data_6J95
# 
_entry.id   6J95 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.327 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6J95         
WWPDB D_1300010677 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6J95 
_pdbx_database_status.recvd_initial_deposition_date   2019-01-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Niu, G.'  1 ? 
'Guo, Q.'  2 ? 
'Wang, J.' 3 ? 
'Zhao, S.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                14150 
_citation.page_last                 14157 
_citation.title                     'Structural basis for plant lutein biosynthesis from alpha-carotene.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.2001806117 
_citation.pdbx_database_id_PubMed   32513704 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Niu, G.'  1 ? 
primary 'Guo, Q.'  2 ? 
primary 'Wang, J.' 3 ? 
primary 'Zhao, S.' 4 ? 
primary 'He, Y.'   5 ? 
primary 'Liu, L.'  6 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6J95 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     58.481 
_cell.length_a_esd                 ? 
_cell.length_b                     82.097 
_cell.length_b_esd                 ? 
_cell.length_c                     110.339 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6J95 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein LUTEIN DEFICIENT 5, chloroplastic' 58463.828 1   1.14.-.- ? ? ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'           616.487   1   ?        ? ? ? 
3 non-polymer syn RETINAL                                     284.436   1   ?        ? ? ? 
4 water       nat water                                       18.015    516 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cytochrome P450 97A3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSFPSTVKNGLSKIGIPSNVLDFMFDWTGSDQDYPKVPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVS
DPSIAKHILKDNAKAYSKGILAEILDFVMGKGLIPADGEIWRRRRRAIVPALHQKYVAAMISLFGEASDRLCQKLDAAAL
KGEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKL
INDTLDDLIATCKRMVEEEELQFHEEYMNERDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTE
PSVVAKLQEEVDSVIGDRFPTIQDMKKLKYTTRVMNESLRLYPQPPVLIRRSIDNDILGEYPIKRGEDIFISVWNLHRSP
LHWDDAEKFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPPVKMTTGATI
HTTEGLKLTVTKRTKPLDIPSVPILPMDTSRDEVSSALS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSFPSTVKNGLSKIGIPSNVLDFMFDWTGSDQDYPKVPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVS
DPSIAKHILKDNAKAYSKGILAEILDFVMGKGLIPADGEIWRRRRRAIVPALHQKYVAAMISLFGEASDRLCQKLDAAAL
KGEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKL
INDTLDDLIATCKRMVEEEELQFHEEYMNERDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTE
PSVVAKLQEEVDSVIGDRFPTIQDMKKLKYTTRVMNESLRLYPQPPVLIRRSIDNDILGEYPIKRGEDIFISVWNLHRSP
LHWDDAEKFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPPVKMTTGATI
HTTEGLKLTVTKRTKPLDIPSVPILPMDTSRDEVSSALS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PHE n 
1 4   PRO n 
1 5   SER n 
1 6   THR n 
1 7   VAL n 
1 8   LYS n 
1 9   ASN n 
1 10  GLY n 
1 11  LEU n 
1 12  SER n 
1 13  LYS n 
1 14  ILE n 
1 15  GLY n 
1 16  ILE n 
1 17  PRO n 
1 18  SER n 
1 19  ASN n 
1 20  VAL n 
1 21  LEU n 
1 22  ASP n 
1 23  PHE n 
1 24  MET n 
1 25  PHE n 
1 26  ASP n 
1 27  TRP n 
1 28  THR n 
1 29  GLY n 
1 30  SER n 
1 31  ASP n 
1 32  GLN n 
1 33  ASP n 
1 34  TYR n 
1 35  PRO n 
1 36  LYS n 
1 37  VAL n 
1 38  PRO n 
1 39  GLU n 
1 40  ALA n 
1 41  LYS n 
1 42  GLY n 
1 43  SER n 
1 44  ILE n 
1 45  GLN n 
1 46  ALA n 
1 47  VAL n 
1 48  ARG n 
1 49  ASN n 
1 50  GLU n 
1 51  ALA n 
1 52  PHE n 
1 53  PHE n 
1 54  ILE n 
1 55  PRO n 
1 56  LEU n 
1 57  TYR n 
1 58  GLU n 
1 59  LEU n 
1 60  PHE n 
1 61  LEU n 
1 62  THR n 
1 63  TYR n 
1 64  GLY n 
1 65  GLY n 
1 66  ILE n 
1 67  PHE n 
1 68  ARG n 
1 69  LEU n 
1 70  THR n 
1 71  PHE n 
1 72  GLY n 
1 73  PRO n 
1 74  LYS n 
1 75  SER n 
1 76  PHE n 
1 77  LEU n 
1 78  ILE n 
1 79  VAL n 
1 80  SER n 
1 81  ASP n 
1 82  PRO n 
1 83  SER n 
1 84  ILE n 
1 85  ALA n 
1 86  LYS n 
1 87  HIS n 
1 88  ILE n 
1 89  LEU n 
1 90  LYS n 
1 91  ASP n 
1 92  ASN n 
1 93  ALA n 
1 94  LYS n 
1 95  ALA n 
1 96  TYR n 
1 97  SER n 
1 98  LYS n 
1 99  GLY n 
1 100 ILE n 
1 101 LEU n 
1 102 ALA n 
1 103 GLU n 
1 104 ILE n 
1 105 LEU n 
1 106 ASP n 
1 107 PHE n 
1 108 VAL n 
1 109 MET n 
1 110 GLY n 
1 111 LYS n 
1 112 GLY n 
1 113 LEU n 
1 114 ILE n 
1 115 PRO n 
1 116 ALA n 
1 117 ASP n 
1 118 GLY n 
1 119 GLU n 
1 120 ILE n 
1 121 TRP n 
1 122 ARG n 
1 123 ARG n 
1 124 ARG n 
1 125 ARG n 
1 126 ARG n 
1 127 ALA n 
1 128 ILE n 
1 129 VAL n 
1 130 PRO n 
1 131 ALA n 
1 132 LEU n 
1 133 HIS n 
1 134 GLN n 
1 135 LYS n 
1 136 TYR n 
1 137 VAL n 
1 138 ALA n 
1 139 ALA n 
1 140 MET n 
1 141 ILE n 
1 142 SER n 
1 143 LEU n 
1 144 PHE n 
1 145 GLY n 
1 146 GLU n 
1 147 ALA n 
1 148 SER n 
1 149 ASP n 
1 150 ARG n 
1 151 LEU n 
1 152 CYS n 
1 153 GLN n 
1 154 LYS n 
1 155 LEU n 
1 156 ASP n 
1 157 ALA n 
1 158 ALA n 
1 159 ALA n 
1 160 LEU n 
1 161 LYS n 
1 162 GLY n 
1 163 GLU n 
1 164 GLU n 
1 165 VAL n 
1 166 GLU n 
1 167 MET n 
1 168 GLU n 
1 169 SER n 
1 170 LEU n 
1 171 PHE n 
1 172 SER n 
1 173 ARG n 
1 174 LEU n 
1 175 THR n 
1 176 LEU n 
1 177 ASP n 
1 178 ILE n 
1 179 ILE n 
1 180 GLY n 
1 181 LYS n 
1 182 ALA n 
1 183 VAL n 
1 184 PHE n 
1 185 ASN n 
1 186 TYR n 
1 187 ASP n 
1 188 PHE n 
1 189 ASP n 
1 190 SER n 
1 191 LEU n 
1 192 THR n 
1 193 ASN n 
1 194 ASP n 
1 195 THR n 
1 196 GLY n 
1 197 VAL n 
1 198 ILE n 
1 199 GLU n 
1 200 ALA n 
1 201 VAL n 
1 202 TYR n 
1 203 THR n 
1 204 VAL n 
1 205 LEU n 
1 206 ARG n 
1 207 GLU n 
1 208 ALA n 
1 209 GLU n 
1 210 ASP n 
1 211 ARG n 
1 212 SER n 
1 213 VAL n 
1 214 SER n 
1 215 PRO n 
1 216 ILE n 
1 217 PRO n 
1 218 VAL n 
1 219 TRP n 
1 220 ASP n 
1 221 ILE n 
1 222 PRO n 
1 223 ILE n 
1 224 TRP n 
1 225 LYS n 
1 226 ASP n 
1 227 ILE n 
1 228 SER n 
1 229 PRO n 
1 230 ARG n 
1 231 GLN n 
1 232 ARG n 
1 233 LYS n 
1 234 VAL n 
1 235 ALA n 
1 236 THR n 
1 237 SER n 
1 238 LEU n 
1 239 LYS n 
1 240 LEU n 
1 241 ILE n 
1 242 ASN n 
1 243 ASP n 
1 244 THR n 
1 245 LEU n 
1 246 ASP n 
1 247 ASP n 
1 248 LEU n 
1 249 ILE n 
1 250 ALA n 
1 251 THR n 
1 252 CYS n 
1 253 LYS n 
1 254 ARG n 
1 255 MET n 
1 256 VAL n 
1 257 GLU n 
1 258 GLU n 
1 259 GLU n 
1 260 GLU n 
1 261 LEU n 
1 262 GLN n 
1 263 PHE n 
1 264 HIS n 
1 265 GLU n 
1 266 GLU n 
1 267 TYR n 
1 268 MET n 
1 269 ASN n 
1 270 GLU n 
1 271 ARG n 
1 272 ASP n 
1 273 PRO n 
1 274 SER n 
1 275 ILE n 
1 276 LEU n 
1 277 HIS n 
1 278 PHE n 
1 279 LEU n 
1 280 LEU n 
1 281 ALA n 
1 282 SER n 
1 283 GLY n 
1 284 ASP n 
1 285 ASP n 
1 286 VAL n 
1 287 SER n 
1 288 SER n 
1 289 LYS n 
1 290 GLN n 
1 291 LEU n 
1 292 ARG n 
1 293 ASP n 
1 294 ASP n 
1 295 LEU n 
1 296 MET n 
1 297 THR n 
1 298 MET n 
1 299 LEU n 
1 300 ILE n 
1 301 ALA n 
1 302 GLY n 
1 303 HIS n 
1 304 GLU n 
1 305 THR n 
1 306 SER n 
1 307 ALA n 
1 308 ALA n 
1 309 VAL n 
1 310 LEU n 
1 311 THR n 
1 312 TRP n 
1 313 THR n 
1 314 PHE n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 THR n 
1 319 THR n 
1 320 GLU n 
1 321 PRO n 
1 322 SER n 
1 323 VAL n 
1 324 VAL n 
1 325 ALA n 
1 326 LYS n 
1 327 LEU n 
1 328 GLN n 
1 329 GLU n 
1 330 GLU n 
1 331 VAL n 
1 332 ASP n 
1 333 SER n 
1 334 VAL n 
1 335 ILE n 
1 336 GLY n 
1 337 ASP n 
1 338 ARG n 
1 339 PHE n 
1 340 PRO n 
1 341 THR n 
1 342 ILE n 
1 343 GLN n 
1 344 ASP n 
1 345 MET n 
1 346 LYS n 
1 347 LYS n 
1 348 LEU n 
1 349 LYS n 
1 350 TYR n 
1 351 THR n 
1 352 THR n 
1 353 ARG n 
1 354 VAL n 
1 355 MET n 
1 356 ASN n 
1 357 GLU n 
1 358 SER n 
1 359 LEU n 
1 360 ARG n 
1 361 LEU n 
1 362 TYR n 
1 363 PRO n 
1 364 GLN n 
1 365 PRO n 
1 366 PRO n 
1 367 VAL n 
1 368 LEU n 
1 369 ILE n 
1 370 ARG n 
1 371 ARG n 
1 372 SER n 
1 373 ILE n 
1 374 ASP n 
1 375 ASN n 
1 376 ASP n 
1 377 ILE n 
1 378 LEU n 
1 379 GLY n 
1 380 GLU n 
1 381 TYR n 
1 382 PRO n 
1 383 ILE n 
1 384 LYS n 
1 385 ARG n 
1 386 GLY n 
1 387 GLU n 
1 388 ASP n 
1 389 ILE n 
1 390 PHE n 
1 391 ILE n 
1 392 SER n 
1 393 VAL n 
1 394 TRP n 
1 395 ASN n 
1 396 LEU n 
1 397 HIS n 
1 398 ARG n 
1 399 SER n 
1 400 PRO n 
1 401 LEU n 
1 402 HIS n 
1 403 TRP n 
1 404 ASP n 
1 405 ASP n 
1 406 ALA n 
1 407 GLU n 
1 408 LYS n 
1 409 PHE n 
1 410 ASN n 
1 411 PRO n 
1 412 GLU n 
1 413 ARG n 
1 414 TRP n 
1 415 PRO n 
1 416 LEU n 
1 417 ASP n 
1 418 GLY n 
1 419 PRO n 
1 420 ASN n 
1 421 PRO n 
1 422 ASN n 
1 423 GLU n 
1 424 THR n 
1 425 ASN n 
1 426 GLN n 
1 427 ASN n 
1 428 PHE n 
1 429 SER n 
1 430 TYR n 
1 431 LEU n 
1 432 PRO n 
1 433 PHE n 
1 434 GLY n 
1 435 GLY n 
1 436 GLY n 
1 437 PRO n 
1 438 ARG n 
1 439 LYS n 
1 440 CYS n 
1 441 ILE n 
1 442 GLY n 
1 443 ASP n 
1 444 MET n 
1 445 PHE n 
1 446 ALA n 
1 447 SER n 
1 448 PHE n 
1 449 GLU n 
1 450 ASN n 
1 451 VAL n 
1 452 VAL n 
1 453 ALA n 
1 454 ILE n 
1 455 ALA n 
1 456 MET n 
1 457 LEU n 
1 458 ILE n 
1 459 ARG n 
1 460 ARG n 
1 461 PHE n 
1 462 ASN n 
1 463 PHE n 
1 464 GLN n 
1 465 ILE n 
1 466 ALA n 
1 467 PRO n 
1 468 GLY n 
1 469 ALA n 
1 470 PRO n 
1 471 PRO n 
1 472 VAL n 
1 473 LYS n 
1 474 MET n 
1 475 THR n 
1 476 THR n 
1 477 GLY n 
1 478 ALA n 
1 479 THR n 
1 480 ILE n 
1 481 HIS n 
1 482 THR n 
1 483 THR n 
1 484 GLU n 
1 485 GLY n 
1 486 LEU n 
1 487 LYS n 
1 488 LEU n 
1 489 THR n 
1 490 VAL n 
1 491 THR n 
1 492 LYS n 
1 493 ARG n 
1 494 THR n 
1 495 LYS n 
1 496 PRO n 
1 497 LEU n 
1 498 ASP n 
1 499 ILE n 
1 500 PRO n 
1 501 SER n 
1 502 VAL n 
1 503 PRO n 
1 504 ILE n 
1 505 LEU n 
1 506 PRO n 
1 507 MET n 
1 508 ASP n 
1 509 THR n 
1 510 SER n 
1 511 ARG n 
1 512 ASP n 
1 513 GLU n 
1 514 VAL n 
1 515 SER n 
1 516 SER n 
1 517 ALA n 
1 518 LEU n 
1 519 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   519 
_entity_src_gen.gene_src_common_name               'Mouse-ear cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CYP97A3, LUT5, At1g31800, F5M6.19' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LUT5_ARATH 
_struct_ref.pdbx_db_accession          Q93VK5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SFPSTVKNGLSKIGIPSNVLDFMFDWTGSDQDYPKVPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSD
PSIAKHILKDNAKAYSKGILAEILDFVMGKGLIPADGEIWRRRRRAIVPALHQKYVAAMISLFGEASDRLCQKLDAAALK
GEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKLI
NDTLDDLIATCKRMVEEEELQFHEEYMNERDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEP
SVVAKLQEEVDSVIGDRFPTIQDMKKLKYTTRVMNESLRLYPQPPVLIRRSIDNDILGEYPIKRGEDIFISVWNLHRSPL
HWDDAEKFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPPVKMTTGATIH
TTEGLKLTVTKRTKPLDIPSVPILPMDTSRDEVSSALS
;
_struct_ref.pdbx_align_begin           78 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6J95 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 519 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q93VK5 
_struct_ref_seq.db_align_beg                  78 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  595 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       78 
_struct_ref_seq.pdbx_auth_seq_align_end       595 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             6J95 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q93VK5 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            77 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
RET non-polymer         . RETINAL                           ?    'C20 H28 O'        284.436 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6J95 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.7 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIQUID DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M potassium sulfate, 20% (w/v) PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-11-01 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            29.160 
_reflns.entry_id                         6J95 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.0 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       36341 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.1 
_reflns.pdbx_Rmerge_I_obs                0.115 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            23.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.120 
_reflns.pdbx_Rpim_I_all                  0.036 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.968 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.07 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3557 
_reflns_shell.percent_possible_all        99.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.698 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             10.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.734 
_reflns_shell.pdbx_Rpim_I_all             0.223 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.875 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                94.160 
_refine.B_iso_mean                               34.3516 
_refine.B_iso_min                                15.680 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6J95 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.0020 
_refine.ls_d_res_low                             47.6320 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     36262 
_refine.ls_number_reflns_R_free                  1815 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.3400 
_refine.ls_percent_reflns_R_free                 5.0100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1670 
_refine.ls_R_factor_R_free                       0.1972 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1653 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4KF2 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.2900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.0020 
_refine_hist.d_res_low                        47.6320 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             516 
_refine_hist.number_atoms_total               4052 
_refine_hist.pdbx_number_residues_total       445 
_refine_hist.pdbx_B_iso_mean_ligand           23.92 
_refine_hist.pdbx_B_iso_mean_solvent          47.02 
_refine_hist.pdbx_number_atoms_protein        3472 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 3640 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.817  ? 4968 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 559  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 634  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 12.872 ? 2173 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0023 2.0565  2679 . 128 2551 97.0000  . . . 0.2728 0.0000 0.2208 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.0565 2.1170  2733 . 133 2600 99.0000  . . . 0.2627 0.0000 0.2115 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.1170 2.1853  2751 . 144 2607 99.0000  . . . 0.2446 0.0000 0.1958 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.1853 2.2634  2758 . 126 2632 99.0000  . . . 0.2321 0.0000 0.1849 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.2634 2.3541  2763 . 130 2633 99.0000  . . . 0.2490 0.0000 0.1759 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.3541 2.4612  2750 . 138 2612 100.0000 . . . 0.2228 0.0000 0.1742 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.4612 2.5909  2777 . 131 2646 100.0000 . . . 0.2359 0.0000 0.1740 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.5909 2.7533  2792 . 133 2659 100.0000 . . . 0.2438 0.0000 0.1736 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.7533 2.9658  2793 . 147 2646 99.0000  . . . 0.1986 0.0000 0.1638 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.9658 3.2642  2803 . 137 2666 100.0000 . . . 0.2219 0.0000 0.1698 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 3.2642 3.7364  2831 . 165 2666 100.0000 . . . 0.1931 0.0000 0.1578 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 3.7364 4.7068  2849 . 142 2707 100.0000 . . . 0.1486 0.0000 0.1330 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 4.7068 47.6452 2983 . 161 2822 99.0000  . . . 0.1606 0.0000 0.1643 . . . . . . 13 . . . 
# 
_struct.entry_id                     6J95 
_struct.title                        'Crystal structure of CYP97A3 in complex with retinal' 
_struct.pdbx_descriptor              'Protein LUTEIN DEFICIENT 5, chloroplastic (E.C.1.14.-.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6J95 
_struct_keywords.text            'lutein biosynthesis, photosynthesis, monooxygenase, carotenoid, P450, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PHE A 52  ? GLY A 64  ? PHE A 128 GLY A 140 1 ? 13 
HELX_P HELX_P2  AA2 ASP A 81  ? LYS A 90  ? ASP A 157 LYS A 166 1 ? 10 
HELX_P HELX_P3  AA3 ASN A 92  ? LYS A 94  ? ASN A 168 LYS A 170 5 ? 3  
HELX_P HELX_P4  AA4 GLY A 99  ? GLY A 110 ? GLY A 175 GLY A 186 1 ? 12 
HELX_P HELX_P5  AA5 ASP A 117 ? VAL A 129 ? ASP A 193 VAL A 205 1 ? 13 
HELX_P HELX_P6  AA6 PRO A 130 ? LEU A 132 ? PRO A 206 LEU A 208 5 ? 3  
HELX_P HELX_P7  AA7 HIS A 133 ? GLY A 162 ? HIS A 209 GLY A 238 1 ? 30 
HELX_P HELX_P8  AA8 MET A 167 ? ASN A 185 ? MET A 243 ASN A 261 1 ? 19 
HELX_P HELX_P9  AA9 THR A 195 ? SER A 214 ? THR A 271 SER A 290 1 ? 20 
HELX_P HELX_P10 AB1 PRO A 229 ? GLU A 259 ? PRO A 305 GLU A 335 1 ? 31 
HELX_P HELX_P11 AB2 SER A 274 ? SER A 282 ? SER A 350 SER A 358 1 ? 9  
HELX_P HELX_P12 AB3 SER A 287 ? GLU A 320 ? SER A 363 GLU A 396 1 ? 34 
HELX_P HELX_P13 AB4 GLU A 320 ? ILE A 335 ? GLU A 396 ILE A 411 1 ? 16 
HELX_P HELX_P14 AB5 THR A 341 ? LEU A 348 ? THR A 417 LEU A 424 1 ? 8  
HELX_P HELX_P15 AB6 LEU A 348 ? TYR A 362 ? LEU A 424 TYR A 438 1 ? 15 
HELX_P HELX_P16 AB7 VAL A 393 ? SER A 399 ? VAL A 469 SER A 475 1 ? 7  
HELX_P HELX_P17 AB8 ASN A 410 ? TRP A 414 ? ASN A 486 TRP A 490 5 ? 5  
HELX_P HELX_P18 AB9 GLY A 435 ? LYS A 439 ? GLY A 511 LYS A 515 5 ? 5  
HELX_P HELX_P19 AC1 GLY A 442 ? ARG A 460 ? GLY A 518 ARG A 536 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            440 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           HEM 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           FE 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             516 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            HEM 
_struct_conn.ptnr2_auth_seq_id             601 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.581 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 228 A . ? SER 304 A PRO 229 A ? PRO 305 A 1 -14.48 
2 GLN 364 A . ? GLN 440 A PRO 365 A ? PRO 441 A 1 -0.62  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 66  ? PHE A 71  ? ILE A 142 PHE A 147 
AA1 2 LYS A 74  ? VAL A 79  ? LYS A 150 VAL A 155 
AA1 3 ASP A 388 ? SER A 392 ? ASP A 464 SER A 468 
AA1 4 VAL A 367 ? SER A 372 ? VAL A 443 SER A 448 
AA1 5 TYR A 96  ? SER A 97  ? TYR A 172 SER A 173 
AA2 1 VAL A 165 ? GLU A 166 ? VAL A 241 GLU A 242 
AA2 2 LYS A 487 ? LYS A 492 ? LYS A 563 LYS A 568 
AA2 3 PHE A 461 ? ILE A 465 ? PHE A 537 ILE A 541 
AA3 1 ASP A 376 ? LEU A 378 ? ASP A 452 LEU A 454 
AA3 2 TYR A 381 ? ILE A 383 ? TYR A 457 ILE A 459 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 67  ? N PHE A 143 O ILE A 78  ? O ILE A 154 
AA1 2 3 N LEU A 77  ? N LEU A 153 O PHE A 390 ? O PHE A 466 
AA1 3 4 O ILE A 389 ? O ILE A 465 N ARG A 370 ? N ARG A 446 
AA1 4 5 O ARG A 371 ? O ARG A 447 N SER A 97  ? N SER A 173 
AA2 1 2 N VAL A 165 ? N VAL A 241 O LEU A 488 ? O LEU A 564 
AA2 2 3 O THR A 489 ? O THR A 565 N GLN A 464 ? N GLN A 540 
AA3 1 2 N LEU A 378 ? N LEU A 454 O TYR A 381 ? O TYR A 457 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A HEM 601 ? 24 'binding site for residue HEM A 601' 
AC2 Software A RET 602 ? 9  'binding site for residue RET A 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 LYS A 98  ? LYS A 174 . ? 1_555 ? 
