  ? 15   LYS G C     1 
ATOM   4696  O O     . LYS G 3 7   ? 166.497 101.368 149.947 1.00 76.58  ? 15   LYS G O     1 
ATOM   4697  C CB    . LYS G 3 7   ? 168.633 99.823  149.055 1.00 76.58  ? 15   LYS G CB    1 
ATOM   4698  C CG    . LYS G 3 7   ? 169.891 99.021  148.778 1.00 76.58  ? 15   LYS G CG    1 
ATOM   4699  C CD    . LYS G 3 7   ? 170.839 99.751  147.845 1.00 76.58  ? 15   LYS G CD    1 
ATOM   4700  C CE    . LYS G 3 7   ? 170.313 99.810  146.432 1.00 76.58  ? 15   LYS G CE    1 
ATOM   4701  N NZ    . LYS G 3 7   ? 171.316 100.427 145.527 1.00 76.58  ? 15   LYS G NZ    1 
ATOM   4702  N N     . THR G 3 8   ? 167.737 103.240 150.214 1.00 63.22  ? 16   THR G N     1 
ATOM   4703  C CA    . THR G 3 8   ? 166.602 104.140 150.336 1.00 63.22  ? 16   THR G CA    1 
ATOM   4704  C C     . THR G 3 8   ? 165.790 104.172 149.047 1.00 63.22  ? 16   THR G C     1 
ATOM   4705  O O     . THR G 3 8   ? 166.290 103.903 147.955 1.00 63.22  ? 16   THR G O     1 
ATOM   4706  C CB    . THR G 3 8   ? 167.073 105.550 150.662 1.00 63.22  ? 16   THR G CB    1 
ATOM   4707  O OG1   . THR G 3 8   ? 167.930 106.010 149.611 1.00 63.22  ? 16   THR G OG1   1 
ATOM   4708  C CG2   . THR G 3 8   ? 167.827 105.563 151.971 1.00 63.22  ? 16   THR G CG2   1 
ATOM   4709  N N     . ARG G 3 9   ? 164.518 104.532 149.191 1.00 54.56  ? 17   ARG G N     1 
ATOM   4710  C CA    . ARG G 3 9   ? 163.560 104.461 148.097 1.00 54.56  ? 17   ARG G CA    1 
ATOM   4711  C C     . ARG G 3 9   ? 163.869 105.441 146.975 1.00 54.56  ? 17   ARG G C     1 
ATOM   4712  O O     . ARG G 3 9   ? 163.440 105.218 145.841 1.00 54.56  ? 17   ARG G O     1 
ATOM   4713  C CB    . ARG G 3 9   ? 162.176 104.711 148.671 1.00 54.56  ? 17   ARG G CB    1 
ATOM   4714  C CG    . ARG G 3 9   ? 161.838 103.687 149.715 1.00 54.56  ? 17   ARG G CG    1 
ATOM   4715  C CD    . ARG G 3 9   ? 160.616 104.027 150.532 1.00 54.56  ? 17   ARG G CD    1 
ATOM   4716  N NE    . ARG G 3 9   ? 159.388 104.025 149.761 1.00 54.56  ? 17   ARG G NE    1 
ATOM   4717  C CZ    . ARG G 3 9   ? 158.200 104.267 150.292 1.00 54.56  ? 17   ARG G CZ    1 
ATOM   4718  N NH1   . ARG G 3 9   ? 158.095 104.497 151.592 1.00 54.56  ? 17   ARG G NH1   1 
ATOM   4719  N NH2   . ARG G 3 9   ? 157.118 104.249 149.531 1.00 54.56  ? 17   ARG G NH2   1 
ATOM   4720  N N     . SER G 3 10  ? 164.629 106.499 147.252 1.00 51.99  ? 18   SER G N     1 
ATOM   4721  C CA    . SER G 3 10  ? 165.097 107.367 146.184 1.00 51.99  ? 18   SER G CA    1 
ATOM   4722  C C     . SER G 3 10  ? 166.178 106.707 145.345 1.00 51.99  ? 18   SER G C     1 
ATOM   4723  O O     . SER G 3 10  ? 166.370 107.093 144.189 1.00 51.99  ? 18   SER G O     1 
ATOM   4724  C CB    . SER G 3 10  ? 165.637 108.670 146.761 1.00 51.99  ? 18   SER G CB    1 
ATOM   4725  O OG    . SER G 3 10  ? 164.624 109.380 147.445 1.00 51.99  ? 18   SER G OG    1 
ATOM   4726  N N     . SER G 3 11  ? 166.892 105.730 145.903 1.00 54.66  ? 19   SER G N     1 
ATOM   4727  C CA    . SER G 3 11  ? 167.970 105.081 145.173 1.00 54.66  ? 19   SER G CA    1 
ATOM   4728  C C     . SER G 3 11  ? 167.452 104.054 144.187 1.00 54.66  ? 19   SER G C     1 
ATOM   4729  O O     . SER G 3 11  ? 168.084 103.825 143.154 1.00 54.66  ? 19   SER G O     1 
ATOM   4730  C CB    . SER G 3 11  ? 168.933 104.408 146.144 1.00 54.66  ? 19   SER G CB    1 
ATOM   4731  O OG    . SER G 3 11  ? 169.475 105.357 147.040 1.00 54.66  ? 19   SER G OG    1 
ATOM   4732  N N     . ARG G 3 12  ? 166.320 103.425 144.488 1.00 60.50  ? 20   ARG G N     1 
ATOM   4733  C CA    . ARG G 3 12  ? 165.822 102.360 143.632 1.00 60.50  ? 20   ARG G CA    1 
ATOM   4734  C C     . ARG G 3 12  ? 165.209 102.899 142.352 1.00 60.50  ? 20   ARG G C     1 
ATOM   4735  O O     . ARG G 3 12  ? 165.471 102.367 141.270 1.00 60.50  ? 20   ARG G O     1 
ATOM   4736  C CB    . ARG G 3 12  ? 164.814 101.512 144.389 1.00 60.50  ? 20   ARG G CB    1 
ATOM   4737  C CG    . ARG G 3 12  ? 165.470 100.748 145.486 1.00 60.50  ? 20   ARG G CG    1 
ATOM   4738  C CD    . ARG G 3 12  ? 164.504 99.971  146.315 1.00 60.50  ? 20   ARG G CD    1 
ATOM   4739  N NE    . ARG G 3 12  ? 165.218 99.336  147.411 1.00 60.50  ? 20   ARG G NE    1 
ATOM   4740  C CZ    . ARG G 3 12  ? 164.633 98.678  148.396 1.00 60.50  ? 20   ARG G CZ    1 
ATOM   4741  N NH1   . ARG G 3 12  ? 163.314 98.569  148.423 1.00 60.50  ? 20   ARG G NH1   1 
ATOM   4742  N NH2   . ARG G 3 12  ? 165.367 98.134  149.355 1.00 60.50  ? 20   ARG G NH2   1 
ATOM   4743  N N     . ALA G 3 13  ? 164.403 103.949 142.437 1.00 49.58  ? 21   ALA G N     1 
ATOM   4744  C CA    . ALA G 3 13  ? 163.825 104.483 141.216 1.00 49.58  ? 21   ALA G CA    1 
ATOM   4745  C C     . ALA G 3 13  ? 164.805 105.330 140.419 1.00 49.58  ? 21   ALA G C     1 
ATOM   4746  O O     . ALA G 3 13  ? 164.508 105.674 139.274 1.00 49.58  ? 21   ALA G O     1 
ATOM   4747  C CB    . ALA G 3 13  ? 162.579 105.307 141.532 1.00 49.58  ? 21   ALA G CB    1 
ATOM   4748  N N     . GLY G 3 14  ? 165.959 105.665 140.978 1.00 44.53  ? 22   GLY G N     1 
ATOM   4749  C CA    . GLY G 3 14  ? 166.851 106.569 140.286 1.00 44.53  ? 22   GLY G CA    1 
ATOM   4750  C C     . GLY G 3 14  ? 166.399 108.005 140.377 1.00 44.53  ? 22   GLY G C     1 
ATOM   4751  O O     . GLY G 3 14  ? 166.479 108.745 139.392 1.00 44.53  ? 22   GLY G O     1 
ATOM   4752  N N     . LEU G 3 15  ? 165.913 108.418 141.536 1.00 42.79  ? 23   LEU G N     1 
ATOM   4753  C CA    . LEU G 3 15  ? 165.439 109.770 141.758 1.00 42.79  ? 23   LEU G CA    1 
ATOM   4754  C C     . LEU G 3 15  ? 166.408 110.508 142.660 1.00 42.79  ? 23   LEU G C     1 
ATOM   4755  O O     . LEU G 3 15  ? 167.172 109.888 143.405 1.00 42.79  ? 23   LEU G O     1 
ATOM   4756  C CB    . LEU G 3 15  ? 164.062 109.773 142.403 1.00 42.79  ? 23   LEU G CB    1 
ATOM   4757  C CG    . LEU G 3 15  ? 162.967 109.215 141.519 1.00 42.79  ? 23   LEU G CG    1 
ATOM   4758  C CD1   . LEU G 3 15  ? 161.664 109.242 142.272 1.00 42.79  ? 23   LEU G CD1   1 
ATOM   4759  C CD2   . LEU G 3 15  ? 162.885 110.010 140.246 1.00 42.79  ? 23   LEU G CD2   1 
ATOM   4760  N N     . GLN G 3 16  ? 166.380 111.833 142.592 1.00 41.29  ? 24   GLN G N     1 
ATOM   4761  C CA    . GLN G 3 16  ? 167.165 112.606 143.532 1.00 41.29  ? 24   GLN G CA    1 
ATOM   4762  C C     . GLN G 3 16  ? 166.329 113.159 144.675 1.00 41.29  ? 24   GLN G C     1 
ATOM   4763  O O     . GLN G 3 16  ? 166.878 113.422 145.743 1.00 41.29  ? 24   GLN G O     1 
ATOM   4764  C CB    . GLN G 3 16  ? 167.884 113.746 142.813 1.00 41.29  ? 24   GLN G CB    1 
ATOM   4765  C CG    . GLN G 3 16  ? 168.763 113.300 141.651 1.00 41.29  ? 24   GLN G CG    1 
ATOM   4766  C CD    . GLN G 3 16  ? 169.835 112.299 142.039 1.00 41.29  ? 24   GLN G CD    1 
ATOM   4767  O OE1   . GLN G 3 16  ? 170.421 112.370 143.115 1.00 41.29  ? 24   GLN G OE1   1 
ATOM   4768  N NE2   . GLN G 3 16  ? 170.101 111.360 141.148 1.00 41.29  ? 24   GLN G NE2   1 
ATOM   4769  N N     . PHE G 3 17  ? 165.030 113.312 144.490 1.00 37.67  ? 25   PHE G N     1 
ATOM   4770  C CA    . PHE G 3 17  ? 164.145 113.814 145.528 1.00 37.67  ? 25   PHE G CA    1 
ATOM   4771  C C     . PHE G 3 17  ? 163.876 112.778 146.613 1.00 37.67  ? 25   PHE G C     1 
ATOM   4772  O O     . PHE G 3 17  ? 163.802 111.582 146.334 1.00 37.67  ? 25   PHE G O     1 
ATOM   4773  C CB    . PHE G 3 17  ? 162.842 114.282 144.910 1.00 37.67  ? 25   PHE G CB    1 
ATOM   4774  C CG    . PHE G 3 17  ? 162.875 115.702 144.519 1.00 37.67  ? 25   PHE G CG    1 
ATOM   4775  C CD1   . PHE G 3 17  ? 162.391 116.659 145.380 1.00 37.67  ? 25   PHE G CD1   1 
ATOM   4776  C CD2   . PHE G 3 17  ? 163.498 116.099 143.360 1.00 37.67  ? 25   PHE G CD2   1 
ATOM   4777  C CE1   . PHE G 3 17  ? 162.450 117.975 145.049 1.00 37.67  ? 25   PHE G CE1   1 
ATOM   4778  C CE2   . PHE G 3 17  ? 163.567 117.420 143.032 1.00 37.67  ? 25   PHE G CE2   1 
ATOM   4779  C CZ    . PHE G 3 17  ? 163.043 118.361 143.871 1.00 37.67  ? 25   PHE G CZ    1 
ATOM   4780  N N     . PRO G 3 18  ? 163.738 113.214 147.860 1.00 35.34  ? 26   PRO G N     1 
ATOM   4781  C CA    . PRO G 3 18  ? 163.618 112.271 148.977 1.00 35.34  ? 26   PRO G CA    1 
ATOM   4782  C C     . PRO G 3 18  ? 162.235 111.644 149.032 1.00 35.34  ? 26   PRO G C     1 
ATOM   4783  O O     . PRO G 3 18  ? 161.259 112.281 149.447 1.00 35.34  ? 26   PRO G O     1 
ATOM   4784  C CB    . PRO G 3 18  ? 163.897 113.151 150.200 1.00 35.34  ? 26   PRO G CB    1 
ATOM   4785  C CG    . PRO G 3 18  ? 163.508 114.502 149.770 1.00 35.34  ? 26   PRO G CG    1 
ATOM   4786  C CD    . PRO G 3 18  ? 163.847 114.601 148.335 1.00 35.34  ? 26   PRO G CD    1 
ATOM   4787  N N     . VAL G 3 19  ? 162.153 110.377 148.633 1.00 35.20  ? 27   VAL G N     1 
ATOM   4788  C CA    . VAL G 3 19  ? 160.859 109.723 148.552 1.00 35.20  ? 27   VAL G CA    1 
ATOM   4789  C C     . VAL G 3 19  ? 160.292 109.490 149.941 1.00 35.20  ? 27   VAL G C     1 
ATOM   4790  O O     . VAL G 3 19  ? 159.079 109.581 150.144 1.00 35.20  ? 27   VAL G O     1 
ATOM   4791  C CB    . VAL G 3 19  ? 160.991 108.432 147.737 1.00 35.20  ? 27   VAL G CB    1 
ATOM   4792  C CG1   . VAL G 3 19  ? 159.678 107.719 147.636 1.00 35.20  ? 27   VAL G CG1   1 
ATOM   4793  C CG2   . VAL G 3 19  ? 161.461 108.777 146.365 1.00 35.20  ? 27   VAL G CG2   1 
ATOM   4794  N N     . GLY G 3 20  ? 161.155 109.287 150.933 1.00 39.94  ? 28   GLY G N     1 
ATOM   4795  C CA    . GLY G 3 20  ? 160.676 109.160 152.297 1.00 39.94  ? 28   GLY G CA    1 
ATOM   4796  C C     . GLY G 3 20  ? 160.079 110.448 152.827 1.00 39.94  ? 28   GLY G C     1 
ATOM   4797  O O     . GLY G 3 20  ? 159.047 110.434 153.502 1.00 39.94  ? 28   GLY G O     1 
ATOM   4798  N N     . ARG G 3 21  ? 160.691 111.580 152.485 1.00 38.98  ? 29   ARG G N     1 
ATOM   4799  C CA    . ARG G 3 21  ? 160.161 112.866 152.914 1.00 38.98  ? 29   ARG G CA    1 
ATOM   4800  C C     . ARG G 3 21  ? 158.851 113.187 152.207 1.00 38.98  ? 29   ARG G C     1 
ATOM   4801  O O     . ARG G 3 21  ? 157.914 113.696 152.837 1.00 38.98  ? 29   ARG G O     1 
ATOM   4802  C CB    . ARG G 3 21  ? 161.201 113.951 152.671 1.00 38.98  ? 29   ARG G CB    1 
ATOM   4803  C CG    . ARG G 3 21  ? 160.767 115.320 153.078 1.00 38.98  ? 29   ARG G CG    1 
ATOM   4804  C CD    . ARG G 3 21  ? 161.882 116.325 152.954 1.00 38.98  ? 29   ARG G CD    1 
ATOM   4805  N NE    . ARG G 3 21  ? 162.876 116.170 154.003 1.00 38.98  ? 29   ARG G NE    1 
ATOM   4806  C CZ    . ARG G 3 21  ? 164.024 116.832 154.032 1.00 38.98  ? 29   ARG G CZ    1 
ATOM   4807  N NH1   . ARG G 3 21  ? 164.322 117.687 153.068 1.00 38.98  ? 29   ARG G NH1   1 
ATOM   4808  N NH2   . ARG G 3 21  ? 164.877 116.639 155.023 1.00 38.98  ? 29   ARG G NH2   1 
ATOM   4809  N N     . VAL G 3 22  ? 158.747 112.851 150.917 1.00 34.60  ? 30   VAL G N     1 
ATOM   4810  C CA    . VAL G 3 22  ? 157.485 113.036 150.199 1.00 34.60  ? 30   VAL G CA    1 
ATOM   4811  C C     . VAL G 3 22  ? 156.400 112.146 150.787 1.00 34.60  ? 30   VAL G C     1 
ATOM   4812  O O     . VAL G 3 22  ? 155.245 112.562 150.928 1.00 34.60  ? 30   VAL G O     1 
ATOM   4813  C CB    . VAL G 3 22  ? 157.684 112.774 148.695 1.00 34.60  ? 30   VAL G CB    1 
ATOM   4814  C CG1   . VAL G 3 22  ? 156.386 112.831 147.951 1.00 34.60  ? 30   VAL G CG1   1 
ATOM   4815  C CG2   . VAL G 3 22  ? 158.595 113.796 148.115 1.00 34.60  ? 30   VAL G CG2   1 
ATOM   4816  N N     . HIS G 3 23  ? 156.765 110.942 151.213 1.00 32.16  ? 31   HIS G N     1 
ATOM   4817  C CA    . HIS G 3 23  ? 155.759 110.035 151.743 1.00 32.16  ? 31   HIS G CA    1 
ATOM   4818  C C     . HIS G 3 23  ? 155.290 110.480 153.117 1.00 32.16  ? 31   HIS G C     1 
ATOM   4819  O O     . HIS G 3 23  ? 154.102 110.364 153.441 1.00 32.16  ? 31   HIS G O     1 
ATOM   4820  C CB    . HIS G 3 23  ? 156.317 108.622 151.793 1.00 32.16  ? 31   HIS G CB    1 
ATOM   4821  C CG    . HIS G 3 23  ? 155.273 107.572 151.965 1.00 32.16  ? 31   HIS G CG    1 
ATOM   4822  N ND1   . HIS G 3 23  ? 155.576 106.263 152.257 1.00 32.16  ? 31   HIS G ND1   1 
ATOM   4823  C CD2   . HIS G 3 23  ? 153.927 107.636 151.874 1.00 32.16  ? 31   HIS G CD2   1 
ATOM   4824  C CE1   . HIS G 3 23  ? 154.460 105.565 152.341 1.00 32.16  ? 31   HIS G CE1   1 
ATOM   4825  N NE2   . HIS G 3 23  ? 153.444 106.376 152.115 1.00 32.16  ? 31   HIS G NE2   1 
ATOM   4826  N N     . ARG G 3 24  ? 156.199 111.021 153.922 1.00 33.51  ? 32   ARG G N     1 
ATOM   4827  C CA    . ARG G 3 24  ? 155.814 111.569 155.218 1.00 33.51  ? 32   ARG G CA    1 
ATOM   4828  C C     . ARG G 3 24  ? 154.904 112.774 155.064 1.00 33.51  ? 32   ARG G C     1 
ATOM   4829  O O     . ARG G 3 24  ? 153.940 112.931 155.823 1.00 33.51  ? 32   ARG G O     1 
ATOM   4830  C CB    . ARG G 3 24  ? 157.060 111.943 156.006 1.00 33.51  ? 32   ARG G CB    1 
ATOM   4831  C CG    . ARG G 3 24  ? 156.796 112.553 157.350 1.00 33.51  ? 32   ARG G CG    1 
ATOM   4832  C CD    . ARG G 3 24  ? 158.105 112.779 158.055 1.00 33.51  ? 32   ARG G CD    1 
ATOM   4833  N NE    . ARG G 3 24  ? 158.988 113.660 157.299 1.00 33.51  ? 32   ARG G NE    1 
ATOM   4834  C CZ    . ARG G 3 24  ? 159.020 114.978 157.439 1.00 33.51  ? 32   ARG G CZ    1 
ATOM   4835  N NH1   . ARG G 3 24  ? 158.238 115.571 158.324 1.00 33.51  ? 32   ARG G NH1   1 
ATOM   4836  N NH2   . ARG G 3 24  ? 159.854 115.702 156.716 1.00 33.51  ? 32   ARG G NH2   1 
ATOM   4837  N N     . LEU G 3 25  ? 155.183 113.629 154.077 1.00 27.72  ? 33   LEU G N     1 
ATOM   4838  C CA    . LEU G 3 25  ? 154.324 114.787 153.859 1.00 27.72  ? 33   LEU G CA    1 
ATOM   4839  C C     . LEU G 3 25  ? 152.955 114.384 153.336 1.00 27.72  ? 33   LEU G C     1 
ATOM   4840  O O     . LEU G 3 25  ? 151.943 114.943 153.771 1.00 27.72  ? 33   LEU G O     1 
ATOM   4841  C CB    . LEU G 3 25  ? 154.982 115.766 152.905 1.00 27.72  ? 33   LEU G CB    1 
ATOM   4842  C CG    . LEU G 3 25  ? 156.206 116.409 153.517 1.00 27.72  ? 33   LEU G CG    1 
ATOM   4843  C CD1   . LEU G 3 25  ? 156.899 117.278 152.509 1.00 27.72  ? 33   LEU G CD1   1 
ATOM   4844  C CD2   . LEU G 3 25  ? 155.798 117.219 154.710 1.00 27.72  ? 33   LEU G CD2   1 
ATOM   4845  N N     . LEU G 3 26  ? 152.896 113.405 152.427 1.00 28.28  ? 34   LEU G N     1 
ATOM   4846  C CA    . LEU G 3 26  ? 151.599 112.923 151.963 1.00 28.28  ? 34   LEU G CA    1 
ATOM   4847  C C     . LEU G 3 26  ? 150.807 112.244 153.063 1.00 28.28  ? 34   LEU G C     1 
ATOM   4848  O O     . LEU G 3 26  ? 149.577 112.297 153.042 1.00 28.28  ? 34   LEU G O     1 
ATOM   4849  C CB    . LEU G 3 26  ? 151.728 111.946 150.804 1.00 28.28  ? 34   LEU G CB    1 
ATOM   4850  C CG    . LEU G 3 26  ? 151.953 112.411 149.384 1.00 28.28  ? 34   LEU G CG    1 
ATOM   4851  C CD1   . LEU G 3 26  ? 152.037 111.211 148.505 1.00 28.28  ? 34   LEU G CD1   1 
ATOM   4852  C CD2   . LEU G 3 26  ? 150.804 113.261 148.976 1.00 28.28  ? 34   LEU G CD2   1 
ATOM   4853  N N     . ARG G 3 27  ? 151.470 111.588 154.017 1.00 33.91  ? 35   ARG G N     1 
ATOM   4854  C CA    . ARG G 3 27  ? 150.711 111.013 155.122 1.00 33.91  ? 35   ARG G CA    1 
ATOM   4855  C C     . ARG G 3 27  ? 150.204 112.095 156.056 1.00 33.91  ? 35   ARG G C     1 
ATOM   4856  O O     . ARG G 3 27  ? 148.993 112.293 156.191 1.00 33.91  ? 35   ARG G O     1 
ATOM   4857  C CB    . ARG G 3 27  ? 151.533 109.991 155.900 1.00 33.91  ? 35   ARG G CB    1 
ATOM   4858  C CG    . ARG G 3 27  ? 151.642 108.655 155.233 1.00 33.91  ? 35   ARG G CG    1 
ATOM   4859  C CD    . ARG G 3 27  ? 151.990 107.603 156.252 1.00 33.91  ? 35   ARG G CD    1 
ATOM   4860  N NE    . ARG G 3 27  ? 153.274 107.865 156.884 1.00 33.91  ? 35   ARG G NE    1 
ATOM   4861  C CZ    . ARG G 3 27  ? 154.432 107.435 156.403 1.00 33.91  ? 35   ARG G CZ    1 
ATOM   4862  N NH1   . ARG G 3 27  ? 154.460 106.727 155.284 1.00 33.91  ? 35   ARG G NH1   1 
ATOM   4863  N NH2   . ARG G 3 27  ? 155.561 107.716 157.039 1.00 33.91  ? 35   ARG G NH2   1 
ATOM   4864  N N     . LYS G 3 28  ? 151.109 112.830 156.691 1.00 28.95  ? 36   LYS G N     1 
ATOM   4865  C CA    . LYS G 3 28  ? 150.660 113.712 157.757 1.00 28.95  ? 36   LYS G CA    1 
ATOM   4866  C C     . LYS G 3 28  ? 150.158 115.057 157.255 1.00 28.95  ? 36   LYS G C     1 
ATOM   4867  O O     . LYS G 3 28  ? 149.896 115.941 158.073 1.00 28.95  ? 36   LYS G O     1 
ATOM   4868  C CB    . LYS G 3 28  ? 151.769 113.931 158.786 1.00 28.95  ? 36   LYS G CB    1 
ATOM   4869  C CG    . LYS G 3 28  ? 152.908 114.812 158.340 1.00 28.95  ? 36   LYS G CG    1 
ATOM   4870  C CD    . LYS G 3 28  ? 153.877 115.040 159.478 1.00 28.95  ? 36   LYS G CD    1 
ATOM   4871  C CE    . LYS G 3 28  ? 154.937 116.040 159.084 1.00 28.95  ? 36   LYS G CE    1 
ATOM   4872  N NZ    . LYS G 3 28  ? 155.888 116.270 160.193 1.00 28.95  ? 36   LYS G NZ    1 
ATOM   4873  N N     . GLY G 3 29  ? 149.993 115.244 155.955 1.00 29.62  ? 37   GLY G N     1 
ATOM   4874  C CA    . GLY G 3 29  ? 149.338 116.456 155.534 1.00 29.62  ? 37   GLY G CA    1 
ATOM   4875  C C     . GLY G 3 29  ? 147.830 116.388 155.473 1.00 29.62  ? 37   GLY G C     1 
ATOM   4876  O O     . GLY G 3 29  ? 147.220 117.381 155.067 1.00 29.62  ? 37   GLY G O     1 
ATOM   4877  N N     . ASN G 3 30  ? 147.226 115.256 155.857 1.00 30.01  ? 38   ASN G N     1 
ATOM   4878  C CA    . ASN G 3 30  ? 145.774 115.024 155.828 1.00 30.01  ? 38   ASN G CA    1 
ATOM   4879  C C     . ASN G 3 30  ? 145.190 115.221 154.432 1.00 30.01  ? 38   ASN G C     1 
ATOM   4880  O O     . ASN G 3 30  ? 144.219 115.952 154.242 1.00 30.01  ? 38   ASN G O     1 
ATOM   4881  C CB    . ASN G 3 30  ? 145.032 115.898 156.844 1.00 30.01  ? 38   ASN G CB    1 
ATOM   4882  C CG    . ASN G 3 30  ? 145.363 115.541 158.269 1.00 30.01  ? 38   ASN G CG    1 
ATOM   4883  O OD1   . ASN G 3 30  ? 145.872 116.364 159.024 1.00 30.01  ? 38   ASN G OD1   1 
ATOM   4884  N ND2   . ASN G 3 30  ? 145.094 114.302 158.642 1.00 30.01  ? 38   ASN G ND2   1 
ATOM   4885  N N     . TYR G 3 31  ? 145.792 114.566 153.446 1.00 23.19  ? 39   TYR G N     1 
ATOM   4886  C CA    . TYR G 3 31  ? 145.261 114.629 152.091 1.00 23.19  ? 39   TYR G CA    1 
ATOM   4887  C C     . TYR G 3 31  ? 144.208 113.551 151.880 1.00 23.19  ? 39   TYR G C     1 
ATOM   4888  O O     . TYR G 3 31  ? 143.045 113.858 151.616 1.00 23.19  ? 39   TYR G O     1 
ATOM   4889  C CB    . TYR G 3 31  ? 146.398 114.519 151.077 1.00 23.19  ? 39   TYR G CB    1 
ATOM   4890  C CG    . TYR G 3 31  ? 147.297 115.714 151.129 1.00 23.19  ? 39   TYR G CG    1 
ATOM   4891  C CD1   . TYR G 3 31  ? 146.969 116.880 150.469 1.00 23.19  ? 39   TYR G CD1   1 
ATOM   4892  C CD2   . TYR G 3 31  ? 148.453 115.690 151.876 1.00 23.19  ? 39   TYR G CD2   1 
ATOM   4893  C CE1   . TYR G 3 31  ? 147.784 117.980 150.537 1.00 23.19  ? 39   TYR G CE1   1 
ATOM   4894  C CE2   . TYR G 3 31  ? 149.274 116.782 151.946 1.00 23.19  ? 39   TYR G CE2   1 
ATOM   4895  C CZ    . TYR G 3 31  ? 148.937 117.920 151.279 1.00 23.19  ? 39   TYR G CZ    1 
ATOM   4896  O OH    . TYR G 3 31  ? 149.771 119.004 151.366 1.00 23.19  ? 39   TYR G OH    1 
ATOM   4897  N N     . ALA G 3 32  ? 144.583 112.292 152.025 1.00 30.69  ? 40   ALA G N     1 
ATOM   4898  C CA    . ALA G 3 32  ? 143.594 111.232 152.048 1.00 30.69  ? 40   ALA G CA    1 
ATOM   4899  C C     . ALA G 3 32  ? 143.821 110.362 153.268 1.00 30.69  ? 40   ALA G C     1 
ATOM   4900  O O     . ALA G 3 32  ? 144.678 110.639 154.109 1.00 30.69  ? 40   ALA G O     1 
ATOM   4901  C CB    . ALA G 3 32  ? 143.629 110.387 150.779 1.00 30.69  ? 40   ALA G CB    1 
ATOM   4902  N N     . GLU G 3 33  ? 143.041 109.292 153.357 1.00 40.86  ? 41   GLU G N     1 
ATOM   4903  C CA    . GLU G 3 33  ? 143.067 108.471 154.555 1.00 40.86  ? 41   GLU G CA    1 
ATOM   4904  C C     . GLU G 3 33  ? 144.273 107.548 154.592 1.00 40.86  ? 41   GLU G C     1 
ATOM   4905  O O     . GLU G 3 33  ? 144.823 107.302 155.671 1.00 40.86  ? 41   GLU G O     1 
ATOM   4906  C CB    . GLU G 3 33  ? 141.776 107.666 154.652 1.00 40.86  ? 41   GLU G CB    1 
ATOM   4907  C CG    . GLU G 3 33  ? 141.611 106.892 155.943 1.00 40.86  ? 41   GLU G CG    1 
ATOM   4908  C CD    . GLU G 3 33  ? 140.301 106.134 156.001 1.00 40.86  ? 41   GLU G CD    1 
ATOM   4909  O OE1   . GLU G 3 33  ? 139.532 106.191 155.020 1.00 40.86  ? 41   GLU G OE1   1 
ATOM   4910  O OE2   . GLU G 3 33  ? 140.040 105.478 157.030 1.00 40.86  ? 41   GLU G OE2   1 
ATOM   4911  N N     . ARG G 3 34  ? 144.714 107.044 153.442 1.00 43.87  ? 42   ARG G N     1 
ATOM   4912  C CA    . ARG G 3 34  ? 145.805 106.075 153.426 1.00 43.87  ? 42   ARG G CA    1 
ATOM   4913  C C     . ARG G 3 34  ? 146.538 106.139 152.094 1.00 43.87  ? 42   ARG G C     1 
ATOM   4914  O O     . ARG G 3 34  ? 146.030 105.673 151.077 1.00 43.87  ? 42   ARG G O     1 
ATOM   4915  C CB    . ARG G 3 34  ? 145.278 104.681 153.740 1.00 43.87  ? 42   ARG G CB    1 
ATOM   4916  C CG    . ARG G 3 34  ? 143.939 104.346 153.126 1.00 43.87  ? 42   ARG G CG    1 
ATOM   4917  C CD    . ARG G 3 34  ? 143.433 103.007 153.595 1.00 43.87  ? 42   ARG G CD    1 
ATOM   4918  N NE    . ARG G 3 34  ? 144.067 101.903 152.899 1.00 43.87  ? 42   ARG G NE    1 
ATOM   4919  C CZ    . ARG G 3 34  ? 144.082 100.659 153.350 1.00 43.87  ? 42   ARG G CZ    1 
ATOM   4920  N NH1   . ARG G 3 34  ? 143.528 100.373 154.514 1.00 43.87  ? 42   ARG G NH1   1 
ATOM   4921  N NH2   . ARG G 3 34  ? 144.671 99.706  152.654 1.00 43.87  ? 42   ARG G NH2   1 
ATOM   4922  N N     . VAL G 3 35  ? 147.726 106.711 152.125 1.00 32.53  ? 43   VAL G N     1 
ATOM   4923  C CA    . VAL G 3 35  ? 148.559 106.929 150.954 1.00 32.53  ? 43   VAL G CA    1 
ATOM   4924  C C     . VAL G 3 35  ? 149.069 105.593 150.443 1.00 32.53  ? 43   VAL G C     1 
ATOM   4925  O O     . VAL G 3 35  ? 149.390 104.699 151.226 1.00 32.53  ? 43   VAL G O     1 
ATOM   4926  C CB    . VAL G 3 35  ? 149.710 107.865 151.344 1.00 32.53  ? 43   VAL G CB    1 
ATOM   4927  C CG1   . VAL G 3 35  ? 150.602 108.187 150.177 1.00 32.53  ? 43   VAL G CG1   1 
ATOM   4928  C CG2   . VAL G 3 35  ? 149.151 109.114 151.961 1.00 32.53  ? 43   VAL G CG2   1 
ATOM   4929  N N     . GLY G 3 36  ? 149.137 105.441 149.129 1.00 32.51  ? 44   GLY G N     1 
ATOM   4930  C CA    . GLY G 3 36  ? 149.568 104.199 148.524 1.00 32.51  ? 44   GLY G CA    1 
ATOM   4931  C C     . GLY G 3 36  ? 151.063 103.977 148.598 1.00 32.51  ? 44   GLY G C     1 
ATOM   4932  O O     . GLY G 3 36  ? 151.767 104.519 149.450 1.00 32.51  ? 44   GLY G O     1 
ATOM   4933  N N     . ALA G 3 37  ? 151.550 103.131 147.697 1.00 32.37  ? 45   ALA G N     1 
ATOM   4934  C CA    . ALA G 3 37  ? 152.963 102.790 147.664 1.00 32.37  ? 45   ALA G CA    1 
ATOM   4935  C C     . ALA G 3 37  ? 153.689 103.397 146.481 1.00 32.37  ? 45   ALA G C     1 
ATOM   4936  O O     . ALA G 3 37  ? 154.822 103.851 146.631 1.00 32.37  ? 45   ALA G O     1 
ATOM   4937  C CB    . ALA G 3 37  ? 153.142 101.273 147.640 1.00 32.37  ? 45   ALA G CB    1 
ATOM   4938  N N     . GLY G 3 38  ? 153.073 103.415 145.306 1.00 31.87  ? 46   GLY G N     1 
ATOM   4939  C CA    . GLY G 3 38  ? 153.691 104.070 144.172 1.00 31.87  ? 46   GLY G CA    1 
ATOM   4940  C C     . GLY G 3 38  ? 153.546 105.570 144.154 1.00 31.87  ? 46   GLY G C     1 
ATOM   4941  O O     . GLY G 3 38  ? 154.176 106.231 143.318 1.00 31.87  ? 46   GLY G O     1 
ATOM   4942  N N     . ALA G 3 39  ? 152.751 106.115 145.080 1.00 31.98  ? 47   ALA G N     1 
ATOM   4943  C CA    . ALA G 3 39  ? 152.419 107.539 145.054 1.00 31.98  ? 47   ALA G CA    1 
ATOM   4944  C C     . ALA G 3 39  ? 153.615 108.455 145.289 1.00 31.98  ? 47   ALA G C     1 
ATOM   4945  O O     . ALA G 3 39  ? 153.852 109.334 144.440 1.00 31.98  ? 47   ALA G O     1 
ATOM   4946  C CB    . ALA G 3 39  ? 151.263 107.819 146.019 1.00 31.98  ? 47   ALA G CB    1 
ATOM   4947  N N     . PRO G 3 40  ? 154.400 108.340 146.378 1.00 31.81  ? 48   PRO G N     1 
ATOM   4948  C CA    . PRO G 3 40  ? 155.490 109.305 146.535 1.00 31.81  ? 48   PRO G CA    1 
ATOM   4949  C C     . PRO G 3 40  ? 156.604 109.101 145.539 1.00 31.81  ? 48   PRO G C     1 
ATOM   4950  O O     . PRO G 3 40  ? 157.283 110.074 145.206 1.00 31.81  ? 48   PRO G O     1 
ATOM   4951  C CB    . PRO G 3 40  ? 155.967 109.070 147.966 1.00 31.81  ? 48   PRO G CB    1 
ATOM   4952  C CG    . PRO G 3 40  ? 155.720 107.696 148.192 1.00 31.81  ? 48   PRO G CG    1 
ATOM   4953  C CD    . PRO G 3 40  ? 154.453 107.372 147.495 1.00 31.81  ? 48   PRO G CD    1 
ATOM   4954  N N     . VAL G 3 41  ? 156.765 107.892 145.004 1.00 32.69  ? 49   VAL G N     1 
ATOM   4955  C CA    . VAL G 3 41  ? 157.749 107.662 143.955 1.00 32.69  ? 49   VAL G CA    1 
ATOM   4956  C C     . VAL G 3 41  ? 157.355 108.404 142.689 1.00 32.69  ? 49   VAL G C     1 
ATOM   4957  O O     . VAL G 3 41  ? 158.175 109.123 142.096 1.00 32.69  ? 49   VAL G O     1 
ATOM   4958  C CB    . VAL G 3 41  ? 157.902 106.160 143.696 1.00 32.69  ? 49   VAL G CB    1 
ATOM   4959  C CG1   . VAL G 3 41  ? 158.797 105.936 142.518 1.00 32.69  ? 49   VAL G CG1   1 
ATOM   4960  C CG2   . VAL G 3 41  ? 158.457 105.483 144.908 1.00 32.69  ? 49   VAL G CG2   1 
ATOM   4961  N N     . TYR G 3 42  ? 156.080 108.286 142.294 1.00 29.17  ? 50   TYR G N     1 
ATOM   4962  C CA    . TYR G 3 42  ? 155.585 108.990 141.115 1.00 29.17  ? 50   TYR G CA    1 
ATOM   4963  C C     . TYR G 3 42  ? 155.704 110.494 141.301 1.00 29.17  ? 50   TYR G C     1 
ATOM   4964  O O     . TYR G 3 42  ? 156.145 111.221 140.397 1.00 29.17  ? 50   TYR G O     1 
ATOM   4965  C CB    . TYR G 3 42  ? 154.122 108.626 140.881 1.00 29.17  ? 50   TYR G CB    1 
ATOM   4966  C CG    . TYR G 3 42  ? 153.620 108.886 139.489 1.00 29.17  ? 50   TYR G CG    1 
ATOM   4967  C CD1   . TYR G 3 42  ? 153.589 107.875 138.561 1.00 29.17  ? 50   TYR G CD1   1 
ATOM   4968  C CD2   . TYR G 3 42  ? 153.246 110.148 139.081 1.00 29.17  ? 50   TYR G CD2   1 
ATOM   4969  C CE1   . TYR G 3 42  ? 153.141 108.096 137.295 1.00 29.17  ? 50   TYR G CE1   1 
ATOM   4970  C CE2   . TYR G 3 42  ? 152.827 110.380 137.808 1.00 29.17  ? 50   TYR G CE2   1 
ATOM   4971  C CZ    . TYR G 3 42  ? 152.780 109.349 136.916 1.00 29.17  ? 50   TYR G CZ    1 
ATOM   4972  O OH    . TYR G 3 42  ? 152.349 109.555 135.634 1.00 29.17  ? 50   TYR G OH    1 
ATOM   4973  N N     . LEU G 3 43  ? 155.367 110.964 142.494 1.00 27.18  ? 51   LEU G N     1 
ATOM   4974  C CA    . LEU G 3 43  ? 155.295 112.393 142.728 1.00 27.18  ? 51   LEU G CA    1 
ATOM   4975  C C     . LEU G 3 43  ? 156.678 113.013 142.817 1.00 27.18  ? 51   LEU G C     1 
ATOM   4976  O O     . LEU G 3 43  ? 156.894 114.129 142.327 1.00 27.18  ? 51   LEU G O     1 
ATOM   4977  C CB    . LEU G 3 43  ? 154.490 112.635 143.989 1.00 27.18  ? 51   LEU G CB    1 
ATOM   4978  C CG    . LEU G 3 43  ? 154.272 114.037 144.471 1.00 27.18  ? 51   LEU G CG    1 
ATOM   4979  C CD1   . LEU G 3 43  ? 153.671 114.820 143.380 1.00 27.18  ? 51   LEU G CD1   1 
ATOM   4980  C CD2   . LEU G 3 43  ? 153.286 113.909 145.574 1.00 27.18  ? 51   LEU G CD2   1 
ATOM   4981  N N     . ALA G 3 44  ? 157.633 112.301 143.419 1.00 32.07  ? 52   ALA G N     1 
ATOM   4982  C CA    . ALA G 3 44  ? 158.991 112.807 143.458 1.00 32.07  ? 52   ALA G CA    1 
ATOM   4983  C C     . ALA G 3 44  ? 159.620 112.790 142.079 1.00 32.07  ? 52   ALA G C     1 
ATOM   4984  O O     . ALA G 3 44  ? 160.434 113.664 141.771 1.00 32.07  ? 52   ALA G O     1 
ATOM   4985  C CB    . ALA G 3 44  ? 159.828 112.008 144.440 1.00 32.07  ? 52   ALA G CB    1 
ATOM   4986  N N     . ALA G 3 45  ? 159.203 111.862 141.214 1.00 38.33  ? 53   ALA G N     1 
ATOM   4987  C CA    . ALA G 3 45  ? 159.672 111.906 139.832 1.00 38.33  ? 53   ALA G CA    1 
ATOM   4988  C C     . ALA G 3 45  ? 159.133 113.120 139.088 1.00 38.33  ? 53   ALA G C     1 
ATOM   4989  O O     . ALA G 3 45  ? 159.867 113.752 138.317 1.00 38.33  ? 53   ALA G O     1 
ATOM   4990  C CB    . ALA G 3 45  ? 159.276 110.630 139.104 1.00 38.33  ? 53   ALA G CB    1 
ATOM   4991  N N     . VAL G 3 46  ? 157.863 113.469 139.318 1.00 38.26  ? 54   VAL G N     1 
ATOM   4992  C CA    . VAL G 3 46  ? 157.281 114.646 138.665 1.00 38.26  ? 54   VAL G CA    1 
ATOM   4993  C C     . VAL G 3 46  ? 157.974 115.928 139.128 1.00 38.26  ? 54   VAL G C     1 
ATOM   4994  O O     . VAL G 3 46  ? 158.345 116.784 138.311 1.00 38.26  ? 54   VAL G O     1 
ATOM   4995  C CB    . VAL G 3 46  ? 155.769 114.699 138.919 1.00 38.26  ? 54   VAL G CB    1 
ATOM   4996  C CG1   . VAL G 3 46  ? 155.195 115.989 138.431 1.00 38.26  ? 54   VAL G CG1   1 
ATOM   4997  C CG2   . VAL G 3 46  ? 155.105 113.550 138.231 1.00 38.26  ? 54   VAL G CG2   1 
ATOM   4998  N N     . LEU G 3 47  ? 158.187 116.064 140.442 1.00 62.13  ? 55   LEU G N     1 
ATOM   4999  C CA    . LEU G 3 47  ? 158.856 117.259 140.957 1.00 62.13  ? 55   LEU G CA    1 
ATOM   5000  C C     . LEU G 3 47  ? 160.308 117.337 140.510 1.00 62.13  ? 55   LEU G C     1 
ATOM   5001  O O     . LEU G 3 47  ? 160.811 118.436 140.244 1.00 62.13  ? 55   LEU G O     1 
ATOM   5002  C CB    . LEU G 3 47  ? 158.758 117.303 142.477 1.00 62.13  ? 55   LEU G CB    1 
ATOM   5003  C CG    . LEU G 3 47  ? 157.343 117.497 142.989 1.00 62.13  ? 55   LEU G CG    1 
ATOM   5004  C CD1   . LEU G 3 47  ? 157.287 117.387 144.479 1.00 62.13  ? 55   LEU G CD1   1 
ATOM   5005  C CD2   . LEU G 3 47  ? 156.913 118.850 142.576 1.00 62.13  ? 55   LEU G CD2   1 
ATOM   5006  N N     . GLU G 3 48  ? 160.982 116.192 140.373 1.00 49.14  ? 56   GLU G N     1 
ATOM   5007  C CA    . GLU G 3 48  ? 162.340 116.217 139.847 1.00 49.14  ? 56   GLU G CA    1 
ATOM   5008  C C     . GLU G 3 48  ? 162.360 116.625 138.386 1.00 49.14  ? 56   GLU G C     1 
ATOM   5009  O O     . GLU G 3 48  ? 163.255 117.366 137.965 1.00 49.14  ? 56   GLU G O     1 
ATOM   5010  C CB    . GLU G 3 48  ? 163.023 114.867 140.048 1.00 49.14  ? 56   GLU G CB    1 
ATOM   5011  C CG    . GLU G 3 48  ? 164.434 114.840 139.523 1.00 49.14  ? 56   GLU G CG    1 
ATOM   5012  C CD    . GLU G 3 48  ? 165.196 113.616 139.932 1.00 49.14  ? 56   GLU G CD    1 
ATOM   5013  O OE1   . GLU G 3 48  ? 164.664 112.816 140.724 1.00 49.14  ? 56   GLU G OE1   1 
ATOM   5014  O OE2   . GLU G 3 48  ? 166.331 113.443 139.447 1.00 49.14  ? 56   GLU G OE2   1 
ATOM   5015  N N     . TYR G 3 49  ? 161.351 116.213 137.619 1.00 43.41  ? 57   TYR G N     1 
ATOM   5016  C CA    . TYR G 3 49  ? 161.258 116.676 136.238 1.00 43.41  ? 57   TYR G CA    1 
ATOM   5017  C C     . TYR G 3 49  ? 161.062 118.184 136.156 1.00 43.41  ? 57   TYR G C     1 
ATOM   5018  O O     . TYR G 3 49  ? 161.698 118.850 135.327 1.00 43.41  ? 57   TYR G O     1 
ATOM   5019  C CB    . TYR G 3 49  ? 160.132 115.977 135.486 1.00 43.41  ? 57   TYR G CB    1 
ATOM   5020  C CG    . TYR G 3 49  ? 159.974 116.600 134.132 1.00 43.41  ? 57   TYR G CG    1 
ATOM   5021  C CD1   . TYR G 3 49  ? 160.986 116.496 133.193 1.00 43.41  ? 57   TYR G CD1   1 
ATOM   5022  C CD2   . TYR G 3 49  ? 158.839 117.321 133.797 1.00 43.41  ? 57   TYR G CD2   1 
ATOM   5023  C CE1   . TYR G 3 49  ? 160.873 117.092 131.958 1.00 43.41  ? 57   TYR G CE1   1 
ATOM   5024  C CE2   . TYR G 3 49  ? 158.716 117.909 132.563 1.00 43.41  ? 57   TYR G CE2   1 
ATOM   5025  C CZ    . TYR G 3 49  ? 159.735 117.790 131.645 1.00 43.41  ? 57   TYR G CZ    1 
ATOM   5026  O OH    . TYR G 3 49  ? 159.615 118.378 130.409 1.00 43.41  ? 57   TYR G OH    1 
ATOM   5027  N N     . LEU G 3 50  ? 160.208 118.742 137.015 1.00 38.66  ? 58   LEU G N     1 
ATOM   5028  C CA    . LEU G 3 50  ? 159.936 120.175 136.922 1.00 38.66  ? 58   LEU G CA    1 
ATOM   5029  C C     . LEU G 3 50  ? 161.145 121.005 137.341 1.00 38.66  ? 58   LEU G C     1 
ATOM   5030  O O     . LEU G 3 50  ? 161.483 121.998 136.680 1.00 38.66  ? 58   LEU G O     1 
ATOM   5031  C CB    . LEU G 3 50  ? 158.720 120.543 137.756 1.00 38.66  ? 58   LEU G CB    1 
ATOM   5032  C CG    . LEU G 3 50  ? 157.442 119.904 137.250 1.00 38.66  ? 58   LEU G CG    1 
ATOM   5033  C CD1   . LEU G 3 50  ? 156.294 120.272 138.130 1.00 38.66  ? 58   LEU G CD1   1 
ATOM   5034  C CD2   . LEU G 3 50  ? 157.184 120.296 135.829 1.00 38.66  ? 58   LEU G CD2   1 
ATOM   5035  N N     . THR G 3 51  ? 161.829 120.592 138.411 1.00 40.88  ? 59   THR G N     1 
ATOM   5036  C CA    . THR G 3 51  ? 163.027 121.311 138.829 1.00 40.88  ? 59   THR G CA    1 
ATOM   5037  C C     . THR G 3 51  ? 164.151 121.168 137.811 1.00 40.88  ? 59   THR G C     1 
ATOM   5038  O O     . THR G 3 51  ? 164.892 122.131 137.568 1.00 40.88  ? 59   THR G O     1 
ATOM   5039  C CB    . THR G 3 51  ? 163.444 120.825 140.214 1.00 40.88  ? 59   THR G CB    1 
ATOM   5040  O OG1   . THR G 3 51  ? 162.428 121.193 141.151 1.00 40.88  ? 59   THR G OG1   1 
ATOM   5041  C CG2   . THR G 3 51  ? 164.735 121.430 140.664 1.00 40.88  ? 59   THR G CG2   1 
ATOM   5042  N N     . ALA G 3 52  ? 164.241 120.016 137.142 1.00 39.02  ? 60   ALA G N     1 
ATOM   5043  C CA    . ALA G 3 52  ? 165.253 119.846 136.107 1.00 39.02  ? 60   ALA G CA    1 
ATOM   5044  C C     . ALA G 3 52  ? 164.979 120.735 134.909 1.00 39.02  ? 60   ALA G C     1 
ATOM   5045  O O     . ALA G 3 52  ? 165.905 121.342 134.364 1.00 39.02  ? 60   ALA G O     1 
ATOM   5046  C CB    . ALA G 3 52  ? 165.321 118.387 135.672 1.00 39.02  ? 60   ALA G CB    1 
ATOM   5047  N N     . GLU G 3 53  ? 163.709 120.865 134.526 1.00 39.64  ? 61   GLU G N     1 
ATOM   5048  C CA    . GLU G 3 53  ? 163.351 121.729 133.407 1.00 39.64  ? 61   GLU G CA    1 
ATOM   5049  C C     . GLU G 3 53  ? 163.651 123.192 133.704 1.00 39.64  ? 61   GLU G C     1 
ATOM   5050  O O     . GLU G 3 53  ? 164.219 123.903 132.863 1.00 39.64  ? 61   GLU G O     1 
ATOM   5051  C CB    . GLU G 3 53  ? 161.874 121.548 133.079 1.00 39.64  ? 61   GLU G CB    1 
ATOM   5052  C CG    . GLU G 3 53  ? 161.358 122.456 131.988 1.00 39.64  ? 61   GLU G CG    1 
ATOM   5053  C CD    . GLU G 3 53  ? 161.945 122.146 130.628 1.00 39.64  ? 61   GLU G CD    1 
ATOM   5054  O OE1   . GLU G 3 53  ? 162.324 120.984 130.385 1.00 39.64  ? 61   GLU G OE1   1 
ATOM   5055  O OE2   . GLU G 3 53  ? 162.023 123.067 129.791 1.00 39.64  ? 61   GLU G OE2   1 
ATOM   5056  N N     . ILE G 3 54  ? 163.319 123.650 134.909 1.00 31.36  ? 62   ILE G N     1 
ATOM   5057  C CA    . ILE G 3 54  ? 163.493 125.066 135.211 1.00 31.36  ? 62   ILE G CA    1 
ATOM   5058  C C     . ILE G 3 54  ? 164.962 125.411 135.395 1.00 31.36  ? 62   ILE G C     1 
ATOM   5059  O O     . ILE G 3 54  ? 165.427 126.448 134.911 1.00 31.36  ? 62   ILE G O     1 
ATOM   5060  C CB    . ILE G 3 54  ? 162.650 125.449 136.431 1.00 31.36  ? 62   ILE G CB    1 
ATOM   5061  C CG1   . ILE G 3 54  ? 161.197 125.266 136.075 1.00 31.36  ? 62   ILE G CG1   1 
ATOM   5062  C CG2   . ILE G 3 54  ? 162.867 126.877 136.824 1.00 31.36  ? 62   ILE G CG2   1 
ATOM   5063  C CD1   . ILE G 3 54  ? 160.294 125.509 137.182 1.00 31.36  ? 62   ILE G CD1   1 
ATOM   5064  N N     . LEU G 3 55  ? 165.729 124.543 136.056 1.00 34.89  ? 63   LEU G N     1 
ATOM   5065  C CA    . LEU G 3 55  ? 167.148 124.834 136.203 1.00 34.89  ? 63   LEU G CA    1 
ATOM   5066  C C     . LEU G 3 55  ? 167.894 124.695 134.884 1.00 34.89  ? 63   LEU G C     1 
ATOM   5067  O O     . LEU G 3 55  ? 168.878 125.409 134.663 1.00 34.89  ? 63   LEU G O     1 
ATOM   5068  C CB    . LEU G 3 55  ? 167.757 123.941 137.267 1.00 34.89  ? 63   LEU G CB    1 
ATOM   5069  C CG    . LEU G 3 55  ? 167.249 124.313 138.645 1.00 34.89  ? 63   LEU G CG    1 
ATOM   5070  C CD1   . LEU G 3 55  ? 167.770 123.387 139.682 1.00 34.89  ? 63   LEU G CD1   1 
ATOM   5071  C CD2   . LEU G 3 55  ? 167.679 125.701 138.950 1.00 34.89  ? 63   LEU G CD2   1 
ATOM   5072  N N     . GLU G 3 56  ? 167.411 123.839 133.981 1.00 45.32  ? 64   GLU G N     1 
ATOM   5073  C CA    . GLU G 3 56  ? 167.925 123.807 132.619 1.00 45.32  ? 64   GLU G CA    1 
ATOM   5074  C C     . GLU G 3 56  ? 167.696 125.131 131.914 1.00 45.32  ? 64   GLU G C     1 
ATOM   5075  O O     . GLU G 3 56  ? 168.624 125.704 131.331 1.00 45.32  ? 64   GLU G O     1 
ATOM   5076  C CB    . GLU G 3 56  ? 167.249 122.675 131.856 1.00 45.32  ? 64   GLU G CB    1 
ATOM   5077  C CG    . GLU G 3 56  ? 167.535 122.636 130.377 1.00 45.32  ? 64   GLU G CG    1 
ATOM   5078  C CD    . GLU G 3 56  ? 166.754 121.534 129.675 1.00 45.32  ? 64   GLU G CD    1 
ATOM   5079  O OE1   . GLU G 3 56  ? 166.048 120.771 130.364 1.00 45.32  ? 64   GLU G OE1   1 
ATOM   5080  O OE2   . GLU G 3 56  ? 166.821 121.449 128.432 1.00 45.32  ? 64   GLU G OE2   1 
ATOM   5081  N N     . LEU G 3 57  ? 166.469 125.647 131.983 1.00 39.62  ? 65   LEU G N     1 
ATOM   5082  C CA    . LEU G 3 57  ? 166.160 126.883 131.274 1.00 39.62  ? 65   LEU G CA    1 
ATOM   5083  C C     . LEU G 3 57  ? 166.821 128.098 131.911 1.00 39.62  ? 65   LEU G C     1 
ATOM   5084  O O     . LEU G 3 57  ? 167.058 129.097 131.226 1.00 39.62  ? 65   LEU G O     1 
ATOM   5085  C CB    . LEU G 3 57  ? 164.655 127.083 131.208 1.00 39.62  ? 65   LEU G CB    1 
ATOM   5086  C CG    . LEU G 3 57  ? 163.887 126.117 130.326 1.00 39.62  ? 65   LEU G CG    1 
ATOM   5087  C CD1   . LEU G 3 57  ? 162.430 126.321 130.564 1.00 39.62  ? 65   LEU G CD1   1 
ATOM   5088  C CD2   . LEU G 3 57  ? 164.216 126.388 128.886 1.00 39.62  ? 65   LEU G CD2   1 
ATOM   5089  N N     . ALA G 3 58  ? 167.129 128.045 133.203 1.00 36.81  ? 66   ALA G N     1 
ATOM   5090  C CA    . ALA G 3 58  ? 167.836 129.169 133.800 1.00 36.81  ? 66   ALA G CA    1 
ATOM   5091  C C     . ALA G 3 58  ? 169.324 129.102 133.500 1.00 36.81  ? 66   ALA G C     1 
ATOM   5092  O O     . ALA G 3 58  ? 169.952 130.133 133.248 1.00 36.81  ? 66   ALA G O     1 
ATOM   5093  C CB    . ALA G 3 58  ? 167.601 129.208 135.304 1.00 36.81  ? 66   ALA G CB    1 
ATOM   5094  N N     . GLY G 3 59  ? 169.903 127.900 133.508 1.00 47.15  ? 67   GLY G N     1 
ATOM   5095  C CA    . GLY G 3 59  ? 171.295 127.755 133.128 1.00 47.15  ? 67   GLY G CA    1 
ATOM   5096  C C     . GLY G 3 59  ? 171.550 128.061 131.669 1.00 47.15  ? 67   GLY G C     1 
ATOM   5097  O O     . GLY G 3 59  ? 172.664 128.437 131.300 1.00 47.15  ? 67   GLY G O     1 
ATOM   5098  N N     . ASN G 3 60  ? 170.535 127.902 130.817 1.00 48.07  ? 68   ASN G N     1 
ATOM   5099  C CA    . ASN G 3 60  ? 170.648 128.483 129.487 1.00 48.07  ? 68   ASN G CA    1 
ATOM   5100  C C     . ASN G 3 60  ? 170.675 130.001 129.547 1.00 48.07  ? 68   ASN G C     1 
ATOM   5101  O O     . ASN G 3 60  ? 171.364 130.636 128.742 1.00 48.07  ? 68   ASN G O     1 
ATOM   5102  C CB    . ASN G 3 60  ? 169.508 128.024 128.584 1.00 48.07  ? 68   ASN G CB    1 
ATOM   5103  C CG    . ASN G 3 60  ? 169.647 126.589 128.164 1.00 48.07  ? 68   ASN G CG    1 
ATOM   5104  O OD1   . ASN G 3 60  ? 168.803 125.755 128.467 1.00 48.07  ? 68   ASN G OD1   1 
ATOM   5105  N ND2   . ASN G 3 60  ? 170.727 126.287 127.465 1.00 48.07  ? 68   ASN G ND2   1 
ATOM   5106  N N     . ALA G 3 61  ? 169.969 130.599 130.500 1.00 46.29  ? 69   ALA G N     1 
ATOM   5107  C CA    . ALA G 3 61  ? 169.833 132.046 130.521 1.00 46.29  ? 69   ALA G CA    1 
ATOM   5108  C C     . ALA G 3 61  ? 170.957 132.739 131.267 1.00 46.29  ? 69   ALA G C     1 
ATOM   5109  O O     . ALA G 3 61  ? 171.179 133.932 131.046 1.00 46.29  ? 69   ALA G O     1 
ATOM   5110  C CB    . ALA G 3 61  ? 168.493 132.443 131.134 1.00 46.29  ? 69   ALA G CB    1 
ATOM   5111  N N     . ALA G 3 62  ? 171.681 132.032 132.123 1.00 48.91  ? 70   ALA G N     1 
ATOM   5112  C CA    . ALA G 3 62  ? 172.857 132.596 132.761 1.00 48.91  ? 70   ALA G CA    1 
ATOM   5113  C C     . ALA G 3 62  ? 174.051 132.598 131.830 1.00 48.91  ? 70   ALA G C     1 
ATOM   5114  O O     . ALA G 3 62  ? 174.901 133.485 131.924 1.00 48.91  ? 70   ALA G O     1 
ATOM   5115  C CB    . ALA G 3 62  ? 173.191 131.815 134.026 1.00 48.91  ? 70   ALA G CB    1 
ATOM   5116  N N     . ARG G 3 63  ? 174.113 131.630 130.926 1.00 60.24  ? 71   ARG G N     1 
ATOM   5117  C CA    . ARG G 3 63  ? 175.061 131.604 129.827 1.00 60.24  ? 71   ARG G CA    1 
ATOM   5118  C C     . ARG G 3 63  ? 174.866 132.756 128.864 1.00 60.24  ? 71   ARG G C     1 
ATOM   5119  O O     . ARG G 3 63  ? 175.849 133.308 128.364 1.00 60.24  ? 71   ARG G O     1 
ATOM   5120  C CB    . ARG G 3 63  ? 174.908 130.289 129.063 1.00 60.24  ? 71   ARG G CB    1 
ATOM   5121  C CG    . ARG G 3 63  ? 175.917 130.048 127.975 1.00 60.24  ? 71   ARG G CG    1 
ATOM   5122  C CD    . ARG G 3 63  ? 175.596 128.748 127.265 1.00 60.24  ? 71   ARG G CD    1 
ATOM   5123  N NE    . ARG G 3 63  ? 175.582 127.622 128.194 1.00 60.24  ? 71   ARG G NE    1 
ATOM   5124  C CZ    . ARG G 3 63  ? 176.662 126.952 128.583 1.00 60.24  ? 71   ARG G CZ    1 
ATOM   5125  N NH1   . ARG G 3 63  ? 177.860 127.288 128.124 1.00 60.24  ? 71   ARG G NH1   1 
ATOM   5126  N NH2   . ARG G 3 63  ? 176.541 125.944 129.434 1.00 60.24  ? 71   ARG G NH2   1 
ATOM   5127  N N     . ASP G 3 64  ? 173.615 133.140 128.611 1.00 59.45  ? 72   ASP G N     1 
ATOM   5128  C CA    . ASP G 3 64  ? 173.342 134.224 127.678 1.00 59.45  ? 72   ASP G CA    1 
ATOM   5129  C C     . ASP G 3 64  ? 173.742 135.568 128.259 1.00 59.45  ? 72   ASP G C     1 
ATOM   5130  O O     . ASP G 3 64  ? 174.051 136.499 127.511 1.00 59.45  ? 72   ASP G O     1 
ATOM   5131  C CB    . ASP G 3 64  ? 171.862 134.236 127.310 1.00 59.45  ? 72   ASP G CB    1 
ATOM   5132  C CG    . ASP G 3 64  ? 171.425 132.959 126.634 1.00 59.45  ? 72   ASP G CG    1 
ATOM   5133  O OD1   . ASP G 3 64  ? 172.280 132.295 126.021 1.00 59.45  ? 72   ASP G OD1   1 
ATOM   5134  O OD2   . ASP G 3 64  ? 170.229 132.613 126.713 1.00 59.45  ? 72   ASP G OD2   1 
ATOM   5135  N N     . ASN G 3 65  ? 173.752 135.681 129.581 1.00 60.93  ? 73   ASN G N     1 
ATOM   5136  C CA    . ASN G 3 65  ? 174.051 136.930 130.251 1.00 60.93  ? 73   ASN G CA    1 
ATOM   5137  C C     . ASN G 3 65  ? 175.484 136.968 130.760 1.00 60.93  ? 73   ASN G C     1 
ATOM   5138  O O     . ASN G 3 65  ? 175.858 137.921 131.449 1.00 60.93  ? 73   ASN G O     1 
ATOM   5139  C CB    . ASN G 3 65  ? 173.058 137.135 131.395 1.00 60.93  ? 73   ASN G CB    1 
ATOM   5140  C CG    . ASN G 3 65  ? 172.851 138.588 131.735 1.00 60.93  ? 73   ASN G CG    1 
ATOM   5141  O OD1   . ASN G 3 65  ? 173.460 139.470 131.131 1.00 60.93  ? 73   ASN G OD1   1 
ATOM   5142  N ND2   . ASN G 3 65  ? 171.967 138.851 132.691 1.00 60.93  ? 73   ASN G ND2   1 
ATOM   5143  N N     . LYS G 3 66  ? 176.278 135.943 130.431 1.00 61.72  ? 74   LYS G N     1 
ATOM   5144  C CA    . LYS G 3 66  ? 177.711 135.838 130.736 1.00 61.72  ? 74   LYS G CA    1 
ATOM   5145  C C     . LYS G 3 66  ? 177.971 135.921 132.238 1.00 61.72  ? 74   LYS G C     1 
ATOM   5146  O O     . LYS G 3 66  ? 178.650 136.820 132.736 1.00 61.72  ? 74   LYS G O     1 
ATOM   5147  C CB    . LYS G 3 66  ? 178.537 136.881 129.972 1.00 61.72  ? 74   LYS G CB    1 
ATOM   5148  C CG    . LYS G 3 66  ? 179.008 136.429 128.593 1.00 61.72  ? 74   LYS G CG    1 
ATOM   5149  C CD    . LYS G 3 66  ? 177.888 136.414 127.573 1.00 61.72  ? 74   LYS G CD    1 
ATOM   5150  C CE    . LYS G 3 66  ? 178.397 136.010 126.210 1.00 61.72  ? 74   LYS G CE    1 
ATOM   5151  N NZ    . LYS G 3 66  ? 177.286 135.857 125.236 1.00 61.72  ? 74   LYS G NZ    1 
ATOM   5152  N N     . LYS G 3 67  ? 177.413 134.951 132.954 1.00 65.95  ? 75   LYS G N     1 
ATOM   5153  C CA    . LYS G 3 67  ? 177.469 134.951 134.410 1.00 65.95  ? 75   LYS G CA    1 
ATOM   5154  C C     . LYS G 3 67  ? 177.231 133.527 134.871 1.00 65.95  ? 75   LYS G C     1 
ATOM   5155  O O     . LYS G 3 67  ? 176.234 132.919 134.481 1.00 65.95  ? 75   LYS G O     1 
ATOM   5156  C CB    . LYS G 3 67  ? 176.421 135.895 134.979 1.00 65.95  ? 75   LYS G CB    1 
ATOM   5157  C CG    . LYS G 3 67  ? 176.593 136.221 136.436 1.00 65.95  ? 75   LYS G CG    1 
ATOM   5158  C CD    . LYS G 3 67  ? 175.466 137.107 136.926 1.00 65.95  ? 75   LYS G CD    1 
ATOM   5159  C CE    . LYS G 3 67  ? 175.818 138.578 136.850 1.00 65.95  ? 75   LYS G CE    1 
ATOM   5160  N NZ    . LYS G 3 67  ? 175.674 139.136 135.481 1.00 65.95  ? 75   LYS G NZ    1 
ATOM   5161  N N     . THR G 3 68  ? 178.133 132.990 135.690 1.00 61.49  ? 76   THR G N     1 
ATOM   5162  C CA    . THR G 3 68  ? 178.087 131.578 136.047 1.00 61.49  ? 76   THR G CA    1 
ATOM   5163  C C     . THR G 3 68  ? 177.303 131.311 137.321 1.00 61.49  ? 76   THR G C     1 
ATOM   5164  O O     . THR G 3 68  ? 177.619 130.359 138.043 1.00 61.49  ? 76   THR G O     1 
ATOM   5165  C CB    . THR G 3 68  ? 179.499 131.017 136.184 1.00 61.49  ? 76   THR G CB    1 
ATOM   5166  O OG1   . THR G 3 68  ? 180.171 131.695 137.248 1.00 61.49  ? 76   THR G OG1   1 
ATOM   5167  C CG2   . THR G 3 68  ? 180.267 131.215 134.901 1.00 61.49  ? 76   THR G CG2   1 
ATOM   5168  N N     . ARG G 3 69  ? 176.302 132.124 137.633 1.00 57.94  ? 77   ARG G N     1 
ATOM   5169  C CA    . ARG G 3 69  ? 175.476 131.881 138.802 1.00 57.94  ? 77   ARG G CA    1 
ATOM   5170  C C     . ARG G 3 69  ? 174.041 132.267 138.499 1.00 57.94  ? 77   ARG G C     1 
ATOM   5171  O O     . ARG G 3 69  ? 173.787 133.334 137.942 1.00 57.94  ? 77   ARG G O     1 
ATOM   5172  C CB    . ARG G 3 69  ? 175.980 132.657 140.014 1.00 57.94  ? 77   ARG G CB    1 
ATOM   5173  C CG    . ARG G 3 69  ? 175.196 132.392 141.262 1.00 57.94  ? 77   ARG G CG    1 
ATOM   5174  C CD    . ARG G 3 69  ? 175.739 133.129 142.451 1.00 57.94  ? 77   ARG G CD    1 
ATOM   5175  N NE    . ARG G 3 69  ? 177.024 132.590 142.866 1.00 57.94  ? 77   ARG G NE    1 
ATOM   5176  C CZ    . ARG G 3 69  ? 177.749 133.090 143.857 1.00 57.94  ? 77   ARG G CZ    1 
ATOM   5177  N NH1   . ARG G 3 69  ? 177.299 134.128 144.544 1.00 57.94  ? 77   ARG G NH1   1 
ATOM   5178  N NH2   . ARG G 3 69  ? 178.912 132.542 144.175 1.00 57.94  ? 77   ARG G NH2   1 
ATOM   5179  N N     . ILE G 3 70  ? 173.112 131.405 138.878 1.00 37.21  ? 78   ILE G N     1 
ATOM   5180  C CA    . ILE G 3 70  ? 171.690 131.616 138.643 1.00 37.21  ? 78   ILE G CA    1 
ATOM   5181  C C     . ILE G 3 70  ? 171.118 132.538 139.715 1.00 37.21  ? 78   ILE G C     1 
ATOM   5182  O O     . ILE G 3 70  ? 171.330 132.327 140.912 1.00 37.21  ? 78   ILE G O     1 
ATOM   5183  C CB    . ILE G 3 70  ? 170.958 130.270 138.607 1.00 37.21  ? 78   ILE G CB    1 
ATOM   5184  C CG1   . ILE G 3 70  ? 171.419 129.488 137.384 1.00 37.21  ? 78   ILE G CG1   1 
ATOM   5185  C CG2   . ILE G 3 70  ? 169.484 130.458 138.569 1.00 37.21  ? 78   ILE G CG2   1 
ATOM   5186  C CD1   . ILE G 3 70  ? 170.921 128.093 137.333 1.00 37.21  ? 78   ILE G CD1   1 
ATOM   5187  N N     . ILE G 3 71  ? 170.403 133.572 139.281 1.00 30.74  ? 79   ILE G N     1 
ATOM   5188  C CA    . ILE G 3 71  ? 169.856 134.620 140.136 1.00 30.74  ? 79   ILE G CA    1 
ATOM   5189  C C     . ILE G 3 71  ? 168.345 134.666 139.910 1.00 30.74  ? 79   ILE G C     1 
ATOM   5190  O O     . ILE G 3 71  ? 167.862 134.027 138.957 1.00 30.74  ? 79   ILE G O     1 
ATOM   5191  C CB    . ILE G 3 71  ? 170.550 135.956 139.833 1.00 30.74  ? 79   ILE G CB    1 
ATOM   5192  C CG1   . ILE G 3 71  ? 170.428 136.293 138.357 1.00 30.74  ? 79   ILE G CG1   1 
ATOM   5193  C CG2   . ILE G 3 71  ? 171.993 135.906 140.239 1.00 30.74  ? 79   ILE G CG2   1 
ATOM   5194  C CD1   . ILE G 3 71  ? 170.954 137.662 138.020 1.00 30.74  ? 79   ILE G CD1   1 
ATOM   5195  N N     . PRO G 3 72  ? 167.550 135.352 140.753 1.00 27.70  ? 80   PRO G N     1 
ATOM   5196  C CA    . PRO G 3 72  ? 166.103 135.390 140.496 1.00 27.70  ? 80   PRO G CA    1 
ATOM   5197  C C     . PRO G 3 72  ? 165.715 136.057 139.198 1.00 27.70  ? 80   PRO G C     1 
ATOM   5198  O O     . PRO G 3 72  ? 164.676 135.705 138.632 1.00 27.70  ? 80   PRO G O     1 
ATOM   5199  C CB    . PRO G 3 72  ? 165.559 136.169 141.693 1.00 27.70  ? 80   PRO G CB    1 
ATOM   5200  C CG    . PRO G 3 72  ? 166.490 135.921 142.737 1.00 27.70  ? 80   PRO G CG    1 
ATOM   5201  C CD    . PRO G 3 72  ? 167.830 135.871 142.103 1.00 27.70  ? 80   PRO G CD    1 
ATOM   5202  N N     . ARG G 3 73  ? 166.511 137.009 138.722 1.00 28.70  ? 81   ARG G N     1 
ATOM   5203  C CA    . ARG G 3 73  ? 166.338 137.549 137.380 1.00 28.70  ? 81   ARG G CA    1 
ATOM   5204  C C     . ARG G 3 73  ? 166.413 136.451 136.329 1.00 28.70  ? 81   ARG G C     1 
ATOM   5205  O O     . ARG G 3 73  ? 165.612 136.421 135.387 1.00 28.70  ? 81   ARG G O     1 
ATOM   5206  C CB    . ARG G 3 73  ? 167.406 138.608 137.141 1.00 28.70  ? 81   ARG G CB    1 
ATOM   5207  C CG    . ARG G 3 73  ? 167.397 139.220 135.785 1.00 28.70  ? 81   ARG G CG    1 
ATOM   5208  C CD    . ARG G 3 73  ? 166.152 140.002 135.580 1.00 28.70  ? 81   ARG G CD    1 
ATOM   5209  N NE    . ARG G 3 73  ? 166.164 140.680 134.296 1.00 28.70  ? 81   ARG G NE    1 
ATOM   5210  C CZ    . ARG G 3 73  ? 165.105 141.280 133.771 1.00 28.70  ? 81   ARG G CZ    1 
ATOM   5211  N NH1   . ARG G 3 73  ? 163.955 141.268 134.422 1.00 28.70  ? 81   ARG G NH1   1 
ATOM   5212  N NH2   . ARG G 3 73  ? 165.191 141.872 132.592 1.00 28.70  ? 81   ARG G NH2   1 
ATOM   5213  N N     . HIS G 3 74  ? 167.337 135.509 136.503 1.00 32.15  ? 82   HIS G N     1 
ATOM   5214  C CA    . HIS G 3 74  ? 167.454 134.406 135.560 1.00 32.15  ? 82   HIS G CA    1 
ATOM   5215  C C     . HIS G 3 74  ? 166.267 133.466 135.654 1.00 32.15  ? 82   HIS G C     1 
ATOM   5216  O O     . HIS G 3 74  ? 165.780 132.981 134.624 1.00 32.15  ? 82   HIS G O     1 
ATOM   5217  C CB    . HIS G 3 74  ? 168.745 133.645 135.805 1.00 32.15  ? 82   HIS G CB    1 
ATOM   5218  C CG    . HIS G 3 74  ? 169.964 134.418 135.443 1.00 32.15  ? 82   HIS G CG    1 
ATOM   5219  N ND1   . HIS G 3 74  ? 171.221 134.057 135.866 1.00 32.15  ? 82   HIS G ND1   1 
ATOM   5220  C CD2   . HIS G 3 74  ? 170.122 135.521 134.682 1.00 32.15  ? 82   HIS G CD2   1 
ATOM   5221  C CE1   . HIS G 3 74  ? 172.101 134.916 135.395 1.00 32.15  ? 82   HIS G CE1   1 
ATOM   5222  N NE2   . HIS G 3 74  ? 171.461 135.814 134.671 1.00 32.15  ? 82   HIS G NE2   1 
ATOM   5223  N N     . LEU G 3 75  ? 165.782 133.196 136.872 1.00 29.51  ? 83   LEU G N     1 
ATOM   5224  C CA    . LEU G 3 75  ? 164.596 132.344 136.983 1.00 29.51  ? 83   LEU G CA    1 
ATOM   5225  C C     . LEU G 3 75  ? 163.362 133.009 136.389 1.00 29.51  ? 83   LEU G C     1 
ATOM   5226  O O     . LEU G 3 75  ? 162.538 132.328 135.765 1.00 29.51  ? 83   LEU G O     1 
ATOM   5227  C CB    . LEU G 3 75  ? 164.335 131.953 138.430 1.00 29.51  ? 83   LEU G CB    1 
ATOM   5228  C CG    . LEU G 3 75  ? 165.328 130.931 138.957 1.00 29.51  ? 83   LEU G CG    1 
ATOM   5229  C CD1   . LEU G 3 75  ? 165.075 130.683 140.402 1.00 29.51  ? 83   LEU G CD1   1 
ATOM   5230  C CD2   . LEU G 3 75  ? 165.190 129.661 138.201 1.00 29.51  ? 83   LEU G CD2   1 
ATOM   5231  N N     . GLN G 3 76  ? 163.253 134.330 136.527 1.00 28.41  ? 84   GLN G N     1 
ATOM   5232  C CA    . GLN G 3 76  ? 162.159 135.072 135.915 1.00 28.41  ? 84   GLN G CA    1 
ATOM   5233  C C     . GLN G 3 76  ? 162.206 134.981 134.400 1.00 28.41  ? 84   GLN G C     1 
ATOM   5234  O O     . GLN G 3 76  ? 161.180 134.729 133.760 1.00 28.41  ? 84   GLN G O     1 
ATOM   5235  C CB    . GLN G 3 76  ? 162.222 136.528 136.339 1.00 28.41  ? 84   GLN G CB    1 
ATOM   5236  C CG    . GLN G 3 76  ? 161.100 137.386 135.827 1.00 28.41  ? 84   GLN G CG    1 
ATOM   5237  C CD    . GLN G 3 76  ? 159.837 137.194 136.592 1.00 28.41  ? 84   GLN G CD    1 
ATOM   5238  O OE1   . GLN G 3 76  ? 159.871 136.973 137.789 1.00 28.41  ? 84   GLN G OE1   1 
ATOM   5239  N NE2   . GLN G 3 76  ? 158.712 137.339 135.930 1.00 28.41  ? 84   GLN G NE2   1 
ATOM   5240  N N     . LEU G 3 77  ? 163.389 135.188 133.808 1.00 31.21  ? 85   LEU G N     1 
ATOM   5241  C CA    . LEU G 3 77  ? 163.497 135.122 132.352 1.00 31.21  ? 85   LEU G CA    1 
ATOM   5242  C C     . LEU G 3 77  ? 163.225 133.722 131.826 1.00 31.21  ? 85   LEU G C     1 
ATOM   5243  O O     . LEU G 3 77  ? 162.519 133.569 130.822 1.00 31.21  ? 85   LEU G O     1 
ATOM   5244  C CB    . LEU G 3 77  ? 164.859 135.609 131.881 1.00 31.21  ? 85   LEU G CB    1 
ATOM   5245  C CG    . LEU G 3 77  ? 164.930 137.073 131.462 1.00 31.21  ? 85   LEU G CG    1 
ATOM   5246  C CD1   . LEU G 3 77  ? 164.826 138.003 132.627 1.00 31.21  ? 85   LEU G CD1   1 
ATOM   5247  C CD2   . LEU G 3 77  ? 166.212 137.310 130.699 1.00 31.21  ? 85   LEU G CD2   1 
ATOM   5248  N N     . ALA G 3 78  ? 163.700 132.694 132.534 1.00 33.53  ? 86   ALA G N     1 
ATOM   5249  C CA    . ALA G 3 78  ? 163.488 131.316 132.097 1.00 33.53  ? 86   ALA G CA    1 
ATOM   5250  C C     . ALA G 3 78  ? 162.014 130.935 132.129 1.00 33.53  ? 86   ALA G C     1 
ATOM   5251  O O     . ALA G 3 78  ? 161.464 130.447 131.130 1.00 33.53  ? 86   ALA G O     1 
ATOM   5252  C CB    . ALA G 3 78  ? 164.291 130.368 132.979 1.00 33.53  ? 86   ALA G CB    1 
ATOM   5253  N N     . VAL G 3 79  ? 161.355 131.188 133.261 1.00 34.10  ? 87   VAL G N     1 
ATOM   5254  C CA    . VAL G 3 79  ? 159.948 130.839 133.412 1.00 34.10  ? 87   VAL G CA    1 
ATOM   5255  C C     . VAL G 3 79  ? 159.078 131.646 132.458 1.00 34.10  ? 87   VAL G C     1 
ATOM   5256  O O     . VAL G 3 79  ? 158.248 131.088 131.736 1.00 34.10  ? 87   VAL G O     1 
ATOM   5257  C CB    . VAL G 3 79  ? 159.515 131.036 134.869 1.00 34.10  ? 87   VAL G CB    1 
ATOM   5258  C CG1   . VAL G 3 79  ? 158.042 130.889 134.991 1.00 34.10  ? 87   VAL G CG1   1 
ATOM   5259  C CG2   . VAL G 3 79  ? 160.197 130.027 135.739 1.00 34.10  ? 87   VAL G CG2   1 
ATOM   5260  N N     . ARG G 3 80  ? 159.264 132.957 132.410 1.00 31.72  ? 88   ARG G N     1 
ATOM   5261  C CA    . ARG G 3 80  ? 158.358 133.743 131.593 1.00 31.72  ? 88   ARG G CA    1 
ATOM   5262  C C     . ARG G 3 80  ? 158.701 133.734 130.115 1.00 31.72  ? 88   ARG G C     1 
ATOM   5263  O O     . ARG G 3 80  ? 157.951 134.319 129.332 1.00 31.72  ? 88   ARG G O     1 
ATOM   5264  C CB    . ARG G 3 80  ? 158.329 135.175 132.070 1.00 31.72  ? 88   ARG G CB    1 
ATOM   5265  C CG    . ARG G 3 80  ? 157.772 135.365 133.440 1.00 31.72  ? 88   ARG G CG    1 
ATOM   5266  C CD    . ARG G 3 80  ? 156.299 135.067 133.512 1.00 31.72  ? 88   ARG G CD    1 
ATOM   5267  N NE    . ARG G 3 80  ? 155.741 135.549 134.769 1.00 31.72  ? 88   ARG G NE    1 
ATOM   5268  C CZ    . ARG G 3 80  ? 155.712 134.852 135.896 1.00 31.72  ? 88   ARG G CZ    1 
ATOM   5269  N NH1   . ARG G 3 80  ? 156.217 133.634 135.948 1.00 31.72  ? 88   ARG G NH1   1 
ATOM   5270  N NH2   . ARG G 3 80  ? 155.185 135.388 136.979 1.00 31.72  ? 88   ARG G NH2   1 
ATOM   5271  N N     . ASN G 3 81  ? 159.810 133.125 129.704 1.00 32.83  ? 89   ASN G N     1 
ATOM   5272  C CA    . ASN G 3 81  ? 160.037 132.931 128.283 1.00 32.83  ? 89   ASN G CA    1 
ATOM   5273  C C     . ASN G 3 81  ? 159.668 131.546 127.797 1.00 32.83  ? 89   ASN G C     1 
ATOM   5274  O O     . ASN G 3 81  ? 159.355 131.393 126.615 1.00 32.83  ? 89   ASN G O     1 
ATOM   5275  C CB    . ASN G 3 81  ? 161.493 133.209 127.932 1.00 32.83  ? 89   ASN G CB    1 
ATOM   5276  C CG    . ASN G 3 81  ? 161.780 134.669 127.845 1.00 32.83  ? 89   ASN G CG    1 
ATOM   5277  O OD1   . ASN G 3 81  ? 161.004 135.420 127.268 1.00 32.83  ? 89   ASN G OD1   1 
ATOM   5278  N ND2   . ASN G 3 81  ? 162.894 135.091 128.415 1.00 32.83  ? 89   ASN G ND2   1 
ATOM   5279  N N     . ASP G 3 82  ? 159.700 130.524 128.643 1.00 45.60  ? 90   ASP G N     1 
ATOM   5280  C CA    . ASP G 3 82  ? 159.072 129.279 128.225 1.00 45.60  ? 90   ASP G CA    1 
ATOM   5281  C C     . ASP G 3 82  ? 157.564 129.443 128.332 1.00 45.60  ? 90   ASP G C     1 
ATOM   5282  O O     . ASP G 3 82  ? 157.047 129.818 129.387 1.00 45.60  ? 90   ASP G O     1 
ATOM   5283  C CB    . ASP G 3 82  ? 159.546 128.103 129.071 1.00 45.60  ? 90   ASP G CB    1 
ATOM   5284  C CG    . ASP G 3 82  ? 159.205 126.757 128.443 1.00 45.60  ? 90   ASP G CG    1 
ATOM   5285  O OD1   . ASP G 3 82  ? 158.579 126.729 127.363 1.00 45.60  ? 90   ASP G OD1   1 
ATOM   5286  O OD2   . ASP G 3 82  ? 159.576 125.715 129.020 1.00 45.60  ? 90   ASP G OD2   1 
ATOM   5287  N N     . GLU G 3 83  ? 156.865 129.149 127.239 1.00 55.85  ? 91   GLU G N     1 
ATOM   5288  C CA    . GLU G 3 83  ? 155.436 129.428 127.155 1.00 55.85  ? 91   GLU G CA    1 
ATOM   5289  C C     . GLU G 3 83  ? 154.625 128.547 128.096 1.00 55.85  ? 91   GLU G C     1 
ATOM   5290  O O     . GLU G 3 83  ? 153.701 129.027 128.768 1.00 55.85  ? 91   GLU G O     1 
ATOM   5291  C CB    . GLU G 3 83  ? 154.978 129.242 125.715 1.00 55.85  ? 91   GLU G CB    1 
ATOM   5292  C CG    . GLU G 3 83  ? 153.510 129.471 125.488 1.00 55.85  ? 91   GLU G CG    1 
ATOM   5293  C CD    . GLU G 3 83  ? 153.146 129.382 124.026 1.00 55.85  ? 91   GLU G CD    1 
ATOM   5294  O OE1   . GLU G 3 83  ? 154.062 129.194 123.195 1.00 55.85  ? 91   GLU G OE1   1 
ATOM   5295  O OE2   . GLU G 3 83  ? 151.943 129.486 123.710 1.00 55.85  ? 91   GLU G OE2   1 
ATOM   5296  N N     . GLU G 3 84  ? 154.974 127.268 128.184 1.00 50.90  ? 92   GLU G N     1 
ATOM   5297  C CA    . GLU G 3 84  ? 154.201 126.355 129.015 1.00 50.90  ? 92   GLU G CA    1 
ATOM   5298  C C     . GLU G 3 84  ? 154.446 126.612 130.495 1.00 50.90  ? 92   GLU G C     1 
ATOM   5299  O O     . GLU G 3 84  ? 153.517 126.542 131.306 1.00 50.90  ? 92   GLU G O     1 
ATOM   5300  C CB    . GLU G 3 84  ? 154.549 124.926 128.639 1.00 50.90  ? 92   GLU G CB    1 
ATOM   5301  C CG    . GLU G 3 84  ? 154.247 124.645 127.195 1.00 50.90  ? 92   GLU G CG    1 
ATOM   5302  C CD    . GLU G 3 84  ? 154.676 123.268 126.760 1.00 50.90  ? 92   GLU G CD    1 
ATOM   5303  O OE1   . GLU G 3 84  ? 155.290 122.553 127.578 1.00 50.90  ? 92   GLU G OE1   1 
ATOM   5304  O OE2   . GLU G 3 84  ? 154.414 122.906 125.593 1.00 50.90  ? 92   GLU G OE2   1 
ATOM   5305  N N     . LEU G 3 85  ? 155.682 126.940 130.863 1.00 40.69  ? 93   LEU G N     1 
ATOM   5306  C CA    . LEU G 3 85  ? 155.955 127.347 132.232 1.00 40.69  ? 93   LEU G CA    1 
ATOM   5307  C C     . LEU G 3 85  ? 155.309 128.674 132.581 1.00 40.69  ? 93   LEU G C     1 
ATOM   5308  O O     . LEU G 3 85  ? 154.951 128.887 133.742 1.00 40.69  ? 93   LEU G O     1 
ATOM   5309  C CB    . LEU G 3 85  ? 157.446 127.456 132.471 1.00 40.69  ? 93   LEU G CB    1 
ATOM   5310  C CG    . LEU G 3 85  ? 158.231 126.278 133.002 1.00 40.69  ? 93   LEU G CG    1 
ATOM   5311  C CD1   . LEU G 3 85  ? 158.315 125.170 132.013 1.00 40.69  ? 93   LEU G CD1   1 
ATOM   5312  C CD2   . LEU G 3 85  ? 159.585 126.819 133.234 1.00 40.69  ? 93   LEU G CD2   1 
ATOM   5313  N N     . ASN G 3 86  ? 155.186 129.584 131.613 1.00 40.27  ? 94   ASN G N     1 
ATOM   5314  C CA    . ASN G 3 86  ? 154.432 130.811 131.835 1.00 40.27  ? 94   ASN G CA    1 
ATOM   5315  C C     . ASN G 3 86  ? 152.981 130.498 132.150 1.00 40.27  ? 94   ASN G C     1 
ATOM   5316  O O     . ASN G 3 86  ? 152.410 131.049 133.094 1.00 40.27  ? 94   ASN G O     1 
ATOM   5317  C CB    . ASN G 3 86  ? 154.522 131.706 130.601 1.00 40.27  ? 94   ASN G CB    1 
ATOM   5318  C CG    . ASN G 3 86  ? 153.943 133.092 130.822 1.00 40.27  ? 94   ASN G CG    1 
ATOM   5319  O OD1   . ASN G 3 86  ? 153.523 133.454 131.920 1.00 40.27  ? 94   ASN G OD1   1 
ATOM   5320  N ND2   . ASN G 3 86  ? 153.904 133.877 129.756 1.00 40.27  ? 94   ASN G ND2   1 
ATOM   5321  N N     . LYS G 3 87  ? 152.374 129.597 131.380 1.00 39.14  ? 95   LYS G N     1 
ATOM   5322  C CA    . LYS G 3 87  ? 150.970 129.283 131.607 1.00 39.14  ? 95   LYS G CA    1 
ATOM   5323  C C     . LYS G 3 87  ? 150.778 128.451 132.870 1.00 39.14  ? 95   LYS G C     1 
ATOM   5324  O O     . LYS G 3 87  ? 149.697 128.474 133.463 1.00 39.14  ? 95   LYS G O     1 
ATOM   5325  C CB    . LYS G 3 87  ? 150.400 128.583 130.372 1.00 39.14  ? 95   LYS G CB    1 
ATOM   5326  C CG    . LYS G 3 87  ? 148.882 128.476 130.346 1.00 39.14  ? 95   LYS G CG    1 
ATOM   5327  C CD    . LYS G 3 87  ? 148.378 128.013 128.997 1.00 39.14  ? 95   LYS G CD    1 
ATOM   5328  C CE    . LYS G 3 87  ? 148.606 126.536 128.801 1.00 39.14  ? 95   LYS G CE    1 
ATOM   5329  N NZ    . LYS G 3 87  ? 147.724 125.768 129.715 1.00 39.14  ? 95   LYS G NZ    1 
ATOM   5330  N N     . LEU G 3 88  ? 151.816 127.755 133.318 1.00 34.43  ? 96   LEU G N     1 
ATOM   5331  C CA    . LEU G 3 88  ? 151.744 127.066 134.600 1.00 34.43  ? 96   LEU G CA    1 
ATOM   5332  C C     . LEU G 3 88  ? 151.836 128.044 135.760 1.00 34.43  ? 96   LEU G C     1 
ATOM   5333  O O     . LEU G 3 88  ? 150.984 128.041 136.651 1.00 34.43  ? 96   LEU G O     1 
ATOM   5334  C CB    . LEU G 3 88  ? 152.856 126.021 134.703 1.00 34.43  ? 96   LEU G CB    1 
ATOM   5335  C CG    . LEU G 3 88  ? 152.974 125.255 136.019 1.00 34.43  ? 96   LEU G CG    1 
ATOM   5336  C CD1   . LEU G 3 88  ? 151.707 124.507 136.290 1.00 34.43  ? 96   LEU G CD1   1 
ATOM   5337  C CD2   . LEU G 3 88  ? 154.137 124.297 135.964 1.00 34.43  ? 96   LEU G CD2   1 
ATOM   5338  N N     . LEU G 3 89  ? 152.861 128.891 135.764 1.00 31.02  ? 97   LEU G N     1 
ATOM   5339  C CA    . LEU G 3 89  ? 153.129 129.797 136.869 1.00 31.02  ? 97   LEU G CA    1 
ATOM   5340  C C     . LEU G 3 89  ? 152.604 131.200 136.598 1.00 31.02  ? 97   LEU G C     1 
ATOM   5341  O O     . LEU G 3 89  ? 153.249 132.183 136.964 1.00 31.02  ? 97   LEU G O     1 
ATOM   5342  C CB    . LEU G 3 89  ? 154.627 129.837 137.141 1.00 31.02  ? 97   LEU G CB    1 
ATOM   5343  C CG    . LEU G 3 89  ? 155.233 128.481 137.449 1.00 31.02  ? 97   LEU G CG    1 
ATOM   5344  C CD1   . LEU G 3 89  ? 156.717 128.604 137.540 1.00 31.02  ? 97   LEU G CD1   1 
ATOM   5345  C CD2   . LEU G 3 89  ? 154.679 127.967 138.742 1.00 31.02  ? 97   LEU G CD2   1 
ATOM   5346  N N     . GLY G 3 90  ? 151.447 131.309 135.946 1.00 29.47  ? 98   GLY G N     1 
ATOM   5347  C CA    . GLY G 3 90  ? 150.948 132.609 135.539 1.00 29.47  ? 98   GLY G CA    1 
ATOM   5348  C C     . GLY G 3 90  ? 150.427 133.453 136.677 1.00 29.47  ? 98   GLY G C     1 
ATOM   5349  O O     . GLY G 3 90  ? 150.450 134.682 136.600 1.00 29.47  ? 98   GLY G O     1 
ATOM   5350  N N     . ARG G 3 91  ? 149.948 132.823 137.741 1.00 26.27  ? 99   ARG G N     1 
ATOM   5351  C CA    . ARG G 3 91  ? 149.498 133.585 138.892 1.00 26.27  ? 99   ARG G CA    1 
ATOM   5352  C C     . ARG G 3 91  ? 150.650 134.063 139.756 1.00 26.27  ? 99   ARG G C     1 
ATOM   5353  O O     . ARG G 3 91  ? 150.471 134.983 140.555 1.00 26.27  ? 99   ARG G O     1 
ATOM   5354  C CB    . ARG G 3 91  ? 148.555 132.741 139.738 1.00 26.27  ? 99   ARG G CB    1 
ATOM   5355  C CG    . ARG G 3 91  ? 147.308 132.321 139.002 1.00 26.27  ? 99   ARG G CG    1 
ATOM   5356  C CD    . ARG G 3 91  ? 146.447 133.527 138.682 1.00 26.27  ? 99   ARG G CD    1 
ATOM   5357  N NE    . ARG G 3 91  ? 145.953 134.173 139.894 1.00 26.27  ? 99   ARG G NE    1 
ATOM   5358  C CZ    . ARG G 3 91  ? 145.483 135.413 139.939 1.00 26.27  ? 99   ARG G CZ    1 