2  AC1 24 LEU A 113 ? LEU A 189 . ? 1_555 ? 
3  AC1 24 ILE A 114 ? ILE A 190 . ? 1_555 ? 
4  AC1 24 TRP A 121 ? TRP A 197 . ? 1_555 ? 
5  AC1 24 ARG A 125 ? ARG A 201 . ? 1_555 ? 
6  AC1 24 ALA A 301 ? ALA A 377 . ? 1_555 ? 
7  AC1 24 GLY A 302 ? GLY A 378 . ? 1_555 ? 
8  AC1 24 THR A 305 ? THR A 381 . ? 1_555 ? 
9  AC1 24 SER A 306 ? SER A 382 . ? 1_555 ? 
10 AC1 24 VAL A 309 ? VAL A 385 . ? 1_555 ? 
11 AC1 24 GLN A 364 ? GLN A 440 . ? 1_555 ? 
12 AC1 24 ARG A 370 ? ARG A 446 . ? 1_555 ? 
13 AC1 24 PRO A 432 ? PRO A 508 . ? 1_555 ? 
14 AC1 24 PHE A 433 ? PHE A 509 . ? 1_555 ? 
15 AC1 24 GLY A 434 ? GLY A 510 . ? 1_555 ? 
16 AC1 24 ARG A 438 ? ARG A 514 . ? 1_555 ? 
17 AC1 24 CYS A 440 ? CYS A 516 . ? 1_555 ? 
18 AC1 24 ILE A 441 ? ILE A 517 . ? 1_555 ? 
19 AC1 24 PHE A 445 ? PHE A 521 . ? 1_555 ? 
20 AC1 24 ALA A 446 ? ALA A 522 . ? 1_555 ? 
21 AC1 24 RET C .   ? RET A 602 . ? 1_555 ? 
22 AC1 24 HOH D .   ? HOH A 766 . ? 1_555 ? 
23 AC1 24 HOH D .   ? HOH A 802 . ? 1_555 ? 
24 AC1 24 HOH D .   ? HOH A 806 . ? 1_555 ? 
25 AC2 9  PHE A 52  ? PHE A 128 . ? 1_555 ? 
26 AC2 9  LEU A 101 ? LEU A 177 . ? 1_555 ? 
27 AC2 9  SER A 212 ? SER A 288 . ? 1_555 ? 
28 AC2 9  THR A 305 ? THR A 381 . ? 1_555 ? 
29 AC2 9  VAL A 367 ? VAL A 443 . ? 1_555 ? 
30 AC2 9  THR A 476 ? THR A 552 . ? 1_555 ? 
31 AC2 9  GLY A 477 ? GLY A 553 . ? 1_555 ? 
32 AC2 9  ALA A 478 ? ALA A 554 . ? 1_555 ? 
33 AC2 9  HEM B .   ? HEM A 601 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6J95 
_atom_sites.fract_transf_matrix[1][1]   0.017100 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012181 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009063 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 51  ? -24.352 -2.240  -30.344 1.00 47.63 ? 127  ALA A N   1 
ATOM   2    C  CA  . ALA A 1 51  ? -23.049 -2.430  -30.948 1.00 43.72 ? 127  ALA A CA  1 
ATOM   3    C  C   . ALA A 1 51  ? -22.721 -1.287  -31.896 1.00 38.05 ? 127  ALA A C   1 
ATOM   4    O  O   . ALA A 1 51  ? -21.812 -1.419  -32.709 1.00 32.59 ? 127  ALA A O   1 
ATOM   5    C  CB  . ALA A 1 51  ? -23.002 -3.754  -31.683 1.00 45.64 ? 127  ALA A CB  1 
ATOM   6    N  N   . PHE A 1 52  ? -23.458 -0.170  -31.769 1.00 39.96 ? 128  PHE A N   1 
ATOM   7    C  CA  . PHE A 1 52  ? -23.317 0.957   -32.698 1.00 42.67 ? 128  PHE A CA  1 
ATOM   8    C  C   . PHE A 1 52  ? -21.897 1.508   -32.711 1.00 37.72 ? 128  PHE A C   1 
ATOM   9    O  O   . PHE A 1 52  ? -21.386 1.913   -33.763 1.00 35.64 ? 128  PHE A O   1 
ATOM   10   C  CB  . PHE A 1 52  ? -24.308 2.066   -32.329 1.00 45.47 ? 128  PHE A CB  1 
ATOM   11   C  CG  . PHE A 1 52  ? -24.061 3.386   -33.037 1.00 45.99 ? 128  PHE A CG  1 
ATOM   12   C  CD1 . PHE A 1 52  ? -24.111 3.475   -34.418 1.00 45.04 ? 128  PHE A CD1 1 
ATOM   13   C  CD2 . PHE A 1 52  ? -23.806 4.543   -32.312 1.00 45.07 ? 128  PHE A CD2 1 
ATOM   14   C  CE1 . PHE A 1 52  ? -23.897 4.691   -35.060 1.00 43.52 ? 128  PHE A CE1 1 
ATOM   15   C  CE2 . PHE A 1 52  ? -23.592 5.757   -32.946 1.00 44.14 ? 128  PHE A CE2 1 
ATOM   16   C  CZ  . PHE A 1 52  ? -23.638 5.830   -34.322 1.00 44.12 ? 128  PHE A CZ  1 
ATOM   17   N  N   . PHE A 1 53  ? -21.247 1.535   -31.552 1.00 35.66 ? 129  PHE A N   1 
ATOM   18   C  CA  . PHE A 1 53  ? -19.909 2.093   -31.441 1.00 32.28 ? 129  PHE A CA  1 
ATOM   19   C  C   . PHE A 1 53  ? -18.830 1.183   -32.018 1.00 31.29 ? 129  PHE A C   1 
ATOM   20   O  O   . PHE A 1 53  ? -17.702 1.646   -32.207 1.00 35.11 ? 129  PHE A O   1 
ATOM   21   C  CB  . PHE A 1 53  ? -19.605 2.399   -29.974 1.00 29.09 ? 129  PHE A CB  1 
ATOM   22   C  CG  . PHE A 1 53  ? -19.821 1.232   -29.057 1.00 29.22 ? 129  PHE A CG  1 
ATOM   23   C  CD1 . PHE A 1 53  ? -18.803 0.324   -28.818 1.00 30.25 ? 129  PHE A CD1 1 
ATOM   24   C  CD2 . PHE A 1 53  ? -21.047 1.036   -28.438 1.00 31.25 ? 129  PHE A CD2 1 
ATOM   25   C  CE1 . PHE A 1 53  ? -19.001 -0.755  -27.968 1.00 31.78 ? 129  PHE A CE1 1 
ATOM   26   C  CE2 . PHE A 1 53  ? -21.251 -0.042  -27.588 1.00 31.49 ? 129  PHE A CE2 1 
ATOM   27   C  CZ  . PHE A 1 53  ? -20.228 -0.937  -27.354 1.00 30.27 ? 129  PHE A CZ  1 
ATOM   28   N  N   . ILE A 1 54  ? -19.134 -0.082  -32.294 1.00 27.47 ? 130  ILE A N   1 
ATOM   29   C  CA  . ILE A 1 54  ? -18.121 -1.009  -32.796 1.00 26.59 ? 130  ILE A CA  1 
ATOM   30   C  C   . ILE A 1 54  ? -17.696 -0.625  -34.213 1.00 28.32 ? 130  ILE A C   1 
ATOM   31   O  O   . ILE A 1 54  ? -16.490 -0.480  -34.455 1.00 32.51 ? 130  ILE A O   1 
ATOM   32   C  CB  . ILE A 1 54  ? -18.606 -2.467  -32.732 1.00 29.34 ? 130  ILE A CB  1 
ATOM   33   C  CG1 . ILE A 1 54  ? -18.660 -2.942  -31.283 1.00 33.38 ? 130  ILE A CG1 1 
ATOM   34   C  CG2 . ILE A 1 54  ? -17.695 -3.366  -33.550 1.00 28.68 ? 130  ILE A CG2 1 
ATOM   35   C  CD1 . ILE A 1 54  ? -17.340 -2.785  -30.555 1.00 35.47 ? 130  ILE A CD1 1 
ATOM   36   N  N   . PRO A 1 55  ? -18.608 -0.453  -35.181 1.00 27.42 ? 131  PRO A N   1 
ATOM   37   C  CA  . PRO A 1 55  ? -18.147 -0.013  -36.509 1.00 26.62 ? 131  PRO A CA  1 
ATOM   38   C  C   . PRO A 1 55  ? -17.498 1.356   -36.482 1.00 24.29 ? 131  PRO A C   1 
ATOM   39   O  O   . PRO A 1 55  ? -16.655 1.650   -37.338 1.00 24.69 ? 131  PRO A O   1 
ATOM   40   C  CB  . PRO A 1 55  ? -19.431 -0.000  -37.352 1.00 30.58 ? 131  PRO A CB  1 
ATOM   41   C  CG  . PRO A 1 55  ? -20.437 -0.752  -36.573 1.00 31.58 ? 131  PRO A CG  1 
ATOM   42   C  CD  . PRO A 1 55  ? -20.075 -0.592  -35.145 1.00 29.39 ? 131  PRO A CD  1 
ATOM   43   N  N   . LEU A 1 56  ? -17.871 2.210   -35.525 1.00 21.32 ? 132  LEU A N   1 
ATOM   44   C  CA  . LEU A 1 56  ? -17.254 3.529   -35.443 1.00 23.85 ? 132  LEU A CA  1 
ATOM   45   C  C   . LEU A 1 56  ? -15.767 3.437   -35.123 1.00 23.73 ? 132  LEU A C   1 
ATOM   46   O  O   . LEU A 1 56  ? -15.000 4.331   -35.499 1.00 22.54 ? 132  LEU A O   1 
ATOM   47   C  CB  . LEU A 1 56  ? -17.964 4.388   -34.396 1.00 23.93 ? 132  LEU A CB  1 
ATOM   48   C  CG  . LEU A 1 56  ? -19.430 4.726   -34.667 1.00 25.53 ? 132  LEU A CG  1 
ATOM   49   C  CD1 . LEU A 1 56  ? -19.978 5.654   -33.587 1.00 24.73 ? 132  LEU A CD1 1 
ATOM   50   C  CD2 . LEU A 1 56  ? -19.598 5.339   -36.056 1.00 25.63 ? 132  LEU A CD2 1 
ATOM   51   N  N   . TYR A 1 57  ? -15.342 2.369   -34.439 1.00 22.78 ? 133  TYR A N   1 
ATOM   52   C  CA  . TYR A 1 57  ? -13.929 2.210   -34.103 1.00 23.27 ? 133  TYR A CA  1 
ATOM   53   C  C   . TYR A 1 57  ? -13.069 2.064   -35.358 1.00 26.37 ? 133  TYR A C   1 
ATOM   54   O  O   . TYR A 1 57  ? -12.071 2.774   -35.529 1.00 29.64 ? 133  TYR A O   1 
ATOM   55   C  CB  . TYR A 1 57  ? -13.731 1.004   -33.180 1.00 22.87 ? 133  TYR A CB  1 
ATOM   56   C  CG  . TYR A 1 57  ? -12.272 0.736   -32.884 1.00 24.25 ? 133  TYR A CG  1 
ATOM   57   C  CD1 . TYR A 1 57  ? -11.588 1.489   -31.939 1.00 22.74 ? 133  TYR A CD1 1 
ATOM   58   C  CD2 . TYR A 1 57  ? -11.575 -0.256  -33.561 1.00 25.80 ? 133  TYR A CD2 1 
ATOM   59   C  CE1 . TYR A 1 57  ? -10.250 1.256   -31.672 1.00 24.87 ? 133  TYR A CE1 1 
ATOM   60   C  CE2 . TYR A 1 57  ? -10.237 -0.498  -33.302 1.00 26.60 ? 133  TYR A CE2 1 
ATOM   61   C  CZ  . TYR A 1 57  ? -9.581  0.263   -32.357 1.00 26.06 ? 133  TYR A CZ  1 
ATOM   62   O  OH  . TYR A 1 57  ? -8.252  0.032   -32.097 1.00 30.19 ? 133  TYR A OH  1 
ATOM   63   N  N   . GLU A 1 58  ? -13.432 1.138   -36.247 1.00 27.10 ? 134  GLU A N   1 
ATOM   64   C  CA  . GLU A 1 58  ? -12.634 0.956   -37.457 1.00 29.36 ? 134  GLU A CA  1 
ATOM   65   C  C   . GLU A 1 58  ? -12.750 2.152   -38.402 1.00 24.31 ? 134  GLU A C   1 
ATOM   66   O  O   . GLU A 1 58  ? -11.779 2.493   -39.086 1.00 24.73 ? 134  GLU A O   1 
ATOM   67   C  CB  . GLU A 1 58  ? -13.029 -0.339  -38.167 1.00 33.79 ? 134  GLU A CB  1 
ATOM   68   C  CG  . GLU A 1 58  ? -12.458 -1.605  -37.520 1.00 39.35 ? 134  GLU A CG  1 
ATOM   69   C  CD  . GLU A 1 58  ? -10.933 -1.666  -37.548 0.78 41.20 ? 134  GLU A CD  1 
ATOM   70   O  OE1 . GLU A 1 58  ? -10.313 -1.003  -38.406 0.48 41.79 ? 134  GLU A OE1 1 
ATOM   71   O  OE2 . GLU A 1 58  ? -10.350 -2.382  -36.706 0.87 42.59 ? 134  GLU A OE2 1 
ATOM   72   N  N   . LEU A 1 59  ? -13.912 2.807   -38.451 1.00 23.77 ? 135  LEU A N   1 
ATOM   73   C  CA  . LEU A 1 59  ? -14.020 4.037   -39.233 1.00 22.49 ? 135  LEU A CA  1 
ATOM   74   C  C   . LEU A 1 59  ? -13.107 5.119   -38.668 1.00 24.52 ? 135  LEU A C   1 
ATOM   75   O  O   . LEU A 1 59  ? -12.507 5.897   -39.422 1.00 25.28 ? 135  LEU A O   1 
ATOM   76   C  CB  . LEU A 1 59  ? -15.471 4.515   -39.266 1.00 22.31 ? 135  LEU A CB  1 
ATOM   77   C  CG  . LEU A 1 59  ? -16.447 3.690   -40.113 1.00 22.64 ? 135  LEU A CG  1 
ATOM   78   C  CD1 . LEU A 1 59  ? -17.877 4.190   -39.929 1.00 22.94 ? 135  LEU A CD1 1 
ATOM   79   C  CD2 . LEU A 1 59  ? -16.052 3.718   -41.590 1.00 23.38 ? 135  LEU A CD2 1 
ATOM   80   N  N   . PHE A 1 60  ? -12.982 5.169   -37.339 1.00 22.19 ? 136  PHE A N   1 
ATOM   81   C  CA  . PHE A 1 60  ? -12.048 6.084   -36.690 1.00 21.75 ? 136  PHE A CA  1 
ATOM   82   C  C   . PHE A 1 60  ? -10.611 5.799   -37.113 1.00 22.16 ? 136  PHE A C   1 
ATOM   83   O  O   . PHE A 1 60  ? -9.854  6.726   -37.423 1.00 24.42 ? 136  PHE A O   1 
ATOM   84   C  CB  . PHE A 1 60  ? -12.235 5.979   -35.169 1.00 22.33 ? 136  PHE A CB  1 
ATOM   85   C  CG  . PHE A 1 60  ? -11.019 6.326   -34.344 1.00 22.52 ? 136  PHE A CG  1 
ATOM   86   C  CD1 . PHE A 1 60  ? -10.409 7.567   -34.443 1.00 26.04 ? 136  PHE A CD1 1 
ATOM   87   C  CD2 . PHE A 1 60  ? -10.531 5.417   -33.409 1.00 25.99 ? 136  PHE A CD2 1 
ATOM   88   C  CE1 . PHE A 1 60  ? -9.305  7.884   -33.650 1.00 25.87 ? 136  PHE A CE1 1 
ATOM   89   C  CE2 . PHE A 1 60  ? -9.434  5.724   -32.610 1.00 25.18 ? 136  PHE A CE2 1 
ATOM   90   C  CZ  . PHE A 1 60  ? -8.821  6.961   -32.731 1.00 26.51 ? 136  PHE A CZ  1 
ATOM   91   N  N   . LEU A 1 61  ? -10.222 4.524   -37.157 1.00 25.32 ? 137  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 61  ? -8.858  4.184   -37.558 1.00 29.16 ? 137  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 61  ? -8.573  4.627   -38.987 1.00 29.68 ? 137  LEU A C   1 
ATOM   94   O  O   . LEU A 1 61  ? -7.453  5.045   -39.301 1.00 31.55 ? 137  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 61  ? -8.619  2.680   -37.413 1.00 31.74 ? 137  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 61  ? -8.685  2.096   -35.998 1.00 31.53 ? 137  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 61  ? -8.231  0.641   -36.002 1.00 33.59 ? 137  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 61  ? -7.852  2.921   -35.030 1.00 31.54 ? 137  LEU A CD2 1 
ATOM   99   N  N   . THR A 1 62  ? -9.575  4.558   -39.864 1.00 27.27 ? 138  THR A N   1 
ATOM   100  C  CA  . THR A 1 62  ? -9.355  4.888   -41.270 1.00 26.68 ? 138  THR A CA  1 
ATOM   101  C  C   . THR A 1 62  ? -9.476  6.384   -41.537 1.00 29.66 ? 138  THR A C   1 
ATOM   102  O  O   . THR A 1 62  ? -8.646  6.954   -42.253 1.00 30.39 ? 138  THR A O   1 
ATOM   103  C  CB  . THR A 1 62  ? -10.339 4.116   -42.150 1.00 25.90 ? 138  THR A CB  1 
ATOM   104  O  OG1 . THR A 1 62  ? -10.173 2.713   -41.927 1.00 28.87 ? 138  THR A OG1 1 
ATOM   105  C  CG2 . THR A 1 62  ? -10.103 4.419   -43.634 1.00 23.03 ? 138  THR A CG2 1 
ATOM   106  N  N   . TYR A 1 63  ? -10.494 7.038   -40.975 1.00 28.42 ? 139  TYR A N   1 
ATOM   107  C  CA  . TYR A 1 63  ? -10.830 8.401   -41.361 1.00 28.07 ? 139  TYR A CA  1 
ATOM   108  C  C   . TYR A 1 63  ? -10.509 9.450   -40.303 1.00 27.45 ? 139  TYR A C   1 
ATOM   109  O  O   . TYR A 1 63  ? -10.634 10.645  -40.591 1.00 29.34 ? 139  TYR A O   1 
ATOM   110  C  CB  . TYR A 1 63  ? -12.313 8.474   -41.757 1.00 23.91 ? 139  TYR A CB  1 
ATOM   111  C  CG  . TYR A 1 63  ? -12.602 7.536   -42.904 1.00 21.30 ? 139  TYR A CG  1 
ATOM   112  C  CD1 . TYR A 1 63  ? -12.165 7.836   -44.193 1.00 23.18 ? 139  TYR A CD1 1 
ATOM   113  C  CD2 . TYR A 1 63  ? -13.255 6.327   -42.697 1.00 22.65 ? 139  TYR A CD2 1 
ATOM   114  C  CE1 . TYR A 1 63  ? -12.395 6.971   -45.249 1.00 24.85 ? 139  TYR A CE1 1 
ATOM   115  C  CE2 . TYR A 1 63  ? -13.490 5.450   -43.750 1.00 23.08 ? 139  TYR A CE2 1 
ATOM   116  C  CZ  . TYR A 1 63  ? -13.057 5.781   -45.022 1.00 25.85 ? 139  TYR A CZ  1 
ATOM   117  O  OH  . TYR A 1 63  ? -13.279 4.921   -46.075 1.00 27.87 ? 139  TYR A OH  1 
ATOM   118  N  N   . GLY A 1 64  ? -10.084 9.052   -39.110 1.00 24.89 ? 140  GLY A N   1 
ATOM   119  C  CA  . GLY A 1 64  ? -9.485  9.993   -38.180 1.00 24.10 ? 140  GLY A CA  1 
ATOM   120  C  C   . GLY A 1 64  ? -10.413 10.437  -37.067 1.00 25.14 ? 140  GLY A C   1 
ATOM   121  O  O   . GLY A 1 64  ? -11.531 9.944   -36.894 1.00 27.23 ? 140  GLY A O   1 
ATOM   122  N  N   . GLY A 1 65  ? -9.921  11.419  -36.306 1.00 24.03 ? 141  GLY A N   1 
ATOM   123  C  CA  . GLY A 1 65  ? -10.541 11.843  -35.061 1.00 24.16 ? 141  GLY A CA  1 
ATOM   124  C  C   . GLY A 1 65  ? -11.827 12.631  -35.210 1.00 23.60 ? 141  GLY A C   1 
ATOM   125  O  O   . GLY A 1 65  ? -12.488 12.885  -34.198 1.00 21.20 ? 141  GLY A O   1 
ATOM   126  N  N   . ILE A 1 66  ? -12.190 13.041  -36.423 1.00 21.95 ? 142  ILE A N   1 
ATOM   127  C  CA  . ILE A 1 66  ? -13.515 13.607  -36.649 1.00 22.34 ? 142  ILE A CA  1 
ATOM   128  C  C   . ILE A 1 66  ? -13.929 13.319  -38.085 1.00 23.03 ? 142  ILE A C   1 
ATOM   129  O  O   . ILE A 1 66  ? -13.203 13.633  -39.034 1.00 24.21 ? 142  ILE A O   1 
ATOM   130  C  CB  . ILE A 1 66  ? -13.584 15.118  -36.330 1.00 27.39 ? 142  ILE A CB  1 
ATOM   131  C  CG1 . ILE A 1 66  ? -14.985 15.649  -36.645 1.00 28.73 ? 142  ILE A CG1 1 
ATOM   132  C  CG2 . ILE A 1 66  ? -12.513 15.910  -37.083 1.00 29.09 ? 142  ILE A CG2 1 
ATOM   133  C  CD1 . ILE A 1 66  ? -15.286 16.998  -36.036 1.00 32.24 ? 142  ILE A CD1 1 
ATOM   134  N  N   . PHE A 1 67  ? -15.089 12.686  -38.237 1.00 22.99 ? 143  PHE A N   1 
ATOM   135  C  CA  . PHE A 1 67  ? -15.672 12.443  -39.546 1.00 24.06 ? 143  PHE A CA  1 