ATOM   5359  N NH1   . ARG G 3 91  ? 145.448 136.148 138.839 1.00 26.27  ? 99   ARG G NH1   1 
ATOM   5360  N NH2   . ARG G 3 91  ? 145.057 135.922 141.085 1.00 26.27  ? 99   ARG G NH2   1 
ATOM   5361  N N     . VAL G 3 92  ? 151.826 133.485 139.581 1.00 25.48  ? 100  VAL G N     1 
ATOM   5362  C CA    . VAL G 3 92  ? 152.902 133.558 140.557 1.00 25.48  ? 100  VAL G CA    1 
ATOM   5363  C C     . VAL G 3 92  ? 153.863 134.678 140.200 1.00 25.48  ? 100  VAL G C     1 
ATOM   5364  O O     . VAL G 3 92  ? 154.408 134.705 139.096 1.00 25.48  ? 100  VAL G O     1 
ATOM   5365  C CB    . VAL G 3 92  ? 153.644 132.223 140.616 1.00 25.48  ? 100  VAL G CB    1 
ATOM   5366  C CG1   . VAL G 3 92  ? 154.808 132.362 141.471 1.00 25.48  ? 100  VAL G CG1   1 
ATOM   5367  C CG2   . VAL G 3 92  ? 152.747 131.162 141.147 1.00 25.48  ? 100  VAL G CG2   1 
ATOM   5368  N N     . THR G 3 93  ? 154.108 135.578 141.145 1.00 23.57  ? 101  THR G N     1 
ATOM   5369  C CA    . THR G 3 93  ? 155.173 136.555 141.000 1.00 23.57  ? 101  THR G CA    1 
ATOM   5370  C C     . THR G 3 93  ? 156.407 136.103 141.766 1.00 23.57  ? 101  THR G C     1 
ATOM   5371  O O     . THR G 3 93  ? 156.307 135.497 142.833 1.00 23.57  ? 101  THR G O     1 
ATOM   5372  C CB    . THR G 3 93  ? 154.731 137.949 141.452 1.00 23.57  ? 101  THR G CB    1 
ATOM   5373  O OG1   . THR G 3 93  ? 155.827 138.857 141.315 1.00 23.57  ? 101  THR G OG1   1 
ATOM   5374  C CG2   . THR G 3 93  ? 154.242 137.965 142.877 1.00 23.57  ? 101  THR G CG2   1 
ATOM   5375  N N     . ILE G 3 94  ? 157.570 136.379 141.196 1.00 21.72  ? 102  ILE G N     1 
ATOM   5376  C CA    . ILE G 3 94  ? 158.847 135.942 141.736 1.00 21.72  ? 102  ILE G CA    1 
ATOM   5377  C C     . ILE G 3 94  ? 159.551 137.155 142.312 1.00 21.72  ? 102  ILE G C     1 
ATOM   5378  O O     . ILE G 3 94  ? 159.777 138.136 141.597 1.00 21.72  ? 102  ILE G O     1 
ATOM   5379  C CB    . ILE G 3 94  ? 159.699 135.268 140.660 1.00 21.72  ? 102  ILE G CB    1 
ATOM   5380  C CG1   . ILE G 3 94  ? 159.044 133.967 140.226 1.00 21.72  ? 102  ILE G CG1   1 
ATOM   5381  C CG2   . ILE G 3 94  ? 161.081 135.045 141.152 1.00 21.72  ? 102  ILE G CG2   1 
ATOM   5382  C CD1   . ILE G 3 94  ? 159.694 133.338 139.062 1.00 21.72  ? 102  ILE G CD1   1 
ATOM   5383  N N     . ALA G 3 95  ? 159.898 137.087 143.593 1.00 23.77  ? 103  ALA G N     1 
ATOM   5384  C CA    . ALA G 3 95  ? 160.493 138.220 144.286 1.00 23.77  ? 103  ALA G CA    1 
ATOM   5385  C C     . ALA G 3 95  ? 161.872 138.539 143.735 1.00 23.77  ? 103  ALA G C     1 
ATOM   5386  O O     . ALA G 3 95  ? 162.613 137.640 143.334 1.00 23.77  ? 103  ALA G O     1 
ATOM   5387  C CB    . ALA G 3 95  ? 160.588 137.931 145.779 1.00 23.77  ? 103  ALA G CB    1 
ATOM   5388  N N     . GLN G 3 96  ? 162.182 139.841 143.697 1.00 27.30  ? 104  GLN G N     1 
ATOM   5389  C CA    . GLN G 3 96  ? 163.411 140.407 143.134 1.00 27.30  ? 104  GLN G CA    1 
ATOM   5390  C C     . GLN G 3 96  ? 163.568 139.994 141.669 1.00 27.30  ? 104  GLN G C     1 
ATOM   5391  O O     . GLN G 3 96  ? 164.667 139.741 141.178 1.00 27.30  ? 104  GLN G O     1 
ATOM   5392  C CB    . GLN G 3 96  ? 164.632 140.019 143.973 1.00 27.30  ? 104  GLN G CB    1 
ATOM   5393  C CG    . GLN G 3 96  ? 165.784 140.985 143.889 1.00 27.30  ? 104  GLN G CG    1 
ATOM   5394  C CD    . GLN G 3 96  ? 165.402 142.331 144.436 1.00 27.30  ? 104  GLN G CD    1 
ATOM   5395  O OE1   . GLN G 3 96  ? 165.183 143.278 143.691 1.00 27.30  ? 104  GLN G OE1   1 
ATOM   5396  N NE2   . GLN G 3 96  ? 165.298 142.422 145.753 1.00 27.30  ? 104  GLN G NE2   1 
ATOM   5397  N N     . GLY G 3 97  ? 162.450 139.945 140.955 1.00 27.28  ? 105  GLY G N     1 
ATOM   5398  C CA    . GLY G 3 97  ? 162.418 139.263 139.683 1.00 27.28  ? 105  GLY G CA    1 
ATOM   5399  C C     . GLY G 3 97  ? 162.438 140.132 138.449 1.00 27.28  ? 105  GLY G C     1 
ATOM   5400  O O     . GLY G 3 97  ? 162.859 139.671 137.390 1.00 27.28  ? 105  GLY G O     1 
ATOM   5401  N N     . GLY G 3 98  ? 161.991 141.375 138.549 1.00 26.96  ? 106  GLY G N     1 
ATOM   5402  C CA    . GLY G 3 98  ? 161.925 142.218 137.367 1.00 26.96  ? 106  GLY G CA    1 
ATOM   5403  C C     . GLY G 3 98  ? 160.804 141.785 136.433 1.00 26.96  ? 106  GLY G C     1 
ATOM   5404  O O     . GLY G 3 98  ? 159.954 140.970 136.775 1.00 26.96  ? 106  GLY G O     1 
ATOM   5405  N N     . VAL G 3 99  ? 160.805 142.364 135.233 1.00 27.82  ? 107  VAL G N     1 
ATOM   5406  C CA    . VAL G 3 99  ? 159.853 142.008 134.189 1.00 27.82  ? 107  VAL G CA    1 
ATOM   5407  C C     . VAL G 3 99  ? 160.618 141.710 132.909 1.00 27.82  ? 107  VAL G C     1 
ATOM   5408  O O     . VAL G 3 99  ? 161.845 141.684 132.889 1.00 27.82  ? 107  VAL G O     1 
ATOM   5409  C CB    . VAL G 3 99  ? 158.809 143.105 133.934 1.00 27.82  ? 107  VAL G CB    1 
ATOM   5410  C CG1   . VAL G 3 99  ? 157.948 143.326 135.150 1.00 27.82  ? 107  VAL G CG1   1 
ATOM   5411  C CG2   . VAL G 3 99  ? 159.509 144.361 133.540 1.00 27.82  ? 107  VAL G CG2   1 
ATOM   5412  N N     . LEU G 3 100 ? 159.872 141.488 131.832 1.00 32.63  ? 108  LEU G N     1 
ATOM   5413  C CA    . LEU G 3 100 ? 160.577 141.132 130.613 1.00 32.63  ? 108  LEU G CA    1 
ATOM   5414  C C     . LEU G 3 100 ? 160.864 142.369 129.775 1.00 32.63  ? 108  LEU G C     1 
ATOM   5415  O O     . LEU G 3 100 ? 160.120 143.351 129.833 1.00 32.63  ? 108  LEU G O     1 
ATOM   5416  C CB    . LEU G 3 100 ? 159.760 140.161 129.770 1.00 32.63  ? 108  LEU G CB    1 
ATOM   5417  C CG    . LEU G 3 100 ? 159.561 138.729 130.230 1.00 32.63  ? 108  LEU G CG    1 
ATOM   5418  C CD1   . LEU G 3 100 ? 158.349 138.658 131.126 1.00 32.63  ? 108  LEU G CD1   1 
ATOM   5419  C CD2   . LEU G 3 100 ? 159.414 137.838 129.035 1.00 32.63  ? 108  LEU G CD2   1 
ATOM   5420  N N     . PRO G 3 101 ? 161.923 142.329 128.976 1.00 39.39  ? 109  PRO G N     1 
ATOM   5421  C CA    . PRO G 3 101 ? 162.159 143.405 128.010 1.00 39.39  ? 109  PRO G CA    1 
ATOM   5422  C C     . PRO G 3 101 ? 161.194 143.352 126.838 1.00 39.39  ? 109  PRO G C     1 
ATOM   5423  O O     . PRO G 3 101 ? 161.496 142.731 125.817 1.00 39.39  ? 109  PRO G O     1 
ATOM   5424  C CB    . PRO G 3 101 ? 163.602 143.155 127.560 1.00 39.39  ? 109  PRO G CB    1 
ATOM   5425  C CG    . PRO G 3 101 ? 164.210 142.390 128.667 1.00 39.39  ? 109  PRO G CG    1 
ATOM   5426  C CD    . PRO G 3 101 ? 163.127 141.507 129.174 1.00 39.39  ? 109  PRO G CD    1 
ATOM   5427  N N     . ASN G 3 102 ? 160.025 143.974 126.977 1.00 50.62  ? 110  ASN G N     1 
ATOM   5428  C CA    . ASN G 3 102 ? 158.986 143.909 125.952 1.00 50.62  ? 110  ASN G CA    1 
ATOM   5429  C C     . ASN G 3 102 ? 158.363 145.289 125.793 1.00 50.62  ? 110  ASN G C     1 
ATOM   5430  O O     . ASN G 3 102 ? 157.537 145.695 126.615 1.00 50.62  ? 110  ASN G O     1 
ATOM   5431  C CB    . ASN G 3 102 ? 157.926 142.878 126.326 1.00 50.62  ? 110  ASN G CB    1 
ATOM   5432  C CG    . ASN G 3 102 ? 157.029 142.515 125.168 1.00 50.62  ? 110  ASN G CG    1 
ATOM   5433  O OD1   . ASN G 3 102 ? 157.186 143.023 124.059 1.00 50.62  ? 110  ASN G OD1   1 
ATOM   5434  N ND2   . ASN G 3 102 ? 156.081 141.620 125.417 1.00 50.62  ? 110  ASN G ND2   1 
ATOM   5435  N N     . ILE G 3 103 ? 158.739 145.991 124.727 1.00 55.81  ? 111  ILE G N     1 
ATOM   5436  C CA    . ILE G 3 103 ? 158.202 147.305 124.389 1.00 55.81  ? 111  ILE G CA    1 
ATOM   5437  C C     . ILE G 3 103 ? 157.124 147.102 123.335 1.00 55.81  ? 111  ILE G C     1 
ATOM   5438  O O     . ILE G 3 103 ? 157.300 146.297 122.412 1.00 55.81  ? 111  ILE G O     1 
ATOM   5439  C CB    . ILE G 3 103 ? 159.301 148.243 123.854 1.00 55.81  ? 111  ILE G CB    1 
ATOM   5440  C CG1   . ILE G 3 103 ? 160.472 148.343 124.821 1.00 55.81  ? 111  ILE G CG1   1 
ATOM   5441  C CG2   . ILE G 3 103 ? 158.763 149.633 123.639 1.00 55.81  ? 111  ILE G CG2   1 
ATOM   5442  C CD1   . ILE G 3 103 ? 161.679 149.035 124.214 1.00 55.81  ? 111  ILE G CD1   1 
ATOM   5443  N N     . GLN G 3 104 ? 156.003 147.812 123.481 1.00 69.86  ? 112  GLN G N     1 
ATOM   5444  C CA    . GLN G 3 104 ? 154.954 147.766 122.469 1.00 69.86  ? 112  GLN G CA    1 
ATOM   5445  C C     . GLN G 3 104 ? 155.457 148.360 121.160 1.00 69.86  ? 112  GLN G C     1 
ATOM   5446  O O     . GLN G 3 104 ? 156.234 149.317 121.152 1.00 69.86  ? 112  GLN G O     1 
ATOM   5447  C CB    . GLN G 3 104 ? 153.715 148.516 122.947 1.00 69.86  ? 112  GLN G CB    1 
ATOM   5448  C CG    . GLN G 3 104 ? 153.010 147.851 124.105 1.00 69.86  ? 112  GLN G CG    1 
ATOM   5449  C CD    . GLN G 3 104 ? 152.513 146.471 123.745 1.00 69.86  ? 112  GLN G CD    1 
ATOM   5450  O OE1   . GLN G 3 104 ? 153.029 145.467 124.228 1.00 69.86  ? 112  GLN G OE1   1 
ATOM   5451  N NE2   . GLN G 3 104 ? 151.516 146.412 122.877 1.00 69.86  ? 112  GLN G NE2   1 
ATOM   5452  N N     . SER G 3 105 ? 155.024 147.769 120.046 1.00 76.80  ? 113  SER G N     1 
ATOM   5453  C CA    . SER G 3 105 ? 155.614 148.109 118.756 1.00 76.80  ? 113  SER G CA    1 
ATOM   5454  C C     . SER G 3 105 ? 155.175 149.480 118.269 1.00 76.80  ? 113  SER G C     1 
ATOM   5455  O O     . SER G 3 105 ? 155.938 150.161 117.577 1.00 76.80  ? 113  SER G O     1 
ATOM   5456  C CB    . SER G 3 105 ? 155.259 147.044 117.719 1.00 76.80  ? 113  SER G CB    1 
ATOM   5457  O OG    . SER G 3 105 ? 153.867 147.017 117.465 1.00 76.80  ? 113  SER G OG    1 
ATOM   5458  N N     . VAL G 3 106 ? 153.962 149.912 118.626 1.00 66.39  ? 114  VAL G N     1 
ATOM   5459  C CA    . VAL G 3 106 ? 153.413 151.146 118.079 1.00 66.39  ? 114  VAL G CA    1 
ATOM   5460  C C     . VAL G 3 106 ? 153.782 152.354 118.935 1.00 66.39  ? 114  VAL G C     1 
ATOM   5461  O O     . VAL G 3 106 ? 153.343 153.477 118.650 1.00 66.39  ? 114  VAL G O     1 
ATOM   5462  C CB    . VAL G 3 106 ? 151.889 150.955 117.896 1.00 66.39  ? 114  VAL G CB    1 
ATOM   5463  C CG1   . VAL G 3 106 ? 151.155 151.069 119.219 1.00 66.39  ? 114  VAL G CG1   1 
ATOM   5464  C CG2   . VAL G 3 106 ? 151.302 151.851 116.794 1.00 66.39  ? 114  VAL G CG2   1 
ATOM   5465  N N     . LEU G 3 107 ? 154.601 152.164 119.969 1.00 64.96  ? 115  LEU G N     1 
ATOM   5466  C CA    . LEU G 3 107 ? 155.106 153.284 120.755 1.00 64.96  ? 115  LEU G CA    1 
ATOM   5467  C C     . LEU G 3 107 ? 156.379 153.892 120.190 1.00 64.96  ? 115  LEU G C     1 
ATOM   5468  O O     . LEU G 3 107 ? 156.568 155.108 120.291 1.00 64.96  ? 115  LEU G O     1 
ATOM   5469  C CB    . LEU G 3 107 ? 155.380 152.850 122.192 1.00 64.96  ? 115  LEU G CB    1 
ATOM   5470  C CG    . LEU G 3 107 ? 154.141 152.535 123.004 1.00 64.96  ? 115  LEU G CG    1 
ATOM   5471  C CD1   . LEU G 3 107 ? 154.527 151.917 124.323 1.00 64.96  ? 115  LEU G CD1   1 
ATOM   5472  C CD2   . LEU G 3 107 ? 153.380 153.815 123.219 1.00 64.96  ? 115  LEU G CD2   1 
ATOM   5473  N N     . LEU G 3 108 ? 157.260 153.084 119.618 1.00 72.12  ? 116  LEU G N     1 
ATOM   5474  C CA    . LEU G 3 108 ? 158.535 153.614 119.157 1.00 72.12  ? 116  LEU G CA    1 
ATOM   5475  C C     . LEU G 3 108 ? 158.367 154.283 117.796 1.00 72.12  ? 116  LEU G C     1 
ATOM   5476  O O     . LEU G 3 108 ? 157.756 153.699 116.896 1.00 72.12  ? 116  LEU G O     1 
ATOM   5477  C CB    . LEU G 3 108 ? 159.594 152.506 119.108 1.00 72.12  ? 116  LEU G CB    1 
ATOM   5478  C CG    . LEU G 3 108 ? 159.479 151.217 118.286 1.00 72.12  ? 116  LEU G CG    1 
ATOM   5479  C CD1   . LEU G 3 108 ? 160.042 151.358 116.878 1.00 72.12  ? 116  LEU G CD1   1 
ATOM   5480  C CD2   . LEU G 3 108 ? 160.181 150.083 119.005 1.00 72.12  ? 116  LEU G CD2   1 
ATOM   5481  N N     . PRO G 3 109 ? 158.842 155.527 117.625 1.00 69.44  ? 117  PRO G N     1 
ATOM   5482  C CA    . PRO G 3 109 ? 158.843 156.173 116.310 1.00 69.44  ? 117  PRO G CA    1 
ATOM   5483  C C     . PRO G 3 109 ? 160.020 155.711 115.467 1.00 69.44  ? 117  PRO G C     1 
ATOM   5484  O O     . PRO G 3 109 ? 161.094 155.523 116.038 1.00 69.44  ? 117  PRO G O     1 
ATOM   5485  C CB    . PRO G 3 109 ? 158.971 157.662 116.647 1.00 69.44  ? 117  PRO G CB    1 
ATOM   5486  C CG    . PRO G 3 109 ? 158.578 157.772 118.088 1.00 69.44  ? 117  PRO G CG    1 
ATOM   5487  C CD    . PRO G 3 109 ? 159.068 156.504 118.701 1.00 69.44  ? 117  PRO G CD    1 
ATOM   5488  N N     . ARG H 4 2   ? 170.542 127.651 173.047 1.00 113.07 ? 29   ARG H N     1 
ATOM   5489  C CA    . ARG H 4 2   ? 170.163 126.249 172.924 1.00 113.07 ? 29   ARG H CA    1 
ATOM   5490  C C     . ARG H 4 2   ? 170.157 125.816 171.461 1.00 113.07 ? 29   ARG H C     1 
ATOM   5491  O O     . ARG H 4 2   ? 170.335 126.635 170.559 1.00 113.07 ? 29   ARG H O     1 
ATOM   5492  C CB    . ARG H 4 2   ? 168.787 126.007 173.541 1.00 113.07 ? 29   ARG H CB    1 
ATOM   5493  C CG    . ARG H 4 2   ? 167.661 126.626 172.733 1.00 113.07 ? 29   ARG H CG    1 
ATOM   5494  C CD    . ARG H 4 2   ? 166.323 126.518 173.436 1.00 113.07 ? 29   ARG H CD    1 
ATOM   5495  N NE    . ARG H 4 2   ? 165.240 127.017 172.595 1.00 113.07 ? 29   ARG H NE    1 
ATOM   5496  C CZ    . ARG H 4 2   ? 164.867 128.291 172.527 1.00 113.07 ? 29   ARG H CZ    1 
ATOM   5497  N NH1   . ARG H 4 2   ? 165.488 129.212 173.252 1.00 113.07 ? 29   ARG H NH1   1 
ATOM   5498  N NH2   . ARG H 4 2   ? 163.870 128.646 171.731 1.00 113.07 ? 29   ARG H NH2   1 
ATOM   5499  N N     . ARG H 4 3   ? 169.947 124.523 171.234 1.00 119.36 ? 30   ARG H N     1 
ATOM   5500  C CA    . ARG H 4 3   ? 169.873 123.996 169.878 1.00 119.36 ? 30   ARG H CA    1 
ATOM   5501  C C     . ARG H 4 3   ? 168.549 124.398 169.243 1.00 119.36 ? 30   ARG H C     1 
ATOM   5502  O O     . ARG H 4 3   ? 167.484 124.226 169.846 1.00 119.36 ? 30   ARG H O     1 
ATOM   5503  C CB    . ARG H 4 3   ? 170.023 122.480 169.893 1.00 119.36 ? 30   ARG H CB    1 
ATOM   5504  C CG    . ARG H 4 3   ? 170.142 121.862 168.515 1.00 119.36 ? 30   ARG H CG    1 
ATOM   5505  C CD    . ARG H 4 3   ? 170.276 120.356 168.624 1.00 119.36 ? 30   ARG H CD    1 
ATOM   5506  N NE    . ARG H 4 3   ? 171.455 119.985 169.402 1.00 119.36 ? 30   ARG H NE    1 
ATOM   5507  C CZ    . ARG H 4 3   ? 172.683 119.888 168.906 1.00 119.36 ? 30   ARG H CZ    1 
ATOM   5508  N NH1   . ARG H 4 3   ? 172.908 120.123 167.620 1.00 119.36 ? 30   ARG H NH1   1 
ATOM   5509  N NH2   . ARG H 4 3   ? 173.690 119.544 169.698 1.00 119.36 ? 30   ARG H NH2   1 
ATOM   5510  N N     . LYS H 4 4   ? 168.616 124.933 168.028 1.00 113.51 ? 31   LYS H N     1 
ATOM   5511  C CA    . LYS H 4 4   ? 167.435 125.446 167.354 1.00 113.51 ? 31   LYS H CA    1 
ATOM   5512  C C     . LYS H 4 4   ? 166.703 124.321 166.633 1.00 113.51 ? 31   LYS H C     1 
ATOM   5513  O O     . LYS H 4 4   ? 167.310 123.342 166.189 1.00 113.51 ? 31   LYS H O     1 
ATOM   5514  C CB    . LYS H 4 4   ? 167.836 126.550 166.376 1.00 113.51 ? 31   LYS H CB    1 
ATOM   5515  C CG    . LYS H 4 4   ? 168.485 127.739 167.080 1.00 113.51 ? 31   LYS H CG    1 
ATOM   5516  C CD    . LYS H 4 4   ? 169.019 128.772 166.113 1.00 113.51 ? 31   LYS H CD    1 
ATOM   5517  C CE    . LYS H 4 4   ? 167.896 129.549 165.464 1.00 113.51 ? 31   LYS H CE    1 
ATOM   5518  N NZ    . LYS H 4 4   ? 167.174 130.408 166.445 1.00 113.51 ? 31   LYS H NZ    1 
ATOM   5519  N N     . THR H 4 5   ? 165.384 124.460 166.541 1.00 106.89 ? 32   THR H N     1 
ATOM   5520  C CA    . THR H 4 5   ? 164.556 123.438 165.916 1.00 106.89 ? 32   THR H CA    1 
ATOM   5521  C C     . THR H 4 5   ? 164.782 123.449 164.410 1.00 106.89 ? 32   THR H C     1 
ATOM   5522  O O     . THR H 4 5   ? 164.881 124.513 163.794 1.00 106.89 ? 32   THR H O     1 
ATOM   5523  C CB    . THR H 4 5   ? 163.083 123.684 166.246 1.00 106.89 ? 32   THR H CB    1 
ATOM   5524  O OG1   . THR H 4 5   ? 162.924 123.769 167.667 1.00 106.89 ? 32   THR H OG1   1 
ATOM   5525  C CG2   . THR H 4 5   ? 162.207 122.550 165.739 1.00 106.89 ? 32   THR H CG2   1 
ATOM   5526  N N     . ARG H 4 6   ? 164.885 122.256 163.827 1.00 102.54 ? 33   ARG H N     1 
ATOM   5527  C CA    . ARG H 4 6   ? 165.336 122.103 162.450 1.00 102.54 ? 33   ARG H CA    1 
ATOM   5528  C C     . ARG H 4 6   ? 164.333 122.669 161.456 1.00 102.54 ? 33   ARG H C     1 
ATOM   5529  O O     . ARG H 4 6   ? 163.129 122.425 161.561 1.00 102.54 ? 33   ARG H O     1 
ATOM   5530  C CB    . ARG H 4 6   ? 165.572 120.628 162.143 1.00 102.54 ? 33   ARG H CB    1 
ATOM   5531  C CG    . ARG H 4 6   ? 166.696 120.012 162.923 1.00 102.54 ? 33   ARG H CG    1 
ATOM   5532  C CD    . ARG H 4 6   ? 166.810 118.546 162.610 1.00 102.54 ? 33   ARG H CD    1 
ATOM   5533  N NE    . ARG H 4 6   ? 167.846 117.929 163.423 1.00 102.54 ? 33   ARG H NE    1 
ATOM   5534  C CZ    . ARG H 4 6   ? 168.133 116.634 163.408 1.00 102.54 ? 33   ARG H CZ    1 
ATOM   5535  N NH1   . ARG H 4 6   ? 167.457 115.813 162.619 1.00 102.54 ? 33   ARG H NH1   1 
ATOM   5536  N NH2   . ARG H 4 6   ? 169.098 116.161 164.182 1.00 102.54 ? 33   ARG H NH2   1 
ATOM   5537  N N     . LYS H 4 7   ? 164.838 123.434 160.498 1.00 84.34  ? 34   LYS H N     1 
ATOM   5538  C CA    . LYS H 4 7   ? 164.083 123.799 159.309 1.00 84.34  ? 34   LYS H CA    1 
ATOM   5539  C C     . LYS H 4 7   ? 164.452 122.829 158.196 1.00 84.34  ? 34   LYS H C     1 
ATOM   5540  O O     . LYS H 4 7   ? 165.622 122.740 157.812 1.00 84.34  ? 34   LYS H O     1 
ATOM   5541  C CB    . LYS H 4 7   ? 164.389 125.235 158.899 1.00 84.34  ? 34   LYS H CB    1 
ATOM   5542  C CG    . LYS H 4 7   ? 163.643 125.698 157.671 1.00 84.34  ? 34   LYS H CG    1 
ATOM   5543  C CD    . LYS H 4 7   ? 163.959 127.145 157.385 1.00 84.34  ? 34   LYS H CD    1 
ATOM   5544  C CE    . LYS H 4 7   ? 163.185 127.646 156.195 1.00 84.34  ? 34   LYS H CE    1 
ATOM   5545  N NZ    . LYS H 4 7   ? 163.670 126.988 154.963 1.00 84.34  ? 34   LYS H NZ    1 
ATOM   5546  N N     . GLU H 4 8   ? 163.470 122.102 157.684 1.00 66.99  ? 35   GLU H N     1 
ATOM   5547  C CA    . GLU H 4 8   ? 163.712 121.064 156.695 1.00 66.99  ? 35   GLU H CA    1 
ATOM   5548  C C     . GLU H 4 8   ? 163.129 121.484 155.354 1.00 66.99  ? 35   GLU H C     1 
ATOM   5549  O O     . GLU H 4 8   ? 161.982 121.934 155.287 1.00 66.99  ? 35   GLU H O     1 
ATOM   5550  C CB    . GLU H 4 8   ? 163.110 119.740 157.154 1.00 66.99  ? 35   GLU H CB    1 
ATOM   5551  C CG    . GLU H 4 8   ? 163.749 119.221 158.426 1.00 66.99  ? 35   GLU H CG    1 
ATOM   5552  C CD    . GLU H 4 8   ? 163.180 117.892 158.876 1.00 66.99  ? 35   GLU H CD    1 
ATOM   5553  O OE1   . GLU H 4 8   ? 162.212 117.416 158.248 1.00 66.99  ? 35   GLU H OE1   1 
ATOM   5554  O OE2   . GLU H 4 8   ? 163.699 117.328 159.861 1.00 66.99  ? 35   GLU H OE2   1 
ATOM   5555  N N     . SER H 4 9   ? 163.910 121.319 154.290 1.00 47.92  ? 36   SER H N     1 
ATOM   5556  C CA    . SER H 4 9   ? 163.547 121.858 152.993 1.00 47.92  ? 36   SER H CA    1 
ATOM   5557  C C     . SER H 4 9   ? 164.286 121.100 151.900 1.00 47.92  ? 36   SER H C     1 
ATOM   5558  O O     . SER H 4 9   ? 165.063 120.183 152.171 1.00 47.92  ? 36   SER H O     1 
ATOM   5559  C CB    . SER H 4 9   ? 163.863 123.340 152.944 1.00 47.92  ? 36   SER H CB    1 
ATOM   5560  O OG    . SER H 4 9   ? 165.255 123.530 153.062 1.00 47.92  ? 36   SER H OG    1 
ATOM   5561  N N     . TYR H 4 10  ? 164.048 121.503 150.652 1.00 36.64  ? 37   TYR H N     1 
ATOM   5562  C CA    . TYR H 4 10  ? 164.527 120.782 149.480 1.00 36.64  ? 37   TYR H CA    1 
ATOM   5563  C C     . TYR H 4 10  ? 165.813 121.362 148.920 1.00 36.64  ? 37   TYR H C     1 
ATOM   5564  O O     . TYR H 4 10  ? 166.038 121.299 147.704 1.00 36.64  ? 37   TYR H O     1 
ATOM   5565  C CB    . TYR H 4 10  ? 163.463 120.781 148.392 1.00 36.64  ? 37   TYR H CB    1 
ATOM   5566  C CG    . TYR H 4 10  ? 162.193 120.093 148.777 1.00 36.64  ? 37   TYR H CG    1 
ATOM   5567  C CD1   . TYR H 4 10  ? 162.059 118.724 148.665 1.00 36.64  ? 37   TYR H CD1   1 
ATOM   5568  C CD2   . TYR H 4 10  ? 161.123 120.817 149.255 1.00 36.64  ? 37   TYR H CD2   1 
ATOM   5569  C CE1   . TYR H 4 10  ? 160.888 118.099 149.019 1.00 36.64  ? 37   TYR H CE1   1 
ATOM   5570  C CE2   . TYR H 4 10  ? 159.953 120.204 149.609 1.00 36.64  ? 37   TYR H CE2   1 
ATOM   5571  C CZ    . TYR H 4 10  ? 159.839 118.851 149.486 1.00 36.64  ? 37   TYR H CZ    1 
ATOM   5572  O OH    . TYR H 4 10  ? 158.662 118.262 149.849 1.00 36.64  ? 37   TYR H OH    1 
ATOM   5573  N N     . ALA H 4 11  ? 166.673 121.899 149.782 1.00 37.99  ? 38   ALA H N     1 
ATOM   5574  C CA    . ALA H 4 11  ? 167.804 122.689 149.309 1.00 37.99  ? 38   ALA H CA    1 
ATOM   5575  C C     . ALA H 4 11  ? 168.850 121.818 148.631 1.00 37.99  ? 38   ALA H C     1 
ATOM   5576  O O     . ALA H 4 11  ? 169.245 122.084 147.487 1.00 37.99  ? 38   ALA H O     1 
ATOM   5577  C CB    . ALA H 4 11  ? 168.421 123.454 150.474 1.00 37.99  ? 38   ALA H CB    1 
ATOM   5578  N N     . ILE H 4 12  ? 169.289 120.756 149.305 1.00 40.29  ? 39   ILE H N     1 
ATOM   5579  C CA    . ILE H 4 12  ? 170.312 119.899 148.728 1.00 40.29  ? 39   ILE H CA    1 
ATOM   5580  C C     . ILE H 4 12  ? 169.787 119.107 147.549 1.00 40.29  ? 39   ILE H C     1 
ATOM   5581  O O     . ILE H 4 12  ? 170.559 118.761 146.655 1.00 40.29  ? 39   ILE H O     1 
ATOM   5582  C CB    . ILE H 4 12  ? 170.904 118.970 149.794 1.00 40.29  ? 39   ILE H CB    1 
ATOM   5583  C CG1   . ILE H 4 12  ? 169.800 118.229 150.522 1.00 40.29  ? 39   ILE H CG1   1 
ATOM   5584  C CG2   . ILE H 4 12  ? 171.743 119.752 150.762 1.00 40.29  ? 39   ILE H CG2   1 
ATOM   5585  C CD1   . ILE H 4 12  ? 170.316 117.238 151.506 1.00 40.29  ? 39   ILE H CD1   1 
ATOM   5586  N N     . TYR H 4 13  ? 168.481 118.891 147.468 1.00 38.14  ? 40   TYR H N     1 
ATOM   5587  C CA    . TYR H 4 13  ? 167.946 118.154 146.335 1.00 38.14  ? 40   TYR H CA    1 
ATOM   5588  C C     . TYR H 4 13  ? 167.874 119.032 145.089 1.00 38.14  ? 40   TYR H C     1 
ATOM   5589  O O     . TYR H 4 13  ? 168.202 118.570 143.984 1.00 38.14  ? 40   TYR H O     1 
ATOM   5590  C CB    . TYR H 4 13  ? 166.591 117.581 146.715 1.00 38.14  ? 40   TYR H CB    1 
ATOM   5591  C CG    . TYR H 4 13  ? 166.690 116.781 147.984 1.00 38.14  ? 40   TYR H CG    1 
ATOM   5592  C CD1   . TYR H 4 13  ? 167.301 115.551 147.995 1.00 38.14  ? 40   TYR H CD1   1 
ATOM   5593  C CD2   . TYR H 4 13  ? 166.193 117.269 149.176 1.00 38.14  ? 40   TYR H CD2   1 
ATOM   5594  C CE1   . TYR H 4 13  ? 167.401 114.816 149.152 1.00 38.14  ? 40   TYR H CE1   1 
ATOM   5595  C CE2   . TYR H 4 13  ? 166.296 116.542 150.340 1.00 38.14  ? 40   TYR H CE2   1 
ATOM   5596  C CZ    . TYR H 4 13  ? 166.893 115.315 150.320 1.00 38.14  ? 40   TYR H CZ    1 
ATOM   5597  O OH    . TYR H 4 13  ? 166.994 114.585 151.474 1.00 38.14  ? 40   TYR H OH    1 
ATOM   5598  N N     . VAL H 4 14  ? 167.499 120.308 145.256 1.00 36.82  ? 41   VAL H N     1 
ATOM   5599  C CA    . VAL H 4 14  ? 167.592 121.270 144.156 1.00 36.82  ? 41   VAL H CA    1 
ATOM   5600  C C     . VAL H 4 14  ? 169.033 121.417 143.701 1.00 36.82  ? 41   VAL H C     1 
ATOM   5601  O O     . VAL H 4 14  ? 169.327 121.406 142.497 1.00 36.82  ? 41   VAL H O     1 
ATOM   5602  C CB    . VAL H 4 14  ? 167.003 122.625 144.583 1.00 36.82  ? 41   VAL H CB    1 
ATOM   5603  C CG1   . VAL H 4 14  ? 167.339 123.692 143.582 1.00 36.82  ? 41   VAL H CG1   1 
ATOM   5604  C CG2   . VAL H 4 14  ? 165.515 122.524 144.704 1.00 36.82  ? 41   VAL H CG2   1 
ATOM   5605  N N     . TYR H 4 15  ? 169.957 121.500 144.656 1.00 46.42  ? 42   TYR H N     1 
ATOM   5606  C CA    . TYR H 4 15  ? 171.362 121.684 144.323 1.00 46.42  ? 42   TYR H CA    1 
ATOM   5607  C C     . TYR H 4 15  ? 171.932 120.461 143.621 1.00 46.42  ? 42   TYR H C     1 
ATOM   5608  O O     . TYR H 4 15  ? 172.789 120.586 142.743 1.00 46.42  ? 42   TYR H O     1 
ATOM   5609  C CB    . TYR H 4 15  ? 172.131 121.968 145.600 1.00 46.42  ? 42   TYR H CB    1 
ATOM   5610  C CG    . TYR H 4 15  ? 173.493 122.541 145.400 1.00 46.42  ? 42   TYR H CG    1 
ATOM   5611  C CD1   . TYR H 4 15  ? 173.657 123.894 145.171 1.00 46.42  ? 42   TYR H CD1   1 
ATOM   5612  C CD2   . TYR H 4 15  ? 174.615 121.740 145.454 1.00 46.42  ? 42   TYR H CD2   1 
ATOM   5613  C CE1   . TYR H 4 15  ? 174.900 124.437 145.003 1.00 46.42  ? 42   TYR H CE1   1 
ATOM   5614  C CE2   . TYR H 4 15  ? 175.870 122.276 145.283 1.00 46.42  ? 42   TYR H CE2   1 
ATOM   5615  C CZ    . TYR H 4 15  ? 176.002 123.630 145.059 1.00 46.42  ? 42   TYR H CZ    1 
ATOM   5616  O OH    . TYR H 4 15  ? 177.246 124.180 144.881 1.00 46.42  ? 42   TYR H OH    1 
ATOM   5617  N N     . LYS H 4 16  ? 171.412 119.286 143.946 1.00 37.44  ? 43   LYS H N     1 
ATOM   5618  C CA    . LYS H 4 16  ? 171.892 118.060 143.335 1.00 37.44  ? 43   LYS H CA    1 
ATOM   5619  C C     . LYS H 4 16  ? 171.402 117.936 141.897 1.00 37.44  ? 43   LYS H C     1 
ATOM   5620  O O     . LYS H 4 16  ? 172.161 117.525 141.008 1.00 37.44  ? 43   LYS H O     1 
ATOM   5621  C CB    . LYS H 4 16  ? 171.438 116.899 144.207 1.00 37.44  ? 43   LYS H CB    1 
ATOM   5622  C CG    . LYS H 4 16  ? 172.115 115.592 143.994 1.00 37.44  ? 43   LYS H CG    1 
ATOM   5623  C CD    . LYS H 4 16  ? 171.654 114.629 145.078 1.00 37.44  ? 43   LYS H CD    1 
ATOM   5624  C CE    . LYS H 4 16  ? 172.624 114.569 146.248 1.00 37.44  ? 43   LYS H CE    1 
ATOM   5625  N NZ    . LYS H 4 16  ? 172.515 115.731 147.165 1.00 37.44  ? 43   LYS H NZ    1 
ATOM   5626  N N     . VAL H 4 17  ? 170.152 118.337 141.638 1.00 38.59  ? 44   VAL H N     1 
ATOM   5627  C CA    . VAL H 4 17  ? 169.655 118.354 140.260 1.00 38.59  ? 44   VAL H CA    1 
ATOM   5628  C C     . VAL H 4 17  ? 170.392 119.404 139.433 1.00 38.59  ? 44   VAL H C     1 
ATOM   5629  O O     . VAL H 4 17  ? 170.678 119.196 138.242 1.00 38.59  ? 44   VAL H O     1 
ATOM   5630  C CB    . VAL H 4 17  ? 168.133 118.578 140.257 1.00 38.59  ? 44   VAL H CB    1 
ATOM   5631  C CG1   . VAL H 4 17  ? 167.585 118.710 138.854 1.00 38.59  ? 44   VAL H CG1   1 
ATOM   5632  C CG2   . VAL H 4 17  ? 167.460 117.428 140.948 1.00 38.59  ? 44   VAL H CG2   1 
ATOM   5633  N N     . LEU H 4 18  ? 170.751 120.524 140.061 1.00 41.46  ? 45   LEU H N     1 
ATOM   5634  C CA    . LEU H 4 18  ? 171.540 121.536 139.368 1.00 41.46  ? 45   LEU H CA    1 
ATOM   5635  C C     . LEU H 4 18  ? 172.926 121.018 139.014 1.00 41.46  ? 45   LEU H C     1 
ATOM   5636  O O     . LEU H 4 18  ? 173.422 121.262 137.909 1.00 41.46  ? 45   LEU H O     1 
ATOM   5637  C CB    . LEU H 4 18  ? 171.650 122.792 140.222 1.00 41.46  ? 45   LEU H CB    1 
ATOM   5638  C CG    . LEU H 4 18  ? 172.445 123.902 139.557 1.00 41.46  ? 45   LEU H CG    1 
ATOM   5639  C CD1   . LEU H 4 18  ? 171.723 124.331 138.314 1.00 41.46  ? 45   LEU H CD1   1 
ATOM   5640  C CD2   . LEU H 4 18  ? 172.650 125.052 140.485 1.00 41.46  ? 45   LEU H CD2   1 
ATOM   5641  N N     . LYS H 4 19  ? 173.558 120.273 139.922 1.00 46.16  ? 46   LYS H N     1 
ATOM   5642  C CA    . LYS H 4 19  ? 174.869 119.729 139.591 1.00 46.16  ? 46   LYS H CA    1 
ATOM   5643  C C     . LYS H 4 19  ? 174.790 118.583 138.600 1.00 46.16  ? 46   LYS H C     1 
ATOM   5644  O O     . LYS H 4 19  ? 175.812 118.236 138.005 1.00 46.16  ? 46   LYS H O     1 
ATOM   5645  C CB    . LYS H 4 19  ? 175.614 119.284 140.844 1.00 46.16  ? 46   LYS H CB    1 
ATOM   5646  C CG    . LYS H 4 19  ? 175.922 120.441 141.757 1.00 46.16  ? 46   LYS H CG    1 
ATOM   5647  C CD    . LYS H 4 19  ? 176.776 121.456 141.028 1.00 46.16  ? 46   LYS H CD    1 
ATOM   5648  C CE    . LYS H 4 19  ? 177.025 122.674 141.873 1.00 46.16  ? 46   LYS H CE    1 
ATOM   5649  N NZ    . LYS H 4 19  ? 177.732 123.724 141.102 1.00 46.16  ? 46   LYS H NZ    1 
ATOM   5650  N N     . GLN H 4 20  ? 173.620 117.976 138.410 1.00 43.59  ? 47   GLN H N     1 
ATOM   5651  C CA    . GLN H 4 20  ? 173.485 117.093 137.254 1.00 43.59  ? 47   GLN H CA    1 
ATOM   5652  C C     . GLN H 4 20  ? 173.415 117.881 135.956 1.00 43.59  ? 47   GLN H C     1 
ATOM   5653  O O     . GLN H 4 20  ? 174.195 117.632 135.033 1.00 43.59  ? 47   GLN H O     1 
ATOM   5654  C CB    . GLN H 4 20  ? 172.270 116.184 137.369 1.00 43.59  ? 47   GLN H CB    1 
ATOM   5655  C CG    . GLN H 4 20  ? 172.466 115.027 138.298 1.00 43.59  ? 47   GLN H CG    1 
ATOM   5656  C CD    . GLN H 4 20  ? 171.341 114.039 138.193 1.00 43.59  ? 47   GLN H CD    1 
ATOM   5657  O OE1   . GLN H 4 20  ? 170.386 114.251 137.448 1.00 43.59  ? 47   GLN H OE1   1 
ATOM   5658  N NE2   . GLN H 4 20  ? 171.446 112.943 138.930 1.00 43.59  ? 47   GLN H NE2   1 
ATOM   5659  N N     . VAL H 4 21  ? 172.496 118.840 135.861 1.00 47.15  ? 48   VAL H N     1 
ATOM   5660  C CA    . VAL H 4 21  ? 172.233 119.435 134.549 1.00 47.15  ? 48   VAL H CA    1 
ATOM   5661  C C     . VAL H 4 21  ? 173.220 120.523 134.126 1.00 47.15  ? 48   VAL H C     1 
ATOM   5662  O O     . VAL H 4 21  ? 173.321 120.810 132.927 1.00 47.15  ? 48   VAL H O     1 
ATOM   5663  C CB    . VAL H 4 21  ? 170.807 119.996 134.449 1.00 47.15  ? 48   VAL H CB    1 
ATOM   5664  C CG1   . VAL H 4 21  ? 169.811 118.872 134.580 1.00 47.15  ? 48   VAL H CG1   1 
ATOM   5665  C CG2   . VAL H 4 21  ? 170.573 121.058 135.492 1.00 47.15  ? 48   VAL H CG2   1 
ATOM   5666  N N     . HIS H 4 22  ? 173.939 121.136 135.058 1.00 52.72  ? 49   HIS H N     1 
ATOM   5667  C CA    . HIS H 4 22  ? 175.030 122.047 134.727 1.00 52.72  ? 49   HIS H CA    1 
ATOM   5668  C C     . HIS H 4 22  ? 176.121 121.931 135.776 1.00 52.72  ? 49   HIS H C     1 
ATOM   5669  O O     . HIS H 4 22  ? 175.959 122.417 136.899 1.00 52.72  ? 49   HIS H O     1 
ATOM   5670  C CB    . HIS H 4 22  ? 174.567 123.498 134.639 1.00 52.72  ? 49   HIS H CB    1 
ATOM   5671  C CG    . HIS H 4 22  ? 173.804 123.818 133.397 1.00 52.72  ? 49   HIS H CG    1 
ATOM   5672  N ND1   . HIS H 4 22  ? 174.410 123.940 132.167 1.00 52.72  ? 49   HIS H ND1   1 
ATOM   5673  C CD2   . HIS H 4 22  ? 172.490 124.060 133.196 1.00 52.72  ? 49   HIS H CD2   1 
ATOM   5674  C CE1   . HIS H 4 22  ? 173.499 124.232 131.258 1.00 52.72  ? 49   HIS H CE1   1 
ATOM   5675  N NE2   . HIS H 4 22  ? 172.326 124.314 131.857 1.00 52.72  ? 49   HIS H NE2   1 
ATOM   5676  N N     . PRO H 4 23  ? 177.247 121.304 135.449 1.00 53.72  ? 50   PRO H N     1 
ATOM   5677  C CA    . PRO H 4 23  ? 178.251 121.027 136.479 1.00 53.72  ? 50   PRO H CA    1 
ATOM   5678  C C     . PRO H 4 23  ? 179.048 122.235 136.933 1.00 53.72  ? 50   PRO H C     1 
ATOM   5679  O O     . PRO H 4 23  ? 179.670 122.168 138.001 1.00 53.72  ? 50   PRO H O     1 
ATOM   5680  C CB    . PRO H 4 23  ? 179.160 119.994 135.806 1.00 53.72  ? 50   PRO H CB    1 
ATOM   5681  C CG    . PRO H 4 23  ? 178.320 119.401 134.726 1.00 53.72  ? 50   PRO H CG    1 
ATOM   5682  C CD    . PRO H 4 23  ? 177.484 120.521 134.230 1.00 53.72  ? 50   PRO H CD    1 
ATOM   5683  N N     . ASP H 4 24  ? 179.053 123.334 136.180 1.00 55.30  ? 51   ASP H N     1 
ATOM   5684  C CA    . ASP H 4 24  ? 179.853 124.495 136.552 1.00 55.30  ? 51   ASP H CA    1 
ATOM   5685  C C     . ASP H 4 24  ? 179.068 125.581 137.271 1.00 55.30  ? 51   ASP H C     1 
ATOM   5686  O O     . ASP H 4 24  ? 179.673 126.409 137.959 1.00 55.30  ? 51   ASP H O     1 
ATOM   5687  C CB    . ASP H 4 24  ? 180.506 125.108 135.311 1.00 55.30  ? 51   ASP H CB    1 
ATOM   5688  C CG    . ASP H 4 24  ? 179.494 125.507 134.253 1.00 55.30  ? 51   ASP H CG    1 
ATOM   5689  O OD1   . ASP H 4 24  ? 178.300 125.156 134.376 1.00 55.30  ? 51   ASP H OD1   1 
ATOM   5690  O OD2   . ASP H 4 24  ? 179.893 126.198 133.294 1.00 55.30  ? 51   ASP H OD2   1 
ATOM   5691  N N     . THR H 4 25  ? 177.751 125.605 137.115 1.00 50.24  ? 52   THR H N     1 
ATOM   5692  C CA    . THR H 4 25  ? 176.944 126.712 137.598 1.00 50.24  ? 52   THR H CA    1 
ATOM   5693  C C     . THR H 4 25  ? 176.709 126.568 139.093 1.00 50.24  ? 52   THR H C     1 
ATOM   5694  O O     . THR H 4 25  ? 176.556 125.458 139.605 1.00 50.24  ? 52   THR H O     1 
ATOM   5695  C CB    . THR H 4 25  ? 175.609 126.741 136.852 1.00 50.24  ? 52   THR H CB    1 
ATOM   5696  O OG1   . THR H 4 25  ? 175.858 126.678 135.446 1.00 50.24  ? 52   THR H OG1   1 
ATOM   5697  C CG2   . THR H 4 25  ? 174.861 128.025 137.117 1.00 50.24  ? 52   THR H CG2   1 
ATOM   5698  N N     . GLY H 4 26  ? 176.721 127.689 139.799 1.00 47.00  ? 53   GLY H N     1 
ATOM   5699  C CA    . GLY H 4 26  ? 176.239 127.737 141.156 1.00 47.00  ? 53   GLY H CA    1 
ATOM   5700  C C     . GLY H 4 26  ? 174.882 128.398 141.217 1.00 47.00  ? 53   GLY H C     1 
ATOM   5701  O O     . GLY H 4 26  ? 174.469 129.089 140.297 1.00 47.00  ? 53   GLY H O     1 
ATOM   5702  N N     . ILE H 4 27  ? 174.181 128.182 142.319 1.00 39.12  ? 54   ILE H N     1 
ATOM   5703  C CA    . ILE H 4 27  ? 172.897 128.826 142.523 1.00 39.12  ? 54   ILE H CA    1 
ATOM   5704  C C     . ILE H 4 27  ? 173.073 129.804 143.675 1.00 39.12  ? 54   ILE H C     1 
ATOM   5705  O O     . ILE H 4 27  ? 173.990 129.681 144.488 1.00 39.12  ? 54   ILE H O     1 
ATOM   5706  C CB    . ILE H 4 27  ? 171.783 127.795 142.797 1.00 39.12  ? 54   ILE H CB    1 
ATOM   5707  C CG1   . ILE H 4 27  ? 170.396 128.336 142.496 1.00 39.12  ? 54   ILE H CG1   1 
ATOM   5708  C CG2   . ILE H 4 27  ? 171.807 127.333 144.218 1.00 39.12  ? 54   ILE H CG2   1 
ATOM   5709  C CD1   . ILE H 4 27  ? 169.346 127.270 142.508 1.00 39.12  ? 54   ILE H CD1   1 
ATOM   5710  N N     . SER H 4 28  ? 172.212 130.807 143.719 1.00 34.65  ? 55   SER H N     1 
ATOM   5711  C CA    . SER H 4 28  ? 172.286 131.819 144.759 1.00 34.65  ? 55   SER H CA    1 
ATOM   5712  C C     . SER H 4 28  ? 171.663 131.274 146.034 1.00 34.65  ? 55   SER H C     1 
ATOM   5713  O O     . SER H 4 28  ? 171.385 130.081 146.159 1.00 34.65  ? 55   SER H O     1 
ATOM   5714  C CB    . SER H 4 28  ? 171.602 133.096 144.301 1.00 34.65  ? 55   SER H CB    1 
ATOM   5715  O OG    . SER H 4 28  ? 171.583 134.037 145.351 1.00 34.65  ? 55   SER H OG    1 
ATOM   5716  N N     . SER H 4 29  ? 171.450 132.136 147.015 1.00 39.66  ? 56   SER H N     1 
ATOM   5717  C CA    . SER H 4 29  ? 170.652 131.705 148.151 1.00 39.66  ? 56   SER H CA    1 
ATOM   5718  C C     . SER H 4 29  ? 169.195 132.085 147.983 1.00 39.66  ? 56   SER H C     1 
ATOM   5719  O O     . SER H 4 29  ? 168.298 131.307 148.340 1.00 39.66  ? 56   SER H O     1 
ATOM   5720  C CB    . SER H 4 29  ? 171.189 132.302 149.442 1.00 39.66  ? 56   SER H CB    1 
ATOM   5721  O OG    . SER H 4 29  ? 170.351 131.945 150.520 1.00 39.66  ? 56   SER H OG    1 
ATOM   5722  N N     . LYS H 4 30  ? 168.954 133.272 147.434 1.00 33.76  ? 57   LYS H N     1 
ATOM   5723  C CA    . LYS H 4 30  ? 167.596 133.715 147.163 1.00 33.76  ? 57   LYS H CA    1 
ATOM   5724  C C     . LYS H 4 30  ? 166.928 132.841 146.114 1.00 33.76  ? 57   LYS H C     1 
ATOM   5725  O O     . LYS H 4 30  ? 165.746 132.505 146.241 1.00 33.76  ? 57   LYS H O     1 
ATOM   5726  C CB    . LYS H 4 30  ? 167.627 135.167 146.721 1.00 33.76  ? 57   LYS H CB    1 
ATOM   5727  C CG    . LYS H 4 30  ? 166.283 135.823 146.618 1.00 33.76  ? 57   LYS H CG    1 
ATOM   5728  C CD    . LYS H 4 30  ? 166.461 137.281 146.226 1.00 33.76  ? 57   LYS H CD    1 
ATOM   5729  C CE    . LYS H 4 30  ? 167.046 138.086 147.382 1.00 33.76  ? 57   LYS H CE    1 
ATOM   5730  N NZ    . LYS H 4 30  ? 167.149 139.535 147.071 1.00 33.76  ? 57   LYS H NZ    1 
ATOM   5731  N N     . ALA H 4 31  ? 167.674 132.427 145.092 1.00 33.81  ? 58   ALA H N     1 
ATOM   5732  C CA    . ALA H 4 31  ? 167.096 131.539 144.097 1.00 33.81  ? 58   ALA H CA    1 
ATOM   5733  C C     . ALA H 4 31  ? 166.878 130.149 144.659 1.00 33.81  ? 58   ALA H C     1 
ATOM   5734  O O     . ALA H 4 31  ? 165.954 129.451 144.231 1.00 33.81  ? 58   ALA H O     1 
ATOM   5735  C CB    . ALA H 4 31  ? 167.975 131.473 142.862 1.00 33.81  ? 58   ALA H CB    1 
ATOM   5736  N N     . MET H 4 32  ? 167.697 129.740 145.628 1.00 36.14  ? 59   MET H N     1 
ATOM   5737  C CA    . MET H 4 32  ? 167.455 128.473 146.307 1.00 36.14  ? 59   MET H CA    1 
ATOM   5738  C C     . MET H 4 32  ? 166.156 128.516 147.089 1.00 36.14  ? 59   MET H C     1 
ATOM   5739  O O     . MET H 4 32  ? 165.378 127.555 147.070 1.00 36.14  ? 59   MET H O     1 
ATOM   5740  C CB    . MET H 4 32  ? 168.618 128.127 147.224 1.00 36.14  ? 59   MET H CB    1 
ATOM   5741  C CG    . MET H 4 32  ? 168.380 126.862 147.992 1.00 36.14  ? 59   MET H CG    1 
ATOM   5742  S SD    . MET H 4 32  ? 168.000 125.505 146.881 1.00 36.14  ? 59   MET H SD    1 
ATOM   5743  C CE    . MET H 4 32  ? 169.627 125.156 146.256 1.00 36.14  ? 59   MET H CE    1 
ATOM   5744  N N     . SER H 4 33  ? 165.875 129.643 147.734 1.00 30.19  ? 60   SER H N     1 
ATOM   5745  C CA    . SER H 4 33  ? 164.603 129.771 148.432 1.00 30.19  ? 60   SER H CA    1 
ATOM   5746  C C     . SER H 4 33  ? 163.419 129.855 147.474 1.00 30.19  ? 60   SER H C     1 
ATOM   5747  O O     . SER H 4 33  ? 162.330 129.364 147.801 1.00 30.19  ? 60   SER H O     1 
ATOM   5748  C CB    . SER H 4 33  ? 164.626 130.988 149.330 1.00 30.19  ? 60   SER H CB    1 
ATOM   5749  O OG    . SER H 4 33  ? 163.377 131.134 149.959 1.00 30.19  ? 60   SER H OG    1 
ATOM   5750  N N     . ILE H 4 34  ? 163.607 130.462 146.298 1.00 32.99  ? 61   ILE H N     1 
ATOM   5751  C CA    . ILE H 4 34  ? 162.562 130.453 145.269 1.00 32.99  ? 61   ILE H CA    1 
ATOM   5752  C C     . ILE H 4 34  ? 162.246 129.031 144.830 1.00 32.99  ? 61   ILE H C     1 
ATOM   5753  O O     . ILE H 4 34  ? 161.077 128.643 144.749 1.00 32.99  ? 61   ILE H O     1 
ATOM   5754  C CB    . ILE H 4 34  ? 162.976 131.325 144.074 1.00 32.99  ? 61   ILE H CB    1 
ATOM   5755  C CG1   . ILE H 4 34  ? 162.881 132.783 144.450 1.00 32.99  ? 61   ILE H CG1   1 
ATOM   5756  C CG2   . ILE H 4 34  ? 162.138 131.054 142.865 1.00 32.99  ? 61   ILE H CG2   1 
ATOM   5757  C CD1   . ILE H 4 34  ? 163.572 133.643 143.488 1.00 32.99  ? 61   ILE H CD1   1 
ATOM   5758  N N     . MET H 4 35  ? 163.279 128.231 144.555 1.00 62.13  ? 62   MET H N     1 
ATOM   5759  C CA    . MET H 4 35  ? 163.041 126.853 144.133 1.00 62.13  ? 62   MET H CA    1 
ATOM   5760  C C     . MET H 4 35  ? 162.414 126.019 145.241 1.00 62.13  ? 62   MET H C     1 
ATOM   5761  O O     . MET H 4 35  ? 161.589 125.141 144.964 1.00 62.13  ? 62   MET H O     1 
ATOM   5762  C CB    . MET H 4 35  ? 164.338 126.213 143.673 1.00 62.13  ? 62   MET H CB    1 
ATOM   5763  C CG    . MET H 4 35  ? 164.912 126.850 142.455 1.00 62.13  ? 62   MET H CG    1 
ATOM   5764  S SD    . MET H 4 35  ? 163.722 126.806 141.130 1.00 62.13  ? 62   MET H SD    1 
ATOM   5765  C CE    . MET H 4 35  ? 163.653 125.057 140.845 1.00 62.13  ? 62   MET H CE    1 
ATOM   5766  N N     . ASN H 4 36  ? 162.763 126.306 146.494 1.00 39.14  ? 63   ASN H N     1 
ATOM   5767  C CA    . ASN H 4 36  ? 162.138 125.634 147.626 1.00 39.14  ? 63   ASN H CA    1 
ATOM   5768  C C     . ASN H 4 36  ? 160.643 125.930 147.692 1.00 39.14  ? 63   ASN H C     1 
ATOM   5769  O O     . ASN H 4 36  ? 159.824 125.010 147.839 1.00 39.14  ? 63   ASN H O     1 
ATOM   5770  C CB    . ASN H 4 36  ? 162.806 126.091 148.908 1.00 39.14  ? 63   ASN H CB    1 
ATOM   5771  C CG    . ASN H 4 36  ? 162.350 125.325 150.098 1.00 39.14  ? 63   ASN H CG    1 
ATOM   5772  O OD1   . ASN H 4 36  ? 161.726 124.278 149.983 1.00 39.14  ? 63   ASN H OD1   1 
ATOM   5773  N ND2   . ASN H 4 36  ? 162.588 125.887 151.268 1.00 39.14  ? 63   ASN H ND2   1 
ATOM   5774  N N     . SER H 4 37  ? 160.265 127.213 147.601 1.00 34.95  ? 64   SER H N     1 
ATOM   5775  C CA    . SER H 4 37  ? 158.842 127.549 147.632 1.00 34.95  ? 64   SER H CA    1 
ATOM   5776  C C     . SER H 4 37  ? 158.117 127.043 146.400 1.00 34.95  ? 64   SER H C     1 
ATOM   5777  O O     . SER H 4 37  ? 156.933 126.707 146.484 1.00 34.95  ? 64   SER H O     1 
ATOM   5778  C CB    . SER H 4 37  ? 158.623 129.048 147.767 1.00 34.95  ? 64   SER H CB    1 
ATOM   5779  O OG    . SER H 4 37  ? 158.987 129.496 149.052 1.00 34.95  ? 64   SER H OG    1 
ATOM   5780  N N     . PHE H 4 38  ? 158.809 126.949 145.267 1.00 34.68  ? 65   PHE H N     1 
ATOM   5781  C CA    . PHE H 4 38  ? 158.197 126.402 144.066 1.00 34.68  ? 65   PHE H CA    1 
ATOM   5782  C C     . PHE H 4 38  ? 157.854 124.934 144.237 1.00 34.68  ? 65   PHE H C     1 
ATOM   5783  O O     . PHE H 4 38  ? 156.773 124.487 143.827 1.00 34.68  ? 65   PHE H O     1 
ATOM   5784  C CB    . PHE H 4 38  ? 159.122 126.587 142.875 1.00 34.68  ? 65   PHE H CB    1 
ATOM   5785  C CG    . PHE H 4 38  ? 158.725 125.784 141.694 1.00 34.68  ? 65   PHE H CG    1 
ATOM   5786  C CD1   . PHE H 4 38  ? 157.622 126.126 140.962 1.00 34.68  ? 65   PHE H CD1   1 
ATOM   5787  C CD2   . PHE H 4 38  ? 159.467 124.688 141.313 1.00 34.68  ? 65   PHE H CD2   1 
ATOM   5788  C CE1   . PHE H 4 38  ? 157.261 125.386 139.876 1.00 34.68  ? 65   PHE H CE1   1 
ATOM   5789  C CE2   . PHE H 4 38  ? 159.102 123.942 140.234 1.00 34.68  ? 65   PHE H CE2   1 
ATOM   5790  C CZ    . PHE H 4 38  ? 157.994 124.282 139.524 1.00 34.68  ? 65   PHE H CZ    1 
ATOM   5791  N N     . VAL H 4 39  ? 158.759 124.173 144.846 1.00 62.13  ? 66   VAL H N     1 
ATOM   5792  C CA    . VAL H 4 39  ? 158.520 122.751 145.039 1.00 62.13  ? 66   VAL H CA    1 
ATOM   5793  C C     . VAL H 4 39  ? 157.420 122.519 146.065 1.00 62.13  ? 66   VAL H C     1 
ATOM   5794  O O     . VAL H 4 39  ? 156.555 121.656 145.869 1.00 62.13  ? 66   VAL H O     1 
ATOM   5795  C CB    . VAL H 4 39  ? 159.840 122.058 145.402 1.00 62.13  ? 66   VAL H CB    1 
ATOM   5796  C CG1   . VAL H 4 39  ? 159.607 120.710 145.958 1.00 62.13  ? 66   VAL H CG1   1 
ATOM   5797  C CG2   . VAL H 4 39  ? 160.676 121.923 144.160 1.00 62.13  ? 66   VAL H CG2   1 
ATOM   5798  N N     . ASN H 4 40  ? 157.389 123.318 147.135 1.00 35.66  ? 67   ASN H N     1 
ATOM   5799  C CA    . ASN H 4 40  ? 156.264 123.229 148.064 1.00 35.66  ? 67   ASN H CA    1 
ATOM   5800  C C     . ASN H 4 40  ? 154.940 123.605 147.413 1.00 35.66  ? 67   ASN H C     1 
ATOM   5801  O O     . ASN H 4 40  ? 153.915 122.982 147.706 1.00 35.66  ? 67   ASN H O     1 
ATOM   5802  C CB    . ASN H 4 40  ? 156.496 124.111 149.279 1.00 35.66  ? 67   ASN H CB    1 
ATOM   5803  C CG    . ASN H 4 40  ? 157.543 123.561 150.196 1.00 35.66  ? 67   ASN H CG    1 
ATOM   5804  O OD1   . ASN H 4 40  ? 158.594 124.158 150.391 1.00 35.66  ? 67   ASN H OD1   1 
ATOM   5805  N ND2   . ASN H 4 40  ? 157.262 122.409 150.775 1.00 35.66  ? 67   ASN H ND2   1 
ATOM   5806  N N     . ASP H 4 41  ? 154.953 124.561 146.484 1.00 32.89  ? 68   ASP H N     1 
ATOM   5807  C CA    . ASP H 4 41  ? 153.726 124.969 145.809 1.00 32.89  ? 68   ASP H CA    1 
ATOM   5808  C C     . ASP H 4 41  ? 153.183 123.863 144.917 1.00 32.89  ? 68   ASP H C     1 
ATOM   5809  O O     . ASP H 4 41  ? 151.985 123.555 144.953 1.00 32.89  ? 68   ASP H O     1 
ATOM   5810  C CB    . ASP H 4 41  ? 153.994 126.212 144.977 1.00 32.89  ? 68   ASP H CB    1 
ATOM   5811  C CG    . ASP H 4 41  ? 152.732 126.865 144.474 1.00 32.89  ? 68   ASP H CG    1 
ATOM   5812  O OD1   . ASP H 4 41  ? 151.624 126.472 144.895 1.00 32.89  ? 68   ASP H OD1   1 
ATOM   5813  O OD2   . ASP H 4 41  ? 152.847 127.762 143.616 1.00 32.89  ? 68   ASP H OD2   1 
ATOM   5814  N N     . VAL H 4 42  ? 154.047 123.265 144.097 1.00 28.87  ? 69   VAL H N     1 
ATOM   5815  C CA    . VAL H 4 42  ? 153.567 122.244 143.171 1.00 28.87  ? 69   VAL H CA    1 
ATOM   5816  C C     . VAL H 4 42  ? 153.196 120.969 143.916 1.00 28.87  ? 69   VAL H C     1 
ATOM   5817  O O     . VAL H 4 42  ? 152.256 120.262 143.528 1.00 28.87  ? 69   VAL H O     1 
ATOM   5818  C CB    . VAL H 4 42  ? 154.622 122.022 142.080 1.00 28.87  ? 69   VAL H CB    1 
ATOM   5819  C CG1   . VAL H 4 42  ? 154.228 120.952 141.133 1.00 28.87  ? 69   VAL H CG1   1 
ATOM   5820  C CG2   . VAL H 4 42  ? 154.763 123.272 141.302 1.00 28.87  ? 69   VAL H CG2   1 
ATOM   5821  N N     . PHE H 4 43  ? 153.866 120.691 145.032 1.00 25.06  ? 70   PHE H N     1 
ATOM   5822  C CA    . PHE H 4 43  ? 153.446 119.584 145.874 1.00 25.06  ? 70   PHE H CA    1 
ATOM   5823  C C     . PHE H 4 43  ? 152.067 119.819 146.467 1.00 25.06  ? 70   PHE H C     1 
ATOM   5824  O O     . PHE H 4 43  ? 151.246 118.898 146.482 1.00 25.06  ? 70   PHE H O     1 
ATOM   5825  C CB    . PHE H 4 43  ? 154.466 119.360 146.977 1.00 25.06  ? 70   PHE H CB    1 
ATOM   5826  C CG    . PHE H 4 43  ? 154.091 118.287 147.920 1.00 25.06  ? 70   PHE H CG    1 
ATOM   5827  C CD1   . PHE H 4 43  ? 154.241 116.974 147.566 1.00 25.06  ? 70   PHE H CD1   1 
ATOM   5828  C CD2   . PHE H 4 43  ? 153.581 118.588 149.166 1.00 25.06  ? 70   PHE H CD2   1 
ATOM   5829  C CE1   . PHE H 4 43  ? 153.892 115.979 148.430 1.00 25.06  ? 70   PHE H CE1   1 
ATOM   5830  C CE2   . PHE H 4 43  ? 153.225 117.597 150.029 1.00 25.06  ? 70   PHE H CE2   1 
ATOM   5831  C CZ    . PHE H 4 43  ? 153.380 116.290 149.660 1.00 25.06  ? 70   PHE H CZ    1 
ATOM   5832  N N     . GLU H 4 44  ? 151.788 121.036 146.952 1.00 26.02  ? 71   GLU H N     1 
ATOM   5833  C CA    . GLU H 4 44  ? 150.467 121.300 147.515 1.00 26.02  ? 71   GLU H CA    1 
ATOM   5834  C C     . GLU H 4 44  ? 149.374 121.247 146.455 1.00 26.02  ? 71   GLU H C     1 
ATOM   5835  O O     . GLU H 4 44  ? 148.298 120.709 146.728 1.00 26.02  ? 71   GLU H O     1 
ATOM   5836  C CB    . GLU H 4 44  ? 150.455 122.634 148.246 1.00 26.02  ? 71   GLU H CB    1 
ATOM   5837  C CG    . GLU H 4 44  ? 151.251 122.594 149.545 1.00 26.02  ? 71   GLU H CG    1 
ATOM   5838  C CD    . GLU H 4 44  ? 151.257 123.915 150.302 1.00 26.02  ? 71   GLU H CD    1 
ATOM   5839  O OE1   . GLU H 4 44  ? 150.702 124.906 149.785 1.00 26.02  ? 71   GLU H OE1   1 
ATOM   5840  O OE2   . GLU H 4 44  ? 151.826 123.964 151.416 1.00 26.02  ? 71   GLU H OE2   1 
ATOM   5841  N N     . ARG H 4 45  ? 149.664 121.687 145.223 1.00 23.26  ? 72   ARG H N     1 
ATOM   5842  C CA    . ARG H 4 45  ? 148.682 121.573 144.141 1.00 23.26  ? 72   ARG H CA    1 
ATOM   5843  C C     . ARG H 4 45  ? 148.384 120.122 143.796 1.00 23.26  ? 72   ARG H C     1 
ATOM   5844  O O     . ARG H 4 45  ? 147.218 119.718 143.730 1.00 23.26  ? 72   ARG H O     1 
ATOM   5845  C CB    . ARG H 4 45  ? 149.150 122.295 142.881 1.00 23.26  ? 72   ARG H CB    1 
ATOM   5846  C CG    . ARG H 4 45  ? 149.120 123.787 142.946 1.00 23.26  ? 72   ARG H CG    1 
ATOM   5847  C CD    . ARG H 4 45  ? 149.489 124.373 141.610 1.00 23.26  ? 72   ARG H CD    1 
ATOM   5848  N NE    . ARG H 4 45  ? 149.672 125.813 141.708 1.00 23.26  ? 72   ARG H NE    1 
ATOM   5849  C CZ    . ARG H 4 45  ? 150.176 126.561 140.739 1.00 23.26  ? 72   ARG H CZ    1 
ATOM   5850  N NH1   . ARG H 4 45  ? 150.540 125.999 139.603 1.00 23.26  ? 72   ARG H NH1   1 
ATOM   5851  N NH2   . ARG H 4 45  ? 150.322 127.865 140.905 1.00 23.26  ? 72   ARG H NH2   1 
ATOM   5852  N N     . ILE H 4 46  ? 149.426 119.324 143.559 1.00 18.08  ? 73   ILE H N     1 
ATOM   5853  C CA    . ILE H 4 46  ? 149.210 117.970 143.063 1.00 18.08  ? 73   ILE H CA    1 
ATOM   5854  C C     . ILE H 4 46  ? 148.608 117.089 144.144 1.00 18.08  ? 73   ILE H C     1 
ATOM   5855  O O     . ILE H 4 46  ? 147.704 116.291 143.871 1.00 18.08  ? 73   ILE H O     1 
ATOM   5856  C CB    . ILE H 4 46  ? 150.516 117.389 142.500 1.00 18.08  ? 73   ILE H CB    1 
ATOM   5857  C CG1   . ILE H 4 46  ? 150.911 118.123 141.231 1.00 18.08  ? 73   ILE H CG1   1 
ATOM   5858  C CG2   . ILE H 4 46  ? 150.368 115.957 142.149 1.00 18.08  ? 73   ILE H CG2   1 
ATOM   5859  C CD1   . ILE H 4 46  ? 152.246 117.710 140.709 1.00 18.08  ? 73   ILE H CD1   1 
ATOM   5860  N N     . ALA H 4 47  ? 149.022 117.261 145.394 1.00 21.15  ? 74   ALA H N     1 
ATOM   5861  C CA    . ALA H 4 47  ? 148.386 116.448 146.418 1.00 21.15  ? 74   ALA H CA    1 
ATOM   5862  C C     . ALA H 4 47  ? 146.981 116.935 146.749 1.00 21.15  ? 74   ALA H C     1 
ATOM   5863  O O     . ALA H 4 47  ? 146.132 116.113 147.115 1.00 21.15  ? 74   ALA H O     1 
ATOM   5864  C CB    . ALA H 4 47  ? 149.251 116.392 147.667 1.00 21.15  ? 74   ALA H CB    1 
ATOM   5865  N N     . GLY H 4 48  ? 146.681 118.225 146.565 1.00 23.70  ? 75   GLY H N     1 
ATOM   5866  C CA    . GLY H 4 48  ? 145.305 118.668 146.720 1.00 23.70  ? 75   GLY H CA    1 
ATOM   5867  C C     . GLY H 4 48  ? 144.391 118.091 145.661 1.00 23.70  ? 75   GLY H C     1 
ATOM   5868  O O     . GLY H 4 48  ? 143.273 117.664 145.955 1.00 23.70  ? 75   GLY H O     1 
ATOM   5869  N N     . GLU H 4 49  ? 144.878 118.009 144.427 1.00 24.27  ? 76   GLU H N     1 
ATOM   5870  C CA    . GLU H 4 49  ? 144.059 117.443 143.364 1.00 24.27  ? 76   GLU H CA    1 
ATOM   5871  C C     . GLU H 4 49  ? 143.919 115.933 143.498 1.00 24.27  ? 76   GLU H C     1 
ATOM   5872  O O     . GLU H 4 49  ? 142.856 115.381 143.185 1.00 24.27  ? 76   GLU H O     1 
ATOM   5873  C CB    . GLU H 4 49  ? 144.650 117.807 142.014 1.00 24.27  ? 76   GLU H CB    1 
ATOM   5874  C CG    . GLU H 4 49  ? 143.797 117.390 140.887 1.00 24.27  ? 76   GLU H CG    1 
ATOM   5875  C CD    . GLU H 4 49  ? 142.476 118.113 140.874 1.00 24.27  ? 76   GLU H CD    1 
ATOM   5876  O OE1   . GLU H 4 49  ? 142.422 119.292 141.285 1.00 24.27  ? 76   GLU H OE1   1 
ATOM   5877  O OE2   . GLU H 4 49  ? 141.475 117.500 140.460 1.00 24.27  ? 76   GLU H OE2   1 
ATOM   5878  N N     . ALA H 4 50  ? 144.965 115.254 143.978 1.00 18.11  ? 77   ALA H N     1 
ATOM   5879  C CA    . ALA H 4 50  ? 144.851 113.835 144.290 1.00 18.11  ? 77   ALA H CA    1 
ATOM   5880  C C     . ALA H 4 50  ? 143.818 113.591 145.379 1.00 18.11  ? 77   ALA H C     1 
ATOM   5881  O O     . ALA H 4 50  ? 143.042 112.636 145.299 1.00 18.11  ? 77   ALA H O     1 
ATOM   5882  C CB    . ALA H 4 50  ? 146.200 113.292 144.717 1.00 18.11  ? 77   ALA H CB    1 
ATOM   5883  N N     . SER H 4 51  ? 143.751 114.473 146.377 1.00 21.83  ? 78   SER H N     1 
ATOM   5884  C CA    . SER H 4 51  ? 142.732 114.296 147.404 1.00 21.83  ? 78   SER H CA    1 
ATOM   5885  C C     . SER H 4 51  ? 141.340 114.626 146.898 1.00 21.83  ? 78   SER H C     1 
ATOM   5886  O O     . SER H 4 51  ? 140.361 114.043 147.374 1.00 21.83  ? 78   SER H O     1 
ATOM   5887  C CB    . SER H 4 51  ? 143.037 115.148 148.616 1.00 21.83  ? 78   SER H CB    1 
ATOM   5888  O OG    . SER H 4 51  ? 142.034 114.957 149.586 1.00 21.83  ? 78   SER H OG    1 
ATOM   5889  N N     . ARG H 4 52  ? 141.221 115.536 145.936 1.00 21.29  ? 79   ARG H N     1 
ATOM   5890  C CA    . ARG H 4 52  ? 139.903 115.790 145.362 1.00 21.29  ? 79   ARG H CA    1 
ATOM   5891  C C     . ARG H 4 52  ? 139.423 114.615 144.525 1.00 21.29  ? 79   ARG H C     1 
ATOM   5892  O O     . ARG H 4 52  ? 138.237 114.272 144.558 1.00 21.29  ? 79   ARG H O     1 
ATOM   5893  C CB    . ARG H 4 52  ? 139.912 117.071 144.544 1.00 21.29  ? 79   ARG H CB    1 
ATOM   5894  C CG    . ARG H 4 52  ? 139.889 118.303 145.402 1.00 21.29  ? 79   ARG H CG    1 
ATOM   5895  C CD    . ARG H 4 52  ? 139.901 119.573 144.595 1.00 21.29  ? 79   ARG H CD    1 
ATOM   5896  N NE    . ARG H 4 52  ? 139.730 120.726 145.469 1.00 21.29  ? 79   ARG H NE    1 
ATOM   5897  C CZ    . ARG H 4 52  ? 140.725 121.372 146.065 1.00 21.29  ? 79   ARG H CZ    1 
ATOM   5898  N NH1   . ARG H 4 52  ? 141.976 120.982 145.879 1.00 21.29  ? 79   ARG H NH1   1 
ATOM   5899  N NH2   . ARG H 4 52  ? 140.467 122.409 146.846 1.00 21.29  ? 79   ARG H NH2   1 
ATOM   5900  N N     . LEU H 4 53  ? 140.327 113.965 143.795 1.00 21.36  ? 80   LEU H N     1 
ATOM   5901  C CA    . LEU H 4 53  ? 139.955 112.753 143.073 1.00 21.36  ? 80   LEU H CA    1 
ATOM   5902  C C     . LEU H 4 53  ? 139.601 111.617 144.019 1.00 21.36  ? 80   LEU H C     1 
ATOM   5903  O O     . LEU H 4 53  ? 138.687 110.831 143.729 1.00 21.36  ? 80   LEU H O     1 
ATOM   5904  C CB    . LEU H 4 53  ? 141.086 112.340 142.149 1.00 21.36  ? 80   LEU H CB    1 
ATOM   5905  C CG    . LEU H 4 53  ? 141.231 113.378 141.057 1.00 21.36  ? 80   LEU H CG    1 
ATOM   5906  C CD1   . LEU H 4 53  ? 142.473 113.136 140.279 1.00 21.36  ? 80   LEU H CD1   1 
ATOM   5907  C CD2   . LEU H 4 53  ? 140.056 113.265 140.159 1.00 21.36  ? 80   LEU H CD2   1 
ATOM   5908  N N     . ALA H 4 54  ? 140.289 111.542 145.160 1.00 22.43  ? 81   ALA H N     1 
ATOM   5909  C CA    . ALA H 4 54  ? 139.943 110.578 146.195 1.00 22.43  ? 81   ALA H CA    1 
ATOM   5910  C C     . ALA H 4 54  ? 138.531 110.796 146.705 1.00 22.43  ? 81   ALA H C     1 
ATOM   5911  O O     . ALA H 4 54  ? 137.733 109.860 146.748 1.00 22.43  ? 81   ALA H O     1 
ATOM   5912  C CB    . ALA H 4 54  ? 140.936 110.671 147.346 1.00 22.43  ? 81   ALA H CB    1 
ATOM   5913  N N     . HIS H 4 55  ? 138.195 112.027 147.081 1.00 29.66  ? 82   HIS H N     1 
ATOM   5914  C CA    . HIS H 4 55  ? 136.859 112.274 147.606 1.00 29.66  ? 82   HIS H CA    1 
ATOM   5915  C C     . HIS H 4 55  ? 135.776 112.240 146.544 1.00 29.66  ? 82   HIS H C     1 
ATOM   5916  O O     . HIS H 4 55  ? 134.602 112.114 146.897 1.00 29.66  ? 82   HIS H O     1 
ATOM   5917  C CB    . HIS H 4 55  ? 136.787 113.615 148.325 1.00 29.66  ? 82   HIS H CB    1 
ATOM   5918  C CG    . HIS H 4 55  ? 137.422 113.610 149.677 1.00 29.66  ? 82   HIS H CG    1 
ATOM   5919  N ND1   . HIS H 4 55  ? 138.763 113.861 149.871 1.00 29.66  ? 82   HIS H ND1   1 
ATOM   5920  C CD2   . HIS H 4 55  ? 136.899 113.393 150.906 1.00 29.66  ? 82   HIS H CD2   1 
ATOM   5921  C CE1   . HIS H 4 55  ? 139.041 113.789 151.160 1.00 29.66  ? 82   HIS H CE1   1 
ATOM   5922  N NE2   . HIS H 4 55  ? 137.926 113.510 151.811 1.00 29.66  ? 82   HIS H NE2   1 
ATOM   5923  N N     . TYR H 4 56  ? 136.118 112.367 145.263 1.00 25.13  ? 83   TYR H N     1 
ATOM   5924  C CA    . TYR H 4 56  ? 135.069 112.293 144.251 1.00 25.13  ? 83   TYR H CA    1 
ATOM   5925  C C     . TYR H 4 56  ? 134.767 110.858 143.867 1.00 25.13  ? 83   TYR H C     1 
ATOM   5926  O O     . TYR H 4 56  ? 133.606 110.511 143.642 1.00 25.13  ? 83   TYR H O     1 
ATOM   5927  C CB    . TYR H 4 56  ? 135.455 113.095 143.012 1.00 25.13  ? 83   TYR H CB    1 
ATOM   5928  C CG    . TYR H 4 56  ? 135.435 114.586 143.222 1.00 25.13  ? 83   TYR H CG    1 
ATOM   5929  C CD1   . TYR H 4 56  ? 134.747 115.147 144.288 1.00 25.13  ? 83   TYR H CD1   1 
ATOM   5930  C CD2   . TYR H 4 56  ? 136.121 115.433 142.370 1.00 25.13  ? 83   TYR H CD2   1 
ATOM   5931  C CE1   . TYR H 4 56  ? 134.735 116.507 144.489 1.00 25.13  ? 83   TYR H CE1   1 
ATOM   5932  C CE2   . TYR H 4 56  ? 136.113 116.794 142.560 1.00 25.13  ? 83   TYR H CE2   1 
ATOM   5933  C CZ    . TYR H 4 56  ? 135.421 117.324 143.624 1.00 25.13  ? 83   TYR H CZ    1 
ATOM   5934  O OH    . TYR H 4 56  ? 135.403 118.677 143.832 1.00 25.13  ? 83   TYR H OH    1 
ATOM   5935  N N     . ASN H 4 57  ? 135.784 110.001 143.803 1.00 23.58  ? 84   ASN H N     1 
ATOM   5936  C CA    . ASN H 4 57  ? 135.559 108.621 143.405 1.00 23.58  ? 84   ASN H CA    1 
ATOM   5937  C C     . ASN H 4 57  ? 135.183 107.715 144.568 1.00 23.58  ? 84   ASN H C     1 
ATOM   5938  O O     . ASN H 4 57  ? 135.278 106.492 144.425 1.00 23.58  ? 84   ASN H O     1 
ATOM   5939  C CB    . ASN H 4 57  ? 136.788 108.079 142.688 1.00 23.58  ? 84   ASN H CB    1 
ATOM   5940  C CG    . ASN H 4 57  ? 137.044 108.786 141.396 1.00 23.58  ? 84   ASN H CG    1 
ATOM   5941  O OD1   . ASN H 4 57  ? 138.053 109.459 141.233 1.00 23.58  ? 84   ASN H OD1   1 
ATOM   5942  N ND2   . ASN H 4 57  ? 136.110 108.663 140.469 1.00 23.58  ? 84   ASN H ND2   1 
ATOM   5943  N N     . LYS H 4 58  ? 134.773 108.293 145.705 1.00 28.77  ? 85   LYS H N     1 
ATOM   5944  C CA    . LYS H 4 58  ? 134.325 107.577 146.905 1.00 28.77  ? 85   LYS H CA    1 
ATOM   5945  C C     . LYS H 4 58  ? 135.369 106.603 147.433 1.00 28.77  ? 85   LYS H C     1 
ATOM   5946  O O     . LYS H 4 58  ? 135.031 105.558 147.985 1.00 28.77  ? 85   LYS H O     1 
ATOM   5947  C CB    . LYS H 4 58  ? 133.007 106.846 146.658 1.00 28.77  ? 85   LYS H CB    1 
ATOM   5948  C CG    . LYS H 4 58  ? 131.818 107.751 146.424 1.00 28.77  ? 85   LYS H CG    1 
ATOM   5949  C CD    . LYS H 4 58  ? 130.575 106.928 146.136 1.00 28.77  ? 85   LYS H CD    1 
ATOM   5950  C CE    . LYS H 4 58  ? 129.381 107.809 145.836 1.00 28.77  ? 85   LYS H CE    1 
ATOM   5951  N NZ    . LYS H 4 58  ? 128.182 106.997 145.505 1.00 28.77  ? 85   LYS H NZ    1 
ATOM   5952  N N     . ARG H 4 59  ? 136.640 106.929 147.265 1.00 38.74  ? 86   ARG H N     1 
ATOM   5953  C CA    . ARG H 4 59  ? 137.737 106.023 147.543 1.00 38.74  ? 86   ARG H CA    1 
ATOM   5954  C C     . ARG H 4 59  ? 138.586 106.640 148.643 1.00 38.74  ? 86   ARG H C     1 
ATOM   5955  O O     . ARG H 4 59  ? 138.557 107.851 148.857 1.00 38.74  ? 86   ARG H O     1 
ATOM   5956  C CB    . ARG H 4 59  ? 138.558 105.793 146.271 1.00 38.74  ? 86   ARG H CB    1 
ATOM   5957  C CG    . ARG H 4 59  ? 139.492 104.621 146.276 1.00 38.74  ? 86   ARG H CG    1 
ATOM   5958  C CD    . ARG H 4 59  ? 140.335 104.608 145.019 1.00 38.74  ? 86   ARG H CD    1 
ATOM   5959  N NE    . ARG H 4 59  ? 139.542 104.498 143.801 1.00 38.74  ? 86   ARG H NE    1 
ATOM   5960  C CZ    . ARG H 4 59  ? 139.115 103.352 143.287 1.00 38.74  ? 86   ARG H CZ    1 
ATOM   5961  N NH1   . ARG H 4 59  ? 139.398 102.212 143.890 1.00 38.74  ? 86   ARG H NH1   1 
ATOM   5962  N NH2   . ARG H 4 59  ? 138.405 103.346 142.170 1.00 38.74  ? 86   ARG H NH2   1 
ATOM   5963  N N     . SER H 4 60  ? 139.339 105.809 149.360 1.00 38.98  ? 87   SER H N     1 
ATOM   5964  C CA    . SER H 4 60  ? 140.092 106.289 150.510 1.00 38.98  ? 87   SER H CA    1 
ATOM   5965  C C     . SER H 4 60  ? 141.600 106.224 150.328 1.00 38.98  ? 87   SER H C     1 
ATOM   5966  O O     . SER H 4 60  ? 142.329 106.535 151.268 1.00 38.98  ? 87   SER H O     1 
ATOM   5967  C CB    . SER H 4 60  ? 139.699 105.507 151.757 1.00 38.98  ? 87   SER H CB    1 
ATOM   5968  O OG    . SER H 4 60  ? 140.043 104.146 151.616 1.00 38.98  ? 87   SER H OG    1 
ATOM   5969  N N     . THR H 4 61  ? 142.094 105.867 149.146 1.00 35.45  ? 88   THR H N     1 
ATOM   5970  C CA    . THR H 4 61  ? 143.520 105.633 148.953 1.00 35.45  ? 88   THR H CA    1 
ATOM   5971  C C     . THR H 4 61  ? 144.035 106.399 147.746 1.00 35.45  ? 88   THR H C     1 
ATOM   5972  O O     . THR H 4 61  ? 143.599 106.148 146.621 1.00 35.45  ? 88   THR H O     1 
ATOM   5973  C CB    . THR H 4 61  ? 143.798 104.139 148.789 1.00 35.45  ? 88   THR H CB    1 
ATOM   5974  O OG1   . THR H 4 61  ? 143.448 103.453 149.995 1.00 35.45  ? 88   THR H OG1   1 
ATOM   5975  C CG2   . THR H 4 61  ? 145.247 103.887 148.481 1.00 35.45  ? 88   THR H CG2   1 
ATOM   5976  N N     . ILE H 4 62  ? 144.970 107.318 147.982 1.00 24.85  ? 89   ILE H N     1 
ATOM   5977  C CA    . ILE H 4 62  ? 145.773 107.910 146.918 1.00 24.85  ? 89   ILE H CA    1 
ATOM   5978  C C     . ILE H 4 62  ? 146.686 106.842 146.338 1.00 24.85  ? 89   ILE H C     1 
ATOM   5979  O O     . ILE H 4 62  ? 147.483 106.236 147.058 1.00 24.85  ? 89   ILE H O     1 
ATOM   5980  C CB    . ILE H 4 62  ? 146.605 109.076 147.453 1.00 24.85  ? 89   ILE H CB    1 
ATOM   5981  C CG1   . ILE H 4 62  ? 145.730 110.235 147.840 1.00 24.85  ? 89   ILE H CG1   1 
ATOM   5982  C CG2   . ILE H 4 62  ? 147.609 109.524 146.437 1.00 24.85  ? 89   ILE H CG2   1 
ATOM   5983  C CD1   . ILE H 4 62  ? 146.487 111.272 148.580 1.00 24.85  ? 89   ILE H CD1   1 
ATOM   5984  N N     . THR H 4 63  ? 146.595 106.614 145.039 1.00 26.69  ? 90   THR H N     1 
ATOM   5985  C CA    . THR H 4 63  ? 147.503 105.703 144.359 1.00 26.69  ? 90   THR H CA    1 
ATOM   5986  C C     . THR H 4 63  ? 148.211 106.426 143.226 1.00 26.69  ? 90   THR H C     1 
ATOM   5987  O O     . THR H 4 63  ? 148.030 107.630 143.006 1.00 26.69  ? 90   THR H O     1 
ATOM   5988  C CB    . THR H 4 63  ? 146.765 104.486 143.807 1.00 26.69  ? 90   THR H CB    1 
ATOM   5989  O OG1   . THR H 4 63  ? 145.762 104.920 142.886 1.00 26.69  ? 90   THR H OG1   1 
ATOM   5990  C CG2   . THR H 4 63  ? 146.121 103.699 144.907 1.00 26.69  ? 90   THR H CG2   1 
ATOM   5991  N N     . SER H 4 64  ? 149.014 105.658 142.491 1.00 29.08  ? 91   SER H N     1 
ATOM   5992  C CA    . SER H 4 64  ? 149.725 106.209 141.348 1.00 29.08  ? 91   SER H CA    1 
ATOM   5993  C C     . SER H 4 64  ? 148.777 106.665 140.254 1.00 29.08  ? 91   SER H C     1 
ATOM   5994  O O     . SER H 4 64  ? 149.094 107.600 139.518 1.00 29.08  ? 91   SER H O     1 
ATOM   5995  C CB    . SER H 4 64  ? 150.694 105.181 140.793 1.00 29.08  ? 91   SER H CB    1 
ATOM   5996  O OG    . SER H 4 64  ? 151.313 105.667 139.621 1.00 29.08  ? 91   SER H OG    1 
ATOM   5997  N N     . ARG H 4 65  ? 147.610 106.038 140.147 1.00 26.54  ? 92   ARG H N     1 
ATOM   5998  C CA    . ARG H 4 65  ? 146.631 106.473 139.162 1.00 26.54  ? 92   ARG H CA    1 
ATOM   5999  C C     . ARG H 4 65  ? 146.077 107.848 139.512 1.00 26.54  ? 92   ARG H C     1 
ATOM   6000  O O     . ARG H 4 65  ? 145.898 108.687 138.624 1.00 26.54  ? 92   ARG H O     1 
ATOM   6001  C CB    . ARG H 4 65  ? 145.526 105.426 139.054 1.00 26.54  ? 92   ARG H CB    1 
ATOM   6002  C CG    . ARG H 4 65  ? 144.539 105.636 137.939 1.00 26.54  ? 92   ARG H CG    1 
ATOM   6003  C CD    . ARG H 4 65  ? 143.654 104.408 137.803 1.00 26.54  ? 92   ARG H CD    1 
ATOM   6004  N NE    . ARG H 4 65  ? 142.618 104.561 136.787 1.00 26.54  ? 92   ARG H NE    1 
ATOM   6005  C CZ    . ARG H 4 65  ? 142.807 104.354 135.489 1.00 26.54  ? 92   ARG H CZ    1 
ATOM   6006  N NH1   . ARG H 4 65  ? 144.003 104.014 135.038 1.00 26.54  ? 92   ARG H NH1   1 
ATOM   6007  N NH2   . ARG H 4 65  ? 141.808 104.504 134.635 1.00 26.54  ? 92   ARG H NH2   1 
ATOM   6008  N N     . GLU H 4 66  ? 145.848 108.118 140.800 1.00 26.50  ? 93   GLU H N     1 
ATOM   6009  C CA    . GLU H 4 66  ? 145.399 109.447 141.202 1.00 26.50  ? 93   GLU H CA    1 
ATOM   6010  C C     . GLU H 4 66  ? 146.485 110.492 141.033 1.00 26.50  ? 93   GLU H C     1 
ATOM   6011  O O     . GLU H 4 66  ? 146.187 111.628 140.650 1.00 26.50  ? 93   GLU H O     1 
ATOM   6012  C CB    . GLU H 4 66  ? 144.910 109.440 142.640 1.00 26.50  ? 93   GLU H CB    1 
ATOM   6013  C CG    . GLU H 4 66  ? 143.500 108.973 142.774 1.00 26.50  ? 93   GLU H CG    1 
ATOM   6014  C CD    . GLU H 4 66  ? 143.360 107.478 142.761 1.00 26.50  ? 93   GLU H CD    1 
ATOM   6015  O OE1   . GLU H 4 66  ? 144.384 106.770 142.748 1.00 26.50  ? 93   GLU H OE1   1 
ATOM   6016  O OE2   . GLU H 4 66  ? 142.209 106.999 142.756 1.00 26.50  ? 93   GLU H OE2   1 
ATOM   6017  N N     . ILE H 4 67  ? 147.744 110.139 141.301 1.00 20.46  ? 94   ILE H N     1 
ATOM   6018  C CA    . ILE H 4 67  ? 148.792 111.128 141.066 1.00 20.46  ? 94   ILE H CA    1 
ATOM   6019  C C     . ILE H 4 67  ? 148.949 111.395 139.574 1.00 20.46  ? 94   ILE H C     1 
ATOM   6020  O O     . ILE H 4 67  ? 149.153 112.541 139.165 1.00 20.46  ? 94   ILE H O     1 
ATOM   6021  C CB    . ILE H 4 67  ? 150.117 110.708 141.717 1.00 20.46  ? 94   ILE H CB    1 