ATOM   136  C  C   . PHE A 1 67  ? -17.184 12.554  -39.422 1.00 22.90 ? 143  PHE A C   1 
ATOM   137  O  O   . PHE A 1 67  ? -17.744 12.488  -38.323 1.00 23.19 ? 143  PHE A O   1 
ATOM   138  C  CB  . PHE A 1 67  ? -15.260 11.070  -40.119 1.00 24.02 ? 143  PHE A CB  1 
ATOM   139  C  CG  . PHE A 1 67  ? -15.698 9.886   -39.282 1.00 24.50 ? 143  PHE A CG  1 
ATOM   140  C  CD1 . PHE A 1 67  ? -14.846 9.333   -38.336 1.00 23.94 ? 143  PHE A CD1 1 
ATOM   141  C  CD2 . PHE A 1 67  ? -16.945 9.305   -39.470 1.00 25.32 ? 143  PHE A CD2 1 
ATOM   142  C  CE1 . PHE A 1 67  ? -15.241 8.239   -37.572 1.00 24.61 ? 143  PHE A CE1 1 
ATOM   143  C  CE2 . PHE A 1 67  ? -17.343 8.204   -38.712 1.00 22.55 ? 143  PHE A CE2 1 
ATOM   144  C  CZ  . PHE A 1 67  ? -16.491 7.673   -37.767 1.00 22.53 ? 143  PHE A CZ  1 
ATOM   145  N  N   . ARG A 1 68  ? -17.837 12.734  -40.567 1.00 23.56 ? 144  ARG A N   1 
ATOM   146  C  CA  . ARG A 1 68  ? -19.286 12.867  -40.638 1.00 23.49 ? 144  ARG A CA  1 
ATOM   147  C  C   . ARG A 1 68  ? -19.881 11.537  -41.077 1.00 26.33 ? 144  ARG A C   1 
ATOM   148  O  O   . ARG A 1 68  ? -19.650 11.082  -42.204 1.00 26.48 ? 144  ARG A O   1 
ATOM   149  C  CB  . ARG A 1 68  ? -19.692 13.980  -41.601 1.00 24.11 ? 144  ARG A CB  1 
ATOM   150  C  CG  . ARG A 1 68  ? -21.191 14.183  -41.677 1.00 23.73 ? 144  ARG A CG  1 
ATOM   151  C  CD  . ARG A 1 68  ? -21.562 15.312  -42.630 1.00 26.33 ? 144  ARG A CD  1 
ATOM   152  N  NE  . ARG A 1 68  ? -20.941 16.579  -42.244 1.00 26.09 ? 144  ARG A NE  1 
ATOM   153  C  CZ  . ARG A 1 68  ? -21.449 17.433  -41.357 1.00 27.97 ? 144  ARG A CZ  1 
ATOM   154  N  NH1 . ARG A 1 68  ? -22.597 17.167  -40.748 1.00 26.05 ? 144  ARG A NH1 1 
ATOM   155  N  NH2 . ARG A 1 68  ? -20.802 18.556  -41.076 1.00 26.13 ? 144  ARG A NH2 1 
ATOM   156  N  N   . LEU A 1 69  ? -20.646 10.919  -40.188 1.00 23.90 ? 145  LEU A N   1 
ATOM   157  C  CA  . LEU A 1 69  ? -21.374 9.695   -40.496 1.00 23.38 ? 145  LEU A CA  1 
ATOM   158  C  C   . LEU A 1 69  ? -22.731 10.097  -41.057 1.00 26.23 ? 145  LEU A C   1 
ATOM   159  O  O   . LEU A 1 69  ? -23.567 10.635  -40.328 1.00 25.32 ? 145  LEU A O   1 
ATOM   160  C  CB  . LEU A 1 69  ? -21.529 8.841   -39.240 1.00 23.45 ? 145  LEU A CB  1 
ATOM   161  C  CG  . LEU A 1 69  ? -22.251 7.503   -39.387 1.00 25.72 ? 145  LEU A CG  1 
ATOM   162  C  CD1 . LEU A 1 69  ? -21.343 6.488   -40.070 1.00 25.10 ? 145  LEU A CD1 1 
ATOM   163  C  CD2 . LEU A 1 69  ? -22.703 7.002   -38.022 1.00 27.08 ? 145  LEU A CD2 1 
ATOM   164  N  N   . THR A 1 70  ? -22.953 9.850   -42.347 1.00 28.57 ? 146  THR A N   1 
ATOM   165  C  CA  . THR A 1 70  ? -24.196 10.244  -42.996 1.00 29.75 ? 146  THR A CA  1 
ATOM   166  C  C   . THR A 1 70  ? -25.067 9.028   -43.282 1.00 28.89 ? 146  THR A C   1 
ATOM   167  O  O   . THR A 1 70  ? -24.572 7.963   -43.666 1.00 30.51 ? 146  THR A O   1 
ATOM   168  C  CB  . THR A 1 70  ? -23.934 11.017  -44.293 1.00 31.66 ? 146  THR A CB  1 
ATOM   169  O  OG1 . THR A 1 70  ? -23.611 10.105  -45.344 1.00 40.60 ? 146  THR A OG1 1 
ATOM   170  C  CG2 . THR A 1 70  ? -22.782 11.980  -44.102 1.00 27.89 ? 146  THR A CG2 1 
ATOM   171  N  N   . PHE A 1 71  ? -26.370 9.201   -43.081 1.00 28.16 ? 147  PHE A N   1 
ATOM   172  C  CA  . PHE A 1 71  ? -27.357 8.153   -43.322 1.00 29.80 ? 147  PHE A CA  1 
ATOM   173  C  C   . PHE A 1 71  ? -28.559 8.849   -43.949 1.00 32.09 ? 147  PHE A C   1 
ATOM   174  O  O   . PHE A 1 71  ? -29.384 9.442   -43.247 1.00 33.62 ? 147  PHE A O   1 
ATOM   175  C  CB  . PHE A 1 71  ? -27.725 7.396   -42.042 1.00 32.63 ? 147  PHE A CB  1 
ATOM   176  C  CG  . PHE A 1 71  ? -27.756 8.251   -40.799 0.94 34.65 ? 147  PHE A CG  1 
ATOM   177  C  CD1 . PHE A 1 71  ? -26.582 8.598   -40.145 0.81 34.35 ? 147  PHE A CD1 1 
ATOM   178  C  CD2 . PHE A 1 71  ? -28.962 8.676   -40.263 0.97 37.27 ? 147  PHE A CD2 1 
ATOM   179  C  CE1 . PHE A 1 71  ? -26.606 9.378   -39.001 0.67 34.01 ? 147  PHE A CE1 1 
ATOM   180  C  CE2 . PHE A 1 71  ? -28.993 9.456   -39.116 0.99 35.23 ? 147  PHE A CE2 1 
ATOM   181  C  CZ  . PHE A 1 71  ? -27.811 9.808   -38.487 0.87 33.93 ? 147  PHE A CZ  1 
ATOM   182  N  N   . GLY A 1 72  ? -28.640 8.793   -45.274 1.00 34.26 ? 148  GLY A N   1 
ATOM   183  C  CA  . GLY A 1 72  ? -29.640 9.535   -46.001 1.00 36.82 ? 148  GLY A CA  1 
ATOM   184  C  C   . GLY A 1 72  ? -29.415 11.027  -45.872 1.00 37.10 ? 148  GLY A C   1 
ATOM   185  O  O   . GLY A 1 72  ? -28.299 11.525  -46.048 1.00 38.20 ? 148  GLY A O   1 
ATOM   186  N  N   . PRO A 1 73  ? -30.476 11.772  -45.553 1.00 37.18 ? 149  PRO A N   1 
ATOM   187  C  CA  . PRO A 1 73  ? -30.350 13.227  -45.398 1.00 37.96 ? 149  PRO A CA  1 
ATOM   188  C  C   . PRO A 1 73  ? -29.872 13.678  -44.024 1.00 38.41 ? 149  PRO A C   1 
ATOM   189  O  O   . PRO A 1 73  ? -29.759 14.889  -43.802 1.00 41.55 ? 149  PRO A O   1 
ATOM   190  C  CB  . PRO A 1 73  ? -31.781 13.712  -45.662 1.00 38.99 ? 149  PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 73  ? -32.626 12.603  -45.120 1.00 38.73 ? 149  PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 73  ? -31.870 11.320  -45.401 1.00 37.04 ? 149  PRO A CD  1 
ATOM   193  N  N   . LYS A 1 74  ? -29.595 12.763  -43.100 1.00 33.86 ? 150  LYS A N   1 
ATOM   194  C  CA  . LYS A 1 74  ? -29.155 13.114  -41.757 1.00 33.73 ? 150  LYS A CA  1 
ATOM   195  C  C   . LYS A 1 74  ? -27.725 12.644  -41.528 1.00 29.77 ? 150  LYS A C   1 
ATOM   196  O  O   . LYS A 1 74  ? -27.202 11.796  -42.258 1.00 29.82 ? 150  LYS A O   1 
ATOM   197  C  CB  . LYS A 1 74  ? -30.081 12.506  -40.701 1.00 38.46 ? 150  LYS A CB  1 
ATOM   198  C  CG  . LYS A 1 74  ? -31.520 12.962  -40.817 1.00 47.60 ? 150  LYS A CG  1 
ATOM   199  C  CD  . LYS A 1 74  ? -32.346 12.490  -39.629 1.00 54.53 ? 150  LYS A CD  1 
ATOM   200  C  CE  . LYS A 1 74  ? -33.756 13.064  -39.679 1.00 60.23 ? 150  LYS A CE  1 
ATOM   201  N  NZ  . LYS A 1 74  ? -34.542 12.735  -38.453 1.00 63.32 ? 150  LYS A NZ  1 
ATOM   202  N  N   . SER A 1 75  ? -27.091 13.199  -40.498 1.00 27.90 ? 151  SER A N   1 
ATOM   203  C  CA  . SER A 1 75  ? -25.704 12.850  -40.228 1.00 26.28 ? 151  SER A CA  1 
ATOM   204  C  C   . SER A 1 75  ? -25.351 13.185  -38.787 1.00 26.45 ? 151  SER A C   1 
ATOM   205  O  O   . SER A 1 75  ? -25.968 14.047  -38.158 1.00 25.10 ? 151  SER A O   1 
ATOM   206  C  CB  . SER A 1 75  ? -24.751 13.572  -41.187 1.00 29.18 ? 151  SER A CB  1 
ATOM   207  O  OG  . SER A 1 75  ? -24.660 14.951  -40.878 1.00 30.87 ? 151  SER A OG  1 
ATOM   208  N  N   . PHE A 1 76  ? -24.340 12.481  -38.280 1.00 24.26 ? 152  PHE A N   1 
ATOM   209  C  CA  . PHE A 1 76  ? -23.700 12.769  -37.006 1.00 23.11 ? 152  PHE A CA  1 
ATOM   210  C  C   . PHE A 1 76  ? -22.227 13.070  -37.244 1.00 21.58 ? 152  PHE A C   1 
ATOM   211  O  O   . PHE A 1 76  ? -21.601 12.491  -38.132 1.00 24.08 ? 152  PHE A O   1 
ATOM   212  C  CB  . PHE A 1 76  ? -23.781 11.582  -36.039 1.00 24.17 ? 152  PHE A CB  1 
ATOM   213  C  CG  . PHE A 1 76  ? -25.173 11.173  -35.664 1.00 30.06 ? 152  PHE A CG  1 
ATOM   214  C  CD1 . PHE A 1 76  ? -26.161 12.115  -35.451 1.00 32.65 ? 152  PHE A CD1 1 
ATOM   215  C  CD2 . PHE A 1 76  ? -25.481 9.830   -35.486 1.00 34.22 ? 152  PHE A CD2 1 
ATOM   216  C  CE1 . PHE A 1 76  ? -27.441 11.725  -35.085 1.00 35.71 ? 152  PHE A CE1 1 
ATOM   217  C  CE2 . PHE A 1 76  ? -26.758 9.431   -35.120 1.00 34.68 ? 152  PHE A CE2 1 
ATOM   218  C  CZ  . PHE A 1 76  ? -27.738 10.380  -34.921 1.00 36.99 ? 152  PHE A CZ  1 
ATOM   219  N  N   . LEU A 1 77  ? -21.662 13.953  -36.430 1.00 20.55 ? 153  LEU A N   1 
ATOM   220  C  CA  . LEU A 1 77  ? -20.214 14.091  -36.347 1.00 19.02 ? 153  LEU A CA  1 
ATOM   221  C  C   . LEU A 1 77  ? -19.697 13.131  -35.286 1.00 23.21 ? 153  LEU A C   1 
ATOM   222  O  O   . LEU A 1 77  ? -20.180 13.145  -34.150 1.00 22.99 ? 153  LEU A O   1 
ATOM   223  C  CB  . LEU A 1 77  ? -19.813 15.526  -36.000 1.00 19.04 ? 153  LEU A CB  1 
ATOM   224  C  CG  . LEU A 1 77  ? -20.236 16.602  -37.002 1.00 19.79 ? 153  LEU A CG  1 
ATOM   225  C  CD1 . LEU A 1 77  ? -19.642 17.962  -36.634 1.00 16.70 ? 153  LEU A CD1 1 
ATOM   226  C  CD2 . LEU A 1 77  ? -19.839 16.186  -38.423 1.00 20.13 ? 153  LEU A CD2 1 
ATOM   227  N  N   . ILE A 1 78  ? -18.727 12.298  -35.655 1.00 23.38 ? 154  ILE A N   1 
ATOM   228  C  CA  . ILE A 1 78  ? -18.131 11.328  -34.742 1.00 21.15 ? 154  ILE A CA  1 
ATOM   229  C  C   . ILE A 1 78  ? -16.761 11.848  -34.324 1.00 24.14 ? 154  ILE A C   1 
ATOM   230  O  O   . ILE A 1 78  ? -15.869 12.015  -35.166 1.00 22.05 ? 154  ILE A O   1 
ATOM   231  C  CB  . ILE A 1 78  ? -18.017 9.937   -35.387 1.00 23.03 ? 154  ILE A CB  1 
ATOM   232  C  CG1 . ILE A 1 78  ? -19.341 9.522   -36.045 1.00 20.75 ? 154  ILE A CG1 1 
ATOM   233  C  CG2 . ILE A 1 78  ? -17.554 8.920   -34.345 1.00 20.37 ? 154  ILE A CG2 1 
ATOM   234  C  CD1 . ILE A 1 78  ? -20.538 9.500   -35.093 1.00 22.11 ? 154  ILE A CD1 1 
ATOM   235  N  N   . VAL A 1 79  ? -16.591 12.094  -33.026 1.00 20.94 ? 155  VAL A N   1 
ATOM   236  C  CA  . VAL A 1 79  ? -15.372 12.670  -32.467 1.00 21.59 ? 155  VAL A CA  1 
ATOM   237  C  C   . VAL A 1 79  ? -14.654 11.600  -31.651 1.00 22.95 ? 155  VAL A C   1 
ATOM   238  O  O   . VAL A 1 79  ? -15.221 11.045  -30.700 1.00 20.49 ? 155  VAL A O   1 
ATOM   239  C  CB  . VAL A 1 79  ? -15.675 13.908  -31.606 1.00 21.01 ? 155  VAL A CB  1 
ATOM   240  C  CG1 . VAL A 1 79  ? -14.434 14.346  -30.857 1.00 19.94 ? 155  VAL A CG1 1 
ATOM   241  C  CG2 . VAL A 1 79  ? -16.194 15.047  -32.479 1.00 23.40 ? 155  VAL A CG2 1 
ATOM   242  N  N   . SER A 1 80  ? -13.398 11.321  -32.017 1.00 20.53 ? 156  SER A N   1 
ATOM   243  C  CA  . SER A 1 80  ? -12.575 10.339  -31.324 1.00 20.26 ? 156  SER A CA  1 
ATOM   244  C  C   . SER A 1 80  ? -11.215 10.909  -30.948 1.00 22.83 ? 156  SER A C   1 
ATOM   245  O  O   . SER A 1 80  ? -10.313 10.145  -30.578 1.00 24.88 ? 156  SER A O   1 
ATOM   246  C  CB  . SER A 1 80  ? -12.387 9.087   -32.189 1.00 20.00 ? 156  SER A CB  1 
ATOM   247  O  OG  . SER A 1 80  ? -13.615 8.687   -32.770 1.00 19.52 ? 156  SER A OG  1 
ATOM   248  N  N   . ASP A 1 81  ? -11.044 12.222  -31.057 1.00 24.03 ? 157  ASP A N   1 
ATOM   249  C  CA  . ASP A 1 81  ? -9.787  12.903  -30.808 1.00 23.22 ? 157  ASP A CA  1 
ATOM   250  C  C   . ASP A 1 81  ? -9.844  13.522  -29.424 1.00 20.28 ? 157  ASP A C   1 
ATOM   251  O  O   . ASP A 1 81  ? -10.771 14.300  -29.149 1.00 22.12 ? 157  ASP A O   1 
ATOM   252  C  CB  . ASP A 1 81  ? -9.570  13.980  -31.870 1.00 27.98 ? 157  ASP A CB  1 
ATOM   253  C  CG  . ASP A 1 81  ? -8.222  14.684  -31.759 1.00 32.33 ? 157  ASP A CG  1 
ATOM   254  O  OD1 . ASP A 1 81  ? -7.792  15.048  -30.645 1.00 34.05 ? 157  ASP A OD1 1 
ATOM   255  O  OD2 . ASP A 1 81  ? -7.599  14.900  -32.817 1.00 36.00 ? 157  ASP A OD2 1 
ATOM   256  N  N   . PRO A 1 82  ? -8.904  13.213  -28.526 1.00 21.94 ? 158  PRO A N   1 
ATOM   257  C  CA  . PRO A 1 82  ? -9.004  13.752  -27.155 1.00 21.85 ? 158  PRO A CA  1 
ATOM   258  C  C   . PRO A 1 82  ? -8.947  15.267  -27.099 1.00 23.83 ? 158  PRO A C   1 
ATOM   259  O  O   . PRO A 1 82  ? -9.626  15.874  -26.260 1.00 23.62 ? 158  PRO A O   1 
ATOM   260  C  CB  . PRO A 1 82  ? -7.812  13.108  -26.434 1.00 22.87 ? 158  PRO A CB  1 
ATOM   261  C  CG  . PRO A 1 82  ? -6.864  12.707  -27.513 1.00 25.19 ? 158  PRO A CG  1 
ATOM   262  C  CD  . PRO A 1 82  ? -7.711  12.370  -28.712 1.00 21.51 ? 158  PRO A CD  1 
ATOM   263  N  N   . SER A 1 83  ? -8.171  15.900  -27.982 1.00 23.90 ? 159  SER A N   1 
ATOM   264  C  CA  . SER A 1 83  ? -8.124  17.357  -28.002 1.00 28.00 ? 159  SER A CA  1 
ATOM   265  C  C   . SER A 1 83  ? -9.470  17.946  -28.418 1.00 25.50 ? 159  SER A C   1 
ATOM   266  O  O   . SER A 1 83  ? -9.926  18.937  -27.835 1.00 25.94 ? 159  SER A O   1 
ATOM   267  C  CB  . SER A 1 83  ? -7.008  17.829  -28.936 1.00 30.86 ? 159  SER A CB  1 
ATOM   268  O  OG  . SER A 1 83  ? -6.978  19.240  -29.020 1.00 35.92 ? 159  SER A OG  1 
ATOM   269  N  N   . ILE A 1 84  ? -10.124 17.345  -29.415 1.00 24.27 ? 160  ILE A N   1 
ATOM   270  C  CA  . ILE A 1 84  ? -11.440 17.819  -29.836 1.00 23.34 ? 160  ILE A CA  1 
ATOM   271  C  C   . ILE A 1 84  ? -12.474 17.559  -28.747 1.00 23.29 ? 160  ILE A C   1 
ATOM   272  O  O   . ILE A 1 84  ? -13.325 18.410  -28.464 1.00 24.35 ? 160  ILE A O   1 
ATOM   273  C  CB  . ILE A 1 84  ? -11.839 17.164  -31.170 1.00 21.37 ? 160  ILE A CB  1 
ATOM   274  C  CG1 . ILE A 1 84  ? -10.760 17.423  -32.221 1.00 23.07 ? 160  ILE A CG1 1 
ATOM   275  C  CG2 . ILE A 1 84  ? -13.199 17.681  -31.648 1.00 18.40 ? 160  ILE A CG2 1 
ATOM   276  C  CD1 . ILE A 1 84  ? -11.078 16.831  -33.573 1.00 23.91 ? 160  ILE A CD1 1 
ATOM   277  N  N   . ALA A 1 85  ? -12.419 16.380  -28.120 1.00 23.34 ? 161  ALA A N   1 
ATOM   278  C  CA  . ALA A 1 85  ? -13.311 16.089  -27.000 1.00 22.37 ? 161  ALA A CA  1 
ATOM   279  C  C   . ALA A 1 85  ? -13.142 17.109  -25.881 1.00 23.66 ? 161  ALA A C   1 
ATOM   280  O  O   . ALA A 1 85  ? -14.130 17.581  -25.305 1.00 21.96 ? 161  ALA A O   1 
ATOM   281  C  CB  . ALA A 1 85  ? -13.054 14.677  -26.472 1.00 18.97 ? 161  ALA A CB  1 
ATOM   282  N  N   . LYS A 1 86  ? -11.896 17.475  -25.573 1.00 23.39 ? 162  LYS A N   1 
ATOM   283  C  CA  . LYS A 1 86  ? -11.650 18.466  -24.531 1.00 23.20 ? 162  LYS A CA  1 
ATOM   284  C  C   . LYS A 1 86  ? -12.218 19.825  -24.918 1.00 21.97 ? 162  LYS A C   1 
ATOM   285  O  O   . LYS A 1 86  ? -12.726 20.559  -24.061 1.00 21.92 ? 162  LYS A O   1 
ATOM   286  C  CB  . LYS A 1 86  ? -10.149 18.558  -24.256 1.00 27.90 ? 162  LYS A CB  1 
ATOM   287  C  CG  . LYS A 1 86  ? -9.739  19.549  -23.175 1.00 32.57 ? 162  LYS A CG  1 
ATOM   288  C  CD  . LYS A 1 86  ? -8.282  19.323  -22.799 1.00 39.84 ? 162  LYS A CD  1 
ATOM   289  C  CE  . LYS A 1 86  ? -7.489  20.609  -22.824 1.00 47.01 ? 162  LYS A CE  1 
ATOM   290  N  NZ  . LYS A 1 86  ? -7.898  21.520  -21.720 1.00 50.82 ? 162  LYS A NZ  1 
ATOM   291  N  N   . HIS A 1 87  ? -12.141 20.175  -26.205 1.00 20.85 ? 163  HIS A N   1 
ATOM   292  C  CA  . HIS A 1 87  ? -12.688 21.446  -26.668 1.00 24.11 ? 163  HIS A CA  1 
ATOM   293  C  C   . HIS A 1 87  ? -14.197 21.503  -26.465 1.00 23.74 ? 163  HIS A C   1 
ATOM   294  O  O   . HIS A 1 87  ? -14.733 22.523  -26.018 1.00 24.60 ? 163  HIS A O   1 
ATOM   295  C  CB  . HIS A 1 87  ? -12.333 21.654  -28.142 1.00 24.50 ? 163  HIS A CB  1 
ATOM   296  C  CG  . HIS A 1 87  ? -12.762 22.980  -28.692 1.00 27.26 ? 163  HIS A CG  1 
ATOM   297  N  ND1 . HIS A 1 87  ? -12.124 24.160  -28.373 1.00 28.75 ? 163  HIS A ND1 1 
ATOM   298  C  CD2 . HIS A 1 87  ? -13.760 23.311  -29.545 1.00 26.63 ? 163  HIS A CD2 1 
ATOM   299  C  CE1 . HIS A 1 87  ? -12.712 25.160  -29.005 1.00 28.80 ? 163  HIS A CE1 1 
ATOM   300  N  NE2 . HIS A 1 87  ? -13.708 24.672  -29.723 1.00 29.11 ? 163  HIS A NE2 1 
ATOM   301  N  N   . ILE A 1 88  ? -14.891 20.409  -26.774 1.00 21.08 ? 164  ILE A N   1 
ATOM   302  C  CA  . ILE A 1 88  ? -16.346 20.364  -26.676 1.00 20.12 ? 164  ILE A CA  1 
ATOM   303  C  C   . ILE A 1 88  ? -16.794 20.247  -25.226 1.00 22.69 ? 164  ILE A C   1 
ATOM   304  O  O   . ILE A 1 88  ? -17.725 20.935  -24.791 1.00 24.87 ? 164  ILE A O   1 
ATOM   305  C  CB  . ILE A 1 88  ? -16.888 19.191  -27.516 1.00 21.02 ? 164  ILE A CB  1 
ATOM   306  C  CG1 . ILE A 1 88  ? -16.603 19.419  -29.004 1.00 19.72 ? 164  ILE A CG1 1 
ATOM   307  C  CG2 . ILE A 1 88  ? -18.374 18.981  -27.251 1.00 19.40 ? 164  ILE A CG2 1 
ATOM   308  C  CD1 . ILE A 1 88  ? -16.799 18.173  -29.853 1.00 18.77 ? 164  ILE A CD1 1 
ATOM   309  N  N   . LEU A 1 89  ? -16.156 19.355  -24.464 1.00 22.13 ? 165  LEU A N   1 
ATOM   310  C  CA  . LEU A 1 89  ? -16.619 19.048  -23.114 1.00 21.73 ? 165  LEU A CA  1 
ATOM   311  C  C   . LEU A 1 89  ? -16.205 20.100  -22.100 1.00 25.21 ? 165  LEU A C   1 
ATOM   312  O  O   . LEU A 1 89  ? -16.931 20.330  -21.124 1.00 25.95 ? 165  LEU A O   1 
ATOM   313  C  CB  . LEU A 1 89  ? -16.090 17.684  -22.671 1.00 17.81 ? 165  LEU A CB  1 
ATOM   314  C  CG  . LEU A 1 89  ? -16.624 16.485  -23.461 1.00 21.33 ? 165  LEU A CG  1 
ATOM   315  C  CD1 . LEU A 1 89  ? -15.907 15.209  -23.044 1.00 21.97 ? 165  LEU A CD1 1 
ATOM   316  C  CD2 . LEU A 1 89  ? -18.125 16.355  -23.254 1.00 20.70 ? 165  LEU A CD2 1 
ATOM   317  N  N   . LYS A 1 90  ? -15.046 20.731  -22.289 1.00 23.30 ? 166  LYS A N   1 
ATOM   318  C  CA  . LYS A 1 90  ? -14.514 21.633  -21.272 1.00 26.91 ? 166  LYS A CA  1 
ATOM   319  C  C   . LYS A 1 90  ? -14.230 23.030  -21.808 1.00 26.78 ? 166  LYS A C   1 
ATOM   320  O  O   . LYS A 1 90  ? -14.847 23.992  -21.343 1.00 30.31 ? 166  LYS A O   1 
ATOM   321  C  CB  . LYS A 1 90  ? -13.249 21.038  -20.647 1.00 28.74 ? 166  LYS A CB  1 
ATOM   322  C  CG  . LYS A 1 90  ? -12.719 21.877  -19.507 1.00 32.67 ? 166  LYS A CG  1 
ATOM   323  C  CD  . LYS A 1 90  ? -11.390 21.365  -18.988 1.00 37.63 ? 166  LYS A CD  1 
ATOM   324  C  CE  . LYS A 1 90  ? -10.907 22.252  -17.850 1.00 42.66 ? 166  LYS A CE  1 
ATOM   325  N  NZ  . LYS A 1 90  ? -9.526  21.913  -17.437 1.00 46.80 ? 166  LYS A NZ  1 
ATOM   326  N  N   . ASP A 1 91  ? -13.308 23.180  -22.762 1.00 26.27 ? 167  ASP A N   1 
ATOM   327  C  CA  . ASP A 1 91  ? -12.830 24.515  -23.120 1.00 29.83 ? 167  ASP A CA  1 
ATOM   328  C  C   . ASP A 1 91  ? -13.951 25.395  -23.663 1.00 31.29 ? 167  ASP A C   1 
ATOM   329  O  O   . ASP A 1 91  ? -14.009 26.593  -23.363 1.00 30.08 ? 167  ASP A O   1 
ATOM   330  C  CB  . ASP A 1 91  ? -11.699 24.417  -24.146 1.00 33.56 ? 167  ASP A CB  1 
ATOM   331  C  CG  . ASP A 1 91  ? -10.561 23.529  -23.682 1.00 37.17 ? 167  ASP A CG  1 
ATOM   332  O  OD1 . ASP A 1 91  ? -10.421 23.327  -22.458 1.00 36.97 ? 167  ASP A OD1 1 
ATOM   333  O  OD2 . ASP A 1 91  ? -9.810  23.031  -24.548 1.00 38.61 ? 167  ASP A OD2 1 
ATOM   334  N  N   . ASN A 1 92  ? -14.841 24.831  -24.472 1.00 28.29 ? 168  ASN A N   1 
ATOM   335  C  CA  . ASN A 1 92  ? -15.850 25.616  -25.171 1.00 28.27 ? 168  ASN A CA  1 
ATOM   336  C  C   . ASN A 1 92  ? -17.228 24.999  -24.984 1.00 29.03 ? 168  ASN A C   1 
ATOM   337  O  O   . ASN A 1 92  ? -18.052 24.976  -25.906 1.00 26.14 ? 168  ASN A O   1 
ATOM   338  C  CB  . ASN A 1 92  ? -15.498 25.739  -26.651 1.00 28.64 ? 168  ASN A CB  1 
ATOM   339  C  CG  . ASN A 1 92  ? -16.269 26.840  -27.349 1.00 29.79 ? 168  ASN A CG  1 
ATOM   340  O  OD1 . ASN A 1 92  ? -16.649 27.835  -26.736 1.00 31.92 ? 168  ASN A OD1 1 
ATOM   341  N  ND2 . ASN A 1 92  ? -16.508 26.662  -28.644 1.00 28.98 ? 168  ASN A ND2 1 
ATOM   342  N  N   . ALA A 1 93  ? -17.494 24.488  -23.776 1.00 26.95 ? 169  ALA A N   1 
ATOM   343  C  CA  . ALA A 1 93  ? -18.758 23.808  -23.505 1.00 26.15 ? 169  ALA A CA  1 
ATOM   344  C  C   . ALA A 1 93  ? -19.958 24.718  -23.737 1.00 25.16 ? 169  ALA A C   1 
ATOM   345  O  O   . ALA A 1 93  ? -21.043 24.234  -24.078 1.00 24.03 ? 169  ALA A O   1 
ATOM   346  C  CB  . ALA A 1 93  ? -18.774 23.277  -22.066 1.00 24.67 ? 169  ALA A CB  1 
ATOM   347  N  N   . LYS A 1 94  ? -19.785 26.033  -23.575 1.00 25.64 ? 170  LYS A N   1 
ATOM   348  C  CA  . LYS A 1 94  ? -20.904 26.956  -23.730 1.00 27.60 ? 170  LYS A CA  1 
ATOM   349  C  C   . LYS A 1 94  ? -21.473 26.958  -25.146 1.00 29.21 ? 170  LYS A C   1 
ATOM   350  O  O   . LYS A 1 94  ? -22.578 27.471  -25.355 1.00 29.67 ? 170  LYS A O   1 
ATOM   351  C  CB  . LYS A 1 94  ? -20.474 28.373  -23.347 1.00 32.02 ? 170  LYS A CB  1 
ATOM   352  C  CG  . LYS A 1 94  ? -19.516 29.009  -24.339 1.00 36.85 ? 170  LYS A CG  1 
ATOM   353  C  CD  . LYS A 1 94  ? -19.133 30.412  -23.902 1.00 43.28 ? 170  LYS A CD  1 
ATOM   354  C  CE  . LYS A 1 94  ? -18.245 31.086  -24.931 1.00 48.22 ? 170  LYS A CE  1 
ATOM   355  N  NZ  . LYS A 1 94  ? -17.892 32.467  -24.507 1.00 53.70 ? 170  LYS A NZ  1 
ATOM   356  N  N   . ALA A 1 95  ? -20.754 26.405  -26.120 1.00 27.54 ? 171  ALA A N   1 
ATOM   357  C  CA  . ALA A 1 95  ? -21.236 26.349  -27.495 1.00 26.08 ? 171  ALA A CA  1 
ATOM   358  C  C   . ALA A 1 95  ? -22.046 25.093  -27.792 1.00 25.62 ? 171  ALA A C   1 
ATOM   359  O  O   . ALA A 1 95  ? -22.354 24.834  -28.960 1.00 26.69 ? 171  ALA A O   1 
ATOM   360  C  CB  . ALA A 1 95  ? -20.062 26.438  -28.474 1.00 24.40 ? 171  ALA A CB  1 
ATOM   361  N  N   . TYR A 1 96  ? -22.405 24.313  -26.770 1.00 23.51 ? 172  TYR A N   1 
ATOM   362  C  CA  . TYR A 1 96  ? -23.013 23.009  -26.989 1.00 23.99 ? 172  TYR A CA  1 
ATOM   363  C  C   . TYR A 1 96  ? -24.170 22.793  -26.029 1.00 26.42 ? 172  TYR A C   1 
ATOM   364  O  O   . TYR A 1 96  ? -24.155 23.267  -24.889 1.00 30.25 ? 172  TYR A O   1 
ATOM   365  C  CB  . TYR A 1 96  ? -21.975 21.879  -26.847 1.00 21.54 ? 172  TYR A CB  1 
ATOM   366  C  CG  . TYR A 1 96  ? -20.911 21.992  -27.907 1.00 24.07 ? 172  TYR A CG  1 
ATOM   367  C  CD1 . TYR A 1 96  ? -21.106 21.448  -29.171 1.00 24.15 ? 172  TYR A CD1 1 
ATOM   368  C  CD2 . TYR A 1 96  ? -19.736 22.690  -27.668 1.00 24.50 ? 172  TYR A CD2 1 
ATOM   369  C  CE1 . TYR A 1 96  ? -20.151 21.581  -30.158 1.00 25.07 ? 172  TYR A CE1 1 
ATOM   370  C  CE2 . TYR A 1 96  ? -18.770 22.829  -28.658 1.00 23.68 ? 172  TYR A CE2 1 
ATOM   371  C  CZ  . TYR A 1 96  ? -18.986 22.270  -29.898 1.00 25.48 ? 172  TYR A CZ  1 
ATOM   372  O  OH  . TYR A 1 96  ? -18.037 22.396  -30.892 1.00 25.83 ? 172  TYR A OH  1 
ATOM   373  N  N   . SER A 1 97  ? -25.187 22.095  -26.518 1.00 23.86 ? 173  SER A N   1 
ATOM   374  C  CA  . SER A 1 97  ? -26.277 21.592  -25.696 1.00 25.41 ? 173  SER A CA  1 
ATOM   375  C  C   . SER A 1 97  ? -26.172 20.075  -25.632 1.00 24.16 ? 173  SER A C   1 
ATOM   376  O  O   . SER A 1 97  ? -25.328 19.466  -26.295 1.00 21.92 ? 173  SER A O   1 
ATOM   377  C  CB  . SER A 1 97  ? -27.630 22.023  -26.261 1.00 26.91 ? 173  SER A CB  1 
ATOM   378  O  OG  . SER A 1 97  ? -27.948 21.255  -27.409 1.00 27.40 ? 173  SER A OG  1 
ATOM   379  N  N   . LYS A 1 98  ? -27.048 19.458  -24.836 1.00 22.53 ? 174  LYS A N   1 
ATOM   380  C  CA  . LYS A 1 98  ? -27.107 18.003  -24.793 1.00 20.44 ? 174  LYS A CA  1 
ATOM   381  C  C   . LYS A 1 98  ? -27.822 17.408  -26.003 1.00 23.04 ? 174  LYS A C   1 
ATOM   382  O  O   . LYS A 1 98  ? -27.840 16.183  -26.151 1.00 21.19 ? 174  LYS A O   1 
ATOM   383  C  CB  . LYS A 1 98  ? -27.785 17.539  -23.497 1.00 19.76 ? 174  LYS A CB  1 
ATOM   384  C  CG  . LYS A 1 98  ? -26.960 17.788  -22.225 1.00 20.90 ? 174  LYS A CG  1 
ATOM   385  C  CD  . LYS A 1 98  ? -25.556 17.206  -22.355 1.00 20.45 ? 174  LYS A CD  1 
ATOM   386  C  CE  . LYS A 1 98  ? -24.829 17.154  -21.010 1.00 20.34 ? 174  LYS A CE  1 
ATOM   387  N  NZ  . LYS A 1 98  ? -25.306 16.011  -20.185 1.00 23.06 ? 174  LYS A NZ  1 
ATOM   388  N  N   . GLY A 1 99  ? -28.402 18.239  -26.867 1.00 28.36 ? 175  GLY A N   1 
ATOM   389  C  CA  . GLY A 1 99  ? -28.998 17.787  -28.112 1.00 28.26 ? 175  GLY A CA  1 
ATOM   390  C  C   . GLY A 1 99  ? -29.922 16.586  -28.018 1.00 26.72 ? 175  GLY A C   1 
ATOM   391  O  O   . GLY A 1 99  ? -30.916 16.613  -27.287 1.00 26.40 ? 175  GLY A O   1 
ATOM   392  N  N   . ILE A 1 100 ? -29.586 15.522  -28.758 1.00 22.28 ? 176  ILE A N   1 
ATOM   393  C  CA  . ILE A 1 100 ? -30.436 14.336  -28.849 1.00 26.22 ? 176  ILE A CA  1 
ATOM   394  C  C   . ILE A 1 100 ? -30.602 13.668  -27.490 1.00 28.49 ? 176  ILE A C   1 
ATOM   395  O  O   . ILE A 1 100 ? -31.614 13.001  -27.236 1.00 29.68 ? 176  ILE A O   1 
ATOM   396  C  CB  . ILE A 1 100 ? -29.856 13.361  -29.902 1.00 27.65 ? 176  ILE A CB  1 
ATOM   397  C  CG1 . ILE A 1 100 ? -30.588 13.509  -31.230 1.00 34.54 ? 176  ILE A CG1 1 
ATOM   398  C  CG2 . ILE A 1 100 ? -29.917 11.921  -29.452 1.00 28.55 ? 176  ILE A CG2 1 
ATOM   399  C  CD1 . ILE A 1 100 ? -30.229 14.741  -31.961 1.00 36.67 ? 176  ILE A CD1 1 
ATOM   400  N  N   . LEU A 1 101 ? -29.625 13.842  -26.595 1.00 26.78 ? 177  LEU A N   1 
ATOM   401  C  CA  . LEU A 1 101 ? -29.717 13.243  -25.265 1.00 28.11 ? 177  LEU A CA  1 
ATOM   402  C  C   . LEU A 1 101 ? -31.030 13.606  -24.588 1.00 28.44 ? 177  LEU A C   1 
ATOM   403  O  O   . LEU A 1 101 ? -31.662 12.760  -23.944 1.00 30.84 ? 177  LEU A O   1 
ATOM   404  C  CB  . LEU A 1 101 ? -28.532 13.688  -24.407 1.00 26.51 ? 177  LEU A CB  1 
ATOM   405  C  CG  . LEU A 1 101 ? -28.281 12.922  -23.109 1.00 27.84 ? 177  LEU A CG  1 
ATOM   406  C  CD1 . LEU A 1 101 ? -27.955 11.471  -23.418 1.00 26.05 ? 177  LEU A CD1 1 
ATOM   407  C  CD2 . LEU A 1 101 ? -27.151 13.568  -22.325 1.00 27.98 ? 177  LEU A CD2 1 
ATOM   408  N  N   . ALA A 1 102 ? -31.475 14.855  -24.755 1.00 29.87 ? 178  ALA A N   1 
ATOM   409  C  CA  . ALA A 1 102 ? -32.708 15.293  -24.111 1.00 32.78 ? 178  ALA A CA  1 
ATOM   410  C  C   . ALA A 1 102 ? -33.930 14.619  -24.725 1.00 34.53 ? 178  ALA A C   1 
ATOM   411  O  O   . ALA A 1 102 ? -34.858 14.238  -24.003 1.00 33.52 ? 178  ALA A O   1 
ATOM   412  C  CB  . ALA A 1 102 ? -32.833 16.816  -24.189 1.00 33.65 ? 178  ALA A CB  1 
ATOM   413  N  N   . GLU A 1 103 ? -33.955 14.453  -26.050 1.00 34.06 ? 179  GLU A N   1 
ATOM   414  C  CA  . GLU A 1 103 ? -35.097 13.784  -26.665 1.00 33.14 ? 179  GLU A CA  1 
ATOM   415  C  C   . GLU A 1 103 ? -35.192 12.326  -26.237 1.00 30.65 ? 179  GLU A C   1 
ATOM   416  O  O   . GLU A 1 103 ? -36.289 11.759  -26.239 1.00 31.95 ? 179  GLU A O   1 
ATOM   417  C  CB  . GLU A 1 103 ? -35.020 13.888  -28.192 1.00 35.81 ? 179  GLU A CB  1 
ATOM   418  C  CG  . GLU A 1 103 ? -34.365 12.697  -28.863 0.69 39.31 ? 179  GLU A CG  1 
ATOM   419  C  CD  . GLU A 1 103 ? -34.325 12.819  -30.369 0.04 42.54 ? 179  GLU A CD  1 
ATOM   420  O  OE1 . GLU A 1 103 ? -34.591 13.924  -30.888 0.72 43.87 ? 179  GLU A OE1 1 
ATOM   421  O  OE2 . GLU A 1 103 ? -34.027 11.806  -31.032 1.00 44.52 ? 179  GLU A OE2 1 
ATOM   422  N  N   . ILE A 1 104 ? -34.071 11.721  -25.848 1.00 29.64 ? 180  ILE A N   1 
ATOM   423  C  CA  . ILE A 1 104 ? -34.077 10.336  -25.394 1.00 28.57 ? 180  ILE A CA  1 
ATOM   424  C  C   . ILE A 1 104 ? -34.619 10.233  -23.973 1.00 28.48 ? 180  ILE A C   1 
ATOM   425  O  O   . ILE A 1 104 ? -35.491 9.407   -23.687 1.00 31.96 ? 180  ILE A O   1 
ATOM   426  C  CB  . ILE A 1 104 ? -32.660 9.742   -25.500 1.00 28.87 ? 180  ILE A CB  1 
ATOM   427  C  CG1 . ILE A 1 104 ? -32.221 9.655   -26.964 1.00 28.12 ? 180  ILE A CG1 1 
ATOM   428  C  CG2 . ILE A 1 104 ? -32.590 8.369   -24.835 1.00 27.85 ? 180  ILE A CG2 1 
ATOM   429  C  CD1 . ILE A 1 104 ? -30.786 9.204   -27.128 1.00 26.23 ? 180  ILE A CD1 1 
ATOM   430  N  N   . LEU A 1 105 ? -34.125 11.078  -23.066 1.00 25.57 ? 181  LEU A N   1 
ATOM   431  C  CA  . LEU A 1 105 ? -34.342 10.890  -21.636 1.00 27.43 ? 181  LEU A CA  1 
ATOM   432  C  C   . LEU A 1 105 ? -35.466 11.740  -21.057 1.00 29.78 ? 181  LEU A C   1 
ATOM   433  O  O   . LEU A 1 105 ? -35.865 11.499  -19.913 1.00 30.38 ? 181  LEU A O   1 
ATOM   434  C  CB  . LEU A 1 105 ? -33.048 11.188  -20.868 1.00 26.74 ? 181  LEU A CB  1 
ATOM   435  C  CG  . LEU A 1 105 ? -31.846 10.296  -21.184 1.00 27.47 ? 181  LEU A CG  1 
ATOM   436  C  CD1 . LEU A 1 105 ? -30.596 10.823  -20.499 1.00 27.69 ? 181  LEU A CD1 1 
ATOM   437  C  CD2 . LEU A 1 105 ? -32.123 8.863   -20.758 1.00 28.12 ? 181  LEU A CD2 1 
ATOM   438  N  N   . ASP A 1 106 ? -35.984 12.713  -21.814 1.00 32.19 ? 182  ASP A N   1 
ATOM   439  C  CA  . ASP A 1 106 ? -36.945 13.674  -21.272 1.00 38.99 ? 182  ASP A CA  1 
ATOM   440  C  C   . ASP A 1 106 ? -38.169 12.993  -20.667 1.00 36.93 ? 182  ASP A C   1 
ATOM   441  O  O   . ASP A 1 106 ? -38.731 13.474  -19.675 1.00 35.17 ? 182  ASP A O   1 
ATOM   442  C  CB  . ASP A 1 106 ? -37.375 14.654  -22.369 1.00 44.83 ? 182  ASP A CB  1 