ATOM   6022  C CG1   . ILE H 4 67  ? 149.927 110.515 143.211 1.00 20.46  ? 94   ILE H CG1   1 
ATOM   6023  C CG2   . ILE H 4 67  ? 151.163 111.760 141.532 1.00 20.46  ? 94   ILE H CG2   1 
ATOM   6024  C CD1   . ILE H 4 67  ? 149.474 111.726 143.918 1.00 20.46  ? 94   ILE H CD1   1 
ATOM   6025  N N     . GLN H 4 68  ? 148.743 110.383 138.735 1.00 25.82  ? 95   GLN H N     1 
ATOM   6026  C CA    . GLN H 4 68  ? 148.859 110.586 137.295 1.00 25.82  ? 95   GLN H CA    1 
ATOM   6027  C C     . GLN H 4 68  ? 147.704 111.407 136.743 1.00 25.82  ? 95   GLN H C     1 
ATOM   6028  O O     . GLN H 4 68  ? 147.908 112.263 135.874 1.00 25.82  ? 95   GLN H O     1 
ATOM   6029  C CB    . GLN H 4 68  ? 148.938 109.241 136.593 1.00 25.82  ? 95   GLN H CB    1 
ATOM   6030  C CG    . GLN H 4 68  ? 149.083 109.323 135.105 1.00 25.82  ? 95   GLN H CG    1 
ATOM   6031  C CD    . GLN H 4 68  ? 149.230 107.958 134.484 1.00 25.82  ? 95   GLN H CD    1 
ATOM   6032  O OE1   . GLN H 4 68  ? 149.260 106.949 135.181 1.00 25.82  ? 95   GLN H OE1   1 
ATOM   6033  N NE2   . GLN H 4 68  ? 149.297 107.913 133.163 1.00 25.82  ? 95   GLN H NE2   1 
ATOM   6034  N N     . THR H 4 69  ? 146.489 111.187 137.244 1.00 21.86  ? 96   THR H N     1 
ATOM   6035  C CA    . THR H 4 69  ? 145.373 112.016 136.798 1.00 21.86  ? 96   THR H CA    1 
ATOM   6036  C C     . THR H 4 69  ? 145.506 113.445 137.300 1.00 21.86  ? 96   THR H C     1 
ATOM   6037  O O     . THR H 4 69  ? 145.211 114.389 136.556 1.00 21.86  ? 96   THR H O     1 
ATOM   6038  C CB    . THR H 4 69  ? 144.050 111.405 137.238 1.00 21.86  ? 96   THR H CB    1 
ATOM   6039  O OG1   . THR H 4 69  ? 143.925 110.103 136.661 1.00 21.86  ? 96   THR H OG1   1 
ATOM   6040  C CG2   . THR H 4 69  ? 142.902 112.227 136.752 1.00 21.86  ? 96   THR H CG2   1 
ATOM   6041  N N     . ALA H 4 70  ? 146.025 113.633 138.516 1.00 20.38  ? 97   ALA H N     1 
ATOM   6042  C CA    . ALA H 4 70  ? 146.264 114.985 139.000 1.00 20.38  ? 97   ALA H CA    1 
ATOM   6043  C C     . ALA H 4 70  ? 147.341 115.695 138.198 1.00 20.38  ? 97   ALA H C     1 
ATOM   6044  O O     . ALA H 4 70  ? 147.230 116.899 137.956 1.00 20.38  ? 97   ALA H O     1 
ATOM   6045  C CB    . ALA H 4 70  ? 146.633 114.952 140.474 1.00 20.38  ? 97   ALA H CB    1 
ATOM   6046  N N     . VAL H 4 71  ? 148.348 114.962 137.727 1.00 21.33  ? 98   VAL H N     1 
ATOM   6047  C CA    . VAL H 4 71  ? 149.373 115.567 136.887 1.00 21.33  ? 98   VAL H CA    1 
ATOM   6048  C C     . VAL H 4 71  ? 148.803 115.949 135.530 1.00 21.33  ? 98   VAL H C     1 
ATOM   6049  O O     . VAL H 4 71  ? 149.038 117.060 135.045 1.00 21.33  ? 98   VAL H O     1 
ATOM   6050  C CB    . VAL H 4 71  ? 150.576 114.625 136.758 1.00 21.33  ? 98   VAL H CB    1 
ATOM   6051  C CG1   . VAL H 4 71  ? 151.470 115.042 135.647 1.00 21.33  ? 98   VAL H CG1   1 
ATOM   6052  C CG2   . VAL H 4 71  ? 151.368 114.663 138.022 1.00 21.33  ? 98   VAL H CG2   1 
ATOM   6053  N N     . ARG H 4 72  ? 148.023 115.049 134.913 1.00 27.10  ? 99   ARG H N     1 
ATOM   6054  C CA    . ARG H 4 72  ? 147.399 115.349 133.620 1.00 27.10  ? 99   ARG H CA    1 
ATOM   6055  C C     . ARG H 4 72  ? 146.457 116.537 133.690 1.00 27.10  ? 99   ARG H C     1 
ATOM   6056  O O     . ARG H 4 72  ? 146.347 117.297 132.723 1.00 27.10  ? 99   ARG H O     1 
ATOM   6057  C CB    . ARG H 4 72  ? 146.619 114.155 133.101 1.00 27.10  ? 99   ARG H CB    1 
ATOM   6058  C CG    . ARG H 4 72  ? 147.445 113.067 132.510 1.00 27.10  ? 99   ARG H CG    1 
ATOM   6059  C CD    . ARG H 4 72  ? 146.513 111.991 132.059 1.00 27.10  ? 99   ARG H CD    1 
ATOM   6060  N NE    . ARG H 4 72  ? 147.209 110.844 131.507 1.00 27.10  ? 99   ARG H NE    1 
ATOM   6061  C CZ    . ARG H 4 72  ? 146.605 109.707 131.192 1.00 27.10  ? 99   ARG H CZ    1 
ATOM   6062  N NH1   . ARG H 4 72  ? 145.299 109.576 131.395 1.00 27.10  ? 99   ARG H NH1   1 
ATOM   6063  N NH2   . ARG H 4 72  ? 147.305 108.699 130.691 1.00 27.10  ? 99   ARG H NH2   1 
ATOM   6064  N N     . LEU H 4 73  ? 145.779 116.718 134.819 1.00 24.86  ? 100  LEU H N     1 
ATOM   6065  C CA    . LEU H 4 73  ? 144.946 117.902 134.978 1.00 24.86  ? 100  LEU H CA    1 
ATOM   6066  C C     . LEU H 4 73  ? 145.787 119.154 135.172 1.00 24.86  ? 100  LEU H C     1 
ATOM   6067  O O     . LEU H 4 73  ? 145.601 120.147 134.462 1.00 24.86  ? 100  LEU H O     1 
ATOM   6068  C CB    . LEU H 4 73  ? 143.989 117.733 136.149 1.00 24.86  ? 100  LEU H CB    1 
ATOM   6069  C CG    . LEU H 4 73  ? 142.791 116.826 135.976 1.00 24.86  ? 100  LEU H CG    1 
ATOM   6070  C CD1   . LEU H 4 73  ? 142.046 116.775 137.271 1.00 24.86  ? 100  LEU H CD1   1 
ATOM   6071  C CD2   . LEU H 4 73  ? 141.929 117.403 134.911 1.00 24.86  ? 100  LEU H CD2   1 
ATOM   6072  N N     . LEU H 4 74  ? 146.716 119.136 136.130 1.00 27.72  ? 101  LEU H N     1 
ATOM   6073  C CA    . LEU H 4 74  ? 147.358 120.381 136.538 1.00 27.72  ? 101  LEU H CA    1 
ATOM   6074  C C     . LEU H 4 74  ? 148.421 120.845 135.554 1.00 27.72  ? 101  LEU H C     1 
ATOM   6075  O O     . LEU H 4 74  ? 148.408 122.006 135.139 1.00 27.72  ? 101  LEU H O     1 
ATOM   6076  C CB    . LEU H 4 74  ? 147.946 120.239 137.933 1.00 27.72  ? 101  LEU H CB    1 
ATOM   6077  C CG    . LEU H 4 74  ? 146.842 120.125 138.977 1.00 27.72  ? 101  LEU H CG    1 
ATOM   6078  C CD1   . LEU H 4 74  ? 147.435 119.962 140.356 1.00 27.72  ? 101  LEU H CD1   1 
ATOM   6079  C CD2   . LEU H 4 74  ? 145.925 121.334 138.935 1.00 27.72  ? 101  LEU H CD2   1 
ATOM   6080  N N     . LEU H 4 75  ? 149.352 119.979 135.182 1.00 28.28  ? 102  LEU H N     1 
ATOM   6081  C CA    . LEU H 4 75  ? 150.379 120.446 134.267 1.00 28.28  ? 102  LEU H CA    1 
ATOM   6082  C C     . LEU H 4 75  ? 149.829 120.471 132.845 1.00 28.28  ? 102  LEU H C     1 
ATOM   6083  O O     . LEU H 4 75  ? 149.036 119.607 132.477 1.00 28.28  ? 102  LEU H O     1 
ATOM   6084  C CB    . LEU H 4 75  ? 151.602 119.553 134.339 1.00 28.28  ? 102  LEU H CB    1 
ATOM   6085  C CG    . LEU H 4 75  ? 152.209 119.523 135.733 1.00 28.28  ? 102  LEU H CG    1 
ATOM   6086  C CD1   . LEU H 4 75  ? 153.358 118.566 135.791 1.00 28.28  ? 102  LEU H CD1   1 
ATOM   6087  C CD2   . LEU H 4 75  ? 152.672 120.881 136.106 1.00 28.28  ? 102  LEU H CD2   1 
ATOM   6088  N N     . PRO H 4 76  ? 150.178 121.473 132.048 1.00 34.27  ? 103  PRO H N     1 
ATOM   6089  C CA    . PRO H 4 76  ? 149.676 121.541 130.675 1.00 34.27  ? 103  PRO H CA    1 
ATOM   6090  C C     . PRO H 4 76  ? 150.578 120.813 129.688 1.00 34.27  ? 103  PRO H C     1 
ATOM   6091  O O     . PRO H 4 76  ? 151.726 120.491 129.987 1.00 34.27  ? 103  PRO H O     1 
ATOM   6092  C CB    . PRO H 4 76  ? 149.677 123.046 130.386 1.00 34.27  ? 103  PRO H CB    1 
ATOM   6093  C CG    . PRO H 4 76  ? 149.751 123.698 131.717 1.00 34.27  ? 103  PRO H CG    1 
ATOM   6094  C CD    . PRO H 4 76  ? 150.601 122.794 132.518 1.00 34.27  ? 103  PRO H CD    1 
ATOM   6095  N N     . GLY H 4 77  ? 149.968 120.437 128.560 1.00 44.30  ? 104  GLY H N     1 
ATOM   6096  C CA    . GLY H 4 77  ? 150.652 120.103 127.311 1.00 44.30  ? 104  GLY H CA    1 
ATOM   6097  C C     . GLY H 4 77  ? 151.857 119.173 127.356 1.00 44.30  ? 104  GLY H C     1 
ATOM   6098  O O     . GLY H 4 77  ? 151.800 118.036 127.859 1.00 44.30  ? 104  GLY H O     1 
ATOM   6099  N N     . GLU H 4 78  ? 152.962 119.687 126.809 1.00 48.98  ? 105  GLU H N     1 
ATOM   6100  C CA    . GLU H 4 78  ? 154.187 118.912 126.659 1.00 48.98  ? 105  GLU H CA    1 
ATOM   6101  C C     . GLU H 4 78  ? 154.772 118.539 128.014 1.00 48.98  ? 105  GLU H C     1 
ATOM   6102  O O     . GLU H 4 78  ? 155.326 117.440 128.183 1.00 48.98  ? 105  GLU H O     1 
ATOM   6103  C CB    . GLU H 4 78  ? 155.189 119.730 125.849 1.00 48.98  ? 105  GLU H CB    1 
ATOM   6104  C CG    . GLU H 4 78  ? 156.476 119.038 125.461 1.00 48.98  ? 105  GLU H CG    1 
ATOM   6105  C CD    . GLU H 4 78  ? 156.293 118.079 124.316 1.00 48.98  ? 105  GLU H CD    1 
ATOM   6106  O OE1   . GLU H 4 78  ? 155.330 118.269 123.545 1.00 48.98  ? 105  GLU H OE1   1 
ATOM   6107  O OE2   . GLU H 4 78  ? 157.120 117.158 124.169 1.00 48.98  ? 105  GLU H OE2   1 
ATOM   6108  N N     . LEU H 4 79  ? 154.646 119.440 128.993 1.00 44.15  ? 106  LEU H N     1 
ATOM   6109  C CA    . LEU H 4 79  ? 155.125 119.155 130.338 1.00 44.15  ? 106  LEU H CA    1 
ATOM   6110  C C     . LEU H 4 79  ? 154.336 118.031 130.968 1.00 44.15  ? 106  LEU H C     1 
ATOM   6111  O O     . LEU H 4 79  ? 154.900 117.191 131.672 1.00 44.15  ? 106  LEU H O     1 
ATOM   6112  C CB    . LEU H 4 79  ? 155.020 120.385 131.221 1.00 44.15  ? 106  LEU H CB    1 
ATOM   6113  C CG    . LEU H 4 79  ? 155.846 121.591 130.840 1.00 44.15  ? 106  LEU H CG    1 
ATOM   6114  C CD1   . LEU H 4 79  ? 155.586 122.660 131.869 1.00 44.15  ? 106  LEU H CD1   1 
ATOM   6115  C CD2   . LEU H 4 79  ? 157.304 121.232 130.780 1.00 44.15  ? 106  LEU H CD2   1 
ATOM   6116  N N     . ALA H 4 80  ? 153.028 118.013 130.727 1.00 42.88  ? 107  ALA H N     1 
ATOM   6117  C CA    . ALA H 4 80  ? 152.188 116.937 131.230 1.00 42.88  ? 107  ALA H CA    1 
ATOM   6118  C C     . ALA H 4 80  ? 152.603 115.606 130.637 1.00 42.88  ? 107  ALA H C     1 
ATOM   6119  O O     . ALA H 4 80  ? 152.716 114.605 131.359 1.00 42.88  ? 107  ALA H O     1 
ATOM   6120  C CB    . ALA H 4 80  ? 150.727 117.222 130.909 1.00 42.88  ? 107  ALA H CB    1 
ATOM   6121  N N     . LYS H 4 81  ? 152.883 115.597 129.331 1.00 48.35  ? 108  LYS H N     1 
ATOM   6122  C CA    . LYS H 4 81  ? 153.259 114.355 128.661 1.00 48.35  ? 108  LYS H CA    1 
ATOM   6123  C C     . LYS H 4 81  ? 154.585 113.816 129.189 1.00 48.35  ? 108  LYS H C     1 
ATOM   6124  O O     . LYS H 4 81  ? 154.684 112.639 129.567 1.00 48.35  ? 108  LYS H O     1 
ATOM   6125  C CB    . LYS H 4 81  ? 153.324 114.572 127.154 1.00 48.35  ? 108  LYS H CB    1 
ATOM   6126  C CG    . LYS H 4 81  ? 151.972 114.825 126.528 1.00 48.35  ? 108  LYS H CG    1 
ATOM   6127  C CD    . LYS H 4 81  ? 152.084 115.088 125.039 1.00 48.35  ? 108  LYS H CD    1 
ATOM   6128  C CE    . LYS H 4 81  ? 152.360 113.815 124.270 1.00 48.35  ? 108  LYS H CE    1 
ATOM   6129  N NZ    . LYS H 4 81  ? 151.172 112.915 124.281 1.00 48.35  ? 108  LYS H NZ    1 
ATOM   6130  N N     . HIS H 4 82  ? 155.602 114.673 129.290 1.00 48.15  ? 109  HIS H N     1 
ATOM   6131  C CA    . HIS H 4 82  ? 156.876 114.155 129.775 1.00 48.15  ? 109  HIS H CA    1 
ATOM   6132  C C     . HIS H 4 82  ? 156.894 113.919 131.279 1.00 48.15  ? 109  HIS H C     1 
ATOM   6133  O O     . HIS H 4 82  ? 157.669 113.077 131.744 1.00 48.15  ? 109  HIS H O     1 
ATOM   6134  C CB    . HIS H 4 82  ? 158.021 115.071 129.380 1.00 48.15  ? 109  HIS H CB    1 
ATOM   6135  C CG    . HIS H 4 82  ? 158.195 115.191 127.906 1.00 48.15  ? 109  HIS H CG    1 
ATOM   6136  N ND1   . HIS H 4 82  ? 158.600 114.138 127.119 1.00 48.15  ? 109  HIS H ND1   1 
ATOM   6137  C CD2   . HIS H 4 82  ? 158.032 116.242 127.074 1.00 48.15  ? 109  HIS H CD2   1 
ATOM   6138  C CE1   . HIS H 4 82  ? 158.667 114.530 125.861 1.00 48.15  ? 109  HIS H CE1   1 
ATOM   6139  N NE2   . HIS H 4 82  ? 158.331 115.805 125.807 1.00 48.15  ? 109  HIS H NE2   1 
ATOM   6140  N N     . ALA H 4 83  ? 156.028 114.589 132.042 1.00 45.64  ? 110  ALA H N     1 
ATOM   6141  C CA    . ALA H 4 83  ? 155.931 114.292 133.464 1.00 45.64  ? 110  ALA H CA    1 
ATOM   6142  C C     . ALA H 4 83  ? 155.328 112.918 133.698 1.00 45.64  ? 110  ALA H C     1 
ATOM   6143  O O     . ALA H 4 83  ? 155.816 112.159 134.546 1.00 45.64  ? 110  ALA H O     1 
ATOM   6144  C CB    . ALA H 4 83  ? 155.106 115.359 134.167 1.00 45.64  ? 110  ALA H CB    1 
ATOM   6145  N N     . VAL H 4 84  ? 154.273 112.578 132.953 1.00 40.48  ? 111  VAL H N     1 
ATOM   6146  C CA    . VAL H 4 84  ? 153.717 111.228 133.010 1.00 40.48  ? 111  VAL H CA    1 
ATOM   6147  C C     . VAL H 4 84  ? 154.737 110.196 132.544 1.00 40.48  ? 111  VAL H C     1 
ATOM   6148  O O     . VAL H 4 84  ? 154.815 109.091 133.106 1.00 40.48  ? 111  VAL H O     1 
ATOM   6149  C CB    . VAL H 4 84  ? 152.418 111.188 132.187 1.00 40.48  ? 111  VAL H CB    1 
ATOM   6150  C CG1   . VAL H 4 84  ? 151.894 109.792 132.033 1.00 40.48  ? 111  VAL H CG1   1 
ATOM   6151  C CG2   . VAL H 4 84  ? 151.378 112.025 132.876 1.00 40.48  ? 111  VAL H CG2   1 
ATOM   6152  N N     . SER H 4 85  ? 155.570 110.556 131.560 1.00 44.70  ? 112  SER H N     1 
ATOM   6153  C CA    . SER H 4 85  ? 156.644 109.664 131.120 1.00 44.70  ? 112  SER H CA    1 
ATOM   6154  C C     . SER H 4 85  ? 157.638 109.370 132.241 1.00 44.70  ? 112  SER H C     1 
ATOM   6155  O O     . SER H 4 85  ? 157.968 108.200 132.500 1.00 44.70  ? 112  SER H O     1 
ATOM   6156  C CB    . SER H 4 85  ? 157.366 110.276 129.928 1.00 44.70  ? 112  SER H CB    1 
ATOM   6157  O OG    . SER H 4 85  ? 158.490 109.492 129.573 1.00 44.70  ? 112  SER H OG    1 
ATOM   6158  N N     . GLU H 4 86  ? 158.109 110.421 132.925 1.00 44.98  ? 113  GLU H N     1 
ATOM   6159  C CA    . GLU H 4 86  ? 159.032 110.243 134.046 1.00 44.98  ? 113  GLU H CA    1 
ATOM   6160  C C     . GLU H 4 86  ? 158.398 109.447 135.173 1.00 44.98  ? 113  GLU H C     1 
ATOM   6161  O O     . GLU H 4 86  ? 159.066 108.633 135.823 1.00 44.98  ? 113  GLU H O     1 
ATOM   6162  C CB    . GLU H 4 86  ? 159.495 111.593 134.578 1.00 44.98  ? 113  GLU H CB    1 
ATOM   6163  C CG    . GLU H 4 86  ? 160.459 112.328 133.696 1.00 44.98  ? 113  GLU H CG    1 
ATOM   6164  C CD    . GLU H 4 86  ? 161.815 111.678 133.675 1.00 44.98  ? 113  GLU H CD    1 
ATOM   6165  O OE1   . GLU H 4 86  ? 162.182 111.044 134.686 1.00 44.98  ? 113  GLU H OE1   1 
ATOM   6166  O OE2   . GLU H 4 86  ? 162.523 111.817 132.658 1.00 44.98  ? 113  GLU H OE2   1 
ATOM   6167  N N     . GLY H 4 87  ? 157.101 109.641 135.394 1.00 37.57  ? 114  GLY H N     1 
ATOM   6168  C CA    . GLY H 4 87  ? 156.440 108.922 136.464 1.00 37.57  ? 114  GLY H CA    1 
ATOM   6169  C C     . GLY H 4 87  ? 156.333 107.433 136.199 1.00 37.57  ? 114  GLY H C     1 
ATOM   6170  O O     . GLY H 4 87  ? 156.631 106.618 137.080 1.00 37.57  ? 114  GLY H O     1 
ATOM   6171  N N     . THR H 4 88  ? 155.904 107.060 134.989 1.00 41.68  ? 115  THR H N     1 
ATOM   6172  C CA    . THR H 4 88  ? 155.789 105.641 134.666 1.00 41.68  ? 115  THR H CA    1 
ATOM   6173  C C     . THR H 4 88  ? 157.149 104.967 134.659 1.00 41.68  ? 115  THR H C     1 
ATOM   6174  O O     . THR H 4 88  ? 157.280 103.825 135.122 1.00 41.68  ? 115  THR H O     1 
ATOM   6175  C CB    . THR H 4 88  ? 155.110 105.438 133.317 1.00 41.68  ? 115  THR H CB    1 
ATOM   6176  O OG1   . THR H 4 88  ? 155.861 106.106 132.301 1.00 41.68  ? 115  THR H OG1   1 
ATOM   6177  C CG2   . THR H 4 88  ? 153.693 105.956 133.343 1.00 41.68  ? 115  THR H CG2   1 
ATOM   6178  N N     . LYS H 4 89  ? 158.179 105.677 134.180 1.00 43.25  ? 116  LYS H N     1 
ATOM   6179  C CA    . LYS H 4 89  ? 159.535 105.139 134.221 1.00 43.25  ? 116  LYS H CA    1 
ATOM   6180  C C     . LYS H 4 89  ? 159.993 104.877 135.650 1.00 43.25  ? 116  LYS H C     1 
ATOM   6181  O O     . LYS H 4 89  ? 160.521 103.798 135.951 1.00 43.25  ? 116  LYS H O     1 
ATOM   6182  C CB    . LYS H 4 89  ? 160.490 106.098 133.524 1.00 43.25  ? 116  LYS H CB    1 
ATOM   6183  C CG    . LYS H 4 89  ? 161.910 105.617 133.453 1.00 43.25  ? 116  LYS H CG    1 
ATOM   6184  C CD    . LYS H 4 89  ? 162.792 106.690 132.853 1.00 43.25  ? 116  LYS H CD    1 
ATOM   6185  C CE    . LYS H 4 89  ? 162.520 106.844 131.365 1.00 43.25  ? 116  LYS H CE    1 
ATOM   6186  N NZ    . LYS H 4 89  ? 163.444 107.818 130.714 1.00 43.25  ? 116  LYS H NZ    1 
ATOM   6187  N N     . ALA H 4 90  ? 159.735 105.825 136.554 1.00 42.63  ? 117  ALA H N     1 
ATOM   6188  C CA    . ALA H 4 90  ? 160.203 105.683 137.928 1.00 42.63  ? 117  ALA H CA    1 
ATOM   6189  C C     . ALA H 4 90  ? 159.453 104.588 138.670 1.00 42.63  ? 117  ALA H C     1 
ATOM   6190  O O     . ALA H 4 90  ? 160.058 103.833 139.435 1.00 42.63  ? 117  ALA H O     1 
ATOM   6191  C CB    . ALA H 4 90  ? 160.074 107.008 138.665 1.00 42.63  ? 117  ALA H CB    1 
ATOM   6192  N N     . VAL H 4 91  ? 158.147 104.457 138.437 1.00 42.77  ? 118  VAL H N     1 
ATOM   6193  C CA    . VAL H 4 91  ? 157.388 103.458 139.184 1.00 42.77  ? 118  VAL H CA    1 
ATOM   6194  C C     . VAL H 4 91  ? 157.693 102.053 138.675 1.00 42.77  ? 118  VAL H C     1 
ATOM   6195  O O     . VAL H 4 91  ? 157.825 101.113 139.472 1.00 42.77  ? 118  VAL H O     1 
ATOM   6196  C CB    . VAL H 4 91  ? 155.887 103.789 139.148 1.00 42.77  ? 118  VAL H CB    1 
ATOM   6197  C CG1   . VAL H 4 91  ? 155.070 102.705 139.799 1.00 42.77  ? 118  VAL H CG1   1 
ATOM   6198  C CG2   . VAL H 4 91  ? 155.648 105.071 139.889 1.00 42.77  ? 118  VAL H CG2   1 
ATOM   6199  N N     . THR H 4 92  ? 157.875 101.887 137.357 1.00 49.32  ? 119  THR H N     1 
ATOM   6200  C CA    . THR H 4 92  ? 158.245 100.564 136.857 1.00 49.32  ? 119  THR H CA    1 
ATOM   6201  C C     . THR H 4 92  ? 159.659 100.182 137.267 1.00 49.32  ? 119  THR H C     1 
ATOM   6202  O O     . THR H 4 92  ? 159.916 99.011  137.569 1.00 49.32  ? 119  THR H O     1 
ATOM   6203  C CB    . THR H 4 92  ? 158.101 100.492 135.343 1.00 49.32  ? 119  THR H CB    1 
ATOM   6204  O OG1   . THR H 4 92  ? 158.851 101.552 134.739 1.00 49.32  ? 119  THR H OG1   1 
ATOM   6205  C CG2   . THR H 4 92  ? 156.644 100.572 134.940 1.00 49.32  ? 119  THR H CG2   1 
ATOM   6206  N N     . LYS H 4 93  ? 160.584 101.147 137.319 1.00 51.67  ? 120  LYS H N     1 
ATOM   6207  C CA    . LYS H 4 93  ? 161.923 100.807 137.786 1.00 51.67  ? 120  LYS H CA    1 
ATOM   6208  C C     . LYS H 4 93  ? 161.935 100.533 139.285 1.00 51.67  ? 120  LYS H C     1 
ATOM   6209  O O     . LYS H 4 93  ? 162.742 99.731  139.762 1.00 51.67  ? 120  LYS H O     1 
ATOM   6210  C CB    . LYS H 4 93  ? 162.897 101.926 137.430 1.00 51.67  ? 120  LYS H CB    1 
ATOM   6211  C CG    . LYS H 4 93  ? 164.360 101.593 137.663 1.00 51.67  ? 120  LYS H CG    1 
ATOM   6212  C CD    . LYS H 4 93  ? 165.281 102.745 137.269 1.00 51.67  ? 120  LYS H CD    1 
ATOM   6213  C CE    . LYS H 4 93  ? 166.758 102.337 137.316 1.00 51.67  ? 120  LYS H CE    1 
ATOM   6214  N NZ    . LYS H 4 93  ? 167.252 102.016 138.689 1.00 51.67  ? 120  LYS H NZ    1 
ATOM   6215  N N     . TYR H 4 94  ? 161.033 101.167 140.035 1.00 49.79  ? 121  TYR H N     1 
ATOM   6216  C CA    . TYR H 4 94  ? 160.958 100.940 141.473 1.00 49.79  ? 121  TYR H CA    1 
ATOM   6217  C C     . TYR H 4 94  ? 160.384 99.572  141.793 1.00 49.79  ? 121  TYR H C     1 
ATOM   6218  O O     . TYR H 4 94  ? 160.892 98.864  142.668 1.00 49.79  ? 121  TYR H O     1 
ATOM   6219  C CB    . TYR H 4 94  ? 160.120 102.040 142.115 1.00 49.79  ? 121  TYR H CB    1 
ATOM   6220  C CG    . TYR H 4 94  ? 159.731 101.801 143.551 1.00 49.79  ? 121  TYR H CG    1 
ATOM   6221  C CD1   . TYR H 4 94  ? 160.669 101.819 144.563 1.00 49.79  ? 121  TYR H CD1   1 
ATOM   6222  C CD2   . TYR H 4 94  ? 158.406 101.614 143.894 1.00 49.79  ? 121  TYR H CD2   1 
ATOM   6223  C CE1   . TYR H 4 94  ? 160.299 101.620 145.872 1.00 49.79  ? 121  TYR H CE1   1 
ATOM   6224  C CE2   . TYR H 4 94  ? 158.031 101.422 145.194 1.00 49.79  ? 121  TYR H CE2   1 
ATOM   6225  C CZ    . TYR H 4 94  ? 158.979 101.424 146.177 1.00 49.79  ? 121  TYR H CZ    1 
ATOM   6226  O OH    . TYR H 4 94  ? 158.594 101.224 147.475 1.00 49.79  ? 121  TYR H OH    1 
ATOM   6227  N N     . THR H 4 95  ? 159.318 99.185  141.099 1.00 57.92  ? 122  THR H N     1 
ATOM   6228  C CA    . THR H 4 95  ? 158.713 97.887  141.364 1.00 57.92  ? 122  THR H CA    1 
ATOM   6229  C C     . THR H 4 95  ? 159.577 96.759  140.818 1.00 57.92  ? 122  THR H C     1 
ATOM   6230  O O     . THR H 4 95  ? 159.749 95.727  141.478 1.00 57.92  ? 122  THR H O     1 
ATOM   6231  C CB    . THR H 4 95  ? 157.310 97.843  140.765 1.00 57.92  ? 122  THR H CB    1 
ATOM   6232  O OG1   . THR H 4 95  ? 156.532 98.900  141.334 1.00 57.92  ? 122  THR H OG1   1 
ATOM   6233  C CG2   . THR H 4 95  ? 156.630 96.524  141.061 1.00 57.92  ? 122  THR H CG2   1 
ATOM   6234  N N     . SER H 4 96  ? 160.171 96.961  139.640 1.00 66.91  ? 123  SER H N     1 
ATOM   6235  C CA    . SER H 4 96  ? 160.894 95.888  138.968 1.00 66.91  ? 123  SER H CA    1 
ATOM   6236  C C     . SER H 4 96  ? 162.199 95.560  139.681 1.00 66.91  ? 123  SER H C     1 
ATOM   6237  O O     . SER H 4 96  ? 162.387 94.443  140.174 1.00 66.91  ? 123  SER H O     1 
ATOM   6238  C CB    . SER H 4 96  ? 161.154 96.281  137.517 1.00 66.91  ? 123  SER H CB    1 
ATOM   6239  O OG    . SER H 4 96  ? 159.934 96.457  136.823 1.00 66.91  ? 123  SER H OG    1 
ATOM   6240  N N     . ALA H 4 97  ? 163.108 96.525  139.755 1.00 78.79  ? 124  ALA H N     1 
ATOM   6241  C CA    . ALA H 4 97  ? 164.427 96.304  140.345 1.00 78.79  ? 124  ALA H CA    1 
ATOM   6242  C C     . ALA H 4 97  ? 164.291 96.316  141.860 1.00 78.79  ? 124  ALA H C     1 
ATOM   6243  O O     . ALA H 4 97  ? 164.131 97.377  142.466 1.00 78.79  ? 124  ALA H O     1 
ATOM   6244  C CB    . ALA H 4 97  ? 165.412 97.363  139.868 1.00 78.79  ? 124  ALA H CB    1 
ATOM   6245  N N     . LYS H 4 98  ? 164.358 95.123  142.459 1.00 89.46  ? 125  LYS H N     1 
ATOM   6246  C CA    . LYS H 4 98  ? 164.199 94.872  143.899 1.00 89.46  ? 125  LYS H CA    1 
ATOM   6247  C C     . LYS H 4 98  ? 162.863 95.413  144.413 1.00 89.46  ? 125  LYS H C     1 
ATOM   6248  O O     . LYS H 4 98  ? 161.813 95.145  143.829 1.00 89.46  ? 125  LYS H O     1 
ATOM   6249  C CB    . LYS H 4 98  ? 165.371 95.466  144.699 1.00 89.46  ? 125  LYS H CB    1 
ATOM   6250  C CG    . LYS H 4 98  ? 166.726 94.867  144.339 1.00 89.46  ? 125  LYS H CG    1 
ATOM   6251  C CD    . LYS H 4 98  ? 167.886 95.565  145.042 1.00 89.46  ? 125  LYS H CD    1 
ATOM   6252  C CE    . LYS H 4 98  ? 168.038 95.125  146.483 1.00 89.46  ? 125  LYS H CE    1 
ATOM   6253  N NZ    . LYS H 4 98  ? 168.545 93.732  146.560 1.00 89.46  ? 125  LYS H NZ    1 
ATOM   6254  O OXT   . LYS H 4 98  ? 162.799 96.134  145.409 1.00 89.46  ? 125  LYS H OXT   1 
ATOM   6255  O OP3   . DA  I 5 1   ? 108.352 171.597 116.564 1.00 199.94 ? 1    DA  J OP3   1 
ATOM   6256  P P     . DA  I 5 1   ? 107.014 171.659 115.939 1.00 199.94 ? 1    DA  J P     1 
ATOM   6257  O OP1   . DA  I 5 1   ? 106.765 173.076 115.607 1.00 199.94 ? 1    DA  J OP1   1 
ATOM   6258  O OP2   . DA  I 5 1   ? 106.971 170.652 114.858 1.00 199.94 ? 1    DA  J OP2   1 
ATOM   6259  O "O5'" . DA  I 5 1   ? 105.935 171.222 117.032 1.00 199.94 ? 1    DA  J "O5'" 1 
ATOM   6260  C "C5'" . DA  I 5 1   ? 104.698 171.929 117.134 1.00 199.94 ? 1    DA  J "C5'" 1 
ATOM   6261  C "C4'" . DA  I 5 1   ? 103.551 171.096 116.590 1.00 199.94 ? 1    DA  J "C4'" 1 
ATOM   6262  O "O4'" . DA  I 5 1   ? 104.071 170.134 115.632 1.00 199.94 ? 1    DA  J "O4'" 1 
ATOM   6263  C "C3'" . DA  I 5 1   ? 102.804 170.266 117.633 1.00 199.94 ? 1    DA  J "C3'" 1 
ATOM   6264  O "O3'" . DA  I 5 1   ? 101.443 170.087 117.229 1.00 199.94 ? 1    DA  J "O3'" 1 
ATOM   6265  C "C2'" . DA  I 5 1   ? 103.567 168.955 117.583 1.00 199.94 ? 1    DA  J "C2'" 1 
ATOM   6266  C "C1'" . DA  I 5 1   ? 103.791 168.827 116.088 1.00 199.94 ? 1    DA  J "C1'" 1 
ATOM   6267  N N9    . DA  I 5 1   ? 104.906 167.958 115.743 1.00 199.94 ? 1    DA  J N9    1 
ATOM   6268  C C8    . DA  I 5 1   ? 106.168 167.986 116.264 1.00 199.94 ? 1    DA  J C8    1 
ATOM   6269  N N7    . DA  I 5 1   ? 106.965 167.071 115.766 1.00 199.94 ? 1    DA  J N7    1 
ATOM   6270  C C5    . DA  I 5 1   ? 106.166 166.396 114.860 1.00 199.94 ? 1    DA  J C5    1 
ATOM   6271  C C6    . DA  I 5 1   ? 106.412 165.314 114.000 1.00 199.94 ? 1    DA  J C6    1 
ATOM   6272  N N6    . DA  I 5 1   ? 107.593 164.696 113.914 1.00 199.94 ? 1    DA  J N6    1 
ATOM   6273  N N1    . DA  I 5 1   ? 105.394 164.884 113.229 1.00 199.94 ? 1    DA  J N1    1 
ATOM   6274  C C2    . DA  I 5 1   ? 104.212 165.498 113.312 1.00 199.94 ? 1    DA  J C2    1 
ATOM   6275  N N3    . DA  I 5 1   ? 103.862 166.524 114.078 1.00 199.94 ? 1    DA  J N3    1 
ATOM   6276  C C4    . DA  I 5 1   ? 104.894 166.927 114.837 1.00 199.94 ? 1    DA  J C4    1 
ATOM   6277  P P     . DT  I 5 2   ? 100.304 169.726 118.307 1.00 198.16 ? 2    DT  J P     1 
ATOM   6278  O OP1   . DT  I 5 2   ? 100.044 170.944 119.106 1.00 198.16 ? 2    DT  J OP1   1 
ATOM   6279  O OP2   . DT  I 5 2   ? 100.670 168.470 118.997 1.00 198.16 ? 2    DT  J OP2   1 
ATOM   6280  O "O5'" . DT  I 5 2   ? 99.025  169.391 117.409 1.00 198.16 ? 2    DT  J "O5'" 1 
ATOM   6281  C "C5'" . DT  I 5 2   ? 98.028  168.498 117.896 1.00 198.16 ? 2    DT  J "C5'" 1 
ATOM   6282  C "C4'" . DT  I 5 2   ? 97.289  167.842 116.746 1.00 198.16 ? 2    DT  J "C4'" 1 
ATOM   6283  O "O4'" . DT  I 5 2   ? 98.253  167.319 115.801 1.00 198.16 ? 2    DT  J "O4'" 1 
ATOM   6284  C "C3'" . DT  I 5 2   ? 96.440  166.641 117.128 1.00 198.16 ? 2    DT  J "C3'" 1 
ATOM   6285  O "O3'" . DT  I 5 2   ? 95.452  166.411 116.121 1.00 198.16 ? 2    DT  J "O3'" 1 
ATOM   6286  C "C2'" . DT  I 5 2   ? 97.486  165.543 117.142 1.00 198.16 ? 2    DT  J "C2'" 1 
ATOM   6287  C "C1'" . DT  I 5 2   ? 98.310  165.909 115.916 1.00 198.16 ? 2    DT  J "C1'" 1 
ATOM   6288  N N1    . DT  I 5 2   ? 99.729  165.506 116.025 1.00 198.16 ? 2    DT  J N1    1 
ATOM   6289  C C2    . DT  I 5 2   ? 100.340 164.921 114.947 1.00 198.16 ? 2    DT  J C2    1 
ATOM   6290  O O2    . DT  I 5 2   ? 99.772  164.716 113.890 1.00 198.16 ? 2    DT  J O2    1 
ATOM   6291  N N3    . DT  I 5 2   ? 101.650 164.581 115.149 1.00 198.16 ? 2    DT  J N3    1 
ATOM   6292  C C4    . DT  I 5 2   ? 102.394 164.765 116.298 1.00 198.16 ? 2    DT  J C4    1 
ATOM   6293  O O4    . DT  I 5 2   ? 103.569 164.425 116.377 1.00 198.16 ? 2    DT  J O4    1 
ATOM   6294  C C5    . DT  I 5 2   ? 101.692 165.384 117.396 1.00 198.16 ? 2    DT  J C5    1 
ATOM   6295  C C7    . DT  I 5 2   ? 102.394 165.632 118.698 1.00 198.16 ? 2    DT  J C7    1 
ATOM   6296  C C6    . DT  I 5 2   ? 100.408 165.722 117.209 1.00 198.16 ? 2    DT  J C6    1 
ATOM   6297  P P     . DC  I 5 3   ? 94.463  165.143 116.200 1.00 191.40 ? 3    DC  J P     1 
ATOM   6298  O OP1   . DC  I 5 3   ? 93.213  165.513 115.504 1.00 191.40 ? 3    DC  J OP1   1 
ATOM   6299  O OP2   . DC  I 5 3   ? 94.382  164.676 117.602 1.00 191.40 ? 3    DC  J OP2   1 
ATOM   6300  O "O5'" . DC  I 5 3   ? 95.193  164.037 115.306 1.00 191.40 ? 3    DC  J "O5'" 1 
ATOM   6301  C "C5'" . DC  I 5 3   ? 95.424  164.290 113.923 1.00 191.40 ? 3    DC  J "C5'" 1 
ATOM   6302  C "C4'" . DC  I 5 3   ? 96.005  163.070 113.228 1.00 191.40 ? 3    DC  J "C4'" 1 
ATOM   6303  O "O4'" . DC  I 5 3   ? 97.416  162.952 113.543 1.00 191.40 ? 3    DC  J "O4'" 1 
ATOM   6304  C "C3'" . DC  I 5 3   ? 95.363  161.739 113.608 1.00 191.40 ? 3    DC  J "C3'" 1 
ATOM   6305  O "O3'" . DC  I 5 3   ? 95.130  160.966 112.448 1.00 191.40 ? 3    DC  J "O3'" 1 
ATOM   6306  C "C2'" . DC  I 5 3   ? 96.402  161.087 114.514 1.00 191.40 ? 3    DC  J "C2'" 1 
ATOM   6307  C "C1'" . DC  I 5 3   ? 97.705  161.642 113.969 1.00 191.40 ? 3    DC  J "C1'" 1 
ATOM   6308  N N1    . DC  I 5 3   ? 98.786  161.724 114.991 1.00 191.40 ? 3    DC  J N1    1 
ATOM   6309  C C2    . DC  I 5 3   ? 100.068 161.256 114.686 1.00 191.40 ? 3    DC  J C2    1 
ATOM   6310  O O2    . DC  I 5 3   ? 100.284 160.774 113.570 1.00 191.40 ? 3    DC  J O2    1 
ATOM   6311  N N3    . DC  I 5 3   ? 101.041 161.347 115.629 1.00 191.40 ? 3    DC  J N3    1 
ATOM   6312  C C4    . DC  I 5 3   ? 100.766 161.875 116.823 1.00 191.40 ? 3    DC  J C4    1 
ATOM   6313  N N4    . DC  I 5 3   ? 101.754 161.943 117.718 1.00 191.40 ? 3    DC  J N4    1 
ATOM   6314  C C5    . DC  I 5 3   ? 99.466  162.355 117.150 1.00 191.40 ? 3    DC  J C5    1 
ATOM   6315  C C6    . DC  I 5 3   ? 98.517  162.262 116.212 1.00 191.40 ? 3    DC  J C6    1 
ATOM   6316  P P     . DT  I 5 4   ? 94.070  159.761 112.482 1.00 176.70 ? 4    DT  J P     1 
ATOM   6317  O OP1   . DT  I 5 4   ? 93.181  159.941 111.316 1.00 176.70 ? 4    DT  J OP1   1 
ATOM   6318  O OP2   . DT  I 5 4   ? 93.492  159.670 113.840 1.00 176.70 ? 4    DT  J OP2   1 
ATOM   6319  O "O5'" . DT  I 5 4   ? 94.968  158.468 112.234 1.00 176.70 ? 4    DT  J "O5'" 1 
ATOM   6320  C "C5'" . DT  I 5 4   ? 95.639  158.329 111.005 1.00 176.70 ? 4    DT  J "C5'" 1 
ATOM   6321  C "C4'" . DT  I 5 4   ? 96.900  157.505 111.157 1.00 176.70 ? 4    DT  J "C4'" 1 
ATOM   6322  O "O4'" . DT  I 5 4   ? 97.711  158.019 112.244 1.00 176.70 ? 4    DT  J "O4'" 1 
ATOM   6323  C "C3'" . DT  I 5 4   ? 96.679  156.021 111.463 1.00 176.70 ? 4    DT  J "C3'" 1 
ATOM   6324  O "O3'" . DT  I 5 4   ? 97.403  155.249 110.532 1.00 176.70 ? 4    DT  J "O3'" 1 
ATOM   6325  C "C2'" . DT  I 5 4   ? 97.242  155.866 112.879 1.00 176.70 ? 4    DT  J "C2'" 1 
ATOM   6326  C "C1'" . DT  I 5 4   ? 98.323  156.923 112.862 1.00 176.70 ? 4    DT  J "C1'" 1 
ATOM   6327  N N1    . DT  I 5 4   ? 98.842  157.333 114.206 1.00 176.70 ? 4    DT  J N1    1 
ATOM   6328  C C2    . DT  I 5 4   ? 100.167 157.121 114.495 1.00 176.70 ? 4    DT  J C2    1 
ATOM   6329  O O2    . DT  I 5 4   ? 100.942 156.600 113.718 1.00 176.70 ? 4    DT  J O2    1 
ATOM   6330  N N3    . DT  I 5 4   ? 100.558 157.538 115.733 1.00 176.70 ? 4    DT  J N3    1 
ATOM   6331  C C4    . DT  I 5 4   ? 99.780  158.144 116.692 1.00 176.70 ? 4    DT  J C4    1 
ATOM   6332  O O4    . DT  I 5 4   ? 100.227 158.476 117.782 1.00 176.70 ? 4    DT  J O4    1 
ATOM   6333  C C5    . DT  I 5 4   ? 98.402  158.339 116.334 1.00 176.70 ? 4    DT  J C5    1 
ATOM   6334  C C7    . DT  I 5 4   ? 97.460  158.980 117.310 1.00 176.70 ? 4    DT  J C7    1 
ATOM   6335  C C6    . DT  I 5 4   ? 98.001  157.933 115.117 1.00 176.70 ? 4    DT  J C6    1 
ATOM   6336  P P     . DG  I 5 5   ? 97.206  153.659 110.469 1.00 168.74 ? 5    DG  J P     1 
ATOM   6337  O OP1   . DG  I 5 5   ? 97.407  153.231 109.068 1.00 168.74 ? 5    DG  J OP1   1 
ATOM   6338  O OP2   . DG  I 5 5   ? 95.947  153.327 111.172 1.00 168.74 ? 5    DG  J OP2   1 
ATOM   6339  O "O5'" . DG  I 5 5   ? 98.426  153.103 111.331 1.00 168.74 ? 5    DG  J "O5'" 1 
ATOM   6340  C "C5'" . DG  I 5 5   ? 99.731  153.636 111.128 1.00 168.74 ? 5    DG  J "C5'" 1 
ATOM   6341  C "C4'" . DG  I 5 5   ? 100.764 152.930 111.993 1.00 168.74 ? 5    DG  J "C4'" 1 
ATOM   6342  O "O4'" . DG  I 5 5   ? 100.952 153.651 113.239 1.00 168.74 ? 5    DG  J "O4'" 1 
ATOM   6343  C "C3'" . DG  I 5 5   ? 100.434 151.496 112.378 1.00 168.74 ? 5    DG  J "C3'" 1 
ATOM   6344  O "O3'" . DG  I 5 5   ? 101.623 150.741 112.364 1.00 168.74 ? 5    DG  J "O3'" 1 
ATOM   6345  C "C2'" . DG  I 5 5   ? 99.885  151.644 113.798 1.00 168.74 ? 5    DG  J "C2'" 1 
ATOM   6346  C "C1'" . DG  I 5 5   ? 100.726 152.793 114.336 1.00 168.74 ? 5    DG  J "C1'" 1 
ATOM   6347  N N9    . DG  I 5 5   ? 100.068 153.578 115.376 1.00 168.74 ? 5    DG  J N9    1 
ATOM   6348  C C8    . DG  I 5 5   ? 98.781  154.037 115.364 1.00 168.74 ? 5    DG  J C8    1 
ATOM   6349  N N7    . DG  I 5 5   ? 98.467  154.742 116.410 1.00 168.74 ? 5    DG  J N7    1 
ATOM   6350  C C5    . DG  I 5 5   ? 99.623  154.754 117.171 1.00 168.74 ? 5    DG  J C5    1 
ATOM   6351  C C6    . DG  I 5 5   ? 99.883  155.358 118.421 1.00 168.74 ? 5    DG  J C6    1 
ATOM   6352  O O6    . DG  I 5 5   ? 99.115  156.034 119.118 1.00 168.74 ? 5    DG  J O6    1 
ATOM   6353  N N1    . DG  I 5 5   ? 101.189 155.134 118.842 1.00 168.74 ? 5    DG  J N1    1 
ATOM   6354  C C2    . DG  I 5 5   ? 102.122 154.409 118.145 1.00 168.74 ? 5    DG  J C2    1 
ATOM   6355  N N2    . DG  I 5 5   ? 103.327 154.295 118.714 1.00 168.74 ? 5    DG  J N2    1 
ATOM   6356  N N3    . DG  I 5 5   ? 101.891 153.834 116.972 1.00 168.74 ? 5    DG  J N3    1 
ATOM   6357  C C4    . DG  I 5 5   ? 100.624 154.047 116.547 1.00 168.74 ? 5    DG  J C4    1 
ATOM   6358  P P     . DC  I 5 6   ? 101.600 149.181 112.001 1.00 159.14 ? 6    DC  J P     1 
ATOM   6359  O OP1   . DC  I 5 6   ? 102.056 149.050 110.604 1.00 159.14 ? 6    DC  J OP1   1 
ATOM   6360  O OP2   . DC  I 5 6   ? 100.274 148.648 112.379 1.00 159.14 ? 6    DC  J OP2   1 
ATOM   6361  O "O5'" . DC  I 5 6   ? 102.707 148.557 112.975 1.00 159.14 ? 6    DC  J "O5'" 1 
ATOM   6362  C "C5'" . DC  I 5 6   ? 103.452 149.413 113.841 1.00 159.14 ? 6    DC  J "C5'" 1 
ATOM   6363  C "C4'" . DC  I 5 6   ? 103.549 148.831 115.240 1.00 159.14 ? 6    DC  J "C4'" 1 
ATOM   6364  O "O4'" . DC  I 5 6   ? 102.934 149.740 116.200 1.00 159.14 ? 6    DC  J "O4'" 1 
ATOM   6365  C "C3'" . DC  I 5 6   ? 102.833 147.493 115.436 1.00 159.14 ? 6    DC  J "C3'" 1 
ATOM   6366  O "O3'" . DC  I 5 6   ? 103.539 146.720 116.385 1.00 159.14 ? 6    DC  J "O3'" 1 
ATOM   6367  C "C2'" . DC  I 5 6   ? 101.504 147.944 116.019 1.00 159.14 ? 6    DC  J "C2'" 1 
ATOM   6368  C "C1'" . DC  I 5 6   ? 102.018 149.001 116.971 1.00 159.14 ? 6    DC  J "C1'" 1 
ATOM   6369  N N1    . DC  I 5 6   ? 100.974 149.905 117.522 1.00 159.14 ? 6    DC  J N1    1 
ATOM   6370  C C2    . DC  I 5 6   ? 101.245 150.634 118.678 1.00 159.14 ? 6    DC  J C2    1 
ATOM   6371  O O2    . DC  I 5 6   ? 102.352 150.527 119.206 1.00 159.14 ? 6    DC  J O2    1 
ATOM   6372  N N3    . DC  I 5 6   ? 100.292 151.448 119.181 1.00 159.14 ? 6    DC  J N3    1 
ATOM   6373  C C4    . DC  I 5 6   ? 99.110  151.535 118.578 1.00 159.14 ? 6    DC  J C4    1 
ATOM   6374  N N4    . DC  I 5 6   ? 98.198  152.351 119.110 1.00 159.14 ? 6    DC  J N4    1 
ATOM   6375  C C5    . DC  I 5 6   ? 98.809  150.791 117.404 1.00 159.14 ? 6    DC  J C5    1 
ATOM   6376  C C6    . DC  I 5 6   ? 99.758  149.988 116.922 1.00 159.14 ? 6    DC  J C6    1 
ATOM   6377  P P     . DA  I 5 7   ? 104.496 145.513 115.936 1.00 159.13 ? 7    DA  J P     1 
ATOM   6378  O OP1   . DA  I 5 7   ? 105.249 145.951 114.745 1.00 159.13 ? 7    DA  J OP1   1 
ATOM   6379  O OP2   . DA  I 5 7   ? 103.699 144.269 115.902 1.00 159.13 ? 7    DA  J OP2   1 
ATOM   6380  O "O5'" . DA  I 5 7   ? 105.511 145.413 117.154 1.00 159.13 ? 7    DA  J "O5'" 1 
ATOM   6381  C "C5'" . DA  I 5 7   ? 105.892 146.605 117.801 1.00 159.13 ? 7    DA  J "C5'" 1 
ATOM   6382  C "C4'" . DA  I 5 7   ? 105.847 146.491 119.319 1.00 159.13 ? 7    DA  J "C4'" 1 
ATOM   6383  O "O4'" . DA  I 5 7   ? 104.691 147.199 119.829 1.00 159.13 ? 7    DA  J "O4'" 1 
ATOM   6384  C "C3'" . DA  I 5 7   ? 105.761 145.087 119.900 1.00 159.13 ? 7    DA  J "C3'" 1 
ATOM   6385  O "O3'" . DA  I 5 7   ? 106.420 145.073 121.153 1.00 159.13 ? 7    DA  J "O3'" 1 
ATOM   6386  C "C2'" . DA  I 5 7   ? 104.259 144.902 120.075 1.00 159.13 ? 7    DA  J "C2'" 1 
ATOM   6387  C "C1'" . DA  I 5 7   ? 103.833 146.299 120.493 1.00 159.13 ? 7    DA  J "C1'" 1 
ATOM   6388  N N9    . DA  I 5 7   ? 102.473 146.616 120.119 1.00 159.13 ? 7    DA  J N9    1 
ATOM   6389  C C8    . DA  I 5 7   ? 101.783 146.132 119.051 1.00 159.13 ? 7    DA  J C8    1 
ATOM   6390  N N7    . DA  I 5 7   ? 100.566 146.599 118.956 1.00 159.13 ? 7    DA  J N7    1 
ATOM   6391  C C5    . DA  I 5 7   ? 100.458 147.448 120.037 1.00 159.13 ? 7    DA  J C5    1 
ATOM   6392  C C6    . DA  I 5 7   ? 99.410  148.256 120.504 1.00 159.13 ? 7    DA  J C6    1 
ATOM   6393  N N6    . DA  I 5 7   ? 98.217  148.339 119.904 1.00 159.13 ? 7    DA  J N6    1 
ATOM   6394  N N1    . DA  I 5 7   ? 99.633  148.980 121.617 1.00 159.13 ? 7    DA  J N1    1 
ATOM   6395  C C2    . DA  I 5 7   ? 100.824 148.900 122.216 1.00 159.13 ? 7    DA  J C2    1 
ATOM   6396  N N3    . DA  I 5 7   ? 101.880 148.175 121.871 1.00 159.13 ? 7    DA  J N3    1 
ATOM   6397  C C4    . DA  I 5 7   ? 101.627 147.468 120.763 1.00 159.13 ? 7    DA  J C4    1 
ATOM   6398  P P     . DA  I 5 8   ? 107.007 143.712 121.771 1.00 165.41 ? 8    DA  J P     1 
ATOM   6399  O OP1   . DA  I 5 8   ? 108.366 143.529 121.219 1.00 165.41 ? 8    DA  J OP1   1 
ATOM   6400  O OP2   . DA  I 5 8   ? 106.016 142.629 121.600 1.00 165.41 ? 8    DA  J OP2   1 
ATOM   6401  O "O5'" . DA  I 5 8   ? 107.101 144.037 123.336 1.00 165.41 ? 8    DA  J "O5'" 1 
ATOM   6402  C "C5'" . DA  I 5 8   ? 107.668 145.265 123.771 1.00 165.41 ? 8    DA  J "C5'" 1 
ATOM   6403  C "C4'" . DA  I 5 8   ? 106.862 145.869 124.908 1.00 165.41 ? 8    DA  J "C4'" 1 
ATOM   6404  O "O4'" . DA  I 5 8   ? 105.564 146.293 124.420 1.00 165.41 ? 8    DA  J "O4'" 1 
ATOM   6405  C "C3'" . DA  I 5 8   ? 106.593 144.936 126.089 1.00 165.41 ? 8    DA  J "C3'" 1 
ATOM   6406  O "O3'" . DA  I 5 8   ? 106.879 145.607 127.307 1.00 165.41 ? 8    DA  J "O3'" 1 
ATOM   6407  C "C2'" . DA  I 5 8   ? 105.107 144.614 125.960 1.00 165.41 ? 8    DA  J "C2'" 1 
ATOM   6408  C "C1'" . DA  I 5 8   ? 104.568 145.878 125.322 1.00 165.41 ? 8    DA  J "C1'" 1 
ATOM   6409  N N9    . DA  I 5 8   ? 103.337 145.654 124.574 1.00 165.41 ? 8    DA  J N9    1 
ATOM   6410  C C8    . DA  I 5 8   ? 103.163 144.792 123.536 1.00 165.41 ? 8    DA  J C8    1 
ATOM   6411  N N7    . DA  I 5 8   ? 101.952 144.792 123.041 1.00 165.41 ? 8    DA  J N7    1 
ATOM   6412  C C5    . DA  I 5 8   ? 101.280 145.712 123.818 1.00 165.41 ? 8    DA  J C5    1 
ATOM   6413  C C6    . DA  I 5 8   ? 99.943  146.153 123.820 1.00 165.41 ? 8    DA  J C6    1 
ATOM   6414  N N6    . DA  I 5 8   ? 99.029  145.723 122.946 1.00 165.41 ? 8    DA  J N6    1 
ATOM   6415  N N1    . DA  I 5 8   ? 99.593  147.087 124.731 1.00 165.41 ? 8    DA  J N1    1 
ATOM   6416  C C2    . DA  I 5 8   ? 100.520 147.525 125.595 1.00 165.41 ? 8    DA  J C2    1 
ATOM   6417  N N3    . DA  I 5 8   ? 101.801 147.172 125.696 1.00 165.41 ? 8    DA  J N3    1 
ATOM   6418  C C4    . DA  I 5 8   ? 102.120 146.260 124.767 1.00 165.41 ? 8    DA  J C4    1 
ATOM   6419  P P     . DC  I 5 9   ? 106.771 144.839 128.714 1.00 163.28 ? 9    DC  J P     1 
ATOM   6420  O OP1   . DC  I 5 9   ? 107.736 145.470 129.639 1.00 163.28 ? 9    DC  J OP1   1 
ATOM   6421  O OP2   . DC  I 5 9   ? 106.841 143.384 128.467 1.00 163.28 ? 9    DC  J OP2   1 
ATOM   6422  O "O5'" . DC  I 5 9   ? 105.293 145.171 129.217 1.00 163.28 ? 9    DC  J "O5'" 1 
ATOM   6423  C "C5'" . DC  I 5 9   ? 104.902 146.520 129.432 1.00 163.28 ? 9    DC  J "C5'" 1 
ATOM   6424  C "C4'" . DC  I 5 9   ? 103.492 146.575 129.976 1.00 163.28 ? 9    DC  J "C4'" 1 
ATOM   6425  O "O4'" . DC  I 5 9   ? 102.553 146.402 128.889 1.00 163.28 ? 9    DC  J "O4'" 1 
ATOM   6426  C "C3'" . DC  I 5 9   ? 103.168 145.487 131.000 1.00 163.28 ? 9    DC  J "C3'" 1 
ATOM   6427  O "O3'" . DC  I 5 9   ? 102.588 146.061 132.145 1.00 163.28 ? 9    DC  J "O3'" 1 
ATOM   6428  C "C2'" . DC  I 5 9   ? 102.185 144.577 130.272 1.00 163.28 ? 9    DC  J "C2'" 1 
ATOM   6429  C "C1'" . DC  I 5 9   ? 101.532 145.535 129.299 1.00 163.28 ? 9    DC  J "C1'" 1 
ATOM   6430  N N1    . DC  I 5 9   ? 100.988 144.850 128.116 1.00 163.28 ? 9    DC  J N1    1 
ATOM   6431  C C2    . DC  I 5 9   ? 99.644  145.000 127.793 1.00 163.28 ? 9    DC  J C2    1 
ATOM   6432  O O2    . DC  I 5 9   ? 98.929  145.705 128.509 1.00 163.28 ? 9    DC  J O2    1 
ATOM   6433  N N3    . DC  I 5 9   ? 99.148  144.340 126.722 1.00 163.28 ? 9    DC  J N3    1 
ATOM   6434  C C4    . DC  I 5 9   ? 99.950  143.572 125.985 1.00 163.28 ? 9    DC  J C4    1 
ATOM   6435  N N4    . DC  I 5 9   ? 99.423  142.953 124.924 1.00 163.28 ? 9    DC  J N4    1 
ATOM   6436  C C5    . DC  I 5 9   ? 101.328 143.405 126.301 1.00 163.28 ? 9    DC  J C5    1 
ATOM   6437  C C6    . DC  I 5 9   ? 101.799 144.059 127.365 1.00 163.28 ? 9    DC  J C6    1 
ATOM   6438  P P     . DA  I 5 10  ? 102.745 145.344 133.572 1.00 164.81 ? 10   DA  J P     1 
ATOM   6439  O OP1   . DA  I 5 10  ? 103.561 146.221 134.440 1.00 164.81 ? 10   DA  J OP1   1 
ATOM   6440  O OP2   . DA  I 5 10  ? 103.169 143.949 133.333 1.00 164.81 ? 10   DA  J OP2   1 
ATOM   6441  O "O5'" . DA  I 5 10  ? 101.250 145.291 134.126 1.00 164.81 ? 10   DA  J "O5'" 1 
ATOM   6442  C "C5'" . DA  I 5 10  ? 100.314 144.434 133.510 1.00 164.81 ? 10   DA  J "C5'" 1 
ATOM   6443  C "C4'" . DA  I 5 10  ? 98.956  145.089 133.414 1.00 164.81 ? 10   DA  J "C4'" 1 
ATOM   6444  O "O4'" . DA  I 5 10  ? 98.527  145.074 132.027 1.00 164.81 ? 10   DA  J "O4'" 1 
ATOM   6445  C "C3'" . DA  I 5 10  ? 97.858  144.352 134.160 1.00 164.81 ? 10   DA  J "C3'" 1 
ATOM   6446  O "O3'" . DA  I 5 10  ? 96.760  145.227 134.404 1.00 164.81 ? 10   DA  J "O3'" 1 
ATOM   6447  C "C2'" . DA  I 5 10  ? 97.496  143.294 133.143 1.00 164.81 ? 10   DA  J "C2'" 1 
ATOM   6448  C "C1'" . DA  I 5 10  ? 97.483  144.130 131.875 1.00 164.81 ? 10   DA  J "C1'" 1 
ATOM   6449  N N9    . DA  I 5 10  ? 97.717  143.357 130.665 1.00 164.81 ? 10   DA  J N9    1 
ATOM   6450  C C8    . DA  I 5 10  ? 98.918  142.920 130.189 1.00 164.81 ? 10   DA  J C8    1 
ATOM   6451  N N7    . DA  I 5 10  ? 98.828  142.241 129.072 1.00 164.81 ? 10   DA  J N7    1 
ATOM   6452  C C5    . DA  I 5 10  ? 97.473  142.228 128.801 1.00 164.81 ? 10   DA  J C5    1 
ATOM   6453  C C6    . DA  I 5 10  ? 96.719  141.669 127.752 1.00 164.81 ? 10   DA  J C6    1 
ATOM   6454  N N6    . DA  I 5 10  ? 97.262  140.980 126.746 1.00 164.81 ? 10   DA  J N6    1 
ATOM   6455  N N1    . DA  I 5 10  ? 95.377  141.829 127.786 1.00 164.81 ? 10   DA  J N1    1 
ATOM   6456  C C2    . DA  I 5 10  ? 94.835  142.523 128.793 1.00 164.81 ? 10   DA  J C2    1 
ATOM   6457  N N3    . DA  I 5 10  ? 95.442  143.089 129.836 1.00 164.81 ? 10   DA  J N3    1 
ATOM   6458  C C4    . DA  I 5 10  ? 96.773  142.908 129.776 1.00 164.81 ? 10   DA  J C4    1 
ATOM   6459  P P     . DG  I 5 11  ? 95.637  144.841 135.488 1.00 160.70 ? 11   DG  J P     1 
ATOM   6460  O OP1   . DG  I 5 11  ? 94.871  146.064 135.801 1.00 160.70 ? 11   DG  J OP1   1 
ATOM   6461  O OP2   . DG  I 5 11  ? 96.295  144.085 136.572 1.00 160.70 ? 11   DG  J OP2   1 
ATOM   6462  O "O5'" . DG  I 5 11  ? 94.675  143.827 134.718 1.00 160.70 ? 11   DG  J "O5'" 1 
ATOM   6463  C "C5'" . DG  I 5 11  ? 93.903  142.891 135.459 1.00 160.70 ? 11   DG  J "C5'" 1 
ATOM   6464  C "C4'" . DG  I 5 11  ? 92.513  142.750 134.872 1.00 160.70 ? 11   DG  J "C4'" 1 
ATOM   6465  O "O4'" . DG  I 5 11  ? 92.620  142.560 133.447 1.00 160.70 ? 11   DG  J "O4'" 1 
ATOM   6466  C "C3'" . DG  I 5 11  ? 91.745  141.536 135.350 1.00 160.70 ? 11   DG  J "C3'" 1 
ATOM   6467  O "O3'" . DG  I 5 11  ? 90.368  141.697 135.055 1.00 160.70 ? 11   DG  J "O3'" 1 
ATOM   6468  C "C2'" . DG  I 5 11  ? 92.358  140.458 134.485 1.00 160.70 ? 11   DG  J "C2'" 1 
ATOM   6469  C "C1'" . DG  I 5 11  ? 92.473  141.186 133.149 1.00 160.70 ? 11   DG  J "C1'" 1 
ATOM   6470  N N9    . DG  I 5 11  ? 93.617  140.772 132.354 1.00 160.70 ? 11   DG  J N9    1 
ATOM   6471  C C8    . DG  I 5 11  ? 94.934  141.056 132.591 1.00 160.70 ? 11   DG  J C8    1 
ATOM   6472  N N7    . DG  I 5 11  ? 95.742  140.554 131.703 1.00 160.70 ? 11   DG  J N7    1 
ATOM   6473  C C5    . DG  I 5 11  ? 94.902  139.901 130.817 1.00 160.70 ? 11   DG  J C5    1 
ATOM   6474  C C6    . DG  I 5 11  ? 95.200  139.191 129.634 1.00 160.70 ? 11   DG  J C6    1 
ATOM   6475  O O6    . DG  I 5 11  ? 96.309  138.963 129.135 1.00 160.70 ? 11   DG  J O6    1 
ATOM   6476  N N1    . DG  I 5 11  ? 94.047  138.695 129.030 1.00 160.70 ? 11   DG  J N1    1 
ATOM   6477  C C2    . DG  I 5 11  ? 92.771  138.882 129.504 1.00 160.70 ? 11   DG  J C2    1 
ATOM   6478  N N2    . DG  I 5 11  ? 91.782  138.332 128.791 1.00 160.70 ? 11   DG  J N2    1 
ATOM   6479  N N3    . DG  I 5 11  ? 92.483  139.553 130.603 1.00 160.70 ? 11   DG  J N3    1 
ATOM   6480  C C4    . DG  I 5 11  ? 93.591  140.038 131.200 1.00 160.70 ? 11   DG  J C4    1 
ATOM   6481  P P     . DT  I 5 12  ? 89.264  140.831 135.836 1.00 152.87 ? 12   DT  J P     1 
ATOM   6482  O OP1   . DT  I 5 12  ? 87.960  141.497 135.638 1.00 152.87 ? 12   DT  J OP1   1 
ATOM   6483  O OP2   . DT  I 5 12  ? 89.763  140.591 137.208 1.00 152.87 ? 12   DT  J OP2   1 
ATOM   6484  O "O5'" . DT  I 5 12  ? 89.241  139.435 135.055 1.00 152.87 ? 12   DT  J "O5'" 1 
ATOM   6485  C "C5'" . DT  I 5 12  ? 88.851  139.394 133.689 1.00 152.87 ? 12   DT  J "C5'" 1 
ATOM   6486  C "C4'" . DT  I 5 12  ? 88.722  137.961 133.199 1.00 152.87 ? 12   DT  J "C4'" 1 
ATOM   6487  O "O4'" . DT  I 5 12  ? 89.822  137.646 132.303 1.00 152.87 ? 12   DT  J "O4'" 1 
ATOM   6488  C "C3'" . DT  I 5 12  ? 88.753  136.886 134.287 1.00 152.87 ? 12   DT  J "C3'" 1 
ATOM   6489  O "O3'" . DT  I 5 12  ? 87.868  135.841 133.938 1.00 152.87 ? 12   DT  J "O3'" 1 
ATOM   6490  C "C2'" . DT  I 5 12  ? 90.197  136.411 134.232 1.00 152.87 ? 12   DT  J "C2'" 1 
ATOM   6491  C "C1'" . DT  I 5 12  ? 90.446  136.462 132.738 1.00 152.87 ? 12   DT  J "C1'" 1 
ATOM   6492  N N1    . DT  I 5 12  ? 91.874  136.530 132.381 1.00 152.87 ? 12   DT  J N1    1 
ATOM   6493  C C2    . DT  I 5 12  ? 92.291  136.005 131.187 1.00 152.87 ? 12   DT  J C2    1 
ATOM   6494  O O2    . DT  I 5 12  ? 91.542  135.462 130.399 1.00 152.87 ? 12   DT  J O2    1 
ATOM   6495  N N3    . DT  I 5 12  ? 93.630  136.123 130.950 1.00 152.87 ? 12   DT  J N3    1 
ATOM   6496  C C4    . DT  I 5 12  ? 94.569  136.707 131.775 1.00 152.87 ? 12   DT  J C4    1 
ATOM   6497  O O4    . DT  I 5 12  ? 95.751  136.771 131.478 1.00 152.87 ? 12   DT  J O4    1 
ATOM   6498  C C5    . DT  I 5 12  ? 94.063  137.242 133.006 1.00 152.87 ? 12   DT  J C5    1 
ATOM   6499  C C7    . DT  I 5 12  ? 94.995  137.895 133.977 1.00 152.87 ? 12   DT  J C7    1 
ATOM   6500  C C6    . DT  I 5 12  ? 92.755  137.129 133.248 1.00 152.87 ? 12   DT  J C6    1 
ATOM   6501  P P     . DC  I 5 13  ? 87.244  134.889 135.068 1.00 150.06 ? 13   DC  J P     1 
ATOM   6502  O OP1   . DC  I 5 13  ? 86.273  135.700 135.832 1.00 150.06 ? 13   DC  J OP1   1 
ATOM   6503  O OP2   . DC  I 5 13  ? 88.344  134.210 135.784 1.00 150.06 ? 13   DC  J OP2   1 
ATOM   6504  O "O5'" . DC  I 5 13  ? 86.475  133.768 134.230 1.00 150.06 ? 13   DC  J "O5'" 1 
ATOM   6505  C "C5'" . DC  I 5 13  ? 86.832  132.403 134.384 1.00 150.06 ? 13   DC  J "C5'" 1 
ATOM   6506  C "C4'" . DC  I 5 13  ? 87.016  131.735 133.035 1.00 150.06 ? 13   DC  J "C4'" 1 
ATOM   6507  O "O4'" . DC  I 5 13  ? 88.162  132.323 132.355 1.00 150.06 ? 13   DC  J "O4'" 1 
ATOM   6508  C "C3'" . DC  I 5 13  ? 87.334  130.247 133.102 1.00 150.06 ? 13   DC  J "C3'" 1 
ATOM   6509  O "O3'" . DC  I 5 13  ? 86.964  129.631 131.872 1.00 150.06 ? 13   DC  J "O3'" 1 
ATOM   6510  C "C2'" . DC  I 5 13  ? 88.842  130.289 133.250 1.00 150.06 ? 13   DC  J "C2'" 1 
ATOM   6511  C "C1'" . DC  I 5 13  ? 89.156  131.326 132.194 1.00 150.06 ? 13   DC  J "C1'" 1 
ATOM   6512  N N1    . DC  I 5 13  ? 90.499  131.947 132.315 1.00 150.06 ? 13   DC  J N1    1 
ATOM   6513  C C2    . DC  I 5 13  ? 91.458  131.694 131.336 1.00 150.06 ? 13   DC  J C2    1 
ATOM   6514  O O2    . DC  I 5 13  ? 91.171  130.948 130.392 1.00 150.06 ? 13   DC  J O2    1 
ATOM   6515  N N3    . DC  I 5 13  ? 92.676  132.274 131.446 1.00 150.06 ? 13   DC  J N3    1 
ATOM   6516  C C4    . DC  I 5 13  ? 92.936  133.076 132.472 1.00 150.06 ? 13   DC  J C4    1 
ATOM   6517  N N4    . DC  I 5 13  ? 94.150  133.620 132.544 1.00 150.06 ? 13   DC  J N4    1 
ATOM   6518  C C5    . DC  I 5 13  ? 91.977  133.336 133.484 1.00 150.06 ? 13   DC  J C5    1 
ATOM   6519  C C6    . DC  I 5 13  ? 90.778  132.766 133.362 1.00 150.06 ? 13   DC  J C6    1 
ATOM   6520  P P     . DC  I 5 14  ? 86.774  128.038 131.767 1.00 140.61 ? 14   DC  J P     1 
ATOM   6521  O OP1   . DC  I 5 14  ? 85.340  127.797 131.503 1.00 140.61 ? 14   DC  J OP1   1 
ATOM   6522  O OP2   . DC  I 5 14  ? 87.418  127.384 132.925 1.00 140.61 ? 14   DC  J OP2   1 
ATOM   6523  O "O5'" . DC  I 5 14  ? 87.598  127.640 130.456 1.00 140.61 ? 14   DC  J "O5'" 1 
ATOM   6524  C "C5'" . DC  I 5 14  ? 88.900  128.173 130.244 1.00 140.61 ? 14   DC  J "C5'" 1 
ATOM   6525  C "C4'" . DC  I 5 14  ? 89.916  127.061 130.067 1.00 140.61 ? 14   DC  J "C4'" 1 
ATOM   6526  O "O4'" . DC  I 5 14  ? 91.255  127.590 130.274 1.00 140.61 ? 14   DC  J "O4'" 1 
ATOM   6527  C "C3'" . DC  I 5 14  ? 89.787  125.928 131.064 1.00 140.61 ? 14   DC  J "C3'" 1 
ATOM   6528  O "O3'" . DC  I 5 14  ? 90.349  124.763 130.524 1.00 140.61 ? 14   DC  J "O3'" 1 
ATOM   6529  C "C2'" . DC  I 5 14  ? 90.623  126.452 132.214 1.00 140.61 ? 14   DC  J "C2'" 1 
ATOM   6530  C "C1'" . DC  I 5 14  ? 91.803  127.034 131.453 1.00 140.61 ? 14   DC  J "C1'" 1 
ATOM   6531  N N1    . DC  I 5 14  ? 92.532  128.109 132.187 1.00 140.61 ? 14   DC  J N1    1 
ATOM   6532  C C2    . DC  I 5 14  ? 93.777  128.526 131.731 1.00 140.61 ? 14   DC  J C2    1 
ATOM   6533  O O2    . DC  I 5 14  ? 94.257  127.996 130.727 1.00 140.61 ? 14   DC  J O2    1 
ATOM   6534  N N3    . DC  I 5 14  ? 94.427  129.505 132.401 1.00 140.61 ? 14   DC  J N3    1 
ATOM   6535  C C4    . DC  I 5 14  ? 93.876  130.051 133.480 1.00 140.61 ? 14   DC  J C4    1 
ATOM   6536  N N4    . DC  I 5 14  ? 94.557  131.006 134.116 1.00 140.61 ? 14   DC  J N4    1 
ATOM   6537  C C5    . DC  I 5 14  ? 92.605  129.644 133.958 1.00 140.61 ? 14   DC  J C5    1 
ATOM   6538  C C6    . DC  I 5 14  ? 91.979  128.674 133.292 1.00 140.61 ? 14   DC  J C6    1 
ATOM   6539  P P     . DT  I 5 15  ? 89.822  123.320 130.984 1.00 128.69 ? 15   DT  J P     1 
ATOM   6540  O OP1   . DT  I 5 15  ? 88.500  123.089 130.363 1.00 128.69 ? 15   DT  J OP1   1 
ATOM   6541  O OP2   . DT  I 5 15  ? 89.980  123.220 132.452 1.00 128.69 ? 15   DT  J OP2   1 
ATOM   6542  O "O5'" . DT  I 5 15  ? 90.875  122.333 130.316 1.00 128.69 ? 15   DT  J "O5'" 1 
ATOM   6543  C "C5'" . DT  I 5 15  ? 91.782  122.837 129.355 1.00 128.69 ? 15   DT  J "C5'" 1 
ATOM   6544  C "C4'" . DT  I 5 15  ? 93.210  122.613 129.798 1.00 128.69 ? 15   DT  J "C4'" 1 
ATOM   6545  O "O4'" . DT  I 5 15  ? 93.680  123.748 130.566 1.00 128.69 ? 15   DT  J "O4'" 1 
ATOM   6546  C "C3'" . DT  I 5 15  ? 93.424  121.386 130.675 1.00 128.69 ? 15   DT  J "C3'" 1 
ATOM   6547  O "O3'" . DT  I 5 15  ? 94.527  120.680 130.190 1.00 128.69 ? 15   DT  J "O3'" 1 
ATOM   6548  C "C2'" . DT  I 5 15  ? 93.695  121.982 132.063 1.00 128.69 ? 15   DT  J "C2'" 1 
ATOM   6549  C "C1'" . DT  I 5 15  ? 94.373  123.286 131.700 1.00 128.69 ? 15   DT  J "C1'" 1 
ATOM   6550  N N1    . DT  I 5 15  ? 94.283  124.341 132.746 1.00 128.69 ? 15   DT  J N1    1 
ATOM   6551  C C2    . DT  I 5 15  ? 95.270  125.289 132.819 1.00 128.69 ? 15   DT  J C2    1 
ATOM   6552  O O2    . DT  I 5 15  ? 96.236  125.302 132.079 1.00 128.69 ? 15   DT  J O2    1 
ATOM   6553  N N3    . DT  I 5 15  ? 95.093  126.228 133.799 1.00 128.69 ? 15   DT  J N3    1 
ATOM   6554  C C4    . DT  I 5 15  ? 94.044  126.313 134.689 1.00 128.69 ? 15   DT  J C4    1 
ATOM   6555  O O4    . DT  I 5 15  ? 93.973  127.193 135.535 1.00 128.69 ? 15   DT  J O4    1 
ATOM   6556  C C5    . DT  I 5 15  ? 93.040  125.294 134.557 1.00 128.69 ? 15   DT  J C5    1 
ATOM   6557  C C7    . DT  I 5 15  ? 91.856  125.288 135.475 1.00 128.69 ? 15   DT  J C7    1 
ATOM   6558  C C6    . DT  I 5 15  ? 93.202  124.367 133.601 1.00 128.69 ? 15   DT  J C6    1 
ATOM   6559  P P     . DA  I 5 16  ? 94.683  119.108 130.453 1.00 118.21 ? 16   DA  J P     1 
ATOM   6560  O OP1   . DA  I 5 16  ? 94.369  118.408 129.191 1.00 118.21 ? 16   DA  J OP1   1 
ATOM   6561  O OP2   . DA  I 5 16  ? 93.943  118.750 131.683 1.00 118.21 ? 16   DA  J OP2   1 
ATOM   6562  O "O5'" . DA  I 5 16  ? 96.244  118.966 130.727 1.00 118.21 ? 16   DA  J "O5'" 1 
ATOM   6563  C "C5'" . DA  I 5 16  ? 97.128  119.980 130.251 1.00 118.21 ? 16   DA  J "C5'" 1 
ATOM   6564  C "C4'" . DA  I 5 16  ? 98.154  120.347 131.307 1.00 118.21 ? 16   DA  J "C4'" 1 
ATOM   6565  O "O4'" . DA  I 5 16  ? 97.595  121.315 132.234 1.00 118.21 ? 16   DA  J "O4'" 1 
ATOM   6566  C "C3'" . DA  I 5 16  ? 98.639  119.179 132.161 1.00 118.21 ? 16   DA  J "C3'" 1 
ATOM   6567  O "O3'" . DA  I 5 16  ? 100.025 119.257 132.313 1.00 118.21 ? 16   DA  J "O3'" 1 
ATOM   6568  C "C2'" . DA  I 5 16  ? 97.931  119.409 133.489 1.00 118.21 ? 16   DA  J "C2'" 1 
ATOM   6569  C "C1'" . DA  I 5 16  ? 97.925  120.918 133.538 1.00 118.21 ? 16   DA  J "C1'" 1 
ATOM   6570  N N9    . DA  I 5 16  ? 96.954  121.463 134.473 1.00 118.21 ? 16   DA  J N9    1 
ATOM   6571  C C8    . DA  I 5 16  ? 95.734  120.947 134.793 1.00 118.21 ? 16   DA  J C8    1 
ATOM   6572  N N7    . DA  I 5 16  ? 95.080  121.653 135.681 1.00 118.21 ? 16   DA  J N7    1 
ATOM   6573  C C5    . DA  I 5 16  ? 95.935  122.699 135.960 1.00 118.21 ? 16   DA  J C5    1 
ATOM   6574  C C6    . DA  I 5 16  ? 95.834  123.803 136.821 1.00 118.21 ? 16   DA  J C6    1 
ATOM   6575  N N6    . DA  I 5 16  ? 94.772  124.038 137.594 1.00 118.21 ? 16   DA  J N6    1 
ATOM   6576  N N1    . DA  I 5 16  ? 96.874  124.661 136.863 1.00 118.21 ? 16   DA  J N1    1 
ATOM   6577  C C2    . DA  I 5 16  ? 97.937  124.425 136.093 1.00 118.21 ? 16   DA  J C2    1 
ATOM   6578  N N3    . DA  I 5 16  ? 98.142  123.424 135.245 1.00 118.21 ? 16   DA  J N3    1 
ATOM   6579  C C4    . DA  I 5 16  ? 97.095  122.592 135.227 1.00 118.21 ? 16   DA  J C4    1 
ATOM   6580  P P     . DA  I 5 17  ? 100.949 118.052 131.806 1.00 115.02 ? 17   DA  J P     1 
ATOM   6581  O OP1   . DA  I 5 17  ? 101.343 118.377 130.418 1.00 115.02 ? 17   DA  J OP1   1 
ATOM   6582  O OP2   . DA  I 5 17  ? 100.262 116.780 132.115 1.00 115.02 ? 17   DA  J OP2   1 
ATOM   6583  O "O5'" . DA  I 5 17  ? 102.245 118.161 132.723 1.00 115.02 ? 17   DA  J "O5'" 1 
ATOM   6584  C "C5'" . DA  I 5 17  ? 103.320 118.970 132.303 1.00 115.02 ? 17   DA  J "C5'" 1 
ATOM   6585  C "C4'" . DA  I 5 17  ? 103.771 119.897 133.410 1.00 115.02 ? 17   DA  J "C4'" 1 
ATOM   6586  O "O4'" . DA  I 5 17  ? 102.622 120.358 134.165 1.00 115.02 ? 17   DA  J "O4'" 1 
ATOM   6587  C "C3'" . DA  I 5 17  ? 104.709 119.276 134.432 1.00 115.02 ? 17   DA  J "C3'" 1 
ATOM   6588  O "O3'" . DA  I 5 17  ? 105.598 120.272 134.877 1.00 115.02 ? 17   DA  J "O3'" 1 
ATOM   6589  C "C2'" . DA  I 5 17  ? 103.746 118.854 135.537 1.00 115.02 ? 17   DA  J "C2'" 1 
ATOM   6590  C "C1'" . DA  I 5 17  ? 102.776 120.016 135.523 1.00 115.02 ? 17   DA  J "C1'" 1 
ATOM   6591  N N9    . DA  I 5 17  ? 101.462 119.690 136.043 1.00 115.02 ? 17   DA  J N9    1 
ATOM   6592  C C8    . DA  I 5 17  ? 100.681 118.636 135.683 1.00 115.02 ? 17   DA  J C8    1 
ATOM   6593  N N7    . DA  I 5 17  ? 99.529  118.598 136.303 1.00 115.02 ? 17   DA  J N7    1 
ATOM   6594  C C5    . DA  I 5 17  ? 99.554  119.711 137.112 1.00 115.02 ? 17   DA  J C5    1 
ATOM   6595  C C6    . DA  I 5 17  ? 98.625  120.237 138.017 1.00 115.02 ? 17   DA  J C6    1 
ATOM   6596  N N6    . DA  I 5 17  ? 97.440  119.678 138.252 1.00 115.02 ? 17   DA  J N6    1 
ATOM   6597  N N1    . DA  I 5 17  ? 98.958  121.367 138.673 1.00 115.02 ? 17   DA  J N1    1 
ATOM   6598  C C2    . DA  I 5 17  ? 100.145 121.927 138.427 1.00 115.02 ? 17   DA  J C2    1 
ATOM   6599  N N3    . DA  I 5 17  ? 101.100 121.521 137.594 1.00 115.02 ? 17   DA  J N3    1 
ATOM   6600  C C4    . DA  I 5 17  ? 100.738 120.396 136.965 1.00 115.02 ? 17   DA  J C4    1 
ATOM   6601  P P     . DC  I 5 18  ? 106.982 119.902 135.597 1.00 107.12 ? 18   DC  J P     1 
ATOM   6602  O OP1   . DC  I 5 18  ? 108.056 120.296 134.666 1.00 107.12 ? 18   DC  J OP1   1 
ATOM   6603  O OP2   . DC  I 5 18  ? 106.933 118.518 136.111 1.00 107.12 ? 18   DC  J OP2   1 
ATOM   6604  O "O5'" . DC  I 5 18  ? 106.998 120.882 136.848 1.00 107.12 ? 18   DC  J "O5'" 1 
ATOM   6605  C "C5'" . DC  I 5 18  ? 105.841 121.638 137.146 1.00 107.12 ? 18   DC  J "C5'" 1 
ATOM   6606  C "C4'" . DC  I 5 18  ? 105.549 121.597 138.624 1.00 107.12 ? 18   DC  J "C4'" 1 
ATOM   6607  O "O4'" . DC  I 5 18  ? 104.179 121.165 138.843 1.00 107.12 ? 18   DC  J "O4'" 1 
ATOM   6608  C "C3'" . DC  I 5 18  ? 106.420 120.622 139.415 1.00 107.12 ? 18   DC  J "C3'" 1 
ATOM   6609  O "O3'" . DC  I 5 18  ? 106.753 121.196 140.664 1.00 107.12 ? 18   DC  J "O3'" 1 
ATOM   6610  C "C2'" . DC  I 5 18  ? 105.486 119.439 139.596 1.00 107.12 ? 18   DC  J "C2'" 1 
ATOM   6611  C "C1'" . DC  I 5 18  ? 104.201 120.190 139.847 1.00 107.12 ? 18   DC  J "C1'" 1 
ATOM   6612  N N1    . DC  I 5 18  ? 102.984 119.359 139.776 1.00 107.12 ? 18   DC  J N1    1 
ATOM   6613  C C2    . DC  I 5 18  ? 101.890 119.690 140.570 1.00 107.12 ? 18   DC  J C2    1 
ATOM   6614  O O2    . DC  I 5 18  ? 101.956 120.683 141.298 1.00 107.12 ? 18   DC  J O2    1 
ATOM   6615  N N3    . DC  I 5 18  ? 100.782 118.922 140.510 1.00 107.12 ? 18   DC  J N3    1 
ATOM   6616  C C4    . DC  I 5 18  ? 100.752 117.864 139.713 1.00 107.12 ? 18   DC  J C4    1 
ATOM   6617  N N4    . DC  I 5 18  ? 99.638  117.137 139.689 1.00 107.12 ? 18   DC  J N4    1 
ATOM   6618  C C5    . DC  I 5 18  ? 101.861 117.502 138.901 1.00 107.12 ? 18   DC  J C5    1 
ATOM   6619  C C6    . DC  I 5 18  ? 102.949 118.268 138.969 1.00 107.12 ? 18   DC  J C6    1 
ATOM   6620  P P     . DA  I 5 19  ? 108.243 121.716 140.945 1.00 95.34  ? 19   DA  J P     1 
ATOM   6621  O OP1   . DA  I 5 19  ? 108.617 122.649 139.864 1.00 95.34  ? 19   DA  J OP1   1 
ATOM   6622  O OP2   . DA  I 5 19  ? 109.080 120.537 141.227 1.00 95.34  ? 19   DA  J OP2   1 
ATOM   6623  O "O5'" . DA  I 5 19  ? 108.097 122.533 142.298 1.00 95.34  ? 19   DA  J "O5'" 1 
ATOM   6624  C "C5'" . DA  I 5 19  ? 107.646 121.878 143.450 1.00 95.34  ? 19   DA  J "C5'" 1 
ATOM   6625  C "C4'" . DA  I 5 19  ? 106.526 122.649 144.093 1.00 95.34  ? 19   DA  J "C4'" 1 
ATOM   6626  O "O4'" . DA  I 5 19  ? 105.263 122.122 143.640 1.00 95.34  ? 19   DA  J "O4'" 1 
ATOM   6627  C "C3'" . DA  I 5 19  ? 106.450 122.513 145.591 1.00 95.34  ? 19   DA  J "C3'" 1 
ATOM   6628  O "O3'" . DA  I 5 19  ? 105.636 123.528 146.112 1.00 95.34  ? 19   DA  J "O3'" 1 
ATOM   6629  C "C2'" . DA  I 5 19  ? 105.783 121.153 145.718 1.00 95.34  ? 19   DA  J "C2'" 1 
ATOM   6630  C "C1'" . DA  I 5 19  ? 104.732 121.245 144.623 1.00 95.34  ? 19   DA  J "C1'" 1 
ATOM   6631  N N9    . DA  I 5 19  ? 104.427 119.979 143.963 1.00 95.34  ? 19   DA  J N9    1 
ATOM   6632  C C8    . DA  I 5 19  ? 105.218 119.312 143.081 1.00 95.34  ? 19   DA  J C8    1 
ATOM   6633  N N7    . DA  I 5 19  ? 104.681 118.214 142.613 1.00 95.34  ? 19   DA  J N7    1 
ATOM   6634  C C5    . DA  I 5 19  ? 103.446 118.164 143.218 1.00 95.34  ? 19   DA  J C5    1 
ATOM   6635  C C6    . DA  I 5 19  ? 102.392 117.240 143.136 1.00 95.34  ? 19   DA  J C6    1 
ATOM   6636  N N6    . DA  I 5 19  ? 102.433 116.149 142.370 1.00 95.34  ? 19   DA  J N6    1 
ATOM   6637  N N1    . DA  I 5 19  ? 101.289 117.478 143.874 1.00 95.34  ? 19   DA  J N1    1 
ATOM   6638  C C2    . DA  I 5 19  ? 101.253 118.568 144.641 1.00 95.34  ? 19   DA  J C2    1 
ATOM   6639  N N3    . DA  I 5 19  ? 102.182 119.510 144.797 1.00 95.34  ? 19   DA  J N3    1 
ATOM   6640  C C4    . DA  I 5 19  ? 103.264 119.245 144.051 1.00 95.34  ? 19   DA  J C4    1 
ATOM   6641  P P     . DT  I 5 20  ? 105.774 123.952 147.650 1.00 100.20 ? 20   DT  J P     1 
ATOM   6642  O OP1   . DT  I 5 20  ? 105.189 125.296 147.808 1.00 100.20 ? 20   DT  J OP1   1 
ATOM   6643  O OP2   . DT  I 5 20  ? 107.166 123.687 148.057 1.00 100.20 ? 20   DT  J OP2   1 
ATOM   6644  O "O5'" . DT  I 5 20  ? 104.834 122.922 148.403 1.00 100.20 ? 20   DT  J "O5'" 1 
ATOM   6645  C "C5'" . DT  I 5 20  ? 103.486 122.804 148.012 1.00 100.20 ? 20   DT  J "C5'" 1 
ATOM   6646  C "C4'" . DT  I 5 20  ? 102.702 121.962 148.994 1.00 100.20 ? 20   DT  J "C4'" 1 
ATOM   6647  O "O4'" . DT  I 5 20  ? 102.264 120.734 148.354 1.00 100.20 ? 20   DT  J "O4'" 1 
ATOM   6648  C "C3'" . DT  I 5 20  ? 103.469 121.526 150.226 1.00 100.20 ? 20   DT  J "C3'" 1 
ATOM   6649  O "O3'" . DT  I 5 20  ? 102.574 121.415 151.274 1.00 100.20 ? 20   DT  J "O3'" 1 
ATOM   6650  C "C2'" . DT  I 5 20  ? 103.978 120.157 149.806 1.00 100.20 ? 20   DT  J "C2'" 1 
ATOM   6651  C "C1'" . DT  I 5 20  ? 102.760 119.630 149.078 1.00 100.20 ? 20   DT  J "C1'" 1 
ATOM   6652  N N1    . DT  I 5 20  ? 103.037 118.531 148.116 1.00 100.20 ? 20   DT  J N1    1 
ATOM   6653  C C2    . DT  I 5 20  ? 102.054 117.618 147.857 1.00 100.20 ? 20   DT  J C2    1 
ATOM   6654  O O2    . DT  I 5 20  ? 100.962 117.649 148.386 1.00 100.20 ? 20   DT  J O2    1 
ATOM   6655  N N3    . DT  I 5 20  ? 102.392 116.656 146.955 1.00 100.20 ? 20   DT  J N3    1 
ATOM   6656  C C4    . DT  I 5 20  ? 103.585 116.529 146.284 1.00 100.20 ? 20   DT  J C4    1 
ATOM   6657  O O4    . DT  I 5 20  ? 103.795 115.623 145.490 1.00 100.20 ? 20   DT  J O4    1 
ATOM   6658  C C5    . DT  I 5 20  ? 104.576 117.512 146.602 1.00 100.20 ? 20   DT  J C5    1 
ATOM   6659  C C7    . DT  I 5 20  ? 105.919 117.455 145.945 1.00 100.20 ? 20   DT  J C7    1 
ATOM   6660  C C6    . DT  I 5 20  ? 104.255 118.465 147.485 1.00 100.20 ? 20   DT  J C6    1 
ATOM   6661  P P     . DT  I 5 21  ? 103.055 121.629 152.781 1.00 111.03 ? 21   DT  J P     1 
ATOM   6662  O OP1   . DT  I 5 21  ? 102.591 122.971 153.185 1.00 111.03 ? 21   DT  J OP1   1 
ATOM   6663  O OP2   . DT  I 5 21  ? 104.489 121.295 152.864 1.00 111.03 ? 21   DT  J OP2   1 
ATOM   6664  O "O5'" . DT  I 5 21  ? 102.223 120.526 153.577 1.00 111.03 ? 21   DT  J "O5'" 1 
ATOM   6665  C "C5'" . DT  I 5 21  ? 100.821 120.413 153.349 1.00 111.03 ? 21   DT  J "C5'" 1 
ATOM   6666  C "C4'" . DT  I 5 21  ? 100.371 118.960 153.302 1.00 111.03 ? 21   DT  J "C4'" 1 
ATOM   6667  O "O4'" . DT  I 5 21  ? 100.907 118.297 152.124 1.00 111.03 ? 21   DT  J "O4'" 1 
ATOM   6668  C "C3'" . DT  I 5 21  ? 100.807 118.093 154.484 1.00 111.03 ? 21   DT  J "C3'" 1 
ATOM   6669  O "O3'" . DT  I 5 21  ? 99.753  117.208 154.809 1.00 111.03 ? 21   DT  J "O3'" 1 
ATOM   6670  C "C2'" . DT  I 5 21  ? 101.972 117.317 153.891 1.00 111.03 ? 21   DT  J "C2'" 1 
ATOM   6671  C "C1'" . DT  I 5 21  ? 101.373 117.042 152.539 1.00 111.03 ? 21   DT  J "C1'" 1 
ATOM   6672  N N1    . DT  I 5 21  ? 102.294 116.482 151.524 1.00 111.03 ? 21   DT  J N1    1 
ATOM   6673  C C2    . DT  I 5 21  ? 101.840 115.458 150.748 1.00 111.03 ? 21   DT  J C2    1 
ATOM   6674  O O2    . DT  I 5 21  ? 100.731 114.987 150.870 1.00 111.03 ? 21   DT  J O2    1 
ATOM   6675  N N3    . DT  I 5 21  ? 102.738 114.981 149.837 1.00 111.03 ? 21   DT  J N3    1 
ATOM   6676  C C4    . DT  I 5 21  ? 104.017 115.443 149.611 1.00 111.03 ? 21   DT  J C4    1 
ATOM   6677  O O4    . DT  I 5 21  ? 104.752 114.944 148.768 1.00 111.03 ? 21   DT  J O4    1 
ATOM   6678  C C5    . DT  I 5 21  ? 104.441 116.520 150.467 1.00 111.03 ? 21   DT  J C5    1 
ATOM   6679  C C7    . DT  I 5 21  ? 105.827 117.083 150.333 1.00 111.03 ? 21   DT  J C7    1 
ATOM   6680  C C6    . DT  I 5 21  ? 103.566 116.984 151.379 1.00 111.03 ? 21   DT  J C6    1 
ATOM   6681  P P     . DC  I 5 22  ? 98.805  117.498 156.069 1.00 124.69 ? 22   DC  J P     1 
ATOM   6682  O OP1   . DC  I 5 22  ? 97.404  117.248 155.672 1.00 124.69 ? 22   DC  J OP1   1 
ATOM   6683  O OP2   . DC  I 5 22  ? 99.198  118.822 156.595 1.00 124.69 ? 22   DC  J OP2   1 
ATOM   6684  O "O5'" . DC  I 5 22  ? 99.229  116.378 157.125 1.00 124.69 ? 22   DC  J "O5'" 1 