ATOM   443  C  CG  . ASP A 1 106 ? -38.703 15.317  -22.074 1.00 54.22 ? 182  ASP A CG  1 
ATOM   444  O  OD1 . ASP A 1 106 ? -38.756 16.171  -21.162 1.00 55.25 ? 182  ASP A OD1 1 
ATOM   445  O  OD2 . ASP A 1 106 ? -39.695 14.982  -22.760 1.00 59.62 ? 182  ASP A OD2 1 
ATOM   446  N  N   . PHE A 1 107 ? -38.595 11.871  -21.246 1.00 36.19 ? 183  PHE A N   1 
ATOM   447  C  CA  . PHE A 1 107 ? -39.847 11.253  -20.814 1.00 37.47 ? 183  PHE A CA  1 
ATOM   448  C  C   . PHE A 1 107 ? -39.791 10.767  -19.371 1.00 35.54 ? 183  PHE A C   1 
ATOM   449  O  O   . PHE A 1 107 ? -40.839 10.658  -18.723 1.00 36.39 ? 183  PHE A O   1 
ATOM   450  C  CB  . PHE A 1 107 ? -40.203 10.091  -21.738 1.00 37.65 ? 183  PHE A CB  1 
ATOM   451  C  CG  . PHE A 1 107 ? -39.493 8.818   -21.402 1.00 38.37 ? 183  PHE A CG  1 
ATOM   452  C  CD1 . PHE A 1 107 ? -40.153 7.795   -20.743 1.00 37.68 ? 183  PHE A CD1 1 
ATOM   453  C  CD2 . PHE A 1 107 ? -38.159 8.646   -21.733 1.00 36.23 ? 183  PHE A CD2 1 
ATOM   454  C  CE1 . PHE A 1 107 ? -39.500 6.620   -20.425 1.00 38.32 ? 183  PHE A CE1 1 
ATOM   455  C  CE2 . PHE A 1 107 ? -37.499 7.473   -21.420 1.00 36.74 ? 183  PHE A CE2 1 
ATOM   456  C  CZ  . PHE A 1 107 ? -38.170 6.457   -20.765 1.00 36.76 ? 183  PHE A CZ  1 
ATOM   457  N  N   . VAL A 1 108 ? -38.597 10.473  -18.849 1.00 30.80 ? 184  VAL A N   1 
ATOM   458  C  CA  . VAL A 1 108 ? -38.443 9.953   -17.497 1.00 32.91 ? 184  VAL A CA  1 
ATOM   459  C  C   . VAL A 1 108 ? -37.657 10.907  -16.604 1.00 35.00 ? 184  VAL A C   1 
ATOM   460  O  O   . VAL A 1 108 ? -37.951 11.027  -15.410 1.00 35.58 ? 184  VAL A O   1 
ATOM   461  C  CB  . VAL A 1 108 ? -37.795 8.550   -17.501 1.00 32.54 ? 184  VAL A CB  1 
ATOM   462  C  CG1 . VAL A 1 108 ? -36.429 8.576   -18.190 1.00 33.07 ? 184  VAL A CG1 1 
ATOM   463  C  CG2 . VAL A 1 108 ? -37.649 8.022   -16.079 1.00 31.22 ? 184  VAL A CG2 1 
ATOM   464  N  N   . MET A 1 109 ? -36.656 11.597  -17.156 1.00 32.36 ? 185  MET A N   1 
ATOM   465  C  CA  . MET A 1 109 ? -35.838 12.497  -16.362 1.00 30.26 ? 185  MET A CA  1 
ATOM   466  C  C   . MET A 1 109 ? -36.366 13.924  -16.334 1.00 31.79 ? 185  MET A C   1 
ATOM   467  O  O   . MET A 1 109 ? -35.924 14.707  -15.485 1.00 34.15 ? 185  MET A O   1 
ATOM   468  C  CB  . MET A 1 109 ? -34.393 12.507  -16.875 1.00 27.31 ? 185  MET A CB  1 
ATOM   469  C  CG  . MET A 1 109 ? -33.651 11.191  -16.695 1.00 23.91 ? 185  MET A CG  1 
ATOM   470  S  SD  . MET A 1 109 ? -31.891 11.356  -17.056 1.00 25.58 ? 185  MET A SD  1 
ATOM   471  C  CE  . MET A 1 109 ? -31.308 9.697   -16.733 1.00 22.21 ? 185  MET A CE  1 
ATOM   472  N  N   . GLY A 1 110 ? -37.293 14.279  -17.227 1.00 32.11 ? 186  GLY A N   1 
ATOM   473  C  CA  . GLY A 1 110 ? -37.822 15.629  -17.299 1.00 32.22 ? 186  GLY A CA  1 
ATOM   474  C  C   . GLY A 1 110 ? -36.747 16.695  -17.248 1.00 33.85 ? 186  GLY A C   1 
ATOM   475  O  O   . GLY A 1 110 ? -35.822 16.694  -18.064 1.00 32.04 ? 186  GLY A O   1 
ATOM   476  N  N   . LYS A 1 111 ? -36.833 17.586  -16.261 1.00 35.62 ? 187  LYS A N   1 
ATOM   477  C  CA  . LYS A 1 111 ? -35.884 18.678  -16.112 1.00 38.76 ? 187  LYS A CA  1 
ATOM   478  C  C   . LYS A 1 111 ? -34.688 18.309  -15.236 1.00 36.56 ? 187  LYS A C   1 
ATOM   479  O  O   . LYS A 1 111 ? -34.063 19.203  -14.655 1.00 35.96 ? 187  LYS A O   1 
ATOM   480  C  CB  . LYS A 1 111 ? -36.590 19.913  -15.547 1.00 42.70 ? 187  LYS A CB  1 
ATOM   481  N  N   . GLY A 1 112 ? -34.358 17.022  -15.136 1.00 33.53 ? 188  GLY A N   1 
ATOM   482  C  CA  . GLY A 1 112 ? -33.212 16.595  -14.359 1.00 31.26 ? 188  GLY A CA  1 
ATOM   483  C  C   . GLY A 1 112 ? -31.899 17.010  -14.996 1.00 31.85 ? 188  GLY A C   1 
ATOM   484  O  O   . GLY A 1 112 ? -31.840 17.478  -16.134 1.00 33.83 ? 188  GLY A O   1 
ATOM   485  N  N   . LEU A 1 113 ? -30.815 16.801  -14.242 1.00 27.92 ? 189  LEU A N   1 
ATOM   486  C  CA  . LEU A 1 113 ? -29.526 17.392  -14.600 1.00 27.69 ? 189  LEU A CA  1 
ATOM   487  C  C   . LEU A 1 113 ? -29.016 16.892  -15.948 1.00 25.97 ? 189  LEU A C   1 
ATOM   488  O  O   . LEU A 1 113 ? -28.569 17.687  -16.784 1.00 24.98 ? 189  LEU A O   1 
ATOM   489  C  CB  . LEU A 1 113 ? -28.494 17.103  -13.511 1.00 26.27 ? 189  LEU A CB  1 
ATOM   490  C  CG  . LEU A 1 113 ? -28.492 18.030  -12.300 1.00 27.01 ? 189  LEU A CG  1 
ATOM   491  C  CD1 . LEU A 1 113 ? -27.424 17.581  -11.328 1.00 26.01 ? 189  LEU A CD1 1 
ATOM   492  C  CD2 . LEU A 1 113 ? -28.258 19.471  -12.732 1.00 27.90 ? 189  LEU A CD2 1 
ATOM   493  N  N   . ILE A 1 114 ? -29.061 15.575  -16.170 1.00 23.59 ? 190  ILE A N   1 
ATOM   494  C  CA  . ILE A 1 114 ? -28.421 14.997  -17.355 1.00 23.69 ? 190  ILE A CA  1 
ATOM   495  C  C   . ILE A 1 114 ? -28.947 15.596  -18.656 1.00 26.11 ? 190  ILE A C   1 
ATOM   496  O  O   . ILE A 1 114 ? -28.131 16.062  -19.467 1.00 25.88 ? 190  ILE A O   1 
ATOM   497  C  CB  . ILE A 1 114 ? -28.532 13.463  -17.321 1.00 22.20 ? 190  ILE A CB  1 
ATOM   498  C  CG1 . ILE A 1 114 ? -27.658 12.889  -16.205 1.00 23.43 ? 190  ILE A CG1 1 
ATOM   499  C  CG2 . ILE A 1 114 ? -28.157 12.878  -18.680 1.00 23.02 ? 190  ILE A CG2 1 
ATOM   500  C  CD1 . ILE A 1 114 ? -27.781 11.390  -16.023 1.00 23.64 ? 190  ILE A CD1 1 
ATOM   501  N  N   . PRO A 1 115 ? -30.260 15.622  -18.927 1.00 26.28 ? 191  PRO A N   1 
ATOM   502  C  CA  . PRO A 1 115 ? -30.723 16.206  -20.194 1.00 27.68 ? 191  PRO A CA  1 
ATOM   503  C  C   . PRO A 1 115 ? -30.848 17.720  -20.183 1.00 28.87 ? 191  PRO A C   1 
ATOM   504  O  O   . PRO A 1 115 ? -31.091 18.302  -21.249 1.00 30.36 ? 191  PRO A O   1 
ATOM   505  C  CB  . PRO A 1 115 ? -32.096 15.554  -20.394 1.00 26.67 ? 191  PRO A CB  1 
ATOM   506  C  CG  . PRO A 1 115 ? -32.595 15.348  -19.008 1.00 28.24 ? 191  PRO A CG  1 
ATOM   507  C  CD  . PRO A 1 115 ? -31.380 15.023  -18.172 1.00 25.96 ? 191  PRO A CD  1 
ATOM   508  N  N   . ALA A 1 116 ? -30.682 18.375  -19.037 1.00 24.92 ? 192  ALA A N   1 
ATOM   509  C  CA  . ALA A 1 116 ? -30.964 19.799  -18.949 1.00 26.86 ? 192  ALA A CA  1 
ATOM   510  C  C   . ALA A 1 116 ? -29.835 20.633  -19.553 1.00 28.01 ? 192  ALA A C   1 
ATOM   511  O  O   . ALA A 1 116 ? -28.713 20.164  -19.765 1.00 28.13 ? 192  ALA A O   1 
ATOM   512  C  CB  . ALA A 1 116 ? -31.192 20.218  -17.496 1.00 25.69 ? 192  ALA A CB  1 
ATOM   513  N  N   . ASP A 1 117 ? -30.158 21.897  -19.823 1.00 26.48 ? 193  ASP A N   1 
ATOM   514  C  CA  . ASP A 1 117 ? -29.184 22.894  -20.239 1.00 29.03 ? 193  ASP A CA  1 
ATOM   515  C  C   . ASP A 1 117 ? -29.607 24.247  -19.680 1.00 32.19 ? 193  ASP A C   1 
ATOM   516  O  O   . ASP A 1 117 ? -30.712 24.410  -19.153 1.00 35.63 ? 193  ASP A O   1 
ATOM   517  C  CB  . ASP A 1 117 ? -29.053 22.951  -21.768 1.00 30.02 ? 193  ASP A CB  1 
ATOM   518  C  CG  . ASP A 1 117 ? -28.105 21.898  -22.315 1.00 29.58 ? 193  ASP A CG  1 
ATOM   519  O  OD1 . ASP A 1 117 ? -26.890 21.980  -22.030 1.00 28.52 ? 193  ASP A OD1 1 
ATOM   520  O  OD2 . ASP A 1 117 ? -28.576 20.986  -23.024 1.00 28.29 ? 193  ASP A OD2 1 
ATOM   521  N  N   . GLY A 1 118 ? -28.705 25.221  -19.786 1.00 31.20 ? 194  GLY A N   1 
ATOM   522  C  CA  . GLY A 1 118 ? -29.070 26.583  -19.439 1.00 34.15 ? 194  GLY A CA  1 
ATOM   523  C  C   . GLY A 1 118 ? -29.222 26.812  -17.942 1.00 38.57 ? 194  GLY A C   1 
ATOM   524  O  O   . GLY A 1 118 ? -28.576 26.167  -17.109 1.00 39.13 ? 194  GLY A O   1 
ATOM   525  N  N   . GLU A 1 119 ? -30.108 27.754  -17.599 1.00 40.91 ? 195  GLU A N   1 
ATOM   526  C  CA  . GLU A 1 119 ? -30.228 28.202  -16.214 1.00 40.64 ? 195  GLU A CA  1 
ATOM   527  C  C   . GLU A 1 119 ? -30.777 27.105  -15.308 1.00 42.15 ? 195  GLU A C   1 
ATOM   528  O  O   . GLU A 1 119 ? -30.338 26.969  -14.160 1.00 43.87 ? 195  GLU A O   1 
ATOM   529  C  CB  . GLU A 1 119 ? -31.110 29.450  -16.137 1.00 40.53 ? 195  GLU A CB  1 
ATOM   530  N  N   . ILE A 1 120 ? -31.737 26.316  -15.797 1.00 42.82 ? 196  ILE A N   1 
ATOM   531  C  CA  . ILE A 1 120 ? -32.304 25.268  -14.955 1.00 44.29 ? 196  ILE A CA  1 
ATOM   532  C  C   . ILE A 1 120 ? -31.256 24.204  -14.653 1.00 40.81 ? 196  ILE A C   1 
ATOM   533  O  O   . ILE A 1 120 ? -31.259 23.616  -13.564 1.00 39.87 ? 196  ILE A O   1 
ATOM   534  C  CB  . ILE A 1 120 ? -33.572 24.674  -15.601 1.00 47.84 ? 196  ILE A CB  1 
ATOM   535  C  CG1 . ILE A 1 120 ? -34.424 23.943  -14.555 1.00 49.29 ? 196  ILE A CG1 1 
ATOM   536  C  CG2 . ILE A 1 120 ? -33.222 23.751  -16.764 1.00 47.02 ? 196  ILE A CG2 1 
ATOM   537  C  CD1 . ILE A 1 120 ? -34.115 22.465  -14.411 1.00 48.69 ? 196  ILE A CD1 1 
ATOM   538  N  N   . TRP A 1 121 ? -30.333 23.948  -15.586 1.00 36.44 ? 197  TRP A N   1 
ATOM   539  C  CA  . TRP A 1 121 ? -29.215 23.070  -15.266 1.00 32.31 ? 197  TRP A CA  1 
ATOM   540  C  C   . TRP A 1 121 ? -28.333 23.690  -14.194 1.00 33.87 ? 197  TRP A C   1 
ATOM   541  O  O   . TRP A 1 121 ? -27.981 23.031  -13.210 1.00 35.25 ? 197  TRP A O   1 
ATOM   542  C  CB  . TRP A 1 121 ? -28.369 22.762  -16.502 1.00 27.88 ? 197  TRP A CB  1 
ATOM   543  C  CG  . TRP A 1 121 ? -27.037 22.230  -16.064 1.00 27.94 ? 197  TRP A CG  1 
ATOM   544  C  CD1 . TRP A 1 121 ? -26.775 20.976  -15.586 1.00 26.63 ? 197  TRP A CD1 1 
ATOM   545  C  CD2 . TRP A 1 121 ? -25.799 22.950  -15.998 1.00 28.43 ? 197  TRP A CD2 1 
ATOM   546  N  NE1 . TRP A 1 121 ? -25.448 20.866  -15.249 1.00 26.87 ? 197  TRP A NE1 1 
ATOM   547  C  CE2 . TRP A 1 121 ? -24.828 22.065  -15.486 1.00 28.32 ? 197  TRP A CE2 1 
ATOM   548  C  CE3 . TRP A 1 121 ? -25.417 24.256  -16.326 1.00 28.32 ? 197  TRP A CE3 1 
ATOM   549  C  CZ2 . TRP A 1 121 ? -23.498 22.440  -15.303 1.00 28.96 ? 197  TRP A CZ2 1 
ATOM   550  C  CZ3 . TRP A 1 121 ? -24.097 24.628  -16.140 1.00 28.07 ? 197  TRP A CZ3 1 
ATOM   551  C  CH2 . TRP A 1 121 ? -23.153 23.723  -15.636 1.00 29.54 ? 197  TRP A CH2 1 
ATOM   552  N  N   . ARG A 1 122 ? -27.954 24.958  -14.380 1.00 34.60 ? 198  ARG A N   1 
ATOM   553  C  CA  . ARG A 1 122 ? -27.034 25.607  -13.452 1.00 35.33 ? 198  ARG A CA  1 
ATOM   554  C  C   . ARG A 1 122 ? -27.628 25.692  -12.053 1.00 35.71 ? 198  ARG A C   1 
ATOM   555  O  O   . ARG A 1 122 ? -26.928 25.461  -11.061 1.00 36.16 ? 198  ARG A O   1 
ATOM   556  C  CB  . ARG A 1 122 ? -26.665 27.003  -13.962 1.00 35.93 ? 198  ARG A CB  1 
ATOM   557  N  N   . ARG A 1 123 ? -28.921 26.014  -11.955 1.00 35.63 ? 199  ARG A N   1 
ATOM   558  C  CA  . ARG A 1 123 ? -29.555 26.161  -10.649 1.00 38.08 ? 199  ARG A CA  1 
ATOM   559  C  C   . ARG A 1 123 ? -29.616 24.828  -9.910  1.00 38.05 ? 199  ARG A C   1 
ATOM   560  O  O   . ARG A 1 123 ? -29.278 24.750  -8.723  1.00 37.54 ? 199  ARG A O   1 
ATOM   561  C  CB  . ARG A 1 123 ? -30.955 26.759  -10.808 1.00 38.62 ? 199  ARG A CB  1 
ATOM   562  N  N   . ARG A 1 124 ? -30.036 23.762  -10.599 1.00 34.41 ? 200  ARG A N   1 
ATOM   563  C  CA  . ARG A 1 124 ? -30.157 22.472  -9.928  1.00 35.15 ? 200  ARG A CA  1 
ATOM   564  C  C   . ARG A 1 124 ? -28.793 21.867  -9.625  1.00 33.44 ? 200  ARG A C   1 
ATOM   565  O  O   . ARG A 1 124 ? -28.633 21.189  -8.604  1.00 32.77 ? 200  ARG A O   1 
ATOM   566  C  CB  . ARG A 1 124 ? -31.001 21.510  -10.768 1.00 34.41 ? 200  ARG A CB  1 
ATOM   567  C  CG  . ARG A 1 124 ? -32.438 21.976  -10.972 1.00 35.23 ? 200  ARG A CG  1 
ATOM   568  C  CD  . ARG A 1 124 ? -33.047 22.449  -9.654  1.00 35.08 ? 200  ARG A CD  1 
ATOM   569  N  NE  . ARG A 1 124 ? -33.194 21.359  -8.695  1.00 34.12 ? 200  ARG A NE  1 
ATOM   570  C  CZ  . ARG A 1 124 ? -33.247 21.522  -7.376  1.00 34.91 ? 200  ARG A CZ  1 
ATOM   571  N  NH1 . ARG A 1 124 ? -33.147 22.734  -6.850  1.00 34.32 ? 200  ARG A NH1 1 
ATOM   572  N  NH2 . ARG A 1 124 ? -33.385 20.470  -6.581  1.00 36.63 ? 200  ARG A NH2 1 
ATOM   573  N  N   . ARG A 1 125 ? -27.799 22.109  -10.481 1.00 30.42 ? 201  ARG A N   1 
ATOM   574  C  CA  . ARG A 1 125 ? -26.456 21.615  -10.197 1.00 30.85 ? 201  ARG A CA  1 
ATOM   575  C  C   . ARG A 1 125 ? -25.910 22.227  -8.911  1.00 29.60 ? 201  ARG A C   1 
ATOM   576  O  O   . ARG A 1 125 ? -25.386 21.518  -8.046  1.00 28.42 ? 201  ARG A O   1 
ATOM   577  C  CB  . ARG A 1 125 ? -25.523 21.909  -11.372 1.00 32.59 ? 201  ARG A CB  1 
ATOM   578  C  CG  . ARG A 1 125 ? -24.059 21.633  -11.063 1.00 33.81 ? 201  ARG A CG  1 
ATOM   579  C  CD  . ARG A 1 125 ? -23.495 20.591  -11.990 1.00 31.82 ? 201  ARG A CD  1 
ATOM   580  N  NE  . ARG A 1 125 ? -22.119 20.231  -11.661 1.00 31.87 ? 201  ARG A NE  1 
ATOM   581  C  CZ  . ARG A 1 125 ? -21.483 19.199  -12.206 1.00 30.48 ? 201  ARG A CZ  1 
ATOM   582  N  NH1 . ARG A 1 125 ? -22.109 18.440  -13.094 1.00 27.88 ? 201  ARG A NH1 1 
ATOM   583  N  NH2 . ARG A 1 125 ? -20.233 18.921  -11.864 1.00 28.40 ? 201  ARG A NH2 1 
ATOM   584  N  N   . ARG A 1 126 ? -26.035 23.551  -8.766  1.00 30.66 ? 202  ARG A N   1 
ATOM   585  C  CA  . ARG A 1 126 ? -25.555 24.216  -7.558  1.00 31.24 ? 202  ARG A CA  1 
ATOM   586  C  C   . ARG A 1 126 ? -26.294 23.739  -6.313  1.00 34.38 ? 202  ARG A C   1 
ATOM   587  O  O   . ARG A 1 126 ? -25.734 23.769  -5.210  1.00 36.39 ? 202  ARG A O   1 
ATOM   588  C  CB  . ARG A 1 126 ? -25.694 25.735  -7.702  1.00 30.84 ? 202  ARG A CB  1 
ATOM   589  N  N   . ALA A 1 127 ? -27.545 23.296  -6.463  1.00 34.01 ? 203  ALA A N   1 
ATOM   590  C  CA  . ALA A 1 127 ? -28.321 22.853  -5.310  1.00 34.77 ? 203  ALA A CA  1 
ATOM   591  C  C   . ALA A 1 127 ? -28.020 21.410  -4.917  1.00 32.17 ? 203  ALA A C   1 
ATOM   592  O  O   . ALA A 1 127 ? -28.099 21.065  -3.733  1.00 29.87 ? 203  ALA A O   1 
ATOM   593  C  CB  . ALA A 1 127 ? -29.814 23.014  -5.595  1.00 36.38 ? 203  ALA A CB  1 
ATOM   594  N  N   . ILE A 1 128 ? -27.673 20.558  -5.876  1.00 31.98 ? 204  ILE A N   1 
ATOM   595  C  CA  . ILE A 1 128 ? -27.593 19.125  -5.608  1.00 31.86 ? 204  ILE A CA  1 
ATOM   596  C  C   . ILE A 1 128 ? -26.182 18.698  -5.214  1.00 33.25 ? 204  ILE A C   1 