ATOM   6685  C "C5'" . DC  I 5 22  ? 99.956  115.245 156.694 1.00 124.69 ? 22   DC  J "C5'" 1 
ATOM   6686  C "C4'" . DC  I 5 22  ? 99.025  114.178 156.163 1.00 124.69 ? 22   DC  J "C4'" 1 
ATOM   6687  O "O4'" . DC  I 5 22  ? 99.417  113.822 154.811 1.00 124.69 ? 22   DC  J "O4'" 1 
ATOM   6688  C "C3'" . DC  I 5 22  ? 99.094  112.869 156.909 1.00 124.69 ? 22   DC  J "C3'" 1 
ATOM   6689  O "O3'" . DC  I 5 22  ? 97.971  112.089 156.558 1.00 124.69 ? 22   DC  J "O3'" 1 
ATOM   6690  C "C2'" . DC  I 5 22  ? 100.362 112.290 156.309 1.00 124.69 ? 22   DC  J "C2'" 1 
ATOM   6691  C "C1'" . DC  I 5 22  ? 100.104 112.576 154.838 1.00 124.69 ? 22   DC  J "C1'" 1 
ATOM   6692  N N1    . DC  I 5 22  ? 101.314 112.719 153.999 1.00 124.69 ? 22   DC  J N1    1 
ATOM   6693  C C2    . DC  I 5 22  ? 101.572 111.798 152.984 1.00 124.69 ? 22   DC  J C2    1 
ATOM   6694  O O2    . DC  I 5 22  ? 100.816 110.838 152.840 1.00 124.69 ? 22   DC  J O2    1 
ATOM   6695  N N3    . DC  I 5 22  ? 102.660 111.976 152.199 1.00 124.69 ? 22   DC  J N3    1 
ATOM   6696  C C4    . DC  I 5 22  ? 103.456 113.018 152.399 1.00 124.69 ? 22   DC  J C4    1 
ATOM   6697  N N4    . DC  I 5 22  ? 104.511 113.155 151.610 1.00 124.69 ? 22   DC  J N4    1 
ATOM   6698  C C5    . DC  I 5 22  ? 103.204 113.970 153.418 1.00 124.69 ? 22   DC  J C5    1 
ATOM   6699  C C6    . DC  I 5 22  ? 102.123 113.791 154.176 1.00 124.69 ? 22   DC  J C6    1 
ATOM   6700  P P     . DA  I 5 23  ? 97.345  111.043 157.597 1.00 130.93 ? 23   DA  J P     1 
ATOM   6701  O OP1   . DA  I 5 23  ? 95.923  110.862 157.241 1.00 130.93 ? 23   DA  J OP1   1 
ATOM   6702  O OP2   . DA  I 5 23  ? 97.716  111.489 158.955 1.00 130.93 ? 23   DA  J OP2   1 
ATOM   6703  O "O5'" . DA  I 5 23  ? 98.132  109.690 157.295 1.00 130.93 ? 23   DA  J "O5'" 1 
ATOM   6704  C "C5'" . DA  I 5 23  ? 98.330  109.267 155.957 1.00 130.93 ? 23   DA  J "C5'" 1 
ATOM   6705  C "C4'" . DA  I 5 23  ? 99.318  108.125 155.916 1.00 130.93 ? 23   DA  J "C4'" 1 
ATOM   6706  O "O4'" . DA  I 5 23  ? 100.411 108.448 155.011 1.00 130.93 ? 23   DA  J "O4'" 1 
ATOM   6707  C "C3'" . DA  I 5 23  ? 99.982  107.822 157.257 1.00 130.93 ? 23   DA  J "C3'" 1 
ATOM   6708  O "O3'" . DA  I 5 23  ? 100.249 106.439 157.349 1.00 130.93 ? 23   DA  J "O3'" 1 
ATOM   6709  C "C2'" . DA  I 5 23  ? 101.270 108.606 157.139 1.00 130.93 ? 23   DA  J "C2'" 1 
ATOM   6710  C "C1'" . DA  I 5 23  ? 101.617 108.271 155.708 1.00 130.93 ? 23   DA  J "C1'" 1 
ATOM   6711  N N9    . DA  I 5 23  ? 102.649 109.118 155.131 1.00 130.93 ? 23   DA  J N9    1 
ATOM   6712  C C8    . DA  I 5 23  ? 103.060 110.340 155.571 1.00 130.93 ? 23   DA  J C8    1 
ATOM   6713  N N7    . DA  I 5 23  ? 104.018 110.868 154.852 1.00 130.93 ? 23   DA  J N7    1 
ATOM   6714  C C5    . DA  I 5 23  ? 104.263 109.914 153.886 1.00 130.93 ? 23   DA  J C5    1 
ATOM   6715  C C6    . DA  I 5 23  ? 105.168 109.863 152.817 1.00 130.93 ? 23   DA  J C6    1 
ATOM   6716  N N6    . DA  I 5 23  ? 106.039 110.830 152.549 1.00 130.93 ? 23   DA  J N6    1 
ATOM   6717  N N1    . DA  I 5 23  ? 105.155 108.767 152.042 1.00 130.93 ? 23   DA  J N1    1 
ATOM   6718  C C2    . DA  I 5 23  ? 104.289 107.790 152.319 1.00 130.93 ? 23   DA  J C2    1 
ATOM   6719  N N3    . DA  I 5 23  ? 103.391 107.726 153.294 1.00 130.93 ? 23   DA  J N3    1 
ATOM   6720  C C4    . DA  I 5 23  ? 103.423 108.833 154.042 1.00 130.93 ? 23   DA  J C4    1 
ATOM   6721  P P     . DC  I 5 24  ? 99.570  105.555 158.505 1.00 138.91 ? 24   DC  J P     1 
ATOM   6722  O OP1   . DC  I 5 24  ? 98.107  105.592 158.296 1.00 138.91 ? 24   DC  J OP1   1 
ATOM   6723  O OP2   . DC  I 5 24  ? 100.144 105.990 159.795 1.00 138.91 ? 24   DC  J OP2   1 
ATOM   6724  O "O5'" . DC  I 5 24  ? 100.106 104.079 158.212 1.00 138.91 ? 24   DC  J "O5'" 1 
ATOM   6725  C "C5'" . DC  I 5 24  ? 100.468 103.708 156.887 1.00 138.91 ? 24   DC  J "C5'" 1 
ATOM   6726  C "C4'" . DC  I 5 24  ? 101.965 103.516 156.781 1.00 138.91 ? 24   DC  J "C4'" 1 
ATOM   6727  O "O4'" . DC  I 5 24  ? 102.586 104.736 156.323 1.00 138.91 ? 24   DC  J "O4'" 1 
ATOM   6728  C "C3'" . DC  I 5 24  ? 102.654 103.192 158.105 1.00 138.91 ? 24   DC  J "C3'" 1 
ATOM   6729  O "O3'" . DC  I 5 24  ? 102.907 101.748 158.229 1.00 138.91 ? 24   DC  J "O3'" 1 
ATOM   6730  C "C2'" . DC  I 5 24  ? 103.913 104.085 158.126 1.00 138.91 ? 24   DC  J "C2'" 1 
ATOM   6731  C "C1'" . DC  I 5 24  ? 103.927 104.692 156.725 1.00 138.91 ? 24   DC  J "C1'" 1 
ATOM   6732  N N1    . DC  I 5 24  ? 104.535 106.066 156.655 1.00 138.91 ? 24   DC  J N1    1 
ATOM   6733  C C2    . DC  I 5 24  ? 105.324 106.420 155.557 1.00 138.91 ? 24   DC  J C2    1 
ATOM   6734  O O2    . DC  I 5 24  ? 105.532 105.587 154.671 1.00 138.91 ? 24   DC  J O2    1 
ATOM   6735  N N3    . DC  I 5 24  ? 105.895 107.644 155.527 1.00 138.91 ? 24   DC  J N3    1 
ATOM   6736  C C4    . DC  I 5 24  ? 105.664 108.510 156.508 1.00 138.91 ? 24   DC  J C4    1 
ATOM   6737  N N4    . DC  I 5 24  ? 106.225 109.718 156.416 1.00 138.91 ? 24   DC  J N4    1 
ATOM   6738  C C5    . DC  I 5 24  ? 104.854 108.177 157.628 1.00 138.91 ? 24   DC  J C5    1 
ATOM   6739  C C6    . DC  I 5 24  ? 104.329 106.949 157.667 1.00 138.91 ? 24   DC  J C6    1 
ATOM   6740  P P     . DC  I 5 25  ? 104.271 101.008 157.772 1.00 138.72 ? 25   DC  J P     1 
ATOM   6741  O OP1   . DC  I 5 25  ? 103.904 99.583  157.631 1.00 138.72 ? 25   DC  J OP1   1 
ATOM   6742  O OP2   . DC  I 5 25  ? 105.384 101.316 158.697 1.00 138.72 ? 25   DC  J OP2   1 
ATOM   6743  O "O5'" . DC  I 5 25  ? 104.586 101.548 156.298 1.00 138.72 ? 25   DC  J "O5'" 1 
ATOM   6744  C "C5'" . DC  I 5 25  ? 104.654 100.647 155.207 1.00 138.72 ? 25   DC  J "C5'" 1 
ATOM   6745  C "C4'" . DC  I 5 25  ? 106.089 100.436 154.751 1.00 138.72 ? 25   DC  J "C4'" 1 
ATOM   6746  O "O4'" . DC  I 5 25  ? 106.758 101.712 154.604 1.00 138.72 ? 25   DC  J "O4'" 1 
ATOM   6747  C "C3'" . DC  I 5 25  ? 106.959 99.619  155.689 1.00 138.72 ? 25   DC  J "C3'" 1 
ATOM   6748  O "O3'" . DC  I 5 25  ? 107.853 98.834  154.928 1.00 138.72 ? 25   DC  J "O3'" 1 
ATOM   6749  C "C2'" . DC  I 5 25  ? 107.691 100.690 156.493 1.00 138.72 ? 25   DC  J "C2'" 1 
ATOM   6750  C "C1'" . DC  I 5 25  ? 107.901 101.760 155.437 1.00 138.72 ? 25   DC  J "C1'" 1 
ATOM   6751  N N1    . DC  I 5 25  ? 107.999 103.149 155.971 1.00 138.72 ? 25   DC  J N1    1 
ATOM   6752  C C2    . DC  I 5 25  ? 108.734 104.100 155.262 1.00 138.72 ? 25   DC  J C2    1 
ATOM   6753  O O2    . DC  I 5 25  ? 109.315 103.759 154.226 1.00 138.72 ? 25   DC  J O2    1 
ATOM   6754  N N3    . DC  I 5 25  ? 108.797 105.367 155.733 1.00 138.72 ? 25   DC  J N3    1 
ATOM   6755  C C4    . DC  I 5 25  ? 108.160 105.690 156.852 1.00 138.72 ? 25   DC  J C4    1 
ATOM   6756  N N4    . DC  I 5 25  ? 108.255 106.946 157.278 1.00 138.72 ? 25   DC  J N4    1 
ATOM   6757  C C5    . DC  I 5 25  ? 107.393 104.739 157.585 1.00 138.72 ? 25   DC  J C5    1 
ATOM   6758  C C6    . DC  I 5 25  ? 107.337 103.492 157.110 1.00 138.72 ? 25   DC  J C6    1 
ATOM   6759  P P     . DT  I 5 26  ? 108.327 97.407  155.484 1.00 131.20 ? 26   DT  J P     1 
ATOM   6760  O OP1   . DT  I 5 26  ? 109.096 96.734  154.412 1.00 131.20 ? 26   DT  J OP1   1 
ATOM   6761  O OP2   . DT  I 5 26  ? 107.129 96.723  156.020 1.00 131.20 ? 26   DT  J OP2   1 
ATOM   6762  O "O5'" . DT  I 5 26  ? 109.237 97.800  156.741 1.00 131.20 ? 26   DT  J "O5'" 1 
ATOM   6763  C "C5'" . DT  I 5 26  ? 110.636 97.592  156.721 1.00 131.20 ? 26   DT  J "C5'" 1 
ATOM   6764  C "C4'" . DT  I 5 26  ? 111.345 98.594  155.829 1.00 131.20 ? 26   DT  J "C4'" 1 
ATOM   6765  O "O4'" . DT  I 5 26  ? 110.813 99.935  156.031 1.00 131.20 ? 26   DT  J "O4'" 1 
ATOM   6766  C "C3'" . DT  I 5 26  ? 112.835 98.707  156.098 1.00 131.20 ? 26   DT  J "C3'" 1 
ATOM   6767  O "O3'" . DT  I 5 26  ? 113.514 98.935  154.883 1.00 131.20 ? 26   DT  J "O3'" 1 
ATOM   6768  C "C2'" . DT  I 5 26  ? 112.893 99.929  157.001 1.00 131.20 ? 26   DT  J "C2'" 1 
ATOM   6769  C "C1'" . DT  I 5 26  ? 111.894 100.800 156.286 1.00 131.20 ? 26   DT  J "C1'" 1 
ATOM   6770  N N1    . DT  I 5 26  ? 111.423 101.987 157.063 1.00 131.20 ? 26   DT  J N1    1 
ATOM   6771  C C2    . DT  I 5 26  ? 111.779 103.242 156.636 1.00 131.20 ? 26   DT  J C2    1 
ATOM   6772  O O2    . DT  I 5 26  ? 112.478 103.440 155.660 1.00 131.20 ? 26   DT  J O2    1 
ATOM   6773  N N3    . DT  I 5 26  ? 111.290 104.267 157.396 1.00 131.20 ? 26   DT  J N3    1 
ATOM   6774  C C4    . DT  I 5 26  ? 110.513 104.164 158.524 1.00 131.20 ? 26   DT  J C4    1 
ATOM   6775  O O4    . DT  I 5 26  ? 110.115 105.147 159.138 1.00 131.20 ? 26   DT  J O4    1 
ATOM   6776  C C5    . DT  I 5 26  ? 110.161 102.826 158.910 1.00 131.20 ? 26   DT  J C5    1 
ATOM   6777  C C7    . DT  I 5 26  ? 109.288 102.598 160.106 1.00 131.20 ? 26   DT  J C7    1 
ATOM   6778  C C6    . DT  I 5 26  ? 110.636 101.811 158.176 1.00 131.20 ? 26   DT  J C6    1 
ATOM   6779  P P     . DC  I 5 27  ? 114.968 98.301  154.654 1.00 120.06 ? 27   DC  J P     1 
ATOM   6780  O OP1   . DC  I 5 27  ? 114.913 97.447  153.447 1.00 120.06 ? 27   DC  J OP1   1 
ATOM   6781  O OP2   . DC  I 5 27  ? 115.381 97.720  155.948 1.00 120.06 ? 27   DC  J OP2   1 
ATOM   6782  O "O5'" . DC  I 5 27  ? 115.905 99.569  154.356 1.00 120.06 ? 27   DC  J "O5'" 1 
ATOM   6783  C "C5'" . DC  I 5 27  ? 115.456 100.894 154.650 1.00 120.06 ? 27   DC  J "C5'" 1 
ATOM   6784  C "C4'" . DC  I 5 27  ? 116.263 101.508 155.772 1.00 120.06 ? 27   DC  J "C4'" 1 
ATOM   6785  O "O4'" . DC  I 5 27  ? 115.382 102.172 156.707 1.00 120.06 ? 27   DC  J "O4'" 1 
ATOM   6786  C "C3'" . DC  I 5 27  ? 117.075 100.510 156.601 1.00 120.06 ? 27   DC  J "C3'" 1 
ATOM   6787  O "O3'" . DC  I 5 27  ? 118.411 100.930 156.667 1.00 120.06 ? 27   DC  J "O3'" 1 
ATOM   6788  C "C2'" . DC  I 5 27  ? 116.405 100.561 157.974 1.00 120.06 ? 27   DC  J "C2'" 1 
ATOM   6789  C "C1'" . DC  I 5 27  ? 115.915 101.991 157.985 1.00 120.06 ? 27   DC  J "C1'" 1 
ATOM   6790  N N1    . DC  I 5 27  ? 114.867 102.285 159.007 1.00 120.06 ? 27   DC  J N1    1 
ATOM   6791  C C2    . DC  I 5 27  ? 114.326 103.570 159.095 1.00 120.06 ? 27   DC  J C2    1 
ATOM   6792  O O2    . DC  I 5 27  ? 114.713 104.445 158.316 1.00 120.06 ? 27   DC  J O2    1 
ATOM   6793  N N3    . DC  I 5 27  ? 113.386 103.821 160.031 1.00 120.06 ? 27   DC  J N3    1 
ATOM   6794  C C4    . DC  I 5 27  ? 112.991 102.856 160.848 1.00 120.06 ? 27   DC  J C4    1 
ATOM   6795  N N4    . DC  I 5 27  ? 112.077 103.154 161.768 1.00 120.06 ? 27   DC  J N4    1 
ATOM   6796  C C5    . DC  I 5 27  ? 113.538 101.548 160.786 1.00 120.06 ? 27   DC  J C5    1 
ATOM   6797  C C6    . DC  I 5 27  ? 114.466 101.311 159.863 1.00 120.06 ? 27   DC  J C6    1 
ATOM   6798  P P     . DT  I 5 28  ? 119.485 100.366 155.620 1.00 107.35 ? 28   DT  J P     1 
ATOM   6799  O OP1   . DT  I 5 28  ? 118.773 99.784  154.469 1.00 107.35 ? 28   DT  J OP1   1 
ATOM   6800  O OP2   . DT  I 5 28  ? 120.453 99.547  156.374 1.00 107.35 ? 28   DT  J OP2   1 
ATOM   6801  O "O5'" . DT  I 5 28  ? 120.236 101.674 155.118 1.00 107.35 ? 28   DT  J "O5'" 1 
ATOM   6802  C "C5'" . DT  I 5 28  ? 121.202 102.278 155.943 1.00 107.35 ? 28   DT  J "C5'" 1 
ATOM   6803  C "C4'" . DT  I 5 28  ? 120.755 103.653 156.384 1.00 107.35 ? 28   DT  J "C4'" 1 
ATOM   6804  O "O4'" . DT  I 5 28  ? 119.549 103.549 157.183 1.00 107.35 ? 28   DT  J "O4'" 1 
ATOM   6805  C "C3'" . DT  I 5 28  ? 121.759 104.392 157.246 1.00 107.35 ? 28   DT  J "C3'" 1 
ATOM   6806  O "O3'" . DT  I 5 28  ? 121.727 105.739 156.913 1.00 107.35 ? 28   DT  J "O3'" 1 
ATOM   6807  C "C2'" . DT  I 5 28  ? 121.234 104.159 158.658 1.00 107.35 ? 28   DT  J "C2'" 1 
ATOM   6808  C "C1'" . DT  I 5 28  ? 119.743 104.206 158.413 1.00 107.35 ? 28   DT  J "C1'" 1 
ATOM   6809  N N1    . DT  I 5 28  ? 118.941 103.503 159.440 1.00 107.35 ? 28   DT  J N1    1 
ATOM   6810  C C2    . DT  I 5 28  ? 117.941 104.178 160.087 1.00 107.35 ? 28   DT  J C2    1 
ATOM   6811  O O2    . DT  I 5 28  ? 117.678 105.342 159.876 1.00 107.35 ? 28   DT  J O2    1 
ATOM   6812  N N3    . DT  I 5 28  ? 117.253 103.441 161.000 1.00 107.35 ? 28   DT  J N3    1 
ATOM   6813  C C4    . DT  I 5 28  ? 117.458 102.121 161.320 1.00 107.35 ? 28   DT  J C4    1 
ATOM   6814  O O4    . DT  I 5 28  ? 116.786 101.541 162.159 1.00 107.35 ? 28   DT  J O4    1 
ATOM   6815  C C5    . DT  I 5 28  ? 118.521 101.471 160.605 1.00 107.35 ? 28   DT  J C5    1 
ATOM   6816  C C7    . DT  I 5 28  ? 118.832 100.032 160.869 1.00 107.35 ? 28   DT  J C7    1 
ATOM   6817  C C6    . DT  I 5 28  ? 119.199 102.184 159.703 1.00 107.35 ? 28   DT  J C6    1 
ATOM   6818  P P     . DT  I 5 29  ? 123.078 106.597 156.911 1.00 92.34  ? 29   DT  J P     1 
ATOM   6819  O OP1   . DT  I 5 29  ? 123.061 107.453 155.711 1.00 92.34  ? 29   DT  J OP1   1 
ATOM   6820  O OP2   . DT  I 5 29  ? 124.216 105.684 157.140 1.00 92.34  ? 29   DT  J OP2   1 
ATOM   6821  O "O5'" . DT  I 5 29  ? 122.915 107.514 158.192 1.00 92.34  ? 29   DT  J "O5'" 1 
ATOM   6822  C "C5'" . DT  I 5 29  ? 121.622 107.849 158.650 1.00 92.34  ? 29   DT  J "C5'" 1 
ATOM   6823  C "C4'" . DT  I 5 29  ? 121.667 108.146 160.121 1.00 92.34  ? 29   DT  J "C4'" 1 
ATOM   6824  O "O4'" . DT  I 5 29  ? 121.110 107.035 160.867 1.00 92.34  ? 29   DT  J "O4'" 1 
ATOM   6825  C "C3'" . DT  I 5 29  ? 123.081 108.338 160.660 1.00 92.34  ? 29   DT  J "C3'" 1 
ATOM   6826  O "O3'" . DT  I 5 29  ? 123.133 109.475 161.459 1.00 92.34  ? 29   DT  J "O3'" 1 
ATOM   6827  C "C2'" . DT  I 5 29  ? 123.319 107.077 161.473 1.00 92.34  ? 29   DT  J "C2'" 1 
ATOM   6828  C "C1'" . DT  I 5 29  ? 121.923 106.830 161.985 1.00 92.34  ? 29   DT  J "C1'" 1 
ATOM   6829  N N1    . DT  I 5 29  ? 121.712 105.476 162.503 1.00 92.34  ? 29   DT  J N1    1 
ATOM   6830  C C2    . DT  I 5 29  ? 120.710 105.263 163.410 1.00 92.34  ? 29   DT  J C2    1 
ATOM   6831  O O2    . DT  I 5 29  ? 119.963 106.135 163.793 1.00 92.34  ? 29   DT  J O2    1 
ATOM   6832  N N3    . DT  I 5 29  ? 120.603 103.984 163.846 1.00 92.34  ? 29   DT  J N3    1 
ATOM   6833  C C4    . DT  I 5 29  ? 121.390 102.915 163.485 1.00 92.34  ? 29   DT  J C4    1 
ATOM   6834  O O4    . DT  I 5 29  ? 121.213 101.792 163.939 1.00 92.34  ? 29   DT  J O4    1 
ATOM   6835  C C5    . DT  I 5 29  ? 122.433 103.208 162.534 1.00 92.34  ? 29   DT  J C5    1 
ATOM   6836  C C7    . DT  I 5 29  ? 123.350 102.127 162.063 1.00 92.34  ? 29   DT  J C7    1 
ATOM   6837  C C6    . DT  I 5 29  ? 122.546 104.461 162.100 1.00 92.34  ? 29   DT  J C6    1 
ATOM   6838  P P     . DG  I 5 30  ? 124.216 110.601 161.129 1.00 77.97  ? 30   DG  J P     1 
ATOM   6839  O OP1   . DG  I 5 30  ? 123.841 111.130 159.805 1.00 77.97  ? 30   DG  J OP1   1 
ATOM   6840  O OP2   . DG  I 5 30  ? 125.549 110.004 161.357 1.00 77.97  ? 30   DG  J OP2   1 
ATOM   6841  O "O5'" . DG  I 5 30  ? 123.970 111.713 162.237 1.00 77.97  ? 30   DG  J "O5'" 1 
ATOM   6842  C "C5'" . DG  I 5 30  ? 122.711 112.311 162.336 1.00 77.97  ? 30   DG  J "C5'" 1 
ATOM   6843  C "C4'" . DG  I 5 30  ? 122.140 112.121 163.720 1.00 77.97  ? 30   DG  J "C4'" 1 
ATOM   6844  O "O4'" . DG  I 5 30  ? 121.992 110.711 163.988 1.00 77.97  ? 30   DG  J "O4'" 1 
ATOM   6845  C "C3'" . DG  I 5 30  ? 122.993 112.678 164.854 1.00 77.97  ? 30   DG  J "C3'" 1 
ATOM   6846  O "O3'" . DG  I 5 30  ? 122.174 113.387 165.746 1.00 77.97  ? 30   DG  J "O3'" 1 
ATOM   6847  C "C2'" . DG  I 5 30  ? 123.583 111.428 165.499 1.00 77.97  ? 30   DG  J "C2'" 1 
ATOM   6848  C "C1'" . DG  I 5 30  ? 122.476 110.434 165.272 1.00 77.97  ? 30   DG  J "C1'" 1 
ATOM   6849  N N9    . DG  I 5 30  ? 122.909 109.047 165.305 1.00 77.97  ? 30   DG  J N9    1 
ATOM   6850  C C8    . DG  I 5 30  ? 123.923 108.478 164.585 1.00 77.97  ? 30   DG  J C8    1 
ATOM   6851  N N7    . DG  I 5 30  ? 124.067 107.206 164.815 1.00 77.97  ? 30   DG  J N7    1 
ATOM   6852  C C5    . DG  I 5 30  ? 123.086 106.921 165.746 1.00 77.97  ? 30   DG  J C5    1 
ATOM   6853  C C6    . DG  I 5 30  ? 122.757 105.705 166.371 1.00 77.97  ? 30   DG  J C6    1 
ATOM   6854  O O6    . DG  I 5 30  ? 123.287 104.600 166.224 1.00 77.97  ? 30   DG  J O6    1 
ATOM   6855  N N1    . DG  I 5 30  ? 121.696 105.853 167.251 1.00 77.97  ? 30   DG  J N1    1 
ATOM   6856  C C2    . DG  I 5 30  ? 121.040 107.028 167.492 1.00 77.97  ? 30   DG  J C2    1 
ATOM   6857  N N2    . DG  I 5 30  ? 120.040 106.978 168.377 1.00 77.97  ? 30   DG  J N2    1 
ATOM   6858  N N3    . DG  I 5 30  ? 121.339 108.173 166.910 1.00 77.97  ? 30   DG  J N3    1 
ATOM   6859  C C4    . DG  I 5 30  ? 122.369 108.045 166.057 1.00 77.97  ? 30   DG  J C4    1 
ATOM   6860  P P     . DT  I 5 31  ? 122.807 114.150 167.003 1.00 77.88  ? 31   DT  J P     1 
ATOM   6861  O OP1   . DT  I 5 31  ? 121.983 115.355 167.222 1.00 77.88  ? 31   DT  J OP1   1 
ATOM   6862  O OP2   . DT  I 5 31  ? 124.266 114.288 166.829 1.00 77.88  ? 31   DT  J OP2   1 
ATOM   6863  O "O5'" . DT  I 5 31  ? 122.522 113.154 168.206 1.00 77.88  ? 31   DT  J "O5'" 1 
ATOM   6864  C "C5'" . DT  I 5 31  ? 121.191 112.819 168.494 1.00 77.88  ? 31   DT  J "C5'" 1 
ATOM   6865  C "C4'" . DT  I 5 31  ? 121.087 111.923 169.705 1.00 77.88  ? 31   DT  J "C4'" 1 
ATOM   6866  O "O4'" . DT  I 5 31  ? 121.482 110.578 169.356 1.00 77.88  ? 31   DT  J "O4'" 1 
ATOM   6867  C "C3'" . DT  I 5 31  ? 121.943 112.321 170.898 1.00 77.88  ? 31   DT  J "C3'" 1 
ATOM   6868  O "O3'" . DT  I 5 31  ? 121.175 112.194 172.067 1.00 77.88  ? 31   DT  J "O3'" 1 
ATOM   6869  C "C2'" . DT  I 5 31  ? 123.062 111.289 170.864 1.00 77.88  ? 31   DT  J "C2'" 1 
ATOM   6870  C "C1'" . DT  I 5 31  ? 122.304 110.081 170.372 1.00 77.88  ? 31   DT  J "C1'" 1 
ATOM   6871  N N1    . DT  I 5 31  ? 123.160 109.035 169.805 1.00 77.88  ? 31   DT  J N1    1 
ATOM   6872  C C2    . DT  I 5 31  ? 122.959 107.731 170.173 1.00 77.88  ? 31   DT  J C2    1 
ATOM   6873  O O2    . DT  I 5 31  ? 122.101 107.385 170.957 1.00 77.88  ? 31   DT  J O2    1 
ATOM   6874  N N3    . DT  I 5 31  ? 123.804 106.838 169.587 1.00 77.88  ? 31   DT  J N3    1 
ATOM   6875  C C4    . DT  I 5 31  ? 124.801 107.114 168.682 1.00 77.88  ? 31   DT  J C4    1 
ATOM   6876  O O4    . DT  I 5 31  ? 125.512 106.244 168.207 1.00 77.88  ? 31   DT  J O4    1 
ATOM   6877  C C5    . DT  I 5 31  ? 124.959 108.498 168.344 1.00 77.88  ? 31   DT  J C5    1 
ATOM   6878  C C7    . DT  I 5 31  ? 126.018 108.915 167.376 1.00 77.88  ? 31   DT  J C7    1 
ATOM   6879  C C6    . DT  I 5 31  ? 124.139 109.382 168.913 1.00 77.88  ? 31   DT  J C6    1 
ATOM   6880  P P     . DG  I 5 32  ? 121.626 112.901 173.433 1.00 90.97  ? 32   DG  J P     1 
ATOM   6881  O OP1   . DG  I 5 32  ? 120.451 113.616 173.963 1.00 90.97  ? 32   DG  J OP1   1 
ATOM   6882  O OP2   . DG  I 5 32  ? 122.862 113.661 173.167 1.00 90.97  ? 32   DG  J OP2   1 
ATOM   6883  O "O5'" . DG  I 5 32  ? 121.943 111.671 174.410 1.00 90.97  ? 32   DG  J "O5'" 1 
ATOM   6884  C "C5'" . DG  I 5 32  ? 120.866 110.980 175.030 1.00 90.97  ? 32   DG  J "C5'" 1 
ATOM   6885  C "C4'" . DG  I 5 32  ? 121.317 109.688 175.694 1.00 90.97  ? 32   DG  J "C4'" 1 
ATOM   6886  O "O4'" . DG  I 5 32  ? 121.924 108.814 174.717 1.00 90.97  ? 32   DG  J "O4'" 1 
ATOM   6887  C "C3'" . DG  I 5 32  ? 122.334 109.850 176.817 1.00 90.97  ? 32   DG  J "C3'" 1 
ATOM   6888  O "O3'" . DG  I 5 32  ? 121.981 109.022 177.906 1.00 90.97  ? 32   DG  J "O3'" 1 
ATOM   6889  C "C2'" . DG  I 5 32  ? 123.631 109.394 176.176 1.00 90.97  ? 32   DG  J "C2'" 1 
ATOM   6890  C "C1'" . DG  I 5 32  ? 123.143 108.333 175.216 1.00 90.97  ? 32   DG  J "C1'" 1 
ATOM   6891  N N9    . DG  I 5 32  ? 124.029 108.130 174.086 1.00 90.97  ? 32   DG  J N9    1 
ATOM   6892  C C8    . DG  I 5 32  ? 124.450 109.074 173.195 1.00 90.97  ? 32   DG  J C8    1 
ATOM   6893  N N7    . DG  I 5 32  ? 125.241 108.606 172.277 1.00 90.97  ? 32   DG  J N7    1 
ATOM   6894  C C5    . DG  I 5 32  ? 125.339 107.263 172.571 1.00 90.97  ? 32   DG  J C5    1 
ATOM   6895  C C6    . DG  I 5 32  ? 126.059 106.249 171.918 1.00 90.97  ? 32   DG  J C6    1 
ATOM   6896  O O6    . DG  I 5 32  ? 126.771 106.341 170.916 1.00 90.97  ? 32   DG  J O6    1 
ATOM   6897  N N1    . DG  I 5 32  ? 125.890 105.017 172.538 1.00 90.97  ? 32   DG  J N1    1 
ATOM   6898  C C2    . DG  I 5 32  ? 125.123 104.801 173.654 1.00 90.97  ? 32   DG  J C2    1 
ATOM   6899  N N2    . DG  I 5 32  ? 125.080 103.540 174.112 1.00 90.97  ? 32   DG  J N2    1 
ATOM   6900  N N3    . DG  I 5 32  ? 124.440 105.752 174.277 1.00 90.97  ? 32   DG  J N3    1 
ATOM   6901  C C4    . DG  I 5 32  ? 124.597 106.952 173.681 1.00 90.97  ? 32   DG  J C4    1 
ATOM   6902  P P     . DT  I 5 33  ? 122.680 109.225 179.338 1.00 101.65 ? 33   DT  J P     1 
ATOM   6903  O OP1   . DT  I 5 33  ? 121.650 108.934 180.359 1.00 101.65 ? 33   DT  J OP1   1 
ATOM   6904  O OP2   . DT  I 5 33  ? 123.370 110.531 179.347 1.00 101.65 ? 33   DT  J OP2   1 
ATOM   6905  O "O5'" . DT  I 5 33  ? 123.801 108.087 179.379 1.00 101.65 ? 33   DT  J "O5'" 1 
ATOM   6906  C "C5'" . DT  I 5 33  ? 123.428 106.737 179.189 1.00 101.65 ? 33   DT  J "C5'" 1 
ATOM   6907  C "C4'" . DT  I 5 33  ? 124.606 105.801 179.391 1.00 101.65 ? 33   DT  J "C4'" 1 
ATOM   6908  O "O4'" . DT  I 5 33  ? 125.283 105.575 178.128 1.00 101.65 ? 33   DT  J "O4'" 1 
ATOM   6909  C "C3'" . DT  I 5 33  ? 125.675 106.282 180.368 1.00 101.65 ? 33   DT  J "C3'" 1 
ATOM   6910  O "O3'" . DT  I 5 33  ? 126.079 105.190 181.190 1.00 101.65 ? 33   DT  J "O3'" 1 
ATOM   6911  C "C2'" . DT  I 5 33  ? 126.800 106.740 179.442 1.00 101.65 ? 33   DT  J "C2'" 1 
ATOM   6912  C "C1'" . DT  I 5 33  ? 126.668 105.754 178.298 1.00 101.65 ? 33   DT  J "C1'" 1 
ATOM   6913  N N1    . DT  I 5 33  ? 127.214 106.262 177.034 1.00 101.65 ? 33   DT  J N1    1 
ATOM   6914  C C2    . DT  I 5 33  ? 127.949 105.431 176.225 1.00 101.65 ? 33   DT  J C2    1 
ATOM   6915  O O2    . DT  I 5 33  ? 128.182 104.274 176.496 1.00 101.65 ? 33   DT  J O2    1 
ATOM   6916  N N3    . DT  I 5 33  ? 128.398 106.012 175.078 1.00 101.65 ? 33   DT  J N3    1 
ATOM   6917  C C4    . DT  I 5 33  ? 128.189 107.312 174.675 1.00 101.65 ? 33   DT  J C4    1 
ATOM   6918  O O4    . DT  I 5 33  ? 128.623 107.757 173.628 1.00 101.65 ? 33   DT  J O4    1 
ATOM   6919  C C5    . DT  I 5 33  ? 127.416 108.119 175.568 1.00 101.65 ? 33   DT  J C5    1 
ATOM   6920  C C7    . DT  I 5 33  ? 127.139 109.546 175.228 1.00 101.65 ? 33   DT  J C7    1 
ATOM   6921  C C6    . DT  I 5 33  ? 126.970 107.564 176.690 1.00 101.65 ? 33   DT  J C6    1 
ATOM   6922  P P     . DG  I 5 34  ? 127.229 105.361 182.301 1.00 104.32 ? 34   DG  J P     1 
ATOM   6923  O OP1   . DG  I 5 34  ? 126.968 104.360 183.356 1.00 104.32 ? 34   DG  J OP1   1 
ATOM   6924  O OP2   . DG  I 5 34  ? 127.326 106.791 182.663 1.00 104.32 ? 34   DG  J OP2   1 
ATOM   6925  O "O5'" . DG  I 5 34  ? 128.568 104.928 181.541 1.00 104.32 ? 34   DG  J "O5'" 1 
ATOM   6926  C "C5'" . DG  I 5 34  ? 128.587 103.739 180.757 1.00 104.32 ? 34   DG  J "C5'" 1 
ATOM   6927  C "C4'" . DG  I 5 34  ? 130.003 103.225 180.555 1.00 104.32 ? 34   DG  J "C4'" 1 
ATOM   6928  O "O4'" . DG  I 5 34  ? 130.435 103.477 179.197 1.00 104.32 ? 34   DG  J "O4'" 1 
ATOM   6929  C "C3'" . DG  I 5 34  ? 131.064 103.841 181.447 1.00 104.32 ? 34   DG  J "C3'" 1 
ATOM   6930  O "O3'" . DG  I 5 34  ? 132.028 102.851 181.757 1.00 104.32 ? 34   DG  J "O3'" 1 
ATOM   6931  C "C2'" . DG  I 5 34  ? 131.645 104.946 180.568 1.00 104.32 ? 34   DG  J "C2'" 1 
ATOM   6932  C "C1'" . DG  I 5 34  ? 131.563 104.331 179.186 1.00 104.32 ? 34   DG  J "C1'" 1 
ATOM   6933  N N9    . DG  I 5 34  ? 131.362 105.308 178.121 1.00 104.32 ? 34   DG  J N9    1 
ATOM   6934  C C8    . DG  I 5 34  ? 130.603 106.448 178.179 1.00 104.32 ? 34   DG  J C8    1 
ATOM   6935  N N7    . DG  I 5 34  ? 130.579 107.110 177.058 1.00 104.32 ? 34   DG  J N7    1 
ATOM   6936  C C5    . DG  I 5 34  ? 131.368 106.358 176.205 1.00 104.32 ? 34   DG  J C5    1 
ATOM   6937  C C6    . DG  I 5 34  ? 131.712 106.580 174.859 1.00 104.32 ? 34   DG  J C6    1 
ATOM   6938  O O6    . DG  I 5 34  ? 131.382 107.514 174.130 1.00 104.32 ? 34   DG  J O6    1 
ATOM   6939  N N1    . DG  I 5 34  ? 132.534 105.581 174.364 1.00 104.32 ? 34   DG  J N1    1 
ATOM   6940  C C2    . DG  I 5 34  ? 132.966 104.502 175.075 1.00 104.32 ? 34   DG  J C2    1 
ATOM   6941  N N2    . DG  I 5 34  ? 133.753 103.643 174.418 1.00 104.32 ? 34   DG  J N2    1 
ATOM   6942  N N3    . DG  I 5 34  ? 132.653 104.277 176.342 1.00 104.32 ? 34   DG  J N3    1 
ATOM   6943  C C4    . DG  I 5 34  ? 131.852 105.245 176.840 1.00 104.32 ? 34   DG  J C4    1 
ATOM   6944  P P     . DT  I 5 35  ? 133.291 103.178 182.692 1.00 106.27 ? 35   DT  J P     1 
ATOM   6945  O OP1   . DT  I 5 35  ? 133.567 101.935 183.439 1.00 106.27 ? 35   DT  J OP1   1 
ATOM   6946  O OP2   . DT  I 5 35  ? 133.070 104.431 183.445 1.00 106.27 ? 35   DT  J OP2   1 
ATOM   6947  O "O5'" . DT  I 5 35  ? 134.466 103.430 181.642 1.00 106.27 ? 35   DT  J "O5'" 1 
ATOM   6948  C "C5'" . DT  I 5 35  ? 135.809 103.204 182.017 1.00 106.27 ? 35   DT  J "C5'" 1 
ATOM   6949  C "C4'" . DT  I 5 35  ? 136.563 102.508 180.903 1.00 106.27 ? 35   DT  J "C4'" 1 
ATOM   6950  O "O4'" . DT  I 5 35  ? 136.036 102.924 179.619 1.00 106.27 ? 35   DT  J "O4'" 1 
ATOM   6951  C "C3'" . DT  I 5 35  ? 138.019 102.866 180.811 1.00 106.27 ? 35   DT  J "C3'" 1 
ATOM   6952  O "O3'" . DT  I 5 35  ? 138.642 101.936 179.953 1.00 106.27 ? 35   DT  J "O3'" 1 
ATOM   6953  C "C2'" . DT  I 5 35  ? 137.914 104.233 180.150 1.00 106.27 ? 35   DT  J "C2'" 1 
ATOM   6954  C "C1'" . DT  I 5 35  ? 136.889 103.920 179.062 1.00 106.27 ? 35   DT  J "C1'" 1 
ATOM   6955  N N1    . DT  I 5 35  ? 136.020 105.061 178.657 1.00 106.27 ? 35   DT  J N1    1 
ATOM   6956  C C2    . DT  I 5 35  ? 135.750 105.259 177.327 1.00 106.27 ? 35   DT  J C2    1 
ATOM   6957  O O2    . DT  I 5 35  ? 136.222 104.577 176.440 1.00 106.27 ? 35   DT  J O2    1 
ATOM   6958  N N3    . DT  I 5 35  ? 134.906 106.294 177.066 1.00 106.27 ? 35   DT  J N3    1 
ATOM   6959  C C4    . DT  I 5 35  ? 134.310 107.130 177.983 1.00 106.27 ? 35   DT  J C4    1 
ATOM   6960  O O4    . DT  I 5 35  ? 133.562 108.040 177.651 1.00 106.27 ? 35   DT  J O4    1 
ATOM   6961  C C5    . DT  I 5 35  ? 134.622 106.858 179.357 1.00 106.27 ? 35   DT  J C5    1 
ATOM   6962  C C7    . DT  I 5 35  ? 134.034 107.706 180.442 1.00 106.27 ? 35   DT  J C7    1 
ATOM   6963  C C6    . DT  I 5 35  ? 135.446 105.844 179.626 1.00 106.27 ? 35   DT  J C6    1 
ATOM   6964  P P     . DT  I 5 36  ? 140.185 101.558 180.146 1.00 101.33 ? 36   DT  J P     1 
ATOM   6965  O OP1   . DT  I 5 36  ? 140.366 100.158 179.706 1.00 101.33 ? 36   DT  J OP1   1 
ATOM   6966  O OP2   . DT  I 5 36  ? 140.574 101.970 181.509 1.00 101.33 ? 36   DT  J OP2   1 
ATOM   6967  O "O5'" . DT  I 5 36  ? 140.929 102.513 179.115 1.00 101.33 ? 36   DT  J "O5'" 1 
ATOM   6968  C "C5'" . DT  I 5 36  ? 140.364 102.739 177.834 1.00 101.33 ? 36   DT  J "C5'" 1 
ATOM   6969  C "C4'" . DT  I 5 36  ? 141.308 103.544 176.969 1.00 101.33 ? 36   DT  J "C4'" 1 
ATOM   6970  O "O4'" . DT  I 5 36  ? 140.616 104.700 176.438 1.00 101.33 ? 36   DT  J "O4'" 1 
ATOM   6971  C "C3'" . DT  I 5 36  ? 142.516 104.094 177.697 1.00 101.33 ? 36   DT  J "C3'" 1 
ATOM   6972  O "O3'" . DT  I 5 36  ? 143.575 104.227 176.792 1.00 101.33 ? 36   DT  J "O3'" 1 
ATOM   6973  C "C2'" . DT  I 5 36  ? 142.020 105.455 178.173 1.00 101.33 ? 36   DT  J "C2'" 1 
ATOM   6974  C "C1'" . DT  I 5 36  ? 141.124 105.883 177.017 1.00 101.33 ? 36   DT  J "C1'" 1 
ATOM   6975  N N1    . DT  I 5 36  ? 139.967 106.723 177.430 1.00 101.33 ? 36   DT  J N1    1 
ATOM   6976  C C2    . DT  I 5 36  ? 139.138 107.232 176.467 1.00 101.33 ? 36   DT  J C2    1 
ATOM   6977  O O2    . DT  I 5 36  ? 139.304 107.043 175.278 1.00 101.33 ? 36   DT  J O2    1 
ATOM   6978  N N3    . DT  I 5 36  ? 138.103 107.983 176.942 1.00 101.33 ? 36   DT  J N3    1 
ATOM   6979  C C4    . DT  I 5 36  ? 137.817 108.265 178.258 1.00 101.33 ? 36   DT  J C4    1 
ATOM   6980  O O4    . DT  I 5 36  ? 136.862 108.952 178.587 1.00 101.33 ? 36   DT  J O4    1 
ATOM   6981  C C5    . DT  I 5 36  ? 138.722 107.699 179.218 1.00 101.33 ? 36   DT  J C5    1 
ATOM   6982  C C7    . DT  I 5 36  ? 138.512 107.938 180.678 1.00 101.33 ? 36   DT  J C7    1 
ATOM   6983  C C6    . DT  I 5 36  ? 139.742 106.965 178.765 1.00 101.33 ? 36   DT  J C6    1 
ATOM   6984  P P     . DT  I 5 37  ? 144.959 103.451 177.036 1.00 93.69  ? 37   DT  J P     1 
ATOM   6985  O OP1   . DT  I 5 37  ? 145.287 102.750 175.778 1.00 93.69  ? 37   DT  J OP1   1 
ATOM   6986  O OP2   . DT  I 5 37  ? 144.839 102.717 178.311 1.00 93.69  ? 37   DT  J OP2   1 
ATOM   6987  O "O5'" . DT  I 5 37  ? 146.039 104.607 177.260 1.00 93.69  ? 37   DT  J "O5'" 1 
ATOM   6988  C "C5'" . DT  I 5 37  ? 145.660 105.970 177.155 1.00 93.69  ? 37   DT  J "C5'" 1 
ATOM   6989  C "C4'" . DT  I 5 37  ? 145.647 106.424 175.708 1.00 93.69  ? 37   DT  J "C4'" 1 
ATOM   6990  O "O4'" . DT  I 5 37  ? 144.495 107.263 175.478 1.00 93.69  ? 37   DT  J "O4'" 1 
ATOM   6991  C "C3'" . DT  I 5 37  ? 146.809 107.280 175.303 1.00 93.69  ? 37   DT  J "C3'" 1 
ATOM   6992  O "O3'" . DT  I 5 37  ? 146.879 107.302 173.908 1.00 93.69  ? 37   DT  J "O3'" 1 
ATOM   6993  C "C2'" . DT  I 5 37  ? 146.378 108.627 175.857 1.00 93.69  ? 37   DT  J "C2'" 1 
ATOM   6994  C "C1'" . DT  I 5 37  ? 144.890 108.622 175.519 1.00 93.69  ? 37   DT  J "C1'" 1 
ATOM   6995  N N1    . DT  I 5 37  ? 144.032 109.307 176.517 1.00 93.69  ? 37   DT  J N1    1 
ATOM   6996  C C2    . DT  I 5 37  ? 142.981 110.068 176.081 1.00 93.69  ? 37   DT  J C2    1 
ATOM   6997  O O2    . DT  I 5 37  ? 142.722 110.238 174.908 1.00 93.69  ? 37   DT  J O2    1 
ATOM   6998  N N3    . DT  I 5 37  ? 142.244 110.635 177.067 1.00 93.69  ? 37   DT  J N3    1 
ATOM   6999  C C4    . DT  I 5 37  ? 142.438 110.518 178.418 1.00 93.69  ? 37   DT  J C4    1 
ATOM   7000  O O4    . DT  I 5 37  ? 141.711 111.065 179.228 1.00 93.69  ? 37   DT  J O4    1 
ATOM   7001  C C5    . DT  I 5 37  ? 143.548 109.700 178.813 1.00 93.69  ? 37   DT  J C5    1 
ATOM   7002  C C7    . DT  I 5 37  ? 143.854 109.500 180.262 1.00 93.69  ? 37   DT  J C7    1 
ATOM   7003  C C6    . DT  I 5 37  ? 144.284 109.141 177.856 1.00 93.69  ? 37   DT  J C6    1 
ATOM   7004  P P     . DG  I 5 38  ? 148.260 107.656 173.184 1.00 91.27  ? 38   DG  J P     1 
ATOM   7005  O OP1   . DG  I 5 38  ? 148.330 106.858 171.942 1.00 91.27  ? 38   DG  J OP1   1 
ATOM   7006  O OP2   . DG  I 5 38  ? 149.329 107.563 174.197 1.00 91.27  ? 38   DG  J OP2   1 
ATOM   7007  O "O5'" . DG  I 5 38  ? 148.094 109.192 172.815 1.00 91.27  ? 38   DG  J "O5'" 1 
ATOM   7008  C "C5'" . DG  I 5 38  ? 146.909 109.632 172.202 1.00 91.27  ? 38   DG  J "C5'" 1 
ATOM   7009  C "C4'" . DG  I 5 38  ? 146.697 111.100 172.461 1.00 91.27  ? 38   DG  J "C4'" 1 
ATOM   7010  O "O4'" . DG  I 5 38  ? 146.042 111.284 173.742 1.00 91.27  ? 38   DG  J "O4'" 1 
ATOM   7011  C "C3'" . DG  I 5 38  ? 147.983 111.934 172.529 1.00 91.27  ? 38   DG  J "C3'" 1 
ATOM   7012  O "O3'" . DG  I 5 38  ? 147.811 113.121 171.802 1.00 91.27  ? 38   DG  J "O3'" 1 
ATOM   7013  C "C2'" . DG  I 5 38  ? 148.092 112.244 174.015 1.00 91.27  ? 38   DG  J "C2'" 1 
ATOM   7014  C "C1'" . DG  I 5 38  ? 146.632 112.392 174.341 1.00 91.27  ? 38   DG  J "C1'" 1 
ATOM   7015  N N9    . DG  I 5 38  ? 146.341 112.417 175.757 1.00 91.27  ? 38   DG  J N9    1 
ATOM   7016  C C8    . DG  I 5 38  ? 147.095 111.895 176.769 1.00 91.27  ? 38   DG  J C8    1 
ATOM   7017  N N7    . DG  I 5 38  ? 146.586 112.098 177.949 1.00 91.27  ? 38   DG  J N7    1 
ATOM   7018  C C5    . DG  I 5 38  ? 145.433 112.822 177.697 1.00 91.27  ? 38   DG  J C5    1 
ATOM   7019  C C6    . DG  I 5 38  ? 144.471 113.340 178.589 1.00 91.27  ? 38   DG  J C6    1 
ATOM   7020  O O6    . DG  I 5 38  ? 144.440 113.247 179.817 1.00 91.27  ? 38   DG  J O6    1 
ATOM   7021  N N1    . DG  I 5 38  ? 143.463 114.017 177.923 1.00 91.27  ? 38   DG  J N1    1 
ATOM   7022  C C2    . DG  I 5 38  ? 143.394 114.174 176.563 1.00 91.27  ? 38   DG  J C2    1 
ATOM   7023  N N2    . DG  I 5 38  ? 142.346 114.867 176.099 1.00 91.27  ? 38   DG  J N2    1 
ATOM   7024  N N3    . DG  I 5 38  ? 144.291 113.695 175.716 1.00 91.27  ? 38   DG  J N3    1 
ATOM   7025  C C4    . DG  I 5 38  ? 145.279 113.036 176.354 1.00 91.27  ? 38   DG  J C4    1 
ATOM   7026  P P     . DT  I 5 39  ? 148.470 113.317 170.354 1.00 81.07  ? 39   DT  J P     1 
ATOM   7027  O OP1   . DT  I 5 39  ? 147.951 112.243 169.487 1.00 81.07  ? 39   DT  J OP1   1 
ATOM   7028  O OP2   . DT  I 5 39  ? 149.924 113.522 170.505 1.00 81.07  ? 39   DT  J OP2   1 
ATOM   7029  O "O5'" . DT  I 5 39  ? 147.842 114.692 169.869 1.00 81.07  ? 39   DT  J "O5'" 1 
ATOM   7030  C "C5'" . DT  I 5 39  ? 146.443 114.835 169.865 1.00 81.07  ? 39   DT  J "C5'" 1 
ATOM   7031  C "C4'" . DT  I 5 39  ? 146.015 116.072 170.622 1.00 81.07  ? 39   DT  J "C4'" 1 
ATOM   7032  O "O4'" . DT  I 5 39  ? 146.184 115.876 172.048 1.00 81.07  ? 39   DT  J "O4'" 1 
ATOM   7033  C "C3'" . DT  I 5 39  ? 146.791 117.337 170.284 1.00 81.07  ? 39   DT  J "C3'" 1 
ATOM   7034  O "O3'" . DT  I 5 39  ? 145.897 118.391 170.105 1.00 81.07  ? 39   DT  J "O3'" 1 
ATOM   7035  C "C2'" . DT  I 5 39  ? 147.642 117.550 171.527 1.00 81.07  ? 39   DT  J "C2'" 1 
ATOM   7036  C "C1'" . DT  I 5 39  ? 146.688 117.059 172.586 1.00 81.07  ? 39   DT  J "C1'" 1 
ATOM   7037  N N1    . DT  I 5 39  ? 147.323 116.759 173.882 1.00 81.07  ? 39   DT  J N1    1 
ATOM   7038  C C2    . DT  I 5 39  ? 146.714 117.178 175.030 1.00 81.07  ? 39   DT  J C2    1 
ATOM   7039  O O2    . DT  I 5 39  ? 145.670 117.789 175.039 1.00 81.07  ? 39   DT  J O2    1 
ATOM   7040  N N3    . DT  I 5 39  ? 147.370 116.852 176.178 1.00 81.07  ? 39   DT  J N3    1 
ATOM   7041  C C4    . DT  I 5 39  ? 148.549 116.159 176.286 1.00 81.07  ? 39   DT  J C4    1 
ATOM   7042  O O4    . DT  I 5 39  ? 149.068 115.914 177.366 1.00 81.07  ? 39   DT  J O4    1 
ATOM   7043  C C5    . DT  I 5 39  ? 149.138 115.752 175.042 1.00 81.07  ? 39   DT  J C5    1 
ATOM   7044  C C7    . DT  I 5 39  ? 150.427 114.994 175.035 1.00 81.07  ? 39   DT  J C7    1 
ATOM   7045  C C6    . DT  I 5 39  ? 148.502 116.067 173.911 1.00 81.07  ? 39   DT  J C6    1 
ATOM   7046  P P     . DG  I 5 40  ? 146.349 119.689 169.293 1.00 82.58  ? 40   DG  J P     1 
ATOM   7047  O OP1   . DG  I 5 40  ? 145.269 119.956 168.327 1.00 82.58  ? 40   DG  J OP1   1 
ATOM   7048  O OP2   . DG  I 5 40  ? 147.736 119.496 168.838 1.00 82.58  ? 40   DG  J OP2   1 
ATOM   7049  O "O5'" . DG  I 5 40  ? 146.343 120.833 170.394 1.00 82.58  ? 40   DG  J "O5'" 1 
ATOM   7050  C "C5'" . DG  I 5 40  ? 145.126 121.430 170.750 1.00 82.58  ? 40   DG  J "C5'" 1 
ATOM   7051  C "C4'" . DG  I 5 40  ? 145.033 121.643 172.243 1.00 82.58  ? 40   DG  J "C4'" 1 
ATOM   7052  O "O4'" . DG  I 5 40  ? 145.892 120.712 172.932 1.00 82.58  ? 40   DG  J "O4'" 1 
ATOM   7053  C "C3'" . DG  I 5 40  ? 145.448 123.034 172.725 1.00 82.58  ? 40   DG  J "C3'" 1 
ATOM   7054  O "O3'" . DG  I 5 40  ? 144.381 123.616 173.444 1.00 82.58  ? 40   DG  J "O3'" 1 
ATOM   7055  C "C2'" . DG  I 5 40  ? 146.659 122.765 173.628 1.00 82.58  ? 40   DG  J "C2'" 1 
ATOM   7056  C "C1'" . DG  I 5 40  ? 146.388 121.346 174.074 1.00 82.58  ? 40   DG  J "C1'" 1 
ATOM   7057  N N9    . DG  I 5 40  ? 147.564 120.621 174.532 1.00 82.58  ? 40   DG  J N9    1 
ATOM   7058  C C8    . DG  I 5 40  ? 148.519 120.026 173.758 1.00 82.58  ? 40   DG  J C8    1 
ATOM   7059  N N7    . DG  I 5 40  ? 149.446 119.428 174.443 1.00 82.58  ? 40   DG  J N7    1 
ATOM   7060  C C5    . DG  I 5 40  ? 149.080 119.635 175.760 1.00 82.58  ? 40   DG  J C5    1 
ATOM   7061  C C6    . DG  I 5 40  ? 149.706 119.221 176.955 1.00 82.58  ? 40   DG  J C6    1 
ATOM   7062  O O6    . DG  I 5 40  ? 150.745 118.566 177.089 1.00 82.58  ? 40   DG  J O6    1 
ATOM   7063  N N1    . DG  I 5 40  ? 149.005 119.640 178.075 1.00 82.58  ? 40   DG  J N1    1 
ATOM   7064  C C2    . DG  I 5 40  ? 147.848 120.366 178.043 1.00 82.58  ? 40   DG  J C2    1 
ATOM   7065  N N2    . DG  I 5 40  ? 147.316 120.678 179.228 1.00 82.58  ? 40   DG  J N2    1 
ATOM   7066  N N3    . DG  I 5 40  ? 147.252 120.764 176.932 1.00 82.58  ? 40   DG  J N3    1 
ATOM   7067  C C4    . DG  I 5 40  ? 147.918 120.358 175.832 1.00 82.58  ? 40   DG  J C4    1 
ATOM   7068  P P     . DT  I 5 41  ? 144.360 125.193 173.736 1.00 96.55  ? 41   DT  J P     1 
ATOM   7069  O OP1   . DT  I 5 41  ? 142.943 125.611 173.746 1.00 96.55  ? 41   DT  J OP1   1 
ATOM   7070  O OP2   . DT  I 5 41  ? 145.316 125.841 172.817 1.00 96.55  ? 41   DT  J OP2   1 
ATOM   7071  O "O5'" . DT  I 5 41  ? 144.941 125.310 175.216 1.00 96.55  ? 41   DT  J "O5'" 1 
ATOM   7072  C "C5'" . DT  I 5 41  ? 144.548 124.360 176.200 1.00 96.55  ? 41   DT  J "C5'" 1 
ATOM   7073  C "C4'" . DT  I 5 41  ? 145.008 124.769 177.586 1.00 96.55  ? 41   DT  J "C4'" 1 
ATOM   7074  O "O4'" . DT  I 5 41  ? 146.085 123.904 178.024 1.00 96.55  ? 41   DT  J "O4'" 1 
ATOM   7075  C "C3'" . DT  I 5 41  ? 145.543 126.185 177.704 1.00 96.55  ? 41   DT  J "C3'" 1 
ATOM   7076  O "O3'" . DT  I 5 41  ? 145.206 126.696 178.972 1.00 96.55  ? 41   DT  J "O3'" 1 
ATOM   7077  C "C2'" . DT  I 5 41  ? 147.046 125.972 177.580 1.00 96.55  ? 41   DT  J "C2'" 1 
ATOM   7078  C "C1'" . DT  I 5 41  ? 147.208 124.686 178.361 1.00 96.55  ? 41   DT  J "C1'" 1 
ATOM   7079  N N1    . DT  I 5 41  ? 148.415 123.920 178.010 1.00 96.55  ? 41   DT  J N1    1 
ATOM   7080  C C2    . DT  I 5 41  ? 149.170 123.357 179.008 1.00 96.55  ? 41   DT  J C2    1 
ATOM   7081  O O2    . DT  I 5 41  ? 148.912 123.473 180.190 1.00 96.55  ? 41   DT  J O2    1 
ATOM   7082  N N3    . DT  I 5 41  ? 150.254 122.657 178.574 1.00 96.55  ? 41   DT  J N3    1 
ATOM   7083  C C4    . DT  I 5 41  ? 150.643 122.456 177.268 1.00 96.55  ? 41   DT  J C4    1 
ATOM   7084  O O4    . DT  I 5 41  ? 151.641 121.812 176.975 1.00 96.55  ? 41   DT  J O4    1 
ATOM   7085  C C5    . DT  I 5 41  ? 149.809 123.072 176.274 1.00 96.55  ? 41   DT  J C5    1 
ATOM   7086  C C7    . DT  I 5 41  ? 150.143 122.931 174.825 1.00 96.55  ? 41   DT  J C7    1 
ATOM   7087  C C6    . DT  I 5 41  ? 148.743 123.762 176.687 1.00 96.55  ? 41   DT  J C6    1 
ATOM   7088  P P     . DC  I 5 42  ? 145.191 128.277 179.232 1.00 112.38 ? 42   DC  J P     1 
ATOM   7089  O OP1   . DC  I 5 42  ? 143.851 128.612 179.754 1.00 112.38 ? 42   DC  J OP1   1 
ATOM   7090  O OP2   . DC  I 5 42  ? 145.707 128.960 178.029 1.00 112.38 ? 42   DC  J OP2   1 
ATOM   7091  O "O5'" . DC  I 5 42  ? 146.259 128.474 180.397 1.00 112.38 ? 42   DC  J "O5'" 1 
ATOM   7092  C "C5'" . DC  I 5 42  ? 146.060 127.840 181.643 1.00 112.38 ? 42   DC  J "C5'" 1 
ATOM   7093  C "C4'" . DC  I 5 42  ? 147.351 127.794 182.426 1.00 112.38 ? 42   DC  J "C4'" 1 
ATOM   7094  O "O4'" . DC  I 5 42  ? 148.236 126.817 181.834 1.00 112.38 ? 42   DC  J "O4'" 1 
ATOM   7095  C "C3'" . DC  I 5 42  ? 148.119 129.114 182.462 1.00 112.38 ? 42   DC  J "C3'" 1 
ATOM   7096  O "O3'" . DC  I 5 42  ? 148.311 129.521 183.816 1.00 112.38 ? 42   DC  J "O3'" 1 
ATOM   7097  C "C2'" . DC  I 5 42  ? 149.442 128.804 181.753 1.00 112.38 ? 42   DC  J "C2'" 1 
ATOM   7098  C "C1'" . DC  I 5 42  ? 149.550 127.298 181.867 1.00 112.38 ? 42   DC  J "C1'" 1 
ATOM   7099  N N1    . DC  I 5 42  ? 150.285 126.700 180.738 1.00 112.38 ? 42   DC  J N1    1 
ATOM   7100  C C2    . DC  I 5 42  ? 151.385 125.890 180.978 1.00 112.38 ? 42   DC  J C2    1 
ATOM   7101  O O2    . DC  I 5 42  ? 151.729 125.675 182.143 1.00 112.38 ? 42   DC  J O2    1 
ATOM   7102  N N3    . DC  I 5 42  ? 152.047 125.357 179.926 1.00 112.38 ? 42   DC  J N3    1 
ATOM   7103  C C4    . DC  I 5 42  ? 151.643 125.616 178.690 1.00 112.38 ? 42   DC  J C4    1 
ATOM   7104  N N4    . DC  I 5 42  ? 152.326 125.076 177.684 1.00 112.38 ? 42   DC  J N4    1 
ATOM   7105  C C5    . DC  I 5 42  ? 150.526 126.447 178.427 1.00 112.38 ? 42   DC  J C5    1 
ATOM   7106  C C6    . DC  I 5 42  ? 149.883 126.958 179.473 1.00 112.38 ? 42   DC  J C6    1 
ATOM   7107  P P     . DT  I 5 43  ? 149.164 130.836 184.180 1.00 118.08 ? 43   DT  J P     1 
ATOM   7108  O OP1   . DT  I 5 43  ? 148.647 131.304 185.480 1.00 118.08 ? 43   DT  J OP1   1 
ATOM   7109  O OP2   . DT  I 5 43  ? 149.188 131.774 183.036 1.00 118.08 ? 43   DT  J OP2   1 
ATOM   7110  O "O5'" . DT  I 5 43  ? 150.628 130.262 184.445 1.00 118.08 ? 43   DT  J "O5'" 1 
ATOM   7111  C "C5'" . DT  I 5 43  ? 150.762 129.083 185.214 1.00 118.08 ? 43   DT  J "C5'" 1 
ATOM   7112  C "C4'" . DT  I 5 43  ? 152.175 128.543 185.168 1.00 118.08 ? 43   DT  J "C4'" 1 
ATOM   7113  O "O4'" . DT  I 5 43  ? 152.472 127.980 183.862 1.00 118.08 ? 43   DT  J "O4'" 1 
ATOM   7114  C "C3'" . DT  I 5 43  ? 153.272 129.564 185.446 1.00 118.08 ? 43   DT  J "C3'" 1 
ATOM   7115  O "O3'" . DT  I 5 43  ? 154.195 128.985 186.336 1.00 118.08 ? 43   DT  J "O3'" 1 
ATOM   7116  C "C2'" . DT  I 5 43  ? 153.894 129.781 184.062 1.00 118.08 ? 43   DT  J "C2'" 1 
ATOM   7117  C "C1'" . DT  I 5 43  ? 153.767 128.384 183.493 1.00 118.08 ? 43   DT  J "C1'" 1 
ATOM   7118  N N1    . DT  I 5 43  ? 153.883 128.288 182.014 1.00 118.08 ? 43   DT  J N1    1 
ATOM   7119  C C2    . DT  I 5 43  ? 154.855 127.487 181.465 1.00 118.08 ? 43   DT  J C2    1 
ATOM   7120  O O2    . DT  I 5 43  ? 155.646 126.850 182.126 1.00 118.08 ? 43   DT  J O2    1 
ATOM   7121  N N3    . DT  I 5 43  ? 154.866 127.457 180.102 1.00 118.08 ? 43   DT  J N3    1 
ATOM   7122  C C4    . DT  I 5 43  ? 154.026 128.132 179.251 1.00 118.08 ? 43   DT  J C4    1 
ATOM   7123  O O4    . DT  I 5 43  ? 154.113 128.043 178.038 1.00 118.08 ? 43   DT  J O4    1 
ATOM   7124  C C5    . DT  I 5 43  ? 153.031 128.950 179.885 1.00 118.08 ? 43   DT  J C5    1 
ATOM   7125  C C7    . DT  I 5 43  ? 152.065 129.730 179.050 1.00 118.08 ? 43   DT  J C7    1 
ATOM   7126  C C6    . DT  I 5 43  ? 153.005 128.988 181.223 1.00 118.08 ? 43   DT  J C6    1 
ATOM   7127  P P     . DG  I 5 44  ? 155.119 129.898 187.272 1.00 122.89 ? 44   DG  J P     1 
ATOM   7128  O OP1   . DG  I 5 44  ? 154.879 129.487 188.670 1.00 122.89 ? 44   DG  J OP1   1 
ATOM   7129  O OP2   . DG  I 5 44  ? 154.935 131.304 186.856 1.00 122.89 ? 44   DG  J OP2   1 
ATOM   7130  O "O5'" . DG  I 5 44  ? 156.593 129.452 186.873 1.00 122.89 ? 44   DG  J "O5'" 1 
ATOM   7131  C "C5'" . DG  I 5 44  ? 156.777 128.399 185.947 1.00 122.89 ? 44   DG  J "C5'" 1 
ATOM   7132  C "C4'" . DG  I 5 44  ? 158.045 128.608 185.159 1.00 122.89 ? 44   DG  J "C4'" 1 
ATOM   7133  O "O4'" . DG  I 5 44  ? 157.765 128.484 183.738 1.00 122.89 ? 44   DG  J "O4'" 1 
ATOM   7134  C "C3'" . DG  I 5 44  ? 158.664 129.993 185.314 1.00 122.89 ? 44   DG  J "C3'" 1 
ATOM   7135  O "O3'" . DG  I 5 44  ? 160.050 129.887 185.114 1.00 122.89 ? 44   DG  J "O3'" 1 
ATOM   7136  C "C2'" . DG  I 5 44  ? 158.020 130.724 184.158 1.00 122.89 ? 44   DG  J "C2'" 1 
ATOM   7137  C "C1'" . DG  I 5 44  ? 158.218 129.657 183.114 1.00 122.89 ? 44   DG  J "C1'" 1 
ATOM   7138  N N9    . DG  I 5 44  ? 157.497 129.858 181.873 1.00 122.89 ? 44   DG  J N9    1 
ATOM   7139  C C8    . DG  I 5 44  ? 156.324 130.537 181.680 1.00 122.89 ? 44   DG  J C8    1 
ATOM   7140  N N7    . DG  I 5 44  ? 155.932 130.538 180.437 1.00 122.89 ? 44   DG  J N7    1 
ATOM   7141  C C5    . DG  I 5 44  ? 156.914 129.817 179.776 1.00 122.89 ? 44   DG  J C5    1 
ATOM   7142  C C6    . DG  I 5 44  ? 157.035 129.479 178.415 1.00 122.89 ? 44   DG  J C6    1 
ATOM   7143  O O6    . DG  I 5 44  ? 156.278 129.766 177.491 1.00 122.89 ? 44   DG  J O6    1 
ATOM   7144  N N1    . DG  I 5 44  ? 158.179 128.735 178.167 1.00 122.89 ? 44   DG  J N1    1 
ATOM   7145  C C2    . DG  I 5 44  ? 159.089 128.364 179.118 1.00 122.89 ? 44   DG  J C2    1 
ATOM   7146  N N2    . DG  I 5 44  ? 160.138 127.644 178.702 1.00 122.89 ? 44   DG  J N2    1 
ATOM   7147  N N3    . DG  I 5 44  ? 158.984 128.673 180.398 1.00 122.89 ? 44   DG  J N3    1 
ATOM   7148  C C4    . DG  I 5 44  ? 157.876 129.396 180.650 1.00 122.89 ? 44   DG  J C4    1 
ATOM   7149  P P     . DT  I 5 45  ? 161.058 130.912 185.822 1.00 115.59 ? 45   DT  J P     1 
ATOM   7150  O OP1   . DT  I 5 45  ? 161.466 130.300 187.103 1.00 115.59 ? 45   DT  J OP1   1 
ATOM   7151  O OP2   . DT  I 5 45  ? 160.446 132.258 185.804 1.00 115.59 ? 45   DT  J OP2   1 
ATOM   7152  O "O5'" . DT  I 5 45  ? 162.315 130.914 184.843 1.00 115.59 ? 45   DT  J "O5'" 1 
ATOM   7153  C "C5'" . DT  I 5 45  ? 162.830 129.686 184.375 1.00 115.59 ? 45   DT  J "C5'" 1 
ATOM   7154  C "C4'" . DT  I 5 45  ? 163.644 129.886 183.112 1.00 115.59 ? 45   DT  J "C4'" 1 
ATOM   7155  O "O4'" . DT  I 5 45  ? 162.771 129.903 181.955 1.00 115.59 ? 45   DT  J "O4'" 1 
ATOM   7156  C "C3'" . DT  I 5 45  ? 164.459 131.174 183.054 1.00 115.59 ? 45   DT  J "C3'" 1 
ATOM   7157  O "O3'" . DT  I 5 45  ? 165.754 130.872 182.579 1.00 115.59 ? 45   DT  J "O3'" 1 
ATOM   7158  C "C2'" . DT  I 5 45  ? 163.680 132.043 182.063 1.00 115.59 ? 45   DT  J "C2'" 1 
ATOM   7159  C "C1'" . DT  I 5 45  ? 163.090 131.001 181.133 1.00 115.59 ? 45   DT  J "C1'" 1 
ATOM   7160  N N1    . DT  I 5 45  ? 161.836 131.439 180.466 1.00 115.59 ? 45   DT  J N1    1 
ATOM   7161  C C2    . DT  I 5 45  ? 161.661 131.203 179.125 1.00 115.59 ? 45   DT  J C2    1 
ATOM   7162  O O2    . DT  I 5 45  ? 162.492 130.654 178.430 1.00 115.59 ? 45   DT  J O2    1 
ATOM   7163  N N3    . DT  I 5 45  ? 160.469 131.641 178.624 1.00 115.59 ? 45   DT  J N3    1 
ATOM   7164  C C4    . DT  I 5 45  ? 159.460 132.270 179.313 1.00 115.59 ? 45   DT  J C4    1 
ATOM   7165  O O4    . DT  I 5 45  ? 158.421 132.628 178.778 1.00 115.59 ? 45   DT  J O4    1 
ATOM   7166  C C5    . DT  I 5 45  ? 159.707 132.482 180.705 1.00 115.59 ? 45   DT  J C5    1 
ATOM   7167  C C7    . DT  I 5 45  ? 158.676 133.163 181.546 1.00 115.59 ? 45   DT  J C7    1 
ATOM   7168  C C6    . DT  I 5 45  ? 160.868 132.061 181.211 1.00 115.59 ? 45   DT  J C6    1 
ATOM   7169  P P     . DT  I 5 46  ? 166.907 131.988 182.552 1.00 113.14 ? 46   DT  J P     1 
ATOM   7170  O OP1   . DT  I 5 46  ? 168.165 131.323 182.960 1.00 113.14 ? 46   DT  J OP1   1 
ATOM   7171  O OP2   . DT  I 5 46  ? 166.448 133.189 183.286 1.00 113.14 ? 46   DT  J OP2   1 
ATOM   7172  O "O5'" . DT  I 5 46  ? 167.027 132.350 181.004 1.00 113.14 ? 46   DT  J "O5'" 1 
ATOM   7173  C "C5'" . DT  I 5 46  ? 167.602 131.412 180.089 1.00 113.14 ? 46   DT  J "C5'" 1 
ATOM   7174  C "C4'" . DT  I 5 46  ? 167.496 131.885 178.640 1.00 113.14 ? 46   DT  J "C4'" 1 
ATOM   7175  O "O4'" . DT  I 5 46  ? 166.105 132.119 178.285 1.00 113.14 ? 46   DT  J "O4'" 1 
ATOM   7176  C "C3'" . DT  I 5 46  ? 168.217 133.192 178.306 1.00 113.14 ? 46   DT  J "C3'" 1 
ATOM   7177  O "O3'" . DT  I 5 46  ? 168.637 133.148 176.966 1.00 113.14 ? 46   DT  J "O3'" 1 
ATOM   7178  C "C2'" . DT  I 5 46  ? 167.088 134.195 178.443 1.00 113.14 ? 46   DT  J "C2'" 1 
ATOM   7179  C "C1'" . DT  I 5 46  ? 166.002 133.417 177.742 1.00 113.14 ? 46   DT  J "C1'" 1 
ATOM   7180  N N1    . DT  I 5 46  ? 164.626 133.929 177.956 1.00 113.14 ? 46   DT  J N1    1 
ATOM   7181  C C2    . DT  I 5 46  ? 163.746 133.906 176.906 1.00 113.14 ? 46   DT  J C2    1 
ATOM   7182  O O2    . DT  I 5 46  ? 164.039 133.491 175.802 1.00 113.14 ? 46   DT  J O2    1 
ATOM   7183  N N3    . DT  I 5 46  ? 162.502 134.383 177.190 1.00 113.14 ? 46   DT  J N3    1 
ATOM   7184  C C4    . DT  I 5 46  ? 162.056 134.869 178.396 1.00 113.14 ? 46   DT  J C4    1 
ATOM   7185  O O4    . DT  I 5 46  ? 160.915 135.277 178.554 1.00 113.14 ? 46   DT  J O4    1 
ATOM   7186  C C5    . DT  I 5 46  ? 163.025 134.869 179.459 1.00 113.14 ? 46   DT  J C5    1 
ATOM   7187  C C7    . DT  I 5 46  ? 162.648 135.382 180.813 1.00 113.14 ? 46   DT  J C7    1 
ATOM   7188  C C6    . DT  I 5 46  ? 164.254 134.406 179.192 1.00 113.14 ? 46   DT  J C6    1 
ATOM   7189  P P     . DC  I 5 47  ? 170.183 132.988 176.579 1.00 101.81 ? 47   DC  J P     1 
ATOM   7190  O OP1   . DC  I 5 47  ? 170.613 131.656 177.050 1.00 101.81 ? 47   DC  J OP1   1 
ATOM   7191  O OP2   . DC  I 5 47  ? 170.900 134.209 177.007 1.00 101.81 ? 47   DC  J OP2   1 
ATOM   7192  O "O5'" . DC  I 5 47  ? 170.147 132.987 174.984 1.00 101.81 ? 47   DC  J "O5'" 1 
ATOM   7193  C "C5'" . DC  I 5 47  ? 168.913 132.735 174.316 1.00 101.81 ? 47   DC  J "C5'" 1 
ATOM   7194  C "C4'" . DC  I 5 47  ? 168.634 133.779 173.246 1.00 101.81 ? 47   DC  J "C4'" 1 
ATOM   7195  O "O4'" . DC  I 5 47  ? 167.443 134.533 173.587 1.00 101.81 ? 47   DC  J "O4'" 1 
ATOM   7196  C "C3'" . DC  I 5 47  ? 169.733 134.814 173.037 1.00 101.81 ? 47   DC  J "C3'" 1 
ATOM   7197  O "O3'" . DC  I 5 47  ? 169.743 135.232 171.680 1.00 101.81 ? 47   DC  J "O3'" 1 
ATOM   7198  C "C2'" . DC  I 5 47  ? 169.256 135.948 173.938 1.00 101.81 ? 47   DC  J "C2'" 1 
ATOM   7199  C "C1'" . DC  I 5 47  ? 167.761 135.900 173.666 1.00 101.81 ? 47   DC  J "C1'" 1 
ATOM   7200  N N1    . DC  I 5 47  ? 166.928 136.497 174.724 1.00 101.81 ? 47   DC  J N1    1 
ATOM   7201  C C2    . DC  I 5 47  ? 165.593 136.795 174.458 1.00 101.81 ? 47   DC  J C2    1 
ATOM   7202  O O2    . DC  I 5 47  ? 165.142 136.563 173.336 1.00 101.81 ? 47   DC  J O2    1 
ATOM   7203  N N3    . DC  I 5 47  ? 164.837 137.337 175.441 1.00 101.81 ? 47   DC  J N3    1 
ATOM   7204  C C4    . DC  I 5 47  ? 165.368 137.571 176.635 1.00 101.81 ? 47   DC  J C4    1 
ATOM   7205  N N4    . DC  I 5 47  ? 164.594 138.104 177.577 1.00 101.81 ? 47   DC  J N4    1 
ATOM   7206  C C5    . DC  I 5 47  ? 166.722 137.279 176.918 1.00 101.81 ? 47   DC  J C5    1 
ATOM   7207  C C6    . DC  I 5 47  ? 167.458 136.741 175.947 1.00 101.81 ? 47   DC  J C6    1 
ATOM   7208  P P     . DG  I 5 48  ? 170.527 134.418 170.535 1.00 97.91  ? 48   DG  J P     1 
ATOM   7209  O OP1   . DG  I 5 48  ? 170.656 132.987 170.874 1.00 97.91  ? 48   DG  J OP1   1 
ATOM   7210  O OP2   . DG  I 5 48  ? 171.739 135.197 170.215 1.00 97.91  ? 48   DG  J OP2   1 
ATOM   7211  O "O5'" . DG  I 5 48  ? 169.538 134.530 169.291 1.00 97.91  ? 48   DG  J "O5'" 1 
ATOM   7212  C "C5'" . DG  I 5 48  ? 168.150 134.614 169.538 1.00 97.91  ? 48   DG  J "C5'" 1 
ATOM   7213  C "C4'" . DG  I 5 48  ? 167.401 135.192 168.356 1.00 97.91  ? 48   DG  J "C4'" 1 
ATOM   7214  O "O4'" . DG  I 5 48  ? 166.510 136.226 168.812 1.00 97.91  ? 48   DG  J "O4'" 1 
ATOM   7215  C "C3'" . DG  I 5 48  ? 168.239 135.864 167.297 1.00 97.91  ? 48   DG  J "C3'" 1 
ATOM   7216  O "O3'" . DG  I 5 48  ? 167.501 135.827 166.060 1.00 97.91  ? 48   DG  J "O3'" 1 
ATOM   7217  C "C2'" . DG  I 5 48  ? 168.412 137.276 167.867 1.00 97.91  ? 48   DG  J "C2'" 1 
ATOM   7218  C "C1'" . DG  I 5 48  ? 167.128 137.490 168.658 1.00 97.91  ? 48   DG  J "C1'" 1 
ATOM   7219  N N9    . DG  I 5 48  ? 167.346 138.038 169.984 1.00 97.91  ? 48   DG  J N9    1 
ATOM   7220  C C8    . DG  I 5 48  ? 168.512 138.034 170.697 1.00 97.91  ? 48   DG  J C8    1 
ATOM   7221  N N7    . DG  I 5 48  ? 168.401 138.591 171.866 1.00 97.91  ? 48   DG  J N7    1 
ATOM   7222  C C5    . DG  I 5 48  ? 167.073 138.980 171.933 1.00 97.91  ? 48   DG  J C5    1 
ATOM   7223  C C6    . DG  I 5 48  ? 166.368 139.636 172.963 1.00 97.91  ? 48   DG  J C6    1 
ATOM   7224  O O6    . DG  I 5 48  ? 166.790 140.008 174.061 1.00 97.91  ? 48   DG  J O6    1 
ATOM   7225  N N1    . DG  I 5 48  ? 165.038 139.847 172.624 1.00 97.91  ? 48   DG  J N1    1 
ATOM   7226  C C2    . DG  I 5 48  ? 164.467 139.475 171.437 1.00 97.91  ? 48   DG  J C2    1 
ATOM   7227  N N2    . DG  I 5 48  ? 163.168 139.761 171.278 1.00 97.91  ? 48   DG  J N2    1 
ATOM   7228  N N3    . DG  I 5 48  ? 165.120 138.862 170.465 1.00 97.91  ? 48   DG  J N3    1 
ATOM   7229  C C4    . DG  I 5 48  ? 166.413 138.648 170.782 1.00 97.91  ? 48   DG  J C4    1 
ATOM   7230  P P     . DC  I 5 49  ? 167.740 136.855 164.844 1.00 92.73  ? 49   DC  J P     1 
ATOM   7231  O OP1   . DC  I 5 49  ? 167.209 136.153 163.659 1.00 92.73  ? 49   DC  J OP1   1 
ATOM   7232  O OP2   . DC  I 5 49  ? 169.122 137.382 164.772 1.00 92.73  ? 49   DC  J OP2   1 
ATOM   7233  O "O5'" . DC  I 5 49  ? 166.710 138.025 165.155 1.00 92.73  ? 49   DC  J "O5'" 1 
ATOM   7234  C "C5'" . DC  I 5 49  ? 165.358 137.699 165.447 1.00 92.73  ? 49   DC  J "C5'" 1 
ATOM   7235  C "C4'" . DC  I 5 49  ? 164.532 138.938 165.743 1.00 92.73  ? 49   DC  J "C4'" 1 
ATOM   7236  O "O4'" . DC  I 5 49  ? 164.857 139.475 167.054 1.00 92.73  ? 49   DC  J "O4'" 1 
ATOM   7237  C "C3'" . DC  I 5 49  ? 164.706 140.088 164.766 1.00 92.73  ? 49   DC  J "C3'" 1 
ATOM   7238  O "O3'" . DC  I 5 49  ? 163.461 140.678 164.563 1.00 92.73  ? 49   DC  J "O3'" 1 
ATOM   7239  C "C2'" . DC  I 5 49  ? 165.636 141.026 165.528 1.00 92.73  ? 49   DC  J "C2'" 1 
ATOM   7240  C "C1'" . DC  I 5 49  ? 165.119 140.854 166.940 1.00 92.73  ? 49   DC  J "C1'" 1 
ATOM   7241  N N1    . DC  I 5 49  ? 166.099 141.200 167.984 1.00 92.73  ? 49   DC  J N1    1 
ATOM   7242  C C2    . DC  I 5 49  ? 165.674 141.829 169.153 1.00 92.73  ? 49   DC  J C2    1 
ATOM   7243  O O2    . DC  I 5 49  ? 164.485 142.099 169.289 1.00 92.73  ? 49   DC  J O2    1 
ATOM   7244  N N3    . DC  I 5 49  ? 166.587 142.126 170.103 1.00 92.73  ? 49   DC  J N3    1 
ATOM   7245  C C4    . DC  I 5 49  ? 167.865 141.814 169.914 1.00 92.73  ? 49   DC  J C4    1 
ATOM   7246  N N4    . DC  I 5 49  ? 168.737 142.123 170.874 1.00 92.73  ? 49   DC  J N4    1 
ATOM   7247  C C5    . DC  I 5 49  ? 168.313 141.169 168.730 1.00 92.73  ? 49   DC  J C5    1 
ATOM   7248  C C6    . DC  I 5 49  ? 167.404 140.888 167.801 1.00 92.73  ? 49   DC  J C6    1 
ATOM   7249  P P     . DC  I 5 50  ? 163.132 141.482 163.221 1.00 81.61  ? 50   DC  J P     1 
ATOM   7250  O OP1   . DC  I 5 50  ? 162.465 140.541 162.308 1.00 81.61  ? 50   DC  J OP1   1 
ATOM   7251  O OP2   . DC  I 5 50  ? 164.322 142.221 162.763 1.00 81.61  ? 50   DC  J OP2   1 
ATOM   7252  O "O5'" . DC  I 5 50  ? 162.084 142.559 163.726 1.00 81.61  ? 50   DC  J "O5'" 1 
ATOM   7253  C "C5'" . DC  I 5 50  ? 161.259 142.253 164.841 1.00 81.61  ? 50   DC  J "C5'" 1 
ATOM   7254  C "C4'" . DC  I 5 50  ? 160.905 143.503 165.614 1.00 81.61  ? 50   DC  J "C4'" 1 
ATOM   7255  O "O4'" . DC  I 5 50  ? 161.857 143.703 166.690 1.00 81.61  ? 50   DC  J "O4'" 1 
ATOM   7256  C "C3'" . DC  I 5 50  ? 160.901 144.780 164.797 1.00 81.61  ? 50   DC  J "C3'" 1 
ATOM   7257  O "O3'" . DC  I 5 50  ? 159.788 145.566 165.140 1.00 81.61  ? 50   DC  J "O3'" 1 
ATOM   7258  C "C2'" . DC  I 5 50  ? 162.206 145.449 165.194 1.00 81.61  ? 50   DC  J "C2'" 1 
ATOM   7259  C "C1'" . DC  I 5 50  ? 162.379 145.006 166.633 1.00 81.61  ? 50   DC  J "C1'" 1 
ATOM   7260  N N1    . DC  I 5 50  ? 163.814 144.960 167.047 1.00 81.61  ? 50   DC  J N1    1 
ATOM   7261  C C2    . DC  I 5 50  ? 164.218 145.472 168.282 1.00 81.61  ? 50   DC  J C2    1 
ATOM   7262  O O2    . DC  I 5 50  ? 163.382 145.966 169.033 1.00 81.61  ? 50   DC  J O2    1 
ATOM   7263  N N3    . DC  I 5 50  ? 165.528 145.411 168.615 1.00 81.61  ? 50   DC  J N3    1 
ATOM   7264  C C4    . DC  I 5 50  ? 166.404 144.872 167.777 1.00 81.61  ? 50   DC  J C4    1 
ATOM   7265  N N4    . DC  I 5 50  ? 167.687 144.827 168.139 1.00 81.61  ? 50   DC  J N4    1 
ATOM   7266  C C5    . DC  I 5 50  ? 166.012 144.354 166.524 1.00 81.61  ? 50   DC  J C5    1 
ATOM   7267  C C6    . DC  I 5 50  ? 164.723 144.416 166.203 1.00 81.61  ? 50   DC  J C6    1 
ATOM   7268  P P     . DA  I 5 51  ? 159.368 146.818 164.231 1.00 91.22  ? 51   DA  J P     1 
ATOM   7269  O OP1   . DA  I 5 51  ? 157.926 146.696 163.979 1.00 91.22  ? 51   DA  J OP1   1 
ATOM   7270  O OP2   . DA  I 5 51  ? 160.275 146.943 163.081 1.00 91.22  ? 51   DA  J OP2   1 
ATOM   7271  O "O5'" . DA  I 5 51  ? 159.595 148.066 165.190 1.00 91.22  ? 51   DA  J "O5'" 1 
ATOM   7272  C "C5'" . DA  I 5 51  ? 158.761 148.227 166.321 1.00 91.22  ? 51   DA  J "C5'" 1 
ATOM   7273  C "C4'" . DA  I 5 51  ? 159.451 149.037 167.401 1.00 91.22  ? 51   DA  J "C4'" 1 
ATOM   7274  O "O4'" . DA  I 5 51  ? 160.760 148.492 167.653 1.00 91.22  ? 51   DA  J "O4'" 1 
ATOM   7275  C "C3'" . DA  I 5 51  ? 159.657 150.512 167.070 1.00 91.22  ? 51   DA  J "C3'" 1 
ATOM   7276  O "O3'" . DA  I 5 51  ? 159.086 151.299 168.086 1.00 91.22  ? 51   DA  J "O3'" 1 
ATOM   7277  C "C2'" . DA  I 5 51  ? 161.176 150.671 167.019 1.00 91.22  ? 51   DA  J "C2'" 1 
ATOM   7278  C "C1'" . DA  I 5 51  ? 161.640 149.541 167.909 1.00 91.22  ? 51   DA  J "C1'" 1 
ATOM   7279  N N9    . DA  I 5 51  ? 162.987 149.087 167.616 1.00 91.22  ? 51   DA  J N9    1 
ATOM   7280  C C8    . DA  I 5 51  ? 163.390 148.347 166.552 1.00 91.22  ? 51   DA  J C8    1 
ATOM   7281  N N7    . DA  I 5 51  ? 164.669 148.080 166.541 1.00 91.22  ? 51   DA  J N7    1 
ATOM   7282  C C5    . DA  I 5 51  ? 165.128 148.673 167.692 1.00 91.22  ? 51   DA  J C5    1 
ATOM   7283  C C6    . DA  I 5 51  ? 166.400 148.750 168.271 1.00 91.22  ? 51   DA  J C6    1 
ATOM   7284  N N6    . DA  I 5 51  ? 167.485 148.192 167.732 1.00 91.22  ? 51   DA  J N6    1 
ATOM   7285  N N1    . DA  I 5 51  ? 166.518 149.426 169.430 1.00 91.22  ? 51   DA  J N1    1 
ATOM   7286  C C2    . DA  I 5 51  ? 165.430 149.977 169.972 1.00 91.22  ? 51   DA  J C2    1 
ATOM   7287  N N3    . DA  I 5 51  ? 164.185 149.973 169.516 1.00 91.22  ? 51   DA  J N3    1 
ATOM   7288  C C4    . DA  I 5 51  ? 164.103 149.297 168.366 1.00 91.22  ? 51   DA  J C4    1 
ATOM   7289  P P     . DT  I 5 52  ? 158.834 152.867 167.861 1.00 104.57 ? 52   DT  J P     1 
ATOM   7290  O OP1   . DT  I 5 52  ? 157.722 153.246 168.756 1.00 104.57 ? 52   DT  J OP1   1 
ATOM   7291  O OP2   . DT  I 5 52  ? 158.720 153.119 166.411 1.00 104.57 ? 52   DT  J OP2   1 
ATOM   7292  O "O5'" . DT  I 5 52  ? 160.179 153.538 168.400 1.00 104.57 ? 52   DT  J "O5'" 1 
ATOM   7293  C "C5'" . DT  I 5 52  ? 160.651 153.208 169.702 1.00 104.57 ? 52   DT  J "C5'" 1 
ATOM   7294  C "C4'" . DT  I 5 52  ? 161.984 153.871 169.990 1.00 104.57 ? 52   DT  J "C4'" 1 
ATOM   7295  O "O4'" . DT  I 5 52  ? 163.067 153.023 169.544 1.00 104.57 ? 52   DT  J "O4'" 1 
ATOM   7296  C "C3'" . DT  I 5 52  ? 162.194 155.222 169.312 1.00 104.57 ? 52   DT  J "C3'" 1 
ATOM   7297  O "O3'" . DT  I 5 52  ? 162.535 156.185 170.282 1.00 104.57 ? 52   DT  J "O3'" 1 
ATOM   7298  C "C2'" . DT  I 5 52  ? 163.350 154.969 168.344 1.00 104.57 ? 52   DT  J "C2'" 1 
ATOM   7299  C "C1'" . DT  I 5 52  ? 164.083 153.838 169.033 1.00 104.57 ? 52   DT  J "C1'" 1 
ATOM   7300  N N1    . DT  I 5 52  ? 164.905 153.032 168.112 1.00 104.57 ? 52   DT  J N1    1 
ATOM   7301  C C2    . DT  I 5 52  ? 166.243 152.836 168.378 1.00 104.57 ? 52   DT  J C2    1 
ATOM   7302  O O2    . DT  I 5 52  ? 166.812 153.308 169.343 1.00 104.57 ? 52   DT  J O2    1 
ATOM   7303  N N3    . DT  I 5 52  ? 166.896 152.079 167.449 1.00 104.57 ? 52   DT  J N3    1 
ATOM   7304  C C4    . DT  I 5 52  ? 166.358 151.505 166.318 1.00 104.57 ? 52   DT  J C4    1 
ATOM   7305  O O4    . DT  I 5 52  ? 167.019 150.834 165.541 1.00 104.57 ? 52   DT  J O4    1 
ATOM   7306  C C5    . DT  I 5 52  ? 164.960 151.743 166.110 1.00 104.57 ? 52   DT  J C5    1 
ATOM   7307  C C7    . DT  I 5 52  ? 164.276 151.171 164.908 1.00 104.57 ? 52   DT  J C7    1 
ATOM   7308  C C6    . DT  I 5 52  ? 164.308 152.487 167.005 1.00 104.57 ? 52   DT  J C6    1 
ATOM   7309  P P     . DC  I 5 53  ? 161.971 157.681 170.164 1.00 117.52 ? 53   DC  J P     1 
ATOM   7310  O OP1   . DC  I 5 53  ? 161.171 157.975 171.371 1.00 117.52 ? 53   DC  J OP1   1 
ATOM   7311  O OP2   . DC  I 5 53  ? 161.360 157.817 168.827 1.00 117.52 ? 53   DC  J OP2   1 
ATOM   7312  O "O5'" . DC  I 5 53  ? 163.288 158.576 170.162 1.00 117.52 ? 53   DC  J "O5'" 1 
ATOM   7313  C "C5'" . DC  I 5 53  ? 164.124 158.577 169.028 1.00 117.52 ? 53   DC  J "C5'" 1 
ATOM   7314  C "C4'" . DC  I 5 53  ? 165.575 158.507 169.442 1.00 117.52 ? 53   DC  J "C4'" 1 
ATOM   7315  O "O4'" . DC  I 5 53  ? 166.041 157.146 169.327 1.00 117.52 ? 53   DC  J "O4'" 1 
ATOM   7316  C "C3'" . DC  I 5 53  ? 166.516 159.308 168.572 1.00 117.52 ? 53   DC  J "C3'" 1 
ATOM   7317  O "O3'" . DC  I 5 53  ? 166.585 160.645 169.046 1.00 117.52 ? 53   DC  J "O3'" 1 
ATOM   7318  C "C2'" . DC  I 5 53  ? 167.837 158.586 168.783 1.00 117.52 ? 53   DC  J "C2'" 1 
ATOM   7319  C "C1'" . DC  I 5 53  ? 167.417 157.141 168.990 1.00 117.52 ? 53   DC  J "C1'" 1 
ATOM   7320  N N1    . DC  I 5 53  ? 167.617 156.252 167.806 1.00 117.52 ? 53   DC  J N1    1 
ATOM   7321  C C2    . DC  I 5 53  ? 168.893 155.765 167.498 1.00 117.52 ? 53   DC  J C2    1 
ATOM   7322  O O2    . DC  I 5 53  ? 169.856 156.106 168.189 1.00 117.52 ? 53   DC  J O2    1 
ATOM   7323  N N3    . DC  I 5 53  ? 169.038 154.937 166.439 1.00 117.52 ? 53   DC  J N3    1 
ATOM   7324  C C4    . DC  I 5 53  ? 167.976 154.588 165.718 1.00 117.52 ? 53   DC  J C4    1 
ATOM   7325  N N4    . DC  I 5 53  ? 168.168 153.766 164.685 1.00 117.52 ? 53   DC  J N4    1 
ATOM   7326  C C5    . DC  I 5 53  ? 166.674 155.076 166.010 1.00 117.52 ? 53   DC  J C5    1 
ATOM   7327  C C6    . DC  I 5 53  ? 166.542 155.890 167.057 1.00 117.52 ? 53   DC  J C6    1 
ATOM   7328  P P     . DC  I 5 54  ? 166.956 161.847 168.045 1.00 124.80 ? 54   DC  J P     1 
ATOM   7329  O OP1   . DC  I 5 54  ? 166.791 163.104 168.807 1.00 124.80 ? 54   DC  J OP1   1 
ATOM   7330  O OP2   . DC  I 5 54  ? 166.206 161.642 166.787 1.00 124.80 ? 54   DC  J OP2   1 
ATOM   7331  O "O5'" . DC  I 5 54  ? 168.513 161.642 167.740 1.00 124.80 ? 54   DC  J "O5'" 1 
ATOM   7332  C "C5'" . DC  I 5 54  ? 169.463 161.835 168.773 1.00 124.80 ? 54   DC  J "C5'" 1 
ATOM   7333  C "C4'" . DC  I 5 54  ? 170.799 161.217 168.410 1.00 124.80 ? 54   DC  J "C4'" 1 
ATOM   7334  O "O4'" . DC  I 5 54  ? 170.606 159.909 167.804 1.00 124.80 ? 54   DC  J "O4'" 1 
ATOM   7335  C "C3'" . DC  I 5 54  ? 171.624 162.014 167.408 1.00 124.80 ? 54   DC  J "C3'" 1 
ATOM   7336  O "O3'" . DC  I 5 54  ? 172.984 161.935 167.769 1.00 124.80 ? 54   DC  J "O3'" 1 
ATOM   7337  C "C2'" . DC  I 5 54  ? 171.357 161.272 166.104 1.00 124.80 ? 54   DC  J "C2'" 1 
ATOM   7338  C "C1'" . DC  I 5 54  ? 171.350 159.848 166.613 1.00 124.80 ? 54   DC  J "C1'" 1 
ATOM   7339  N N1    . DC  I 5 54  ? 170.708 158.880 165.692 1.00 124.80 ? 54   DC  J N1    1 
ATOM   7340  C C2    . DC  I 5 54  ? 171.503 158.034 164.920 1.00 124.80 ? 54   DC  J C2    1 
ATOM   7341  O O2    . DC  I 5 54  ? 172.726 158.118 165.013 1.00 124.80 ? 54   DC  J O2    1 
ATOM   7342  N N3    . DC  I 5 54  ? 170.904 157.157 164.082 1.00 124.80 ? 54   DC  J N3    1 
ATOM   7343  C C4    . DC  I 5 54  ? 169.578 157.107 164.012 1.00 124.80 ? 54   DC  J C4    1 
ATOM   7344  N N4    . DC  I 5 54  ? 169.027 156.229 163.174 1.00 124.80 ? 54   DC  J N4    1 
ATOM   7345  C C5    . DC  I 5 54  ? 168.751 157.960 164.796 1.00 124.80 ? 54   DC  J C5    1 
ATOM   7346  C C6    . DC  I 5 54  ? 169.355 158.822 165.612 1.00 124.80 ? 54   DC  J C6    1 
ATOM   7347  P P     . DC  I 5 55  ? 173.999 163.104 167.355 1.00 124.79 ? 55   DC  J P     1 
ATOM   7348  O OP1   . DC  I 5 55  ? 174.465 163.740 168.602 1.00 124.79 ? 55   DC  J OP1   1 
ATOM   7349  O OP2   . DC  I 5 55  ? 173.333 163.932 166.327 1.00 124.79 ? 55   DC  J OP2   1 
ATOM   7350  O "O5'" . DC  I 5 55  ? 175.217 162.319 166.674 1.00 124.79 ? 55   DC  J "O5'" 1 
ATOM   7351  C "C5'" . DC  I 5 55  ? 174.991 161.062 166.023 1.00 124.79 ? 55   DC  J "C5'" 1 
ATOM   7352  C "C4'" . DC  I 5 55  ? 175.353 161.150 164.554 1.00 124.79 ? 55   DC  J "C4'" 1 
ATOM   7353  O "O4'" . DC  I 5 55  ? 174.582 160.189 163.789 1.00 124.79 ? 55   DC  J "O4'" 1 
ATOM   7354  C "C3'" . DC  I 5 55  ? 175.073 162.510 163.916 1.00 124.79 ? 55   DC  J "C3'" 1 
ATOM   7355  O "O3'" . DC  I 5 55  ? 176.179 162.908 163.146 1.00 124.79 ? 55   DC  J "O3'" 1 
ATOM   7356  C "C2'" . DC  I 5 55  ? 173.843 162.246 163.056 1.00 124.79 ? 55   DC  J "C2'" 1 
ATOM   7357  C "C1'" . DC  I 5 55  ? 174.112 160.824 162.628 1.00 124.79 ? 55   DC  J "C1'" 1 
ATOM   7358  N N1    . DC  I 5 55  ? 172.922 160.107 162.152 1.00 124.79 ? 55   DC  J N1    1 
ATOM   7359  C C2    . DC  I 5 55  ? 173.076 159.067 161.241 1.00 124.79 ? 55   DC  J C2    1 
ATOM   7360  O O2    . DC  I 5 55  ? 174.211 158.777 160.859 1.00 124.79 ? 55   DC  J O2    1 
ATOM   7361  N N3    . DC  I 5 55  ? 171.980 158.409 160.807 1.00 124.79 ? 55   DC  J N3    1 
ATOM   7362  C C4    . DC  I 5 55  ? 170.776 158.761 161.252 1.00 124.79 ? 55   DC  J C4    1 
ATOM   7363  N N4    . DC  I 5 55  ? 169.720 158.085 160.796 1.00 124.79 ? 55   DC  J N4    1 
ATOM   7364  C C5    . DC  I 5 55  ? 170.599 159.825 162.183 1.00 124.79 ? 55   DC  J C5    1 
ATOM   7365  C C6    . DC  I 5 55  ? 171.691 160.463 162.601 1.00 124.79 ? 55   DC  J C6    1 
ATOM   7366  P P     . DG  I 5 56  ? 177.287 163.870 163.795 1.00 119.33 ? 56   DG  J P     1 
ATOM   7367  O OP1   . DG  I 5 56  ? 178.061 163.076 164.774 1.00 119.33 ? 56   DG  J OP1   1 
ATOM   7368  O OP2   . DG  I 5 56  ? 176.598 165.105 164.229 1.00 119.33 ? 56   DG  J OP2   1 
ATOM   7369  O "O5'" . DG  I 5 56  ? 178.237 164.228 162.567 1.00 119.33 ? 56   DG  J "O5'" 1 
ATOM   7370  C "C5'" . DG  I 5 56  ? 177.672 164.502 161.304 1.00 119.33 ? 56   DG  J "C5'" 1 
ATOM   7371  C "C4'" . DG  I 5 56  ? 178.177 163.521 160.270 1.00 119.33 ? 56   DG  J "C4'" 1 
ATOM   7372  O "O4'" . DG  I 5 56  ? 177.194 162.475 160.071 1.00 119.33 ? 56   DG  J "O4'" 1 
ATOM   7373  C "C3'" . DG  I 5 56  ? 178.398 164.123 158.901 1.00 119.33 ? 56   DG  J "C3'" 1 
ATOM   7374  O "O3'" . DG  I 5 56  ? 179.371 163.388 158.205 1.00 119.33 ? 56   DG  J "O3'" 1 
ATOM   7375  C "C2'" . DG  I 5 56  ? 177.028 163.979 158.262 1.00 119.33 ? 56   DG  J "C2'" 1 
ATOM   7376  C "C1'" . DG  I 5 56  ? 176.571 162.631 158.807 1.00 119.33 ? 56   DG  J "C1'" 1 
ATOM   7377  N N9    . DG  I 5 56  ? 175.123 162.529 158.994 1.00 119.33 ? 56   DG  J N9    1 
ATOM   7378  C C8    . DG  I 5 56  ? 174.334 163.304 159.808 1.00 119.33 ? 56   DG  J C8    1 
ATOM   7379  N N7    . DG  I 5 56  ? 173.073 162.976 159.776 1.00 119.33 ? 56   DG  J N7    1 
ATOM   7380  C C5    . DG  I 5 56  ? 173.023 161.918 158.883 1.00 119.33 ? 56   DG  J C5    1 
ATOM   7381  C C6    . DG  I 5 56  ? 171.923 161.150 158.443 1.00 119.33 ? 56   DG  J C6    1 
ATOM   7382  O O6    . DG  I 5 56  ? 170.736 161.259 158.767 1.00 119.33 ? 56   DG  J O6    1 
ATOM   7383  N N1    . DG  I 5 56  ? 172.309 160.171 157.532 1.00 119.33 ? 56   DG  J N1    1 
ATOM   7384  C C2    . DG  I 5 56  ? 173.596 159.963 157.103 1.00 119.33 ? 56   DG  J C2    1 
ATOM   7385  N N2    . DG  I 5 56  ? 173.783 158.973 156.220 1.00 119.33 ? 56   DG  J N2    1 
ATOM   7386  N N3    . DG  I 5 56  ? 174.634 160.677 157.509 1.00 119.33 ? 56   DG  J N3    1 
ATOM   7387  C C4    . DG  I 5 56  ? 174.275 161.631 158.394 1.00 119.33 ? 56   DG  J C4    1 
ATOM   7388  P P     . DT  I 5 57  ? 180.009 163.997 156.868 1.00 113.37 ? 57   DT  J P     1 
ATOM   7389  O OP1   . DT  I 5 57  ? 181.397 163.502 156.763 1.00 113.37 ? 57   DT  J OP1   1 
ATOM   7390  O OP2   . DT  I 5 57  ? 179.733 165.451 156.870 1.00 113.37 ? 57   DT  J OP2   1 
ATOM   7391  O "O5'" . DT  I 5 57  ? 179.139 163.338 155.709 1.00 113.37 ? 57   DT  J "O5'" 1 
ATOM   7392  C "C5'" . DT  I 5 57  ? 178.986 161.936 155.679 1.00 113.37 ? 57   DT  J "C5'" 1 
ATOM   7393  C "C4'" . DT  I 5 57  ? 178.078 161.493 154.544 1.00 113.37 ? 57   DT  J "C4'" 1 
ATOM   7394  O "O4'" . DT  I 5 57  ? 176.695 161.494 154.978 1.00 113.37 ? 57   DT  J "O4'" 1 
ATOM   7395  C "C3'" . DT  I 5 57  ? 178.117 162.346 153.279 1.00 113.37 ? 57   DT  J "C3'" 1 
ATOM   7396  O "O3'" . DT  I 5 57  ? 178.029 161.482 152.170 1.00 113.37 ? 57   DT  J "O3'" 1 
ATOM   7397  C "C2'" . DT  I 5 57  ? 176.850 163.189 153.418 1.00 113.37 ? 57   DT  J "C2'" 1 
ATOM   7398  C "C1'" . DT  I 5 57  ? 175.919 162.151 154.006 1.00 113.37 ? 57   DT  J "C1'" 1 
ATOM   7399  N N1    . DT  I 5 57  ? 174.702 162.682 154.671 1.00 113.37 ? 57   DT  J N1    1 
ATOM   7400  C C2    . DT  I 5 57  ? 173.508 162.045 154.462 1.00 113.37 ? 57   DT  J C2    1 
ATOM   7401  O O2    . DT  I 5 57  ? 173.388 161.081 153.734 1.00 113.37 ? 57   DT  J O2    1 
ATOM   7402  N N3    . DT  I 5 57  ? 172.450 162.579 155.130 1.00 113.37 ? 57   DT  J N3    1 
ATOM   7403  C C4    . DT  I 5 57  ? 172.464 163.659 155.975 1.00 113.37 ? 57   DT  J C4    1 
ATOM   7404  O O4    . DT  I 5 57  ? 171.454 164.066 156.528 1.00 113.37 ? 57   DT  J O4    1 
ATOM   7405  C C5    . DT  I 5 57  ? 173.746 164.276 156.165 1.00 113.37 ? 57   DT  J C5    1 
ATOM   7406  C C7    . DT  I 5 57  ? 173.875 165.466 157.065 1.00 113.37 ? 57   DT  J C7    1 
ATOM   7407  C C6    . DT  I 5 57  ? 174.796 163.762 155.513 1.00 113.37 ? 57   DT  J C6    1 
ATOM   7408  P P     . DC  I 5 58  ? 178.734 161.848 150.778 1.00 105.29 ? 58   DC  J P     1 
ATOM   7409  O OP1   . DC  I 5 58  ? 180.078 161.232 150.786 1.00 105.29 ? 58   DC  J OP1   1 
ATOM   7410  O OP2   . DC  I 5 58  ? 178.568 163.301 150.555 1.00 105.29 ? 58   DC  J OP2   1 
ATOM   7411  O "O5'" . DC  I 5 58  ? 177.843 161.073 149.707 1.00 105.29 ? 58   DC  J "O5'" 1 
ATOM   7412  C "C5'" . DC  I 5 58  ? 176.570 160.568 150.095 1.00 105.29 ? 58   DC  J "C5'" 1 
ATOM   7413  C "C4'" . DC  I 5 58  ? 175.500 161.021 149.132 1.00 105.29 ? 58   DC  J "C4'" 1 
ATOM   7414  O "O4'" . DC  I 5 58  ? 174.439 161.689 149.863 1.00 105.29 ? 58   DC  J "O4'" 1 
ATOM   7415  C "C3'" . DC  I 5 58  ? 175.980 162.020 148.093 1.00 105.29 ? 58   DC  J "C3'" 1 
ATOM   7416  O "O3'" . DC  I 5 58  ? 175.272 161.826 146.879 1.00 105.29 ? 58   DC  J "O3'" 1 
ATOM   7417  C "C2'" . DC  I 5 58  ? 175.625 163.344 148.750 1.00 105.29 ? 58   DC  J "C2'" 1 
ATOM   7418  C "C1'" . DC  I 5 58  ? 174.286 162.994 149.368 1.00 105.29 ? 58   DC  J "C1'" 1 
ATOM   7419  N N1    . DC  I 5 58  ? 173.880 163.867 150.488 1.00 105.29 ? 58   DC  J N1    1 
ATOM   7420  C C2    . DC  I 5 58  ? 172.582 163.784 150.975 1.00 105.29 ? 58   DC  J C2    1 
ATOM   7421  O O2    . DC  I 5 58  ? 171.807 162.984 150.454 1.00 105.29 ? 58   DC  J O2    1 
ATOM   7422  N N3    . DC  I 5 58  ? 172.209 164.582 152.002 1.00 105.29 ? 58   DC  J N3    1 
ATOM   7423  C C4    . DC  I 5 58  ? 173.083 165.430 152.529 1.00 105.29 ? 58   DC  J C4    1 
ATOM   7424  N N4    . DC  I 5 58  ? 172.680 166.200 153.541 1.00 105.29 ? 58   DC  J N4    1 
ATOM   7425  C C5    . DC  I 5 58  ? 174.413 165.529 152.044 1.00 105.29 ? 58   DC  J C5    1 
ATOM   7426  C C6    . DC  I 5 58  ? 174.763 164.737 151.031 1.00 105.29 ? 58   DC  J C6    1 
ATOM   7427  P P     . DT  I 5 59  ? 175.845 160.837 145.746 1.00 100.25 ? 59   DT  J P     1 
ATOM   7428  O OP1   . DT  I 5 59  ? 176.741 159.837 146.364 1.00 100.25 ? 59   DT  J OP1   1 
ATOM   7429  O OP2   . DT  I 5 59  ? 176.366 161.685 144.654 1.00 100.25 ? 59   DT  J OP2   1 
ATOM   7430  O "O5'" . DT  I 5 59  ? 174.544 160.079 145.204 1.00 100.25 ? 59   DT  J "O5'" 1 
ATOM   7431  C "C5'" . DT  I 5 59  ? 173.579 159.559 146.127 1.00 100.25 ? 59   DT  J "C5'" 1 
ATOM   7432  C "C4'" . DT  I 5 59  ? 172.167 160.086 145.860 1.00 100.25 ? 59   DT  J "C4'" 1 
ATOM   7433  O "O4'" . DT  I 5 59  ? 171.895 161.241 146.698 1.00 100.25 ? 59   DT  J "O4'" 1 
ATOM   7434  C "C3'" . DT  I 5 59  ? 171.863 160.542 144.432 1.00 100.25 ? 59   DT  J "C3'" 1 
ATOM   7435  O "O3'" . DT  I 5 59  ? 170.495 160.338 144.169 1.00 100.25 ? 59   DT  J "O3'" 1 
ATOM   7436  C "C2'" . DT  I 5 59  ? 172.126 162.033 144.535 1.00 100.25 ? 59   DT  J "C2'" 1 
ATOM   7437  C "C1'" . DT  I 5 59  ? 171.470 162.298 145.875 1.00 100.25 ? 59   DT  J "C1'" 1 
ATOM   7438  N N1    . DT  I 5 59  ? 171.851 163.565 146.503 1.00 100.25 ? 59   DT  J N1    1 
ATOM   7439  C C2    . DT  I 5 59  ? 171.002 164.131 147.406 1.00 100.25 ? 59   DT  J C2    1 
ATOM   7440  O O2    . DT  I 5 59  ? 169.941 163.641 147.713 1.00 100.25 ? 59   DT  J O2    1 
ATOM   7441  N N3    . DT  I 5 59  ? 171.435 165.299 147.942 1.00 100.25 ? 59   DT  J N3    1 
ATOM   7442  C C4    . DT  I 5 59  ? 172.615 165.950 147.672 1.00 100.25 ? 59   DT  J C4    1 
ATOM   7443  O O4    . DT  I 5 59  ? 172.917 167.007 148.212 1.00 100.25 ? 59   DT  J O4    1 
ATOM   7444  C C5    . DT  I 5 59  ? 173.468 165.304 146.712 1.00 100.25 ? 59   DT  J C5    1 
ATOM   7445  C C7    . DT  I 5 59  ? 174.781 165.922 146.335 1.00 100.25 ? 59   DT  J C7    1 
ATOM   7446  C C6    . DT  I 5 59  ? 173.049 164.152 146.178 1.00 100.25 ? 59   DT  J C6    1 
ATOM   7447  P P     . DC  I 5 60  ? 169.946 158.993 143.491 1.00 89.33  ? 60   DC  J P     1 
ATOM   7448  O OP1   . DC  I 5 60  ? 170.470 157.821 144.218 1.00 89.33  ? 60   DC  J OP1   1 
ATOM   7449  O OP2   . DC  I 5 60  ? 170.156 159.108 142.032 1.00 89.33  ? 60   DC  J OP2   1 
ATOM   7450  O "O5'" . DC  I 5 60  ? 168.381 159.077 143.790 1.00 89.33  ? 60   DC  J "O5'" 1 
ATOM   7451  C "C5'" . DC  I 5 60  ? 167.946 159.304 145.121 1.00 89.33  ? 60   DC  J "C5'" 1 
ATOM   7452  C "C4'" . DC  I 5 60  ? 166.945 160.446 145.201 1.00 89.33  ? 60   DC  J "C4'" 1 
ATOM   7453  O "O4'" . DC  I 5 60  ? 167.612 161.709 145.474 1.00 89.33  ? 60   DC  J "O4'" 1 
ATOM   7454  C "C3'" . DC  I 5 60  ? 166.106 160.690 143.955 1.00 89.33  ? 60   DC  J "C3'" 1 
ATOM   7455  O "O3'" . DC  I 5 60  ? 164.806 160.984 144.378 1.00 89.33  ? 60   DC  J "O3'" 1 
ATOM   7456  C "C2'" . DC  I 5 60  ? 166.774 161.929 143.362 1.00 89.33  ? 60   DC  J "C2'" 1 
ATOM   7457  C "C1'" . DC  I 5 60  ? 167.057 162.690 144.634 1.00 89.33  ? 60   DC  J "C1'" 1 
ATOM   7458  N N1    . DC  I 5 60  ? 168.035 163.790 144.506 1.00 89.33  ? 60   DC  J N1    1 
ATOM   7459  C C2    . DC  I 5 60  ? 167.912 164.933 145.308 1.00 89.33  ? 60   DC  J C2    1 
ATOM   7460  O O2    . DC  I 5 60  ? 166.977 165.013 146.102 1.00 89.33  ? 60   DC  J O2    1 
ATOM   7461  N N3    . DC  I 5 60  ? 168.829 165.923 145.186 1.00 89.33  ? 60   DC  J N3    1 
ATOM   7462  C C4    . DC  I 5 60  ? 169.825 165.796 144.315 1.00 89.33  ? 60   DC  J C4    1 
ATOM   7463  N N4    . DC  I 5 60  ? 170.712 166.793 144.220 1.00 89.33  ? 60   DC  J N4    1 
ATOM   7464  C C5    . DC  I 5 60  ? 169.962 164.643 143.498 1.00 89.33  ? 60   DC  J C5    1 
ATOM   7465  C C6    . DC  I 5 60  ? 169.054 163.675 143.628 1.00 89.33  ? 60   DC  J C6    1 
ATOM   7466  P P     . DC  I 5 61  ? 163.537 160.615 143.482 1.00 72.55  ? 61   DC  J P     1 
ATOM   7467  O OP1   . DC  I 5 61  ? 163.070 159.284 143.900 1.00 72.55  ? 61   DC  J OP1   1 
ATOM   7468  O OP2   . DC  I 5 61  ? 163.878 160.872 142.074 1.00 72.55  ? 61   DC  J OP2   1 
ATOM   7469  O "O5'" . DC  I 5 61  ? 162.452 161.680 143.946 1.00 72.55  ? 61   DC  J "O5'" 1 
ATOM   7470  C "C5'" . DC  I 5 61  ? 161.944 161.622 145.263 1.00 72.55  ? 61   DC  J "C5'" 1 
ATOM   7471  C "C4'" . DC  I 5 61  ? 161.621 162.994 145.828 1.00 72.55  ? 61   DC  J "C4'" 1 
ATOM   7472  O "O4'" . DC  I 5 61  ? 162.767 163.859 145.700 1.00 72.55  ? 61   DC  J "O4'" 1 
ATOM   7473  C "C3'" . DC  I 5 61  ? 160.471 163.734 145.162 1.00 72.55  ? 61   DC  J "C3'" 1 
ATOM   7474  O "O3'" . DC  I 5 61  ? 159.799 164.506 146.136 1.00 72.55  ? 61   DC  J "O3'" 1 
ATOM   7475  C "C2'" . DC  I 5 61  ? 161.203 164.618 144.169 1.00 72.55  ? 61   DC  J "C2'" 1 
ATOM   7476  C "C1'" . DC  I 5 61  ? 162.402 165.017 144.995 1.00 72.55  ? 61   DC  J "C1'" 1 
ATOM   7477  N N1    . DC  I 5 61  ? 163.563 165.433 144.207 1.00 72.55  ? 61   DC  J N1    1 
ATOM   7478  C C2    . DC  I 5 61  ? 164.163 166.657 144.469 1.00 72.55  ? 61   DC  J C2    1 
ATOM   7479  O O2    . DC  I 5 61  ? 163.685 167.384 145.341 1.00 72.55  ? 61   DC  J O2    1 
ATOM   7480  N N3    . DC  I 5 61  ? 165.246 167.020 143.756 1.00 72.55  ? 61   DC  J N3    1 
ATOM   7481  C C4    . DC  I 5 61  ? 165.727 166.206 142.826 1.00 72.55  ? 61   DC  J C4    1 
ATOM   7482  N N4    . DC  I 5 61  ? 166.799 166.603 142.140 1.00 72.55  ? 61   DC  J N4    1 
ATOM   7483  C C5    . DC  I 5 61  ? 165.127 164.954 142.547 1.00 72.55  ? 61   DC  J C5    1 
ATOM   7484  C C6    . DC  I 5 61  ? 164.063 164.606 143.265 1.00 72.55  ? 61   DC  J C6    1 
ATOM   7485  P P     . DG  I 5 62  ? 158.291 164.997 145.900 1.00 79.61  ? 62   DG  J P     1 
ATOM   7486  O OP1   . DG  I 5 62  ? 157.415 164.217 146.791 1.00 79.61  ? 62   DG  J OP1   1 
ATOM   7487  O OP2   . DG  I 5 62  ? 158.016 165.002 144.452 1.00 79.61  ? 62   DG  J OP2   1 
ATOM   7488  O "O5'" . DG  I 5 62  ? 158.321 166.507 146.403 1.00 79.61  ? 62   DG  J "O5'" 1 
ATOM   7489  C "C5'" . DG  I 5 62  ? 159.563 167.168 146.510 1.00 79.61  ? 62   DG  J "C5'" 1 
ATOM   7490  C "C4'" . DG  I 5 62  ? 159.418 168.654 146.259 1.00 79.61  ? 62   DG  J "C4'" 1 
ATOM   7491  O "O4'" . DG  I 5 62  ? 160.575 169.120 145.526 1.00 79.61  ? 62   DG  J "O4'" 1 
ATOM   7492  C "C3'" . DG  I 5 62  ? 158.231 169.050 145.407 1.00 79.61  ? 62   DG  J "C3'" 1 
ATOM   7493  O "O3'" . DG  I 5 62  ? 157.895 170.386 145.694 1.00 79.61  ? 62   DG  J "O3'" 1 
ATOM   7494  C "C2'" . DG  I 5 62  ? 158.805 168.915 144.010 1.00 79.61  ? 62   DG  J "C2'" 1 
ATOM   7495  C "C1'" . DG  I 5 62  ? 160.197 169.472 144.215 1.00 79.61  ? 62   DG  J "C1'" 1 
ATOM   7496  N N9    . DG  I 5 62  ? 161.167 168.913 143.301 1.00 79.61  ? 62   DG  J N9    1 
ATOM   7497  C C8    . DG  I 5 62  ? 161.110 167.696 142.700 1.00 79.61  ? 62   DG  J C8    1 
ATOM   7498  N N7    . DG  I 5 62  ? 162.123 167.450 141.932 1.00 79.61  ? 62   DG  J N7    1 
ATOM   7499  C C5    . DG  I 5 62  ? 162.897 168.586 142.025 1.00 79.61  ? 62   DG  J C5    1 
ATOM   7500  C C6    . DG  I 5 62  ? 164.120 168.899 141.406 1.00 79.61  ? 62   DG  J C6    1 
ATOM   7501  O O6    . DG  I 5 62  ? 164.781 168.207 140.627 1.00 79.61  ? 62   DG  J O6    1 
ATOM   7502  N N1    . DG  I 5 62  ? 164.571 170.156 141.770 1.00 79.61  ? 62   DG  J N1    1 
ATOM   7503  C C2    . DG  I 5 62  ? 163.918 171.001 142.625 1.00 79.61  ? 62   DG  J C2    1 
ATOM   7504  N N2    . DG  I 5 62  ? 164.502 172.179 142.864 1.00 79.61  ? 62   DG  J N2    1 
ATOM   7505  N N3    . DG  I 5 62  ? 162.767 170.716 143.211 1.00 79.61  ? 62   DG  J N3    1 
ATOM   7506  C C4    . DG  I 5 62  ? 162.321 169.496 142.864 1.00 79.61  ? 62   DG  J C4    1 
ATOM   7507  P P     . DC  I 5 63  ? 156.512 171.025 145.188 1.00 83.61  ? 63   DC  J P     1 
ATOM   7508  O OP1   . DC  I 5 63  ? 155.824 171.535 146.391 1.00 83.61  ? 63   DC  J OP1   1 
ATOM   7509  O OP2   . DC  I 5 63  ? 155.808 170.082 144.295 1.00 83.61  ? 63   DC  J OP2   1 
ATOM   7510  O "O5'" . DC  I 5 63  ? 156.986 172.277 144.322 1.00 83.61  ? 63   DC  J "O5'" 1 
ATOM   7511  C "C5'" . DC  I 5 63  ? 157.675 173.326 144.961 1.00 83.61  ? 63   DC  J "C5'" 1 
ATOM   7512  C "C4'" . DC  I 5 63  ? 158.520 174.104 143.979 1.00 83.61  ? 63   DC  J "C4'" 1 
ATOM   7513  O "O4'" . DC  I 5 63  ? 159.495 173.226 143.360 1.00 83.61  ? 63   DC  J "O4'" 1 
ATOM   7514  C "C3'" . DC  I 5 63  ? 157.749 174.752 142.830 1.00 83.61  ? 63   DC  J "C3'" 1 
ATOM   7515  O "O3'" . DC  I 5 63  ? 158.184 176.084 142.675 1.00 83.61  ? 63   DC  J "O3'" 1 
ATOM   7516  C "C2'" . DC  I 5 63  ? 158.157 173.907 141.638 1.00 83.61  ? 63   DC  J "C2'" 1 
ATOM   7517  C "C1'" . DC  I 5 63  ? 159.576 173.567 142.008 1.00 83.61  ? 63   DC  J "C1'" 1 
ATOM   7518  N N1    . DC  I 5 63  ? 160.093 172.430 141.255 1.00 83.61  ? 63   DC  J N1    1 
ATOM   7519  C C2    . DC  I 5 63  ? 161.274 172.555 140.527 1.00 83.61  ? 63   DC  J C2    1 
ATOM   7520  O O2    . DC  I 5 63  ? 161.871 173.627 140.540 1.00 83.61  ? 63   DC  J O2    1 
ATOM   7521  N N3    . DC  I 5 63  ? 161.728 171.493 139.834 1.00 83.61  ? 63   DC  J N3    1 
ATOM   7522  C C4    . DC  I 5 63  ? 161.050 170.356 139.849 1.00 83.61  ? 63   DC  J C4    1 
ATOM   7523  N N4    . DC  I 5 63  ? 161.529 169.328 139.152 1.00 83.61  ? 63   DC  J N4    1 
ATOM   7524  C C5    . DC  I 5 63  ? 159.843 170.214 140.581 1.00 83.61  ? 63   DC  J C5    1 
ATOM   7525  C C6    . DC  I 5 63  ? 159.408 171.269 141.262 1.00 83.61  ? 63   DC  J C6    1 
ATOM   7526  P P     . DT  I 5 64  ? 157.273 177.185 141.939 1.00 83.19  ? 64   DT  J P     1 
ATOM   7527  O OP1   . DT  I 5 64  ? 156.504 177.885 142.990 1.00 83.19  ? 64   DT  J OP1   1 
ATOM   7528  O OP2   . DT  I 5 64  ? 156.577 176.600 140.774 1.00 83.19  ? 64   DT  J OP2   1 
ATOM   7529  O "O5'" . DT  I 5 64  ? 158.358 178.185 141.347 1.00 83.19  ? 64   DT  J "O5'" 1 
ATOM   7530  C "C5'" . DT  I 5 64  ? 159.679 177.717 141.133 1.00 83.19  ? 64   DT  J "C5'" 1 
ATOM   7531  C "C4'" . DT  I 5 64  ? 160.088 177.913 139.692 1.00 83.19  ? 64   DT  J "C4'" 1 
ATOM   7532  O "O4'" . DT  I 5 64  ? 160.552 176.651 139.136 1.00 83.19  ? 64   DT  J "O4'" 1 
ATOM   7533  C "C3'" . DT  I 5 64  ? 158.968 178.381 138.766 1.00 83.19  ? 64   DT  J "C3'" 1 
ATOM   7534  O "O3'" . DT  I 5 64  ? 159.505 179.256 137.799 1.00 83.19  ? 64   DT  J "O3'" 1 
ATOM   7535  C "C2'" . DT  I 5 64  ? 158.528 177.078 138.126 1.00 83.19  ? 64   DT  J "C2'" 1 
ATOM   7536  C "C1'" . DT  I 5 64  ? 159.883 176.438 137.922 1.00 83.19  ? 64   DT  J "C1'" 1 
ATOM   7537  N N1    . DT  I 5 64  ? 159.828 174.994 137.632 1.00 83.19  ? 64   DT  J N1    1 
ATOM   7538  C C2    . DT  I 5 64  ? 160.816 174.429 136.873 1.00 83.19  ? 64   DT  J C2    1 
ATOM   7539  O O2    . DT  I 5 64  ? 161.751 175.057 136.424 1.00 83.19  ? 64   DT  J O2    1 
ATOM   7540  N N3    . DT  I 5 64  ? 160.672 173.092 136.659 1.00 83.19  ? 64   DT  J N3    1 
ATOM   7541  C C4    . DT  I 5 64  ? 159.665 172.285 137.117 1.00 83.19  ? 64   DT  J C4    1 
ATOM   7542  O O4    . DT  I 5 64  ? 159.619 171.092 136.871 1.00 83.19  ? 64   DT  J O4    1 
ATOM   7543  C C5    . DT  I 5 64  ? 158.660 172.941 137.902 1.00 83.19  ? 64   DT  J C5    1 
ATOM   7544  C C7    . DT  I 5 64  ? 157.507 172.159 138.448 1.00 83.19  ? 64   DT  J C7    1 
ATOM   7545  C C6    . DT  I 5 64  ? 158.788 174.250 138.118 1.00 83.19  ? 64   DT  J C6    1 
ATOM   7546  P P     . DC  I 5 65  ? 158.608 180.421 137.161 1.00 82.24  ? 65   DC  J P     1 
ATOM   7547  O OP1   . DC  I 5 65  ? 158.746 181.613 138.022 1.00 82.24  ? 65   DC  J OP1   1 
ATOM   7548  O OP2   . DC  I 5 65  ? 157.269 179.868 136.873 1.00 82.24  ? 65   DC  J OP2   1 
ATOM   7549  O "O5'" . DC  I 5 65  ? 159.328 180.707 135.772 1.00 82.24  ? 65   DC  J "O5'" 1 
ATOM   7550  C "C5'" . DC  I 5 65  ? 160.728 180.538 135.668 1.00 82.24  ? 65   DC  J "C5'" 1 
ATOM   7551  C "C4'" . DC  I 5 65  ? 161.091 179.895 134.346 1.00 82.24  ? 65   DC  J "C4'" 1 
ATOM   7552  O "O4'" . DC  I 5 65  ? 161.001 178.449 134.457 1.00 82.24  ? 65   DC  J "O4'" 1 
ATOM   7553  C "C3'" . DC  I 5 65  ? 160.196 180.294 133.176 1.00 82.24  ? 65   DC  J "C3'" 1 
ATOM   7554  O "O3'" . DC  I 5 65  ? 160.996 180.667 132.068 1.00 82.24  ? 65   DC  J "O3'" 1 
ATOM   7555  C "C2'" . DC  I 5 65  ? 159.393 179.024 132.898 1.00 82.24  ? 65   DC  J "C2'" 1 
ATOM   7556  C "C1'" . DC  I 5 65  ? 160.365 177.938 133.315 1.00 82.24  ? 65   DC  J "C1'" 1 
ATOM   7557  N N1    . DC  I 5 65  ? 159.694 176.655 133.680 1.00 82.24  ? 65   DC  J N1    1 
ATOM   7558  C C2    . DC  I 5 65  ? 160.151 175.448 133.144 1.00 82.24  ? 65   DC  J C2    1 
ATOM   7559  O O2    . DC  I 5 65  ? 161.106 175.461 132.369 1.00 82.24  ? 65   DC  J O2    1 
ATOM   7560  N N3    . DC  I 5 65  ? 159.524 174.298 133.491 1.00 82.24  ? 65   DC  J N3    1 
ATOM   7561  C C4    . DC  I 5 65  ? 158.494 174.332 134.331 1.00 82.24  ? 65   DC  J C4    1 
ATOM   7562  N N4    . DC  I 5 65  ? 157.902 173.180 134.648 1.00 82.24  ? 65   DC  J N4    1 
ATOM   7563  C C5    . DC  I 5 65  ? 158.017 175.549 134.884 1.00 82.24  ? 65   DC  J C5    1 
ATOM   7564  C C6    . DC  I 5 65  ? 158.639 176.673 134.535 1.00 82.24  ? 65   DC  J C6    1 
ATOM   7565  P P     . DG  I 5 66  ? 160.349 181.413 130.800 1.00 82.18  ? 66   DG  J P     1 
ATOM   7566  O OP1   . DG  I 5 66  ? 161.208 182.572 130.500 1.00 82.18  ? 66   DG  J OP1   1 
ATOM   7567  O OP2   . DG  I 5 66  ? 158.905 181.632 131.014 1.00 82.18  ? 66   DG  J OP2   1 
ATOM   7568  O "O5'" . DG  I 5 66  ? 160.538 180.358 129.625 1.00 82.18  ? 66   DG  J "O5'" 1 
ATOM   7569  C "C5'" . DG  I 5 66  ? 161.841 179.935 129.282 1.00 82.18  ? 66   DG  J "C5'" 1 
ATOM   7570  C "C4'" . DG  I 5 66  ? 161.810 178.657 128.467 1.00 82.18  ? 66   DG  J "C4'" 1 
ATOM   7571  O "O4'" . DG  I 5 66  ? 161.266 177.574 129.263 1.00 82.18  ? 66   DG  J "O4'" 1 
ATOM   7572  C "C3'" . DG  I 5 66  ? 160.966 178.711 127.197 1.00 82.18  ? 66   DG  J "C3'" 1 
ATOM   7573  O "O3'" . DG  I 5 66  ? 161.663 178.077 126.155 1.00 82.18  ? 66   DG  J "O3'" 1 
ATOM   7574  C "C2'" . DG  I 5 66  ? 159.727 177.918 127.586 1.00 82.18  ? 66   DG  J "C2'" 1 
ATOM   7575  C "C1'" . DG  I 5 66  ? 160.336 176.869 128.487 1.00 82.18  ? 66   DG  J "C1'" 1 
ATOM   7576  N N9    . DG  I 5 66  ? 159.393 176.239 129.392 1.00 82.18  ? 66   DG  J N9    1 
ATOM   7577  C C8    . DG  I 5 66  ? 158.630 176.860 130.335 1.00 82.18  ? 66   DG  J C8    1 
ATOM   7578  N N7    . DG  I 5 66  ? 157.875 176.047 131.015 1.00 82.18  ? 66   DG  J N7    1 
ATOM   7579  C C5    . DG  I 5 66  ? 158.165 174.801 130.489 1.00 82.18  ? 66   DG  J C5    1 
ATOM   7580  C C6    . DG  I 5 66  ? 157.654 173.534 130.832 1.00 82.18  ? 66   DG  J C6    1 
ATOM   7581  O O6    . DG  I 5 66  ? 156.818 173.257 131.695 1.00 82.18  ? 66   DG  J O6    1 
ATOM   7582  N N1    . DG  I 5 66  ? 158.212 172.529 130.058 1.00 82.18  ? 66   DG  J N1    1 
ATOM   7583  C C2    . DG  I 5 66  ? 159.145 172.728 129.077 1.00 82.18  ? 66   DG  J C2    1 
ATOM   7584  N N2    . DG  I 5 66  ? 159.570 171.638 128.430 1.00 82.18  ? 66   DG  J N2    1 
ATOM   7585  N N3    . DG  I 5 66  ? 159.634 173.915 128.745 1.00 82.18  ? 66   DG  J N3    1 
ATOM   7586  C C4    . DG  I 5 66  ? 159.100 174.901 129.490 1.00 82.18  ? 66   DG  J C4    1 
ATOM   7587  P P     . DT  I 5 67  ? 161.451 178.546 124.638 1.00 76.88  ? 67   DT  J P     1 
ATOM   7588  O OP1   . DT  I 5 67  ? 162.691 179.230 124.220 1.00 76.88  ? 67   DT  J OP1   1 
ATOM   7589  O OP2   . DT  I 5 67  ? 160.154 179.253 124.562 1.00 76.88  ? 67   DT  J OP2   1 
ATOM   7590  O "O5'" . DT  I 5 67  ? 161.344 177.172 123.832 1.00 76.88  ? 67   DT  J "O5'" 1 
ATOM   7591  C "C5'" . DT  I 5 67  ? 161.338 175.937 124.541 1.00 76.88  ? 67   DT  J "C5'" 1 
ATOM   7592  C "C4'" . DT  I 5 67  ? 160.477 174.909 123.840 1.00 76.88  ? 67   DT  J "C4'" 1 
ATOM   7593  O "O4'" . DT  I 5 67  ? 159.579 174.300 124.810 1.00 76.88  ? 67   DT  J "O4'" 1 
ATOM   7594  C "C3'" . DT  I 5 67  ? 159.551 175.474 122.767 1.00 76.88  ? 67   DT  J "C3'" 1 
ATOM   7595  O "O3'" . DT  I 5 67  ? 159.124 174.433 121.921 1.00 76.88  ? 67   DT  J "O3'" 1 
ATOM   7596  C "C2'" . DT  I 5 67  ? 158.385 175.880 123.633 1.00 76.88  ? 67   DT  J "C2'" 1 
ATOM   7597  C "C1'" . DT  I 5 67  ? 158.262 174.589 124.414 1.00 76.88  ? 67   DT  J "C1'" 1 
ATOM   7598  N N1    . DT  I 5 67  ? 157.354 174.653 125.598 1.00 76.88  ? 67   DT  J N1    1 
ATOM   7599  C C2    . DT  I 5 67  ? 156.724 173.510 126.022 1.00 76.88  ? 67   DT  J C2    1 
ATOM   7600  O O2    . DT  I 5 67  ? 156.868 172.434 125.484 1.00 76.88  ? 67   DT  J O2    1 
ATOM   7601  N N3    . DT  I 5 67  ? 155.915 173.675 127.108 1.00 76.88  ? 67   DT  J N3    1 
ATOM   7602  C C4    . DT  I 5 67  ? 155.679 174.840 127.794 1.00 76.88  ? 67   DT  J C4    1 
ATOM   7603  O O4    . DT  I 5 67  ? 154.936 174.897 128.761 1.00 76.88  ? 67   DT  J O4    1 
ATOM   7604  C C5    . DT  I 5 67  ? 156.361 175.994 127.298 1.00 76.88  ? 67   DT  J C5    1 
ATOM   7605  C C7    . DT  I 5 67  ? 156.165 177.313 127.970 1.00 76.88  ? 67   DT  J C7    1 
ATOM   7606  C C6    . DT  I 5 67  ? 157.155 175.850 126.234 1.00 76.88  ? 67   DT  J C6    1 
ATOM   7607  P P     . DC  I 5 68  ? 159.906 174.002 120.588 1.00 75.54  ? 68   DC  J P     1 
ATOM   7608  O OP1   . DC  I 5 68  ? 161.363 174.042 120.814 1.00 75.54  ? 68   DC  J OP1   1 
ATOM   7609  O OP2   . DC  I 5 68  ? 159.330 174.737 119.448 1.00 75.54  ? 68   DC  J OP2   1 
ATOM   7610  O "O5'" . DC  I 5 68  ? 159.443 172.485 120.434 1.00 75.54  ? 68   DC  J "O5'" 1 
ATOM   7611  C "C5'" . DC  I 5 68  ? 158.828 171.844 121.558 1.00 75.54  ? 68   DC  J "C5'" 1 
ATOM   7612  C "C4'" . DC  I 5 68  ? 157.898 170.735 121.124 1.00 75.54  ? 68   DC  J "C4'" 1 
ATOM   7613  O "O4'" . DC  I 5 68  ? 156.729 170.728 121.969 1.00 75.54  ? 68   DC  J "O4'" 1 
ATOM   7614  C "C3'" . DC  I 5 68  ? 157.348 170.891 119.734 1.00 75.54  ? 68   DC  J "C3'" 1 
ATOM   7615  O "O3'" . DC  I 5 68  ? 156.872 169.644 119.287 1.00 75.54  ? 68   DC  J "O3'" 1 
ATOM   7616  C "C2'" . DC  I 5 68  ? 156.205 171.872 119.974 1.00 75.54  ? 68   DC  J "C2'" 1 
ATOM   7617  C "C1'" . DC  I 5 68  ? 155.656 171.377 121.308 1.00 75.54  ? 68   DC  J "C1'" 1 
ATOM   7618  N N1    . DC  I 5 68  ? 155.172 172.442 122.205 1.00 75.54  ? 68   DC  J N1    1 
ATOM   7619  C C2    . DC  I 5 68  ? 154.289 172.116 123.219 1.00 75.54  ? 68   DC  J C2    1 
ATOM   7620  O O2    . DC  I 5 68  ? 153.933 170.953 123.331 1.00 75.54  ? 68   DC  J O2    1 
ATOM   7621  N N3    . DC  I 5 68  ? 153.853 173.084 124.052 1.00 75.54  ? 68   DC  J N3    1 
ATOM   7622  C C4    . DC  I 5 68  ? 154.271 174.328 123.892 1.00 75.54  ? 68   DC  J C4    1 
ATOM   7623  N N4    . DC  I 5 68  ? 153.819 175.260 124.732 1.00 75.54  ? 68   DC  J N4    1 
ATOM   7624  C C5    . DC  I 5 68  ? 155.165 174.682 122.855 1.00 75.54  ? 68   DC  J C5    1 
ATOM   7625  C C6    . DC  I 5 68  ? 155.600 173.714 122.048 1.00 75.54  ? 68   DC  J C6    1 
ATOM   7626  P P     . DA  I 5 69  ? 157.790 168.705 118.366 1.00 72.12  ? 69   DA  J P     1 
ATOM   7627  O OP1   . DA  I 5 69  ? 159.167 168.701 118.896 1.00 72.12  ? 69   DA  J OP1   1 
ATOM   7628  O OP2   . DA  I 5 69  ? 157.569 169.103 116.964 1.00 72.12  ? 69   DA  J OP2   1 
ATOM   7629  O "O5'" . DA  I 5 69  ? 157.145 167.258 118.551 1.00 72.12  ? 69   DA  J "O5'" 1 
ATOM   7630  C "C5'" . DA  I 5 69  ? 157.254 166.584 119.789 1.00 72.12  ? 69   DA  J "C5'" 1 
ATOM   7631  C "C4'" . DA  I 5 69  ? 155.892 166.162 120.324 1.00 72.12  ? 69   DA  J "C4'" 1 
ATOM   7632  O "O4'" . DA  I 5 69  ? 155.107 167.326 120.658 1.00 72.12  ? 69   DA  J "O4'" 1 
ATOM   7633  C "C3'" . DA  I 5 69  ? 155.028 165.333 119.385 1.00 72.12  ? 69   DA  J "C3'" 1 
ATOM   7634  O "O3'" . DA  I 5 69  ? 154.346 164.360 120.137 1.00 72.12  ? 69   DA  J "O3'" 1 
ATOM   7635  C "C2'" . DA  I 5 69  ? 154.060 166.363 118.824 1.00 72.12  ? 69   DA  J "C2'" 1 
ATOM   7636  C "C1'" . DA  I 5 69  ? 153.848 167.233 120.043 1.00 72.12  ? 69   DA  J "C1'" 1 
ATOM   7637  N N9    . DA  I 5 69  ? 153.428 168.581 119.738 1.00 72.12  ? 69   DA  J N9    1 
ATOM   7638  C C8    . DA  I 5 69  ? 153.794 169.331 118.664 1.00 72.12  ? 69   DA  J C8    1 
ATOM   7639  N N7    . DA  I 5 69  ? 153.268 170.528 118.657 1.00 72.12  ? 69   DA  J N7    1 
ATOM   7640  C C5    . DA  I 5 69  ? 152.514 170.559 119.809 1.00 72.12  ? 69   DA  J C5    1 
ATOM   7641  C C6    . DA  I 5 69  ? 151.710 171.547 120.378 1.00 72.12  ? 69   DA  J C6    1 
ATOM   7642  N N6    . DA  I 5 69  ? 151.530 172.746 119.829 1.00 72.12  ? 69   DA  J N6    1 
ATOM   7643  N N1    . DA  I 5 69  ? 151.093 171.260 121.538 1.00 72.12  ? 69   DA  J N1    1 
ATOM   7644  C C2    . DA  I 5 69  ? 151.270 170.058 122.081 1.00 72.12  ? 69   DA  J C2    1 
ATOM   7645  N N3    . DA  I 5 69  ? 152.008 169.050 121.637 1.00 72.12  ? 69   DA  J N3    1 
ATOM   7646  C C4    . DA  I 5 69  ? 152.604 169.369 120.487 1.00 72.12  ? 69   DA  J C4    1 
ATOM   7647  P P     . DC  I 5 70  ? 154.042 162.921 119.506 1.00 63.92  ? 70   DC  J P     1 
ATOM   7648  O OP1   . DC  I 5 70  ? 154.986 161.962 120.110 1.00 63.92  ? 70   DC  J OP1   1 
ATOM   7649  O OP2   . DC  I 5 70  ? 153.961 163.066 118.042 1.00 63.92  ? 70   DC  J OP2   1 
ATOM   7650  O "O5'" . DC  I 5 70  ? 152.584 162.585 120.035 1.00 63.92  ? 70   DC  J "O5'" 1 
ATOM   7651  C "C5'" . DC  I 5 70  ? 152.378 162.393 121.402 1.00 63.92  ? 70   DC  J "C5'" 1 
ATOM   7652  C "C4'" . DC  I 5 70  ? 151.277 163.289 121.903 1.00 63.92  ? 70   DC  J "C4'" 1 
ATOM   7653  O "O4'" . DC  I 5 70  ? 151.375 164.566 121.272 1.00 63.92  ? 70   DC  J "O4'" 1 
ATOM   7654  C "C3'" . DC  I 5 70  ? 149.867 162.818 121.590 1.00 63.92  ? 70   DC  J "C3'" 1 
ATOM   7655  O "O3'" . DC  I 5 70  ? 149.312 162.189 122.703 1.00 63.92  ? 70   DC  J "O3'" 1 
ATOM   7656  C "C2'" . DC  I 5 70  ? 149.109 164.107 121.279 1.00 63.92  ? 70   DC  J "C2'" 1 
ATOM   7657  C "C1'" . DC  I 5 70  ? 150.149 165.192 121.462 1.00 63.92  ? 70   DC  J "C1'" 1 
ATOM   7658  N N1    . DC  I 5 70  ? 150.005 166.305 120.502 1.00 63.92  ? 70   DC  J N1    1 
ATOM   7659  C C2    . DC  I 5 70  ? 149.370 167.467 120.911 1.00 63.92  ? 70   DC  J C2    1 
ATOM   7660  O O2    . DC  I 5 70  ? 148.958 167.546 122.068 1.00 63.92  ? 70   DC  J O2    1 
ATOM   7661  N N3    . DC  I 5 70  ? 149.241 168.486 120.042 1.00 63.92  ? 70   DC  J N3    1 
ATOM   7662  C C4    . DC  I 5 70  ? 149.707 168.366 118.811 1.00 63.92  ? 70   DC  J C4    1 
ATOM   7663  N N4    . DC  I 5 70  ? 149.551 169.397 117.986 1.00 63.92  ? 70   DC  J N4    1 
ATOM   7664  C C5    . DC  I 5 70  ? 150.354 167.183 118.366 1.00 63.92  ? 70   DC  J C5    1 
ATOM   7665  C C6    . DC  I 5 70  ? 150.472 166.180 119.237 1.00 63.92  ? 70   DC  J C6    1 
ATOM   7666  P P     . DT  I 5 71  ? 147.966 161.345 122.531 1.00 59.30  ? 71   DT  J P     1 
ATOM   7667  O OP1   . DT  I 5 71  ? 147.947 160.310 123.571 1.00 59.30  ? 71   DT  J OP1   1 
ATOM   7668  O OP2   . DT  I 5 71  ? 147.860 160.993 121.107 1.00 59.30  ? 71   DT  J OP2   1 
ATOM   7669  O "O5'" . DT  I 5 71  ? 146.815 162.380 122.863 1.00 59.30  ? 71   DT  J "O5'" 1 
ATOM   7670  C "C5'" . DT  I 5 71  ? 146.465 162.594 124.192 1.00 59.30  ? 71   DT  J "C5'" 1 
ATOM   7671  C "C4'" . DT  I 5 71  ? 145.443 163.699 124.308 1.00 59.30  ? 71   DT  J "C4'" 1 
ATOM   7672  O "O4'" . DT  I 5 71  ? 145.808 164.788 123.430 1.00 59.30  ? 71   DT  J "O4'" 1 
ATOM   7673  C "C3'" . DT  I 5 71  ? 144.024 163.309 123.924 1.00 59.30  ? 71   DT  J "C3'" 1 
ATOM   7674  O "O3'" . DT  I 5 71  ? 143.128 163.869 124.847 1.00 59.30  ? 71   DT  J "O3'" 1 
ATOM   7675  C "C2'" . DT  I 5 71  ? 143.869 163.925 122.541 1.00 59.30  ? 71   DT  J "C2'" 1 
ATOM   7676  C "C1'" . DT  I 5 71  ? 144.674 165.192 122.720 1.00 59.30  ? 71   DT  J "C1'" 1 
ATOM   7677  N N1    . DT  I 5 71  ? 145.113 165.877 121.453 1.00 59.30  ? 71   DT  J N1    1 
ATOM   7678  C C2    . DT  I 5 71  ? 144.797 167.195 121.274 1.00 59.30  ? 71   DT  J C2    1 
ATOM   7679  O O2    . DT  I 5 71  ? 144.153 167.837 122.076 1.00 59.30  ? 71   DT  J O2    1 
ATOM   7680  N N3    . DT  I 5 71  ? 145.247 167.743 120.111 1.00 59.30  ? 71   DT  J N3    1 
ATOM   7681  C C4    . DT  I 5 71  ? 145.979 167.124 119.133 1.00 59.30  ? 71   DT  J C4    1 
ATOM   7682  O O4    . DT  I 5 71  ? 146.341 167.702 118.122 1.00 59.30  ? 71   DT  J O4    1 
ATOM   7683  C C5    . DT  I 5 71  ? 146.290 165.750 119.380 1.00 59.30  ? 71   DT  J C5    1 
ATOM   7684  C C7    . DT  I 5 71  ? 147.077 164.978 118.375 1.00 59.30  ? 71   DT  J C7    1 
ATOM   7685  C C6    . DT  I 5 71  ? 145.844 165.193 120.515 1.00 59.30  ? 71   DT  J C6    1 
ATOM   7686  P P     . DT  I 5 72  ? 141.585 163.439 124.851 1.00 68.30  ? 72   DT  J P     1 
ATOM   7687  O OP1   . DT  I 5 72  ? 141.062 163.607 126.216 1.00 68.30  ? 72   DT  J OP1   1 
ATOM   7688  O OP2   . DT  I 5 72  ? 141.446 162.159 124.136 1.00 68.30  ? 72   DT  J OP2   1 
ATOM   7689  O "O5'" . DT  I 5 72  ? 140.891 164.525 123.938 1.00 68.30  ? 72   DT  J "O5'" 1 
ATOM   7690  C "C5'" . DT  I 5 72  ? 140.912 165.877 124.318 1.00 68.30  ? 72   DT  J "C5'" 1 
ATOM   7691  C "C4'" . DT  I 5 72  ? 140.177 166.720 123.300 1.00 68.30  ? 72   DT  J "C4'" 1 
ATOM   7692  O "O4'" . DT  I 5 72  ? 141.027 166.953 122.148 1.00 68.30  ? 72   DT  J "O4'" 1 
ATOM   7693  C "C3'" . DT  I 5 72  ? 138.895 166.101 122.758 1.00 68.30  ? 72   DT  J "C3'" 1 
ATOM   7694  O "O3'" . DT  I 5 72  ? 137.917 167.087 122.690 1.00 68.30  ? 72   DT  J "O3'" 1 
ATOM   7695  C "C2'" . DT  I 5 72  ? 139.305 165.636 121.365 1.00 68.30  ? 72   DT  J "C2'" 1 
ATOM   7696  C "C1'" . DT  I 5 72  ? 140.282 166.720 120.986 1.00 68.30  ? 72   DT  J "C1'" 1 
ATOM   7697  N N1    . DT  I 5 72  ? 141.206 166.338 119.911 1.00 68.30  ? 72   DT  J N1    1 
ATOM   7698  C C2    . DT  I 5 72  ? 141.506 167.247 118.938 1.00 68.30  ? 72   DT  J C2    1 
ATOM   7699  O O2    . DT  I 5 72  ? 141.045 168.364 118.913 1.00 68.30  ? 72   DT  J O2    1 
ATOM   7700  N N3    . DT  I 5 72  ? 142.372 166.801 117.986 1.00 68.30  ? 72   DT  J N3    1 
ATOM   7701  C C4    . DT  I 5 72  ? 142.956 165.560 117.913 1.00 68.30  ? 72   DT  J C4    1 
ATOM   7702  O O4    . DT  I 5 72  ? 143.727 165.243 117.018 1.00 68.30  ? 72   DT  J O4    1 
ATOM   7703  C C5    . DT  I 5 72  ? 142.599 164.656 118.962 1.00 68.30  ? 72   DT  J C5    1 
ATOM   7704  C C7    . DT  I 5 72  ? 143.177 163.274 118.978 1.00 68.30  ? 72   DT  J C7    1 
ATOM   7705  C C6    . DT  I 5 72  ? 141.747 165.082 119.902 1.00 68.30  ? 72   DT  J C6    1 
ATOM   7706  P P     . DA  I 5 73  ? 136.359 166.723 122.768 1.00 80.92  ? 73   DA  J P     1 
ATOM   7707  O OP1   . DA  I 5 73  ? 135.944 166.877 124.178 1.00 80.92  ? 73   DA  J OP1   1 
ATOM   7708  O OP2   . DA  I 5 73  ? 136.109 165.452 122.060 1.00 80.92  ? 73   DA  J OP2   1 
ATOM   7709  O "O5'" . DA  I 5 73  ? 135.704 167.893 121.911 1.00 80.92  ? 73   DA  J "O5'" 1 
ATOM   7710  C "C5'" . DA  I 5 73  ? 136.418 169.112 121.746 1.00 80.92  ? 73   DA  J "C5'" 1 
ATOM   7711  C "C4'" . DA  I 5 73  ? 136.279 169.646 120.334 1.00 80.92  ? 73   DA  J "C4'" 1 
ATOM   7712  O "O4'" . DA  I 5 73  ? 137.373 169.180 119.503 1.00 80.92  ? 73   DA  J "O4'" 1 
ATOM   7713  C "C3'" . DA  I 5 73  ? 135.006 169.238 119.610 1.00 80.92  ? 73   DA  J "C3'" 1 
ATOM   7714  O "O3'" . DA  I 5 73  ? 134.510 170.357 118.920 1.00 80.92  ? 73   DA  J "O3'" 1 
ATOM   7715  C "C2'" . DA  I 5 73  ? 135.499 168.163 118.643 1.00 80.92  ? 73   DA  J "C2'" 1 
ATOM   7716  C "C1'" . DA  I 5 73  ? 136.851 168.730 118.281 1.00 80.92  ? 73   DA  J "C1'" 1 
ATOM   7717  N N9    . DA  I 5 73  ? 137.777 167.756 117.733 1.00 80.92  ? 73   DA  J N9    1 
ATOM   7718  C C8    . DA  I 5 73  ? 138.074 166.544 118.254 1.00 80.92  ? 73   DA  J C8    1 
ATOM   7719  N N7    . DA  I 5 73  ? 138.955 165.872 117.565 1.00 80.92  ? 73   DA  J N7    1 
ATOM   7720  C C5    . DA  I 5 73  ? 139.256 166.707 116.518 1.00 80.92  ? 73   DA  J C5    1 
ATOM   7721  C C6    . DA  I 5 73  ? 140.124 166.573 115.438 1.00 80.92  ? 73   DA  J C6    1 
ATOM   7722  N N6    . DA  I 5 73  ? 140.869 165.494 115.242 1.00 80.92  ? 73   DA  J N6    1 
ATOM   7723  N N1    . DA  I 5 73  ? 140.201 167.588 114.562 1.00 80.92  ? 73   DA  J N1    1 
ATOM   7724  C C2    . DA  I 5 73  ? 139.448 168.671 114.765 1.00 80.92  ? 73   DA  J C2    1 
ATOM   7725  N N3    . DA  I 5 73  ? 138.591 168.909 115.756 1.00 80.92  ? 73   DA  J N3    1 
ATOM   7726  C C4    . DA  I 5 73  ? 138.544 167.876 116.604 1.00 80.92  ? 73   DA  J C4    1 
ATOM   7727  P P     . DT  I 5 74  ? 132.934 170.631 118.837 1.00 92.11  ? 74   DT  J P     1 
ATOM   7728  O OP1   . DT  I 5 74  ? 132.641 171.863 119.595 1.00 92.11  ? 74   DT  J OP1   1 
ATOM   7729  O OP2   . DT  I 5 74  ? 132.237 169.371 119.162 1.00 92.11  ? 74   DT  J OP2   1 
ATOM   7730  O "O5'" . DT  I 5 74  ? 132.710 170.915 117.291 1.00 92.11  ? 74   DT  J "O5'" 1 
ATOM   7731  C "C5'" . DT  I 5 74  ? 133.417 170.146 116.361 1.00 92.11  ? 74   DT  J "C5'" 1 
ATOM   7732  C "C4'" . DT  I 5 74  ? 133.869 170.985 115.201 1.00 92.11  ? 74   DT  J "C4'" 1 
ATOM   7733  O "O4'" . DT  I 5 74  ? 135.146 170.485 114.734 1.00 92.11  ? 74   DT  J "O4'" 1 
ATOM   7734  C "C3'" . DT  I 5 74  ? 132.950 170.894 114.011 1.00 92.11  ? 74   DT  J "C3'" 1 
ATOM   7735  O "O3'" . DT  I 5 74  ? 133.096 172.021 113.184 1.00 92.11  ? 74   DT  J "O3'" 1 
ATOM   7736  C "C2'" . DT  I 5 74  ? 133.470 169.647 113.339 1.00 92.11  ? 74   DT  J "C2'" 1 
ATOM   7737  C "C1'" . DT  I 5 74  ? 134.971 169.806 113.510 1.00 92.11  ? 74   DT  J "C1'" 1 
ATOM   7738  N N1    . DT  I 5 74  ? 135.675 168.509 113.590 1.00 92.11  ? 74   DT  J N1    1 
ATOM   7739  C C2    . DT  I 5 74  ? 136.586 168.156 112.621 1.00 92.11  ? 74   DT  J C2    1 
ATOM   7740  O O2    . DT  I 5 74  ? 136.865 168.865 111.678 1.00 92.11  ? 74   DT  J O2    1 
ATOM   7741  N N3    . DT  I 5 74  ? 137.163 166.932 112.806 1.00 92.11  ? 74   DT  J N3    1 
ATOM   7742  C C4    . DT  I 5 74  ? 136.923 166.055 113.832 1.00 92.11  ? 74   DT  J C4    1 
ATOM   7743  O O4    . DT  I 5 74  ? 137.485 164.977 113.922 1.00 92.11  ? 74   DT  J O4    1 
ATOM   7744  C C5    . DT  I 5 74  ? 135.962 166.487 114.800 1.00 92.11  ? 74   DT  J C5    1 
ATOM   7745  C C7    . DT  I 5 74  ? 135.623 165.606 115.958 1.00 92.11  ? 74   DT  J C7    1 
ATOM   7746  C C6    . DT  I 5 74  ? 135.391 167.676 114.635 1.00 92.11  ? 74   DT  J C6    1 
ATOM   7747  P P     . DC  I 5 75  ? 131.919 172.413 112.166 1.00 91.88  ? 75   DC  J P     1 
ATOM   7748  O OP1   . DC  I 5 75  ? 132.133 173.816 111.764 1.00 91.88  ? 75   DC  J OP1   1 
ATOM   7749  O OP2   . DC  I 5 75  ? 130.639 172.007 112.783 1.00 91.88  ? 75   DC  J OP2   1 
ATOM   7750  O "O5'" . DC  I 5 75  ? 132.171 171.467 110.905 1.00 91.88  ? 75   DC  J "O5'" 1 
ATOM   7751  C "C5'" . DC  I 5 75  ? 133.400 171.543 110.207 1.00 91.88  ? 75   DC  J "C5'" 1 
ATOM   7752  C "C4'" . DC  I 5 75  ? 133.464 170.499 109.112 1.00 91.88  ? 75   DC  J "C4'" 1 
ATOM   7753  O "O4'" . DC  I 5 75  ? 134.163 169.325 109.581 1.00 91.88  ? 75   DC  J "O4'" 1 
ATOM   7754  C "C3'" . DC  I 5 75  ? 132.111 170.026 108.592 1.00 91.88  ? 75   DC  J "C3'" 1 
ATOM   7755  O "O3'" . DC  I 5 75  ? 132.029 170.320 107.189 1.00 91.88  ? 75   DC  J "O3'" 1 
ATOM   7756  C "C2'" . DC  I 5 75  ? 132.097 168.521 108.905 1.00 91.88  ? 75   DC  J "C2'" 1 
ATOM   7757  C "C1'" . DC  I 5 75  ? 133.567 168.181 109.034 1.00 91.88  ? 75   DC  J "C1'" 1 
ATOM   7758  N N1    . DC  I 5 75  ? 133.826 167.070 109.964 1.00 91.88  ? 75   DC  J N1    1 
ATOM   7759  C C2    . DC  I 5 75  ? 134.787 166.114 109.663 1.00 91.88  ? 75   DC  J C2    1 
ATOM   7760  O O2    . DC  I 5 75  ? 135.407 166.203 108.606 1.00 91.88  ? 75   DC  J O2    1 
ATOM   7761  N N3    . DC  I 5 75  ? 135.009 165.111 110.547 1.00 91.88  ? 75   DC  J N3    1 
ATOM   7762  C C4    . DC  I 5 75  ? 134.314 165.057 111.679 1.00 91.88  ? 75   DC  J C4    1 
ATOM   7763  N N4    . DC  I 5 75  ? 134.558 164.057 112.524 1.00 91.88  ? 75   DC  J N4    1 
ATOM   7764  C C5    . DC  I 5 75  ? 133.334 166.026 111.997 1.00 91.88  ? 75   DC  J C5    1 
ATOM   7765  C C6    . DC  I 5 75  ? 133.126 167.000 111.117 1.00 91.88  ? 75   DC  J C6    1 
ATOM   7766  P P     . DC  I 5 76  ? 130.966 169.618 106.206 1.00 86.76  ? 76   DC  J P     1 
ATOM   7767  O OP1   . DC  I 5 76  ? 130.836 170.547 105.068 1.00 86.76  ? 76   DC  J OP1   1 
ATOM   7768  O OP2   . DC  I 5 76  ? 129.733 169.164 106.888 1.00 86.76  ? 76   DC  J OP2   1 
ATOM   7769  O "O5'" . DC  I 5 76  ? 131.775 168.374 105.650 1.00 86.76  ? 76   DC  J "O5'" 1 
ATOM   7770  C "C5'" . DC  I 5 76  ? 133.108 168.562 105.227 1.00 86.76  ? 76   DC  J "C5'" 1 
ATOM   7771  C "C4'" . DC  I 5 76  ? 133.569 167.415 104.352 1.00 86.76  ? 76   DC  J "C4'" 1 
ATOM   7772  O "O4'" . DC  I 5 76  ? 134.077 166.346 105.180 1.00 86.76  ? 76   DC  J "O4'" 1 
ATOM   7773  C "C3'" . DC  I 5 76  ? 132.496 166.815 103.461 1.00 86.76  ? 76   DC  J "C3'" 1 
ATOM   7774  O "O3'" . DC  I 5 76  ? 133.026 166.558 102.179 1.00 86.76  ? 76   DC  J "O3'" 1 
ATOM   7775  C "C2'" . DC  I 5 76  ? 132.093 165.534 104.175 1.00 86.76  ? 76   DC  J "C2'" 1 
ATOM   7776  C "C1'" . DC  I 5 76  ? 133.293 165.187 105.044 1.00 86.76  ? 76   DC  J "C1'" 1 
ATOM   7777  N N1    . DC  I 5 76  ? 132.900 164.737 106.397 1.00 86.76  ? 76   DC  J N1    1 
ATOM   7778  C C2    . DC  I 5 76  ? 133.519 163.631 106.962 1.00 86.76  ? 76   DC  J C2    1 
ATOM   7779  O O2    . DC  I 5 76  ? 134.390 163.052 106.321 1.00 86.76  ? 76   DC  J O2    1 
ATOM   7780  N N3    . DC  I 5 76  ? 133.146 163.232 108.197 1.00 86.76  ? 76   DC  J N3    1 
ATOM   7781  C C4    . DC  I 5 76  ? 132.199 163.892 108.850 1.00 86.76  ? 76   DC  J C4    1 
ATOM   7782  N N4    . DC  I 5 76  ? 131.861 163.466 110.066 1.00 86.76  ? 76   DC  J N4    1 
ATOM   7783  C C5    . DC  I 5 76  ? 131.553 165.021 108.288 1.00 86.76  ? 76   DC  J C5    1 
ATOM   7784  C C6    . DC  I 5 76  ? 131.931 165.405 107.071 1.00 86.76  ? 76   DC  J C6    1 
ATOM   7785  P P     . DT  I 5 77  ? 132.113 165.905 101.031 1.00 85.08  ? 77   DT  J P     1 
ATOM   7786  O OP1   . DT  I 5 77  ? 132.616 166.429 99.748  1.00 85.08  ? 77   DT  J OP1   1 
ATOM   7787  O OP2   . DT  I 5 77  ? 130.681 166.095 101.354 1.00 85.08  ? 77   DT  J OP2   1 
ATOM   7788  O "O5'" . DT  I 5 77  ? 132.508 164.359 101.102 1.00 85.08  ? 77   DT  J "O5'" 1 
ATOM   7789  C "C5'" . DT  I 5 77  ? 133.887 164.002 101.032 1.00 85.08  ? 77   DT  J "C5'" 1 
ATOM   7790  C "C4'" . DT  I 5 77  ? 134.115 162.528 101.335 1.00 85.08  ? 77   DT  J "C4'" 1 
ATOM   7791  O "O4'" . DT  I 5 77  ? 133.807 162.237 102.724 1.00 85.08  ? 77   DT  J "O4'" 1 
ATOM   7792  C "C3'" . DT  I 5 77  ? 133.296 161.546 100.510 1.00 85.08  ? 77   DT  J "C3'" 1 
ATOM   7793  O "O3'" . DT  I 5 77  ? 134.130 160.464 100.152 1.00 85.08  ? 77   DT  J "O3'" 1 
ATOM   7794  C "C2'" . DT  I 5 77  ? 132.212 161.115 101.497 1.00 85.08  ? 77   DT  J "C2'" 1 
ATOM   7795  C "C1'" . DT  I 5 77  ? 133.003 161.085 102.787 1.00 85.08  ? 77   DT  J "C1'" 1 
ATOM   7796  N N1    . DT  I 5 77  ? 132.191 161.167 104.047 1.00 85.08  ? 77   DT  J N1    1 
ATOM   7797  C C2    . DT  I 5 77  ? 132.444 160.283 105.068 1.00 85.08  ? 77   DT  J C2    1 
ATOM   7798  O O2    . DT  I 5 77  ? 133.287 159.414 105.002 1.00 85.08  ? 77   DT  J O2    1 
ATOM   7799  N N3    . DT  I 5 77  ? 131.665 160.452 106.178 1.00 85.08  ? 77   DT  J N3    1 
ATOM   7800  C C4    . DT  I 5 77  ? 130.685 161.396 106.369 1.00 85.08  ? 77   DT  J C4    1 
ATOM   7801  O O4    . DT  I 5 77  ? 130.035 161.471 107.402 1.00 85.08  ? 77   DT  J O4    1 
ATOM   7802  C C5    . DT  I 5 77  ? 130.474 162.291 105.273 1.00 85.08  ? 77   DT  J C5    1 
ATOM   7803  C C7    . DT  I 5 77  ? 129.427 163.354 105.379 1.00 85.08  ? 77   DT  J C7    1 
ATOM   7804  C C6    . DT  I 5 77  ? 131.229 162.138 104.174 1.00 85.08  ? 77   DT  J C6    1 
ATOM   7805  P P     . DT  I 5 78  ? 133.834 159.585 98.843  1.00 81.44  ? 78   DT  J P     1 
ATOM   7806  O OP1   . DT  I 5 78  ? 134.854 159.912 97.827  1.00 81.44  ? 78   DT  J OP1   1 
ATOM   7807  O OP2   . DT  I 5 78  ? 132.395 159.696 98.521  1.00 81.44  ? 78   DT  J OP2   1 
ATOM   7808  O "O5'" . DT  I 5 78  ? 134.118 158.101 99.342  1.00 81.44  ? 78   DT  J "O5'" 1 
ATOM   7809  C "C5'" . DT  I 5 78  ? 134.732 157.907 100.606 1.00 81.44  ? 78   DT  J "C5'" 1 
ATOM   7810  C "C4'" . DT  I 5 78  ? 134.208 156.662 101.299 1.00 81.44  ? 78   DT  J "C4'" 1 
ATOM   7811  O "O4'" . DT  I 5 78  ? 133.371 157.029 102.430 1.00 81.44  ? 78   DT  J "O4'" 1 
ATOM   7812  C "C3'" . DT  I 5 78  ? 133.348 155.735 100.450 1.00 81.44  ? 78   DT  J "C3'" 1 
ATOM   7813  O "O3'" . DT  I 5 78  ? 133.560 154.434 100.913 1.00 81.44  ? 78   DT  J "O3'" 1 
ATOM   7814  C "C2'" . DT  I 5 78  ? 131.948 156.206 100.819 1.00 81.44  ? 78   DT  J "C2'" 1 
ATOM   7815  C "C1'" . DT  I 5 78  ? 132.143 156.351 102.312 1.00 81.44  ? 78   DT  J "C1'" 1 
ATOM   7816  N N1    . DT  I 5 78  ? 131.102 157.131 103.026 1.00 81.44  ? 78   DT  J N1    1 
ATOM   7817  C C2    . DT  I 5 78  ? 130.807 156.807 104.325 1.00 81.44  ? 78   DT  J C2    1 
ATOM   7818  O O2    . DT  I 5 78  ? 131.349 155.900 104.922 1.00 81.44  ? 78   DT  J O2    1 
ATOM   7819  N N3    . DT  I 5 78  ? 129.851 157.580 104.905 1.00 81.44  ? 78   DT  J N3    1 
ATOM   7820  C C4    . DT  I 5 78  ? 129.177 158.624 104.329 1.00 81.44  ? 78   DT  J C4    1 
ATOM   7821  O O4    . DT  I 5 78  ? 128.330 159.266 104.927 1.00 81.44  ? 78   DT  J O4    1 
ATOM   7822  C C5    . DT  I 5 78  ? 129.530 158.915 102.974 1.00 81.44  ? 78   DT  J C5    1 
ATOM   7823  C C7    . DT  I 5 78  ? 128.848 160.036 102.258 1.00 81.44  ? 78   DT  J C7    1 
ATOM   7824  C C6    . DT  I 5 78  ? 130.469 158.164 102.391 1.00 81.44  ? 78   DT  J C6    1 
ATOM   7825  P P     . DC  I 5 79  ? 133.422 153.162 99.953  1.00 78.92  ? 79   DC  J P     1 
ATOM   7826  O OP1   . DC  I 5 79  ? 134.539 153.200 98.990  1.00 78.92  ? 79   DC  J OP1   1 
ATOM   7827  O OP2   . DC  I 5 79  ? 132.024 153.102 99.475  1.00 78.92  ? 79   DC  J OP2   1 
ATOM   7828  O "O5'" . DC  I 5 79  ? 133.662 151.945 100.959 1.00 78.92  ? 79   DC  J "O5'" 1 
ATOM   7829  C "C5'" . DC  I 5 79  ? 133.808 152.213 102.359 1.00 78.92  ? 79   DC  J "C5'" 1 
ATOM   7830  C "C4'" . DC  I 5 79  ? 132.737 151.509 103.171 1.00 78.92  ? 79   DC  J "C4'" 1 
ATOM   7831  O "O4'" . DC  I 5 79  ? 131.762 152.469 103.674 1.00 78.92  ? 79   DC  J "O4'" 1 
ATOM   7832  C "C3'" . DC  I 5 79  ? 131.928 150.467 102.408 1.00 78.92  ? 79   DC  J "C3'" 1 
ATOM   7833  O "O3'" . DC  I 5 79  ? 131.567 149.398 103.292 1.00 78.92  ? 79   DC  J "O3'" 1 
ATOM   7834  C "C2'" . DC  I 5 79  ? 130.695 151.281 102.016 1.00 78.92  ? 79   DC  J "C2'" 1 
ATOM   7835  C "C1'" . DC  I 5 79  ? 130.472 152.032 103.314 1.00 78.92  ? 79   DC  J "C1'" 1 
ATOM   7836  N N1    . DC  I 5 79  ? 129.591 153.216 103.200 1.00 78.92  ? 79   DC  J N1    1 
ATOM   7837  C C2    . DC  I 5 79  ? 128.803 153.625 104.291 1.00 78.92  ? 79   DC  J C2    1 
ATOM   7838  O O2    . DC  I 5 79  ? 128.841 152.987 105.343 1.00 78.92  ? 79   DC  J O2    1 
ATOM   7839  N N3    . DC  I 5 79  ? 128.016 154.721 104.154 1.00 78.92  ? 79   DC  J N3    1 
ATOM   7840  C C4    . DC  I 5 79  ? 128.001 155.384 103.005 1.00 78.92  ? 79   DC  J C4    1 
ATOM   7841  N N4    . DC  I 5 79  ? 127.217 156.457 102.905 1.00 78.92  ? 79   DC  J N4    1 
ATOM   7842  C C5    . DC  I 5 79  ? 128.791 154.981 101.898 1.00 78.92  ? 79   DC  J C5    1 
ATOM   7843  C C6    . DC  I 5 79  ? 129.561 153.903 102.039 1.00 78.92  ? 79   DC  J C6    1 
ATOM   7844  P P     . DA  I 5 80  ? 132.562 148.171 103.615 1.00 67.11  ? 80   DA  J P     1 
ATOM   7845  O OP1   . DA  I 5 80  ? 133.946 148.487 103.205 1.00 67.11  ? 80   DA  J OP1   1 
ATOM   7846  O OP2   . DA  I 5 80  ? 131.920 146.959 103.072 1.00 67.11  ? 80   DA  J OP2   1 
ATOM   7847  O "O5'" . DA  I 5 80  ? 132.486 148.059 105.208 1.00 67.11  ? 80   DA  J "O5'" 1 
ATOM   7848  C "C5'" . DA  I 5 80  ? 131.907 149.134 105.949 1.00 67.11  ? 80   DA  J "C5'" 1 
ATOM   7849  C "C4'" . DA  I 5 80  ? 130.871 148.660 106.962 1.00 67.11  ? 80   DA  J "C4'" 1 
ATOM   7850  O "O4'" . DA  I 5 80  ? 129.637 149.391 106.772 1.00 67.11  ? 80   DA  J "O4'" 1 
ATOM   7851  C "C3'" . DA  I 5 80  ? 130.451 147.215 106.872 1.00 67.11  ? 80   DA  J "C3'" 1 
ATOM   7852  O "O3'" . DA  I 5 80  ? 129.826 146.874 108.087 1.00 67.11  ? 80   DA  J "O3'" 1 
ATOM   7853  C "C2'" . DA  I 5 80  ? 129.423 147.291 105.755 1.00 67.11  ? 80   DA  J "C2'" 1 
ATOM   7854  C "C1'" . DA  I 5 80  ? 128.679 148.554 106.148 1.00 67.11  ? 80   DA  J "C1'" 1 
ATOM   7855  N N9    . DA  I 5 80  ? 128.137 149.280 105.021 1.00 67.11  ? 80   DA  J N9    1 
ATOM   7856  C C8    . DA  I 5 80  ? 128.489 149.142 103.720 1.00 67.11  ? 80   DA  J C8    1 
ATOM   7857  N N7    . DA  I 5 80  ? 127.843 149.942 102.914 1.00 67.11  ? 80   DA  J N7    1 
ATOM   7858  C C5    . DA  I 5 80  ? 127.017 150.655 103.748 1.00 67.11  ? 80   DA  J C5    1 
ATOM   7859  C C6    . DA  I 5 80  ? 126.081 151.663 103.505 1.00 67.11  ? 80   DA  J C6    1 
ATOM   7860  N N6    . DA  I 5 80  ? 125.821 152.139 102.289 1.00 67.11  ? 80   DA  J N6    1 
ATOM   7861  N N1    . DA  I 5 80  ? 125.415 152.166 104.558 1.00 67.11  ? 80   DA  J N1    1 
ATOM   7862  C C2    . DA  I 5 80  ? 125.674 151.685 105.771 1.00 67.11  ? 80   DA  J C2    1 
ATOM   7863  N N3    . DA  I 5 80  ? 126.538 150.740 106.123 1.00 67.11  ? 80   DA  J N3    1 
ATOM   7864  C C4    . DA  I 5 80  ? 127.181 150.261 105.051 1.00 67.11  ? 80   DA  J C4    1 
ATOM   7865  P P     . DC  I 5 81  ? 129.750 145.360 108.597 1.00 54.96  ? 81   DC  J P     1 
ATOM   7866  O OP1   . DC  I 5 81  ? 130.953 145.149 109.410 1.00 54.96  ? 81   DC  J OP1   1 
ATOM   7867  O OP2   . DC  I 5 81  ? 129.442 144.452 107.481 1.00 54.96  ? 81   DC  J OP2   1 
ATOM   7868  O "O5'" . DC  I 5 81  ? 128.502 145.385 109.578 1.00 54.96  ? 81   DC  J "O5'" 1 
ATOM   7869  C "C5'" . DC  I 5 81  ? 128.429 146.389 110.566 1.00 54.96  ? 81   DC  J "C5'" 1 
ATOM   7870  C "C4'" . DC  I 5 81  ? 127.004 146.853 110.777 1.00 54.96  ? 81   DC  J "C4'" 1 
ATOM   7871  O "O4'" . DC  I 5 81  ? 126.524 147.531 109.592 1.00 54.96  ? 81   DC  J "O4'" 1 
ATOM   7872  C "C3'" . DC  I 5 81  ? 125.999 145.761 111.084 1.00 54.96  ? 81   DC  J "C3'" 1 
ATOM   7873  O "O3'" . DC  I 5 81  ? 125.162 146.201 112.118 1.00 54.96  ? 81   DC  J "O3'" 1 
ATOM   7874  C "C2'" . DC  I 5 81  ? 125.249 145.608 109.773 1.00 54.96  ? 81   DC  J "C2'" 1 
ATOM   7875  C "C1'" . DC  I 5 81  ? 125.277 147.010 109.210 1.00 54.96  ? 81   DC  J "C1'" 1 
ATOM   7876  N N1    . DC  I 5 81  ? 125.204 147.068 107.712 1.00 54.96  ? 81   DC  J N1    1 
ATOM   7877  C C2    . DC  I 5 81  ? 124.308 147.934 107.078 1.00 54.96  ? 81   DC  J C2    1 
ATOM   7878  O O2    . DC  I 5 81  ? 123.574 148.639 107.759 1.00 54.96  ? 81   DC  J O2    1 
ATOM   7879  N N3    . DC  I 5 81  ? 124.277 147.970 105.729 1.00 54.96  ? 81   DC  J N3    1 
ATOM   7880  C C4    . DC  I 5 81  ? 125.088 147.194 105.031 1.00 54.96  ? 81   DC  J C4    1 
ATOM   7881  N N4    . DC  I 5 81  ? 125.030 147.255 103.698 1.00 54.96  ? 81   DC  J N4    1 
ATOM   7882  C C5    . DC  I 5 81  ? 125.995 146.310 105.656 1.00 54.96  ? 81   DC  J C5    1 
ATOM   7883  C C6    . DC  I 5 81  ? 126.023 146.286 106.983 1.00 54.96  ? 81   DC  J C6    1 
ATOM   7884  P P     . DT  I 5 82  ? 124.076 145.231 112.788 1.00 54.82  ? 82   DT  J P     1 
ATOM   7885  O OP1   . DT  I 5 82  ? 124.188 145.385 114.239 1.00 54.82  ? 82   DT  J OP1   1 
ATOM   7886  O OP2   . DT  I 5 82  ? 124.139 143.871 112.231 1.00 54.82  ? 82   DT  J OP2   1 
ATOM   7887  O "O5'" . DT  I 5 82  ? 122.714 145.920 112.381 1.00 54.82  ? 82   DT  J "O5'" 1 
ATOM   7888  C "C5'" . DT  I 5 82  ? 122.607 147.323 112.472 1.00 54.82  ? 82   DT  J "C5'" 1 
ATOM   7889  C "C4'" . DT  I 5 82  ? 121.294 147.819 111.904 1.00 54.82  ? 82   DT  J "C4'" 1 
ATOM   7890  O "O4'" . DT  I 5 82  ? 121.382 147.908 110.461 1.00 54.82  ? 82   DT  J "O4'" 1 
ATOM   7891  C "C3'" . DT  I 5 82  ? 120.099 146.936 112.196 1.00 54.82  ? 82   DT  J "C3'" 1 
ATOM   7892  O "O3'" . DT  I 5 82  ? 118.993 147.732 112.518 1.00 54.82  ? 82   DT  J "O3'" 1 
ATOM   7893  C "C2'" . DT  I 5 82  ? 119.890 146.203 110.881 1.00 54.82  ? 82   DT  J "C2'" 1 
ATOM   7894  C "C1'" . DT  I 5 82  ? 120.283 147.255 109.884 1.00 54.82  ? 82   DT  J "C1'" 1 
ATOM   7895  N N1    . DT  I 5 82  ? 120.720 146.727 108.577 1.00 54.82  ? 82   DT  J N1    1 
ATOM   7896  C C2    . DT  I 5 82  ? 120.196 147.268 107.441 1.00 54.82  ? 82   DT  J C2    1 
ATOM   7897  O O2    . DT  I 5 82  ? 119.374 148.156 107.450 1.00 54.82  ? 82   DT  J O2    1 
ATOM   7898  N N3    . DT  I 5 82  ? 120.670 146.727 106.283 1.00 54.82  ? 82   DT  J N3    1 
ATOM   7899  C C4    . DT  I 5 82  ? 121.593 145.727 106.149 1.00 54.82  ? 82   DT  J C4    1 
ATOM   7900  O O4    . DT  I 5 82  ? 121.957 145.305 105.067 1.00 54.82  ? 82   DT  J O4    1 
ATOM   7901  C C5    . DT  I 5 82  ? 122.107 145.207 107.364 1.00 54.82  ? 82   DT  J C5    1 
ATOM   7902  C C7    . DT  I 5 82  ? 123.115 144.111 107.309 1.00 54.82  ? 82   DT  J C7    1 
ATOM   7903  C C6    . DT  I 5 82  ? 121.657 145.722 108.519 1.00 54.82  ? 82   DT  J C6    1 
ATOM   7904  P P     . DT  I 5 83  ? 117.815 147.114 113.405 1.00 60.18  ? 83   DT  J P     1 
ATOM   7905  O OP1   . DT  I 5 83  ? 117.473 148.103 114.440 1.00 60.18  ? 83   DT  J OP1   1 
ATOM   7906  O OP2   . DT  I 5 83  ? 118.237 145.755 113.775 1.00 60.18  ? 83   DT  J OP2   1 
ATOM   7907  O "O5'" . DT  I 5 83  ? 116.600 146.963 112.384 1.00 60.18  ? 83   DT  J "O5'" 1 
ATOM   7908  C "C5'" . DT  I 5 83  ? 116.045 148.112 111.795 1.00 60.18  ? 83   DT  J "C5'" 1 
ATOM   7909  C "C4'" . DT  I 5 83  ? 115.232 147.760 110.569 1.00 60.18  ? 83   DT  J "C4'" 1 
ATOM   7910  O "O4'" . DT  I 5 83  ? 116.103 147.269 109.527 1.00 60.18  ? 83   DT  J "O4'" 1 
ATOM   7911  C "C3'" . DT  I 5 83  ? 114.170 146.689 110.779 1.00 60.18  ? 83   DT  J "C3'" 1 
ATOM   7912  O "O3'" . DT  I 5 83  ? 112.935 147.179 110.317 1.00 60.18  ? 83   DT  J "O3'" 1 
ATOM   7913  C "C2'" . DT  I 5 83  ? 114.663 145.523 109.927 1.00 60.18  ? 83   DT  J "C2'" 1 
ATOM   7914  C "C1'" . DT  I 5 83  ? 115.459 146.230 108.857 1.00 60.18  ? 83   DT  J "C1'" 1 
ATOM   7915  N N1    . DT  I 5 83  ? 116.487 145.381 108.243 1.00 60.18  ? 83   DT  J N1    1 
ATOM   7916  C C2    . DT  I 5 83  ? 116.636 145.377 106.884 1.00 60.18  ? 83   DT  J C2    1 
ATOM   7917  O O2    . DT  I 5 83  ? 115.954 146.041 106.137 1.00 60.18  ? 83   DT  J O2    1 
ATOM   7918  N N3    . DT  I 5 83  ? 117.621 144.561 106.426 1.00 60.18  ? 83   DT  J N3    1 
ATOM   7919  C C4    . DT  I 5 83  ? 118.454 143.769 107.164 1.00 60.18  ? 83   DT  J C4    1 
ATOM   7920  O O4    . DT  I 5 83  ? 119.314 143.066 106.660 1.00 60.18  ? 83   DT  J O4    1 
ATOM   7921  C C5    . DT  I 5 83  ? 118.249 143.818 108.578 1.00 60.18  ? 83   DT  J C5    1 
ATOM   7922  C C7    . DT  I 5 83  ? 119.107 142.982 109.482 1.00 60.18  ? 83   DT  J C7    1 
ATOM   7923  C C6    . DT  I 5 83  ? 117.286 144.616 109.046 1.00 60.18  ? 83   DT  J C6    1 
ATOM   7924  P P     . DT  I 5 84  ? 111.560 146.455 110.707 1.00 71.52  ? 84   DT  J P     1 
ATOM   7925  O OP1   . DT  I 5 84  ? 110.626 147.504 111.151 1.00 71.52  ? 84   DT  J OP1   1 
ATOM   7926  O OP2   . DT  I 5 84  ? 111.853 145.319 111.599 1.00 71.52  ? 84   DT  J OP2   1 
ATOM   7927  O "O5'" . DT  I 5 84  ? 111.044 145.886 109.313 1.00 71.52  ? 84   DT  J "O5'" 1 
ATOM   7928  C "C5'" . DT  I 5 84  ? 111.032 146.732 108.187 1.00 71.52  ? 84   DT  J "C5'" 1 
ATOM   7929  C "C4'" . DT  I 5 84  ? 110.960 145.929 106.909 1.00 71.52  ? 84   DT  J "C4'" 1 
ATOM   7930  O "O4'" . DT  I 5 84  ? 112.243 145.333 106.628 1.00 71.52  ? 84   DT  J "O4'" 1 
ATOM   7931  C "C3'" . DT  I 5 84  ? 109.955 144.787 106.935 1.00 71.52  ? 84   DT  J "C3'" 1 
ATOM   7932  O "O3'" . DT  I 5 84  ? 108.995 144.986 105.913 1.00 71.52  ? 84   DT  J "O3'" 1 
ATOM   7933  C "C2'" . DT  I 5 84  ? 110.801 143.528 106.698 1.00 71.52  ? 84   DT  J "C2'" 1 
ATOM   7934  C "C1'" . DT  I 5 84  ? 112.044 144.083 106.033 1.00 71.52  ? 84   DT  J "C1'" 1 
ATOM   7935  N N1    . DT  I 5 84  ? 113.243 143.272 106.285 1.00 71.52  ? 84   DT  J N1    1 
ATOM   7936  C C2    . DT  I 5 84  ? 114.010 142.842 105.233 1.00 71.52  ? 84   DT  J C2    1 
ATOM   7937  O O2    . DT  I 5 84  ? 113.758 143.093 104.076 1.00 71.52  ? 84   DT  J O2    1 
ATOM   7938  N N3    . DT  I 5 84  ? 115.092 142.102 105.589 1.00 71.52  ? 84   DT  J N3    1 
ATOM   7939  C C4    . DT  I 5 84  ? 115.479 141.756 106.857 1.00 71.52  ? 84   DT  J C4    1 
ATOM   7940  O O4    . DT  I 5 84  ? 116.472 141.086 107.081 1.00 71.52  ? 84   DT  J O4    1 
ATOM   7941  C C5    . DT  I 5 84  ? 114.637 142.237 107.909 1.00 71.52  ? 84   DT  J C5    1 
ATOM   7942  C C7    . DT  I 5 84  ? 114.963 141.914 109.333 1.00 71.52  ? 84   DT  J C7    1 
ATOM   7943  C C6    . DT  I 5 84  ? 113.570 142.962 107.577 1.00 71.52  ? 84   DT  J C6    1 
ATOM   7944  P P     . DC  I 5 85  ? 107.716 144.026 105.798 1.00 75.06  ? 85   DC  J P     1 
ATOM   7945  O OP1   . DC  I 5 85  ? 106.610 144.837 105.262 1.00 75.06  ? 85   DC  J OP1   1 
ATOM   7946  O OP2   . DC  I 5 85  ? 107.525 143.307 107.074 1.00 75.06  ? 85   DC  J OP2   1 
ATOM   7947  O "O5'" . DC  I 5 85  ? 108.156 142.979 104.688 1.00 75.06  ? 85   DC  J "O5'" 1 
ATOM   7948  C "C5'" . DC  I 5 85  ? 108.876 143.426 103.545 1.00 75.06  ? 85   DC  J "C5'" 1 
ATOM   7949  C "C4'" . DC  I 5 85  ? 109.175 142.272 102.614 1.00 75.06  ? 85   DC  J "C4'" 1 
ATOM   7950  O "O4'" . DC  I 5 85  ? 110.475 141.716 102.931 1.00 75.06  ? 85   DC  J "O4'" 1 
ATOM   7951  C "C3'" . DC  I 5 85  ? 108.186 141.116 102.705 1.00 75.06  ? 85   DC  J "C3'" 1 
ATOM   7952  O "O3'" . DC  I 5 85  ? 107.896 140.620 101.408 1.00 75.06  ? 85   DC  J "O3'" 1 
ATOM   7953  C "C2'" . DC  I 5 85  ? 108.938 140.092 103.547 1.00 75.06  ? 85   DC  J "C2'" 1 
ATOM   7954  C "C1'" . DC  I 5 85  ? 110.361 140.326 103.093 1.00 75.06  ? 85   DC  J "C1'" 1 
ATOM   7955  N N1    . DC  I 5 85  ? 111.379 139.886 104.072 1.00 75.06  ? 85   DC  J N1    1 
ATOM   7956  C C2    . DC  I 5 85  ? 112.553 139.297 103.614 1.00 75.06  ? 85   DC  J C2    1 
ATOM   7957  O O2    . DC  I 5 85  ? 112.711 139.156 102.404 1.00 75.06  ? 85   DC  J O2    1 
ATOM   7958  N N3    . DC  I 5 85  ? 113.479 138.898 104.509 1.00 75.06  ? 85   DC  J N3    1 
ATOM   7959  C C4    . DC  I 5 85  ? 113.261 139.072 105.805 1.00 75.06  ? 85   DC  J C4    1 
ATOM   7960  N N4    . DC  I 5 85  ? 114.201 138.666 106.658 1.00 75.06  ? 85   DC  J N4    1 
ATOM   7961  C C5    . DC  I 5 85  ? 112.068 139.675 106.291 1.00 75.06  ? 85   DC  J C5    1 
ATOM   7962  C C6    . DC  I 5 85  ? 111.162 140.062 105.397 1.00 75.06  ? 85   DC  J C6    1 
ATOM   7963  P P     . DC  I 5 86  ? 106.565 139.756 101.150 1.00 76.25  ? 86   DC  J P     1 
ATOM   7964  O OP1   . DC  I 5 86  ? 105.805 140.420 100.075 1.00 76.25  ? 86   DC  J OP1   1 
ATOM   7965  O OP2   . DC  I 5 86  ? 105.900 139.504 102.444 1.00 76.25  ? 86   DC  J OP2   1 
ATOM   7966  O "O5'" . DC  I 5 86  ? 107.118 138.363 100.598 1.00 76.25  ? 86   DC  J "O5'" 1 
ATOM   7967  C "C5'" . DC  I 5 86  ? 107.824 138.324 99.366  1.00 76.25  ? 86   DC  J "C5'" 1 
ATOM   7968  C "C4'" . DC  I 5 86  ? 108.671 137.069 99.249  1.00 76.25  ? 86   DC  J "C4'" 1 
ATOM   7969  O "O4'" . DC  I 5 86  ? 109.664 137.048 100.301 1.00 76.25  ? 86   DC  J "O4'" 1 
ATOM   7970  C "C3'" . DC  I 5 86  ? 107.915 135.743 99.361  1.00 76.25  ? 86   DC  J "C3'" 1 
ATOM   7971  O "O3'" . DC  I 5 86  ? 108.450 134.814 98.427  1.00 76.25  ? 86   DC  J "O3'" 1 
ATOM   7972  C "C2'" . DC  I 5 86  ? 108.216 135.312 100.788 1.00 76.25  ? 86   DC  J "C2'" 1 
ATOM   7973  C "C1'" . DC  I 5 86  ? 109.643 135.793 100.925 1.00 76.25  ? 86   DC  J "C1'" 1 
ATOM   7974  N N1    . DC  I 5 86  ? 110.070 135.971 102.313 1.00 76.25  ? 86   DC  J N1    1 
ATOM   7975  C C2    . DC  I 5 86  ? 111.326 135.527 102.707 1.00 76.25  ? 86   DC  J C2    1 
ATOM   7976  O O2    . DC  I 5 86  ? 112.050 134.980 101.875 1.00 76.25  ? 86   DC  J O2    1 
ATOM   7977  N N3    . DC  I 5 86  ? 111.706 135.698 103.992 1.00 76.25  ? 86   DC  J N3    1 
ATOM   7978  C C4    . DC  I 5 86  ? 110.885 136.291 104.851 1.00 76.25  ? 86   DC  J C4    1 
ATOM   7979  N N4    . DC  I 5 86  ? 111.297 136.446 106.108 1.00 76.25  ? 86   DC  J N4    1 
ATOM   7980  C C5    . DC  I 5 86  ? 109.603 136.751 104.465 1.00 76.25  ? 86   DC  J C5    1 
ATOM   7981  C C6    . DC  I 5 86  ? 109.241 136.573 103.197 1.00 76.25  ? 86   DC  J C6    1 
ATOM   7982  P P     . DA  I 5 87  ? 107.565 133.583 97.893  1.00 75.96  ? 87   DA  J P     1 
ATOM   7983  O OP1   . DA  I 5 87  ? 107.429 133.750 96.432  1.00 75.96  ? 87   DA  J OP1   1 
ATOM   7984  O OP2   . DA  I 5 87  ? 106.362 133.463 98.747  1.00 75.96  ? 87   DA  J OP2   1 
ATOM   7985  O "O5'" . DA  I 5 87  ? 108.486 132.307 98.158  1.00 75.96  ? 87   DA  J "O5'" 1 
ATOM   7986  C "C5'" . DA  I 5 87  ? 109.822 132.274 97.660  1.00 75.96  ? 87   DA  J "C5'" 1 
ATOM   7987  C "C4'" . DA  I 5 87  ? 110.714 131.338 98.472  1.00 75.96  ? 87   DA  J "C4'" 1 
ATOM   7988  O "O4'" . DA  I 5 87  ? 111.074 131.950 99.742  1.00 75.96  ? 87   DA  J "O4'" 1 
ATOM   7989  C "C3'" . DA  I 5 87  ? 110.110 129.983 98.838  1.00 75.96  ? 87   DA  J "C3'" 1 
ATOM   7990  O "O3'" . DA  I 5 87  ? 111.134 129.012 98.825  1.00 75.96  ? 87   DA  J "O3'" 1 
ATOM   7991  C "C2'" . DA  I 5 87  ? 109.647 130.230 100.263 1.00 75.96  ? 87   DA  J "C2'" 1 
ATOM   7992  C "C1'" . DA  I 5 87  ? 110.843 131.005 100.759 1.00 75.96  ? 87   DA  J "C1'" 1 
ATOM   7993  N N9    . DA  I 5 87  ? 110.633 131.704 102.016 1.00 75.96  ? 87   DA  J N9    1 
ATOM   7994  C C8    . DA  I 5 87  ? 109.576 132.491 102.350 1.00 75.96  ? 87   DA  J C8    1 
ATOM   7995  N N7    . DA  I 5 87  ? 109.655 132.998 103.552 1.00 75.96  ? 87   DA  J N7    1 
ATOM   7996  C C5    . DA  I 5 87  ? 110.850 132.508 104.041 1.00 75.96  ? 87   DA  J C5    1 
ATOM   7997  C C6    . DA  I 5 87  ? 111.510 132.681 105.266 1.00 75.96  ? 87   DA  J C6    1 
ATOM   7998  N N6    . DA  I 5 87  ? 111.023 133.427 106.249 1.00 75.96  ? 87   DA  J N6    1 
ATOM   7999  N N1    . DA  I 5 87  ? 112.690 132.053 105.444 1.00 75.96  ? 87   DA  J N1    1 
ATOM   8000  C C2    . DA  I 5 87  ? 113.173 131.301 104.447 1.00 75.96  ? 87   DA  J C2    1 
ATOM   8001  N N3    . DA  I 5 87  ? 112.639 131.067 103.246 1.00 75.96  ? 87   DA  J N3    1 
ATOM   8002  C C4    . DA  I 5 87  ? 111.467 131.708 103.109 1.00 75.96  ? 87   DA  J C4    1 
ATOM   8003  P P     . DG  I 5 88  ? 111.027 127.718 97.885  1.00 70.14  ? 88   DG  J P     1 
ATOM   8004  O OP1   . DG  I 5 88  ? 111.551 128.084 96.553  1.00 70.14  ? 88   DG  J OP1   1 
ATOM   8005  O OP2   . DG  I 5 88  ? 109.662 127.168 98.032  1.00 70.14  ? 88   DG  J OP2   1 
ATOM   8006  O "O5'" . DG  I 5 88  ? 112.050 126.690 98.549  1.00 70.14  ? 88   DG  J "O5'" 1 
ATOM   8007  C "C5'" . DG  I 5 88  ? 113.365 127.110 98.880  1.00 70.14  ? 88   DG  J "C5'" 1 
ATOM   8008  C "C4'" . DG  I 5 88  ? 113.770 126.672 100.283 1.00 70.14  ? 88   DG  J "C4'" 1 
ATOM   8009  O "O4'" . DG  I 5 88  ? 113.251 127.596 101.277 1.00 70.14  ? 88   DG  J "O4'" 1 