ATOM   597  O  O   . ILE A 1 128 ? -26.011 17.874  -4.312  1.00 31.59 ? 204  ILE A O   1 
ATOM   598  C  CB  . ILE A 1 128 ? -28.110 18.342  -6.832  1.00 32.18 ? 204  ILE A CB  1 
ATOM   599  C  CG1 . ILE A 1 128 ? -29.602 18.622  -7.027  1.00 33.90 ? 204  ILE A CG1 1 
ATOM   600  C  CG2 . ILE A 1 128 ? -27.865 16.849  -6.664  1.00 30.52 ? 204  ILE A CG2 1 
ATOM   601  C  CD1 . ILE A 1 128 ? -30.151 18.153  -8.351  1.00 34.01 ? 204  ILE A CD1 1 
ATOM   602  N  N   . VAL A 1 129 ? -25.164 19.251  -5.868  1.00 33.05 ? 205  VAL A N   1 
ATOM   603  C  CA  . VAL A 1 129 ? -23.761 18.929  -5.593  1.00 32.69 ? 205  VAL A CA  1 
ATOM   604  C  C   . VAL A 1 129 ? -23.429 19.003  -4.102  1.00 32.31 ? 205  VAL A C   1 
ATOM   605  O  O   . VAL A 1 129 ? -22.746 18.099  -3.598  1.00 32.42 ? 205  VAL A O   1 
ATOM   606  C  CB  . VAL A 1 129 ? -22.830 19.831  -6.423  1.00 34.30 ? 205  VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 129 ? -21.410 19.795  -5.880  1.00 35.04 ? 205  VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 129 ? -22.842 19.390  -7.878  1.00 35.31 ? 205  VAL A CG2 1 
ATOM   609  N  N   . PRO A 1 130 ? -23.879 20.014  -3.344  1.00 31.45 ? 206  PRO A N   1 
ATOM   610  C  CA  . PRO A 1 130 ? -23.570 20.019  -1.903  1.00 31.45 ? 206  PRO A CA  1 
ATOM   611  C  C   . PRO A 1 130 ? -24.074 18.792  -1.160  1.00 31.14 ? 206  PRO A C   1 
ATOM   612  O  O   . PRO A 1 130 ? -23.547 18.486  -0.083  1.00 30.83 ? 206  PRO A O   1 
ATOM   613  C  CB  . PRO A 1 130 ? -24.257 21.295  -1.397  1.00 34.30 ? 206  PRO A CB  1 
ATOM   614  C  CG  . PRO A 1 130 ? -24.328 22.176  -2.586  1.00 34.84 ? 206  PRO A CG  1 
ATOM   615  C  CD  . PRO A 1 130 ? -24.577 21.253  -3.741  1.00 32.68 ? 206  PRO A CD  1 
ATOM   616  N  N   . ALA A 1 131 ? -25.066 18.075  -1.696  1.00 32.00 ? 207  ALA A N   1 
ATOM   617  C  CA  . ALA A 1 131 ? -25.590 16.904  -0.999  1.00 33.48 ? 207  ALA A CA  1 
ATOM   618  C  C   . ALA A 1 131 ? -24.581 15.765  -0.962  1.00 36.82 ? 207  ALA A C   1 
ATOM   619  O  O   . ALA A 1 131 ? -24.597 14.956  -0.025  1.00 38.18 ? 207  ALA A O   1 
ATOM   620  C  CB  . ALA A 1 131 ? -26.887 16.433  -1.656  1.00 31.93 ? 207  ALA A CB  1 
ATOM   621  N  N   . LEU A 1 132 ? -23.710 15.675  -1.962  1.00 35.72 ? 208  LEU A N   1 
ATOM   622  C  CA  . LEU A 1 132 ? -22.722 14.599  -2.027  1.00 34.37 ? 208  LEU A CA  1 
ATOM   623  C  C   . LEU A 1 132 ? -21.404 15.004  -1.376  1.00 35.35 ? 208  LEU A C   1 
ATOM   624  O  O   . LEU A 1 132 ? -20.332 14.888  -1.968  1.00 35.94 ? 208  LEU A O   1 
ATOM   625  C  CB  . LEU A 1 132 ? -22.514 14.172  -3.474  1.00 34.75 ? 208  LEU A CB  1 
ATOM   626  C  CG  . LEU A 1 132 ? -23.732 13.474  -4.082  1.00 34.94 ? 208  LEU A CG  1 
ATOM   627  C  CD1 . LEU A 1 132 ? -24.501 14.415  -4.993  1.00 36.20 ? 208  LEU A CD1 1 
ATOM   628  C  CD2 . LEU A 1 132 ? -23.317 12.217  -4.822  1.00 32.50 ? 208  LEU A CD2 1 
ATOM   629  N  N   . HIS A 1 133 ? -21.477 15.474  -0.134  1.00 37.29 ? 209  HIS A N   1 
ATOM   630  C  CA  . HIS A 1 133 ? -20.272 15.892  0.559   1.00 38.63 ? 209  HIS A CA  1 
ATOM   631  C  C   . HIS A 1 133 ? -19.539 14.678  1.128   1.00 39.92 ? 209  HIS A C   1 
ATOM   632  O  O   . HIS A 1 133 ? -20.009 13.541  1.050   1.00 40.20 ? 209  HIS A O   1 
ATOM   633  C  CB  . HIS A 1 133 ? -20.602 16.916  1.650   1.00 38.32 ? 209  HIS A CB  1 
ATOM   634  C  CG  . HIS A 1 133 ? -21.682 16.488  2.599   1.00 39.70 ? 209  HIS A CG  1 
ATOM   635  N  ND1 . HIS A 1 133 ? -21.508 15.485  3.528   1.00 39.52 ? 209  HIS A ND1 1 
ATOM   636  C  CD2 . HIS A 1 133 ? -22.941 16.954  2.783   1.00 40.65 ? 209  HIS A CD2 1 
ATOM   637  C  CE1 . HIS A 1 133 ? -22.616 15.342  4.234   1.00 39.96 ? 209  HIS A CE1 1 
ATOM   638  N  NE2 . HIS A 1 133 ? -23.501 16.221  3.802   1.00 40.07 ? 209  HIS A NE2 1 
ATOM   639  N  N   . GLN A 1 134 ? -18.358 14.936  1.698   1.00 41.61 ? 210  GLN A N   1 
ATOM   640  C  CA  . GLN A 1 134 ? -17.499 13.846  2.150   1.00 42.65 ? 210  GLN A CA  1 
ATOM   641  C  C   . GLN A 1 134 ? -18.185 13.000  3.213   1.00 43.27 ? 210  GLN A C   1 
ATOM   642  O  O   . GLN A 1 134 ? -18.117 11.766  3.171   1.00 45.94 ? 210  GLN A O   1 
ATOM   643  C  CB  . GLN A 1 134 ? -16.173 14.401  2.675   1.00 43.56 ? 210  GLN A CB  1 
ATOM   644  N  N   . LYS A 1 135 ? -18.861 13.642  4.169   1.00 40.43 ? 211  LYS A N   1 
ATOM   645  C  CA  . LYS A 1 135 ? -19.547 12.891  5.214   1.00 38.70 ? 211  LYS A CA  1 
ATOM   646  C  C   . LYS A 1 135 ? -20.630 11.995  4.628   1.00 33.87 ? 211  LYS A C   1 
ATOM   647  O  O   . LYS A 1 135 ? -20.813 10.858  5.078   1.00 32.43 ? 211  LYS A O   1 
ATOM   648  C  CB  . LYS A 1 135 ? -20.145 13.845  6.249   1.00 42.16 ? 211  LYS A CB  1 
ATOM   649  C  CG  . LYS A 1 135 ? -20.779 13.136  7.441   1.00 46.04 ? 211  LYS A CG  1 
ATOM   650  C  CD  . LYS A 1 135 ? -21.711 14.060  8.227   1.00 51.00 ? 211  LYS A CD  1 
ATOM   651  C  CE  . LYS A 1 135 ? -20.971 15.234  8.854   1.00 53.81 ? 211  LYS A CE  1 
ATOM   652  N  NZ  . LYS A 1 135 ? -21.884 16.125  9.635   1.00 54.11 ? 211  LYS A NZ  1 
ATOM   653  N  N   . TYR A 1 136 ? -21.357 12.488  3.624   1.00 32.48 ? 212  TYR A N   1 
ATOM   654  C  CA  . TYR A 1 136 ? -22.387 11.671  2.990   1.00 29.83 ? 212  TYR A CA  1 
ATOM   655  C  C   . TYR A 1 136 ? -21.771 10.470  2.287   1.00 29.86 ? 212  TYR A C   1 
ATOM   656  O  O   . TYR A 1 136 ? -22.241 9.337   2.441   1.00 29.68 ? 212  TYR A O   1 
ATOM   657  C  CB  . TYR A 1 136 ? -23.197 12.513  2.003   1.00 28.37 ? 212  TYR A CB  1 
ATOM   658  C  CG  . TYR A 1 136 ? -24.094 11.697  1.089   1.00 26.66 ? 212  TYR A CG  1 
ATOM   659  C  CD1 . TYR A 1 136 ? -25.282 11.146  1.556   1.00 29.55 ? 212  TYR A CD1 1 
ATOM   660  C  CD2 . TYR A 1 136 ? -23.757 11.487  -0.239  1.00 24.81 ? 212  TYR A CD2 1 
ATOM   661  C  CE1 . TYR A 1 136 ? -26.107 10.398  0.724   1.00 28.01 ? 212  TYR A CE1 1 
ATOM   662  C  CE2 . TYR A 1 136 ? -24.575 10.746  -1.081  1.00 26.81 ? 212  TYR A CE2 1 
ATOM   663  C  CZ  . TYR A 1 136 ? -25.752 10.207  -0.594  1.00 27.46 ? 212  TYR A CZ  1 
ATOM   664  O  OH  . TYR A 1 136 ? -26.567 9.465   -1.423  1.00 25.77 ? 212  TYR A OH  1 
ATOM   665  N  N   . VAL A 1 137 ? -20.717 10.704  1.501   1.00 29.31 ? 213  VAL A N   1 
ATOM   666  C  CA  . VAL A 1 137 ? -20.064 9.610   0.787   1.00 29.49 ? 213  VAL A CA  1 
ATOM   667  C  C   . VAL A 1 137 ? -19.510 8.587   1.771   1.00 28.94 ? 213  VAL A C   1 
ATOM   668  O  O   . VAL A 1 137 ? -19.646 7.375   1.567   1.00 25.57 ? 213  VAL A O   1 
ATOM   669  C  CB  . VAL A 1 137 ? -18.971 10.160  -0.150  1.00 32.46 ? 213  VAL A CB  1 
ATOM   670  C  CG1 . VAL A 1 137 ? -18.205 9.020   -0.812  1.00 33.43 ? 213  VAL A CG1 1 
ATOM   671  C  CG2 . VAL A 1 137 ? -19.593 11.061  -1.209  1.00 33.23 ? 213  VAL A CG2 1 
ATOM   672  N  N   . ALA A 1 138 ? -18.898 9.056   2.864   1.00 30.75 ? 214  ALA A N   1 
ATOM   673  C  CA  . ALA A 1 138 ? -18.389 8.132   3.873   1.00 33.31 ? 214  ALA A CA  1 
ATOM   674  C  C   . ALA A 1 138 ? -19.510 7.282   4.457   1.00 33.01 ? 214  ALA A C   1 
ATOM   675  O  O   . ALA A 1 138 ? -19.337 6.078   4.673   1.00 34.68 ? 214  ALA A O   1 
ATOM   676  C  CB  . ALA A 1 138 ? -17.664 8.901   4.978   1.00 37.43 ? 214  ALA A CB  1 
ATOM   677  N  N   . ALA A 1 139 ? -20.675 7.889   4.705   1.00 32.38 ? 215  ALA A N   1 
ATOM   678  C  CA  . ALA A 1 139 ? -21.811 7.132   5.223   1.00 31.77 ? 215  ALA A CA  1 
ATOM   679  C  C   . ALA A 1 139 ? -22.364 6.155   4.191   1.00 30.64 ? 215  ALA A C   1 
ATOM   680  O  O   . ALA A 1 139 ? -22.854 5.078   4.557   1.00 29.76 ? 215  ALA A O   1 
ATOM   681  C  CB  . ALA A 1 139 ? -22.911 8.086   5.686   1.00 35.01 ? 215  ALA A CB  1 
ATOM   682  N  N   . MET A 1 140 ? -22.297 6.499   2.903   1.00 25.31 ? 216  MET A N   1 
ATOM   683  C  CA  . MET A 1 140 ? -22.820 5.590   1.893   1.00 23.06 ? 216  MET A CA  1 
ATOM   684  C  C   . MET A 1 140 ? -21.960 4.343   1.736   1.00 24.29 ? 216  MET A C   1 
ATOM   685  O  O   . MET A 1 140 ? -22.452 3.325   1.236   1.00 23.86 ? 216  MET A O   1 
ATOM   686  C  CB  . MET A 1 140 ? -22.957 6.315   0.553   1.00 22.53 ? 216  MET A CB  1 
ATOM   687  C  CG  . MET A 1 140 ? -24.028 7.405   0.541   1.00 26.17 ? 216  MET A CG  1 
ATOM   688  S  SD  . MET A 1 140 ? -25.676 6.801   0.984   1.00 29.27 ? 216  MET A SD  1 
ATOM   689  C  CE  . MET A 1 140 ? -25.797 7.282   2.710   1.00 30.72 ? 216  MET A CE  1 
ATOM   690  N  N   . ILE A 1 141 ? -20.693 4.397   2.151   1.00 23.69 ? 217  ILE A N   1 
ATOM   691  C  CA  . ILE A 1 141 ? -19.839 3.215   2.078   1.00 29.18 ? 217  ILE A CA  1 
ATOM   692  C  C   . ILE A 1 141 ? -20.386 2.100   2.970   1.00 27.51 ? 217  ILE A C   1 
ATOM   693  O  O   . ILE A 1 141 ? -20.318 0.915   2.619   1.00 25.23 ? 217  ILE A O   1 
ATOM   694  C  CB  . ILE A 1 141 ? -18.386 3.588   2.431   1.00 32.52 ? 217  ILE A CB  1 
ATOM   695  C  CG1 . ILE A 1 141 ? -17.774 4.408   1.289   1.00 33.85 ? 217  ILE A CG1 1 
ATOM   696  C  CG2 . ILE A 1 141 ? -17.545 2.342   2.712   1.00 29.48 ? 217  ILE A CG2 1 
ATOM   697  C  CD1 . ILE A 1 141 ? -16.330 4.776   1.505   1.00 35.29 ? 217  ILE A CD1 1 
ATOM   698  N  N   . SER A 1 142 ? -20.962 2.460   4.121   1.00 26.35 ? 218  SER A N   1 
ATOM   699  C  CA  . SER A 1 142 ? -21.626 1.454   4.950   1.00 28.53 ? 218  SER A CA  1 
ATOM   700  C  C   . SER A 1 142 ? -22.772 0.794   4.194   1.00 25.98 ? 218  SER A C   1 
ATOM   701  O  O   . SER A 1 142 ? -22.927 -0.434  4.229   1.00 24.12 ? 218  SER A O   1 
ATOM   702  C  CB  . SER A 1 142 ? -22.139 2.085   6.245   1.00 31.26 ? 218  SER A CB  1 
ATOM   703  O  OG  . SER A 1 142 ? -21.071 2.635   6.989   1.00 40.30 ? 218  SER A OG  1 
ATOM   704  N  N   . LEU A 1 143 ? -23.583 1.595   3.499   1.00 23.41 ? 219  LEU A N   1 
ATOM   705  C  CA  . LEU A 1 143 ? -24.659 1.033   2.689   1.00 23.14 ? 219  LEU A CA  1 
ATOM   706  C  C   . LEU A 1 143 ? -24.107 0.123   1.598   1.00 23.70 ? 219  LEU A C   1 
ATOM   707  O  O   . LEU A 1 143 ? -24.658 -0.956  1.349   1.00 24.54 ? 219  LEU A O   1 
ATOM   708  C  CB  . LEU A 1 143 ? -25.504 2.154   2.080   1.00 25.35 ? 219  LEU A CB  1 
ATOM   709  C  CG  . LEU A 1 143 ? -26.443 1.731   0.941   1.00 28.02 ? 219  LEU A CG  1 
ATOM   710  C  CD1 . LEU A 1 143 ? -27.508 0.761   1.451   1.00 28.17 ? 219  LEU A CD1 1 
ATOM   711  C  CD2 . LEU A 1 143 ? -27.079 2.954   0.281   1.00 27.61 ? 219  LEU A CD2 1 
ATOM   712  N  N   . PHE A 1 144 ? -23.015 0.538   0.940   1.00 22.89 ? 220  PHE A N   1 
ATOM   713  C  CA  . PHE A 1 144 ? -22.415 -0.295  -0.101  1.00 21.37 ? 220  PHE A CA  1 
ATOM   714  C  C   . PHE A 1 144 ? -22.035 -1.663  0.446   1.00 21.12 ? 220  PHE A C   1 
ATOM   715  O  O   . PHE A 1 144 ? -22.279 -2.689  -0.199  1.00 22.36 ? 220  PHE A O   1 
ATOM   716  C  CB  . PHE A 1 144 ? -21.174 0.379   -0.696  1.00 21.62 ? 220  PHE A CB  1 
ATOM   717  C  CG  . PHE A 1 144 ? -21.423 1.745   -1.283  1.00 22.55 ? 220  PHE A CG  1 
ATOM   718  C  CD1 . PHE A 1 144 ? -22.685 2.126   -1.711  1.00 20.38 ? 220  PHE A CD1 1 
ATOM   719  C  CD2 . PHE A 1 144 ? -20.381 2.650   -1.402  1.00 20.98 ? 220  PHE A CD2 1 
ATOM   720  C  CE1 . PHE A 1 144 ? -22.899 3.390   -2.241  1.00 22.13 ? 220  PHE A CE1 1 
ATOM   721  C  CE2 . PHE A 1 144 ? -20.587 3.905   -1.936  1.00 21.93 ? 220  PHE A CE2 1 
ATOM   722  C  CZ  . PHE A 1 144 ? -21.850 4.277   -2.357  1.00 21.17 ? 220  PHE A CZ  1 
ATOM   723  N  N   . GLY A 1 145 ? -21.428 -1.694  1.634   1.00 22.58 ? 221  GLY A N   1 
ATOM   724  C  CA  . GLY A 1 145 ? -21.008 -2.962  2.203   1.00 23.96 ? 221  GLY A CA  1 
ATOM   725  C  C   . GLY A 1 145 ? -22.173 -3.828  2.639   1.00 23.80 ? 221  GLY A C   1 
ATOM   726  O  O   . GLY A 1 145 ? -22.147 -5.048  2.466   1.00 24.55 ? 221  GLY A O   1 
ATOM   727  N  N   . GLU A 1 146 ? -23.204 -3.214  3.222   1.00 23.40 ? 222  GLU A N   1 
ATOM   728  C  CA  . GLU A 1 146 ? -24.360 -3.984  3.665   1.00 26.16 ? 222  GLU A CA  1 
ATOM   729  C  C   . GLU A 1 146 ? -25.079 -4.612  2.480   1.00 25.42 ? 222  GLU A C   1 
ATOM   730  O  O   . GLU A 1 146 ? -25.444 -5.793  2.511   1.00 25.94 ? 222  GLU A O   1 
ATOM   731  C  CB  . GLU A 1 146 ? -25.304 -3.089  4.469   1.00 29.03 ? 222  GLU A CB  1 
ATOM   732  C  CG  . GLU A 1 146 ? -24.778 -2.755  5.865   1.00 33.90 ? 222  GLU A CG  1 
ATOM   733  C  CD  . GLU A 1 146 ? -25.167 -1.365  6.332   0.11 37.53 ? 222  GLU A CD  1 
ATOM   734  O  OE1 . GLU A 1 146 ? -24.674 -0.940  7.401   0.86 40.39 ? 222  GLU A OE1 1 
ATOM   735  O  OE2 . GLU A 1 146 ? -25.956 -0.695  5.631   0.48 38.35 ? 222  GLU A OE2 1 
ATOM   736  N  N   . ALA A 1 147 ? -25.282 -3.834  1.415   1.00 24.32 ? 223  ALA A N   1 
ATOM   737  C  CA  . ALA A 1 147 ? -25.956 -4.364  0.238   1.00 21.29 ? 223  ALA A CA  1 
ATOM   738  C  C   . ALA A 1 147 ? -25.088 -5.391  -0.476  1.00 21.30 ? 223  ALA A C   1 
ATOM   739  O  O   . ALA A 1 147 ? -25.593 -6.422  -0.933  1.00 20.17 ? 223  ALA A O   1 
ATOM   740  C  CB  . ALA A 1 147 ? -26.339 -3.225  -0.708  1.00 20.63 ? 223  ALA A CB  1 
ATOM   741  N  N   . SER A 1 148 ? -23.782 -5.127  -0.589  1.00 21.77 ? 224  SER A N   1 
ATOM   742  C  CA  . SER A 1 148 ? -22.895 -6.108  -1.206  1.00 21.95 ? 224  SER A CA  1 
ATOM   743  C  C   . SER A 1 148 ? -22.892 -7.402  -0.407  1.00 23.33 ? 224  SER A C   1 
ATOM   744  O  O   . SER A 1 148 ? -22.837 -8.498  -0.980  1.00 22.79 ? 224  SER A O   1 
ATOM   745  C  CB  . SER A 1 148 ? -21.478 -5.546  -1.327  1.00 22.46 ? 224  SER A CB  1 
ATOM   746  O  OG  . SER A 1 148 ? -21.453 -4.412  -2.183  1.00 22.13 ? 224  SER A OG  1 
ATOM   747  N  N   . ASP A 1 149 ? -22.975 -7.292  0.919   1.00 22.31 ? 225  ASP A N   1 
ATOM   748  C  CA  . ASP A 1 149 ? -23.023 -8.485  1.756   1.00 25.17 ? 225  ASP A CA  1 
ATOM   749  C  C   . ASP A 1 149 ? -24.293 -9.284  1.500   1.00 25.04 ? 225  ASP A C   1 
ATOM   750  O  O   . ASP A 1 149 ? -24.262 -10.519 1.492   1.00 25.62 ? 225  ASP A O   1 
ATOM   751  C  CB  . ASP A 1 149 ? -22.911 -8.100  3.230   1.00 25.75 ? 225  ASP A CB  1 
ATOM   752  C  CG  . ASP A 1 149 ? -22.929 -9.305  4.147   1.00 30.77 ? 225  ASP A CG  1 
ATOM   753  O  OD1 . ASP A 1 149 ? -21.957 -10.093 4.129   1.00 30.12 ? 225  ASP A OD1 1 
ATOM   754  O  OD2 . ASP A 1 149 ? -23.923 -9.461  4.881   1.00 32.91 ? 225  ASP A OD2 1 
ATOM   755  N  N   . ARG A 1 150 ? -25.422 -8.602  1.279   1.00 25.86 ? 226  ARG A N   1 
ATOM   756  C  CA  . ARG A 1 150 ? -26.651 -9.316  0.937   1.00 27.42 ? 226  ARG A CA  1 
ATOM   757  C  C   . ARG A 1 150 ? -26.499 -10.079 -0.377  1.00 27.23 ? 226  ARG A C   1 
ATOM   758  O  O   . ARG A 1 150 ? -27.027 -11.188 -0.522  1.00 25.85 ? 226  ARG A O   1 
ATOM   759  C  CB  . ARG A 1 150 ? -27.835 -8.347  0.869   1.00 30.31 ? 226  ARG A CB  1 
ATOM   760  C  CG  . ARG A 1 150 ? -28.315 -7.877  2.238   0.76 35.50 ? 226  ARG A CG  1 
ATOM   761  C  CD  . ARG A 1 150 ? -29.608 -7.064  2.166   1.00 40.85 ? 226  ARG A CD  1 
ATOM   762  N  NE  . ARG A 1 150 ? -29.367 -5.632  1.994   1.00 42.64 ? 226  ARG A NE  1 
ATOM   763  C  CZ  . ARG A 1 150 ? -29.844 -4.899  0.993   0.43 46.28 ? 226  ARG A CZ  1 
ATOM   764  N  NH1 . ARG A 1 150 ? -30.610 -5.452  0.056   1.00 47.45 ? 226  ARG A NH1 1 
ATOM   765  N  NH2 . ARG A 1 150 ? -29.564 -3.602  0.939   1.00 48.79 ? 226  ARG A NH2 1 
ATOM   766  N  N   . LEU A 1 151 ? -25.776 -9.508  -1.345  1.00 26.38 ? 227  LEU A N   1 
ATOM   767  C  CA  . LEU A 1 151 ? -25.488 -10.257 -2.565  1.00 23.41 ? 227  LEU A CA  1 
ATOM   768  C  C   . LEU A 1 151 ? -24.591 -11.453 -2.270  1.00 25.86 ? 227  LEU A C   1 
ATOM   769  O  O   . LEU A 1 151 ? -24.827 -12.555 -2.780  1.00 26.21 ? 227  LEU A O   1 
ATOM   770  C  CB  . LEU A 1 151 ? -24.845 -9.346  -3.615  1.00 22.58 ? 227  LEU A CB  1 
ATOM   771  C  CG  . LEU A 1 151 ? -24.346 -10.040 -4.891  1.00 21.74 ? 227  LEU A CG  1 
ATOM   772  C  CD1 . LEU A 1 151 ? -25.462 -10.844 -5.552  1.00 23.01 ? 227  LEU A CD1 1 
ATOM   773  C  CD2 . LEU A 1 151 ? -23.748 -9.031  -5.875  1.00 19.93 ? 227  LEU A CD2 1 
ATOM   774  N  N   . CYS A 1 152 ? -23.564 -11.257 -1.440  1.00 27.03 ? 228  CYS A N   1 
ATOM   775  C  CA  . CYS A 1 152 ? -22.676 -12.362 -1.092  1.00 28.29 ? 228  CYS A CA  1 
ATOM   776  C  C   . CYS A 1 152 ? -23.449 -13.523 -0.480  1.00 28.70 ? 228  CYS A C   1 
ATOM   777  O  O   . CYS A 1 152 ? -23.151 -14.691 -0.756  1.00 28.09 ? 228  CYS A O   1 
ATOM   778  C  CB  . CYS A 1 152 ? -21.584 -11.877 -0.139  1.00 28.35 ? 228  CYS A CB  1 
ATOM   779  S  SG  . CYS A 1 152 ? -20.428 -10.714 -0.914  1.00 27.90 ? 228  CYS A SG  1 
ATOM   780  N  N   . GLN A 1 153 ? -24.455 -13.224 0.345   1.00 27.04 ? 229  GLN A N   1 
ATOM   781  C  CA  . GLN A 1 153 ? -25.262 -14.290 0.928   1.00 29.28 ? 229  GLN A CA  1 
ATOM   782  C  C   . GLN A 1 153 ? -25.988 -15.087 -0.149  1.00 27.47 ? 229  GLN A C   1 
ATOM   783  O  O   . GLN A 1 153 ? -26.098 -16.315 -0.051  1.00 26.60 ? 229  GLN A O   1 
ATOM   784  C  CB  . GLN A 1 153 ? -26.253 -13.706 1.934   1.00 31.11 ? 229  GLN A CB  1 
ATOM   785  C  CG  . GLN A 1 153 ? -25.594 -13.166 3.193   1.00 34.31 ? 229  GLN A CG  1 
ATOM   786  C  CD  . GLN A 1 153 ? -26.563 -12.397 4.065   1.00 41.25 ? 229  GLN A CD  1 
ATOM   787  O  OE1 . GLN A 1 153 ? -27.727 -12.773 4.198   1.00 46.22 ? 229  GLN A OE1 1 
ATOM   788  N  NE2 . GLN A 1 153 ? -26.093 -11.301 4.650   1.00 40.60 ? 229  GLN A NE2 1 
ATOM   789  N  N   . LYS A 1 154 ? -26.489 -14.406 -1.189  1.00 25.70 ? 230  LYS A N   1 
ATOM   790  C  CA  . LYS A 1 154 ? -27.108 -15.114 -2.309  1.00 28.00 ? 230  LYS A CA  1 
ATOM   791  C  C   . LYS A 1 154 ? -26.090 -15.970 -3.048  1.00 26.94 ? 230  LYS A C   1 
ATOM   792  O  O   . LYS A 1 154 ? -26.375 -17.119 -3.406  1.00 28.67 ? 230  LYS A O   1 
ATOM   793  C  CB  . LYS A 1 154 ? -27.758 -14.125 -3.279  1.00 28.96 ? 230  LYS A CB  1 
ATOM   794  C  CG  . LYS A 1 154 ? -28.926 -13.345 -2.705  1.00 32.61 ? 230  LYS A CG  1 
ATOM   795  C  CD  . LYS A 1 154 ? -29.445 -12.331 -3.715  1.00 32.28 ? 230  LYS A CD  1 
ATOM   796  C  CE  . LYS A 1 154 ? -30.137 -13.021 -4.874  1.00 32.16 ? 230  LYS A CE  1 
ATOM   797  N  NZ  . LYS A 1 154 ? -31.344 -13.754 -4.413  1.00 32.87 ? 230  LYS A NZ  1 
ATOM   798  N  N   . LEU A 1 155 ? -24.901 -15.422 -3.302  1.00 24.47 ? 231  LEU A N   1 
ATOM   799  C  CA  . LEU A 1 155 ? -23.878 -16.186 -4.007  1.00 27.20 ? 231  LEU A CA  1 
ATOM   800  C  C   . LEU A 1 155 ? -23.408 -17.366 -3.172  1.00 27.92 ? 231  LEU A C   1 
ATOM   801  O  O   . LEU A 1 155 ? -23.123 -18.444 -3.709  1.00 29.38 ? 231  LEU A O   1 
ATOM   802  C  CB  . LEU A 1 155 ? -22.705 -15.278 -4.368  1.00 22.59 ? 231  LEU A CB  1 
ATOM   803  C  CG  . LEU A 1 155 ? -23.044 -14.142 -5.334  1.00 21.40 ? 231  LEU A CG  1 
ATOM   804  C  CD1 . LEU A 1 155 ? -21.884 -13.177 -5.435  1.00 24.04 ? 231  LEU A CD1 1 
ATOM   805  C  CD2 . LEU A 1 155 ? -23.399 -14.705 -6.708  1.00 19.71 ? 231  LEU A CD2 1 
ATOM   806  N  N   . ASP A 1 156 ? -23.328 -17.179 -1.855  1.00 25.51 ? 232  ASP A N   1 
ATOM   807  C  CA  . ASP A 1 156 ? -22.907 -18.261 -0.975  1.00 30.47 ? 232  ASP A CA  1 
ATOM   808  C  C   . ASP A 1 156 ? -23.904 -19.413 -1.006  1.00 32.35 ? 232  ASP A C   1 
ATOM   809  O  O   . ASP A 1 156 ? -23.509 -20.585 -1.005  1.00 34.87 ? 232  ASP A O   1 
ATOM   810  C  CB  . ASP A 1 156 ? -22.737 -17.730 0.448   1.00 32.90 ? 232  ASP A CB  1 
ATOM   811  C  CG  . ASP A 1 156 ? -21.882 -18.630 1.305   1.00 38.48 ? 232  ASP A CG  1 
ATOM   812  O  OD1 . ASP A 1 156 ? -20.644 -18.476 1.272   1.00 40.22 ? 232  ASP A OD1 1 
ATOM   813  O  OD2 . ASP A 1 156 ? -22.448 -19.496 2.005   1.00 41.46 ? 232  ASP A OD2 1 
ATOM   814  N  N   . ALA A 1 157 ? -25.202 -19.100 -1.036  1.00 31.39 ? 233  ALA A N   1 
ATOM   815  C  CA  . ALA A 1 157 ? -26.210 -20.151 -1.134  1.00 32.63 ? 233  ALA A CA  1 
ATOM   816  C  C   . ALA A 1 157 ? -26.094 -20.901 -2.455  1.00 31.39 ? 233  ALA A C   1 
ATOM   817  O  O   . ALA A 1 157 ? -26.226 -22.130 -2.496  1.00 28.67 ? 233  ALA A O   1 
ATOM   818  C  CB  . ALA A 1 157 ? -27.609 -19.556 -0.974  1.00 31.85 ? 233  ALA A CB  1 
ATOM   819  N  N   . ALA A 1 158 ? -25.843 -20.178 -3.548  1.00 29.09 ? 234  ALA A N   1 
ATOM   820  C  CA  . ALA A 1 158 ? -25.663 -20.842 -4.833  1.00 29.73 ? 234  ALA A CA  1 
ATOM   821  C  C   . ALA A 1 158 ? -24.386 -21.671 -4.851  1.00 30.62 ? 234  ALA A C   1 
ATOM   822  O  O   . ALA A 1 158 ? -24.371 -22.786 -5.385  1.00 29.41 ? 234  ALA A O   1 
ATOM   823  C  CB  . ALA A 1 158 ? -25.650 -19.811 -5.961  1.00 26.24 ? 234  ALA A CB  1 
ATOM   824  N  N   . ALA A 1 159 ? -23.305 -21.144 -4.272  1.00 30.95 ? 235  ALA A N   1 
ATOM   825  C  CA  . ALA A 1 159 ? -22.042 -21.876 -4.253  1.00 30.91 ? 235  ALA A CA  1 
ATOM   826  C  C   . ALA A 1 159 ? -22.180 -23.202 -3.511  1.00 32.56 ? 235  ALA A C   1 
ATOM   827  O  O   . ALA A 1 159 ? -21.647 -24.228 -3.952  1.00 35.92 ? 235  ALA A O   1 
ATOM   828  C  CB  . ALA A 1 159 ? -20.950 -21.013 -3.624  1.00 29.80 ? 235  ALA A CB  1 
ATOM   829  N  N   . LEU A 1 160 ? -22.907 -23.205 -2.392  1.00 32.85 ? 236  LEU A N   1 
ATOM   830  C  CA  . LEU A 1 160 ? -23.071 -24.432 -1.618  1.00 33.15 ? 236  LEU A CA  1 
ATOM   831  C  C   . LEU A 1 160 ? -23.875 -25.478 -2.377  1.00 35.05 ? 236  LEU A C   1 
ATOM   832  O  O   . LEU A 1 160 ? -23.666 -26.678 -2.179  1.00 33.72 ? 236  LEU A O   1 
ATOM   833  C  CB  . LEU A 1 160 ? -23.734 -24.124 -0.279  1.00 35.23 ? 236  LEU A CB  1 
ATOM   834  C  CG  . LEU A 1 160 ? -22.860 -23.354 0.711   1.00 38.44 ? 236  LEU A CG  1 
ATOM   835  C  CD1 . LEU A 1 160 ? -23.618 -23.097 2.006   1.00 38.48 ? 236  LEU A CD1 1 
ATOM   836  C  CD2 . LEU A 1 160 ? -21.578 -24.131 0.982   1.00 40.44 ? 236  LEU A CD2 1 
ATOM   837  N  N   . LYS A 1 161 ? -24.788 -25.054 -3.246  1.00 33.85 ? 237  LYS A N   1 
ATOM   838  C  CA  . LYS A 1 161 ? -25.551 -25.995 -4.050  1.00 38.39 ? 237  LYS A CA  1 
ATOM   839  C  C   . LYS A 1 161 ? -24.913 -26.264 -5.405  1.00 37.63 ? 237  LYS A C   1 
ATOM   840  O  O   . LYS A 1 161 ? -25.468 -27.037 -6.191  1.00 37.25 ? 237  LYS A O   1 
ATOM   841  C  CB  . LYS A 1 161 ? -26.987 -25.490 -4.234  1.00 42.97 ? 237  LYS A CB  1 
ATOM   842  C  CG  . LYS A 1 161 ? -27.818 -25.553 -2.960  1.00 47.05 ? 237  LYS A CG  1 
ATOM   843  C  CD  . LYS A 1 161 ? -29.256 -25.112 -3.189  1.00 52.61 ? 237  LYS A CD  1 
ATOM   844  C  CE  . LYS A 1 161 ? -30.100 -25.330 -1.935  1.00 57.90 ? 237  LYS A CE  1 
ATOM   845  N  NZ  . LYS A 1 161 ? -31.516 -24.891 -2.110  1.00 59.80 ? 237  LYS A NZ  1 
ATOM   846  N  N   . GLY A 1 162 ? -23.762 -25.660 -5.692  1.00 32.83 ? 238  GLY A N   1 
ATOM   847  C  CA  . GLY A 1 162 ? -23.131 -25.861 -6.978  1.00 32.09 ? 238  GLY A CA  1 
ATOM   848  C  C   . GLY A 1 162 ? -23.897 -25.269 -8.134  1.00 35.43 ? 238  GLY A C   1 
ATOM   849  O  O   . GLY A 1 162 ? -23.750 -25.737 -9.267  1.00 36.55 ? 238  GLY A O   1 
ATOM   850  N  N   . GLU A 1 163 ? -24.725 -24.258 -7.878  1.00 33.28 ? 239  GLU A N   1 
ATOM   851  C  CA  . GLU A 1 163 ? -25.515 -23.616 -8.916  1.00 37.31 ? 239  GLU A CA  1 
ATOM   852  C  C   . GLU A 1 163 ? -24.701 -22.535 -9.608  1.00 35.66 ? 239  GLU A C   1 
ATOM   853  O  O   . GLU A 1 163 ? -23.924 -21.821 -8.968  1.00 35.91 ? 239  GLU A O   1 
ATOM   854  C  CB  . GLU A 1 163 ? -26.780 -22.992 -8.326  1.00 40.56 ? 239  GLU A CB  1 
ATOM   855  C  CG  . GLU A 1 163 ? -27.734 -23.973 -7.685  1.00 45.64 ? 239  GLU A CG  1 
ATOM   856  C  CD  . GLU A 1 163 ? -28.902 -23.277 -7.019  1.00 51.64 ? 239  GLU A CD  1 
ATOM   857  O  OE1 . GLU A 1 163 ? -28.885 -22.027 -6.943  1.00 53.29 ? 239  GLU A OE1 1 
ATOM   858  O  OE2 . GLU A 1 163 ? -29.836 -23.974 -6.571  1.00 54.83 ? 239  GLU A OE2 1 
ATOM   859  N  N   . GLU A 1 164 ? -24.892 -22.415 -10.918 1.00 34.21 ? 240  GLU A N   1 
ATOM   860  C  CA  . GLU A 1 164 ? -24.341 -21.289 -11.653 1.00 33.34 ? 240  GLU A CA  1 
ATOM   861  C  C   . GLU A 1 164 ? -25.199 -20.051 -11.421 1.00 31.83 ? 240  GLU A C   1 
ATOM   862  O  O   . GLU A 1 164 ? -26.356 -20.136 -11.000 1.00 32.11 ? 240  GLU A O   1 
ATOM   863  C  CB  . GLU A 1 164 ? -24.253 -21.615 -13.144 1.00 36.27 ? 240  GLU A CB  1 
ATOM   864  C  CG  . GLU A 1 164 ? -23.427 -22.861 -13.421 1.00 40.13 ? 240  GLU A CG  1 
ATOM   865  C  CD  . GLU A 1 164 ? -23.526 -23.343 -14.854 1.00 43.20 ? 240  GLU A CD  1 
ATOM   866  O  OE1 . GLU A 1 164 ? -24.408 -22.860 -15.596 1.00 43.97 ? 240  GLU A OE1 1 
ATOM   867  O  OE2 . GLU A 1 164 ? -22.711 -24.207 -15.235 1.00 44.88 ? 240  GLU A OE2 1 
ATOM   868  N  N   . VAL A 1 165 ? -24.616 -18.887 -11.685 1.00 28.89 ? 241  VAL A N   1 
ATOM   869  C  CA  . VAL A 1 165 ? -25.294 -17.623 -11.441 1.00 28.14 ? 241  VAL A CA  1 
ATOM   870  C  C   . VAL A 1 165 ? -25.122 -16.723 -12.656 1.00 27.93 ? 241  VAL A C   1 
ATOM   871  O  O   . VAL A 1 165 ? -24.085 -16.736 -13.328 1.00 29.46 ? 241  VAL A O   1 
ATOM   872  C  CB  . VAL A 1 165 ? -24.778 -16.922 -10.161 1.00 28.81 ? 241  VAL A CB  1 
ATOM   873  C  CG1 . VAL A 1 165 ? -25.151 -17.728 -8.921  1.00 28.78 ? 241  VAL A CG1 1 
ATOM   874  C  CG2 . VAL A 1 165 ? -23.272 -16.721 -10.225 1.00 30.89 ? 241  VAL A CG2 1 
ATOM   875  N  N   . GLU A 1 166 ? -26.154 -15.939 -12.936 1.00 26.79 ? 242  GLU A N   1 
ATOM   876  C  CA  . GLU A 1 166 ? -26.133 -14.961 -14.020 1.00 26.07 ? 242  GLU A CA  1 
ATOM   877  C  C   . GLU A 1 166 ? -25.854 -13.609 -13.371 1.00 25.52 ? 242  GLU A C   1 
ATOM   878  O  O   . GLU A 1 166 ? -26.743 -12.997 -12.774 1.00 24.90 ? 242  GLU A O   1 
ATOM   879  C  CB  . GLU A 1 166 ? -27.447 -14.985 -14.798 1.00 26.47 ? 242  GLU A CB  1 
ATOM   880  C  CG  . GLU A 1 166 ? -27.375 -14.331 -16.165 1.00 26.02 ? 242  GLU A CG  1 
ATOM   881  C  CD  . GLU A 1 166 ? -27.147 -12.843 -16.072 1.00 24.91 ? 242  GLU A CD  1 
ATOM   882  O  OE1 . GLU A 1 166 ? -28.124 -12.108 -15.818 1.00 23.64 ? 242  GLU A OE1 1 
ATOM   883  O  OE2 . GLU A 1 166 ? -25.986 -12.412 -16.226 1.00 23.70 ? 242  GLU A OE2 1 
ATOM   884  N  N   . MET A 1 167 ? -24.609 -13.146 -13.492 1.00 25.51 ? 243  MET A N   1 
ATOM   885  C  CA  . MET A 1 167 ? -24.141 -12.043 -12.662 1.00 23.81 ? 243  MET A CA  1 
ATOM   886  C  C   . MET A 1 167 ? -24.710 -10.693 -13.088 1.00 24.69 ? 243  MET A C   1 
ATOM   887  O  O   . MET A 1 167 ? -24.809 -9.788  -12.253 1.00 22.25 ? 243  MET A O   1 
ATOM   888  C  CB  . MET A 1 167 ? -22.613 -11.994 -12.670 1.00 24.32 ? 243  MET A CB  1 
ATOM   889  C  CG  . MET A 1 167 ? -21.949 -13.087 -11.845 1.00 28.89 ? 243  MET A CG  1 
ATOM   890  S  SD  . MET A 1 167 ? -22.574 -13.225 -10.154 1.00 29.79 ? 243  MET A SD  1 
ATOM   891  C  CE  . MET A 1 167 ? -22.284 -11.575 -9.528  1.00 28.15 ? 243  MET A CE  1 
ATOM   892  N  N   . GLU A 1 168 ? -25.077 -10.521 -14.362 1.00 20.83 ? 244  GLU A N   1 
ATOM   893  C  CA  . GLU A 1 168 ? -25.547 -9.208  -14.803 1.00 20.13 ? 244  GLU A CA  1 
ATOM   894  C  C   . GLU A 1 168 ? -26.841 -8.827  -14.092 1.00 22.50 ? 244  GLU A C   1 
ATOM   895  O  O   . GLU A 1 168 ? -26.977 -7.709  -13.582 1.00 21.90 ? 244  GLU A O   1 
ATOM   896  C  CB  . GLU A 1 168 ? -25.735 -9.182  -16.323 1.00 20.68 ? 244  GLU A CB  1 
ATOM   897  C  CG  . GLU A 1 168 ? -25.906 -7.775  -16.900 1.00 24.13 ? 244  GLU A CG  1 
ATOM   898  C  CD  . GLU A 1 168 ? -26.082 -7.774  -18.418 1.00 27.04 ? 244  GLU A CD  1 
ATOM   899  O  OE1 . GLU A 1 168 ? -26.713 -8.709  -18.943 1.00 29.03 ? 244  GLU A OE1 1 
ATOM   900  O  OE2 . GLU A 1 168 ? -25.578 -6.847  -19.090 1.00 26.88 ? 244  GLU A OE2 1 
ATOM   901  N  N   . SER A 1 169 ? -27.800 -9.753  -14.032 1.00 22.38 ? 245  SER A N   1 
ATOM   902  C  CA  A SER A 1 169 ? -29.061 -9.465  -13.354 0.46 23.39 ? 245  SER A CA  1 
ATOM   903  C  CA  B SER A 1 169 ? -29.060 -9.460  -13.355 0.54 23.38 ? 245  SER A CA  1 
ATOM   904  C  C   . SER A 1 169 ? -28.851 -9.250  -11.858 1.00 23.31 ? 245  SER A C   1 