ATOM   8010  C "C3'" . DG  I 5 88  ? 113.284 125.289 100.734 1.00 70.14  ? 88   DG  J "C3'" 1 
ATOM   8011  O "O3'" . DG  I 5 88  ? 114.249 124.733 101.598 1.00 70.14  ? 88   DG  J "O3'" 1 
ATOM   8012  C "C2'" . DG  I 5 88  ? 112.070 125.668 101.562 1.00 70.14  ? 88   DG  J "C2'" 1 
ATOM   8013  C "C1'" . DG  I 5 88  ? 112.698 126.821 102.303 1.00 70.14  ? 88   DG  J "C1'" 1 
ATOM   8014  N N9    . DG  I 5 88  ? 111.787 127.620 103.102 1.00 70.14  ? 88   DG  J N9    1 
ATOM   8015  C C8    . DG  I 5 88  ? 110.572 128.092 102.728 1.00 70.14  ? 88   DG  J C8    1 
ATOM   8016  N N7    . DG  I 5 88  ? 109.974 128.787 103.645 1.00 70.14  ? 88   DG  J N7    1 
ATOM   8017  C C5    . DG  I 5 88  ? 110.851 128.764 104.706 1.00 70.14  ? 88   DG  J C5    1 
ATOM   8018  C C6    . DG  I 5 88  ? 110.738 129.349 105.983 1.00 70.14  ? 88   DG  J C6    1 
ATOM   8019  O O6    . DG  I 5 88  ? 109.804 130.019 106.428 1.00 70.14  ? 88   DG  J O6    1 
ATOM   8020  N N1    . DG  I 5 88  ? 111.850 129.092 106.773 1.00 70.14  ? 88   DG  J N1    1 
ATOM   8021  C C2    . DG  I 5 88  ? 112.941 128.360 106.374 1.00 70.14  ? 88   DG  J C2    1 
ATOM   8022  N N2    . DG  I 5 88  ? 113.928 128.217 107.276 1.00 70.14  ? 88   DG  J N2    1 
ATOM   8023  N N3    . DG  I 5 88  ? 113.059 127.807 105.169 1.00 70.14  ? 88   DG  J N3    1 
ATOM   8024  C C4    . DG  I 5 88  ? 111.976 128.053 104.392 1.00 70.14  ? 88   DG  J C4    1 
ATOM   8025  P P     . DA  I 5 89  ? 115.442 123.792 101.082 1.00 67.90  ? 89   DA  J P     1 
ATOM   8026  O OP1   . DA  I 5 89  ? 115.975 124.268 99.790  1.00 67.90  ? 89   DA  J OP1   1 
ATOM   8027  O OP2   . DA  I 5 89  ? 114.974 122.402 101.227 1.00 67.90  ? 89   DA  J OP2   1 
ATOM   8028  O "O5'" . DA  I 5 89  ? 116.558 124.021 102.194 1.00 67.90  ? 89   DA  J "O5'" 1 
ATOM   8029  C "C5'" . DA  I 5 89  ? 116.301 124.932 103.250 1.00 67.90  ? 89   DA  J "C5'" 1 
ATOM   8030  C "C4'" . DA  I 5 89  ? 116.560 124.284 104.583 1.00 67.90  ? 89   DA  J "C4'" 1 
ATOM   8031  O "O4'" . DA  I 5 89  ? 115.577 124.739 105.550 1.00 67.90  ? 89   DA  J "O4'" 1 
ATOM   8032  C "C3'" . DA  I 5 89  ? 116.420 122.791 104.580 1.00 67.90  ? 89   DA  J "C3'" 1 
ATOM   8033  O "O3'" . DA  I 5 89  ? 117.112 122.270 105.700 1.00 67.90  ? 89   DA  J "O3'" 1 
ATOM   8034  C "C2'" . DA  I 5 89  ? 114.914 122.653 104.741 1.00 67.90  ? 89   DA  J "C2'" 1 
ATOM   8035  C "C1'" . DA  I 5 89  ? 114.648 123.707 105.808 1.00 67.90  ? 89   DA  J "C1'" 1 
ATOM   8036  N N9    . DA  I 5 89  ? 113.328 124.291 105.738 1.00 67.90  ? 89   DA  J N9    1 
ATOM   8037  C C8    . DA  I 5 89  ? 112.519 124.298 104.662 1.00 67.90  ? 89   DA  J C8    1 
ATOM   8038  N N7    . DA  I 5 89  ? 111.383 124.915 104.848 1.00 67.90  ? 89   DA  J N7    1 
ATOM   8039  C C5    . DA  I 5 89  ? 111.448 125.335 106.153 1.00 67.90  ? 89   DA  J C5    1 
ATOM   8040  C C6    . DA  I 5 89  ? 110.551 126.055 106.953 1.00 67.90  ? 89   DA  J C6    1 
ATOM   8041  N N6    . DA  I 5 89  ? 109.363 126.472 106.517 1.00 67.90  ? 89   DA  J N6    1 
ATOM   8042  N N1    . DA  I 5 89  ? 110.913 126.325 108.219 1.00 67.90  ? 89   DA  J N1    1 
ATOM   8043  C C2    . DA  I 5 89  ? 112.107 125.902 108.648 1.00 67.90  ? 89   DA  J C2    1 
ATOM   8044  N N3    . DA  I 5 89  ? 113.043 125.218 107.977 1.00 67.90  ? 89   DA  J N3    1 
ATOM   8045  C C4    . DA  I 5 89  ? 112.645 124.968 106.724 1.00 67.90  ? 89   DA  J C4    1 
ATOM   8046  P P     . DG  I 5 90  ? 118.627 121.745 105.570 1.00 60.70  ? 90   DG  J P     1 
ATOM   8047  O OP1   . DG  I 5 90  ? 119.468 122.816 104.996 1.00 60.70  ? 90   DG  J OP1   1 
ATOM   8048  O OP2   . DG  I 5 90  ? 118.598 120.406 104.942 1.00 60.70  ? 90   DG  J OP2   1 
ATOM   8049  O "O5'" . DG  I 5 90  ? 119.087 121.557 107.083 1.00 60.70  ? 90   DG  J "O5'" 1 
ATOM   8050  C "C5'" . DG  I 5 90  ? 119.497 122.680 107.829 1.00 60.70  ? 90   DG  J "C5'" 1 
ATOM   8051  C "C4'" . DG  I 5 90  ? 118.715 122.805 109.124 1.00 60.70  ? 90   DG  J "C4'" 1 
ATOM   8052  O "O4'" . DG  I 5 90  ? 117.301 122.950 108.849 1.00 60.70  ? 90   DG  J "O4'" 1 
ATOM   8053  C "C3'" . DG  I 5 90  ? 118.825 121.628 110.084 1.00 60.70  ? 90   DG  J "C3'" 1 
ATOM   8054  O "O3'" . DG  I 5 90  ? 118.853 122.131 111.384 1.00 60.70  ? 90   DG  J "O3'" 1 
ATOM   8055  C "C2'" . DG  I 5 90  ? 117.526 120.881 109.834 1.00 60.70  ? 90   DG  J "C2'" 1 
ATOM   8056  C "C1'" . DG  I 5 90  ? 116.584 122.042 109.646 1.00 60.70  ? 90   DG  J "C1'" 1 
ATOM   8057  N N9    . DG  I 5 90  ? 115.373 121.698 108.938 1.00 60.70  ? 90   DG  J N9    1 
ATOM   8058  C C8    . DG  I 5 90  ? 115.287 120.965 107.797 1.00 60.70  ? 90   DG  J C8    1 
ATOM   8059  N N7    . DG  I 5 90  ? 114.074 120.819 107.367 1.00 60.70  ? 90   DG  J N7    1 
ATOM   8060  C C5    . DG  I 5 90  ? 113.309 121.504 108.282 1.00 60.70  ? 90   DG  J C5    1 
ATOM   8061  C C6    . DG  I 5 90  ? 111.927 121.685 108.324 1.00 60.70  ? 90   DG  J C6    1 
ATOM   8062  O O6    . DG  I 5 90  ? 111.092 121.260 107.533 1.00 60.70  ? 90   DG  J O6    1 
ATOM   8063  N N1    . DG  I 5 90  ? 111.532 122.438 109.418 1.00 60.70  ? 90   DG  J N1    1 
ATOM   8064  C C2    . DG  I 5 90  ? 112.382 122.955 110.353 1.00 60.70  ? 90   DG  J C2    1 
ATOM   8065  N N2    . DG  I 5 90  ? 111.820 123.656 111.345 1.00 60.70  ? 90   DG  J N2    1 
ATOM   8066  N N3    . DG  I 5 90  ? 113.699 122.792 110.321 1.00 60.70  ? 90   DG  J N3    1 
ATOM   8067  C C4    . DG  I 5 90  ? 114.087 122.053 109.259 1.00 60.70  ? 90   DG  J C4    1 
ATOM   8068  P P     . DG  I 5 91  ? 119.578 121.324 112.553 1.00 48.77  ? 91   DG  J P     1 
ATOM   8069  O OP1   . DG  I 5 91  ? 120.816 122.056 112.860 1.00 48.77  ? 91   DG  J OP1   1 
ATOM   8070  O OP2   . DG  I 5 91  ? 119.639 119.900 112.186 1.00 48.77  ? 91   DG  J OP2   1 
ATOM   8071  O "O5'" . DG  I 5 91  ? 118.590 121.500 113.781 1.00 48.77  ? 91   DG  J "O5'" 1 
ATOM   8072  C "C5'" . DG  I 5 91  ? 118.564 122.729 114.466 1.00 48.77  ? 91   DG  J "C5'" 1 
ATOM   8073  C "C4'" . DG  I 5 91  ? 117.259 122.947 115.216 1.00 48.77  ? 91   DG  J "C4'" 1 
ATOM   8074  O "O4'" . DG  I 5 91  ? 116.134 122.824 114.321 1.00 48.77  ? 91   DG  J "O4'" 1 
ATOM   8075  C "C3'" . DG  I 5 91  ? 116.977 121.998 116.359 1.00 48.77  ? 91   DG  J "C3'" 1 
ATOM   8076  O "O3'" . DG  I 5 91  ? 116.283 122.698 117.359 1.00 48.77  ? 91   DG  J "O3'" 1 
ATOM   8077  C "C2'" . DG  I 5 91  ? 116.084 120.964 115.707 1.00 48.77  ? 91   DG  J "C2'" 1 
ATOM   8078  C "C1'" . DG  I 5 91  ? 115.249 121.834 114.793 1.00 48.77  ? 91   DG  J "C1'" 1 
ATOM   8079  N N9    . DG  I 5 91  ? 114.721 121.148 113.622 1.00 48.77  ? 91   DG  J N9    1 
ATOM   8080  C C8    . DG  I 5 91  ? 115.455 120.583 112.625 1.00 48.77  ? 91   DG  J C8    1 
ATOM   8081  N N7    . DG  I 5 91  ? 114.737 120.050 111.685 1.00 48.77  ? 91   DG  J N7    1 
ATOM   8082  C C5    . DG  I 5 91  ? 113.437 120.271 112.082 1.00 48.77  ? 91   DG  J C5    1 
ATOM   8083  C C6    . DG  I 5 91  ? 112.235 119.921 111.448 1.00 48.77  ? 91   DG  J C6    1 
ATOM   8084  O O6    . DG  I 5 91  ? 112.085 119.314 110.386 1.00 48.77  ? 91   DG  J O6    1 
ATOM   8085  N N1    . DG  I 5 91  ? 111.132 120.334 112.171 1.00 48.77  ? 91   DG  J N1    1 
ATOM   8086  C C2    . DG  I 5 91  ? 111.189 121.012 113.355 1.00 48.77  ? 91   DG  J C2    1 
ATOM   8087  N N2    . DG  I 5 91  ? 110.016 121.327 113.914 1.00 48.77  ? 91   DG  J N2    1 
ATOM   8088  N N3    . DG  I 5 91  ? 112.318 121.354 113.962 1.00 48.77  ? 91   DG  J N3    1 
ATOM   8089  C C4    . DG  I 5 91  ? 113.400 120.960 113.265 1.00 48.77  ? 91   DG  J C4    1 
ATOM   8090  P P     . DG  I 5 92  ? 116.173 122.086 118.830 1.00 59.09  ? 92   DG  J P     1 
ATOM   8091  O OP1   . DG  I 5 92  ? 116.171 123.195 119.793 1.00 59.09  ? 92   DG  J OP1   1 
ATOM   8092  O OP2   . DG  I 5 92  ? 117.166 121.010 118.934 1.00 59.09  ? 92   DG  J OP2   1 
ATOM   8093  O "O5'" . DG  I 5 92  ? 114.734 121.429 118.857 1.00 59.09  ? 92   DG  J "O5'" 1 
ATOM   8094  C "C5'" . DG  I 5 92  ? 113.605 122.255 118.735 1.00 59.09  ? 92   DG  J "C5'" 1 
ATOM   8095  C "C4'" . DG  I 5 92  ? 112.329 121.437 118.677 1.00 59.09  ? 92   DG  J "C4'" 1 
ATOM   8096  O "O4'" . DG  I 5 92  ? 112.135 120.919 117.342 1.00 59.09  ? 92   DG  J "O4'" 1 
ATOM   8097  C "C3'" . DG  I 5 92  ? 112.285 120.231 119.603 1.00 59.09  ? 92   DG  J "C3'" 1 
ATOM   8098  O "O3'" . DG  I 5 92  ? 111.019 120.174 120.199 1.00 59.09  ? 92   DG  J "O3'" 1 
ATOM   8099  C "C2'" . DG  I 5 92  ? 112.501 119.058 118.653 1.00 59.09  ? 92   DG  J "C2'" 1 
ATOM   8100  C "C1'" . DG  I 5 92  ? 111.784 119.567 117.428 1.00 59.09  ? 92   DG  J "C1'" 1 
ATOM   8101  N N9    . DG  I 5 92  ? 112.191 118.924 116.202 1.00 59.09  ? 92   DG  J N9    1 
ATOM   8102  C C8    . DG  I 5 92  ? 113.462 118.769 115.747 1.00 59.09  ? 92   DG  J C8    1 
ATOM   8103  N N7    . DG  I 5 92  ? 113.535 118.151 114.607 1.00 59.09  ? 92   DG  J N7    1 
ATOM   8104  C C5    . DG  I 5 92  ? 112.216 117.895 114.283 1.00 59.09  ? 92   DG  J C5    1 
ATOM   8105  C C6    . DG  I 5 92  ? 111.667 117.247 113.159 1.00 59.09  ? 92   DG  J C6    1 
ATOM   8106  O O6    . DG  I 5 92  ? 112.262 116.768 112.189 1.00 59.09  ? 92   DG  J O6    1 
ATOM   8107  N N1    . DG  I 5 92  ? 110.282 117.196 113.218 1.00 59.09  ? 92   DG  J N1    1 
ATOM   8108  C C2    . DG  I 5 92  ? 109.525 117.701 114.243 1.00 59.09  ? 92   DG  J C2    1 
ATOM   8109  N N2    . DG  I 5 92  ? 108.199 117.557 114.133 1.00 59.09  ? 92   DG  J N2    1 
ATOM   8110  N N3    . DG  I 5 92  ? 110.029 118.308 115.306 1.00 59.09  ? 92   DG  J N3    1 
ATOM   8111  C C4    . DG  I 5 92  ? 111.377 118.364 115.258 1.00 59.09  ? 92   DG  J C4    1 
ATOM   8112  P P     . DT  I 5 93  ? 110.882 119.912 121.772 1.00 60.98  ? 93   DT  J P     1 
ATOM   8113  O OP1   . DT  I 5 93  ? 110.206 121.079 122.374 1.00 60.98  ? 93   DT  J OP1   1 
ATOM   8114  O OP2   . DT  I 5 93  ? 112.206 119.482 122.262 1.00 60.98  ? 93   DT  J OP2   1 
ATOM   8115  O "O5'" . DT  I 5 93  ? 109.936 118.635 121.846 1.00 60.98  ? 93   DT  J "O5'" 1 
ATOM   8116  C "C5'" . DT  I 5 93  ? 110.277 117.479 121.107 1.00 60.98  ? 93   DT  J "C5'" 1 
ATOM   8117  C "C4'" . DT  I 5 93  ? 109.172 117.107 120.146 1.00 60.98  ? 93   DT  J "C4'" 1 
ATOM   8118  O "O4'" . DT  I 5 93  ? 109.696 117.008 118.791 1.00 60.98  ? 93   DT  J "O4'" 1 
ATOM   8119  C "C3'" . DT  I 5 93  ? 108.535 115.762 120.437 1.00 60.98  ? 93   DT  J "C3'" 1 
ATOM   8120  O "O3'" . DT  I 5 93  ? 107.149 115.838 120.230 1.00 60.98  ? 93   DT  J "O3'" 1 
ATOM   8121  C "C2'" . DT  I 5 93  ? 109.205 114.859 119.415 1.00 60.98  ? 93   DT  J "C2'" 1 
ATOM   8122  C "C1'" . DT  I 5 93  ? 109.278 115.792 118.238 1.00 60.98  ? 93   DT  J "C1'" 1 
ATOM   8123  N N1    . DT  I 5 93  ? 110.243 115.369 117.205 1.00 60.98  ? 93   DT  J N1    1 
ATOM   8124  C C2    . DT  I 5 93  ? 109.788 114.731 116.079 1.00 60.98  ? 93   DT  J C2    1 
ATOM   8125  O O2    . DT  I 5 93  ? 108.621 114.485 115.880 1.00 60.98  ? 93   DT  J O2    1 
ATOM   8126  N N3    . DT  I 5 93  ? 110.757 114.385 115.187 1.00 60.98  ? 93   DT  J N3    1 
ATOM   8127  C C4    . DT  I 5 93  ? 112.109 114.613 115.301 1.00 60.98  ? 93   DT  J C4    1 
ATOM   8128  O O4    . DT  I 5 93  ? 112.911 114.264 114.446 1.00 60.98  ? 93   DT  J O4    1 
ATOM   8129  C C5    . DT  I 5 93  ? 112.520 115.281 116.500 1.00 60.98  ? 93   DT  J C5    1 
ATOM   8130  C C7    . DT  I 5 93  ? 113.972 115.566 116.730 1.00 60.98  ? 93   DT  J C7    1 
ATOM   8131  C C6    . DT  I 5 93  ? 111.577 115.627 117.386 1.00 60.98  ? 93   DT  J C6    1 
ATOM   8132  P P     . DC  I 5 94  ? 106.147 115.073 121.222 1.00 67.40  ? 94   DC  J P     1 
ATOM   8133  O OP1   . DC  I 5 94  ? 104.939 115.909 121.372 1.00 67.40  ? 94   DC  J OP1   1 
ATOM   8134  O OP2   . DC  I 5 94  ? 106.929 114.701 122.417 1.00 67.40  ? 94   DC  J OP2   1 
ATOM   8135  O "O5'" . DC  I 5 94  ? 105.789 113.726 120.437 1.00 67.40  ? 94   DC  J "O5'" 1 
ATOM   8136  C "C5'" . DC  I 5 94  ? 106.614 112.585 120.596 1.00 67.40  ? 94   DC  J "C5'" 1 
ATOM   8137  C "C4'" . DC  I 5 94  ? 106.585 111.710 119.364 1.00 67.40  ? 94   DC  J "C4'" 1 
ATOM   8138  O "O4'" . DC  I 5 94  ? 107.637 112.102 118.456 1.00 67.40  ? 94   DC  J "O4'" 1 
ATOM   8139  C "C3'" . DC  I 5 94  ? 106.829 110.235 119.652 1.00 67.40  ? 94   DC  J "C3'" 1 
ATOM   8140  O "O3'" . DC  I 5 94  ? 105.690 109.488 119.370 1.00 67.40  ? 94   DC  J "O3'" 1 
ATOM   8141  C "C2'" . DC  I 5 94  ? 107.975 109.845 118.728 1.00 67.40  ? 94   DC  J "C2'" 1 
ATOM   8142  C "C1'" . DC  I 5 94  ? 108.007 110.970 117.725 1.00 67.40  ? 94   DC  J "C1'" 1 
ATOM   8143  N N1    . DC  I 5 94  ? 109.345 111.152 117.195 1.00 67.40  ? 94   DC  J N1    1 
ATOM   8144  C C2    . DC  I 5 94  ? 109.688 110.574 115.982 1.00 67.40  ? 94   DC  J C2    1 
ATOM   8145  O O2    . DC  I 5 94  ? 108.844 109.926 115.371 1.00 67.40  ? 94   DC  J O2    1 
ATOM   8146  N N3    . DC  I 5 94  ? 110.940 110.734 115.514 1.00 67.40  ? 94   DC  J N3    1 
ATOM   8147  C C4    . DC  I 5 94  ? 111.818 111.432 116.213 1.00 67.40  ? 94   DC  J C4    1 
ATOM   8148  N N4    . DC  I 5 94  ? 113.046 111.574 115.718 1.00 67.40  ? 94   DC  J N4    1 
ATOM   8149  C C5    . DC  I 5 94  ? 111.482 112.028 117.456 1.00 67.40  ? 94   DC  J C5    1 
ATOM   8150  C C6    . DC  I 5 94  ? 110.247 111.857 117.904 1.00 67.40  ? 94   DC  J C6    1 
ATOM   8151  P P     . DC  I 5 95  ? 105.567 108.005 119.959 1.00 73.69  ? 95   DC  J P     1 
ATOM   8152  O OP1   . DC  I 5 95  ? 104.126 107.727 120.064 1.00 73.69  ? 95   DC  J OP1   1 
ATOM   8153  O OP2   . DC  I 5 95  ? 106.444 107.898 121.133 1.00 73.69  ? 95   DC  J OP2   1 
ATOM   8154  O "O5'" . DC  I 5 95  ? 106.235 107.068 118.854 1.00 73.69  ? 95   DC  J "O5'" 1 
ATOM   8155  C "C5'" . DC  I 5 95  ? 105.799 107.135 117.521 1.00 73.69  ? 95   DC  J "C5'" 1 
ATOM   8156  C "C4'" . DC  I 5 95  ? 106.657 106.273 116.622 1.00 73.69  ? 95   DC  J "C4'" 1 
ATOM   8157  O "O4'" . DC  I 5 95  ? 107.861 106.985 116.236 1.00 73.69  ? 95   DC  J "O4'" 1 
ATOM   8158  C "C3'" . DC  I 5 95  ? 107.127 104.960 117.244 1.00 73.69  ? 95   DC  J "C3'" 1 
ATOM   8159  O "O3'" . DC  I 5 95  ? 106.862 103.900 116.349 1.00 73.69  ? 95   DC  J "O3'" 1 
ATOM   8160  C "C2'" . DC  I 5 95  ? 108.626 105.178 117.408 1.00 73.69  ? 95   DC  J "C2'" 1 
ATOM   8161  C "C1'" . DC  I 5 95  ? 108.906 106.061 116.215 1.00 73.69  ? 95   DC  J "C1'" 1 
ATOM   8162  N N1    . DC  I 5 95  ? 110.187 106.772 116.305 1.00 73.69  ? 95   DC  J N1    1 
ATOM   8163  C C2    . DC  I 5 95  ? 111.153 106.580 115.321 1.00 73.69  ? 95   DC  J C2    1 
ATOM   8164  O O2    . DC  I 5 95  ? 110.914 105.814 114.389 1.00 73.69  ? 95   DC  J O2    1 
ATOM   8165  N N3    . DC  I 5 95  ? 112.329 107.235 115.425 1.00 73.69  ? 95   DC  J N3    1 
ATOM   8166  C C4    . DC  I 5 95  ? 112.548 108.044 116.453 1.00 73.69  ? 95   DC  J C4    1 
ATOM   8167  N N4    . DC  I 5 95  ? 113.722 108.675 116.520 1.00 73.69  ? 95   DC  J N4    1 
ATOM   8168  C C5    . DC  I 5 95  ? 111.575 108.246 117.466 1.00 73.69  ? 95   DC  J C5    1 
ATOM   8169  C C6    . DC  I 5 95  ? 110.420 107.595 117.351 1.00 73.69  ? 95   DC  J C6    1 
ATOM   8170  P P     . DC  I 5 96  ? 106.929 102.377 116.846 1.00 81.61  ? 96   DC  J P     1 
ATOM   8171  O OP1   . DC  I 5 96  ? 105.789 101.675 116.224 1.00 81.61  ? 96   DC  J OP1   1 
ATOM   8172  O OP2   . DC  I 5 96  ? 107.099 102.372 118.315 1.00 81.61  ? 96   DC  J OP2   1 
ATOM   8173  O "O5'" . DC  I 5 96  ? 108.273 101.821 116.189 1.00 81.61  ? 96   DC  J "O5'" 1 
ATOM   8174  C "C5'" . DC  I 5 96  ? 108.741 102.383 114.974 1.00 81.61  ? 96   DC  J "C5'" 1 
ATOM   8175  C "C4'" . DC  I 5 96  ? 109.758 101.484 114.310 1.00 81.61  ? 96   DC  J "C4'" 1 
ATOM   8176  O "O4'" . DC  I 5 96  ? 110.978 102.229 114.064 1.00 81.61  ? 96   DC  J "O4'" 1 
ATOM   8177  C "C3'" . DC  I 5 96  ? 110.192 100.290 115.132 1.00 81.61  ? 96   DC  J "C3'" 1 
ATOM   8178  O "O3'" . DC  I 5 96  ? 110.614 99.267  114.260 1.00 81.61  ? 96   DC  J "O3'" 1 
ATOM   8179  C "C2'" . DC  I 5 96  ? 111.369 100.869 115.899 1.00 81.61  ? 96   DC  J "C2'" 1 
ATOM   8180  C "C1'" . DC  I 5 96  ? 112.037 101.638 114.783 1.00 81.61  ? 96   DC  J "C1'" 1 
ATOM   8181  N N1    . DC  I 5 96  ? 112.940 102.706 115.239 1.00 81.61  ? 96   DC  J N1    1 
ATOM   8182  C C2    . DC  I 5 96  ? 114.178 102.864 114.622 1.00 81.61  ? 96   DC  J C2    1 
ATOM   8183  O O2    . DC  I 5 96  ? 114.489 102.097 113.707 1.00 81.61  ? 96   DC  J O2    1 
ATOM   8184  N N3    . DC  I 5 96  ? 114.999 103.851 115.044 1.00 81.61  ? 96   DC  J N3    1 
ATOM   8185  C C4    . DC  I 5 96  ? 114.619 104.650 116.035 1.00 81.61  ? 96   DC  J C4    1 
ATOM   8186  N N4    . DC  I 5 96  ? 115.456 105.613 116.424 1.00 81.61  ? 96   DC  J N4    1 
ATOM   8187  C C5    . DC  I 5 96  ? 113.362 104.495 116.677 1.00 81.61  ? 96   DC  J C5    1 
ATOM   8188  C C6    . DC  I 5 96  ? 112.559 103.523 116.246 1.00 81.61  ? 96   DC  J C6    1 
ATOM   8189  P P     . DC  I 5 97  ? 110.142 97.755  114.502 1.00 89.89  ? 97   DC  J P     1 
ATOM   8190  O OP1   . DC  I 5 97  ? 109.347 97.327  113.334 1.00 89.89  ? 97   DC  J OP1   1 
ATOM   8191  O OP2   . DC  I 5 97  ? 109.573 97.679  115.863 1.00 89.89  ? 97   DC  J OP2   1 
ATOM   8192  O "O5'" . DC  I 5 97  ? 111.501 96.935  114.472 1.00 89.89  ? 97   DC  J "O5'" 1 
ATOM   8193  C "C5'" . DC  I 5 97  ? 112.675 97.573  114.049 1.00 89.89  ? 97   DC  J "C5'" 1 
ATOM   8194  C "C4'" . DC  I 5 97  ? 113.886 96.932  114.681 1.00 89.89  ? 97   DC  J "C4'" 1 
ATOM   8195  O "O4'" . DC  I 5 97  ? 114.775 97.974  115.165 1.00 89.89  ? 97   DC  J "O4'" 1 
ATOM   8196  C "C3'" . DC  I 5 97  ? 113.584 96.062  115.897 1.00 89.89  ? 97   DC  J "C3'" 1 
ATOM   8197  O "O3'" . DC  I 5 97  ? 114.594 95.065  116.021 1.00 89.89  ? 97   DC  J "O3'" 1 
ATOM   8198  C "C2'" . DC  I 5 97  ? 113.675 97.082  117.013 1.00 89.89  ? 97   DC  J "C2'" 1 
ATOM   8199  C "C1'" . DC  I 5 97  ? 114.906 97.841  116.560 1.00 89.89  ? 97   DC  J "C1'" 1 
ATOM   8200  N N1    . DC  I 5 97  ? 115.064 99.182  117.196 1.00 89.89  ? 97   DC  J N1    1 
ATOM   8201  C C2    . DC  I 5 97  ? 116.228 99.910  116.973 1.00 89.89  ? 97   DC  J C2    1 
ATOM   8202  O O2    . DC  I 5 97  ? 117.094 99.428  116.240 1.00 89.89  ? 97   DC  J O2    1 
ATOM   8203  N N3    . DC  I 5 97  ? 116.369 101.121 117.563 1.00 89.89  ? 97   DC  J N3    1 
ATOM   8204  C C4    . DC  I 5 97  ? 115.397 101.594 118.348 1.00 89.89  ? 97   DC  J C4    1 
ATOM   8205  N N4    . DC  I 5 97  ? 115.572 102.790 118.910 1.00 89.89  ? 97   DC  J N4    1 
ATOM   8206  C C5    . DC  I 5 97  ? 114.206 100.862 118.590 1.00 89.89  ? 97   DC  J C5    1 
ATOM   8207  C C6    . DC  I 5 97  ? 114.084 99.672  118.004 1.00 89.89  ? 97   DC  J C6    1 
ATOM   8208  P P     . DC  I 5 98  ? 114.437 93.811  117.019 1.00 95.30  ? 98   DC  J P     1 
ATOM   8209  O OP1   . DC  I 5 98  ? 114.408 92.605  116.172 1.00 95.30  ? 98   DC  J OP1   1 
ATOM   8210  O OP2   . DC  I 5 98  ? 113.383 94.033  118.030 1.00 95.30  ? 98   DC  J OP2   1 
ATOM   8211  O "O5'" . DC  I 5 98  ? 115.831 93.782  117.769 1.00 95.30  ? 98   DC  J "O5'" 1 
ATOM   8212  C "C5'" . DC  I 5 98  ? 117.001 93.806  117.003 1.00 95.30  ? 98   DC  J "C5'" 1 
ATOM   8213  C "C4'" . DC  I 5 98  ? 118.158 94.337  117.798 1.00 95.30  ? 98   DC  J "C4'" 1 
ATOM   8214  O "O4'" . DC  I 5 98  ? 117.910 95.703  118.162 1.00 95.30  ? 98   DC  J "O4'" 1 
ATOM   8215  C "C3'" . DC  I 5 98  ? 118.417 93.602  119.108 1.00 95.30  ? 98   DC  J "C3'" 1 
ATOM   8216  O "O3'" . DC  I 5 98  ? 119.577 92.799  118.961 1.00 95.30  ? 98   DC  J "O3'" 1 
ATOM   8217  C "C2'" . DC  I 5 98  ? 118.601 94.728  120.142 1.00 95.30  ? 98   DC  J "C2'" 1 
ATOM   8218  C "C1'" . DC  I 5 98  ? 118.689 95.976  119.281 1.00 95.30  ? 98   DC  J "C1'" 1 
ATOM   8219  N N1    . DC  I 5 98  ? 118.161 97.167  119.945 1.00 95.30  ? 98   DC  J N1    1 
ATOM   8220  C C2    . DC  I 5 98  ? 118.973 98.281  120.080 1.00 95.30  ? 98   DC  J C2    1 
ATOM   8221  O O2    . DC  I 5 98  ? 120.116 98.234  119.630 1.00 95.30  ? 98   DC  J O2    1 
ATOM   8222  N N3    . DC  I 5 98  ? 118.486 99.374  120.696 1.00 95.30  ? 98   DC  J N3    1 
ATOM   8223  C C4    . DC  I 5 98  ? 117.242 99.369  121.165 1.00 95.30  ? 98   DC  J C4    1 
ATOM   8224  N N4    . DC  I 5 98  ? 116.795 100.474 121.769 1.00 95.30  ? 98   DC  J N4    1 
ATOM   8225  C C5    . DC  I 5 98  ? 116.396 98.233  121.036 1.00 95.30  ? 98   DC  J C5    1 
ATOM   8226  C C6    . DC  I 5 98  ? 116.895 97.163  120.423 1.00 95.30  ? 98   DC  J C6    1 
ATOM   8227  P P     . DC  I 5 99  ? 120.233 92.031  120.207 1.00 92.57  ? 99   DC  J P     1 
ATOM   8228  O OP1   . DC  I 5 99  ? 120.946 90.873  119.634 1.00 92.57  ? 99   DC  J OP1   1 
ATOM   8229  O OP2   . DC  I 5 99  ? 119.235 91.801  121.275 1.00 92.57  ? 99   DC  J OP2   1 
ATOM   8230  O "O5'" . DC  I 5 99  ? 121.341 93.050  120.712 1.00 92.57  ? 99   DC  J "O5'" 1 
ATOM   8231  C "C5'" . DC  I 5 99  ? 122.120 93.751  119.763 1.00 92.57  ? 99   DC  J "C5'" 1 
ATOM   8232  C "C4'" . DC  I 5 99  ? 123.048 94.744  120.433 1.00 92.57  ? 99   DC  J "C4'" 1 
ATOM   8233  O "O4'" . DC  I 5 99  ? 122.304 95.922  120.836 1.00 92.57  ? 99   DC  J "O4'" 1 
ATOM   8234  C "C3'" . DC  I 5 99  ? 123.741 94.228  121.690 1.00 92.57  ? 99   DC  J "C3'" 1 
ATOM   8235  O "O3'" . DC  I 5 99  ? 125.094 94.644  121.690 1.00 92.57  ? 99   DC  J "O3'" 1 
ATOM   8236  C "C2'" . DC  I 5 99  ? 122.950 94.903  122.800 1.00 92.57  ? 99   DC  J "C2'" 1 
ATOM   8237  C "C1'" . DC  I 5 99  ? 122.634 96.234  122.160 1.00 92.57  ? 99   DC  J "C1'" 1 
ATOM   8238  N N1    . DC  I 5 99  ? 121.490 96.921  122.769 1.00 92.57  ? 99   DC  J N1    1 
ATOM   8239  C C2    . DC  I 5 99  ? 121.609 98.259  123.127 1.00 92.57  ? 99   DC  J C2    1 
ATOM   8240  O O2    . DC  I 5 99  ? 122.678 98.835  122.923 1.00 92.57  ? 99   DC  J O2    1 
ATOM   8241  N N3    . DC  I 5 99  ? 120.550 98.885  123.688 1.00 92.57  ? 99   DC  J N3    1 
ATOM   8242  C C4    . DC  I 5 99  ? 119.416 98.219  123.887 1.00 92.57  ? 99   DC  J C4    1 
ATOM   8243  N N4    . DC  I 5 99  ? 118.391 98.873  124.443 1.00 92.57  ? 99   DC  J N4    1 
ATOM   8244  C C5    . DC  I 5 99  ? 119.280 96.848  123.525 1.00 92.57  ? 99   DC  J C5    1 
ATOM   8245  C C6    . DC  I 5 99  ? 120.334 96.247  122.974 1.00 92.57  ? 99   DC  J C6    1 
ATOM   8246  P P     . DG  I 5 100 ? 126.197 93.869  122.564 1.00 90.12  ? 100  DG  J P     1 
ATOM   8247  O OP1   . DG  I 5 100 ? 127.016 93.066  121.637 1.00 90.12  ? 100  DG  J OP1   1 
ATOM   8248  O OP2   . DG  I 5 100 ? 125.559 93.225  123.727 1.00 90.12  ? 100  DG  J OP2   1 
ATOM   8249  O "O5'" . DG  I 5 100 ? 127.100 95.051  123.120 1.00 90.12  ? 100  DG  J "O5'" 1 
ATOM   8250  C "C5'" . DG  I 5 100 ? 126.870 96.370  122.657 1.00 90.12  ? 100  DG  J "C5'" 1 
ATOM   8251  C "C4'" . DG  I 5 100 ? 126.941 97.387  123.784 1.00 90.12  ? 100  DG  J "C4'" 1 
ATOM   8252  O "O4'" . DG  I 5 100 ? 125.603 97.798  124.175 1.00 90.12  ? 100  DG  J "O4'" 1 
ATOM   8253  C "C3'" . DG  I 5 100 ? 127.607 96.914  125.070 1.00 90.12  ? 100  DG  J "C3'" 1 
ATOM   8254  O "O3'" . DG  I 5 100 ? 128.253 98.021  125.654 1.00 90.12  ? 100  DG  J "O3'" 1 
ATOM   8255  C "C2'" . DG  I 5 100 ? 126.401 96.506  125.895 1.00 90.12  ? 100  DG  J "C2'" 1 
ATOM   8256  C "C1'" . DG  I 5 100 ? 125.498 97.670  125.567 1.00 90.12  ? 100  DG  J "C1'" 1 
ATOM   8257  N N9    . DG  I 5 100 ? 124.099 97.488  125.921 1.00 90.12  ? 100  DG  J N9    1 
ATOM   8258  C C8    . DG  I 5 100 ? 123.363 96.343  125.834 1.00 90.12  ? 100  DG  J C8    1 
ATOM   8259  N N7    . DG  I 5 100 ? 122.125 96.487  126.213 1.00 90.12  ? 100  DG  J N7    1 
ATOM   8260  C C5    . DG  I 5 100 ? 122.043 97.818  126.582 1.00 90.12  ? 100  DG  J C5    1 
ATOM   8261  C C6    . DG  I 5 100 ? 120.951 98.562  127.082 1.00 90.12  ? 100  DG  J C6    1 
ATOM   8262  O O6    . DG  I 5 100 ? 119.798 98.179  127.306 1.00 90.12  ? 100  DG  J O6    1 
ATOM   8263  N N1    . DG  I 5 100 ? 121.301 99.882  127.327 1.00 90.12  ? 100  DG  J N1    1 
ATOM   8264  C C2    . DG  I 5 100 ? 122.545 100.412 127.116 1.00 90.12  ? 100  DG  J C2    1 
ATOM   8265  N N2    . DG  I 5 100 ? 122.703 101.705 127.409 1.00 90.12  ? 100  DG  J N2    1 
ATOM   8266  N N3    . DG  I 5 100 ? 123.571 99.725  126.650 1.00 90.12  ? 100  DG  J N3    1 
ATOM   8267  C C4    . DG  I 5 100 ? 123.250 98.443  126.406 1.00 90.12  ? 100  DG  J C4    1 
ATOM   8268  P P     . DC  I 5 101 ? 129.555 97.842  126.573 1.00 87.82  ? 101  DC  J P     1 
ATOM   8269  O OP1   . DC  I 5 101 ? 130.688 97.522  125.680 1.00 87.82  ? 101  DC  J OP1   1 
ATOM   8270  O OP2   . DC  I 5 101 ? 129.217 96.928  127.681 1.00 87.82  ? 101  DC  J OP2   1 
ATOM   8271  O "O5'" . DC  I 5 101 ? 129.766 99.300  127.193 1.00 87.82  ? 101  DC  J "O5'" 1 
ATOM   8272  C "C5'" . DC  I 5 101 ? 128.850 100.336 126.869 1.00 87.82  ? 101  DC  J "C5'" 1 
ATOM   8273  C "C4'" . DC  I 5 101 ? 128.201 100.950 128.109 1.00 87.82  ? 101  DC  J "C4'" 1 
ATOM   8274  O "O4'" . DC  I 5 101 ? 126.831 100.486 128.252 1.00 87.82  ? 101  DC  J "O4'" 1 
ATOM   8275  C "C3'" . DC  I 5 101 ? 128.849 100.644 129.452 1.00 87.82  ? 101  DC  J "C3'" 1 
ATOM   8276  O "O3'" . DC  I 5 101 ? 128.570 101.724 130.328 1.00 87.82  ? 101  DC  J "O3'" 1 
ATOM   8277  C "C2'" . DC  I 5 101 ? 128.045 99.430  129.883 1.00 87.82  ? 101  DC  J "C2'" 1 
ATOM   8278  C "C1'" . DC  I 5 101 ? 126.678 99.971  129.556 1.00 87.82  ? 101  DC  J "C1'" 1 
ATOM   8279  N N1    . DC  I 5 101 ? 125.580 98.981  129.548 1.00 87.82  ? 101  DC  J N1    1 
ATOM   8280  C C2    . DC  I 5 101 ? 124.327 99.369  129.991 1.00 87.82  ? 101  DC  J C2    1 
ATOM   8281  O O2    . DC  I 5 101 ? 124.180 100.522 130.383 1.00 87.82  ? 101  DC  J O2    1 
ATOM   8282  N N3    . DC  I 5 101 ? 123.314 98.476  129.976 1.00 87.82  ? 101  DC  J N3    1 
ATOM   8283  C C4    . DC  I 5 101 ? 123.526 97.242  129.538 1.00 87.82  ? 101  DC  J C4    1 
ATOM   8284  N N4    . DC  I 5 101 ? 122.495 96.387  129.543 1.00 87.82  ? 101  DC  J N4    1 
ATOM   8285  C C5    . DC  I 5 101 ? 124.807 96.824  129.081 1.00 87.82  ? 101  DC  J C5    1 
ATOM   8286  C C6    . DC  I 5 101 ? 125.795 97.722  129.107 1.00 87.82  ? 101  DC  J C6    1 
ATOM   8287  P P     . DA  I 5 102 ? 129.727 102.706 130.838 1.00 88.18  ? 102  DA  J P     1 
ATOM   8288  O OP1   . DA  I 5 102 ? 129.566 103.997 130.158 1.00 88.18  ? 102  DA  J OP1   1 
ATOM   8289  O OP2   . DA  I 5 102 ? 130.999 101.970 130.760 1.00 88.18  ? 102  DA  J OP2   1 
ATOM   8290  O "O5'" . DA  I 5 102 ? 129.365 102.949 132.367 1.00 88.18  ? 102  DA  J "O5'" 1 
ATOM   8291  C "C5'" . DA  I 5 102 ? 128.845 104.200 132.768 1.00 88.18  ? 102  DA  J "C5'" 1 
ATOM   8292  C "C4'" . DA  I 5 102 ? 127.711 104.045 133.767 1.00 88.18  ? 102  DA  J "C4'" 1 
ATOM   8293  O "O4'" . DA  I 5 102 ? 126.792 103.005 133.330 1.00 88.18  ? 102  DA  J "O4'" 1 
ATOM   8294  C "C3'" . DA  I 5 102 ? 128.137 103.643 135.174 1.00 88.18  ? 102  DA  J "C3'" 1 
ATOM   8295  O "O3'" . DA  I 5 102 ? 127.296 104.268 136.122 1.00 88.18  ? 102  DA  J "O3'" 1 
ATOM   8296  C "C2'" . DA  I 5 102 ? 127.901 102.148 135.157 1.00 88.18  ? 102  DA  J "C2'" 1 
ATOM   8297  C "C1'" . DA  I 5 102 ? 126.597 102.104 134.393 1.00 88.18  ? 102  DA  J "C1'" 1 
ATOM   8298  N N9    . DA  I 5 102 ? 126.275 100.791 133.844 1.00 88.18  ? 102  DA  J N9    1 
ATOM   8299  C C8    . DA  I 5 102 ? 127.112 99.966  133.163 1.00 88.18  ? 102  DA  J C8    1 
ATOM   8300  N N7    . DA  I 5 102 ? 126.559 98.844  132.780 1.00 88.18  ? 102  DA  J N7    1 
ATOM   8301  C C5    . DA  I 5 102 ? 125.267 98.938  133.240 1.00 88.18  ? 102  DA  J C5    1 
ATOM   8302  C C6    . DA  I 5 102 ? 124.167 98.066  133.154 1.00 88.18  ? 102  DA  J C6    1 
ATOM   8303  N N6    . DA  I 5 102 ? 124.221 96.878  132.548 1.00 88.18  ? 102  DA  J N6    1 
ATOM   8304  N N1    . DA  I 5 102 ? 123.009 98.457  133.725 1.00 88.18  ? 102  DA  J N1    1 
ATOM   8305  C C2    . DA  I 5 102 ? 122.967 99.648  134.334 1.00 88.18  ? 102  DA  J C2    1 
ATOM   8306  N N3    . DA  I 5 102 ? 123.938 100.550 134.478 1.00 88.18  ? 102  DA  J N3    1 
ATOM   8307  C C4    . DA  I 5 102 ? 125.069 100.133 133.898 1.00 88.18  ? 102  DA  J C4    1 
ATOM   8308  P P     . DG  I 5 103 ? 127.851 104.618 137.587 1.00 108.92 ? 103  DG  J P     1 
ATOM   8309  O OP1   . DG  I 5 103 ? 128.618 105.875 137.479 1.00 108.92 ? 103  DG  J OP1   1 
ATOM   8310  O OP2   . DG  I 5 103 ? 128.461 103.402 138.162 1.00 108.92 ? 103  DG  J OP2   1 
ATOM   8311  O "O5'" . DG  I 5 103 ? 126.535 104.926 138.420 1.00 108.92 ? 103  DG  J "O5'" 1 
ATOM   8312  C "C5'" . DG  I 5 103 ? 125.283 104.669 137.841 1.00 108.92 ? 103  DG  J "C5'" 1 
ATOM   8313  C "C4'" . DG  I 5 103 ? 124.471 103.725 138.698 1.00 108.92 ? 103  DG  J "C4'" 1 
ATOM   8314  O "O4'" . DG  I 5 103 ? 124.233 102.493 137.971 1.00 108.92 ? 103  DG  J "O4'" 1 
ATOM   8315  C "C3'" . DG  I 5 103 ? 125.126 103.296 140.010 1.00 108.92 ? 103  DG  J "C3'" 1 
ATOM   8316  O "O3'" . DG  I 5 103 ? 124.109 103.068 140.967 1.00 108.92 ? 103  DG  J "O3'" 1 
ATOM   8317  C "C2'" . DG  I 5 103 ? 125.777 101.984 139.608 1.00 108.92 ? 103  DG  J "C2'" 1 
ATOM   8318  C "C1'" . DG  I 5 103 ? 124.650 101.423 138.777 1.00 108.92 ? 103  DG  J "C1'" 1 
ATOM   8319  N N9    . DG  I 5 103 ? 124.998 100.297 137.932 1.00 108.92 ? 103  DG  J N9    1 
ATOM   8320  C C8    . DG  I 5 103 ? 126.148 100.084 137.229 1.00 108.92 ? 103  DG  J C8    1 
ATOM   8321  N N7    . DG  I 5 103 ? 126.147 98.966  136.556 1.00 108.92 ? 103  DG  J N7    1 
ATOM   8322  C C5    . DG  I 5 103 ? 124.911 98.417  136.840 1.00 108.92 ? 103  DG  J C5    1 
ATOM   8323  C C6    . DG  I 5 103 ? 124.316 97.215  136.403 1.00 108.92 ? 103  DG  J C6    1 
ATOM   8324  O O6    . DG  I 5 103 ? 124.783 96.345  135.658 1.00 108.92 ? 103  DG  J O6    1 
ATOM   8325  N N1    . DG  I 5 103 ? 123.047 97.051  136.950 1.00 108.92 ? 103  DG  J N1    1 
ATOM   8326  C C2    . DG  I 5 103 ? 122.438 97.943  137.793 1.00 108.92 ? 103  DG  J C2    1 
ATOM   8327  N N2    . DG  I 5 103 ? 121.215 97.640  138.224 1.00 108.92 ? 103  DG  J N2    1 
ATOM   8328  N N3    . DG  I 5 103 ? 122.983 99.060  138.194 1.00 108.92 ? 103  DG  J N3    1 
ATOM   8329  C C4    . DG  I 5 103 ? 124.205 99.233  137.683 1.00 108.92 ? 103  DG  J C4    1 
ATOM   8330  P P     . DA  I 5 104 ? 124.332 103.451 142.507 1.00 126.77 ? 104  DA  J P     1 
ATOM   8331  O OP1   . DA  I 5 104 ? 124.030 104.889 142.654 1.00 126.77 ? 104  DA  J OP1   1 
ATOM   8332  O OP2   . DA  I 5 104 ? 125.647 102.919 142.915 1.00 126.77 ? 104  DA  J OP2   1 
ATOM   8333  O "O5'" . DA  I 5 104 ? 123.216 102.604 143.271 1.00 126.77 ? 104  DA  J "O5'" 1 
ATOM   8334  C "C5'" . DA  I 5 104 ? 122.255 101.866 142.529 1.00 126.77 ? 104  DA  J "C5'" 1 
ATOM   8335  C "C4'" . DA  I 5 104 ? 122.153 100.441 143.039 1.00 126.77 ? 104  DA  J "C4'" 1 
ATOM   8336  O "O4'" . DA  I 5 104 ? 122.575 99.521  141.992 1.00 126.77 ? 104  DA  J "O4'" 1 
ATOM   8337  C "C3'" . DA  I 5 104 ? 123.038 100.117 144.244 1.00 126.77 ? 104  DA  J "C3'" 1 
ATOM   8338  O "O3'" . DA  I 5 104 ? 122.390 99.155  145.063 1.00 126.77 ? 104  DA  J "O3'" 1 
ATOM   8339  C "C2'" . DA  I 5 104 ? 124.253 99.510  143.566 1.00 126.77 ? 104  DA  J "C2'" 1 
ATOM   8340  C "C1'" . DA  I 5 104 ? 123.552 98.670  142.529 1.00 126.77 ? 104  DA  J "C1'" 1 
ATOM   8341  N N9    . DA  I 5 104 ? 124.425 98.194  141.474 1.00 126.77 ? 104  DA  J N9    1 
ATOM   8342  C C8    . DA  I 5 104 ? 125.538 98.808  140.983 1.00 126.77 ? 104  DA  J C8    1 
ATOM   8343  N N7    . DA  I 5 104 ? 126.138 98.137  140.033 1.00 126.77 ? 104  DA  J N7    1 
ATOM   8344  C C5    . DA  I 5 104 ? 125.362 97.002  139.897 1.00 126.77 ? 104  DA  J C5    1 
ATOM   8345  C C6    . DA  I 5 104 ? 125.469 95.877  139.066 1.00 126.77 ? 104  DA  J C6    1 
ATOM   8346  N N6    . DA  I 5 104 ? 126.440 95.725  138.156 1.00 126.77 ? 104  DA  J N6    1 
ATOM   8347  N N1    . DA  I 5 104 ? 124.523 94.918  139.187 1.00 126.77 ? 104  DA  J N1    1 
ATOM   8348  C C2    . DA  I 5 104 ? 123.552 95.078  140.092 1.00 126.77 ? 104  DA  J C2    1 
ATOM   8349  N N3    . DA  I 5 104 ? 123.359 96.085  140.935 1.00 126.77 ? 104  DA  J N3    1 
ATOM   8350  C C4    . DA  I 5 104 ? 124.308 97.020  140.786 1.00 126.77 ? 104  DA  J C4    1 
ATOM   8351  P P     . DC  I 5 105 ? 122.893 98.866  146.563 1.00 140.49 ? 105  DC  J P     1 
ATOM   8352  O OP1   . DC  I 5 105 ? 122.549 100.063 147.357 1.00 140.49 ? 105  DC  J OP1   1 
ATOM   8353  O OP2   . DC  I 5 105 ? 124.286 98.376  146.568 1.00 140.49 ? 105  DC  J OP2   1 
ATOM   8354  O "O5'" . DC  I 5 105 ? 121.998 97.626  147.030 1.00 140.49 ? 105  DC  J "O5'" 1 
ATOM   8355  C "C5'" . DC  I 5 105 ? 122.528 96.674  147.949 1.00 140.49 ? 105  DC  J "C5'" 1 
ATOM   8356  C "C4'" . DC  I 5 105 ? 122.856 95.374  147.245 1.00 140.49 ? 105  DC  J "C4'" 1 
ATOM   8357  O "O4'" . DC  I 5 105 ? 123.406 95.666  145.942 1.00 140.49 ? 105  DC  J "O4'" 1 
ATOM   8358  C "C3'" . DC  I 5 105 ? 123.902 94.495  147.956 1.00 140.49 ? 105  DC  J "C3'" 1 
ATOM   8359  O "O3'" . DC  I 5 105 ? 123.326 93.254  148.392 1.00 140.49 ? 105  DC  J "O3'" 1 
ATOM   8360  C "C2'" . DC  I 5 105 ? 124.979 94.261  146.892 1.00 140.49 ? 105  DC  J "C2'" 1 
ATOM   8361  C "C1'" . DC  I 5 105 ? 124.251 94.612  145.606 1.00 140.49 ? 105  DC  J "C1'" 1 
ATOM   8362  N N1    . DC  I 5 105 ? 125.175 95.017  144.536 1.00 140.49 ? 105  DC  J N1    1 
ATOM   8363  C C2    . DC  I 5 105 ? 125.565 94.066  143.612 1.00 140.49 ? 105  DC  J C2    1 
ATOM   8364  O O2    . DC  I 5 105 ? 125.107 92.932  143.723 1.00 140.49 ? 105  DC  J O2    1 
ATOM   8365  N N3    . DC  I 5 105 ? 126.423 94.407  142.632 1.00 140.49 ? 105  DC  J N3    1 
ATOM   8366  C C4    . DC  I 5 105 ? 126.888 95.648  142.566 1.00 140.49 ? 105  DC  J C4    1 
ATOM   8367  N N4    . DC  I 5 105 ? 127.740 95.944  141.576 1.00 140.49 ? 105  DC  J N4    1 
ATOM   8368  C C5    . DC  I 5 105 ? 126.502 96.644  143.512 1.00 140.49 ? 105  DC  J C5    1 
ATOM   8369  C C6    . DC  I 5 105 ? 125.650 96.284  144.476 1.00 140.49 ? 105  DC  J C6    1 
ATOM   8370  P P     . DC  I 5 106 ? 123.933 92.484  149.672 1.00 147.91 ? 106  DC  J P     1 
ATOM   8371  O OP1   . DC  I 5 106 ? 122.872 92.420  150.698 1.00 147.91 ? 106  DC  J OP1   1 
ATOM   8372  O OP2   . DC  I 5 106 ? 125.243 93.089  149.993 1.00 147.91 ? 106  DC  J OP2   1 
ATOM   8373  O "O5'" . DC  I 5 106 ? 124.226 90.999  149.154 1.00 147.91 ? 106  DC  J "O5'" 1 
ATOM   8374  C "C5'" . DC  I 5 106 ? 125.191 90.795  148.148 1.00 147.91 ? 106  DC  J "C5'" 1 
ATOM   8375  C "C4'" . DC  I 5 106 ? 125.837 89.421  148.245 1.00 147.91 ? 106  DC  J "C4'" 1 
ATOM   8376  O "O4'" . DC  I 5 106 ? 126.734 89.271  147.128 1.00 147.91 ? 106  DC  J "O4'" 1 
ATOM   8377  C "C3'" . DC  I 5 106 ? 126.747 89.202  149.439 1.00 147.91 ? 106  DC  J "C3'" 1 
ATOM   8378  O "O3'" . DC  I 5 106 ? 127.075 87.810  149.526 1.00 147.91 ? 106  DC  J "O3'" 1 
ATOM   8379  C "C2'" . DC  I 5 106 ? 127.958 90.019  149.014 1.00 147.91 ? 106  DC  J "C2'" 1 
ATOM   8380  C "C1'" . DC  I 5 106 ? 128.035 89.676  147.527 1.00 147.91 ? 106  DC  J "C1'" 1 
ATOM   8381  N N1    . DC  I 5 106 ? 128.468 90.810  146.660 1.00 147.91 ? 106  DC  J N1    1 
ATOM   8382  C C2    . DC  I 5 106 ? 129.063 90.525  145.446 1.00 147.91 ? 106  DC  J C2    1 
ATOM   8383  O O2    . DC  I 5 106 ? 129.211 89.344  145.135 1.00 147.91 ? 106  DC  J O2    1 
ATOM   8384  N N3    . DC  I 5 106 ? 129.460 91.542  144.652 1.00 147.91 ? 106  DC  J N3    1 
ATOM   8385  C C4    . DC  I 5 106 ? 129.276 92.800  145.043 1.00 147.91 ? 106  DC  J C4    1 
ATOM   8386  N N4    . DC  I 5 106 ? 129.684 93.773  144.226 1.00 147.91 ? 106  DC  J N4    1 
ATOM   8387  C C5    . DC  I 5 106 ? 128.663 93.118  146.285 1.00 147.91 ? 106  DC  J C5    1 
ATOM   8388  C C6    . DC  I 5 106 ? 128.280 92.101  147.057 1.00 147.91 ? 106  DC  J C6    1 
ATOM   8389  P P     . DC  I 5 107 ? 127.895 87.211  150.776 1.00 146.47 ? 107  DC  J P     1 
ATOM   8390  O OP1   . DC  I 5 107 ? 127.178 86.005  151.227 1.00 146.47 ? 107  DC  J OP1   1 
ATOM   8391  O OP2   . DC  I 5 107 ? 128.180 88.290  151.744 1.00 146.47 ? 107  DC  J OP2   1 
ATOM   8392  O "O5'" . DC  I 5 107 ? 129.275 86.716  150.138 1.00 146.47 ? 107  DC  J "O5'" 1 
ATOM   8393  C "C5'" . DC  I 5 107 ? 130.050 85.713  150.802 1.00 146.47 ? 107  DC  J "C5'" 1 
ATOM   8394  C "C4'" . DC  I 5 107 ? 131.108 85.142  149.874 1.00 146.47 ? 107  DC  J "C4'" 1 
ATOM   8395  O "O4'" . DC  I 5 107 ? 131.342 86.077  148.798 1.00 146.47 ? 107  DC  J "O4'" 1 
ATOM   8396  C "C3'" . DC  I 5 107 ? 132.479 84.969  150.497 1.00 146.47 ? 107  DC  J "C3'" 1 
ATOM   8397  O "O3'" . DC  I 5 107 ? 133.276 84.147  149.647 1.00 146.47 ? 107  DC  J "O3'" 1 
ATOM   8398  C "C2'" . DC  I 5 107 ? 132.967 86.403  150.458 1.00 146.47 ? 107  DC  J "C2'" 1 
ATOM   8399  C "C1'" . DC  I 5 107 ? 132.566 86.749  149.036 1.00 146.47 ? 107  DC  J "C1'" 1 
ATOM   8400  N N1    . DC  I 5 107 ? 132.369 88.190  148.772 1.00 146.47 ? 107  DC  J N1    1 
ATOM   8401  C C2    . DC  I 5 107 ? 132.818 88.695  147.569 1.00 146.47 ? 107  DC  J C2    1 
ATOM   8402  O O2    . DC  I 5 107 ? 133.367 87.920  146.789 1.00 146.47 ? 107  DC  J O2    1 
ATOM   8403  N N3    . DC  I 5 107 ? 132.649 90.005  147.296 1.00 146.47 ? 107  DC  J N3    1 
ATOM   8404  C C4    . DC  I 5 107 ? 132.046 90.795  148.179 1.00 146.47 ? 107  DC  J C4    1 
ATOM   8405  N N4    . DC  I 5 107 ? 131.901 92.086  147.863 1.00 146.47 ? 107  DC  J N4    1 
ATOM   8406  C C5    . DC  I 5 107 ? 131.571 90.296  149.428 1.00 146.47 ? 107  DC  J C5    1 
ATOM   8407  C C6    . DC  I 5 107 ? 131.751 88.993  149.681 1.00 146.47 ? 107  DC  J C6    1 
ATOM   8408  P P     . DC  I 5 108 ? 134.496 83.290  150.245 1.00 141.68 ? 108  DC  J P     1 
ATOM   8409  O OP1   . DC  I 5 108 ? 134.073 81.875  150.270 1.00 141.68 ? 108  DC  J OP1   1 
ATOM   8410  O OP2   . DC  I 5 108 ? 134.976 83.964  151.470 1.00 141.68 ? 108  DC  J OP2   1 
ATOM   8411  O "O5'" . DC  I 5 108 ? 135.635 83.427  149.143 1.00 141.68 ? 108  DC  J "O5'" 1 
ATOM   8412  C "C5'" . DC  I 5 108 ? 135.619 84.526  148.271 1.00 141.68 ? 108  DC  J "C5'" 1 
ATOM   8413  C "C4'" . DC  I 5 108 ? 136.987 85.161  148.182 1.00 141.68 ? 108  DC  J "C4'" 1 
ATOM   8414  O "O4'" . DC  I 5 108 ? 136.826 86.572  147.896 1.00 141.68 ? 108  DC  J "O4'" 1 
ATOM   8415  C "C3'" . DC  I 5 108 ? 137.791 85.141  149.474 1.00 141.68 ? 108  DC  J "C3'" 1 
ATOM   8416  O "O3'" . DC  I 5 108 ? 139.149 85.414  149.164 1.00 141.68 ? 108  DC  J "O3'" 1 
ATOM   8417  C "C2'" . DC  I 5 108 ? 137.186 86.341  150.176 1.00 141.68 ? 108  DC  J "C2'" 1 
ATOM   8418  C "C1'" . DC  I 5 108 ? 137.297 87.298  149.013 1.00 141.68 ? 108  DC  J "C1'" 1 
ATOM   8419  N N1    . DC  I 5 108 ? 136.561 88.583  149.128 1.00 141.68 ? 108  DC  J N1    1 
ATOM   8420  C C2    . DC  I 5 108 ? 136.815 89.544  148.175 1.00 141.68 ? 108  DC  J C2    1 
ATOM   8421  O O2    . DC  I 5 108 ? 137.636 89.275  147.300 1.00 141.68 ? 108  DC  J O2    1 
ATOM   8422  N N3    . DC  I 5 108 ? 136.179 90.728  148.239 1.00 141.68 ? 108  DC  J N3    1 
ATOM   8423  C C4    . DC  I 5 108 ? 135.309 90.959  149.211 1.00 141.68 ? 108  DC  J C4    1 
ATOM   8424  N N4    . DC  I 5 108 ? 134.702 92.149  149.227 1.00 141.68 ? 108  DC  J N4    1 
ATOM   8425  C C5    . DC  I 5 108 ? 135.025 89.981  150.211 1.00 141.68 ? 108  DC  J C5    1 
ATOM   8426  C C6    . DC  I 5 108 ? 135.672 88.811  150.132 1.00 141.68 ? 108  DC  J C6    1 
ATOM   8427  P P     . DG  I 5 109 ? 140.225 84.239  148.974 1.00 132.16 ? 109  DG  J P     1 
ATOM   8428  O OP1   . DG  I 5 109 ? 139.494 82.981  148.708 1.00 132.16 ? 109  DG  J OP1   1 
ATOM   8429  O OP2   . DG  I 5 109 ? 141.167 84.321  150.112 1.00 132.16 ? 109  DG  J OP2   1 
ATOM   8430  O "O5'" . DG  I 5 109 ? 141.020 84.669  147.652 1.00 132.16 ? 109  DG  J "O5'" 1 
ATOM   8431  C "C5'" . DG  I 5 109 ? 142.445 84.677  147.640 1.00 132.16 ? 109  DG  J "C5'" 1 
ATOM   8432  C "C4'" . DG  I 5 109 ? 142.981 86.079  147.403 1.00 132.16 ? 109  DG  J "C4'" 1 
ATOM   8433  O "O4'" . DG  I 5 109 ? 141.939 87.051  147.717 1.00 132.16 ? 109  DG  J "O4'" 1 
ATOM   8434  C "C3'" . DG  I 5 109 ? 144.125 86.478  148.324 1.00 132.16 ? 109  DG  J "C3'" 1 
ATOM   8435  O "O3'" . DG  I 5 109 ? 144.747 87.681  147.823 1.00 132.16 ? 109  DG  J "O3'" 1 
ATOM   8436  C "C2'" . DG  I 5 109 ? 143.305 86.824  149.548 1.00 132.16 ? 109  DG  J "C2'" 1 
ATOM   8437  C "C1'" . DG  I 5 109 ? 142.389 87.790  148.834 1.00 132.16 ? 109  DG  J "C1'" 1 
ATOM   8438  N N9    . DG  I 5 109 ? 141.259 88.350  149.574 1.00 132.16 ? 109  DG  J N9    1 
ATOM   8439  C C8    . DG  I 5 109 ? 140.529 87.801  150.599 1.00 132.16 ? 109  DG  J C8    1 
ATOM   8440  N N7    . DG  I 5 109 ? 139.573 88.590  151.028 1.00 132.16 ? 109  DG  J N7    1 
ATOM   8441  C C5    . DG  I 5 109 ? 139.686 89.719  150.226 1.00 132.16 ? 109  DG  J C5    1 
ATOM   8442  C C6    . DG  I 5 109 ? 138.936 90.925  150.208 1.00 132.16 ? 109  DG  J C6    1 
ATOM   8443  O O6    . DG  I 5 109 ? 137.973 91.241  150.917 1.00 132.16 ? 109  DG  J O6    1 
ATOM   8444  N N1    . DG  I 5 109 ? 139.402 91.807  149.224 1.00 132.16 ? 109  DG  J N1    1 
ATOM   8445  C C2    . DG  I 5 109 ? 140.463 91.535  148.388 1.00 132.16 ? 109  DG  J C2    1 
ATOM   8446  N N2    . DG  I 5 109 ? 140.806 92.468  147.497 1.00 132.16 ? 109  DG  J N2    1 
ATOM   8447  N N3    . DG  I 5 109 ? 141.155 90.423  148.411 1.00 132.16 ? 109  DG  J N3    1 
ATOM   8448  C C4    . DG  I 5 109 ? 140.719 89.573  149.341 1.00 132.16 ? 109  DG  J C4    1 
ATOM   8449  P P     . DG  I 5 110 ? 146.025 87.655  146.849 1.00 123.86 ? 110  DG  J P     1 
ATOM   8450  O OP1   . DG  I 5 110 ? 145.599 87.075  145.561 1.00 123.86 ? 110  DG  J OP1   1 
ATOM   8451  O OP2   . DG  I 5 110 ? 147.144 87.045  147.596 1.00 123.86 ? 110  DG  J OP2   1 
ATOM   8452  O "O5'" . DG  I 5 110 ? 146.362 89.215  146.620 1.00 123.86 ? 110  DG  J "O5'" 1 
ATOM   8453  C "C5'" . DG  I 5 110 ? 145.299 90.159  146.314 1.00 123.86 ? 110  DG  J "C5'" 1 
ATOM   8454  C "C4'" . DG  I 5 110 ? 145.747 91.629  146.423 1.00 123.86 ? 110  DG  J "C4'" 1 
ATOM   8455  O "O4'" . DG  I 5 110 ? 145.154 92.270  147.582 1.00 123.86 ? 110  DG  J "O4'" 1 
ATOM   8456  C "C3'" . DG  I 5 110 ? 147.231 91.887  146.562 1.00 123.86 ? 110  DG  J "C3'" 1 
ATOM   8457  O "O3'" . DG  I 5 110 ? 147.537 93.162  145.977 1.00 123.86 ? 110  DG  J "O3'" 1 
ATOM   8458  C "C2'" . DG  I 5 110 ? 147.435 91.889  148.083 1.00 123.86 ? 110  DG  J "C2'" 1 
ATOM   8459  C "C1'" . DG  I 5 110 ? 146.046 92.193  148.677 1.00 123.86 ? 110  DG  J "C1'" 1 
ATOM   8460  N N9    . DG  I 5 110 ? 145.556 91.123  149.529 1.00 123.86 ? 110  DG  J N9    1 
ATOM   8461  C C8    . DG  I 5 110 ? 146.132 89.890  149.673 1.00 123.86 ? 110  DG  J C8    1 
ATOM   8462  N N7    . DG  I 5 110 ? 145.488 89.106  150.472 1.00 123.86 ? 110  DG  J N7    1 
ATOM   8463  C C5    . DG  I 5 110 ? 144.399 89.853  150.890 1.00 123.86 ? 110  DG  J C5    1 
ATOM   8464  C C6    . DG  I 5 110 ? 143.357 89.504  151.769 1.00 123.86 ? 110  DG  J C6    1 
ATOM   8465  O O6    . DG  I 5 110 ? 143.183 88.437  152.365 1.00 123.86 ? 110  DG  J O6    1 
ATOM   8466  N N1    . DG  I 5 110 ? 142.455 90.527  151.932 1.00 123.86 ? 110  DG  J N1    1 
ATOM   8467  C C2    . DG  I 5 110 ? 142.526 91.751  151.337 1.00 123.86 ? 110  DG  J C2    1 
ATOM   8468  N N2    . DG  I 5 110 ? 141.515 92.571  151.670 1.00 123.86 ? 110  DG  J N2    1 
ATOM   8469  N N3    . DG  I 5 110 ? 143.502 92.119  150.496 1.00 123.86 ? 110  DG  J N3    1 
ATOM   8470  C C4    . DG  I 5 110 ? 144.411 91.106  150.320 1.00 123.86 ? 110  DG  J C4    1 
ATOM   8471  P P     . DC  I 5 111 ? 149.011 93.807  146.041 1.00 112.35 ? 111  DC  J P     1 
ATOM   8472  O OP1   . DC  I 5 111 ? 149.185 94.594  144.803 1.00 112.35 ? 111  DC  J OP1   1 
ATOM   8473  O OP2   . DC  I 5 111 ? 150.014 92.782  146.399 1.00 112.35 ? 111  DC  J OP2   1 
ATOM   8474  O "O5'" . DC  I 5 111 ? 148.911 94.856  147.237 1.00 112.35 ? 111  DC  J "O5'" 1 
ATOM   8475  C "C5'" . DC  I 5 111 ? 147.686 95.566  147.467 1.00 112.35 ? 111  DC  J "C5'" 1 
ATOM   8476  C "C4'" . DC  I 5 111 ? 147.733 96.398  148.746 1.00 112.35 ? 111  DC  J "C4'" 1 
ATOM   8477  O "O4'" . DC  I 5 111 ? 147.077 95.697  149.840 1.00 112.35 ? 111  DC  J "O4'" 1 
ATOM   8478  C "C3'" . DC  I 5 111 ? 149.116 96.747  149.252 1.00 112.35 ? 111  DC  J "C3'" 1 
ATOM   8479  O "O3'" . DC  I 5 111 ? 149.066 97.994  149.883 1.00 112.35 ? 111  DC  J "O3'" 1 
ATOM   8480  C "C2'" . DC  I 5 111 ? 149.374 95.644  150.266 1.00 112.35 ? 111  DC  J "C2'" 1 
ATOM   8481  C "C1'" . DC  I 5 111 ? 147.994 95.470  150.893 1.00 112.35 ? 111  DC  J "C1'" 1 
ATOM   8482  N N1    . DC  I 5 111 ? 147.754 94.100  151.398 1.00 112.35 ? 111  DC  J N1    1 
ATOM   8483  C C2    . DC  I 5 111 ? 146.639 93.807  152.190 1.00 112.35 ? 111  DC  J C2    1 
ATOM   8484  O O2    . DC  I 5 111 ? 145.822 94.665  152.520 1.00 112.35 ? 111  DC  J O2    1 
ATOM   8485  N N3    . DC  I 5 111 ? 146.458 92.537  152.612 1.00 112.35 ? 111  DC  J N3    1 
ATOM   8486  C C4    . DC  I 5 111 ? 147.311 91.591  152.284 1.00 112.35 ? 111  DC  J C4    1 
ATOM   8487  N N4    . DC  I 5 111 ? 147.073 90.359  152.734 1.00 112.35 ? 111  DC  J N4    1 
ATOM   8488  C C5    . DC  I 5 111 ? 148.444 91.857  151.481 1.00 112.35 ? 111  DC  J C5    1 
ATOM   8489  C C6    . DC  I 5 111 ? 148.627 93.112  151.069 1.00 112.35 ? 111  DC  J C6    1 
ATOM   8490  P P     . DG  I 5 112 ? 149.663 99.294  149.170 1.00 92.18  ? 112  DG  J P     1 
ATOM   8491  O OP1   . DG  I 5 112 ? 149.046 99.414  147.834 1.00 92.18  ? 112  DG  J OP1   1 
ATOM   8492  O OP2   . DG  I 5 112 ? 151.131 99.196  149.285 1.00 92.18  ? 112  DG  J OP2   1 
ATOM   8493  O "O5'" . DG  I 5 112 ? 149.153 100.478 150.112 1.00 92.18  ? 112  DG  J "O5'" 1 
ATOM   8494  C "C5'" . DG  I 5 112 ? 147.881 100.370 150.738 1.00 92.18  ? 112  DG  J "C5'" 1 
ATOM   8495  C "C4'" . DG  I 5 112 ? 147.898 100.741 152.224 1.00 92.18  ? 112  DG  J "C4'" 1 
ATOM   8496  O "O4'" . DG  I 5 112 ? 147.784 99.557  153.042 1.00 92.18  ? 112  DG  J "O4'" 1 
ATOM   8497  C "C3'" . DG  I 5 112 ? 149.115 101.455 152.773 1.00 92.18  ? 112  DG  J "C3'" 1 
ATOM   8498  O "O3'" . DG  I 5 112 ? 148.687 102.143 153.926 1.00 92.18  ? 112  DG  J "O3'" 1 
ATOM   8499  C "C2'" . DG  I 5 112 ? 150.003 100.273 153.158 1.00 92.18  ? 112  DG  J "C2'" 1 
ATOM   8500  C "C1'" . DG  I 5 112 ? 148.966 99.387  153.809 1.00 92.18  ? 112  DG  J "C1'" 1 
ATOM   8501  N N9    . DG  I 5 112 ? 149.265 97.964  153.814 1.00 92.18  ? 112  DG  J N9    1 
ATOM   8502  C C8    . DG  I 5 112 ? 150.265 97.290  153.168 1.00 92.18  ? 112  DG  J C8    1 
ATOM   8503  N N7    . DG  I 5 112 ? 150.229 95.997  153.384 1.00 92.18  ? 112  DG  J N7    1 
ATOM   8504  C C5    . DG  I 5 112 ? 149.128 95.827  154.210 1.00 92.18  ? 112  DG  J C5    1 
ATOM   8505  C C6    . DG  I 5 112 ? 148.574 94.657  154.791 1.00 92.18  ? 112  DG  J C6    1 
ATOM   8506  O O6    . DG  I 5 112 ? 148.955 93.486  154.676 1.00 92.18  ? 112  DG  J O6    1 
ATOM   8507  N N1    . DG  I 5 112 ? 147.458 94.956  155.573 1.00 92.18  ? 112  DG  J N1    1 
ATOM   8508  C C2    . DG  I 5 112 ? 146.969 96.226  155.753 1.00 92.18  ? 112  DG  J C2    1 
ATOM   8509  N N2    . DG  I 5 112 ? 145.900 96.376  156.523 1.00 92.18  ? 112  DG  J N2    1 
ATOM   8510  N N3    . DG  I 5 112 ? 147.485 97.298  155.220 1.00 92.18  ? 112  DG  J N3    1 
ATOM   8511  C C4    . DG  I 5 112 ? 148.546 97.030  154.472 1.00 92.18  ? 112  DG  J C4    1 
ATOM   8512  P P     . DA  I 5 113 ? 149.505 103.374 154.535 1.00 87.81  ? 113  DA  J P     1 
ATOM   8513  O OP1   . DA  I 5 113 ? 148.918 104.624 154.042 1.00 87.81  ? 113  DA  J OP1   1 
ATOM   8514  O OP2   . DA  I 5 113 ? 150.949 103.129 154.394 1.00 87.81  ? 113  DA  J OP2   1 
ATOM   8515  O "O5'" . DA  I 5 113 ? 149.152 103.304 156.076 1.00 87.81  ? 113  DA  J "O5'" 1 
ATOM   8516  C "C5'" . DA  I 5 113 ? 147.824 103.556 156.513 1.00 87.81  ? 113  DA  J "C5'" 1 
ATOM   8517  C "C4'" . DA  I 5 113 ? 147.497 102.838 157.823 1.00 87.81  ? 113  DA  J "C4'" 1 
ATOM   8518  O "O4'" . DA  I 5 113 ? 147.722 101.420 157.684 1.00 87.81  ? 113  DA  J "O4'" 1 
ATOM   8519  C "C3'" . DA  I 5 113 ? 148.301 103.251 159.045 1.00 87.81  ? 113  DA  J "C3'" 1 
ATOM   8520  O "O3'" . DA  I 5 113 ? 147.508 103.079 160.197 1.00 87.81  ? 113  DA  J "O3'" 1 
ATOM   8521  C "C2'" . DA  I 5 113 ? 149.452 102.257 159.029 1.00 87.81  ? 113  DA  J "C2'" 1 
ATOM   8522  C "C1'" . DA  I 5 113 ? 148.734 101.000 158.579 1.00 87.81  ? 113  DA  J "C1'" 1 
ATOM   8523  N N9    . DA  I 5 113 ? 149.560 100.041 157.868 1.00 87.81  ? 113  DA  J N9    1 
ATOM   8524  C C8    . DA  I 5 113 ? 150.507 100.287 156.921 1.00 87.81  ? 113  DA  J C8    1 
ATOM   8525  N N7    . DA  I 5 113 ? 151.070 99.200  156.446 1.00 87.81  ? 113  DA  J N7    1 
ATOM   8526  C C5    . DA  I 5 113 ? 150.437 98.186  157.123 1.00 87.81  ? 113  DA  J C5    1 
ATOM   8527  C C6    . DA  I 5 113 ? 150.569 96.788  157.088 1.00 87.81  ? 113  DA  J C6    1 
ATOM   8528  N N6    . DA  I 5 113 ? 151.429 96.154  156.295 1.00 87.81  ? 113  DA  J N6    1 
ATOM   8529  N N1    . DA  I 5 113 ? 149.773 96.065  157.903 1.00 87.81  ? 113  DA  J N1    1 
ATOM   8530  C C2    . DA  I 5 113 ? 148.921 96.725  158.685 1.00 87.81  ? 113  DA  J C2    1 
ATOM   8531  N N3    . DA  I 5 113 ? 148.713 98.019  158.805 1.00 87.81  ? 113  DA  J N3    1 
ATOM   8532  C C4    . DA  I 5 113 ? 149.505 98.696  157.996 1.00 87.81  ? 113  DA  J C4    1 
ATOM   8533  P P     . DC  I 5 114 ? 148.020 103.612 161.621 1.00 100.76 ? 114  DC  J P     1 
ATOM   8534  O OP1   . DC  I 5 114 ? 146.843 103.862 162.472 1.00 100.76 ? 114  DC  J OP1   1 
ATOM   8535  O OP2   . DC  I 5 114 ? 148.979 104.702 161.358 1.00 100.76 ? 114  DC  J OP2   1 
ATOM   8536  O "O5'" . DC  I 5 114 ? 148.821 102.372 162.232 1.00 100.76 ? 114  DC  J "O5'" 1 
ATOM   8537  C "C5'" . DC  I 5 114 ? 148.211 101.086 162.295 1.00 100.76 ? 114  DC  J "C5'" 1 
ATOM   8538  C "C4'" . DC  I 5 114 ? 148.953 100.194 163.270 1.00 100.76 ? 114  DC  J "C4'" 1 
ATOM   8539  O "O4'" . DC  I 5 114 ? 149.694 99.180  162.547 1.00 100.76 ? 114  DC  J "O4'" 1 
ATOM   8540  C "C3'" . DC  I 5 114 ? 149.946 100.929 164.149 1.00 100.76 ? 114  DC  J "C3'" 1 
ATOM   8541  O "O3'" . DC  I 5 114 ? 149.845 100.504 165.485 1.00 100.76 ? 114  DC  J "O3'" 1 
ATOM   8542  C "C2'" . DC  I 5 114 ? 151.300 100.595 163.556 1.00 100.76 ? 114  DC  J "C2'" 1 
ATOM   8543  C "C1'" . DC  I 5 114 ? 151.078 99.305  162.770 1.00 100.76 ? 114  DC  J "C1'" 1 
ATOM   8544  N N1    . DC  I 5 114 ? 151.739 99.341  161.446 1.00 100.76 ? 114  DC  J N1    1 
ATOM   8545  C C2    . DC  I 5 114 ? 152.126 98.168  160.794 1.00 100.76 ? 114  DC  J C2    1 
ATOM   8546  O O2    . DC  I 5 114 ? 151.946 97.063  161.283 1.00 100.76 ? 114  DC  J O2    1 
ATOM   8547  N N3    . DC  I 5 114 ? 152.722 98.261  159.584 1.00 100.76 ? 114  DC  J N3    1 
ATOM   8548  C C4    . DC  I 5 114 ? 152.934 99.438  159.026 1.00 100.76 ? 114  DC  J C4    1 
ATOM   8549  N N4    . DC  I 5 114 ? 153.526 99.463  157.830 1.00 100.76 ? 114  DC  J N4    1 
ATOM   8550  C C5    . DC  I 5 114 ? 152.552 100.643 159.663 1.00 100.76 ? 114  DC  J C5    1 
ATOM   8551  C C6    . DC  I 5 114 ? 151.964 100.548 160.856 1.00 100.76 ? 114  DC  J C6    1 
ATOM   8552  P P     . DC  I 5 115 ? 149.827 101.601 166.655 1.00 110.85 ? 115  DC  J P     1 
ATOM   8553  O OP1   . DC  I 5 115 ? 148.467 101.617 167.234 1.00 110.85 ? 115  DC  J OP1   1 
ATOM   8554  O OP2   . DC  I 5 115 ? 150.404 102.843 166.101 1.00 110.85 ? 115  DC  J OP2   1 
ATOM   8555  O "O5'" . DC  I 5 115 ? 150.874 101.043 167.721 1.00 110.85 ? 115  DC  J "O5'" 1 
ATOM   8556  C "C5'" . DC  I 5 115 ? 152.262 101.205 167.495 1.00 110.85 ? 115  DC  J "C5'" 1 
ATOM   8557  C "C4'" . DC  I 5 115 ? 153.006 99.927  167.817 1.00 110.85 ? 115  DC  J "C4'" 1 
ATOM   8558  O "O4'" . DC  I 5 115 ? 153.194 99.153  166.604 1.00 110.85 ? 115  DC  J "O4'" 1 
ATOM   8559  C "C3'" . DC  I 5 115 ? 154.403 100.118 168.388 1.00 110.85 ? 115  DC  J "C3'" 1 
ATOM   8560  O "O3'" . DC  I 5 115 ? 154.718 99.015  169.223 1.00 110.85 ? 115  DC  J "O3'" 1 
ATOM   8561  C "C2'" . DC  I 5 115 ? 155.254 100.111 167.129 1.00 110.85 ? 115  DC  J "C2'" 1 
ATOM   8562  C "C1'" . DC  I 5 115 ? 154.576 98.993  166.361 1.00 110.85 ? 115  DC  J "C1'" 1 
ATOM   8563  N N1    . DC  I 5 115 ? 154.795 99.039  164.904 1.00 110.85 ? 115  DC  J N1    1 
ATOM   8564  C C2    . DC  I 5 115 ? 155.132 97.873  164.235 1.00 110.85 ? 115  DC  J C2    1 
ATOM   8565  O O2    . DC  I 5 115 ? 155.245 96.836  164.883 1.00 110.85 ? 115  DC  J O2    1 
ATOM   8566  N N3    . DC  I 5 115 ? 155.329 97.916  162.898 1.00 110.85 ? 115  DC  J N3    1 
ATOM   8567  C C4    . DC  I 5 115 ? 155.190 99.062  162.244 1.00 110.85 ? 115  DC  J C4    1 
ATOM   8568  N N4    . DC  I 5 115 ? 155.398 99.058  160.927 1.00 110.85 ? 115  DC  J N4    1 
ATOM   8569  C C5    . DC  I 5 115 ? 154.847 100.269 162.913 1.00 110.85 ? 115  DC  J C5    1 
ATOM   8570  C C6    . DC  I 5 115 ? 154.663 100.210 164.234 1.00 110.85 ? 115  DC  J C6    1 
ATOM   8571  P P     . DC  I 5 116 ? 155.676 99.196  170.498 1.00 117.54 ? 116  DC  J P     1 
ATOM   8572  O OP1   . DC  I 5 116 ? 154.806 99.187  171.694 1.00 117.54 ? 116  DC  J OP1   1 
ATOM   8573  O OP2   . DC  I 5 116 ? 156.591 100.329 170.238 1.00 117.54 ? 116  DC  J OP2   1 
ATOM   8574  O "O5'" . DC  I 5 116 ? 156.554 97.865  170.499 1.00 117.54 ? 116  DC  J "O5'" 1 
ATOM   8575  C "C5'" . DC  I 5 116 ? 156.846 97.226  169.274 1.00 117.54 ? 116  DC  J "C5'" 1 
ATOM   8576  C "C4'" . DC  I 5 116 ? 158.340 97.057  169.091 1.00 117.54 ? 116  DC  J "C4'" 1 
ATOM   8577  O "O4'" . DC  I 5 116 ? 158.629 96.926  167.674 1.00 117.54 ? 116  DC  J "O4'" 1 
ATOM   8578  C "C3'" . DC  I 5 116 ? 159.185 98.238  169.556 1.00 117.54 ? 116  DC  J "C3'" 1 
ATOM   8579  O "O3'" . DC  I 5 116 ? 160.487 97.781  169.892 1.00 117.54 ? 116  DC  J "O3'" 1 
ATOM   8580  C "C2'" . DC  I 5 116 ? 159.221 99.084  168.301 1.00 117.54 ? 116  DC  J "C2'" 1 
ATOM   8581  C "C1'" . DC  I 5 116 ? 159.453 97.996  167.275 1.00 117.54 ? 116  DC  J "C1'" 1 
ATOM   8582  N N1    . DC  I 5 116 ? 159.110 98.380  165.888 1.00 117.54 ? 116  DC  J N1    1 
ATOM   8583  C C2    . DC  I 5 116 ? 159.447 97.524  164.850 1.00 117.54 ? 116  DC  J C2    1 
ATOM   8584  O O2    . DC  I 5 116 ? 160.018 96.469  165.119 1.00 117.54 ? 116  DC  J O2    1 
ATOM   8585  N N3    . DC  I 5 116 ? 159.141 97.876  163.583 1.00 117.54 ? 116  DC  J N3    1 
ATOM   8586  C C4    . DC  I 5 116 ? 158.528 99.021  163.343 1.00 117.54 ? 116  DC  J C4    1 
ATOM   8587  N N4    . DC  I 5 116 ? 158.251 99.325  162.078 1.00 117.54 ? 116  DC  J N4    1 
ATOM   8588  C C5    . DC  I 5 116 ? 158.169 99.912  164.389 1.00 117.54 ? 116  DC  J C5    1 
ATOM   8589  C C6    . DC  I 5 116 ? 158.483 99.558  165.636 1.00 117.54 ? 116  DC  J C6    1 
ATOM   8590  P P     . DT  I 5 117 ? 161.422 98.627  170.887 1.00 122.19 ? 117  DT  J P     1 
ATOM   8591  O OP1   . DT  I 5 117 ? 161.475 97.877  172.158 1.00 122.19 ? 117  DT  J OP1   1 
ATOM   8592  O OP2   . DT  I 5 117 ? 160.981 100.039 170.888 1.00 122.19 ? 117  DT  J OP2   1 
ATOM   8593  O "O5'" . DT  I 5 117 ? 162.865 98.552  170.207 1.00 122.19 ? 117  DT  J "O5'" 1 
ATOM   8594  C "C5'" . DT  I 5 117 ? 163.605 97.346  170.264 1.00 122.19 ? 117  DT  J "C5'" 1 
ATOM   8595  C "C4'" . DT  I 5 117 ? 164.310 97.079  168.949 1.00 122.19 ? 117  DT  J "C4'" 1 
ATOM   8596  O "O4'" . DT  I 5 117 ? 163.448 97.466  167.846 1.00 122.19 ? 117  DT  J "O4'" 1 
ATOM   8597  C "C3'" . DT  I 5 117 ? 165.621 97.850  168.736 1.00 122.19 ? 117  DT  J "C3'" 1 
ATOM   8598  O "O3'" . DT  I 5 117 ? 166.570 97.001  168.088 1.00 122.19 ? 117  DT  J "O3'" 1 
ATOM   8599  C "C2'" . DT  I 5 117 ? 165.183 98.989  167.825 1.00 122.19 ? 117  DT  J "C2'" 1 
ATOM   8600  C "C1'" . DT  I 5 117 ? 164.201 98.248  166.952 1.00 122.19 ? 117  DT  J "C1'" 1 
ATOM   8601  N N1    . DT  I 5 117 ? 163.296 99.116  166.182 1.00 122.19 ? 117  DT  J N1    1 
ATOM   8602  C C2    . DT  I 5 117 ? 163.172 98.891  164.847 1.00 122.19 ? 117  DT  J C2    1 
ATOM   8603  O O2    . DT  I 5 117 ? 163.778 98.013  164.271 1.00 122.19 ? 117  DT  J O2    1 
ATOM   8604  N N3    . DT  I 5 117 ? 162.315 99.727  164.196 1.00 122.19 ? 117  DT  J N3    1 
ATOM   8605  C C4    . DT  I 5 117 ? 161.580 100.754 164.750 1.00 122.19 ? 117  DT  J C4    1 
ATOM   8606  O O4    . DT  I 5 117 ? 160.835 101.459 164.086 1.00 122.19 ? 117  DT  J O4    1 
ATOM   8607  C C5    . DT  I 5 117 ? 161.755 100.939 166.166 1.00 122.19 ? 117  DT  J C5    1 
ATOM   8608  C C7    . DT  I 5 117 ? 161.008 102.023 166.875 1.00 122.19 ? 117  DT  J C7    1 
ATOM   8609  C C6    . DT  I 5 117 ? 162.598 100.120 166.809 1.00 122.19 ? 117  DT  J C6    1 
ATOM   8610  P P     . DC  I 5 118 ? 168.039 97.537  167.711 1.00 119.68 ? 118  DC  J P     1 
ATOM   8611  O OP1   . DC  I 5 118 ? 168.945 96.372  167.724 1.00 119.68 ? 118  DC  J OP1   1 
ATOM   8612  O OP2   . DC  I 5 118 ? 168.355 98.714  168.549 1.00 119.68 ? 118  DC  J OP2   1 
ATOM   8613  O "O5'" . DC  I 5 118 ? 167.895 98.009  166.193 1.00 119.68 ? 118  DC  J "O5'" 1 
ATOM   8614  C "C5'" . DC  I 5 118 ? 168.552 97.283  165.158 1.00 119.68 ? 118  DC  J "C5'" 1 
ATOM   8615  C "C4'" . DC  I 5 118 ? 169.082 98.218  164.082 1.00 119.68 ? 118  DC  J "C4'" 1 
ATOM   8616  O "O4'" . DC  I 5 118 ? 168.071 99.208  163.760 1.00 119.68 ? 118  DC  J "O4'" 1 
ATOM   8617  C "C3'" . DC  I 5 118 ? 170.333 98.998  164.466 1.00 119.68 ? 118  DC  J "C3'" 1 
ATOM   8618  O "O3'" . DC  I 5 118 ? 171.181 99.160  163.343 1.00 119.68 ? 118  DC  J "O3'" 1 
ATOM   8619  C "C2'" . DC  I 5 118 ? 169.779 100.335 164.937 1.00 119.68 ? 118  DC  J "C2'" 1 
ATOM   8620  C "C1'" . DC  I 5 118 ? 168.540 100.504 164.064 1.00 119.68 ? 118  DC  J "C1'" 1 
ATOM   8621  N N1    . DC  I 5 118 ? 167.444 101.248 164.741 1.00 119.68 ? 118  DC  J N1    1 
ATOM   8622  C C2    . DC  I 5 118 ? 166.349 101.716 164.007 1.00 119.68 ? 118  DC  J C2    1 
ATOM   8623  O O2    . DC  I 5 118 ? 166.272 101.525 162.792 1.00 119.68 ? 118  DC  J O2    1 
ATOM   8624  N N3    . DC  I 5 118 ? 165.370 102.393 164.653 1.00 119.68 ? 118  DC  J N3    1 
ATOM   8625  C C4    . DC  I 5 118 ? 165.447 102.601 165.959 1.00 119.68 ? 118  DC  J C4    1 
ATOM   8626  N N4    . DC  I 5 118 ? 164.453 103.272 166.539 1.00 119.68 ? 118  DC  J N4    1 
ATOM   8627  C C5    . DC  I 5 118 ? 166.550 102.136 166.727 1.00 119.68 ? 118  DC  J C5    1 
ATOM   8628  C C6    . DC  I 5 118 ? 167.513 101.470 166.086 1.00 119.68 ? 118  DC  J C6    1 
ATOM   8629  P P     . DA  I 5 119 ? 172.774 99.166  163.541 1.00 111.09 ? 119  DA  J P     1 
ATOM   8630  O OP1   . DA  I 5 119 ? 173.191 97.754  163.656 1.00 111.09 ? 119  DA  J OP1   1 
ATOM   8631  O OP2   . DA  I 5 119 ? 173.082 100.121 164.629 1.00 111.09 ? 119  DA  J OP2   1 
ATOM   8632  O "O5'" . DA  I 5 119 ? 173.344 99.777  162.174 1.00 111.09 ? 119  DA  J "O5'" 1 
ATOM   8633  C "C5'" . DA  I 5 119 ? 172.491 99.919  161.038 1.00 111.09 ? 119  DA  J "C5'" 1 
ATOM   8634  C "C4'" . DA  I 5 119 ? 172.574 101.314 160.418 1.00 111.09 ? 119  DA  J "C4'" 1 
ATOM   8635  O "O4'" . DA  I 5 119 ? 171.384 102.071 160.751 1.00 111.09 ? 119  DA  J "O4'" 1 
ATOM   8636  C "C3'" . DA  I 5 119 ? 173.737 102.193 160.861 1.00 111.09 ? 119  DA  J "C3'" 1 
ATOM   8637  O "O3'" . DA  I 5 119 ? 174.047 103.114 159.808 1.00 111.09 ? 119  DA  J "O3'" 1 
ATOM   8638  C "C2'" . DA  I 5 119 ? 173.112 102.935 162.041 1.00 111.09 ? 119  DA  J "C2'" 1 
ATOM   8639  C "C1'" . DA  I 5 119 ? 171.759 103.246 161.439 1.00 111.09 ? 119  DA  J "C1'" 1 
ATOM   8640  N N9    . DA  I 5 119 ? 170.704 103.569 162.388 1.00 111.09 ? 119  DA  J N9    1 
ATOM   8641  C C8    . DA  I 5 119 ? 170.719 103.462 163.746 1.00 111.09 ? 119  DA  J C8    1 
ATOM   8642  N N7    . DA  I 5 119 ? 169.589 103.828 164.312 1.00 111.09 ? 119  DA  J N7    1 
ATOM   8643  C C5    . DA  I 5 119 ? 168.791 104.196 163.243 1.00 111.09 ? 119  DA  J C5    1 
ATOM   8644  C C6    . DA  I 5 119 ? 167.466 104.684 163.145 1.00 111.09 ? 119  DA  J C6    1 
ATOM   8645  N N6    . DA  I 5 119 ? 166.680 104.892 164.200 1.00 111.09 ? 119  DA  J N6    1 
ATOM   8646  N N1    . DA  I 5 119 ? 166.983 104.949 161.908 1.00 111.09 ? 119  DA  J N1    1 
ATOM   8647  C C2    . DA  I 5 119 ? 167.783 104.736 160.867 1.00 111.09 ? 119  DA  J C2    1 
ATOM   8648  N N3    . DA  I 5 119 ? 169.023 104.289 160.837 1.00 111.09 ? 119  DA  J N3    1 
ATOM   8649  C C4    . DA  I 5 119 ? 169.471 104.037 162.062 1.00 111.09 ? 119  DA  J C4    1 
ATOM   8650  P P     . DG  I 5 120 ? 175.066 102.742 158.618 1.00 110.25 ? 120  DG  J P     1 
ATOM   8651  O OP1   . DG  I 5 120 ? 175.215 101.276 158.509 1.00 110.25 ? 120  DG  J OP1   1 
ATOM   8652  O OP2   . DG  I 5 120 ? 176.266 103.582 158.800 1.00 110.25 ? 120  DG  J OP2   1 
ATOM   8653  O "O5'" . DG  I 5 120 ? 174.333 103.292 157.308 1.00 110.25 ? 120  DG  J "O5'" 1 
ATOM   8654  C "C5'" . DG  I 5 120 ? 172.986 103.733 157.392 1.00 110.25 ? 120  DG  J "C5'" 1 
ATOM   8655  C "C4'" . DG  I 5 120 ? 172.836 105.204 157.014 1.00 110.25 ? 120  DG  J "C4'" 1 
ATOM   8656  O "O4'" . DG  I 5 120 ? 172.130 105.898 158.068 1.00 110.25 ? 120  DG  J "O4'" 1 
ATOM   8657  C "C3'" . DG  I 5 120 ? 174.121 105.999 156.848 1.00 110.25 ? 120  DG  J "C3'" 1 
ATOM   8658  O "O3'" . DG  I 5 120 ? 173.829 107.191 156.096 1.00 110.25 ? 120  DG  J "O3'" 1 
ATOM   8659  C "C2'" . DG  I 5 120 ? 174.422 106.353 158.302 1.00 110.25 ? 120  DG  J "C2'" 1 
ATOM   8660  C "C1'" . DG  I 5 120 ? 173.029 106.761 158.742 1.00 110.25 ? 120  DG  J "C1'" 1 
ATOM   8661  N N9    . DG  I 5 120 ? 172.750 106.678 160.164 1.00 110.25 ? 120  DG  J N9    1 
ATOM   8662  C C8    . DG  I 5 120 ? 173.551 106.241 161.181 1.00 110.25 ? 120  DG  J C8    1 
ATOM   8663  N N7    . DG  I 5 120 ? 172.961 106.293 162.352 1.00 110.25 ? 120  DG  J N7    1 
ATOM   8664  C C5    . DG  I 5 120 ? 171.701 106.799 162.068 1.00 110.25 ? 120  DG  J C5    1 
ATOM   8665  C C6    . DG  I 5 120 ? 170.598 107.090 162.915 1.00 110.25 ? 120  DG  J C6    1 
ATOM   8666  O O6    . DG  I 5 120 ? 170.510 106.950 164.140 1.00 110.25 ? 120  DG  J O6    1 
ATOM   8667  N N1    . DG  I 5 120 ? 169.513 107.595 162.188 1.00 110.25 ? 120  DG  J N1    1 
ATOM   8668  C C2    . DG  I 5 120 ? 169.529 107.779 160.826 1.00 110.25 ? 120  DG  J C2    1 
ATOM   8669  N N2    . DG  I 5 120 ? 168.438 108.264 160.252 1.00 110.25 ? 120  DG  J N2    1 
ATOM   8670  N N3    . DG  I 5 120 ? 170.544 107.509 160.056 1.00 110.25 ? 120  DG  J N3    1 
ATOM   8671  C C4    . DG  I 5 120 ? 171.579 107.029 160.731 1.00 110.25 ? 120  DG  J C4    1 
ATOM   8672  P P     . DG  I 5 121 ? 173.938 107.223 154.489 1.00 107.86 ? 121  DG  J P     1 
ATOM   8673  O OP1   . DG  I 5 121 ? 173.898 105.841 153.971 1.00 107.86 ? 121  DG  J OP1   1 
ATOM   8674  O OP2   . DG  I 5 121 ? 175.099 108.080 154.177 1.00 107.86 ? 121  DG  J OP2   1 
ATOM   8675  O "O5'" . DG  I 5 121 ? 172.620 108.020 154.009 1.00 107.86 ? 121  DG  J "O5'" 1 
ATOM   8676  C "C5'" . DG  I 5 121 ? 171.517 108.213 154.914 1.00 107.86 ? 121  DG  J "C5'" 1 
ATOM   8677  C "C4'" . DG  I 5 121 ? 170.593 109.363 154.490 1.00 107.86 ? 121  DG  J "C4'" 1 
ATOM   8678  O "O4'" . DG  I 5 121 ? 170.225 110.137 155.647 1.00 107.86 ? 121  DG  J "O4'" 1 
ATOM   8679  C "C3'" . DG  I 5 121 ? 171.189 110.417 153.603 1.00 107.86 ? 121  DG  J "C3'" 1 
ATOM   8680  O "O3'" . DG  I 5 121 ? 170.105 111.235 153.129 1.00 107.86 ? 121  DG  J "O3'" 1 
ATOM   8681  C "C2'" . DG  I 5 121 ? 172.073 111.156 154.607 1.00 107.86 ? 121  DG  J "C2'" 1 
ATOM   8682  C "C1'" . DG  I 5 121 ? 171.211 111.140 155.863 1.00 107.86 ? 121  DG  J "C1'" 1 
ATOM   8683  N N9    . DG  I 5 121 ? 171.899 110.753 157.081 1.00 107.86 ? 121  DG  J N9    1 
ATOM   8684  C C8    . DG  I 5 121 ? 173.148 110.213 157.222 1.00 107.86 ? 121  DG  J C8    1 
ATOM   8685  N N7    . DG  I 5 121 ? 173.452 109.952 158.464 1.00 107.86 ? 121  DG  J N7    1 
ATOM   8686  C C5    . DG  I 5 121 ? 172.320 110.320 159.176 1.00 107.86 ? 121  DG  J C5    1 
ATOM   8687  C C6    . DG  I 5 121 ? 172.037 110.272 160.573 1.00 107.86 ? 121  DG  J C6    1 
ATOM   8688  O O6    . DG  I 5 121 ? 172.761 109.862 161.491 1.00 107.86 ? 121  DG  J O6    1 
ATOM   8689  N N1    . DG  I 5 121 ? 170.755 110.760 160.856 1.00 107.86 ? 121  DG  J N1    1 
ATOM   8690  C C2    . DG  I 5 121 ? 169.888 111.230 159.894 1.00 107.86 ? 121  DG  J C2    1 
ATOM   8691  N N2    . DG  I 5 121 ? 168.700 111.669 160.295 1.00 107.86 ? 121  DG  J N2    1 
ATOM   8692  N N3    . DG  I 5 121 ? 170.153 111.273 158.611 1.00 107.86 ? 121  DG  J N3    1 
ATOM   8693  C C4    . DG  I 5 121 ? 171.370 110.811 158.327 1.00 107.86 ? 121  DG  J C4    1 
ATOM   8694  P P     . DT  I 5 122 ? 170.310 112.707 152.512 1.00 96.86  ? 122  DT  J P     1 
ATOM   8695  O OP1   . DT  I 5 122 ? 169.139 112.899 151.634 1.00 96.86  ? 122  DT  J OP1   1 
ATOM   8696  O OP2   . DT  I 5 122 ? 171.665 112.917 151.960 1.00 96.86  ? 122  DT  J OP2   1 
ATOM   8697  O "O5'" . DT  I 5 122 ? 170.078 113.676 153.754 1.00 96.86  ? 122  DT  J "O5'" 1 
ATOM   8698  C "C5'" . DT  I 5 122 ? 168.765 113.820 154.274 1.00 96.86  ? 122  DT  J "C5'" 1 
ATOM   8699  C "C4'" . DT  I 5 122 ? 168.650 114.900 155.351 1.00 96.86  ? 122  DT  J "C4'" 1 
ATOM   8700  O "O4'" . DT  I 5 122 ? 169.384 114.544 156.545 1.00 96.86  ? 122  DT  J "O4'" 1 
ATOM   8701  C "C3'" . DT  I 5 122 ? 169.120 116.294 154.996 1.00 96.86  ? 122  DT  J "C3'" 1 
ATOM   8702  O "O3'" . DT  I 5 122 ? 168.320 117.186 155.738 1.00 96.86  ? 122  DT  J "O3'" 1 
ATOM   8703  C "C2'" . DT  I 5 122 ? 170.556 116.276 155.522 1.00 96.86  ? 122  DT  J "C2'" 1 
ATOM   8704  C "C1'" . DT  I 5 122 ? 170.350 115.542 156.831 1.00 96.86  ? 122  DT  J "C1'" 1 
ATOM   8705  N N1    . DT  I 5 122 ? 171.528 114.826 157.385 1.00 96.86  ? 122  DT  J N1    1 
ATOM   8706  C C2    . DT  I 5 122 ? 171.545 114.566 158.728 1.00 96.86  ? 122  DT  J C2    1 
ATOM   8707  O O2    . DT  I 5 122 ? 170.674 114.947 159.482 1.00 96.86  ? 122  DT  J O2    1 
ATOM   8708  N N3    . DT  I 5 122 ? 172.613 113.843 159.163 1.00 96.86  ? 122  DT  J N3    1 
ATOM   8709  C C4    . DT  I 5 122 ? 173.635 113.336 158.402 1.00 96.86  ? 122  DT  J C4    1 
ATOM   8710  O O4    . DT  I 5 122 ? 174.568 112.716 158.893 1.00 96.86  ? 122  DT  J O4    1 
ATOM   8711  C C5    . DT  I 5 122 ? 173.569 113.643 156.998 1.00 96.86  ? 122  DT  J C5    1 
ATOM   8712  C C7    . DT  I 5 122 ? 174.658 113.172 156.082 1.00 96.86  ? 122  DT  J C7    1 
ATOM   8713  C C6    . DT  I 5 122 ? 172.520 114.359 156.554 1.00 96.86  ? 122  DT  J C6    1 
ATOM   8714  P P     . DC  I 5 123 ? 168.151 118.725 155.330 1.00 99.71  ? 123  DC  J P     1 
ATOM   8715  O OP1   . DC  I 5 123 ? 166.732 118.917 154.976 1.00 99.71  ? 123  DC  J OP1   1 
ATOM   8716  O OP2   . DC  I 5 123 ? 169.197 119.063 154.348 1.00 99.71  ? 123  DC  J OP2   1 
ATOM   8717  O "O5'" . DC  I 5 123 ? 168.445 119.477 156.708 1.00 99.71  ? 123  DC  J "O5'" 1 
ATOM   8718  C "C5'" . DC  I 5 123 ? 168.705 118.692 157.863 1.00 99.71  ? 123  DC  J "C5'" 1 
ATOM   8719  C "C4'" . DC  I 5 123 ? 169.066 119.541 159.060 1.00 99.71  ? 123  DC  J "C4'" 1 
ATOM   8720  O "O4'" . DC  I 5 123 ? 170.271 119.024 159.678 1.00 99.71  ? 123  DC  J "O4'" 1 
ATOM   8721  C "C3'" . DC  I 5 123 ? 169.354 120.992 158.767 1.00 99.71  ? 123  DC  J "C3'" 1 
ATOM   8722  O "O3'" . DC  I 5 123 ? 169.056 121.753 159.914 1.00 99.71  ? 123  DC  J "O3'" 1 
ATOM   8723  C "C2'" . DC  I 5 123 ? 170.851 120.978 158.474 1.00 99.71  ? 123  DC  J "C2'" 1 
ATOM   8724  C "C1'" . DC  I 5 123 ? 171.385 119.811 159.317 1.00 99.71  ? 123  DC  J "C1'" 1 
ATOM   8725  N N1    . DC  I 5 123 ? 172.339 118.941 158.560 1.00 99.71  ? 123  DC  J N1    1 
ATOM   8726  C C2    . DC  I 5 123 ? 173.162 118.001 159.216 1.00 99.71  ? 123  DC  J C2    1 
ATOM   8727  O O2    . DC  I 5 123 ? 173.144 117.854 160.442 1.00 99.71  ? 123  DC  J O2    1 
ATOM   8728  N N3    . DC  I 5 123 ? 173.995 117.243 158.470 1.00 99.71  ? 123  DC  J N3    1 
ATOM   8729  C C4    . DC  I 5 123 ? 174.041 117.382 157.157 1.00 99.71  ? 123  DC  J C4    1 
ATOM   8730  N N4    . DC  I 5 123 ? 174.885 116.605 156.479 1.00 99.71  ? 123  DC  J N4    1 
ATOM   8731  C C5    . DC  I 5 123 ? 173.226 118.318 156.475 1.00 99.71  ? 123  DC  J C5    1 
ATOM   8732  C C6    . DC  I 5 123 ? 172.399 119.063 157.204 1.00 99.71  ? 123  DC  J C6    1 
ATOM   8733  P P     . DG  I 5 124 ? 168.819 123.340 159.837 1.00 120.51 ? 124  DG  J P     1 
ATOM   8734  O OP1   . DG  I 5 124 ? 167.379 123.558 160.084 1.00 120.51 ? 124  DG  J OP1   1 
ATOM   8735  O OP2   . DG  I 5 124 ? 169.448 123.906 158.625 1.00 120.51 ? 124  DG  J OP2   1 
ATOM   8736  O "O5'" . DG  I 5 124 ? 169.636 123.867 161.097 1.00 120.51 ? 124  DG  J "O5'" 1 
ATOM   8737  C "C5'" . DG  I 5 124 ? 170.322 122.917 161.901 1.00 120.51 ? 124  DG  J "C5'" 1 
ATOM   8738  C "C4'" . DG  I 5 124 ? 171.462 123.544 162.676 1.00 120.51 ? 124  DG  J "C4'" 1 
ATOM   8739  O "O4'" . DG  I 5 124 ? 172.650 122.731 162.530 1.00 120.51 ? 124  DG  J "O4'" 1 
ATOM   8740  C "C3'" . DG  I 5 124 ? 171.892 124.915 162.211 1.00 120.51 ? 124  DG  J "C3'" 1 
ATOM   8741  O "O3'" . DG  I 5 124 ? 172.646 125.555 163.248 1.00 120.51 ? 124  DG  J "O3'" 1 
ATOM   8742  C "C2'" . DG  I 5 124 ? 172.799 124.540 161.049 1.00 120.51 ? 124  DG  J "C2'" 1 
ATOM   8743  C "C1'" . DG  I 5 124 ? 173.567 123.397 161.686 1.00 120.51 ? 124  DG  J "C1'" 1 
ATOM   8744  N N9    . DG  I 5 124 ? 174.094 122.425 160.753 1.00 120.51 ? 124  DG  J N9    1 
ATOM   8745  C C8    . DG  I 5 124 ? 173.871 122.334 159.411 1.00 120.51 ? 124  DG  J C8    1 
ATOM   8746  N N7    . DG  I 5 124 ? 174.483 121.324 158.856 1.00 120.51 ? 124  DG  J N7    1 
ATOM   8747  C C5    . DG  I 5 124 ? 175.153 120.725 159.907 1.00 120.51 ? 124  DG  J C5    1 
ATOM   8748  C C6    . DG  I 5 124 ? 175.993 119.589 159.939 1.00 120.51 ? 124  DG  J C6    1 
ATOM   8749  O O6    . DG  I 5 124 ? 176.328 118.858 159.004 1.00 120.51 ? 124  DG  J O6    1 
ATOM   8750  N N1    . DG  I 5 124 ? 176.463 119.334 161.229 1.00 120.51 ? 124  DG  J N1    1 
ATOM   8751  C C2    . DG  I 5 124 ? 176.146 120.094 162.329 1.00 120.51 ? 124  DG  J C2    1 
ATOM   8752  N N2    . DG  I 5 124 ? 176.668 119.733 163.500 1.00 120.51 ? 124  DG  J N2    1 
ATOM   8753  N N3    . DG  I 5 124 ? 175.368 121.146 162.296 1.00 120.51 ? 124  DG  J N3    1 
ATOM   8754  C C4    . DG  I 5 124 ? 174.913 121.400 161.070 1.00 120.51 ? 124  DG  J C4    1 
ATOM   8755  P P     . DG  I 5 125 ? 172.113 125.608 164.767 1.00 139.70 ? 125  DG  J P     1 
ATOM   8756  O OP1   . DG  I 5 125 ? 172.686 124.477 165.530 1.00 139.70 ? 125  DG  J OP1   1 
ATOM   8757  O OP2   . DG  I 5 125 ? 170.663 125.889 164.773 1.00 139.70 ? 125  DG  J OP2   1 
ATOM   8758  O "O5'" . DG  I 5 125 ? 172.796 126.915 165.345 1.00 139.70 ? 125  DG  J "O5'" 1 
ATOM   8759  C "C5'" . DG  I 5 125 ? 173.717 127.604 164.561 1.00 139.70 ? 125  DG  J "C5'" 1 
ATOM   8760  C "C4'" . DG  I 5 125 ? 175.131 127.294 164.995 1.00 139.70 ? 125  DG  J "C4'" 1 
ATOM   8761  O "O4'" . DG  I 5 125 ? 175.591 126.071 164.347 1.00 139.70 ? 125  DG  J "O4'" 1 
ATOM   8762  C "C3'" . DG  I 5 125 ? 176.140 128.356 164.588 1.00 139.70 ? 125  DG  J "C3'" 1 
ATOM   8763  O "O3'" . DG  I 5 125 ? 177.237 128.365 165.500 1.00 139.70 ? 125  DG  J "O3'" 1 
ATOM   8764  C "C2'" . DG  I 5 125 ? 176.585 127.831 163.241 1.00 139.70 ? 125  DG  J "C2'" 1 
ATOM   8765  C "C1'" . DG  I 5 125 ? 176.753 126.375 163.607 1.00 139.70 ? 125  DG  J "C1'" 1 
ATOM   8766  N N9    . DG  I 5 125 ? 176.842 125.485 162.464 1.00 139.70 ? 125  DG  J N9    1 
ATOM   8767  C C8    . DG  I 5 125 ? 176.161 125.593 161.282 1.00 139.70 ? 125  DG  J C8    1 
ATOM   8768  N N7    . DG  I 5 125 ? 176.443 124.644 160.433 1.00 139.70 ? 125  DG  J N7    1 
ATOM   8769  C C5    . DG  I 5 125 ? 177.369 123.857 161.099 1.00 139.70 ? 125  DG  J C5    1 
ATOM   8770  C C6    . DG  I 5 125 ? 178.047 122.694 160.672 1.00 139.70 ? 125  DG  J C6    1 
ATOM   8771  O O6    . DG  I 5 125 ? 177.942 122.101 159.593 1.00 139.70 ? 125  DG  J O6    1 
ATOM   8772  N N1    . DG  I 5 125 ? 178.913 122.215 161.648 1.00 139.70 ? 125  DG  J N1    1 
ATOM   8773  C C2    . DG  I 5 125 ? 179.104 122.797 162.881 1.00 139.70 ? 125  DG  J C2    1 
ATOM   8774  N N2    . DG  I 5 125 ? 179.981 122.196 163.696 1.00 139.70 ? 125  DG  J N2    1 
ATOM   8775  N N3    . DG  I 5 125 ? 178.479 123.894 163.287 1.00 139.70 ? 125  DG  J N3    1 
ATOM   8776  C C4    . DG  I 5 125 ? 177.634 124.368 162.346 1.00 139.70 ? 125  DG  J C4    1 
ATOM   8777  P P     . DC  I 5 126 ? 177.512 129.632 166.449 1.00 152.37 ? 126  DC  J P     1 
ATOM   8778  O OP1   . DC  I 5 126 ? 178.098 129.109 167.701 1.00 152.37 ? 126  DC  J OP1   1 
ATOM   8779  O OP2   . DC  I 5 126 ? 176.274 130.436 166.494 1.00 152.37 ? 126  DC  J OP2   1 
ATOM   8780  O "O5'" . DC  I 5 126 ? 178.619 130.506 165.678 1.00 152.37 ? 126  DC  J "O5'" 1 
ATOM   8781  C "C5'" . DC  I 5 126 ? 179.369 129.961 164.586 1.00 152.37 ? 126  DC  J "C5'" 1 
ATOM   8782  C "C4'" . DC  I 5 126 ? 180.464 129.043 165.076 1.00 152.37 ? 126  DC  J "C4'" 1 
ATOM   8783  O "O4'" . DC  I 5 126 ? 180.298 127.731 164.469 1.00 152.37 ? 126  DC  J "O4'" 1 
ATOM   8784  C "C3'" . DC  I 5 126 ? 181.860 129.477 164.684 1.00 152.37 ? 126  DC  J "C3'" 1 
ATOM   8785  O "O3'" . DC  I 5 126 ? 182.796 128.910 165.580 1.00 152.37 ? 126  DC  J "O3'" 1 
ATOM   8786  C "C2'" . DC  I 5 126 ? 181.975 128.863 163.300 1.00 152.37 ? 126  DC  J "C2'" 1 
ATOM   8787  C "C1'" . DC  I 5 126 ? 181.355 127.499 163.556 1.00 152.37 ? 126  DC  J "C1'" 1 
ATOM   8788  N N1    . DC  I 5 126 ? 180.798 126.876 162.342 1.00 152.37 ? 126  DC  J N1    1 
ATOM   8789  C C2    . DC  I 5 126 ? 181.374 125.717 161.819 1.00 152.37 ? 126  DC  J C2    1 
ATOM   8790  O O2    . DC  I 5 126 ? 182.361 125.229 162.380 1.00 152.37 ? 126  DC  J O2    1 
ATOM   8791  N N3    . DC  I 5 126 ? 180.836 125.171 160.694 1.00 152.37 ? 126  DC  J N3    1 
ATOM   8792  C C4    . DC  I 5 126 ? 179.775 125.745 160.117 1.00 152.37 ? 126  DC  J C4    1 
ATOM   8793  N N4    . DC  I 5 126 ? 179.266 125.179 159.017 1.00 152.37 ? 126  DC  J N4    1 
ATOM   8794  C C5    . DC  I 5 126 ? 179.184 126.918 160.645 1.00 152.37 ? 126  DC  J C5    1 
ATOM   8795  C C6    . DC  I 5 126 ? 179.724 127.441 161.745 1.00 152.37 ? 126  DC  J C6    1 
ATOM   8796  P P     . DC  I 5 127 ? 184.361 129.240 165.439 1.00 161.99 ? 127  DC  J P     1 
ATOM   8797  O OP1   . DC  I 5 127 ? 184.982 129.017 166.763 1.00 161.99 ? 127  DC  J OP1   1 
ATOM   8798  O OP2   . DC  I 5 127 ? 184.495 130.549 164.763 1.00 161.99 ? 127  DC  J OP2   1 
ATOM   8799  O "O5'" . DC  I 5 127 ? 184.902 128.120 164.441 1.00 161.99 ? 127  DC  J "O5'" 1 
ATOM   8800  C "C5'" . DC  I 5 127 ? 186.254 127.772 164.462 1.00 161.99 ? 127  DC  J "C5'" 1 
ATOM   8801  C "C4'" . DC  I 5 127 ? 186.740 127.403 163.078 1.00 161.99 ? 127  DC  J "C4'" 1 
ATOM   8802  O "O4'" . DC  I 5 127 ? 185.652 126.853 162.279 1.00 161.99 ? 127  DC  J "O4'" 1 
ATOM   8803  C "C3'" . DC  I 5 127 ? 187.313 128.564 162.240 1.00 161.99 ? 127  DC  J "C3'" 1 
ATOM   8804  O "O3'" . DC  I 5 127 ? 188.488 128.096 161.584 1.00 161.99 ? 127  DC  J "O3'" 1 
ATOM   8805  C "C2'" . DC  I 5 127 ? 186.190 128.802 161.235 1.00 161.99 ? 127  DC  J "C2'" 1 
ATOM   8806  C "C1'" . DC  I 5 127 ? 185.839 127.363 160.990 1.00 161.99 ? 127  DC  J "C1'" 1 
ATOM   8807  N N1    . DC  I 5 127 ? 184.665 127.109 160.117 1.00 161.99 ? 127  DC  J N1    1 
ATOM   8808  C C2    . DC  I 5 127 ? 184.755 126.067 159.198 1.00 161.99 ? 127  DC  J C2    1 
ATOM   8809  O O2    . DC  I 5 127 ? 185.799 125.407 159.163 1.00 161.99 ? 127  DC  J O2    1 
ATOM   8810  N N3    . DC  I 5 127 ? 183.713 125.812 158.384 1.00 161.99 ? 127  DC  J N3    1 
ATOM   8811  C C4    . DC  I 5 127 ? 182.616 126.553 158.464 1.00 161.99 ? 127  DC  J C4    1 
ATOM   8812  N N4    . DC  I 5 127 ? 181.619 126.264 157.629 1.00 161.99 ? 127  DC  J N4    1 
ATOM   8813  C C5    . DC  I 5 127 ? 182.497 127.636 159.395 1.00 161.99 ? 127  DC  J C5    1 
ATOM   8814  C C6    . DC  I 5 127 ? 183.542 127.877 160.197 1.00 161.99 ? 127  DC  J C6    1 
ATOM   8815  P P     . DG  I 5 128 ? 189.550 129.096 160.906 1.00 161.79 ? 128  DG  J P     1 
ATOM   8816  O OP1   . DG  I 5 128 ? 190.710 129.161 161.821 1.00 161.79 ? 128  DG  J OP1   1 
ATOM   8817  O OP2   . DG  I 5 128 ? 188.900 130.354 160.476 1.00 161.79 ? 128  DG  J OP2   1 
ATOM   8818  O "O5'" . DG  I 5 128 ? 189.992 128.310 159.584 1.00 161.79 ? 128  DG  J "O5'" 1 
ATOM   8819  C "C5'" . DG  I 5 128 ? 189.494 126.993 159.339 1.00 161.79 ? 128  DG  J "C5'" 1 
ATOM   8820  C "C4'" . DG  I 5 128 ? 189.808 126.539 157.921 1.00 161.79 ? 128  DG  J "C4'" 1 
ATOM   8821  O "O4'" . DG  I 5 128 ? 188.603 126.478 157.126 1.00 161.79 ? 128  DG  J "O4'" 1 
ATOM   8822  C "C3'" . DG  I 5 128 ? 190.767 127.418 157.145 1.00 161.79 ? 128  DG  J "C3'" 1 
ATOM   8823  O "O3'" . DG  I 5 128 ? 191.574 126.603 156.316 1.00 161.79 ? 128  DG  J "O3'" 1 
ATOM   8824  C "C2'" . DG  I 5 128 ? 189.852 128.339 156.321 1.00 161.79 ? 128  DG  J "C2'" 1 
ATOM   8825  C "C1'" . DG  I 5 128 ? 188.493 127.625 156.307 1.00 161.79 ? 128  DG  J "C1'" 1 
ATOM   8826  N N9    . DG  I 5 128 ? 187.425 128.436 156.859 1.00 161.79 ? 128  DG  J N9    1 
ATOM   8827  C C8    . DG  I 5 128 ? 187.567 129.416 157.804 1.00 161.79 ? 128  DG  J C8    1 
ATOM   8828  N N7    . DG  I 5 128 ? 186.455 129.983 158.136 1.00 161.79 ? 128  DG  J N7    1 
ATOM   8829  C C5    . DG  I 5 128 ? 185.503 129.340 157.369 1.00 161.79 ? 128  DG  J C5    1 
ATOM   8830  C C6    . DG  I 5 128 ? 184.125 129.550 157.313 1.00 161.79 ? 128  DG  J C6    1 
ATOM   8831  O O6    . DG  I 5 128 ? 183.451 130.357 157.959 1.00 161.79 ? 128  DG  J O6    1 
ATOM   8832  N N1    . DG  I 5 128 ? 183.507 128.701 156.414 1.00 161.79 ? 128  DG  J N1    1 
ATOM   8833  C C2    . DG  I 5 128 ? 184.135 127.757 155.648 1.00 161.79 ? 128  DG  J C2    1 
ATOM   8834  N N2    . DG  I 5 128 ? 183.305 127.057 154.846 1.00 161.79 ? 128  DG  J N2    1 
ATOM   8835  N N3    . DG  I 5 128 ? 185.454 127.539 155.676 1.00 161.79 ? 128  DG  J N3    1 
ATOM   8836  C C4    . DG  I 5 128 ? 186.074 128.377 156.569 1.00 161.79 ? 128  DG  J C4    1 
ATOM   8837  P P     . DA  I 5 129 ? 192.959 127.157 155.729 1.00 155.31 ? 129  DA  J P     1 
ATOM   8838  O OP1   . DA  I 5 129 ? 193.899 126.019 155.620 1.00 155.31 ? 129  DA  J OP1   1 
ATOM   8839  O OP2   . DA  I 5 129 ? 193.327 128.349 156.525 1.00 155.31 ? 129  DA  J OP2   1 
ATOM   8840  O "O5'" . DA  I 5 129 ? 192.565 127.640 154.261 1.00 155.31 ? 129  DA  J "O5'" 1 
ATOM   8841  C "C5'" . DA  I 5 129 ? 191.670 126.860 153.482 1.00 155.31 ? 129  DA  J "C5'" 1 
ATOM   8842  C "C4'" . DA  I 5 129 ? 190.923 127.723 152.483 1.00 155.31 ? 129  DA  J "C4'" 1 
ATOM   8843  O "O4'" . DA  I 5 129 ? 189.625 128.103 153.007 1.00 155.31 ? 129  DA  J "O4'" 1 
ATOM   8844  C "C3'" . DA  I 5 129 ? 191.609 129.051 152.097 1.00 155.31 ? 129  DA  J "C3'" 1 
ATOM   8845  O "O3'" . DA  I 5 129 ? 191.388 129.336 150.704 1.00 155.31 ? 129  DA  J "O3'" 1 
ATOM   8846  C "C2'" . DA  I 5 129 ? 190.818 130.052 152.939 1.00 155.31 ? 129  DA  J "C2'" 1 
ATOM   8847  C "C1'" . DA  I 5 129 ? 189.463 129.453 152.680 1.00 155.31 ? 129  DA  J "C1'" 1 
ATOM   8848  N N9    . DA  I 5 129 ? 188.318 130.028 153.367 1.00 155.31 ? 129  DA  J N9    1 
ATOM   8849  C C8    . DA  I 5 129 ? 188.290 130.902 154.415 1.00 155.31 ? 129  DA  J C8    1 
ATOM   8850  N N7    . DA  I 5 129 ? 187.070 131.226 154.789 1.00 155.31 ? 129  DA  J N7    1 
ATOM   8851  C C5    . DA  I 5 129 ? 186.263 130.518 153.918 1.00 155.31 ? 129  DA  J C5    1 
ATOM   8852  C C6    . DA  I 5 129 ? 184.866 130.411 153.770 1.00 155.31 ? 129  DA  J C6    1 
ATOM   8853  N N6    . DA  I 5 129 ? 183.996 131.061 154.541 1.00 155.31 ? 129  DA  J N6    1 
ATOM   8854  N N1    . DA  I 5 129 ? 184.398 129.600 152.784 1.00 155.31 ? 129  DA  J N1    1 
ATOM   8855  C C2    . DA  I 5 129 ? 185.283 128.960 152.024 1.00 155.31 ? 129  DA  J C2    1 
ATOM   8856  N N3    . DA  I 5 129 ? 186.598 128.984 152.070 1.00 155.31 ? 129  DA  J N3    1 
ATOM   8857  C C4    . DA  I 5 129 ? 187.025 129.784 153.044 1.00 155.31 ? 129  DA  J C4    1 
ATOM   8858  P P     . DC  I 5 130 ? 191.873 128.363 149.512 1.00 149.22 ? 130  DC  J P     1 
ATOM   8859  O OP1   . DC  I 5 130 ? 192.911 127.410 149.971 1.00 149.22 ? 130  DC  J OP1   1 
ATOM   8860  O OP2   . DC  I 5 130 ? 192.215 129.266 148.395 1.00 149.22 ? 130  DC  J OP2   1 
ATOM   8861  O "O5'" . DC  I 5 130 ? 190.533 127.595 149.066 1.00 149.22 ? 130  DC  J "O5'" 1 
ATOM   8862  C "C5'" . DC  I 5 130 ? 189.250 128.207 149.256 1.00 149.22 ? 130  DC  J "C5'" 1 
ATOM   8863  C "C4'" . DC  I 5 130 ? 188.498 128.365 147.952 1.00 149.22 ? 130  DC  J "C4'" 1 
ATOM   8864  O "O4'" . DC  I 5 130 ? 187.356 129.231 148.165 1.00 149.22 ? 130  DC  J "O4'" 1 
ATOM   8865  C "C3'" . DC  I 5 130 ? 189.270 129.059 146.865 1.00 149.22 ? 130  DC  J "C3'" 1 
ATOM   8866  O "O3'" . DC  I 5 130 ? 188.639 128.833 145.622 1.00 149.22 ? 130  DC  J "O3'" 1 
ATOM   8867  C "C2'" . DC  I 5 130 ? 189.141 130.512 147.296 1.00 149.22 ? 130  DC  J "C2'" 1 
ATOM   8868  C "C1'" . DC  I 5 130 ? 187.720 130.571 147.879 1.00 149.22 ? 130  DC  J "C1'" 1 
ATOM   8869  N N1    . DC  I 5 130 ? 187.637 131.345 149.157 1.00 149.22 ? 130  DC  J N1    1 
ATOM   8870  C C2    . DC  I 5 130 ? 186.392 131.660 149.732 1.00 149.22 ? 130  DC  J C2    1 
ATOM   8871  O O2    . DC  I 5 130 ? 185.326 131.321 149.202 1.00 149.22 ? 130  DC  J O2    1 
ATOM   8872  N N3    . DC  I 5 130 ? 186.371 132.351 150.895 1.00 149.22 ? 130  DC  J N3    1 
ATOM   8873  C C4    . DC  I 5 130 ? 187.500 132.723 151.478 1.00 149.22 ? 130  DC  J C4    1 
ATOM   8874  N N4    . DC  I 5 130 ? 187.412 133.403 152.623 1.00 149.22 ? 130  DC  J N4    1 
ATOM   8875  C C5    . DC  I 5 130 ? 188.768 132.420 150.917 1.00 149.22 ? 130  DC  J C5    1 
ATOM   8876  C C6    . DC  I 5 130 ? 188.791 131.735 149.774 1.00 149.22 ? 130  DC  J C6    1 
ATOM   8877  P P     . DT  I 5 131 ? 189.450 129.038 144.253 1.00 139.04 ? 131  DT  J P     1 
ATOM   8878  O OP1   . DT  I 5 131 ? 189.443 127.746 143.536 1.00 139.04 ? 131  DT  J OP1   1 
ATOM   8879  O OP2   . DT  I 5 131 ? 190.741 129.686 144.573 1.00 139.04 ? 131  DT  J OP2   1 
ATOM   8880  O "O5'" . DT  I 5 131 ? 188.551 130.077 143.440 1.00 139.04 ? 131  DT  J "O5'" 1 
ATOM   8881  C "C5'" . DT  I 5 131 ? 187.357 129.636 142.787 1.00 139.04 ? 131  DT  J "C5'" 1 
ATOM   8882  C "C4'" . DT  I 5 131 ? 186.254 130.692 142.822 1.00 139.04 ? 131  DT  J "C4'" 1 
ATOM   8883  O "O4'" . DT  I 5 131 ? 186.142 131.267 144.154 1.00 139.04 ? 131  DT  J "O4'" 1 
ATOM   8884  C "C3'" . DT  I 5 131 ? 186.442 131.898 141.898 1.00 139.04 ? 131  DT  J "C3'" 1 
ATOM   8885  O "O3'" . DT  I 5 131 ? 185.155 132.415 141.569 1.00 139.04 ? 131  DT  J "O3'" 1 
ATOM   8886  C "C2'" . DT  I 5 131 ? 187.149 132.860 142.844 1.00 139.04 ? 131  DT  J "C2'" 1 
ATOM   8887  C "C1'" . DT  I 5 131 ? 186.222 132.670 144.018 1.00 139.04 ? 131  DT  J "C1'" 1 
ATOM   8888  N N1    . DT  I 5 131 ? 186.636 133.274 145.316 1.00 139.04 ? 131  DT  J N1    1 
ATOM   8889  C C2    . DT  I 5 131 ? 185.649 133.675 146.166 1.00 139.04 ? 131  DT  J C2    1 
ATOM   8890  O O2    . DT  I 5 131 ? 184.473 133.565 145.893 1.00 139.04 ? 131  DT  J O2    1 
ATOM   8891  N N3    . DT  I 5 131 ? 186.071 134.210 147.348 1.00 139.04 ? 131  DT  J N3    1 
ATOM   8892  C C4    . DT  I 5 131 ? 187.373 134.379 147.754 1.00 139.04 ? 131  DT  J C4    1 
ATOM   8893  O O4    . DT  I 5 131 ? 187.658 134.871 148.838 1.00 139.04 ? 131  DT  J O4    1 
ATOM   8894  C C5    . DT  I 5 131 ? 188.375 133.935 146.812 1.00 139.04 ? 131  DT  J C5    1 
ATOM   8895  C C7    . DT  I 5 131 ? 189.828 134.071 147.148 1.00 139.04 ? 131  DT  J C7    1 
ATOM   8896  C C6    . DT  I 5 131 ? 187.962 133.409 145.645 1.00 139.04 ? 131  DT  J C6    1 
ATOM   8897  P P     . DG  I 5 132 ? 184.427 132.078 140.178 1.00 135.11 ? 132  DG  J P     1 
ATOM   8898  O OP1   . DG  I 5 132 ? 184.269 130.614 140.089 1.00 135.11 ? 132  DG  J OP1   1 
ATOM   8899  O OP2   . DG  I 5 132 ? 185.139 132.815 139.116 1.00 135.11 ? 132  DG  J OP2   1 
ATOM   8900  O "O5'" . DG  I 5 132 ? 182.975 132.752 140.333 1.00 135.11 ? 132  DG  J "O5'" 1 
ATOM   8901  C "C5'" . DG  I 5 132 ? 182.250 132.635 141.574 1.00 135.11 ? 132  DG  J "C5'" 1 
ATOM   8902  C "C4'" . DG  I 5 132 ? 181.137 133.686 141.725 1.00 135.11 ? 132  DG  J "C4'" 1 
ATOM   8903  O "O4'" . DG  I 5 132 ? 181.519 134.706 142.679 1.00 135.11 ? 132  DG  J "O4'" 1 
ATOM   8904  C "C3'" . DG  I 5 132 ? 180.738 134.449 140.481 1.00 135.11 ? 132  DG  J "C3'" 1 
ATOM   8905  O "O3'" . DG  I 5 132 ? 179.357 134.813 140.577 1.00 135.11 ? 132  DG  J "O3'" 1 
ATOM   8906  C "C2'" . DG  I 5 132 ? 181.653 135.670 140.524 1.00 135.11 ? 132  DG  J "C2'" 1 
ATOM   8907  C "C1'" . DG  I 5 132 ? 182.030 135.837 142.002 1.00 135.11 ? 132  DG  J "C1'" 1 
ATOM   8908  N N9    . DG  I 5 132 ? 183.463 135.820 142.181 1.00 135.11 ? 132  DG  J N9    1 
ATOM   8909  C C8    . DG  I 5 132 ? 184.358 135.374 141.255 1.00 135.11 ? 132  DG  J C8    1 
ATOM   8910  N N7    . DG  I 5 132 ? 185.584 135.434 141.639 1.00 135.11 ? 132  DG  J N7    1 
ATOM   8911  C C5    . DG  I 5 132 ? 185.518 135.953 142.913 1.00 135.11 ? 132  DG  J C5    1 
ATOM   8912  C C6    . DG  I 5 132 ? 186.556 136.230 143.808 1.00 135.11 ? 132  DG  J C6    1 
ATOM   8913  O O6    . DG  I 5 132 ? 187.768 136.068 143.647 1.00 135.11 ? 132  DG  J O6    1 
ATOM   8914  N N1    . DG  I 5 132 ? 186.087 136.746 144.989 1.00 135.11 ? 132  DG  J N1    1 
ATOM   8915  C C2    . DG  I 5 132 ? 184.774 136.974 145.295 1.00 135.11 ? 132  DG  J C2    1 
ATOM   8916  N N2    . DG  I 5 132 ? 184.601 137.485 146.522 1.00 135.11 ? 132  DG  J N2    1 
ATOM   8917  N N3    . DG  I 5 132 ? 183.754 136.718 144.465 1.00 135.11 ? 132  DG  J N3    1 
ATOM   8918  C C4    . DG  I 5 132 ? 184.212 136.202 143.282 1.00 135.11 ? 132  DG  J C4    1 
ATOM   8919  P P     . DC  I 5 133 ? 178.684 135.893 139.588 1.00 141.77 ? 133  DC  J P     1 
ATOM   8920  O OP1   . DC  I 5 133 ? 177.239 135.633 139.605 1.00 141.77 ? 133  DC  J OP1   1 
ATOM   8921  O OP2   . DC  I 5 133 ? 179.377 135.916 138.285 1.00 141.77 ? 133  DC  J OP2   1 
ATOM   8922  O "O5'" . DC  I 5 133 ? 178.870 137.287 140.344 1.00 141.77 ? 133  DC  J "O5'" 1 
ATOM   8923  C "C5'" . DC  I 5 133 ? 178.600 137.372 141.742 1.00 141.77 ? 133  DC  J "C5'" 1 
ATOM   8924  C "C4'" . DC  I 5 133 ? 178.946 138.743 142.311 1.00 141.77 ? 133  DC  J "C4'" 1 
ATOM   8925  O "O4'" . DC  I 5 133 ? 180.357 138.823 142.663 1.00 141.77 ? 133  DC  J "O4'" 1 
ATOM   8926  C "C3'" . DC  I 5 133 ? 178.680 139.926 141.399 1.00 141.77 ? 133  DC  J "C3'" 1 
ATOM   8927  O "O3'" . DC  I 5 133 ? 178.256 141.002 142.179 1.00 141.77 ? 133  DC  J "O3'" 1 
ATOM   8928  C "C2'" . DC  I 5 133 ? 180.062 140.210 140.820 1.00 141.77 ? 133  DC  J "C2'" 1 
ATOM   8929  C "C1'" . DC  I 5 133 ? 180.952 139.943 142.025 1.00 141.77 ? 133  DC  J "C1'" 1 
ATOM   8930  N N1    . DC  I 5 133 ? 182.339 139.546 141.672 1.00 141.77 ? 133  DC  J N1    1 
ATOM   8931  C C2    . DC  I 5 133 ? 183.397 139.722 142.586 1.00 141.77 ? 133  DC  J C2    1 
ATOM   8932  O O2    . DC  I 5 133 ? 183.208 140.233 143.703 1.00 141.77 ? 133  DC  J O2    1 
ATOM   8933  N N3    . DC  I 5 133 ? 184.637 139.324 142.222 1.00 141.77 ? 133  DC  J N3    1 
ATOM   8934  C C4    . DC  I 5 133 ? 184.844 138.778 141.032 1.00 141.77 ? 133  DC  J C4    1 
ATOM   8935  N N4    . DC  I 5 133 ? 186.089 138.407 140.727 1.00 141.77 ? 133  DC  J N4    1 
ATOM   8936  C C5    . DC  I 5 133 ? 183.790 138.590 140.099 1.00 141.77 ? 133  DC  J C5    1 
ATOM   8937  C C6    . DC  I 5 133 ? 182.573 138.987 140.457 1.00 141.77 ? 133  DC  J C6    1 
ATOM   8938  P P     . DG  I 5 134 ? 176.732 141.133 142.662 1.00 165.93 ? 134  DG  J P     1 
ATOM   8939  O OP1   . DG  I 5 134 ? 176.570 140.405 143.938 1.00 165.93 ? 134  DG  J OP1   1 
ATOM   8940  O OP2   . DG  I 5 134 ? 175.857 140.823 141.513 1.00 165.93 ? 134  DG  J OP2   1 
ATOM   8941  O "O5'" . DG  I 5 134 ? 176.619 142.690 142.945 1.00 165.93 ? 134  DG  J "O5'" 1 
ATOM   8942  C "C5'" . DG  I 5 134 ? 177.504 143.555 142.272 1.00 165.93 ? 134  DG  J "C5'" 1 
ATOM   8943  C "C4'" . DG  I 5 134 ? 178.295 144.408 143.243 1.00 165.93 ? 134  DG  J "C4'" 1 
ATOM   8944  O "O4'" . DG  I 5 134 ? 179.710 144.093 143.143 1.00 165.93 ? 134  DG  J "O4'" 1 
ATOM   8945  C "C3'" . DG  I 5 134 ? 178.249 145.868 142.914 1.00 165.93 ? 134  DG  J "C3'" 1 
ATOM   8946  O "O3'" . DG  I 5 134 ? 178.739 146.608 143.998 1.00 165.93 ? 134  DG  J "O3'" 1 
ATOM   8947  C "C2'" . DG  I 5 134 ? 179.207 145.906 141.734 1.00 165.93 ? 134  DG  J "C2'" 1 
ATOM   8948  C "C1'" . DG  I 5 134 ? 180.327 144.974 142.209 1.00 165.93 ? 134  DG  J "C1'" 1 
ATOM   8949  N N9    . DG  I 5 134 ? 180.851 144.143 141.143 1.00 165.93 ? 134  DG  J N9    1 
ATOM   8950  C C8    . DG  I 5 134 ? 180.163 143.770 140.023 1.00 165.93 ? 134  DG  J C8    1 
ATOM   8951  N N7    . DG  I 5 134 ? 180.834 143.013 139.222 1.00 165.93 ? 134  DG  J N7    1 
ATOM   8952  C C5    . DG  I 5 134 ? 182.058 142.858 139.843 1.00 165.93 ? 134  DG  J C5    1 
ATOM   8953  C C6    . DG  I 5 134 ? 183.177 142.128 139.419 1.00 165.93 ? 134  DG  J C6    1 
ATOM   8954  O O6    . DG  I 5 134 ? 183.311 141.459 138.388 1.00 165.93 ? 134  DG  J O6    1 
ATOM   8955  N N1    . DG  I 5 134 ? 184.211 142.215 140.318 1.00 165.93 ? 134  DG  J N1    1 
ATOM   8956  C C2    . DG  I 5 134 ? 184.195 142.915 141.491 1.00 165.93 ? 134  DG  J C2    1 
ATOM   8957  N N2    . DG  I 5 134 ? 185.349 142.826 142.172 1.00 165.93 ? 134  DG  J N2    1 
ATOM   8958  N N3    . DG  I 5 134 ? 183.145 143.623 141.930 1.00 165.93 ? 134  DG  J N3    1 
ATOM   8959  C C4    . DG  I 5 134 ? 182.102 143.544 141.041 1.00 165.93 ? 134  DG  J C4    1 
ATOM   8960  P P     . DG  I 5 135 ? 177.774 147.626 144.771 1.00 182.97 ? 135  DG  J P     1 
ATOM   8961  O OP1   . DG  I 5 135 ? 176.923 146.825 145.677 1.00 182.97 ? 135  DG  J OP1   1 
ATOM   8962  O OP2   . DG  I 5 135 ? 177.145 148.490 143.749 1.00 182.97 ? 135  DG  J OP2   1 
ATOM   8963  O "O5'" . DG  I 5 135 ? 178.790 148.515 145.621 1.00 182.97 ? 135  DG  J "O5'" 1 
ATOM   8964  C "C5'" . DG  I 5 135 ? 180.192 148.318 145.457 1.00 182.97 ? 135  DG  J "C5'" 1 
ATOM   8965  C "C4'" . DG  I 5 135 ? 180.913 149.643 145.317 1.00 182.97 ? 135  DG  J "C4'" 1 
ATOM   8966  O "O4'" . DG  I 5 135 ? 182.039 149.479 144.427 1.00 182.97 ? 135  DG  J "O4'" 1 
ATOM   8967  C "C3'" . DG  I 5 135 ? 180.095 150.753 144.688 1.00 182.97 ? 135  DG  J "C3'" 1 
ATOM   8968  O "O3'" . DG  I 5 135 ? 180.677 151.996 145.015 1.00 182.97 ? 135  DG  J "O3'" 1 
ATOM   8969  C "C2'" . DG  I 5 135 ? 180.263 150.447 143.210 1.00 182.97 ? 135  DG  J "C2'" 1 
ATOM   8970  C "C1'" . DG  I 5 135 ? 181.728 150.036 143.161 1.00 182.97 ? 135  DG  J "C1'" 1 
ATOM   8971  N N9    . DG  I 5 135 ? 182.007 149.032 142.147 1.00 182.97 ? 135  DG  J N9    1 
ATOM   8972  C C8    . DG  I 5 135 ? 181.170 148.599 141.156 1.00 182.97 ? 135  DG  J C8    1 
ATOM   8973  N N7    . DG  I 5 135 ? 181.697 147.674 140.399 1.00 182.97 ? 135  DG  J N7    1 
ATOM   8974  C C5    . DG  I 5 135 ? 182.965 147.494 140.924 1.00 182.97 ? 135  DG  J C5    1 
ATOM   8975  C C6    . DG  I 5 135 ? 184.007 146.631 140.522 1.00 182.97 ? 135  DG  J C6    1 
ATOM   8976  O O6    . DG  I 5 135 ? 184.012 145.819 139.589 1.00 182.97 ? 135  DG  J O6    1 
ATOM   8977  N N1    . DG  I 5 135 ? 185.133 146.774 141.332 1.00 182.97 ? 135  DG  J N1    1 
ATOM   8978  C C2    . DG  I 5 135 ? 185.219 147.648 142.390 1.00 182.97 ? 135  DG  J C2    1 
ATOM   8979  N N2    . DG  I 5 135 ? 186.363 147.673 143.072 1.00 182.97 ? 135  DG  J N2    1 
ATOM   8980  N N3    . DG  I 5 135 ? 184.253 148.453 142.764 1.00 182.97 ? 135  DG  J N3    1 
ATOM   8981  C C4    . DG  I 5 135 ? 183.165 148.327 141.995 1.00 182.97 ? 135  DG  J C4    1 
ATOM   8982  P P     . DC  I 5 136 ? 179.782 153.324 145.104 1.00 193.38 ? 136  DC  J P     1 
ATOM   8983  O OP1   . DC  I 5 136 ? 179.464 153.531 146.533 1.00 193.38 ? 136  DC  J OP1   1 
ATOM   8984  O OP2   . DC  I 5 136 ? 178.687 153.218 144.114 1.00 193.38 ? 136  DC  J OP2   1 
ATOM   8985  O "O5'" . DC  I 5 136 ? 180.788 154.474 144.627 1.00 193.38 ? 136  DC  J "O5'" 1 
ATOM   8986  C "C5'" . DC  I 5 136 ? 182.001 154.677 145.336 1.00 193.38 ? 136  DC  J "C5'" 1 
ATOM   8987  C "C4'" . DC  I 5 136 ? 183.147 155.023 144.399 1.00 193.38 ? 136  DC  J "C4'" 1 
ATOM   8988  O "O4'" . DC  I 5 136 ? 183.620 153.833 143.699 1.00 193.38 ? 136  DC  J "O4'" 1 
ATOM   8989  C "C3'" . DC  I 5 136 ? 182.833 156.058 143.306 1.00 193.38 ? 136  DC  J "C3'" 1 
ATOM   8990  O "O3'" . DC  I 5 136 ? 183.881 157.061 143.305 1.00 193.38 ? 136  DC  J "O3'" 1 
ATOM   8991  C "C2'" . DC  I 5 136 ? 182.830 155.200 142.036 1.00 193.38 ? 136  DC  J "C2'" 1 
ATOM   8992  C "C1'" . DC  I 5 136 ? 183.923 154.216 142.382 1.00 193.38 ? 136  DC  J "C1'" 1 
ATOM   8993  N N1    . DC  I 5 136 ? 183.971 153.020 141.497 1.00 193.38 ? 136  DC  J N1    1 
ATOM   8994  C C2    . DC  I 5 136 ? 185.196 152.406 141.244 1.00 193.38 ? 136  DC  J C2    1 
ATOM   8995  O O2    . DC  I 5 136 ? 186.215 152.868 141.763 1.00 193.38 ? 136  DC  J O2    1 
ATOM   8996  N N3    . DC  I 5 136 ? 185.232 151.323 140.433 1.00 193.38 ? 136  DC  J N3    1 
ATOM   8997  C C4    . DC  I 5 136 ? 184.108 150.855 139.893 1.00 193.38 ? 136  DC  J C4    1 
ATOM   8998  N N4    . DC  I 5 136 ? 184.192 149.787 139.097 1.00 193.38 ? 136  DC  J N4    1 
ATOM   8999  C C5    . DC  I 5 136 ? 182.850 151.475 140.131 1.00 193.38 ? 136  DC  J C5    1 
ATOM   9000  C C6    . DC  I 5 136 ? 182.828 152.546 140.933 1.00 193.38 ? 136  DC  J C6    1 
ATOM   9001  P P     . DA  I 5 137 ? 184.202 158.003 142.035 1.00 197.53 ? 137  DA  J P     1 
ATOM   9002  O OP1   . DA  I 5 137 ? 184.975 159.138 142.578 1.00 197.53 ? 137  DA  J OP1   1 
ATOM   9003  O OP2   . DA  I 5 137 ? 182.983 158.300 141.250 1.00 197.53 ? 137  DA  J OP2   1 
ATOM   9004  O "O5'" . DA  I 5 137 ? 185.221 157.136 141.158 1.00 197.53 ? 137  DA  J "O5'" 1 
ATOM   9005  C "C5'" . DA  I 5 137 ? 186.036 157.759 140.188 1.00 197.53 ? 137  DA  J "C5'" 1 
ATOM   9006  C "C4'" . DA  I 5 137 ? 187.312 156.965 139.971 1.00 197.53 ? 137  DA  J "C4'" 1 
ATOM   9007  O "O4'" . DA  I 5 137 ? 186.995 155.551 139.885 1.00 197.53 ? 137  DA  J "O4'" 1 
ATOM   9008  C "C3'" . DA  I 5 137 ? 188.064 157.316 138.691 1.00 197.53 ? 137  DA  J "C3'" 1 
ATOM   9009  O "O3'" . DA  I 5 137 ? 189.459 157.356 138.924 1.00 197.53 ? 137  DA  J "O3'" 1 
ATOM   9010  C "C2'" . DA  I 5 137 ? 187.685 156.194 137.739 1.00 197.53 ? 137  DA  J "C2'" 1 
ATOM   9011  C "C1'" . DA  I 5 137 ? 187.489 155.018 138.678 1.00 197.53 ? 137  DA  J "C1'" 1 
ATOM   9012  N N9    . DA  I 5 137 ? 186.526 154.046 138.176 1.00 197.53 ? 137  DA  J N9    1 
ATOM   9013  C C8    . DA  I 5 137 ? 185.173 154.058 138.358 1.00 197.53 ? 137  DA  J C8    1 
ATOM   9014  N N7    . DA  I 5 137 ? 184.553 153.056 137.784 1.00 197.53 ? 137  DA  J N7    1 
ATOM   9015  C C5    . DA  I 5 137 ? 185.570 152.333 137.189 1.00 197.53 ? 137  DA  J C5    1 
ATOM   9016  C C6    . DA  I 5 137 ? 185.577 151.152 136.421 1.00 197.53 ? 137  DA  J C6    1 
ATOM   9017  N N6    . DA  I 5 137 ? 184.475 150.460 136.118 1.00 197.53 ? 137  DA  J N6    1 
ATOM   9018  N N1    . DA  I 5 137 ? 186.768 150.707 135.975 1.00 197.53 ? 137  DA  J N1    1 
ATOM   9019  C C2    . DA  I 5 137 ? 187.873 151.398 136.277 1.00 197.53 ? 137  DA  J C2    1 
ATOM   9020  N N3    . DA  I 5 137 ? 187.991 152.515 136.985 1.00 197.53 ? 137  DA  J N3    1 
ATOM   9021  C C4    . DA  I 5 137 ? 186.793 152.934 137.416 1.00 197.53 ? 137  DA  J C4    1 
ATOM   9022  P P     . DC  I 5 138 ? 190.375 158.362 138.070 1.00 197.53 ? 138  DC  J P     1 
ATOM   9023  O OP1   . DC  I 5 138 ? 191.746 158.288 138.617 1.00 197.53 ? 138  DC  J OP1   1 
ATOM   9024  O OP2   . DC  I 5 138 ? 189.684 159.666 137.997 1.00 197.53 ? 138  DC  J OP2   1 
ATOM   9025  O "O5'" . DC  I 5 138 ? 190.382 157.725 136.604 1.00 197.53 ? 138  DC  J "O5'" 1 
ATOM   9026  C "C5'" . DC  I 5 138 ? 191.238 156.639 136.335 1.00 197.53 ? 138  DC  J "C5'" 1 
ATOM   9027  C "C4'" . DC  I 5 138 ? 190.880 155.944 135.033 1.00 197.53 ? 138  DC  J "C4'" 1 
ATOM   9028  O "O4'" . DC  I 5 138 ? 189.663 155.184 135.169 1.00 197.53 ? 138  DC  J "O4'" 1 
ATOM   9029  C "C3'" . DC  I 5 138 ? 190.664 156.851 133.805 1.00 197.53 ? 138  DC  J "C3'" 1 
ATOM   9030  O "O3'" . DC  I 5 138 ? 191.713 156.619 132.866 1.00 197.53 ? 138  DC  J "O3'" 1 
ATOM   9031  C "C2'" . DC  I 5 138 ? 189.303 156.390 133.251 1.00 197.53 ? 138  DC  J "C2'" 1 
ATOM   9032  C "C1'" . DC  I 5 138 ? 189.196 155.013 133.869 1.00 197.53 ? 138  DC  J "C1'" 1 
ATOM   9033  N N1    . DC  I 5 138 ? 187.834 154.428 133.865 1.00 197.53 ? 138  DC  J N1    1 
ATOM   9034  C C2    . DC  I 5 138 ? 187.630 153.260 133.148 1.00 197.53 ? 138  DC  J C2    1 
ATOM   9035  O O2    . DC  I 5 138 ? 188.597 152.765 132.558 1.00 197.53 ? 138  DC  J O2    1 
ATOM   9036  N N3    . DC  I 5 138 ? 186.398 152.707 133.122 1.00 197.53 ? 138  DC  J N3    1 
ATOM   9037  C C4    . DC  I 5 138 ? 185.398 153.290 133.780 1.00 197.53 ? 138  DC  J C4    1 
ATOM   9038  N N4    . DC  I 5 138 ? 184.199 152.708 133.729 1.00 197.53 ? 138  DC  J N4    1 
ATOM   9039  C C5    . DC  I 5 138 ? 185.586 154.494 134.521 1.00 197.53 ? 138  DC  J C5    1 
ATOM   9040  C C6    . DC  I 5 138 ? 186.811 155.025 134.532 1.00 197.53 ? 138  DC  J C6    1 
ATOM   9041  P P     . DA  I 5 139 ? 191.832 157.482 131.515 1.00 196.55 ? 139  DA  J P     1 
ATOM   9042  O OP1   . DA  I 5 139 ? 193.273 157.664 131.248 1.00 196.55 ? 139  DA  J OP1   1 
ATOM   9043  O OP2   . DA  I 5 139 ? 190.958 158.670 131.625 1.00 196.55 ? 139  DA  J OP2   1 
ATOM   9044  O "O5'" . DA  I 5 139 ? 191.236 156.514 130.391 1.00 196.55 ? 139  DA  J "O5'" 1 
ATOM   9045  C "C5'" . DA  I 5 139 ? 191.533 156.748 129.016 1.00 196.55 ? 139  DA  J "C5'" 1 
ATOM   9046  C "C4'" . DA  I 5 139 ? 191.365 155.474 128.208 1.00 196.55 ? 139  DA  J "C4'" 1 
ATOM   9047  O "O4'" . DA  I 5 139 ? 190.412 154.611 128.886 1.00 196.55 ? 139  DA  J "O4'" 1 
ATOM   9048  C "C3'" . DA  I 5 139 ? 190.785 155.674 126.811 1.00 196.55 ? 139  DA  J "C3'" 1 
ATOM   9049  O "O3'" . DA  I 5 139 ? 191.137 154.570 125.971 1.00 196.55 ? 139  DA  J "O3'" 1 
ATOM   9050  C "C2'" . DA  I 5 139 ? 189.309 155.655 127.126 1.00 196.55 ? 139  DA  J "C2'" 1 
ATOM   9051  C "C1'" . DA  I 5 139 ? 189.270 154.472 128.068 1.00 196.55 ? 139  DA  J "C1'" 1 
ATOM   9052  N N9    . DA  I 5 139 ? 188.072 154.425 128.895 1.00 196.55 ? 139  DA  J N9    1 
ATOM   9053  C C8    . DA  I 5 139 ? 187.720 155.274 129.907 1.00 196.55 ? 139  DA  J C8    1 
ATOM   9054  N N7    . DA  I 5 139 ? 186.570 154.975 130.467 1.00 196.55 ? 139  DA  J N7    1 
ATOM   9055  C C5    . DA  I 5 139 ? 186.147 153.857 129.770 1.00 196.55 ? 139  DA  J C5    1 
ATOM   9056  C C6    . DA  I 5 139 ? 185.001 153.050 129.872 1.00 196.55 ? 139  DA  J C6    1 
ATOM   9057  N N6    . DA  I 5 139 ? 184.030 153.262 130.759 1.00 196.55 ? 139  DA  J N6    1 
ATOM   9058  N N1    . DA  I 5 139 ? 184.889 152.009 129.020 1.00 196.55 ? 139  DA  J N1    1 
ATOM   9059  C C2    . DA  I 5 139 ? 185.861 151.797 128.130 1.00 196.55 ? 139  DA  J C2    1 
ATOM   9060  N N3    . DA  I 5 139 ? 186.979 152.486 127.941 1.00 196.55 ? 139  DA  J N3    1 
ATOM   9061  C C4    . DA  I 5 139 ? 187.061 153.510 128.801 1.00 196.55 ? 139  DA  J C4    1 
ATOM   9062  P P     . DG  I 5 140 ? 190.930 154.643 124.373 1.00 196.54 ? 140  DG  J P     1 
ATOM   9063  O OP1   . DG  I 5 140 ? 192.234 154.343 123.745 1.00 196.54 ? 140  DG  J OP1   1 
ATOM   9064  O OP2   . DG  I 5 140 ? 190.236 155.901 124.023 1.00 196.54 ? 140  DG  J OP2   1 
ATOM   9065  O "O5'" . DG  I 5 140 ? 189.931 153.435 124.048 1.00 196.54 ? 140  DG  J "O5'" 1 
ATOM   9066  C "C5'" . DG  I 5 140 ? 190.010 152.769 122.783 1.00 196.54 ? 140  DG  J "C5'" 1 
ATOM   9067  C "C4'" . DG  I 5 140 ? 188.632 152.376 122.284 1.00 196.54 ? 140  DG  J "C4'" 1 
ATOM   9068  O "O4'" . DG  I 5 140 ? 187.658 152.642 123.331 1.00 196.54 ? 140  DG  J "O4'" 1 
ATOM   9069  C "C3'" . DG  I 5 140 ? 188.132 153.174 121.079 1.00 196.54 ? 140  DG  J "C3'" 1 
ATOM   9070  O "O3'" . DG  I 5 140 ? 187.118 152.421 120.380 1.00 196.54 ? 140  DG  J "O3'" 1 
ATOM   9071  C "C2'" . DG  I 5 140 ? 187.529 154.372 121.784 1.00 196.54 ? 140  DG  J "C2'" 1 
ATOM   9072  C "C1'" . DG  I 5 140 ? 186.770 153.645 122.877 1.00 196.54 ? 140  DG  J "C1'" 1 
ATOM   9073  N N9    . DG  I 5 140 ? 186.382 154.489 123.997 1.00 196.54 ? 140  DG  J N9    1 
ATOM   9074  C C8    . DG  I 5 140 ? 187.047 155.588 124.472 1.00 196.54 ? 140  DG  J C8    1 
ATOM   9075  N N7    . DG  I 5 140 ? 186.457 156.149 125.491 1.00 196.54 ? 140  DG  J N7    1 
ATOM   9076  C C5    . DG  I 5 140 ? 185.331 155.373 125.703 1.00 196.54 ? 140  DG  J C5    1 
ATOM   9077  C C6    . DG  I 5 140 ? 184.309 155.497 126.670 1.00 196.54 ? 140  DG  J C6    1 
ATOM   9078  O O6    . DG  I 5 140 ? 184.197 156.346 127.564 1.00 196.54 ? 140  DG  J O6    1 
ATOM   9079  N N1    . DG  I 5 140 ? 183.348 154.501 126.532 1.00 196.54 ? 140  DG  J N1    1 
ATOM   9080  C C2    . DG  I 5 140 ? 183.375 153.513 125.579 1.00 196.54 ? 140  DG  J C2    1 
ATOM   9081  N N2    . DG  I 5 140 ? 182.361 152.641 125.603 1.00 196.54 ? 140  DG  J N2    1 
ATOM   9082  N N3    . DG  I 5 140 ? 184.326 153.386 124.666 1.00 196.54 ? 140  DG  J N3    1 
ATOM   9083  C C4    . DG  I 5 140 ? 185.268 154.348 124.788 1.00 196.54 ? 140  DG  J C4    1 
ATOM   9084  P P     . DT  I 5 141 ? 186.524 152.926 118.968 1.00 199.19 ? 141  DT  J P     1 
ATOM   9085  O OP1   . DT  I 5 141 ? 187.662 152.993 118.030 1.00 199.19 ? 141  DT  J OP1   1 
ATOM   9086  O OP2   . DT  I 5 141 ? 185.675 154.120 119.158 1.00 199.19 ? 141  DT  J OP2   1 
ATOM   9087  O "O5'" . DT  I 5 141 ? 185.519 151.754 118.527 1.00 199.19 ? 141  DT  J "O5'" 1 
ATOM   9088  C "C5'" . DT  I 5 141 ? 185.016 150.837 119.498 1.00 199.19 ? 141  DT  J "C5'" 1 
ATOM   9089  C "C4'" . DT  I 5 141 ? 183.490 150.730 119.477 1.00 199.19 ? 141  DT  J "C4'" 1 
ATOM   9090  O "O4'" . DT  I 5 141 ? 182.939 151.389 120.649 1.00 199.19 ? 141  DT  J "O4'" 1 
ATOM   9091  C "C3'" . DT  I 5 141 ? 182.757 151.358 118.291 1.00 199.19 ? 141  DT  J "C3'" 1 
ATOM   9092  O "O3'" . DT  I 5 141 ? 181.524 150.637 118.082 1.00 199.19 ? 141  DT  J "O3'" 1 
ATOM   9093  C "C2'" . DT  I 5 141 ? 182.477 152.755 118.828 1.00 199.19 ? 141  DT  J "C2'" 1 
ATOM   9094  C "C1'" . DT  I 5 141 ? 182.045 152.404 120.235 1.00 199.19 ? 141  DT  J "C1'" 1 
ATOM   9095  N N1    . DT  I 5 141 ? 182.124 153.523 121.214 1.00 199.19 ? 141  DT  J N1    1 
ATOM   9096  C C2    . DT  I 5 141 ? 181.145 153.630 122.164 1.00 199.19 ? 141  DT  J C2    1 
ATOM   9097  O O2    . DT  I 5 141 ? 180.207 152.859 122.241 1.00 199.19 ? 141  DT  J O2    1 
ATOM   9098  N N3    . DT  I 5 141 ? 181.296 154.674 123.027 1.00 199.19 ? 141  DT  J N3    1 
ATOM   9099  C C4    . DT  I 5 141 ? 182.308 155.605 123.041 1.00 199.19 ? 141  DT  J C4    1 
ATOM   9100  O O4    . DT  I 5 141 ? 182.349 156.511 123.866 1.00 199.19 ? 141  DT  J O4    1 
ATOM   9101  C C5    . DT  I 5 141 ? 183.311 155.440 122.019 1.00 199.19 ? 141  DT  J C5    1 
ATOM   9102  C C7    . DT  I 5 141 ? 184.457 156.397 121.934 1.00 199.19 ? 141  DT  J C7    1 
ATOM   9103  C C6    . DT  I 5 141 ? 183.175 154.416 121.162 1.00 199.19 ? 141  DT  J C6    1 
ATOM   9104  P P     . DT  I 5 142 ? 180.673 150.762 116.718 1.00 206.35 ? 142  DT  J P     1 
ATOM   9105  O OP1   . DT  I 5 142 ? 181.177 149.716 115.805 1.00 206.35 ? 142  DT  J OP1   1 
ATOM   9106  O OP2   . DT  I 5 142 ? 180.645 152.162 116.244 1.00 206.35 ? 142  DT  J OP2   1 
ATOM   9107  O "O5'" . DT  I 5 142 ? 179.178 150.377 117.171 1.00 206.35 ? 142  DT  J "O5'" 1 
ATOM   9108  C "C5'" . DT  I 5 142 ? 178.727 150.712 118.493 1.00 206.35 ? 142  DT  J "C5'" 1 
ATOM   9109  C "C4'" . DT  I 5 142 ? 177.339 151.360 118.510 1.00 206.35 ? 142  DT  J "C4'" 1 
ATOM   9110  O "O4'" . DT  I 5 142 ? 177.399 152.568 119.310 1.00 206.35 ? 142  DT  J "O4'" 1 
ATOM   9111  C "C3'" . DT  I 5 142 ? 176.793 151.853 117.179 1.00 206.35 ? 142  DT  J "C3'" 1 
ATOM   9112  O "O3'" . DT  I 5 142 ? 175.413 152.192 117.351 1.00 206.35 ? 142  DT  J "O3'" 1 
ATOM   9113  C "C2'" . DT  I 5 142 ? 177.582 153.138 117.045 1.00 206.35 ? 142  DT  J "C2'" 1 
ATOM   9114  C "C1'" . DT  I 5 142 ? 177.332 153.690 118.441 1.00 206.35 ? 142  DT  J "C1'" 1 
ATOM   9115  N N1    . DT  I 5 142 ? 178.298 154.718 118.909 1.00 206.35 ? 142  DT  J N1    1 
ATOM   9116  C C2    . DT  I 5 142 ? 177.997 155.399 120.050 1.00 206.35 ? 142  DT  J C2    1 
ATOM   9117  O O2    . DT  I 5 142 ? 176.981 155.199 120.687 1.00 206.35 ? 142  DT  J O2    1 
ATOM   9118  N N3    . DT  I 5 142 ? 178.920 156.326 120.428 1.00 206.35 ? 142  DT  J N3    1 
ATOM   9119  C C4    . DT  I 5 142 ? 180.100 156.639 119.792 1.00 206.35 ? 142  DT  J C4    1 
ATOM   9120  O O4    . DT  I 5 142 ? 180.864 157.498 120.222 1.00 206.35 ? 142  DT  J O4    1 
ATOM   9121  C C5    . DT  I 5 142 ? 180.368 155.887 118.591 1.00 206.35 ? 142  DT  J C5    1 
ATOM   9122  C C7    . DT  I 5 142 ? 181.622 156.144 117.810 1.00 206.35 ? 142  DT  J C7    1 
ATOM   9123  C C6    . DT  I 5 142 ? 179.464 154.967 118.208 1.00 206.35 ? 142  DT  J C6    1 
ATOM   9124  P P     . DT  I 5 143 ? 174.219 151.153 117.077 1.00 208.99 ? 143  DT  J P     1 
ATOM   9125  O OP1   . DT  I 5 143 ? 174.362 150.000 117.994 1.00 208.99 ? 143  DT  J OP1   1 
ATOM   9126  O OP2   . DT  I 5 143 ? 174.140 150.936 115.617 1.00 208.99 ? 143  DT  J OP2   1 
ATOM   9127  O "O5'" . DT  I 5 143 ? 172.916 151.979 117.516 1.00 208.99 ? 143  DT  J "O5'" 1 
ATOM   9128  C "C5'" . DT  I 5 143 ? 172.701 153.300 117.006 1.00 208.99 ? 143  DT  J "C5'" 1 
ATOM   9129  C "C4'" . DT  I 5 143 ? 172.035 154.193 118.042 1.00 208.99 ? 143  DT  J "C4'" 1 
ATOM   9130  O "O4'" . DT  I 5 143 ? 173.055 154.955 118.742 1.00 208.99 ? 143  DT  J "O4'" 1 
ATOM   9131  C "C3'" . DT  I 5 143 ? 171.108 155.255 117.467 1.00 208.99 ? 143  DT  J "C3'" 1 
ATOM   9132  O "O3'" . DT  I 5 143 ? 170.189 155.701 118.478 1.00 208.99 ? 143  DT  J "O3'" 1 
ATOM   9133  C "C2'" . DT  I 5 143 ? 172.110 156.338 117.135 1.00 208.99 ? 143  DT  J "C2'" 1 
ATOM   9134  C "C1'" . DT  I 5 143 ? 172.916 156.326 118.408 1.00 208.99 ? 143  DT  J "C1'" 1 
ATOM   9135  N N1    . DT  I 5 143 ? 174.268 156.923 118.300 1.00 208.99 ? 143  DT  J N1    1 
ATOM   9136  C C2    . DT  I 5 143 ? 174.657 157.831 119.244 1.00 208.99 ? 143  DT  J C2    1 
ATOM   9137  O O2    . DT  I 5 143 ? 173.936 158.180 120.160 1.00 208.99 ? 143  DT  J O2    1 
ATOM   9138  N N3    . DT  I 5 143 ? 175.921 158.330 119.086 1.00 208.99 ? 143  DT  J N3    1 
ATOM   9139  C C4    . DT  I 5 143 ? 176.820 158.008 118.089 1.00 208.99 ? 143  DT  J C4    1 
ATOM   9140  O O4    . DT  I 5 143 ? 177.937 158.507 118.027 1.00 208.99 ? 143  DT  J O4    1 
ATOM   9141  C C5    . DT  I 5 143 ? 176.350 157.040 117.126 1.00 208.99 ? 143  DT  J C5    1 
ATOM   9142  C C7    . DT  I 5 143 ? 177.234 156.616 115.996 1.00 208.99 ? 143  DT  J C7    1 
ATOM   9143  C C6    . DT  I 5 143 ? 175.108 156.547 117.277 1.00 208.99 ? 143  DT  J C6    1 
ATOM   9144  P P     . DT  I 5 144 ? 168.756 156.308 118.070 1.00 202.43 ? 144  DT  J P     1 
ATOM   9145  O OP1   . DT  I 5 144 ? 167.724 155.407 118.627 1.00 202.43 ? 144  DT  J OP1   1 
ATOM   9146  O OP2   . DT  I 5 144 ? 168.793 156.597 116.621 1.00 202.43 ? 144  DT  J OP2   1 
ATOM   9147  O "O5'" . DT  I 5 144 ? 168.675 157.713 118.842 1.00 202.43 ? 144  DT  J "O5'" 1 
ATOM   9148  C "C5'" . DT  I 5 144 ? 169.760 158.613 118.762 1.00 202.43 ? 144  DT  J "C5'" 1 
ATOM   9149  C "C4'" . DT  I 5 144 ? 169.404 159.998 119.272 1.00 202.43 ? 144  DT  J "C4'" 1 
ATOM   9150  O "O4'" . DT  I 5 144 ? 170.565 160.843 119.134 1.00 202.43 ? 144  DT  J "O4'" 1 
ATOM   9151  C "C3'" . DT  I 5 144 ? 168.373 160.738 118.467 1.00 202.43 ? 144  DT  J "C3'" 1 
ATOM   9152  O "O3'" . DT  I 5 144 ? 168.026 161.924 119.172 1.00 202.43 ? 144  DT  J "O3'" 1 
ATOM   9153  C "C2'" . DT  I 5 144 ? 169.192 161.065 117.223 1.00 202.43 ? 144  DT  J "C2'" 1 
ATOM   9154  C "C1'" . DT  I 5 144 ? 170.544 161.435 117.845 1.00 202.43 ? 144  DT  J "C1'" 1 
ATOM   9155  N N1    . DT  I 5 144 ? 171.740 160.935 117.096 1.00 202.43 ? 144  DT  J N1    1 
ATOM   9156  C C2    . DT  I 5 144 ? 172.973 161.415 117.442 1.00 202.43 ? 144  DT  J C2    1 
ATOM   9157  O O2    . DT  I 5 144 ? 173.143 162.236 118.323 1.00 202.43 ? 144  DT  J O2    1 
ATOM   9158  N N3    . DT  I 5 144 ? 174.013 160.905 116.715 1.00 202.43 ? 144  DT  J N3    1 
ATOM   9159  C C4    . DT  I 5 144 ? 173.948 159.978 115.699 1.00 202.43 ? 144  DT  J C4    1 
ATOM   9160  O O4    . DT  I 5 144 ? 174.948 159.584 115.108 1.00 202.43 ? 144  DT  J O4    1 
ATOM   9161  C C5    . DT  I 5 144 ? 172.625 159.507 115.381 1.00 202.43 ? 144  DT  J C5    1 
ATOM   9162  C C7    . DT  I 5 144 ? 172.429 158.499 114.285 1.00 202.43 ? 144  DT  J C7    1 
ATOM   9163  C C6    . DT  I 5 144 ? 171.593 160.002 116.086 1.00 202.43 ? 144  DT  J C6    1 
ATOM   9164  P P     . DG  I 5 145 ? 166.630 162.674 118.916 1.00 191.32 ? 145  DG  J P     1 
ATOM   9165  O OP1   . DG  I 5 145 ? 165.771 162.432 120.093 1.00 191.32 ? 145  DG  J OP1   1 
ATOM   9166  O OP2   . DG  I 5 145 ? 166.149 162.304 117.571 1.00 191.32 ? 145  DG  J OP2   1 
ATOM   9167  O "O5'" . DG  I 5 145 ? 167.040 164.223 118.898 1.00 191.32 ? 145  DG  J "O5'" 1 
ATOM   9168  C "C5'" . DG  I 5 145 ? 168.416 164.586 118.820 1.00 191.32 ? 145  DG  J "C5'" 1 
ATOM   9169  C "C4'" . DG  I 5 145 ? 168.608 165.966 118.204 1.00 191.32 ? 145  DG  J "C4'" 1 
ATOM   9170  O "O4'" . DG  I 5 145 ? 169.862 165.978 117.489 1.00 191.32 ? 145  DG  J "O4'" 1 
ATOM   9171  C "C3'" . DG  I 5 145 ? 167.614 166.348 117.128 1.00 191.32 ? 145  DG  J "C3'" 1 
ATOM   9172  O "O3'" . DG  I 5 145 ? 167.850 167.708 116.751 1.00 191.32 ? 145  DG  J "O3'" 1 
ATOM   9173  C "C2'" . DG  I 5 145 ? 168.112 165.442 116.020 1.00 191.32 ? 145  DG  J "C2'" 1 
ATOM   9174  C "C1'" . DG  I 5 145 ? 169.587 165.808 116.105 1.00 191.32 ? 145  DG  J "C1'" 1 
ATOM   9175  N N9    . DG  I 5 145 ? 170.518 164.829 115.571 1.00 191.32 ? 145  DG  J N9    1 
ATOM   9176  C C8    . DG  I 5 145 ? 170.250 163.613 114.999 1.00 191.32 ? 145  DG  J C8    1 
ATOM   9177  N N7    . DG  I 5 145 ? 171.329 162.976 114.622 1.00 191.32 ? 145  DG  J N7    1 
ATOM   9178  C C5    . DG  I 5 145 ? 172.363 163.833 114.969 1.00 191.32 ? 145  DG  J C5    1 
ATOM   9179  C C6    . DG  I 5 145 ? 173.762 163.703 114.815 1.00 191.32 ? 145  DG  J C6    1 
ATOM   9180  O O6    . DG  I 5 145 ? 174.403 162.768 114.321 1.00 191.32 ? 145  DG  J O6    1 
ATOM   9181  N N1    . DG  I 5 145 ? 174.435 164.816 115.311 1.00 191.32 ? 145  DG  J N1    1 
ATOM   9182  C C2    . DG  I 5 145 ? 173.831 165.907 115.879 1.00 191.32 ? 145  DG  J C2    1 
ATOM   9183  N N2    . DG  I 5 145 ? 174.623 166.892 116.305 1.00 191.32 ? 145  DG  J N2    1 
ATOM   9184  N N3    . DG  I 5 145 ? 172.535 166.033 116.024 1.00 191.32 ? 145  DG  J N3    1 
ATOM   9185  C C4    . DG  I 5 145 ? 171.869 164.968 115.551 1.00 191.32 ? 145  DG  J C4    1 
ATOM   9186  P P     . DA  I 5 146 ? 167.120 168.949 117.468 1.00 196.54 ? 146  DA  J P     1 
ATOM   9187  O OP1   . DA  I 5 146 ? 167.122 168.784 118.936 1.00 196.54 ? 146  DA  J OP1   1 
ATOM   9188  O OP2   . DA  I 5 146 ? 165.835 169.144 116.767 1.00 196.54 ? 146  DA  J OP2   1 
ATOM   9189  O "O5'" . DA  I 5 146 ? 168.077 170.188 117.113 1.00 196.54 ? 146  DA  J "O5'" 1 
ATOM   9190  C "C5'" . DA  I 5 146 ? 168.138 170.696 115.773 1.00 196.54 ? 146  DA  J "C5'" 1 
ATOM   9191  C "C4'" . DA  I 5 146 ? 169.561 171.081 115.389 1.00 196.54 ? 146  DA  J "C4'" 1 
ATOM   9192  O "O4'" . DA  I 5 146 ? 170.332 169.873 115.144 1.00 196.54 ? 146  DA  J "O4'" 1 
ATOM   9193  C "C3'" . DA  I 5 146 ? 169.690 171.892 114.096 1.00 196.54 ? 146  DA  J "C3'" 1 
ATOM   9194  O "O3'" . DA  I 5 146 ? 170.894 172.676 114.129 1.00 196.54 ? 146  DA  J "O3'" 1 
ATOM   9195  C "C2'" . DA  I 5 146 ? 169.796 170.783 113.066 1.00 196.54 ? 146  DA  J "C2'" 1 
ATOM   9196  C "C1'" . DA  I 5 146 ? 170.756 169.869 113.795 1.00 196.54 ? 146  DA  J "C1'" 1 
ATOM   9197  N N9    . DA  I 5 146 ? 170.773 168.502 113.305 1.00 196.54 ? 146  DA  J N9    1 
ATOM   9198  C C8    . DA  I 5 146 ? 169.716 167.653 113.156 1.00 196.54 ? 146  DA  J C8    1 
ATOM   9199  N N7    . DA  I 5 146 ? 170.054 166.470 112.692 1.00 196.54 ? 146  DA  J N7    1 
ATOM   9200  C C5    . DA  I 5 146 ? 171.426 166.563 112.526 1.00 196.54 ? 146  DA  J C5    1 
ATOM   9201  C C6    . DA  I 5 146 ? 172.399 165.652 112.064 1.00 196.54 ? 146  DA  J C6    1 
ATOM   9202  N N6    . DA  I 5 146 ? 172.114 164.410 111.667 1.00 196.54 ? 146  DA  J N6    1 
ATOM   9203  N N1    . DA  I 5 146 ? 173.687 166.075 112.026 1.00 196.54 ? 146  DA  J N1    1 
ATOM   9204  C C2    . DA  I 5 146 ? 173.962 167.320 112.426 1.00 196.54 ? 146  DA  J C2    1 
ATOM   9205  N N3    . DA  I 5 146 ? 173.138 168.255 112.875 1.00 196.54 ? 146  DA  J N3    1 
ATOM   9206  C C4    . DA  I 5 146 ? 171.877 167.809 112.901 1.00 196.54 ? 146  DA  J C4    1 
ATOM   9207  P P     . DT  I 5 147 ? 171.225 173.742 112.967 1.00 201.64 ? 147  DT  J P     1 
ATOM   9208  O OP1   . DT  I 5 147 ? 171.801 174.932 113.627 1.00 201.64 ? 147  DT  J OP1   1 
ATOM   9209  O OP2   . DT  I 5 147 ? 170.036 173.902 112.105 1.00 201.64 ? 147  DT  J OP2   1 
ATOM   9210  O "O5'" . DT  I 5 147 ? 172.383 173.048 112.101 1.00 201.64 ? 147  DT  J "O5'" 1 
ATOM   9211  C "C5'" . DT  I 5 147 ? 173.734 173.531 112.190 1.00 201.64 ? 147  DT  J "C5'" 1 
ATOM   9212  C "C4'" . DT  I 5 147 ? 174.309 173.867 110.813 1.00 201.64 ? 147  DT  J "C4'" 1 
ATOM   9213  O "O4'" . DT  I 5 147 ? 174.409 172.662 110.018 1.00 201.64 ? 147  DT  J "O4'" 1 
ATOM   9214  C "C3'" . DT  I 5 147 ? 173.515 174.893 110.002 1.00 201.64 ? 147  DT  J "C3'" 1 
ATOM   9215  O "O3'" . DT  I 5 147 ? 174.245 176.111 109.916 1.00 201.64 ? 147  DT  J "O3'" 1 
ATOM   9216  C "C2'" . DT  I 5 147 ? 173.321 174.258 108.615 1.00 201.64 ? 147  DT  J "C2'" 1 
ATOM   9217  C "C1'" . DT  I 5 147 ? 173.714 172.790 108.797 1.00 201.64 ? 147  DT  J "C1'" 1 
ATOM   9218  N N1    . DT  I 5 147 ? 172.562 171.819 108.804 1.00 201.64 ? 147  DT  J N1    1 
ATOM   9219  C C2    . DT  I 5 147 ? 172.793 170.518 108.439 1.00 201.64 ? 147  DT  J C2    1 
ATOM   9220  O O2    . DT  I 5 147 ? 173.889 170.104 108.111 1.00 201.64 ? 147  DT  J O2    1 
ATOM   9221  N N3    . DT  I 5 147 ? 171.696 169.704 108.493 1.00 201.64 ? 147  DT  J N3    1 
ATOM   9222  C C4    . DT  I 5 147 ? 170.416 170.052 108.869 1.00 201.64 ? 147  DT  J C4    1 
ATOM   9223  O O4    . DT  I 5 147 ? 169.491 169.246 108.868 1.00 201.64 ? 147  DT  J O4    1 
ATOM   9224  C C5    . DT  I 5 147 ? 170.237 171.439 109.226 1.00 201.64 ? 147  DT  J C5    1 
ATOM   9225  C C7    . DT  I 5 147 ? 168.889 171.948 109.640 1.00 201.64 ? 147  DT  J C7    1 
ATOM   9226  C C6    . DT  I 5 147 ? 171.305 172.242 109.179 1.00 201.64 ? 147  DT  J C6    1 
ATOM   9227  P P     . DA  J 6 1   ? 174.789 161.213 102.976 1.00 208.80 ? 1    DA  I P     1 
ATOM   9228  O OP1   . DA  J 6 1   ? 175.575 160.255 102.165 1.00 208.80 ? 1    DA  I OP1   1 
ATOM   9229  O OP2   . DA  J 6 1   ? 174.086 160.740 104.187 1.00 208.80 ? 1    DA  I OP2   1 
ATOM   9230  O "O5'" . DA  J 6 1   ? 175.727 162.442 103.394 1.00 208.80 ? 1    DA  I "O5'" 1 
ATOM   9231  C "C5'" . DA  J 6 1   ? 177.006 162.199 103.970 1.00 208.80 ? 1    DA  I "C5'" 1 
ATOM   9232  C "C4'" . DA  J 6 1   ? 177.696 163.502 104.326 1.00 208.80 ? 1    DA  I "C4'" 1 
ATOM   9233  O "O4'" . DA  J 6 1   ? 176.703 164.484 104.677 1.00 208.80 ? 1    DA  I "O4'" 1 
ATOM   9234  C "C3'" . DA  J 6 1   ? 178.583 163.437 105.546 1.00 208.80 ? 1    DA  I "C3'" 1 
ATOM   9235  O "O3'" . DA  J 6 1   ? 179.430 164.571 105.565 1.00 208.80 ? 1    DA  I "O3'" 1 
ATOM   9236  C "C2'" . DA  J 6 1   ? 177.549 163.507 106.659 1.00 208.80 ? 1    DA  I "C2'" 1 
ATOM   9237  C "C1'" . DA  J 6 1   ? 176.568 164.531 106.088 1.00 208.80 ? 1    DA  I "C1'" 1 
ATOM   9238  N N9    . DA  J 6 1   ? 175.172 164.262 106.407 1.00 208.80 ? 1    DA  I N9    1 
ATOM   9239  C C8    . DA  J 6 1   ? 174.513 163.071 106.295 1.00 208.80 ? 1    DA  I C8    1 
ATOM   9240  N N7    . DA  J 6 1   ? 173.249 163.132 106.633 1.00 208.80 ? 1    DA  I N7    1 
ATOM   9241  C C5    . DA  J 6 1   ? 173.065 164.457 106.981 1.00 208.80 ? 1    DA  I C5    1 
ATOM   9242  C C6    . DA  J 6 1   ? 171.939 165.175 107.419 1.00 208.80 ? 1    DA  I C6    1 
ATOM   9243  N N6    . DA  J 6 1   ? 170.739 164.616 107.612 1.00 208.80 ? 1    DA  I N6    1 
ATOM   9244  N N1    . DA  J 6 1   ? 172.101 166.487 107.689 1.00 208.80 ? 1    DA  I N1    1 
ATOM   9245  C C2    . DA  J 6 1   ? 173.305 167.039 107.509 1.00 208.80 ? 1    DA  I C2    1 
ATOM   9246  N N3    . DA  J 6 1   ? 174.429 166.471 107.089 1.00 208.80 ? 1    DA  I N3    1 
ATOM   9247  C C4    . DA  J 6 1   ? 174.242 165.166 106.852 1.00 208.80 ? 1    DA  I C4    1 
ATOM   9248  P P     . DT  J 6 2   ? 180.858 164.504 106.294 1.00 206.32 ? 2    DT  I P     1 
ATOM   9249  O OP1   . DT  J 6 2   ? 181.824 165.227 105.438 1.00 206.32 ? 2    DT  I OP1   1 
ATOM   9250  O OP2   . DT  J 6 2   ? 181.107 163.097 106.678 1.00 206.32 ? 2    DT  I OP2   1 
ATOM   9251  O "O5'" . DT  J 6 2   ? 180.639 165.338 107.639 1.00 206.32 ? 2    DT  I "O5'" 1 
ATOM   9252  C "C5'" . DT  J 6 2   ? 181.676 165.409 108.603 1.00 206.32 ? 2    DT  I "C5'" 1 
ATOM   9253  C "C4'" . DT  J 6 2   ? 181.346 166.437 109.664 1.00 206.32 ? 2    DT  I "C4'" 1 
ATOM   9254  O "O4'" . DT  J 6 2   ? 179.905 166.484 109.855 1.00 206.32 ? 2    DT  I "O4'" 1 
ATOM   9255  C "C3'" . DT  J 6 2   ? 181.905 166.126 111.041 1.00 206.32 ? 2    DT  I "C3'" 1 
ATOM   9256  O "O3'" . DT  J 6 2   ? 181.959 167.324 111.804 1.00 206.32 ? 2    DT  I "O3'" 1 
ATOM   9257  C "C2'" . DT  J 6 2   ? 180.830 165.195 111.569 1.00 206.32 ? 2    DT  I "C2'" 1 
ATOM   9258  C "C1'" . DT  J 6 2   ? 179.592 165.965 111.135 1.00 206.32 ? 2    DT  I "C1'" 1 
ATOM   9259  N N1    . DT  J 6 2   ? 178.354 165.141 111.026 1.00 206.32 ? 2    DT  I N1    1 
ATOM   9260  C C2    . DT  J 6 2   ? 177.156 165.694 111.394 1.00 206.32 ? 2    DT  I C2    1 
ATOM   9261  O O2    . DT  J 6 2   ? 177.052 166.831 111.813 1.00 206.32 ? 2    DT  I O2    1 
ATOM   9262  N N3    . DT  J 6 2   ? 176.074 164.869 111.257 1.00 206.32 ? 2    DT  I N3    1 
ATOM   9263  C C4    . DT  J 6 2   ? 176.073 163.568 110.796 1.00 206.32 ? 2    DT  I C4    1 
ATOM   9264  O O4    . DT  J 6 2   ? 175.047 162.904 110.707 1.00 206.32 ? 2    DT  I O4    1 
ATOM   9265  C C5    . DT  J 6 2   ? 177.367 163.046 110.425 1.00 206.32 ? 2    DT  I C5    1 
ATOM   9266  C C7    . DT  J 6 2   ? 177.495 161.645 109.910 1.00 206.32 ? 2    DT  I C7    1 
ATOM   9267  C C6    . DT  J 6 2   ? 178.432 163.849 110.556 1.00 206.32 ? 2    DT  I C6    1 
ATOM   9268  P P     . DC  J 6 3   ? 182.968 167.463 113.046 1.00 204.63 ? 3    DC  I P     1 
ATOM   9269  O OP1   . DC  J 6 3   ? 184.324 167.668 112.491 1.00 204.63 ? 3    DC  I OP1   1 
ATOM   9270  O OP2   . DC  J 6 3   ? 182.711 166.359 113.996 1.00 204.63 ? 3    DC  I OP2   1 
ATOM   9271  O "O5'" . DC  J 6 3   ? 182.505 168.814 113.761 1.00 204.63 ? 3    DC  I "O5'" 1 
ATOM   9272  C "C5'" . DC  J 6 3   ? 182.722 168.983 115.151 1.00 204.63 ? 3    DC  I "C5'" 1 
ATOM   9273  C "C4'" . DC  J 6 3   ? 181.406 168.967 115.899 1.00 204.63 ? 3    DC  I "C4'" 1 
ATOM   9274  O "O4'" . DC  J 6 3   ? 180.469 168.084 115.215 1.00 204.63 ? 3    DC  I "O4'" 1 
ATOM   9275  C "C3'" . DC  J 6 3   ? 181.479 168.454 117.352 1.00 204.63 ? 3    DC  I "C3'" 1 
ATOM   9276  O "O3'" . DC  J 6 3   ? 180.679 169.283 118.205 1.00 204.63 ? 3    DC  I "O3'" 1 
ATOM   9277  C "C2'" . DC  J 6 3   ? 180.880 167.060 117.227 1.00 204.63 ? 3    DC  I "C2'" 1 
ATOM   9278  C "C1'" . DC  J 6 3   ? 179.812 167.341 116.200 1.00 204.63 ? 3    DC  I "C1'" 1 
ATOM   9279  N N1    . DC  J 6 3   ? 179.205 166.124 115.630 1.00 204.63 ? 3    DC  I N1    1 
ATOM   9280  C C2    . DC  J 6 3   ? 177.828 165.999 115.666 1.00 204.63 ? 3    DC  I C2    1 
ATOM   9281  O O2    . DC  J 6 3   ? 177.177 166.922 116.157 1.00 204.63 ? 3    DC  I O2    1 
ATOM   9282  N N3    . DC  J 6 3   ? 177.252 164.885 115.162 1.00 204.63 ? 3    DC  I N3    1 
ATOM   9283  C C4    . DC  J 6 3   ? 178.010 163.921 114.645 1.00 204.63 ? 3    DC  I C4    1 
ATOM   9284  N N4    . DC  J 6 3   ? 177.397 162.835 114.156 1.00 204.63 ? 3    DC  I N4    1 
ATOM   9285  C C5    . DC  J 6 3   ? 179.429 164.030 114.604 1.00 204.63 ? 3    DC  I C5    1 
ATOM   9286  C C6    . DC  J 6 3   ? 179.981 165.137 115.109 1.00 204.63 ? 3    DC  I C6    1 
ATOM   9287  P P     . DA  J 6 4   ? 180.800 169.204 119.811 1.00 198.67 ? 4    DA  I P     1 
ATOM   9288  O OP1   . DA  J 6 4   ? 181.323 170.506 120.264 1.00 198.67 ? 4    DA  I OP1   1 
ATOM   9289  O OP2   . DA  J 6 4   ? 181.489 167.968 120.240 1.00 198.67 ? 4    DA  I OP2   1 
ATOM   9290  O "O5'" . DA  J 6 4   ? 179.283 169.110 120.300 1.00 198.67 ? 4    DA  I "O5'" 1 
ATOM   9291  C "C5'" . DA  J 6 4   ? 178.442 168.070 119.822 1.00 198.67 ? 4    DA  I "C5'" 1 
ATOM   9292  C "C4'" . DA  J 6 4   ? 177.377 167.724 120.846 1.00 198.67 ? 4    DA  I "C4'" 1 
ATOM   9293  O "O4'" . DA  J 6 4   ? 176.841 166.429 120.536 1.00 198.67 ? 4    DA  I "O4'" 1 
ATOM   9294  C "C3'" . DA  J 6 4   ? 177.892 167.572 122.258 1.00 198.67 ? 4    DA  I "C3'" 1 
ATOM   9295  O "O3'" . DA  J 6 4   ? 176.819 167.647 123.180 1.00 198.67 ? 4    DA  I "O3'" 1 
ATOM   9296  C "C2'" . DA  J 6 4   ? 178.492 166.172 122.222 1.00 198.67 ? 4    DA  I "C2'" 1 
ATOM   9297  C "C1'" . DA  J 6 4   ? 177.586 165.446 121.224 1.00 198.67 ? 4    DA  I "C1'" 1 
ATOM   9298  N N9    . DA  J 6 4   ? 178.327 164.670 120.242 1.00 198.67 ? 4    DA  I N9    1 
ATOM   9299  C C8    . DA  J 6 4   ? 179.676 164.678 120.035 1.00 198.67 ? 4    DA  I C8    1 
ATOM   9300  N N7    . DA  J 6 4   ? 180.069 163.874 119.077 1.00 198.67 ? 4    DA  I N7    1 
ATOM   9301  C C5    . DA  J 6 4   ? 178.894 163.302 118.625 1.00 198.67 ? 4    DA  I C5    1 
ATOM   9302  C C6    . DA  J 6 4   ? 178.620 162.355 117.619 1.00 198.67 ? 4    DA  I C6    1 
ATOM   9303  N N6    . DA  J 6 4   ? 179.565 161.799 116.856 1.00 198.67 ? 4    DA  I N6    1 
ATOM   9304  N N1    . DA  J 6 4   ? 177.331 161.999 117.427 1.00 198.67 ? 4    DA  I N1    1 
ATOM   9305  C C2    . DA  J 6 4   ? 176.388 162.555 118.194 1.00 198.67 ? 4    DA  I C2    1 
ATOM   9306  N N3    . DA  J 6 4   ? 176.524 163.448 119.168 1.00 198.67 ? 4    DA  I N3    1 
ATOM   9307  C C4    . DA  J 6 4   ? 177.811 163.782 119.335 1.00 198.67 ? 4    DA  I C4    1 
ATOM   9308  P P     . DA  J 6 5   ? 176.995 168.467 124.550 1.00 190.51 ? 5    DA  I P     1 
ATOM   9309  O OP1   . DA  J 6 5   ? 176.047 169.600 124.519 1.00 190.51 ? 5    DA  I OP1   1 
ATOM   9310  O OP2   . DA  J 6 5   ? 178.440 168.718 124.739 1.00 190.51 ? 5    DA  I OP2   1 
ATOM   9311  O "O5'" . DA  J 6 5   ? 176.517 167.444 125.677 1.00 190.51 ? 5    DA  I "O5'" 1 
ATOM   9312  C "C5'" . DA  J 6 5   ? 176.754 166.061 125.515 1.00 190.51 ? 5    DA  I "C5'" 1 
ATOM   9313  C "C4'" . DA  J 6 5   ? 175.535 165.256 125.918 1.00 190.51 ? 5    DA  I "C4'" 1 
ATOM   9314  O "O4'" . DA  J 6 5   ? 175.260 164.270 124.905 1.00 190.51 ? 5    DA  I "O4'" 1 
ATOM   9315  C "C3'" . DA  J 6 5   ? 175.709 164.434 127.172 1.00 190.51 ? 5    DA  I "C3'" 1 
ATOM   9316  O "O3'" . DA  J 6 5   ? 174.435 164.012 127.634 1.00 190.51 ? 5    DA  I "O3'" 1 
ATOM   9317  C "C2'" . DA  J 6 5   ? 176.519 163.267 126.636 1.00 190.51 ? 5    DA  I "C2'" 1 
ATOM   9318  C "C1'" . DA  J 6 5   ? 175.858 163.041 125.275 1.00 190.51 ? 5    DA  I "C1'" 1 
ATOM   9319  N N9    . DA  J 6 5   ? 176.781 162.665 124.210 1.00 190.51 ? 5    DA  I N9    1 
ATOM   9320  C C8    . DA  J 6 5   ? 178.046 163.134 123.998 1.00 190.51 ? 5    DA  I C8    1 
ATOM   9321  N N7    . DA  J 6 5   ? 178.632 162.617 122.942 1.00 190.51 ? 5    DA  I N7    1 
ATOM   9322  C C5    . DA  J 6 5   ? 177.682 161.754 122.429 1.00 190.51 ? 5    DA  I C5    1 
ATOM   9323  C C6    . DA  J 6 5   ? 177.673 160.894 121.310 1.00 190.51 ? 5    DA  I C6    1 
ATOM   9324  N N6    . DA  J 6 5   ? 178.707 160.760 120.475 1.00 190.51 ? 5    DA  I N6    1 
ATOM   9325  N N1    . DA  J 6 5   ? 176.555 160.168 121.085 1.00 190.51 ? 5    DA  I N1    1 
ATOM   9326  C C2    . DA  J 6 5   ? 175.525 160.304 121.926 1.00 190.51 ? 5    DA  I C2    1 
ATOM   9327  N N3    . DA  J 6 5   ? 175.417 161.073 123.001 1.00 190.51 ? 5    DA  I N3    1 
ATOM   9328  C C4    . DA  J 6 5   ? 176.537 161.777 123.199 1.00 190.51 ? 5    DA  I C4    1 
ATOM   9329  P P     . DA  J 6 6   ? 174.256 163.432 129.121 1.00 184.26 ? 6    DA  I P     1 
ATOM   9330  O OP1   . DA  J 6 6   ? 172.977 163.945 129.654 1.00 184.26 ? 6    DA  I OP1   1 
ATOM   9331  O OP2   . DA  J 6 6   ? 175.514 163.646 129.868 1.00 184.26 ? 6    DA  I OP2   1 
ATOM   9332  O "O5'" . DA  J 6 6   ? 174.096 161.868 128.882 1.00 184.26 ? 6    DA  I "O5'" 1 
ATOM   9333  C "C5'" . DA  J 6 6   ? 173.327 161.405 127.786 1.00 184.26 ? 6    DA  I "C5'" 1 
ATOM   9334  C "C4'" . DA  J 6 6   ? 173.632 159.952 127.469 1.00 184.26 ? 6    DA  I "C4'" 1 
ATOM   9335  O "O4'" . DA  J 6 6   ? 174.593 159.876 126.385 1.00 184.26 ? 6    DA  I "O4'" 1 
ATOM   9336  C "C3'" . DA  J 6 6   ? 174.244 159.141 128.614 1.00 184.26 ? 6    DA  I "C3'" 1 
ATOM   9337  O "O3'" . DA  J 6 6   ? 173.751 157.822 128.555 1.00 184.26 ? 6    DA  I "O3'" 1 
ATOM   9338  C "C2'" . DA  J 6 6   ? 175.722 159.161 128.254 1.00 184.26 ? 6    DA  I "C2'" 1 
ATOM   9339  C "C1'" . DA  J 6 6   ? 175.589 158.965 126.764 1.00 184.26 ? 6    DA  I "C1'" 1 
ATOM   9340  N N9    . DA  J 6 6   ? 176.804 159.207 125.996 1.00 184.26 ? 6    DA  I N9    1 
ATOM   9341  C C8    . DA  J 6 6   ? 177.805 160.097 126.259 1.00 184.26 ? 6    DA  I C8    1 
ATOM   9342  N N7    . DA  J 6 6   ? 178.774 160.077 125.374 1.00 184.26 ? 6    DA  I N7    1 
ATOM   9343  C C5    . DA  J 6 6   ? 178.376 159.105 124.478 1.00 184.26 ? 6    DA  I C5    1 
ATOM   9344  C C6    . DA  J 6 6   ? 178.959 158.589 123.305 1.00 184.26 ? 6    DA  I C6    1 
ATOM   9345  N N6    . DA  J 6 6   ? 180.128 159.010 122.810 1.00 184.26 ? 6    DA  I N6    1 
ATOM   9346  N N1    . DA  J 6 6   ? 178.287 157.619 122.653 1.00 184.26 ? 6    DA  I N1    1 
ATOM   9347  C C2    . DA  J 6 6   ? 177.121 157.198 123.142 1.00 184.26 ? 6    DA  I C2    1 
ATOM   9348  N N3    . DA  J 6 6   ? 176.481 157.601 124.227 1.00 184.26 ? 6    DA  I N3    1 
ATOM   9349  C C4    . DA  J 6 6   ? 177.166 158.562 124.853 1.00 184.26 ? 6    DA  I C4    1 
ATOM   9350  P P     . DA  J 6 7   ? 172.579 157.340 129.536 1.00 180.26 ? 7    DA  I P     1 
ATOM   9351  O OP1   . DA  J 6 7   ? 171.307 157.726 128.892 1.00 180.26 ? 7    DA  I OP1   1 
ATOM   9352  O OP2   . DA  J 6 7   ? 172.900 157.815 130.898 1.00 180.26 ? 7    DA  I OP2   1 
ATOM   9353  O "O5'" . DA  J 6 7   ? 172.692 155.744 129.511 1.00 180.26 ? 7    DA  I "O5'" 1 
ATOM   9354  C "C5'" . DA  J 6 7   ? 171.973 154.998 128.535 1.00 180.26 ? 7    DA  I "C5'" 1 
ATOM   9355  C "C4'" . DA  J 6 7   ? 172.845 153.923 127.899 1.00 180.26 ? 7    DA  I "C4'" 1 
ATOM   9356  O "O4'" . DA  J 6 7   ? 173.967 154.536 127.213 1.00 180.26 ? 7    DA  I "O4'" 1 
ATOM   9357  C "C3'" . DA  J 6 7   ? 173.449 152.895 128.863 1.00 180.26 ? 7    DA  I "C3'" 1 
ATOM   9358  O "O3'" . DA  J 6 7   ? 173.334 151.595 128.295 1.00 180.26 ? 7    DA  I "O3'" 1 
ATOM   9359  C "C2'" . DA  J 6 7   ? 174.909 153.332 128.952 1.00 180.26 ? 7    DA  I "C2'" 1 
ATOM   9360  C "C1'" . DA  J 6 7   ? 175.137 153.831 127.542 1.00 180.26 ? 7    DA  I "C1'" 1 
ATOM   9361  N N9    . DA  J 6 7   ? 176.283 154.723 127.402 1.00 180.26 ? 7    DA  I N9    1 
ATOM   9362  C C8    . DA  J 6 7   ? 176.593 155.808 128.169 1.00 180.26 ? 7    DA  I C8    1 
ATOM   9363  N N7    . DA  J 6 7   ? 177.693 156.422 127.800 1.00 180.26 ? 7    DA  I N7    1 
ATOM   9364  C C5    . DA  J 6 7   ? 178.132 155.683 126.718 1.00 180.26 ? 7    DA  I C5    1 
ATOM   9365  C C6    . DA  J 6 7   ? 179.249 155.804 125.867 1.00 180.26 ? 7    DA  I C6    1 
ATOM   9366  N N6    . DA  J 6 7   ? 180.169 156.765 125.988 1.00 180.26 ? 7    DA  I N6    1 
ATOM   9367  N N1    . DA  J 6 7   ? 179.386 154.890 124.882 1.00 180.26 ? 7    DA  I N1    1 
ATOM   9368  C C2    . DA  J 6 7   ? 178.468 153.929 124.760 1.00 180.26 ? 7    DA  I C2    1 
ATOM   9369  N N3    . DA  J 6 7   ? 177.384 153.714 125.493 1.00 180.26 ? 7    DA  I N3    1 
ATOM   9370  C C4    . DA  J 6 7   ? 177.270 154.636 126.460 1.00 180.26 ? 7    DA  I C4    1 
ATOM   9371  P P     . DC  J 6 8   ? 173.351 150.280 129.220 1.00 187.09 ? 8    DC  I P     1 
ATOM   9372  O OP1   . DC  J 6 8   ? 171.984 149.717 129.225 1.00 187.09 ? 8    DC  I OP1   1 
ATOM   9373  O OP2   . DC  J 6 8   ? 174.015 150.590 130.504 1.00 187.09 ? 8    DC  I OP2   1 
ATOM   9374  O "O5'" . DC  J 6 8   ? 174.297 149.278 128.415 1.00 187.09 ? 8    DC  I "O5'" 1 
ATOM   9375  C "C5'" . DC  J 6 8   ? 174.069 149.050 127.032 1.00 187.09 ? 8    DC  I "C5'" 1 
ATOM   9376  C "C4'" . DC  J 6 8   ? 175.348 148.630 126.332 1.00 187.09 ? 8    DC  I "C4'" 1 
ATOM   9377  O "O4'" . DC  J 6 8   ? 176.237 149.770 126.209 1.00 187.09 ? 8    DC  I "O4'" 1 
ATOM   9378  C "C3'" . DC  J 6 8   ? 176.157 147.541 127.045 1.00 187.09 ? 8    DC  I "C3'" 1 
ATOM   9379  O "O3'" . DC  J 6 8   ? 176.570 146.556 126.111 1.00 187.09 ? 8    DC  I "O3'" 1 
ATOM   9380  C "C2'" . DC  J 6 8   ? 177.352 148.308 127.601 1.00 187.09 ? 8    DC  I "C2'" 1 
ATOM   9381  C "C1'" . DC  J 6 8   ? 177.538 149.351 126.523 1.00 187.09 ? 8    DC  I "C1'" 1 
ATOM   9382  N N1    . DC  J 6 8   ? 178.335 150.521 126.956 1.00 187.09 ? 8    DC  I N1    1 
ATOM   9383  C C2    . DC  J 6 8   ? 179.509 150.835 126.278 1.00 187.09 ? 8    DC  I C2    1 
ATOM   9384  O O2    . DC  J 6 8   ? 179.859 150.130 125.325 1.00 187.09 ? 8    DC  I O2    1 
ATOM   9385  N N3    . DC  J 6 8   ? 180.234 151.902 126.681 1.00 187.09 ? 8    DC  I N3    1 
ATOM   9386  C C4    . DC  J 6 8   ? 179.823 152.634 127.711 1.00 187.09 ? 8    DC  I C4    1 
ATOM   9387  N N4    . DC  J 6 8   ? 180.575 153.678 128.071 1.00 187.09 ? 8    DC  I N4    1 
ATOM   9388  C C5    . DC  J 6 8   ? 178.629 152.325 128.422 1.00 187.09 ? 8    DC  I C5    1 
ATOM   9389  C C6    . DC  J 6 8   ? 177.921 151.274 128.009 1.00 187.09 ? 8    DC  I C6    1 
ATOM   9390  P P     . DT  J 6 9   ? 176.697 145.018 126.560 1.00 191.51 ? 9    DT  I P     1 
ATOM   9391  O OP1   . DT  J 6 9   ? 175.829 144.202 125.683 1.00 191.51 ? 9    DT  I OP1   1 
ATOM   9392  O OP2   . DT  J 6 9   ? 176.541 144.978 128.030 1.00 191.51 ? 9    DT  I OP2   1 
ATOM   9393  O "O5'" . DT  J 6 9   ? 178.213 144.651 126.238 1.00 191.51 ? 9    DT  I "O5'" 1 
ATOM   9394  C "C5'" . DT  J 6 9   ? 179.247 145.261 126.976 1.00 191.51 ? 9    DT  I "C5'" 1 
ATOM   9395  C "C4'" . DT  J 6 9   ? 180.369 145.700 126.065 1.00 191.51 ? 9    DT  I "C4'" 1 
ATOM   9396  O "O4'" . DT  J 6 9   ? 180.646 147.108 126.292 1.00 191.51 ? 9    DT  I "O4'" 1 
ATOM   9397  C "C3'" . DT  J 6 9   ? 181.688 144.996 126.323 1.00 191.51 ? 9    DT  I "C3'" 1 
ATOM   9398  O "O3'" . DT  J 6 9   ? 182.499 145.054 125.161 1.00 191.51 ? 9    DT  I "O3'" 1 
ATOM   9399  C "C2'" . DT  J 6 9   ? 182.256 145.862 127.423 1.00 191.51 ? 9    DT  I "C2'" 1 
ATOM   9400  C "C1'" . DT  J 6 9   ? 181.931 147.234 126.863 1.00 191.51 ? 9    DT  I "C1'" 1 
ATOM   9401  N N1    . DT  J 6 9   ? 181.896 148.320 127.871 1.00 191.51 ? 9    DT  I N1    1 
ATOM   9402  C C2    . DT  J 6 9   ? 182.937 149.215 127.922 1.00 191.51 ? 9    DT  I C2    1 
ATOM   9403  O O2    . DT  J 6 9   ? 183.901 149.159 127.184 1.00 191.51 ? 9    DT  I O2    1 
ATOM   9404  N N3    . DT  J 6 9   ? 182.812 150.182 128.881 1.00 191.51 ? 9    DT  I N3    1 
ATOM   9405  C C4    . DT  J 6 9   ? 181.770 150.346 129.772 1.00 191.51 ? 9    DT  I C4    1 
ATOM   9406  O O4    . DT  J 6 9   ? 181.749 151.252 130.597 1.00 191.51 ? 9    DT  I O4    1 
ATOM   9407  C C5    . DT  J 6 9   ? 180.708 149.377 129.664 1.00 191.51 ? 9    DT  I C5    1 
ATOM   9408  C C7    . DT  J 6 9   ? 179.526 149.454 130.582 1.00 191.51 ? 9    DT  I C7    1 
ATOM   9409  C C6    . DT  J 6 9   ? 180.820 148.420 128.728 1.00 191.51 ? 9    DT  I C6    1 
ATOM   9410  P P     . DG  J 6 10  ? 183.735 144.044 124.991 1.00 194.71 ? 10   DG  I P     1 
ATOM   9411  O OP1   . DG  J 6 10  ? 184.098 144.009 123.558 1.00 194.71 ? 10   DG  I OP1   1 
ATOM   9412  O OP2   . DG  J 6 10  ? 183.383 142.797 125.703 1.00 194.71 ? 10   DG  I OP2   1 
ATOM   9413  O "O5'" . DG  J 6 10  ? 184.921 144.740 125.799 1.00 194.71 ? 10   DG  I "O5'" 1 
ATOM   9414  C "C5'" . DG  J 6 10  ? 186.066 143.984 126.142 1.00 194.71 ? 10   DG  I "C5'" 1 
ATOM   9415  C "C4'" . DG  J 6 10  ? 187.039 144.819 126.944 1.00 194.71 ? 10   DG  I "C4'" 1 
ATOM   9416  O "O4'" . DG  J 6 10  ? 186.352 145.968 127.484 1.00 194.71 ? 10   DG  I "O4'" 1 
ATOM   9417  C "C3'" . DG  J 6 10  ? 187.666 144.094 128.144 1.00 194.71 ? 10   DG  I "C3'" 1 
ATOM   9418  O "O3'" . DG  J 6 10  ? 189.081 144.080 128.035 1.00 194.71 ? 10   DG  I "O3'" 1 
ATOM   9419  C "C2'" . DG  J 6 10  ? 187.206 144.908 129.356 1.00 194.71 ? 10   DG  I "C2'" 1 
ATOM   9420  C "C1'" . DG  J 6 10  ? 186.904 146.256 128.735 1.00 194.71 ? 10   DG  I "C1'" 1 
ATOM   9421  N N9    . DG  J 6 10  ? 185.952 147.039 129.507 1.00 194.71 ? 10   DG  I N9    1 
ATOM   9422  C C8    . DG  J 6 10  ? 184.625 146.778 129.701 1.00 194.71 ? 10   DG  I C8    1 
ATOM   9423  N N7    . DG  J 6 10  ? 184.024 147.659 130.449 1.00 194.71 ? 10   DG  I N7    1 
ATOM   9424  C C5    . DG  J 6 10  ? 185.021 148.559 130.767 1.00 194.71 ? 10   DG  I C5    1 
ATOM   9425  C C6    . DG  J 6 10  ? 184.974 149.729 131.550 1.00 194.71 ? 10   DG  I C6    1 
ATOM   9426  O O6    . DG  J 6 10  ? 184.005 150.223 132.140 1.00 194.71 ? 10   DG  I O6    1 
ATOM   9427  N N1    . DG  J 6 10  ? 186.217 150.345 131.617 1.00 194.71 ? 10   DG  I N1    1 
ATOM   9428  C C2    . DG  J 6 10  ? 187.358 149.884 131.002 1.00 194.71 ? 10   DG  I C2    1 
ATOM   9429  N N2    . DG  J 6 10  ? 188.470 150.603 131.172 1.00 194.71 ? 10   DG  I N2    1 
ATOM   9430  N N3    . DG  J 6 10  ? 187.409 148.791 130.268 1.00 194.71 ? 10   DG  I N3    1 
ATOM   9431  C C4    . DG  J 6 10  ? 186.213 148.183 130.195 1.00 194.71 ? 10   DG  I C4    1 
ATOM   9432  P P     . DT  J 6 11  ? 189.955 143.193 129.052 1.00 193.72 ? 11   DT  I P     1 
ATOM   9433  O OP1   . DT  J 6 11  ? 191.191 142.785 128.346 1.00 193.72 ? 11   DT  I OP1   1 
ATOM   9434  O OP2   . DT  J 6 11  ? 189.065 142.159 129.623 1.00 193.72 ? 11   DT  I OP2   1 
ATOM   9435  O "O5'" . DT  J 6 11  ? 190.327 144.209 130.231 1.00 193.72 ? 11   DT  I "O5'" 1 
ATOM   9436  C "C5'" . DT  J 6 11  ? 191.080 145.380 129.941 1.00 193.72 ? 11   DT  I "C5'" 1 
ATOM   9437  C "C4'" . DT  J 6 11  ? 191.430 146.142 131.207 1.00 193.72 ? 11   DT  I "C4'" 1 
ATOM   9438  O "O4'" . DT  J 6 11  ? 190.298 146.941 131.628 1.00 193.72 ? 11   DT  I "O4'" 1 
ATOM   9439  C "C3'" . DT  J 6 11  ? 191.809 145.275 132.413 1.00 193.72 ? 11   DT  I "C3'" 1 
ATOM   9440  O "O3'" . DT  J 6 11  ? 192.974 145.804 133.035 1.00 193.72 ? 11   DT  I "O3'" 1 
ATOM   9441  C "C2'" . DT  J 6 11  ? 190.593 145.402 133.324 1.00 193.72 ? 11   DT  I "C2'" 1 
ATOM   9442  C "C1'" . DT  J 6 11  ? 190.171 146.824 133.017 1.00 193.72 ? 11   DT  I "C1'" 1 
ATOM   9443  N N1    . DT  J 6 11  ? 188.777 147.138 133.402 1.00 193.72 ? 11   DT  I N1    1 
ATOM   9444  C C2    . DT  J 6 11  ? 188.537 148.255 134.156 1.00 193.72 ? 11   DT  I C2    1 
ATOM   9445  O O2    . DT  J 6 11  ? 189.415 149.008 134.528 1.00 193.72 ? 11   DT  I O2    1 
ATOM   9446  N N3    . DT  J 6 11  ? 187.226 148.467 134.464 1.00 193.72 ? 11   DT  I N3    1 
ATOM   9447  C C4    . DT  J 6 11  ? 186.151 147.692 134.098 1.00 193.72 ? 11   DT  I C4    1 
ATOM   9448  O O4    . DT  J 6 11  ? 185.004 147.969 134.431 1.00 193.72 ? 11   DT  I O4    1 
ATOM   9449  C C5    . DT  J 6 11  ? 186.470 146.530 133.309 1.00 193.72 ? 11   DT  I C5    1 
ATOM   9450  C C7    . DT  J 6 11  ? 185.384 145.608 132.858 1.00 193.72 ? 11   DT  I C7    1 
ATOM   9451  C C6    . DT  J 6 11  ? 187.754 146.312 132.999 1.00 193.72 ? 11   DT  I C6    1 
ATOM   9452  P P     . DG  J 6 12  ? 193.878 144.877 133.986 1.00 191.60 ? 12   DG  I P     1 
ATOM   9453  O OP1   . DG  J 6 12  ? 195.293 145.126 133.635 1.00 191.60 ? 12   DG  I OP1   1 
ATOM   9454  O OP2   . DG  J 6 12  ? 193.340 143.503 133.909 1.00 191.60 ? 12   DG  I OP2   1 
ATOM   9455  O "O5'" . DG  J 6 12  ? 193.590 145.433 135.461 1.00 191.60 ? 12   DG  I "O5'" 1 
ATOM   9456  C "C5'" . DG  J 6 12  ? 194.112 146.701 135.866 1.00 191.60 ? 12   DG  I "C5'" 1 
ATOM   9457  C "C4'" . DG  J 6 12  ? 193.542 147.131 137.212 1.00 191.60 ? 12   DG  I "C4'" 1 
ATOM   9458  O "O4'" . DG  J 6 12  ? 192.125 147.405 137.076 1.00 191.60 ? 12   DG  I "O4'" 1 
ATOM   9459  C "C3'" . DG  J 6 12  ? 193.673 146.103 138.341 1.00 191.60 ? 12   DG  I "C3'" 1 
ATOM   9460  O "O3'" . DG  J 6 12  ? 194.087 146.746 139.537 1.00 191.60 ? 12   DG  I "O3'" 1 
ATOM   9461  C "C2'" . DG  J 6 12  ? 192.258 145.544 138.474 1.00 191.60 ? 12   DG  I "C2'" 1 
ATOM   9462  C "C1'" . DG  J 6 12  ? 191.421 146.755 138.105 1.00 191.60 ? 12   DG  I "C1'" 1 
ATOM   9463  N N9    . DG  J 6 12  ? 190.095 146.417 137.610 1.00 191.60 ? 12   DG  I N9    1 
ATOM   9464  C C8    . DG  J 6 12  ? 189.763 145.385 136.771 1.00 191.60 ? 12   DG  I C8    1 
ATOM   9465  N N7    . DG  J 6 12  ? 188.491 145.329 136.499 1.00 191.60 ? 12   DG  I N7    1 
ATOM   9466  C C5    . DG  J 6 12  ? 187.947 146.392 137.204 1.00 191.60 ? 12   DG  I C5    1 
ATOM   9467  C C6    . DG  J 6 12  ? 186.609 146.832 137.300 1.00 191.60 ? 12   DG  I C6    1 
ATOM   9468  O O6    . DG  J 6 12  ? 185.605 146.354 136.761 1.00 191.60 ? 12   DG  I O6    1 
ATOM   9469  N N1    . DG  J 6 12  ? 186.491 147.947 138.119 1.00 191.60 ? 12   DG  I N1    1 
ATOM   9470  C C2    . DG  J 6 12  ? 187.535 148.557 138.767 1.00 191.60 ? 12   DG  I C2    1 
ATOM   9471  N N2    . DG  J 6 12  ? 187.227 149.622 139.517 1.00 191.60 ? 12   DG  I N2    1 
ATOM   9472  N N3    . DG  J 6 12  ? 188.793 148.152 138.688 1.00 191.60 ? 12   DG  I N3    1 
ATOM   9473  C C4    . DG  J 6 12  ? 188.923 147.069 137.892 1.00 191.60 ? 12   DG  I C4    1 
ATOM   9474  P P     . DC  J 6 13  ? 195.044 145.979 140.575 1.00 187.51 ? 13   DC  I P     1 
ATOM   9475  O OP1   . DC  J 6 13  ? 196.436 146.378 140.273 1.00 187.51 ? 13   DC  I OP1   1 
ATOM   9476  O OP2   . DC  J 6 13  ? 194.684 144.544 140.552 1.00 187.51 ? 13   DC  I OP2   1 
ATOM   9477  O "O5'" . DC  J 6 13  ? 194.634 146.583 142.002 1.00 187.51 ? 13   DC  I "O5'" 1 
ATOM   9478  C "C5'" . DC  J 6 13  ? 193.412 147.295 142.150 1.00 187.51 ? 13   DC  I "C5'" 1 
ATOM   9479  C "C4'" . DC  J 6 13  ? 192.498 146.600 143.141 1.00 187.51 ? 13   DC  I "C4'" 1 
ATOM   9480  O "O4'" . DC  J 6 13  ? 191.176 146.467 142.562 1.00 187.51 ? 13   DC  I "O4'" 1 
ATOM   9481  C "C3'" . DC  J 6 13  ? 192.919 145.172 143.517 1.00 187.51 ? 13   DC  I "C3'" 1 
ATOM   9482  O "O3'" . DC  J 6 13  ? 192.592 144.806 144.923 1.00 187.51 ? 13   DC  I "O3'" 1 
ATOM   9483  C "C2'" . DC  J 6 13  ? 192.080 144.351 142.543 1.00 187.51 ? 13   DC  I "C2'" 1 
ATOM   9484  C "C1'" . DC  J 6 13  ? 190.786 145.121 142.680 1.00 187.51 ? 13   DC  I "C1'" 1 
ATOM   9485  N N1    . DC  J 6 13  ? 189.710 144.808 141.685 1.00 187.51 ? 13   DC  I N1    1 
ATOM   9486  C C2    . DC  J 6 13  ? 188.503 145.487 141.788 1.00 187.51 ? 13   DC  I C2    1 
ATOM   9487  O O2    . DC  J 6 13  ? 188.383 146.316 142.688 1.00 187.51 ? 13   DC  I O2    1 
ATOM   9488  N N3    . DC  J 6 13  ? 187.511 145.220 140.910 1.00 187.51 ? 13   DC  I N3    1 
ATOM   9489  C C4    . DC  J 6 13  ? 187.702 144.307 139.959 1.00 187.51 ? 13   DC  I C4    1 
ATOM   9490  N N4    . DC  J 6 13  ? 186.700 144.072 139.108 1.00 187.51 ? 13   DC  I N4    1 
ATOM   9491  C C5    . DC  J 6 13  ? 188.933 143.594 139.837 1.00 187.51 ? 13   DC  I C5    1 
ATOM   9492  C C6    . DC  J 6 13  ? 189.902 143.872 140.718 1.00 187.51 ? 13   DC  I C6    1 
ATOM   9493  P P     . DC  J 6 14  ? 192.175 145.839 146.105 1.00 174.86 ? 14   DC  I P     1 
ATOM   9494  O OP1   . DC  J 6 14  ? 193.025 147.045 146.234 1.00 174.86 ? 14   DC  I OP1   1 
ATOM   9495  O OP2   . DC  J 6 14  ? 192.122 144.977 147.301 1.00 174.86 ? 14   DC  I OP2   1 
ATOM   9496  O "O5'" . DC  J 6 14  ? 190.644 146.212 145.816 1.00 174.86 ? 14   DC  I "O5'" 1 
ATOM   9497  C "C5'" . DC  J 6 14  ? 189.968 147.147 146.663 1.00 174.86 ? 14   DC  I "C5'" 1 
ATOM   9498  C "C4'" . DC  J 6 14  ? 188.617 146.622 147.158 1.00 174.86 ? 14   DC  I "C4'" 1 
ATOM   9499  O "O4'" . DC  J 6 14  ? 188.033 145.704 146.199 1.00 174.86 ? 14   DC  I "O4'" 1 
ATOM   9500  C "C3'" . DC  J 6 14  ? 188.644 145.852 148.466 1.00 174.86 ? 14   DC  I "C3'" 1 
ATOM   9501  O "O3'" . DC  J 6 14  ? 187.373 145.936 149.071 1.00 174.86 ? 14   DC  I "O3'" 1 
ATOM   9502  C "C2'" . DC  J 6 14  ? 188.910 144.442 147.979 1.00 174.86 ? 14   DC  I "C2'" 1 
ATOM   9503  C "C1'" . DC  J 6 14  ? 188.029 144.387 146.729 1.00 174.86 ? 14   DC  I "C1'" 1 
ATOM   9504  N N1    . DC  J 6 14  ? 188.558 143.511 145.667 1.00 174.86 ? 14   DC  I N1    1 
ATOM   9505  C C2    . DC  J 6 14  ? 187.766 143.201 144.558 1.00 174.86 ? 14   DC  I C2    1 
ATOM   9506  O O2    . DC  J 6 14  ? 186.611 143.635 144.462 1.00 174.86 ? 14   DC  I O2    1 
ATOM   9507  N N3    . DC  J 6 14  ? 188.282 142.411 143.591 1.00 174.86 ? 14   DC  I N3    1 
ATOM   9508  C C4    . DC  J 6 14  ? 189.518 141.946 143.694 1.00 174.86 ? 14   DC  I C4    1 
ATOM   9509  N N4    . DC  J 6 14  ? 189.974 141.170 142.708 1.00 174.86 ? 14   DC  I N4    1 
ATOM   9510  C C5    . DC  J 6 14  ? 190.343 142.251 144.812 1.00 174.86 ? 14   DC  I C5    1 
ATOM   9511  C C6    . DC  J 6 14  ? 189.830 143.035 145.759 1.00 174.86 ? 14   DC  I C6    1 
ATOM   9512  P P     . DG  J 6 15  ? 187.218 146.000 150.666 1.00 152.33 ? 15   DG  I P     1 
ATOM   9513  O OP1   . DG  J 6 15  ? 187.397 147.412 151.065 1.00 152.33 ? 15   DG  I OP1   1 
ATOM   9514  O OP2   . DG  J 6 15  ? 188.077 144.954 151.262 1.00 152.33 ? 15   DG  I OP2   1 
ATOM   9515  O "O5'" . DG  J 6 15  ? 185.688 145.592 150.892 1.00 152.33 ? 15   DG  I "O5'" 1 
ATOM   9516  C "C5'" . DG  J 6 15  ? 184.724 145.931 149.898 1.00 152.33 ? 15   DG  I "C5'" 1 
ATOM   9517  C "C4'" . DG  J 6 15  ? 183.470 145.070 150.000 1.00 152.33 ? 15   DG  I "C4'" 1 
ATOM   9518  O "O4'" . DG  J 6 15  ? 183.569 143.915 149.131 1.00 152.33 ? 15   DG  I "O4'" 1 
ATOM   9519  C "C3'" . DG  J 6 15  ? 183.123 144.548 151.387 1.00 152.33 ? 15   DG  I "C3'" 1 
ATOM   9520  O "O3'" . DG  J 6 15  ? 181.710 144.713 151.612 1.00 152.33 ? 15   DG  I "O3'" 1 
ATOM   9521  C "C2'" . DG  J 6 15  ? 183.545 143.074 151.357 1.00 152.33 ? 15   DG  I "C2'" 1 
ATOM   9522  C "C1'" . DG  J 6 15  ? 183.817 142.749 149.881 1.00 152.33 ? 15   DG  I "C1'" 1 
ATOM   9523  N N9    . DG  J 6 15  ? 185.197 142.371 149.657 1.00 152.33 ? 15   DG  I N9    1 
ATOM   9524  C C8    . DG  J 6 15  ? 186.220 142.549 150.547 1.00 152.33 ? 15   DG  I C8    1 
ATOM   9525  N N7    . DG  J 6 15  ? 187.368 142.142 150.114 1.00 152.33 ? 15   DG  I N7    1 
ATOM   9526  C C5    . DG  J 6 15  ? 187.101 141.653 148.849 1.00 152.33 ? 15   DG  I C5    1 
ATOM   9527  C C6    . DG  J 6 15  ? 187.980 141.083 147.915 1.00 152.33 ? 15   DG  I C6    1 
ATOM   9528  O O6    . DG  J 6 15  ? 189.196 140.897 148.030 1.00 152.33 ? 15   DG  I O6    1 
ATOM   9529  N N1    . DG  J 6 15  ? 187.332 140.720 146.751 1.00 152.33 ? 15   DG  I N1    1 
ATOM   9530  C C2    . DG  J 6 15  ? 185.994 140.875 146.503 1.00 152.33 ? 15   DG  I C2    1 
ATOM   9531  N N2    . DG  J 6 15  ? 185.608 140.434 145.288 1.00 152.33 ? 15   DG  I N2    1 
ATOM   9532  N N3    . DG  J 6 15  ? 185.130 141.415 147.376 1.00 152.33 ? 15   DG  I N3    1 
ATOM   9533  C C4    . DG  J 6 15  ? 185.765 141.783 148.535 1.00 152.33 ? 15   DG  I C4    1 
ATOM   9534  P P     . DC  J 6 16  ? 180.956 144.075 152.883 1.00 136.05 ? 16   DC  I P     1 
ATOM   9535  O OP1   . DC  J 6 16  ? 179.790 144.938 153.151 1.00 136.05 ? 16   DC  I OP1   1 
ATOM   9536  O OP2   . DC  J 6 16  ? 181.898 143.826 153.992 1.00 136.05 ? 16   DC  I OP2   1 
ATOM   9537  O "O5'" . DC  J 6 16  ? 180.405 142.683 152.324 1.00 136.05 ? 16   DC  I "O5'" 1 
ATOM   9538  C "C5'" . DC  J 6 16  ? 179.903 142.593 150.978 1.00 136.05 ? 16   DC  I "C5'" 1 
ATOM   9539  C "C4'" . DC  J 6 16  ? 179.691 141.145 150.543 1.00 136.05 ? 16   DC  I "C4'" 1 
ATOM   9540  O "O4'" . DC  J 6 16  ? 180.896 140.613 149.917 1.00 136.05 ? 16   DC  I "O4'" 1 
ATOM   9541  C "C3'" . DC  J 6 16  ? 179.345 140.167 151.659 1.00 136.05 ? 16   DC  I "C3'" 1 
ATOM   9542  O "O3'" . DC  J 6 16  ? 178.455 139.189 151.161 1.00 136.05 ? 16   DC  I "O3'" 1 
ATOM   9543  C "C2'" . DC  J 6 16  ? 180.699 139.548 151.955 1.00 136.05 ? 16   DC  I "C2'" 1 
ATOM   9544  C "C1'" . DC  J 6 16  ? 181.241 139.398 150.544 1.00 136.05 ? 16   DC  I "C1'" 1 
ATOM   9545  N N1    . DC  J 6 16  ? 182.719 139.246 150.494 1.00 136.05 ? 16   DC  I N1    1 
ATOM   9546  C C2    . DC  J 6 16  ? 183.365 138.732 149.355 1.00 136.05 ? 16   DC  I C2    1 
ATOM   9547  O O2    . DC  J 6 16  ? 182.746 138.374 148.352 1.00 136.05 ? 16   DC  I O2    1 
ATOM   9548  N N3    . DC  J 6 16  ? 184.714 138.630 149.367 1.00 136.05 ? 16   DC  I N3    1 
ATOM   9549  C C4    . DC  J 6 16  ? 185.411 139.004 150.425 1.00 136.05 ? 16   DC  I C4    1 
ATOM   9550  N N4    . DC  J 6 16  ? 186.737 138.876 150.371 1.00 136.05 ? 16   DC  I N4    1 
ATOM   9551  C C5    . DC  J 6 16  ? 184.785 139.526 151.584 1.00 136.05 ? 16   DC  I C5    1 
ATOM   9552  C C6    . DC  J 6 16  ? 183.456 139.619 151.577 1.00 136.05 ? 16   DC  I C6    1 
ATOM   9553  P P     . DA  J 6 17  ? 176.870 139.310 151.396 1.00 122.44 ? 17   DA  I P     1 
ATOM   9554  O OP1   . DA  J 6 17  ? 176.476 140.730 151.288 1.00 122.44 ? 17   DA  I OP1   1 
ATOM   9555  O OP2   . DA  J 6 17  ? 176.547 138.551 152.621 1.00 122.44 ? 17   DA  I OP2   1 
ATOM   9556  O "O5'" . DA  J 6 17  ? 176.257 138.508 150.159 1.00 122.44 ? 17   DA  I "O5'" 1 
ATOM   9557  C "C5'" . DA  J 6 17  ? 177.076 138.241 149.025 1.00 122.44 ? 17   DA  I "C5'" 1 
ATOM   9558  C "C4'" . DA  J 6 17  ? 177.260 136.747 148.798 1.00 122.44 ? 17   DA  I "C4'" 1 
ATOM   9559  O "O4'" . DA  J 6 17  ? 178.671 136.408 148.832 1.00 122.44 ? 17   DA  I "O4'" 1 
ATOM   9560  C "C3'" . DA  J 6 17  ? 176.627 135.830 149.834 1.00 122.44 ? 17   DA  I "C3'" 1 
ATOM   9561  O "O3'" . DA  J 6 17  ? 176.442 134.547 149.249 1.00 122.44 ? 17   DA  I "O3'" 1 
ATOM   9562  C "C2'" . DA  J 6 17  ? 177.754 135.751 150.851 1.00 122.44 ? 17   DA  I "C2'" 1 
ATOM   9563  C "C1'" . DA  J 6 17  ? 178.884 135.488 149.883 1.00 122.44 ? 17   DA  I "C1'" 1 
ATOM   9564  N N9    . DA  J 6 17  ? 180.217 135.696 150.417 1.00 122.44 ? 17   DA  I N9    1 
ATOM   9565  C C8    . DA  J 6 17  ? 180.560 136.225 151.618 1.00 122.44 ? 17   DA  I C8    1 
ATOM   9566  N N7    . DA  J 6 17  ? 181.860 136.308 151.808 1.00 122.44 ? 17   DA  I N7    1 
ATOM   9567  C C5    . DA  J 6 17  ? 182.394 135.771 150.650 1.00 122.44 ? 17   DA  I C5    1 
ATOM   9568  C C6    . DA  J 6 17  ? 183.719 135.550 150.212 1.00 122.44 ? 17   DA  I C6    1 
ATOM   9569  N N6    . DA  J 6 17  ? 184.796 135.867 150.934 1.00 122.44 ? 17   DA  I N6    1 
ATOM   9570  N N1    . DA  J 6 17  ? 183.889 134.989 148.990 1.00 122.44 ? 17   DA  I N1    1 
ATOM   9571  C C2    . DA  J 6 17  ? 182.802 134.681 148.281 1.00 122.44 ? 17   DA  I C2    1 
ATOM   9572  N N3    . DA  J 6 17  ? 181.527 134.837 148.585 1.00 122.44 ? 17   DA  I N3    1 
ATOM   9573  C C4    . DA  J 6 17  ? 181.389 135.391 149.790 1.00 122.44 ? 17   DA  I C4    1 
ATOM   9574  P P     . DG  J 6 18  ? 175.148 134.169 148.378 1.00 110.73 ? 18   DG  I P     1 
ATOM   9575  O OP1   . DG  J 6 18  ? 174.538 135.344 147.727 1.00 110.73 ? 18   DG  I OP1   1 
ATOM   9576  O OP2   . DG  J 6 18  ? 174.326 133.323 149.260 1.00 110.73 ? 18   DG  I OP2   1 
ATOM   9577  O "O5'" . DG  J 6 18  ? 175.739 133.212 147.245 1.00 110.73 ? 18   DG  I "O5'" 1 
ATOM   9578  C "C5'" . DG  J 6 18  ? 175.651 131.804 147.398 1.00 110.73 ? 18   DG  I "C5'" 1 
ATOM   9579  C "C4'" . DG  J 6 18  ? 176.826 131.093 146.744 1.00 110.73 ? 18   DG  I "C4'" 1 
ATOM   9580  O "O4'" . DG  J 6 18  ? 178.073 131.561 147.308 1.00 110.73 ? 18   DG  I "O4'" 1 
ATOM   9581  C "C3'" . DG  J 6 18  ? 176.854 129.603 146.967 1.00 110.73 ? 18   DG  I "C3'" 1 
ATOM   9582  O "O3'" . DG  J 6 18  ? 177.626 129.003 145.978 1.00 110.73 ? 18   DG  I "O3'" 1 
ATOM   9583  C "C2'" . DG  J 6 18  ? 177.530 129.503 148.328 1.00 110.73 ? 18   DG  I "C2'" 1 
ATOM   9584  C "C1'" . DG  J 6 18  ? 178.535 130.651 148.294 1.00 110.73 ? 18   DG  I "C1'" 1 
ATOM   9585  N N9    . DG  J 6 18  ? 178.585 131.383 149.545 1.00 110.73 ? 18   DG  I N9    1 
ATOM   9586  C C8    . DG  J 6 18  ? 177.498 131.804 150.261 1.00 110.73 ? 18   DG  I C8    1 
ATOM   9587  N N7    . DG  J 6 18  ? 177.798 132.442 151.340 1.00 110.73 ? 18   DG  I N7    1 
ATOM   9588  C C5    . DG  J 6 18  ? 179.178 132.464 151.351 1.00 110.73 ? 18   DG  I C5    1 
ATOM   9589  C C6    . DG  J 6 18  ? 180.043 133.047 152.282 1.00 110.73 ? 18   DG  I C6    1 
ATOM   9590  O O6    . DG  J 6 18  ? 179.756 133.661 153.315 1.00 110.73 ? 18   DG  I O6    1 
ATOM   9591  N N1    . DG  J 6 18  ? 181.358 132.870 151.937 1.00 110.73 ? 18   DG  I N1    1 
ATOM   9592  C C2    . DG  J 6 18  ? 181.811 132.217 150.828 1.00 110.73 ? 18   DG  I C2    1 
ATOM   9593  N N2    . DG  J 6 18  ? 183.151 132.193 150.743 1.00 110.73 ? 18   DG  I N2    1 
ATOM   9594  N N3    . DG  J 6 18  ? 181.014 131.654 149.914 1.00 110.73 ? 18   DG  I N3    1 
ATOM   9595  C C4    . DG  J 6 18  ? 179.696 131.826 150.246 1.00 110.73 ? 18   DG  I C4    1 
ATOM   9596  P P     . DT  J 6 19  ? 177.415 127.458 145.608 1.00 121.04 ? 19   DT  I P     1 
ATOM   9597  O OP1   . DT  J 6 19  ? 176.639 127.414 144.364 1.00 121.04 ? 19   DT  I OP1   1 
ATOM   9598  O OP2   . DT  J 6 19  ? 176.893 126.725 146.775 1.00 121.04 ? 19   DT  I OP2   1 
ATOM   9599  O "O5'" . DT  J 6 19  ? 178.899 126.961 145.326 1.00 121.04 ? 19   DT  I "O5'" 1 
ATOM   9600  C "C5'" . DT  J 6 19  ? 179.982 127.598 145.991 1.00 121.04 ? 19   DT  I "C5'" 1 
ATOM   9601  C "C4'" . DT  J 6 19  ? 180.842 126.572 146.683 1.00 121.04 ? 19   DT  I "C4'" 1 
ATOM   9602  O "O4'" . DT  J 6 19  ? 181.453 127.157 147.866 1.00 121.04 ? 19   DT  I "O4'" 1 
ATOM   9603  C "C3'" . DT  J 6 19  ? 180.068 125.383 147.214 1.00 121.04 ? 19   DT  I "C3'" 1 
ATOM   9604  O "O3'" . DT  J 6 19  ? 180.969 124.321 147.457 1.00 121.04 ? 19   DT  I "O3'" 1 
ATOM   9605  C "C2'" . DT  J 6 19  ? 179.593 125.966 148.524 1.00 121.04 ? 19   DT  I "C2'" 1 
ATOM   9606  C "C1'" . DT  J 6 19  ? 180.931 126.497 148.997 1.00 121.04 ? 19   DT  I "C1'" 1 
ATOM   9607  N N1    . DT  J 6 19  ? 180.885 127.445 150.139 1.00 121.04 ? 19   DT  I N1    1 
ATOM   9608  C C2    . DT  J 6 19  ? 182.067 127.877 150.677 1.00 121.04 ? 19   DT  I C2    1 
ATOM   9609  O O2    . DT  J 6 19  ? 183.149 127.517 150.258 1.00 121.04 ? 19   DT  I O2    1 
ATOM   9610  N N3    . DT  J 6 19  ? 181.943 128.749 151.728 1.00 121.04 ? 19   DT  I N3    1 
ATOM   9611  C C4    . DT  J 6 19  ? 180.770 129.218 152.276 1.00 121.04 ? 19   DT  I C4    1 
ATOM   9612  O O4    . DT  J 6 19  ? 180.752 129.999 153.219 1.00 121.04 ? 19   DT  I O4    1 
ATOM   9613  C C5    . DT  J 6 19  ? 179.565 128.722 151.663 1.00 121.04 ? 19   DT  I C5    1 
ATOM   9614  C C7    . DT  J 6 19  ? 178.236 129.150 152.181 1.00 121.04 ? 19   DT  I C7    1 
ATOM   9615  C C6    . DT  J 6 19  ? 179.679 127.873 150.633 1.00 121.04 ? 19   DT  I C6    1 
ATOM   9616  P P     . DC  J 6 20  ? 181.358 123.256 146.316 1.00 140.76 ? 20   DC  I P     1 
ATOM   9617  O OP1   . DC  J 6 20  ? 181.872 123.934 145.105 1.00 140.76 ? 20   DC  I OP1   1 
ATOM   9618  O OP2   . DC  J 6 20  ? 180.230 122.308 146.207 1.00 140.76 ? 20   DC  I OP2   1 
ATOM   9619  O "O5'" . DC  J 6 20  ? 182.595 122.490 146.968 1.00 140.76 ? 20   DC  I "O5'" 1 
ATOM   9620  C "C5'" . DC  J 6 20  ? 183.725 123.238 147.414 1.00 140.76 ? 20   DC  I "C5'" 1 
ATOM   9621  C "C4'" . DC  J 6 20  ? 184.240 122.709 148.740 1.00 140.76 ? 20   DC  I "C4'" 1 
ATOM   9622  O "O4'" . DC  J 6 20  ? 183.795 123.569 149.819 1.00 140.76 ? 20   DC  I "O4'" 1 
ATOM   9623  C "C3'" . DC  J 6 20  ? 183.779 121.299 149.081 1.00 140.76 ? 20   DC  I "C3'" 1 
ATOM   9624  O "O3'" . DC  J 6 20  ? 184.869 120.529 149.535 1.00 140.76 ? 20   DC  I "O3'" 1 
ATOM   9625  C "C2'" . DC  J 6 20  ? 182.741 121.506 150.172 1.00 140.76 ? 20   DC  I "C2'" 1 
ATOM   9626  C "C1'" . DC  J 6 20  ? 183.195 122.804 150.833 1.00 140.76 ? 20   DC  I "C1'" 1 
ATOM   9627  N N1    . DC  J 6 20  ? 182.058 123.592 151.389 1.00 140.76 ? 20   DC  I N1    1 
ATOM   9628  C C2    . DC  J 6 20  ? 182.259 124.594 152.364 1.00 140.76 ? 20   DC  I C2    1 
ATOM   9629  O O2    . DC  J 6 20  ? 183.387 124.855 152.812 1.00 140.76 ? 20   DC  I O2    1 
ATOM   9630  N N3    . DC  J 6 20  ? 181.182 125.280 152.815 1.00 140.76 ? 20   DC  I N3    1 
ATOM   9631  C C4    . DC  J 6 20  ? 179.971 125.013 152.350 1.00 140.76 ? 20   DC  I C4    1 
ATOM   9632  N N4    . DC  J 6 20  ? 178.948 125.720 152.836 1.00 140.76 ? 20   DC  I N4    1 
ATOM   9633  C C5    . DC  J 6 20  ? 179.747 124.010 151.377 1.00 140.76 ? 20   DC  I C5    1 
ATOM   9634  C C6    . DC  J 6 20  ? 180.802 123.338 150.926 1.00 140.76 ? 20   DC  I C6    1 
ATOM   9635  P P     . DG  J 6 21  ? 185.493 119.401 148.579 1.00 158.58 ? 21   DG  I P     1 
ATOM   9636  O OP1   . DG  J 6 21  ? 186.508 120.046 147.718 1.00 158.58 ? 21   DG  I OP1   1 
ATOM   9637  O OP2   . DG  J 6 21  ? 184.367 118.660 147.972 1.00 158.58 ? 21   DG  I OP2   1 
ATOM   9638  O "O5'" . DG  J 6 21  ? 186.234 118.416 149.587 1.00 158.58 ? 21   DG  I "O5'" 1 
ATOM   9639  C "C5'" . DG  J 6 21  ? 185.610 118.054 150.799 1.00 158.58 ? 21   DG  I "C5'" 1 
ATOM   9640  C "C4'" . DG  J 6 21  ? 186.458 118.479 151.975 1.00 158.58 ? 21   DG  I "C4'" 1 
ATOM   9641  O "O4'" . DG  J 6 21  ? 186.018 119.786 152.442 1.00 158.58 ? 21   DG  I "O4'" 1 
ATOM   9642  C "C3'" . DG  J 6 21  ? 186.368 117.563 153.191 1.00 158.58 ? 21   DG  I "C3'" 1 
ATOM   9643  O "O3'" . DG  J 6 21  ? 187.630 117.594 153.906 1.00 158.58 ? 21   DG  I "O3'" 1 
ATOM   9644  C "C2'" . DG  J 6 21  ? 185.240 118.221 153.956 1.00 158.58 ? 21   DG  I "C2'" 1 
ATOM   9645  C "C1'" . DG  J 6 21  ? 185.623 119.672 153.791 1.00 158.58 ? 21   DG  I "C1'" 1 
ATOM   9646  N N9    . DG  J 6 21  ? 184.543 120.611 154.062 1.00 158.58 ? 21   DG  I N9    1 
ATOM   9647  C C8    . DG  J 6 21  ? 183.329 120.665 153.450 1.00 158.58 ? 21   DG  I C8    1 
ATOM   9648  N N7    . DG  J 6 21  ? 182.561 121.626 153.890 1.00 158.58 ? 21   DG  I N7    1 
ATOM   9649  C C5    . DG  J 6 21  ? 183.323 122.242 154.866 1.00 158.58 ? 21   DG  I C5    1 
ATOM   9650  C C6    . DG  J 6 21  ? 183.014 123.335 155.710 1.00 158.58 ? 21   DG  I C6    1 
ATOM   9651  O O6    . DG  J 6 21  ? 181.974 124.009 155.750 1.00 158.58 ? 21   DG  I O6    1 
ATOM   9652  N N1    . DG  J 6 21  ? 184.064 123.630 156.572 1.00 158.58 ? 21   DG  I N1    1 
ATOM   9653  C C2    . DG  J 6 21  ? 185.259 122.949 156.614 1.00 158.58 ? 21   DG  I C2    1 
ATOM   9654  N N2    . DG  J 6 21  ? 186.162 123.370 157.508 1.00 158.58 ? 21   DG  I N2    1 
ATOM   9655  N N3    . DG  J 6 21  ? 185.553 121.919 155.833 1.00 158.58 ? 21   DG  I N3    1 
ATOM   9656  C C4    . DG  J 6 21  ? 184.542 121.621 154.991 1.00 158.58 ? 21   DG  I C4    1 
ATOM   9657  P P     . DG  J 6 22  ? 187.773 117.190 155.462 1.00 159.53 ? 22   DG  I P     1 
ATOM   9658  O OP1   . DG  J 6 22  ? 189.199 116.886 155.679 1.00 159.53 ? 22   DG  I OP1   1 
ATOM   9659  O OP2   . DG  J 6 22  ? 186.783 116.157 155.842 1.00 159.53 ? 22   DG  I OP2   1 
ATOM   9660  O "O5'" . DG  J 6 22  ? 187.484 118.563 156.223 1.00 159.53 ? 22   DG  I "O5'" 1 
ATOM   9661  C "C5'" . DG  J 6 22  ? 187.897 118.755 157.546 1.00 159.53 ? 22   DG  I "C5'" 1 
ATOM   9662  C "C4'" . DG  J 6 22  ? 186.698 118.777 158.468 1.00 159.53 ? 22   DG  I "C4'" 1 
ATOM   9663  O "O4'" . DG  J 6 22  ? 185.590 119.460 157.835 1.00 159.53 ? 22   DG  I "O4'" 1 
ATOM   9664  C "C3'" . DG  J 6 22  ? 186.175 117.393 158.853 1.00 159.53 ? 22   DG  I "C3'" 1 
ATOM   9665  O "O3'" . DG  J 6 22  ? 186.245 117.240 160.245 1.00 159.53 ? 22   DG  I "O3'" 1 
ATOM   9666  C "C2'" . DG  J 6 22  ? 184.725 117.391 158.352 1.00 159.53 ? 22   DG  I "C2'" 1 
ATOM   9667  C "C1'" . DG  J 6 22  ? 184.417 118.875 158.316 1.00 159.53 ? 22   DG  I "C1'" 1 
ATOM   9668  N N9    . DG  J 6 22  ? 183.296 119.237 157.452 1.00 159.53 ? 22   DG  I N9    1 
ATOM   9669  C C8    . DG  J 6 22  ? 182.861 118.579 156.339 1.00 159.53 ? 22   DG  I C8    1 
ATOM   9670  N N7    . DG  J 6 22  ? 181.833 119.133 155.771 1.00 159.53 ? 22   DG  I N7    1 
ATOM   9671  C C5    . DG  J 6 22  ? 181.554 120.225 156.570 1.00 159.53 ? 22   DG  I C5    1 
ATOM   9672  C C6    . DG  J 6 22  ? 180.549 121.216 156.447 1.00 159.53 ? 22   DG  I C6    1 
ATOM   9673  O O6    . DG  J 6 22  ? 179.666 121.310 155.587 1.00 159.53 ? 22   DG  I O6    1 
ATOM   9674  N N1    . DG  J 6 22  ? 180.627 122.157 157.473 1.00 159.53 ? 22   DG  I N1    1 
ATOM   9675  C C2    . DG  J 6 22  ? 181.566 122.146 158.478 1.00 159.53 ? 22   DG  I C2    1 
ATOM   9676  N N2    . DG  J 6 22  ? 181.491 123.132 159.378 1.00 159.53 ? 22   DG  I N2    1 
ATOM   9677  N N3    . DG  J 6 22  ? 182.513 121.230 158.595 1.00 159.53 ? 22   DG  I N3    1 
ATOM   9678  C C4    . DG  J 6 22  ? 182.453 120.311 157.604 1.00 159.53 ? 22   DG  I C4    1 
ATOM   9679  P P     . DC  J 6 23  ? 187.550 116.595 160.929 1.00 153.80 ? 23   DC  I P     1 
ATOM   9680  O OP1   . DC  J 6 23  ? 188.732 117.444 160.669 1.00 153.80 ? 23   DC  I OP1   1 
ATOM   9681  O OP2   . DC  J 6 23  ? 187.568 115.163 160.569 1.00 153.80 ? 23   DC  I OP2   1 
ATOM   9682  O "O5'" . DC  J 6 23  ? 187.223 116.697 162.486 1.00 153.80 ? 23   DC  I "O5'" 1 
ATOM   9683  C "C5'" . DC  J 6 23  ? 186.520 117.830 162.980 1.00 153.80 ? 23   DC  I "C5'" 1 
ATOM   9684  C "C4'" . DC  J 6 23  ? 185.098 117.460 163.360 1.00 153.80 ? 23   DC  I "C4'" 1 
ATOM   9685  O "O4'" . DC  J 6 23  ? 184.159 118.268 162.623 1.00 153.80 ? 23   DC  I "O4'" 1 
ATOM   9686  C "C3'" . DC  J 6 23  ? 184.692 116.015 163.044 1.00 153.80 ? 23   DC  I "C3'" 1 
ATOM   9687  O "O3'" . DC  J 6 23  ? 184.798 115.103 164.199 1.00 153.80 ? 23   DC  I "O3'" 1 
ATOM   9688  C "C2'" . DC  J 6 23  ? 183.265 116.121 162.482 1.00 153.80 ? 23   DC  I "C2'" 1 
ATOM   9689  C "C1'" . DC  J 6 23  ? 182.932 117.601 162.672 1.00 153.80 ? 23   DC  I "C1'" 1 
ATOM   9690  N N1    . DC  J 6 23  ? 182.003 118.154 161.645 1.00 153.80 ? 23   DC  I N1    1 
ATOM   9691  C C2    . DC  J 6 23  ? 181.263 119.308 161.929 1.00 153.80 ? 23   DC  I C2    1 
ATOM   9692  O O2    . DC  J 6 23  ? 181.404 119.856 163.027 1.00 153.80 ? 23   DC  I O2    1 
ATOM   9693  N N3    . DC  J 6 23  ? 180.416 119.791 160.988 1.00 153.80 ? 23   DC  I N3    1 
ATOM   9694  C C4    . DC  J 6 23  ? 180.296 119.164 159.821 1.00 153.80 ? 23   DC  I C4    1 
ATOM   9695  N N4    . DC  J 6 23  ? 179.451 119.670 158.925 1.00 153.80 ? 23   DC  I N4    1 
ATOM   9696  C C5    . DC  J 6 23  ? 181.043 117.990 159.516 1.00 153.80 ? 23   DC  I C5    1 
ATOM   9697  C C6    . DC  J 6 23  ? 181.867 117.523 160.450 1.00 153.80 ? 23   DC  I C6    1 
ATOM   9698  P P     . DC  J 6 24  ? 184.498 115.519 165.732 1.00 147.10 ? 24   DC  I P     1 
ATOM   9699  O OP1   . DC  J 6 24  ? 185.629 116.278 166.312 1.00 147.10 ? 24   DC  I OP1   1 
ATOM   9700  O OP2   . DC  J 6 24  ? 184.103 114.260 166.395 1.00 147.10 ? 24   DC  I OP2   1 
ATOM   9701  O "O5'" . DC  J 6 24  ? 183.165 116.388 165.687 1.00 147.10 ? 24   DC  I "O5'" 1 
ATOM   9702  C "C5'" . DC  J 6 24  ? 182.545 116.797 166.873 1.00 147.10 ? 24   DC  I "C5'" 1 
ATOM   9703  C "C4'" . DC  J 6 24  ? 181.043 116.656 166.760 1.00 147.10 ? 24   DC  I "C4'" 1 
ATOM   9704  O "O4'" . DC  J 6 24  ? 180.610 116.998 165.411 1.00 147.10 ? 24   DC  I "O4'" 1 
ATOM   9705  C "C3'" . DC  J 6 24  ? 180.497 115.233 167.003 1.00 147.10 ? 24   DC  I "C3'" 1 
ATOM   9706  O "O3'" . DC  J 6 24  ? 179.199 115.325 167.572 1.00 147.10 ? 24   DC  I "O3'" 1 
ATOM   9707  C "C2'" . DC  J 6 24  ? 180.359 114.733 165.573 1.00 147.10 ? 24   DC  I "C2'" 1 
ATOM   9708  C "C1'" . DC  J 6 24  ? 179.724 115.987 165.034 1.00 147.10 ? 24   DC  I "C1'" 1 
ATOM   9709  N N1    . DC  J 6 24  ? 179.408 116.028 163.591 1.00 147.10 ? 24   DC  I N1    1 
ATOM   9710  C C2    . DC  J 6 24  ? 178.566 117.030 163.152 1.00 147.10 ? 24   DC  I C2    1 
ATOM   9711  O O2    . DC  J 6 24  ? 178.160 117.831 163.989 1.00 147.10 ? 24   DC  I O2    1 
ATOM   9712  N N3    . DC  J 6 24  ? 178.230 117.099 161.848 1.00 147.10 ? 24   DC  I N3    1 
ATOM   9713  C C4    . DC  J 6 24  ? 178.709 116.188 161.003 1.00 147.10 ? 24   DC  I C4    1 
ATOM   9714  N N4    . DC  J 6 24  ? 178.358 116.284 159.718 1.00 147.10 ? 24   DC  I N4    1 
ATOM   9715  C C5    . DC  J 6 24  ? 179.575 115.139 161.436 1.00 147.10 ? 24   DC  I C5    1 
ATOM   9716  C C6    . DC  J 6 24  ? 179.895 115.097 162.733 1.00 147.10 ? 24   DC  I C6    1 
ATOM   9717  P P     . DG  J 6 25  ? 178.931 115.447 169.152 1.00 134.62 ? 25   DG  I P     1 
ATOM   9718  O OP1   . DG  J 6 25  ? 179.900 116.360 169.790 1.00 134.62 ? 25   DG  I OP1   1 
ATOM   9719  O OP2   . DG  J 6 25  ? 178.774 114.079 169.683 1.00 134.62 ? 25   DG  I OP2   1 
ATOM   9720  O "O5'" . DG  J 6 25  ? 177.494 116.137 169.179 1.00 134.62 ? 25   DG  I "O5'" 1 
ATOM   9721  C "C5'" . DG  J 6 25  ? 177.074 116.865 168.033 1.00 134.62 ? 25   DG  I "C5'" 1 
ATOM   9722  C "C4'" . DG  J 6 25  ? 175.576 117.117 168.034 1.00 134.62 ? 25   DG  I "C4'" 1 
ATOM   9723  O "O4'" . DG  J 6 25  ? 175.047 116.882 166.714 1.00 134.62 ? 25   DG  I "O4'" 1 
ATOM   9724  C "C3'" . DG  J 6 25  ? 174.752 116.245 168.965 1.00 134.62 ? 25   DG  I "C3'" 1 
ATOM   9725  O "O3'" . DG  J 6 25  ? 173.666 117.000 169.464 1.00 134.62 ? 25   DG  I "O3'" 1 
ATOM   9726  C "C2'" . DG  J 6 25  ? 174.266 115.096 168.076 1.00 134.62 ? 25   DG  I "C2'" 1 
ATOM   9727  C "C1'" . DG  J 6 25  ? 174.504 115.584 166.642 1.00 134.62 ? 25   DG  I "C1'" 1 
ATOM   9728  N N9    . DG  J 6 25  ? 175.436 114.733 165.919 1.00 134.62 ? 25   DG  I N9    1 
ATOM   9729  C C8    . DG  J 6 25  ? 176.269 113.799 166.476 1.00 134.62 ? 25   DG  I C8    1 
ATOM   9730  N N7    . DG  J 6 25  ? 176.999 113.173 165.613 1.00 134.62 ? 25   DG  I N7    1 
ATOM   9731  C C5    . DG  J 6 25  ? 176.631 113.719 164.398 1.00 134.62 ? 25   DG  I C5    1 
ATOM   9732  C C6    . DG  J 6 25  ? 177.096 113.421 163.108 1.00 134.62 ? 25   DG  I C6    1 
ATOM   9733  O O6    . DG  J 6 25  ? 177.950 112.592 162.773 1.00 134.62 ? 25   DG  I O6    1 
ATOM   9734  N N1    . DG  J 6 25  ? 176.474 114.193 162.147 1.00 134.62 ? 25   DG  I N1    1 
ATOM   9735  C C2    . DG  J 6 25  ? 175.517 115.141 162.384 1.00 134.62 ? 25   DG  I C2    1 
ATOM   9736  N N2    . DG  J 6 25  ? 175.064 115.756 161.274 1.00 134.62 ? 25   DG  I N2    1 
ATOM   9737  N N3    . DG  J 6 25  ? 175.057 115.442 163.598 1.00 134.62 ? 25   DG  I N3    1 
ATOM   9738  C C4    . DG  J 6 25  ? 175.665 114.686 164.560 1.00 134.62 ? 25   DG  I C4    1 
ATOM   9739  P P     . DA  J 6 26  ? 172.662 116.384 170.555 1.00 118.57 ? 26   DA  I P     1 
ATOM   9740  O OP1   . DA  J 6 26  ? 172.174 117.511 171.378 1.00 118.57 ? 26   DA  I OP1   1 
ATOM   9741  O OP2   . DA  J 6 26  ? 173.329 115.236 171.206 1.00 118.57 ? 26   DA  I OP2   1 
ATOM   9742  O "O5'" . DA  J 6 26  ? 171.447 115.824 169.682 1.00 118.57 ? 26   DA  I "O5'" 1 
ATOM   9743  C "C5'" . DA  J 6 26  ? 170.833 116.658 168.701 1.00 118.57 ? 26   DA  I "C5'" 1 
ATOM   9744  C "C4'" . DA  J 6 26  ? 169.948 115.859 167.749 1.00 118.57 ? 26   DA  I "C4'" 1 
ATOM   9745  O "O4'" . DA  J 6 26  ? 170.729 115.366 166.623 1.00 118.57 ? 26   DA  I "O4'" 1 
ATOM   9746  C "C3'" . DA  J 6 26  ? 169.270 114.623 168.341 1.00 118.57 ? 26   DA  I "C3'" 1 
ATOM   9747  O "O3'" . DA  J 6 26  ? 167.999 114.470 167.746 1.00 118.57 ? 26   DA  I "O3'" 1 
ATOM   9748  C "C2'" . DA  J 6 26  ? 170.196 113.511 167.869 1.00 118.57 ? 26   DA  I "C2'" 1 
ATOM   9749  C "C1'" . DA  J 6 26  ? 170.443 114.000 166.462 1.00 118.57 ? 26   DA  I "C1'" 1 
ATOM   9750  N N9    . DA  J 6 26  ? 171.552 113.360 165.775 1.00 118.57 ? 26   DA  I N9    1 
ATOM   9751  C C8    . DA  J 6 26  ? 172.550 112.614 166.323 1.00 118.57 ? 26   DA  I C8    1 
ATOM   9752  N N7    . DA  J 6 26  ? 173.425 112.177 165.445 1.00 118.57 ? 26   DA  I N7    1 
ATOM   9753  C C5    . DA  J 6 26  ? 172.959 112.669 164.241 1.00 118.57 ? 26   DA  I C5    1 
ATOM   9754  C C6    . DA  J 6 26  ? 173.437 112.571 162.916 1.00 118.57 ? 26   DA  I C6    1 
ATOM   9755  N N6    . DA  J 6 26  ? 174.513 111.873 162.574 1.00 118.57 ? 26   DA  I N6    1 
ATOM   9756  N N1    . DA  J 6 26  ? 172.720 113.165 161.943 1.00 118.57 ? 26   DA  I N1    1 
ATOM   9757  C C2    . DA  J 6 26  ? 171.624 113.848 162.282 1.00 118.57 ? 26   DA  I C2    1 
ATOM   9758  N N3    . DA  J 6 26  ? 171.080 114.013 163.485 1.00 118.57 ? 26   DA  I N3    1 
ATOM   9759  C C4    . DA  J 6 26  ? 171.793 113.378 164.426 1.00 118.57 ? 26   DA  I C4    1 
ATOM   9760  P P     . DC  J 6 27  ? 166.664 114.933 168.503 1.00 111.87 ? 27   DC  I P     1 
ATOM   9761  O OP1   . DC  J 6 27  ? 166.922 116.266 169.084 1.00 111.87 ? 27   DC  I OP1   1 
ATOM   9762  O OP2   . DC  J 6 27  ? 166.215 113.822 169.364 1.00 111.87 ? 27   DC  I OP2   1 
ATOM   9763  O "O5'" . DC  J 6 27  ? 165.619 115.092 167.310 1.00 111.87 ? 27   DC  I "O5'" 1 
ATOM   9764  C "C5'" . DC  J 6 27  ? 166.112 115.235 165.982 1.00 111.87 ? 27   DC  I "C5'" 1 
ATOM   9765  C "C4'" . DC  J 6 27  ? 165.394 114.329 164.989 1.00 111.87 ? 27   DC  I "C4'" 1 
ATOM   9766  O "O4'" . DC  J 6 27  ? 166.365 113.531 164.275 1.00 111.87 ? 27   DC  I "O4'" 1 
ATOM   9767  C "C3'" . DC  J 6 27  ? 164.435 113.308 165.571 1.00 111.87 ? 27   DC  I "C3'" 1 
ATOM   9768  O "O3'" . DC  J 6 27  ? 163.563 112.825 164.525 1.00 111.87 ? 27   DC  I "O3'" 1 
ATOM   9769  C "C2'" . DC  J 6 27  ? 165.424 112.207 165.950 1.00 111.87 ? 27   DC  I "C2'" 1 
ATOM   9770  C "C1'" . DC  J 6 27  ? 166.229 112.174 164.663 1.00 111.87 ? 27   DC  I "C1'" 1 
ATOM   9771  N N1    . DC  J 6 27  ? 167.592 111.585 164.746 1.00 111.87 ? 27   DC  I N1    1 
ATOM   9772  C C2    . DC  J 6 27  ? 168.296 111.439 163.563 1.00 111.87 ? 27   DC  I C2    1 
ATOM   9773  O O2    . DC  J 6 27  ? 167.738 111.794 162.529 1.00 111.87 ? 27   DC  I O2    1 
ATOM   9774  N N3    . DC  J 6 27  ? 169.547 110.923 163.581 1.00 111.87 ? 27   DC  I N3    1 
ATOM   9775  C C4    . DC  J 6 27  ? 170.083 110.563 164.748 1.00 111.87 ? 27   DC  I C4    1 
ATOM   9776  N N4    . DC  J 6 27  ? 171.317 110.053 164.739 1.00 111.87 ? 27   DC  I N4    1 
ATOM   9777  C C5    . DC  J 6 27  ? 169.370 110.696 165.977 1.00 111.87 ? 27   DC  I C5    1 
ATOM   9778  C C6    . DC  J 6 27  ? 168.138 111.218 165.932 1.00 111.87 ? 27   DC  I C6    1 
ATOM   9779  P P     . DC  J 6 28  ? 162.336 113.678 163.914 1.00 103.94 ? 28   DC  I P     1 
ATOM   9780  O OP1   . DC  J 6 28  ? 162.371 115.111 164.262 1.00 103.94 ? 28   DC  I OP1   1 
ATOM   9781  O OP2   . DC  J 6 28  ? 161.125 112.898 164.225 1.00 103.94 ? 28   DC  I OP2   1 
ATOM   9782  O "O5'" . DC  J 6 28  ? 162.546 113.534 162.339 1.00 103.94 ? 28   DC  I "O5'" 1 
ATOM   9783  C "C5'" . DC  J 6 28  ? 163.786 113.017 161.850 1.00 103.94 ? 28   DC  I "C5'" 1 
ATOM   9784  C "C4'" . DC  J 6 28  ? 163.583 111.958 160.777 1.00 103.94 ? 28   DC  I "C4'" 1 
ATOM   9785  O "O4'" . DC  J 6 28  ? 164.544 110.899 160.964 1.00 103.94 ? 28   DC  I "O4'" 1 
ATOM   9786  C "C3'" . DC  J 6 28  ? 162.281 111.217 160.828 1.00 103.94 ? 28   DC  I "C3'" 1 
ATOM   9787  O "O3'" . DC  J 6 28  ? 162.198 110.422 159.654 1.00 103.94 ? 28   DC  I "O3'" 1 
ATOM   9788  C "C2'" . DC  J 6 28  ? 162.560 110.326 162.028 1.00 103.94 ? 28   DC  I "C2'" 1 
ATOM   9789  C "C1'" . DC  J 6 28  ? 163.902 109.779 161.580 1.00 103.94 ? 28   DC  I "C1'" 1 
ATOM   9790  N N1    . DC  J 6 28  ? 164.801 109.276 162.674 1.00 103.94 ? 28   DC  I N1    1 
ATOM   9791  C C2    . DC  J 6 28  ? 166.079 108.848 162.331 1.00 103.94 ? 28   DC  I C2    1 
ATOM   9792  O O2    . DC  J 6 28  ? 166.394 108.892 161.149 1.00 103.94 ? 28   DC  I O2    1 
ATOM   9793  N N3    . DC  J 6 28  ? 166.919 108.402 163.288 1.00 103.94 ? 28   DC  I N3    1 
ATOM   9794  C C4    . DC  J 6 28  ? 166.513 108.376 164.552 1.00 103.94 ? 28   DC  I C4    1 
ATOM   9795  N N4    . DC  J 6 28  ? 167.372 107.927 165.469 1.00 103.94 ? 28   DC  I N4    1 
ATOM   9796  C C5    . DC  J 6 28  ? 165.202 108.803 164.933 1.00 103.94 ? 28   DC  I C5    1 
ATOM   9797  C C6    . DC  J 6 28  ? 164.385 109.245 163.967 1.00 103.94 ? 28   DC  I C6    1 
ATOM   9798  P P     . DT  J 6 29  ? 161.555 110.974 158.290 1.00 89.16  ? 29   DT  I P     1 
ATOM   9799  O OP1   . DT  J 6 29  ? 161.699 112.433 158.171 1.00 89.16  ? 29   DT  I OP1   1 
ATOM   9800  O OP2   . DT  J 6 29  ? 160.231 110.343 158.188 1.00 89.16  ? 29   DT  I OP2   1 
ATOM   9801  O "O5'" . DT  J 6 29  ? 162.428 110.283 157.153 1.00 89.16  ? 29   DT  I "O5'" 1 
ATOM   9802  C "C5'" . DT  J 6 29  ? 161.909 109.161 156.472 1.00 89.16  ? 29   DT  I "C5'" 1 
ATOM   9803  C "C4'" . DT  J 6 29  ? 163.013 108.319 155.869 1.00 89.16  ? 29   DT  I "C4'" 1 
ATOM   9804  O "O4'" . DT  J 6 29  ? 163.902 107.879 156.921 1.00 89.16  ? 29   DT  I "O4'" 1 
ATOM   9805  C "C3'" . DT  J 6 29  ? 162.537 107.026 155.262 1.00 89.16  ? 29   DT  I "C3'" 1 
ATOM   9806  O "O3'" . DT  J 6 29  ? 163.584 106.458 154.501 1.00 89.16  ? 29   DT  I "O3'" 1 
ATOM   9807  C "C2'" . DT  J 6 29  ? 162.305 106.231 156.525 1.00 89.16  ? 29   DT  I "C2'" 1 
ATOM   9808  C "C1'" . DT  J 6 29  ? 163.606 106.528 157.237 1.00 89.16  ? 29   DT  I "C1'" 1 
ATOM   9809  N N1    . DT  J 6 29  ? 163.563 106.415 158.707 1.00 89.16  ? 29   DT  I N1    1 
ATOM   9810  C C2    . DT  J 6 29  ? 164.677 105.969 159.348 1.00 89.16  ? 29   DT  I C2    1 
ATOM   9811  O O2    . DT  J 6 29  ? 165.683 105.648 158.754 1.00 89.16  ? 29   DT  I O2    1 
ATOM   9812  N N3    . DT  J 6 29  ? 164.580 105.903 160.710 1.00 89.16  ? 29   DT  I N3    1 
ATOM   9813  C C4    . DT  J 6 29  ? 163.488 106.246 161.471 1.00 89.16  ? 29   DT  I C4    1 
ATOM   9814  O O4    . DT  J 6 29  ? 163.486 106.159 162.691 1.00 89.16  ? 29   DT  I O4    1 
ATOM   9815  C C5    . DT  J 6 29  ? 162.344 106.714 160.733 1.00 89.16  ? 29   DT  I C5    1 
ATOM   9816  C C7    . DT  J 6 29  ? 161.097 107.108 161.457 1.00 89.16  ? 29   DT  I C7    1 
ATOM   9817  C C6    . DT  J 6 29  ? 162.437 106.783 159.397 1.00 89.16  ? 29   DT  I C6    1 
ATOM   9818  P P     . DG  J 6 30  ? 163.260 105.320 153.423 1.00 86.13  ? 30   DG  I P     1 
ATOM   9819  O OP1   . DG  J 6 30  ? 164.062 105.595 152.218 1.00 86.13  ? 30   DG  I OP1   1 
ATOM   9820  O OP2   . DG  J 6 30  ? 161.794 105.278 153.314 1.00 86.13  ? 30   DG  I OP2   1 
ATOM   9821  O "O5'" . DG  J 6 30  ? 163.773 103.959 154.107 1.00 86.13  ? 30   DG  I "O5'" 1 
ATOM   9822  C "C5'" . DG  J 6 30  ? 165.142 103.575 153.971 1.00 86.13  ? 30   DG  I "C5'" 1 
ATOM   9823  C "C4'" . DG  J 6 30  ? 165.436 102.223 154.618 1.00 86.13  ? 30   DG  I "C4'" 1 
ATOM   9824  O "O4'" . DG  J 6 30  ? 165.305 102.314 156.049 1.00 86.13  ? 30   DG  I "O4'" 1 
ATOM   9825  C "C3'" . DG  J 6 30  ? 164.587 101.060 154.144 1.00 86.13  ? 30   DG  I "C3'" 1 
ATOM   9826  O "O3'" . DG  J 6 30  ? 165.419 100.101 153.531 1.00 86.13  ? 30   DG  I "O3'" 1 
ATOM   9827  C "C2'" . DG  J 6 30  ? 163.940 100.484 155.400 1.00 86.13  ? 30   DG  I "C2'" 1 
ATOM   9828  C "C1'" . DG  J 6 30  ? 164.406 101.363 156.549 1.00 86.13  ? 30   DG  I "C1'" 1 
ATOM   9829  N N9    . DG  J 6 30  ? 163.316 102.082 157.129 1.00 86.13  ? 30   DG  I N9    1 
ATOM   9830  C C8    . DG  J 6 30  ? 162.238 102.557 156.448 1.00 86.13  ? 30   DG  I C8    1 
ATOM   9831  N N7    . DG  J 6 30  ? 161.388 103.173 157.191 1.00 86.13  ? 30   DG  I N7    1 
ATOM   9832  C C5    . DG  J 6 30  ? 161.937 103.116 158.452 1.00 86.13  ? 30   DG  I C5    1 
ATOM   9833  C C6    . DG  J 6 30  ? 161.443 103.624 159.655 1.00 86.13  ? 30   DG  I C6    1 
ATOM   9834  O O6    . DG  J 6 30  ? 160.400 104.255 159.847 1.00 86.13  ? 30   DG  I O6    1 
ATOM   9835  N N1    . DG  J 6 30  ? 162.286 103.359 160.704 1.00 86.13  ? 30   DG  I N1    1 
ATOM   9836  C C2    . DG  J 6 30  ? 163.463 102.676 160.621 1.00 86.13  ? 30   DG  I C2    1 
ATOM   9837  N N2    . DG  J 6 30  ? 164.089 102.549 161.794 1.00 86.13  ? 30   DG  I N2    1 
ATOM   9838  N N3    . DG  J 6 30  ? 163.958 102.175 159.492 1.00 86.13  ? 30   DG  I N3    1 
ATOM   9839  C C4    . DG  J 6 30  ? 163.132 102.441 158.443 1.00 86.13  ? 30   DG  I C4    1 
ATOM   9840  P P     . DA  J 6 31  ? 164.782 98.900  152.680 1.00 99.10  ? 31   DA  I P     1 
ATOM   9841  O OP1   . DA  J 6 31  ? 165.801 98.434  151.719 1.00 99.10  ? 31   DA  I OP1   1 
ATOM   9842  O OP2   . DA  J 6 31  ? 163.471 99.369  152.197 1.00 99.10  ? 31   DA  I OP2   1 
ATOM   9843  O "O5'" . DA  J 6 31  ? 164.509 97.744  153.750 1.00 99.10  ? 31   DA  I "O5'" 1 
ATOM   9844  C "C5'" . DA  J 6 31  ? 165.552 97.289  154.608 1.00 99.10  ? 31   DA  I "C5'" 1 
ATOM   9845  C "C4'" . DA  J 6 31  ? 165.014 96.376  155.705 1.00 99.10  ? 31   DA  I "C4'" 1 
ATOM   9846  O "O4'" . DA  J 6 31  ? 164.499 97.163  156.810 1.00 99.10  ? 31   DA  I "O4'" 1 
ATOM   9847  C "C3'" . DA  J 6 31  ? 163.870 95.448  155.297 1.00 99.10  ? 31   DA  I "C3'" 1 
ATOM   9848  O "O3'" . DA  J 6 31  ? 164.028 94.218  155.959 1.00 99.10  ? 31   DA  I "O3'" 1 
ATOM   9849  C "C2'" . DA  J 6 31  ? 162.652 96.180  155.839 1.00 99.10  ? 31   DA  I "C2'" 1 
ATOM   9850  C "C1'" . DA  J 6 31  ? 163.223 96.673  157.145 1.00 99.10  ? 31   DA  I "C1'" 1 
ATOM   9851  N N9    . DA  J 6 31  ? 162.467 97.742  157.767 1.00 99.10  ? 31   DA  I N9    1 
ATOM   9852  C C8    . DA  J 6 31  ? 161.603 98.608  157.171 1.00 99.10  ? 31   DA  I C8    1 
ATOM   9853  N N7    . DA  J 6 31  ? 161.073 99.474  157.999 1.00 99.10  ? 31   DA  I N7    1 
ATOM   9854  C C5    . DA  J 6 31  ? 161.632 99.146  159.215 1.00 99.10  ? 31   DA  I C5    1 
ATOM   9855  C C6    . DA  J 6 31  ? 161.485 99.682  160.506 1.00 99.10  ? 31   DA  I C6    1 
ATOM   9856  N N6    . DA  J 6 31  ? 160.690 100.711 160.788 1.00 99.10  ? 31   DA  I N6    1 
ATOM   9857  N N1    . DA  J 6 31  ? 162.192 99.115  161.500 1.00 99.10  ? 31   DA  I N1    1 
ATOM   9858  C C2    . DA  J 6 31  ? 162.988 98.083  161.212 1.00 99.10  ? 31   DA  I C2    1 
ATOM   9859  N N3    . DA  J 6 31  ? 163.204 97.498  160.045 1.00 99.10  ? 31   DA  I N3    1 
ATOM   9860  C C4    . DA  J 6 31  ? 162.490 98.081  159.083 1.00 99.10  ? 31   DA  I C4    1 
ATOM   9861  P P     . DG  J 6 32  ? 164.366 92.875  155.151 1.00 111.53 ? 32   DG  I P     1 
ATOM   9862  O OP1   . DG  J 6 32  ? 165.556 93.122  154.312 1.00 111.53 ? 32   DG  I OP1   1 
ATOM   9863  O OP2   . DG  J 6 32  ? 163.117 92.403  154.521 1.00 111.53 ? 32   DG  I OP2   1 
ATOM   9864  O "O5'" . DG  J 6 32  ? 164.736 91.849  156.314 1.00 111.53 ? 32   DG  I "O5'" 1 
ATOM   9865  C "C5'" . DG  J 6 32  ? 164.705 92.292  157.660 1.00 111.53 ? 32   DG  I "C5'" 1 
ATOM   9866  C "C4'" . DG  J 6 32  ? 163.681 91.521  158.476 1.00 111.53 ? 32   DG  I "C4'" 1 
ATOM   9867  O "O4'" . DG  J 6 32  ? 162.833 92.459  159.189 1.00 111.53 ? 32   DG  I "O4'" 1 
ATOM   9868  C "C3'" . DG  J 6 32  ? 162.711 90.648  157.683 1.00 111.53 ? 32   DG  I "C3'" 1 
ATOM   9869  O "O3'" . DG  J 6 32  ? 162.256 89.584  158.537 1.00 111.53 ? 32   DG  I "O3'" 1 
ATOM   9870  C "C2'" . DG  J 6 32  ? 161.602 91.644  157.397 1.00 111.53 ? 32   DG  I "C2'" 1 
ATOM   9871  C "C1'" . DG  J 6 32  ? 161.498 92.288  158.756 1.00 111.53 ? 32   DG  I "C1'" 1 
ATOM   9872  N N9    . DG  J 6 32  ? 160.843 93.576  158.744 1.00 111.53 ? 32   DG  I N9    1 
ATOM   9873  C C8    . DG  J 6 32  ? 160.382 94.270  157.661 1.00 111.53 ? 32   DG  I C8    1 
ATOM   9874  N N7    . DG  J 6 32  ? 159.837 95.410  157.976 1.00 111.53 ? 32   DG  I N7    1 
ATOM   9875  C C5    . DG  J 6 32  ? 159.945 95.460  159.351 1.00 111.53 ? 32   DG  I C5    1 
ATOM   9876  C C6    . DG  J 6 32  ? 159.534 96.448  160.256 1.00 111.53 ? 32   DG  I C6    1 
ATOM   9877  O O6    . DG  J 6 32  ? 158.971 97.516  160.017 1.00 111.53 ? 32   DG  I O6    1 
ATOM   9878  N N1    . DG  J 6 32  ? 159.838 96.101  161.566 1.00 111.53 ? 32   DG  I N1    1 
ATOM   9879  C C2    . DG  J 6 32  ? 160.463 94.942  161.944 1.00 111.53 ? 32   DG  I C2    1 
ATOM   9880  N N2    . DG  J 6 32  ? 160.679 94.766  163.253 1.00 111.53 ? 32   DG  I N2    1 
ATOM   9881  N N3    . DG  J 6 32  ? 160.851 94.011  161.100 1.00 111.53 ? 32   DG  I N3    1 
ATOM   9882  C C4    . DG  J 6 32  ? 160.562 94.337  159.830 1.00 111.53 ? 32   DG  I C4    1 
ATOM   9883  P P     . DG  J 6 33  ? 161.131 88.524  158.077 1.00 116.98 ? 33   DG  I P     1 
ATOM   9884  O OP1   . DG  J 6 33  ? 161.611 87.215  158.560 1.00 116.98 ? 33   DG  I OP1   1 
ATOM   9885  O OP2   . DG  J 6 33  ? 160.794 88.652  156.643 1.00 116.98 ? 33   DG  I OP2   1 
ATOM   9886  O "O5'" . DG  J 6 33  ? 159.858 88.909  158.968 1.00 116.98 ? 33   DG  I "O5'" 1 
ATOM   9887  C "C5'" . DG  J 6 33  ? 159.820 88.502  160.332 1.00 116.98 ? 33   DG  I "C5'" 1 
ATOM   9888  C "C4'" . DG  J 6 33  ? 158.603 89.047  161.064 1.00 116.98 ? 33   DG  I "C4'" 1 
ATOM   9889  O "O4'" . DG  J 6 33  ? 158.474 90.474  160.840 1.00 116.98 ? 33   DG  I "O4'" 1 
ATOM   9890  C "C3'" . DG  J 6 33  ? 157.242 88.450  160.658 1.00 116.98 ? 33   DG  I "C3'" 1 
ATOM   9891  O "O3'" . DG  J 6 33  ? 156.430 88.328  161.835 1.00 116.98 ? 33   DG  I "O3'" 1 
ATOM   9892  C "C2'" . DG  J 6 33  ? 156.692 89.539  159.745 1.00 116.98 ? 33   DG  I "C2'" 1 
ATOM   9893  C "C1'" . DG  J 6 33  ? 157.118 90.717  160.575 1.00 116.98 ? 33   DG  I "C1'" 1 
ATOM   9894  N N9    . DG  J 6 33  ? 156.945 92.035  159.988 1.00 116.98 ? 33   DG  I N9    1 
ATOM   9895  C C8    . DG  J 6 33  ? 157.076 92.424  158.678 1.00 116.98 ? 33   DG  I C8    1 
ATOM   9896  N N7    . DG  J 6 33  ? 156.849 93.702  158.502 1.00 116.98 ? 33   DG  I N7    1 
ATOM   9897  C C5    . DG  J 6 33  ? 156.555 94.169  159.779 1.00 116.98 ? 33   DG  I C5    1 
ATOM   9898  C C6    . DG  J 6 33  ? 156.225 95.467  160.239 1.00 116.98 ? 33   DG  I C6    1 
ATOM   9899  O O6    . DG  J 6 33  ? 156.121 96.515  159.593 1.00 116.98 ? 33   DG  I O6    1 
ATOM   9900  N N1    . DG  J 6 33  ? 156.007 95.481  161.618 1.00 116.98 ? 33   DG  I N1    1 
ATOM   9901  C C2    . DG  J 6 33  ? 156.097 94.383  162.435 1.00 116.98 ? 33   DG  I C2    1 
ATOM   9902  N N2    . DG  J 6 33  ? 155.854 94.566  163.737 1.00 116.98 ? 33   DG  I N2    1 
ATOM   9903  N N3    . DG  J 6 33  ? 156.399 93.181  162.012 1.00 116.98 ? 33   DG  I N3    1 
ATOM   9904  C C4    . DG  J 6 33  ? 156.614 93.149  160.686 1.00 116.98 ? 33   DG  I C4    1 
ATOM   9905  P P     . DG  J 6 34  ? 155.204 87.292  161.902 1.00 115.13 ? 34   DG  I P     1 
ATOM   9906  O OP1   . DG  J 6 34  ? 155.540 86.280  162.926 1.00 115.13 ? 34   DG  I OP1   1 
ATOM   9907  O OP2   . DG  J 6 34  ? 154.885 86.877  160.522 1.00 115.13 ? 34   DG  I OP2   1 
ATOM   9908  O "O5'" . DG  J 6 34  ? 153.969 88.167  162.432 1.00 115.13 ? 34   DG  I "O5'" 1 
ATOM   9909  C "C5'" . DG  J 6 34  ? 153.952 88.689  163.759 1.00 115.13 ? 34   DG  I "C5'" 1 
ATOM   9910  C "C4'" . DG  J 6 34  ? 152.766 89.636  163.982 1.00 115.13 ? 34   DG  I "C4'" 1 
ATOM   9911  O "O4'" . DG  J 6 34  ? 152.871 90.791  163.116 1.00 115.13 ? 34   DG  I "O4'" 1 
ATOM   9912  C "C3'" . DG  J 6 34  ? 151.379 89.051  163.743 1.00 115.13 ? 34   DG  I "C3'" 1 
ATOM   9913  O "O3'" . DG  J 6 34  ? 150.456 89.559  164.707 1.00 115.13 ? 34   DG  I "O3'" 1 
ATOM   9914  C "C2'" . DG  J 6 34  ? 151.020 89.517  162.331 1.00 115.13 ? 34   DG  I "C2'" 1 
ATOM   9915  C "C1'" . DG  J 6 34  ? 151.836 90.798  162.149 1.00 115.13 ? 34   DG  I "C1'" 1 
ATOM   9916  N N9    . DG  J 6 34  ? 152.475 90.859  160.853 1.00 115.13 ? 34   DG  I N9    1 
ATOM   9917  C C8    . DG  J 6 34  ? 152.906 89.789  160.118 1.00 115.13 ? 34   DG  I C8    1 
ATOM   9918  N N7    . DG  J 6 34  ? 153.455 90.115  158.992 1.00 115.13 ? 34   DG  I N7    1 
ATOM   9919  C C5    . DG  J 6 34  ? 153.390 91.493  158.973 1.00 115.13 ? 34   DG  I C5    1 
ATOM   9920  C C6    . DG  J 6 34  ? 153.834 92.392  157.995 1.00 115.13 ? 34   DG  I C6    1 
ATOM   9921  O O6    . DG  J 6 34  ? 154.390 92.145  156.920 1.00 115.13 ? 34   DG  I O6    1 
ATOM   9922  N N1    . DG  J 6 34  ? 153.585 93.695  158.355 1.00 115.13 ? 34   DG  I N1    1 
ATOM   9923  C C2    . DG  J 6 34  ? 152.980 94.094  159.513 1.00 115.13 ? 34   DG  I C2    1 
ATOM   9924  N N2    . DG  J 6 34  ? 152.850 95.412  159.628 1.00 115.13 ? 34   DG  I N2    1 
ATOM   9925  N N3    . DG  J 6 34  ? 152.548 93.267  160.458 1.00 115.13 ? 34   DG  I N3    1 
ATOM   9926  C C4    . DG  J 6 34  ? 152.790 91.976  160.116 1.00 115.13 ? 34   DG  I C4    1 
ATOM   9927  P P     . DT  J 6 35  ? 149.004 88.888  164.865 1.00 109.76 ? 35   DT  I P     1 
ATOM   9928  O OP1   . DT  J 6 35  ? 148.537 89.126  166.245 1.00 109.76 ? 35   DT  I OP1   1 
ATOM   9929  O OP2   . DT  J 6 35  ? 149.089 87.512  164.338 1.00 109.76 ? 35   DT  I OP2   1 
ATOM   9930  O "O5'" . DT  J 6 35  ? 148.071 89.720  163.872 1.00 109.76 ? 35   DT  I "O5'" 1 
ATOM   9931  C "C5'" . DT  J 6 35  ? 147.698 91.050  164.196 1.00 109.76 ? 35   DT  I "C5'" 1 
ATOM   9932  C "C4'" . DT  J 6 35  ? 146.719 91.628  163.180 1.00 109.76 ? 35   DT  I "C4'" 1 
ATOM   9933  O "O4'" . DT  J 6 35  ? 147.443 92.279  162.111 1.00 109.76 ? 35   DT  I "O4'" 1 
ATOM   9934  C "C3'" . DT  J 6 35  ? 145.786 90.628  162.486 1.00 109.76 ? 35   DT  I "C3'" 1 
ATOM   9935  O "O3'" . DT  J 6 35  ? 144.544 91.263  162.233 1.00 109.76 ? 35   DT  I "O3'" 1 
ATOM   9936  C "C2'" . DT  J 6 35  ? 146.513 90.384  161.165 1.00 109.76 ? 35   DT  I "C2'" 1 
ATOM   9937  C "C1'" . DT  J 6 35  ? 146.945 91.803  160.883 1.00 109.76 ? 35   DT  I "C1'" 1 
ATOM   9938  N N1    . DT  J 6 35  ? 147.989 91.961  159.866 1.00 109.76 ? 35   DT  I N1    1 
ATOM   9939  C C2    . DT  J 6 35  ? 148.303 93.222  159.489 1.00 109.76 ? 35   DT  I C2    1 
ATOM   9940  O O2    . DT  J 6 35  ? 147.750 94.189  159.958 1.00 109.76 ? 35   DT  I O2    1 
ATOM   9941  N N3    . DT  J 6 35  ? 149.281 93.327  158.542 1.00 109.76 ? 35   DT  I N3    1 
ATOM   9942  C C4    . DT  J 6 35  ? 149.962 92.285  157.953 1.00 109.76 ? 35   DT  I C4    1 
ATOM   9943  O O4    . DT  J 6 35  ? 150.829 92.464  157.109 1.00 109.76 ? 35   DT  I O4    1 
ATOM   9944  C C5    . DT  J 6 35  ? 149.581 90.968  158.402 1.00 109.76 ? 35   DT  I C5    1 
ATOM   9945  C C7    . DT  J 6 35  ? 150.250 89.758  157.831 1.00 109.76 ? 35   DT  I C7    1 
ATOM   9946  C C6    . DT  J 6 35  ? 148.621 90.871  159.330 1.00 109.76 ? 35   DT  I C6    1 
ATOM   9947  P P     . DC  J 6 36  ? 143.300 91.113  163.234 1.00 105.04 ? 36   DC  I P     1 
ATOM   9948  O OP1   . DC  J 6 36  ? 143.711 91.625  164.556 1.00 105.04 ? 36   DC  I OP1   1 
ATOM   9949  O OP2   . DC  J 6 36  ? 142.762 89.744  163.109 1.00 105.04 ? 36   DC  I OP2   1 
ATOM   9950  O "O5'" . DC  J 6 36  ? 142.217 92.106  162.604 1.00 105.04 ? 36   DC  I "O5'" 1 
ATOM   9951  C "C5'" . DC  J 6 36  ? 142.444 93.516  162.626 1.00 105.04 ? 36   DC  I "C5'" 1 
ATOM   9952  C "C4'" . DC  J 6 36  ? 142.241 94.167  161.256 1.00 105.04 ? 36   DC  I "C4'" 1 
ATOM   9953  O "O4'" . DC  J 6 36  ? 143.385 93.921  160.403 1.00 105.04 ? 36   DC  I "O4'" 1 
ATOM   9954  C "C3'" . DC  J 6 36  ? 141.030 93.702  160.441 1.00 105.04 ? 36   DC  I "C3'" 1 
ATOM   9955  O "O3'" . DC  J 6 36  ? 140.539 94.810  159.688 1.00 105.04 ? 36   DC  I "O3'" 1 
ATOM   9956  C "C2'" . DC  J 6 36  ? 141.676 92.688  159.500 1.00 105.04 ? 36   DC  I "C2'" 1 
ATOM   9957  C "C1'" . DC  J 6 36  ? 142.900 93.490  159.159 1.00 105.04 ? 36   DC  I "C1'" 1 
ATOM   9958  N N1    . DC  J 6 36  ? 143.988 92.789  158.442 1.00 105.04 ? 36   DC  I N1    1 
ATOM   9959  C C2    . DC  J 6 36  ? 144.844 93.569  157.703 1.00 105.04 ? 36   DC  I C2    1 
ATOM   9960  O O2    . DC  J 6 36  ? 144.625 94.772  157.695 1.00 105.04 ? 36   DC  I O2    1 
ATOM   9961  N N3    . DC  J 6 36  ? 145.865 93.001  157.029 1.00 105.04 ? 36   DC  I N3    1 
ATOM   9962  C C4    . DC  J 6 36  ? 146.031 91.685  157.093 1.00 105.04 ? 36   DC  I C4    1 
ATOM   9963  N N4    . DC  J 6 36  ? 147.051 91.153  156.414 1.00 105.04 ? 36   DC  I N4    1 
ATOM   9964  C C5    . DC  J 6 36  ? 145.156 90.854  157.857 1.00 105.04 ? 36   DC  I C5    1 
ATOM   9965  C C6    . DC  J 6 36  ? 144.152 91.446  158.515 1.00 105.04 ? 36   DC  I C6    1 
ATOM   9966  P P     . DG  J 6 37  ? 139.342 95.728  160.235 1.00 103.81 ? 37   DG  I P     1 
ATOM   9967  O OP1   . DG  J 6 37  ? 139.855 96.498  161.388 1.00 103.81 ? 37   DG  I OP1   1 
ATOM   9968  O OP2   . DG  J 6 37  ? 138.155 94.862  160.373 1.00 103.81 ? 37   DG  I OP2   1 
ATOM   9969  O "O5'" . DG  J 6 37  ? 139.062 96.759  159.040 1.00 103.81 ? 37   DG  I "O5'" 1 
ATOM   9970  C "C5'" . DG  J 6 37  ? 139.817 97.960  158.947 1.00 103.81 ? 37   DG  I "C5'" 1 
ATOM   9971  C "C4'" . DG  J 6 37  ? 140.089 98.391  157.498 1.00 103.81 ? 37   DG  I "C4'" 1 
ATOM   9972  O "O4'" . DG  J 6 37  ? 140.857 97.394  156.779 1.00 103.81 ? 37   DG  I "O4'" 1 
ATOM   9973  C "C3'" . DG  J 6 37  ? 138.891 98.694  156.623 1.00 103.81 ? 37   DG  I "C3'" 1 
ATOM   9974  O "O3'" . DG  J 6 37  ? 139.276 99.705  155.710 1.00 103.81 ? 37   DG  I "O3'" 1 
ATOM   9975  C "C2'" . DG  J 6 37  ? 138.663 97.363  155.915 1.00 103.81 ? 37   DG  I "C2'" 1 
ATOM   9976  C "C1'" . DG  J 6 37  ? 140.072 96.784  155.770 1.00 103.81 ? 37   DG  I "C1'" 1 
ATOM   9977  N N9    . DG  J 6 37  ? 140.117 95.369  156.049 1.00 103.81 ? 37   DG  I N9    1 
ATOM   9978  C C8    . DG  J 6 37  ? 139.214 94.691  156.810 1.00 103.81 ? 37   DG  I C8    1 
ATOM   9979  N N7    . DG  J 6 37  ? 139.477 93.438  156.942 1.00 103.81 ? 37   DG  I N7    1 
ATOM   9980  C C5    . DG  J 6 37  ? 140.636 93.258  156.227 1.00 103.81 ? 37   DG  I C5    1 
ATOM   9981  C C6    . DG  J 6 37  ? 141.369 92.091  156.032 1.00 103.81 ? 37   DG  I C6    1 
ATOM   9982  O O6    . DG  J 6 37  ? 141.130 90.958  156.462 1.00 103.81 ? 37   DG  I O6    1 
ATOM   9983  N N1    . DG  J 6 37  ? 142.475 92.309  155.260 1.00 103.81 ? 37   DG  I N1    1 
ATOM   9984  C C2    . DG  J 6 37  ? 142.852 93.504  154.726 1.00 103.81 ? 37   DG  I C2    1 
ATOM   9985  N N2    . DG  J 6 37  ? 143.980 93.413  154.012 1.00 103.81 ? 37   DG  I N2    1 
ATOM   9986  N N3    . DG  J 6 37  ? 142.177 94.646  154.891 1.00 103.81 ? 37   DG  I N3    1 
ATOM   9987  C C4    . DG  J 6 37  ? 141.068 94.438  155.666 1.00 103.81 ? 37   DG  I C4    1 
ATOM   9988  P P     . DC  J 6 38  ? 138.229 100.474 154.767 1.00 96.20  ? 38   DC  I P     1 
ATOM   9989  O OP1   . DC  J 6 38  ? 138.319 101.894 155.152 1.00 96.20  ? 38   DC  I OP1   1 
ATOM   9990  O OP2   . DC  J 6 38  ? 136.915 99.800  154.724 1.00 96.20  ? 38   DC  I OP2   1 
ATOM   9991  O "O5'" . DC  J 6 38  ? 138.898 100.340 153.337 1.00 96.20  ? 38   DC  I "O5'" 1 
ATOM   9992  C "C5'" . DC  J 6 38  ? 140.058 99.545  153.211 1.00 96.20  ? 38   DC  I "C5'" 1 
ATOM   9993  C "C4'" . DC  J 6 38  ? 140.585 99.531  151.798 1.00 96.20  ? 38   DC  I "C4'" 1 
ATOM   9994  O "O4'" . DC  J 6 38  ? 140.776 98.168  151.364 1.00 96.20  ? 38   DC  I "O4'" 1 
ATOM   9995  C "C3'" . DC  J 6 38  ? 139.673 100.121 150.768 1.00 96.20  ? 38   DC  I "C3'" 1 
ATOM   9996  O "O3'" . DC  J 6 38  ? 140.422 100.454 149.645 1.00 96.20  ? 38   DC  I "O3'" 1 
ATOM   9997  C "C2'" . DC  J 6 38  ? 138.736 98.954  150.473 1.00 96.20  ? 38   DC  I "C2'" 1 
ATOM   9998  C "C1'" . DC  J 6 38  ? 139.619 97.716  150.693 1.00 96.20  ? 38   DC  I "C1'" 1 
ATOM   9999  N N1