ATOM   905  O  O   . SER A 1 169 ? -29.510 -8.400  -11.248 1.00 22.22 ? 245  SER A O   1 
ATOM   906  C  CB  A SER A 1 169 ? -30.058 -10.594 -13.603 0.46 24.73 ? 245  SER A CB  1 
ATOM   907  C  CB  B SER A 1 169 ? -30.063 -10.582 -13.606 0.54 24.73 ? 245  SER A CB  1 
ATOM   908  O  OG  A SER A 1 169 ? -31.271 -10.366 -12.910 0.46 25.61 ? 245  SER A OG  1 
ATOM   909  O  OG  B SER A 1 169 ? -29.576 -11.814 -13.107 0.54 25.29 ? 245  SER A OG  1 
ATOM   910  N  N   . LEU A 1 170 ? -27.942 -10.015 -11.246 1.00 23.47 ? 246  LEU A N   1 
ATOM   911  C  CA  . LEU A 1 170 ? -27.670 -9.842  -9.821  1.00 24.30 ? 246  LEU A CA  1 
ATOM   912  C  C   . LEU A 1 170 ? -27.053 -8.478  -9.538  1.00 22.45 ? 246  LEU A C   1 
ATOM   913  O  O   . LEU A 1 170 ? -27.439 -7.803  -8.577  1.00 23.42 ? 246  LEU A O   1 
ATOM   914  C  CB  . LEU A 1 170 ? -26.754 -10.961 -9.319  1.00 25.46 ? 246  LEU A CB  1 
ATOM   915  C  CG  . LEU A 1 170 ? -27.400 -12.340 -9.197  1.00 29.50 ? 246  LEU A CG  1 
ATOM   916  C  CD1 . LEU A 1 170 ? -26.356 -13.408 -8.901  1.00 28.00 ? 246  LEU A CD1 1 
ATOM   917  C  CD2 . LEU A 1 170 ? -28.474 -12.318 -8.118  1.00 31.62 ? 246  LEU A CD2 1 
ATOM   918  N  N   . PHE A 1 171 ? -26.100 -8.052  -10.371 1.00 21.52 ? 247  PHE A N   1 
ATOM   919  C  CA  . PHE A 1 171 ? -25.507 -6.730  -10.207 1.00 21.84 ? 247  PHE A CA  1 
ATOM   920  C  C   . PHE A 1 171 ? -26.529 -5.624  -10.428 1.00 22.58 ? 247  PHE A C   1 
ATOM   921  O  O   . PHE A 1 171 ? -26.468 -4.581  -9.766  1.00 25.65 ? 247  PHE A O   1 
ATOM   922  C  CB  . PHE A 1 171 ? -24.336 -6.562  -11.170 1.00 22.02 ? 247  PHE A CB  1 
ATOM   923  C  CG  . PHE A 1 171 ? -23.080 -7.252  -10.727 1.00 21.94 ? 247  PHE A CG  1 
ATOM   924  C  CD1 . PHE A 1 171 ? -22.726 -7.279  -9.383  1.00 18.78 ? 247  PHE A CD1 1 
ATOM   925  C  CD2 . PHE A 1 171 ? -22.246 -7.863  -11.652 1.00 21.86 ? 247  PHE A CD2 1 
ATOM   926  C  CE1 . PHE A 1 171 ? -21.570 -7.904  -8.972  1.00 20.44 ? 247  PHE A CE1 1 
ATOM   927  C  CE2 . PHE A 1 171 ? -21.085 -8.490  -11.250 1.00 24.23 ? 247  PHE A CE2 1 
ATOM   928  C  CZ  . PHE A 1 171 ? -20.745 -8.511  -9.903  1.00 23.38 ? 247  PHE A CZ  1 
ATOM   929  N  N   . SER A 1 172 ? -27.467 -5.827  -11.354 1.00 21.67 ? 248  SER A N   1 
ATOM   930  C  CA  . SER A 1 172 ? -28.528 -4.846  -11.554 1.00 21.90 ? 248  SER A CA  1 
ATOM   931  C  C   . SER A 1 172 ? -29.397 -4.719  -10.307 1.00 21.61 ? 248  SER A C   1 
ATOM   932  O  O   . SER A 1 172 ? -29.761 -3.608  -9.907  1.00 22.36 ? 248  SER A O   1 
ATOM   933  C  CB  . SER A 1 172 ? -29.374 -5.227  -12.771 1.00 22.53 ? 248  SER A CB  1 
ATOM   934  O  OG  . SER A 1 172 ? -30.400 -4.278  -13.007 1.00 24.66 ? 248  SER A OG  1 
ATOM   935  N  N   . ARG A 1 173 ? -29.734 -5.845  -9.673  1.00 22.04 ? 249  ARG A N   1 
ATOM   936  C  CA  . ARG A 1 173 ? -30.492 -5.788  -8.424  1.00 22.48 ? 249  ARG A CA  1 
ATOM   937  C  C   . ARG A 1 173 ? -29.688 -5.109  -7.318  1.00 23.76 ? 249  ARG A C   1 
ATOM   938  O  O   . ARG A 1 173 ? -30.229 -4.300  -6.553  1.00 24.07 ? 249  ARG A O   1 
ATOM   939  C  CB  . ARG A 1 173 ? -30.907 -7.197  -7.995  1.00 23.07 ? 249  ARG A CB  1 
ATOM   940  C  CG  . ARG A 1 173 ? -31.806 -7.935  -8.983  1.00 28.09 ? 249  ARG A CG  1 
ATOM   941  C  CD  . ARG A 1 173 ? -33.022 -7.109  -9.351  0.77 32.49 ? 249  ARG A CD  1 
ATOM   942  N  NE  . ARG A 1 173 ? -33.917 -7.814  -10.267 0.33 35.93 ? 249  ARG A NE  1 
ATOM   943  C  CZ  . ARG A 1 173 ? -35.057 -8.393  -9.904  0.69 40.94 ? 249  ARG A CZ  1 
ATOM   944  N  NH1 . ARG A 1 173 ? -35.454 -8.352  -8.638  1.00 43.21 ? 249  ARG A NH1 1 
ATOM   945  N  NH2 . ARG A 1 173 ? -35.807 -9.011  -10.808 1.00 43.83 ? 249  ARG A NH2 1 
ATOM   946  N  N   . LEU A 1 174 ? -28.394 -5.420  -7.226  1.00 23.57 ? 250  LEU A N   1 
ATOM   947  C  CA  . LEU A 1 174 ? -27.548 -4.820  -6.198  1.00 21.10 ? 250  LEU A CA  1 
ATOM   948  C  C   . LEU A 1 174 ? -27.498 -3.302  -6.332  1.00 20.09 ? 250  LEU A C   1 
ATOM   949  O  O   . LEU A 1 174 ? -27.680 -2.576  -5.349  1.00 20.51 ? 250  LEU A O   1 
ATOM   950  C  CB  . LEU A 1 174 ? -26.138 -5.407  -6.275  1.00 21.44 ? 250  LEU A CB  1 
ATOM   951  C  CG  . LEU A 1 174 ? -25.078 -4.665  -5.459  1.00 22.49 ? 250  LEU A CG  1 
ATOM   952  C  CD1 . LEU A 1 174 ? -25.307 -4.881  -3.963  1.00 22.44 ? 250  LEU A CD1 1 
ATOM   953  C  CD2 . LEU A 1 174 ? -23.671 -5.076  -5.878  1.00 20.78 ? 250  LEU A CD2 1 
ATOM   954  N  N   . THR A 1 175 ? -27.253 -2.800  -7.545  1.00 19.00 ? 251  THR A N   1 
ATOM   955  C  CA  . THR A 1 175 ? -27.084 -1.361  -7.722  1.00 20.51 ? 251  THR A CA  1 
ATOM   956  C  C   . THR A 1 175 ? -28.410 -0.618  -7.611  1.00 21.34 ? 251  THR A C   1 
ATOM   957  O  O   . THR A 1 175 ? -28.437 0.545   -7.184  1.00 20.75 ? 251  THR A O   1 
ATOM   958  C  CB  . THR A 1 175 ? -26.411 -1.078  -9.068  1.00 22.12 ? 251  THR A CB  1 
ATOM   959  O  OG1 . THR A 1 175 ? -27.175 -1.671  -10.125 1.00 24.57 ? 251  THR A OG1 1 
ATOM   960  C  CG2 . THR A 1 175 ? -25.008 -1.671  -9.084  1.00 21.99 ? 251  THR A CG2 1 
ATOM   961  N  N   . LEU A 1 176 ? -29.514 -1.267  -7.985  1.00 22.19 ? 252  LEU A N   1 
ATOM   962  C  CA  . LEU A 1 176 ? -30.831 -0.683  -7.748  1.00 22.64 ? 252  LEU A CA  1 
ATOM   963  C  C   . LEU A 1 176 ? -31.091 -0.530  -6.254  1.00 24.19 ? 252  LEU A C   1 
ATOM   964  O  O   . LEU A 1 176 ? -31.531 0.530   -5.791  1.00 23.79 ? 252  LEU A O   1 
ATOM   965  C  CB  . LEU A 1 176 ? -31.913 -1.547  -8.397  1.00 22.79 ? 252  LEU A CB  1 
ATOM   966  C  CG  . LEU A 1 176 ? -33.351 -1.071  -8.173  1.00 25.24 ? 252  LEU A CG  1 
ATOM   967  C  CD1 . LEU A 1 176 ? -33.570 0.289   -8.822  1.00 24.98 ? 252  LEU A CD1 1 
ATOM   968  C  CD2 . LEU A 1 176 ? -34.358 -2.100  -8.693  1.00 22.36 ? 252  LEU A CD2 1 
ATOM   969  N  N   . ASP A 1 177 ? -30.816 -1.584  -5.481  1.00 23.01 ? 253  ASP A N   1 
ATOM   970  C  CA  . ASP A 1 177 ? -31.021 -1.521  -4.038  1.00 22.68 ? 253  ASP A CA  1 
ATOM   971  C  C   . ASP A 1 177 ? -30.177 -0.421  -3.406  1.00 22.04 ? 253  ASP A C   1 
ATOM   972  O  O   . ASP A 1 177 ? -30.655 0.314   -2.536  1.00 24.79 ? 253  ASP A O   1 
ATOM   973  C  CB  . ASP A 1 177 ? -30.700 -2.874  -3.402  1.00 25.60 ? 253  ASP A CB  1 
ATOM   974  C  CG  . ASP A 1 177 ? -31.769 -3.911  -3.669  1.00 31.05 ? 253  ASP A CG  1 
ATOM   975  O  OD1 . ASP A 1 177 ? -32.744 -3.582  -4.376  1.00 33.00 ? 253  ASP A OD1 1 
ATOM   976  O  OD2 . ASP A 1 177 ? -31.642 -5.050  -3.170  1.00 32.84 ? 253  ASP A OD2 1 
ATOM   977  N  N   . ILE A 1 178 ? -28.924 -0.285  -3.839  1.00 21.52 ? 254  ILE A N   1 
ATOM   978  C  CA  . ILE A 1 178 ? -28.052 0.740   -3.275  1.00 22.36 ? 254  ILE A CA  1 
ATOM   979  C  C   . ILE A 1 178 ? -28.581 2.130   -3.599  1.00 23.74 ? 254  ILE A C   1 
ATOM   980  O  O   . ILE A 1 178 ? -28.698 2.990   -2.718  1.00 23.87 ? 254  ILE A O   1 
ATOM   981  C  CB  . ILE A 1 178 ? -26.611 0.558   -3.785  1.00 22.18 ? 254  ILE A CB  1 
ATOM   982  C  CG1 . ILE A 1 178 ? -25.960 -0.663  -3.131  1.00 20.15 ? 254  ILE A CG1 1 
ATOM   983  C  CG2 . ILE A 1 178 ? -25.790 1.817   -3.525  1.00 21.82 ? 254  ILE A CG2 1 
ATOM   984  C  CD1 . ILE A 1 178 ? -24.589 -1.015  -3.719  1.00 18.12 ? 254  ILE A CD1 1 
ATOM   985  N  N   . ILE A 1 179 ? -28.909 2.375   -4.870  1.00 21.47 ? 255  ILE A N   1 
ATOM   986  C  CA  . ILE A 1 179 ? -29.185 3.745   -5.293  1.00 21.72 ? 255  ILE A CA  1 
ATOM   987  C  C   . ILE A 1 179 ? -30.521 4.229   -4.735  1.00 21.61 ? 255  ILE A C   1 
ATOM   988  O  O   . ILE A 1 179 ? -30.664 5.403   -4.373  1.00 22.81 ? 255  ILE A O   1 
ATOM   989  C  CB  . ILE A 1 179 ? -29.115 3.859   -6.833  1.00 23.28 ? 255  ILE A CB  1 
ATOM   990  C  CG1 . ILE A 1 179 ? -28.980 5.324   -7.249  1.00 24.05 ? 255  ILE A CG1 1 
ATOM   991  C  CG2 . ILE A 1 179 ? -30.327 3.219   -7.504  1.00 22.47 ? 255  ILE A CG2 1 
ATOM   992  C  CD1 . ILE A 1 179 ? -27.674 5.955   -6.833  1.00 22.28 ? 255  ILE A CD1 1 
ATOM   993  N  N   . GLY A 1 180 ? -31.515 3.341   -4.638  1.00 21.51 ? 256  GLY A N   1 
ATOM   994  C  CA  . GLY A 1 180 ? -32.792 3.745   -4.066  1.00 25.26 ? 256  GLY A CA  1 
ATOM   995  C  C   . GLY A 1 180 ? -32.664 4.193   -2.622  1.00 27.37 ? 256  GLY A C   1 
ATOM   996  O  O   . GLY A 1 180 ? -33.324 5.146   -2.191  1.00 28.40 ? 256  GLY A O   1 
ATOM   997  N  N   . LYS A 1 181 ? -31.798 3.525   -1.862  1.00 26.71 ? 257  LYS A N   1 
ATOM   998  C  CA  . LYS A 1 181 ? -31.572 3.911   -0.473  1.00 23.88 ? 257  LYS A CA  1 
ATOM   999  C  C   . LYS A 1 181 ? -30.744 5.187   -0.382  1.00 21.92 ? 257  LYS A C   1 
ATOM   1000 O  O   . LYS A 1 181 ? -31.047 6.076   0.422   1.00 23.29 ? 257  LYS A O   1 
ATOM   1001 C  CB  . LYS A 1 181 ? -30.884 2.764   0.268   1.00 24.83 ? 257  LYS A CB  1 
ATOM   1002 C  CG  . LYS A 1 181 ? -30.696 2.996   1.756   1.00 27.45 ? 257  LYS A CG  1 
ATOM   1003 C  CD  . LYS A 1 181 ? -32.031 3.082   2.462   1.00 29.82 ? 257  LYS A CD  1 
ATOM   1004 C  CE  . LYS A 1 181 ? -31.854 3.049   3.972   1.00 30.97 ? 257  LYS A CE  1 
ATOM   1005 N  NZ  . LYS A 1 181 ? -33.171 2.988   4.656   1.00 36.03 ? 257  LYS A NZ  1 
ATOM   1006 N  N   . ALA A 1 182 ? -29.695 5.296   -1.199  1.00 21.80 ? 258  ALA A N   1 
ATOM   1007 C  CA  . ALA A 1 182 ? -28.803 6.448   -1.124  1.00 22.89 ? 258  ALA A CA  1 
ATOM   1008 C  C   . ALA A 1 182 ? -29.499 7.734   -1.562  1.00 26.48 ? 258  ALA A C   1 
ATOM   1009 O  O   . ALA A 1 182 ? -29.238 8.807   -1.005  1.00 25.35 ? 258  ALA A O   1 
ATOM   1010 C  CB  . ALA A 1 182 ? -27.559 6.198   -1.979  1.00 21.47 ? 258  ALA A CB  1 
ATOM   1011 N  N   . VAL A 1 183 ? -30.380 7.654   -2.555  1.00 26.80 ? 259  VAL A N   1 
ATOM   1012 C  CA  . VAL A 1 183 ? -30.940 8.864   -3.151  1.00 27.59 ? 259  VAL A CA  1 
ATOM   1013 C  C   . VAL A 1 183 ? -32.191 9.333   -2.414  1.00 28.80 ? 259  VAL A C   1 
ATOM   1014 O  O   . VAL A 1 183 ? -32.316 10.515  -2.084  1.00 30.56 ? 259  VAL A O   1 
ATOM   1015 C  CB  . VAL A 1 183 ? -31.212 8.644   -4.653  1.00 24.49 ? 259  VAL A CB  1 
ATOM   1016 C  CG1 . VAL A 1 183 ? -31.967 9.822   -5.227  1.00 27.59 ? 259  VAL A CG1 1 
ATOM   1017 C  CG2 . VAL A 1 183 ? -29.897 8.454   -5.399  1.00 20.10 ? 259  VAL A CG2 1 
ATOM   1018 N  N   . PHE A 1 184 ? -33.153 8.443   -2.143  1.00 28.13 ? 260  PHE A N   1 
ATOM   1019 C  CA  . PHE A 1 184 ? -34.389 8.912   -1.517  1.00 30.28 ? 260  PHE A CA  1 
ATOM   1020 C  C   . PHE A 1 184 ? -34.898 7.972   -0.421  1.00 31.13 ? 260  PHE A C   1 
ATOM   1021 O  O   . PHE A 1 184 ? -36.105 7.928   -0.151  1.00 31.20 ? 260  PHE A O   1 
ATOM   1022 C  CB  . PHE A 1 184 ? -35.493 9.155   -2.561  1.00 33.11 ? 260  PHE A CB  1 
ATOM   1023 C  CG  . PHE A 1 184 ? -35.547 8.129   -3.661  1.00 34.29 ? 260  PHE A CG  1 
ATOM   1024 C  CD1 . PHE A 1 184 ? -35.147 8.455   -4.945  1.00 36.23 ? 260  PHE A CD1 1 
ATOM   1025 C  CD2 . PHE A 1 184 ? -36.013 6.849   -3.417  1.00 35.15 ? 260  PHE A CD2 1 
ATOM   1026 C  CE1 . PHE A 1 184 ? -35.201 7.522   -5.964  1.00 36.36 ? 260  PHE A CE1 1 
ATOM   1027 C  CE2 . PHE A 1 184 ? -36.071 5.908   -4.434  1.00 34.67 ? 260  PHE A CE2 1 
ATOM   1028 C  CZ  . PHE A 1 184 ? -35.661 6.246   -5.709  1.00 36.26 ? 260  PHE A CZ  1 
ATOM   1029 N  N   . ASN A 1 185 ? -33.997 7.235   0.232   1.00 29.35 ? 261  ASN A N   1 
ATOM   1030 C  CA  . ASN A 1 185 ? -34.314 6.491   1.456   1.00 32.68 ? 261  ASN A CA  1 
ATOM   1031 C  C   . ASN A 1 185 ? -35.361 5.401   1.221   1.00 32.43 ? 261  ASN A C   1 
ATOM   1032 O  O   . ASN A 1 185 ? -36.182 5.108   2.096   1.00 31.90 ? 261  ASN A O   1 
ATOM   1033 C  CB  . ASN A 1 185 ? -34.775 7.439   2.572   1.00 33.30 ? 261  ASN A CB  1 
ATOM   1034 C  CG  . ASN A 1 185 ? -34.741 6.789   3.937   1.00 38.94 ? 261  ASN A CG  1 
ATOM   1035 O  OD1 . ASN A 1 185 ? -33.907 5.921   4.195   1.00 40.26 ? 261  ASN A OD1 1 
ATOM   1036 N  ND2 . ASN A 1 185 ? -35.654 7.197   4.817   1.00 39.98 ? 261  ASN A ND2 1 
ATOM   1037 N  N   . TYR A 1 186 ? -35.353 4.785   0.045   1.00 30.09 ? 262  TYR A N   1 
ATOM   1038 C  CA  . TYR A 1 186 ? -36.270 3.697   -0.260  1.00 30.37 ? 262  TYR A CA  1 
ATOM   1039 C  C   . TYR A 1 186 ? -35.498 2.388   -0.345  1.00 30.05 ? 262  TYR A C   1 
ATOM   1040 O  O   . TYR A 1 186 ? -34.385 2.345   -0.879  1.00 30.45 ? 262  TYR A O   1 
ATOM   1041 C  CB  . TYR A 1 186 ? -37.019 3.955   -1.569  1.00 29.62 ? 262  TYR A CB  1 
ATOM   1042 C  CG  . TYR A 1 186 ? -38.173 3.006   -1.826  1.00 32.17 ? 262  TYR A CG  1 
ATOM   1043 C  CD1 . TYR A 1 186 ? -39.380 3.153   -1.156  1.00 34.31 ? 262  TYR A CD1 1 
ATOM   1044 C  CD2 . TYR A 1 186 ? -38.062 1.979   -2.758  1.00 31.28 ? 262  TYR A CD2 1 
ATOM   1045 C  CE1 . TYR A 1 186 ? -40.441 2.295   -1.393  1.00 37.11 ? 262  TYR A CE1 1 
ATOM   1046 C  CE2 . TYR A 1 186 ? -39.118 1.116   -3.003  1.00 34.06 ? 262  TYR A CE2 1 
ATOM   1047 C  CZ  . TYR A 1 186 ? -40.304 1.278   -2.319  1.00 37.61 ? 262  TYR A CZ  1 
ATOM   1048 O  OH  . TYR A 1 186 ? -41.358 0.424   -2.559  1.00 41.80 ? 262  TYR A OH  1 
ATOM   1049 N  N   . ASP A 1 187 ? -36.088 1.327   0.193   1.00 31.25 ? 263  ASP A N   1 
ATOM   1050 C  CA  . ASP A 1 187 ? -35.491 -0.005  0.174   1.00 31.95 ? 263  ASP A CA  1 
ATOM   1051 C  C   . ASP A 1 187 ? -36.260 -0.843  -0.846  1.00 29.96 ? 263  ASP A C   1 
ATOM   1052 O  O   . ASP A 1 187 ? -37.290 -1.437  -0.528  1.00 30.80 ? 263  ASP A O   1 
ATOM   1053 C  CB  . ASP A 1 187 ? -35.524 -0.633  1.568   1.00 36.78 ? 263  ASP A CB  1 
ATOM   1054 C  CG  . ASP A 1 187 ? -34.629 0.096   2.556   1.00 41.99 ? 263  ASP A CG  1 
ATOM   1055 O  OD1 . ASP A 1 187 ? -33.396 -0.113  2.516   0.76 43.63 ? 263  ASP A OD1 1 
ATOM   1056 O  OD2 . ASP A 1 187 ? -35.158 0.893   3.358   0.57 43.84 ? 263  ASP A OD2 1 
ATOM   1057 N  N   . PHE A 1 188 ? -35.756 -0.874  -2.085  1.00 29.18 ? 264  PHE A N   1 
ATOM   1058 C  CA  . PHE A 1 188 ? -36.371 -1.716  -3.108  1.00 27.85 ? 264  PHE A CA  1 
ATOM   1059 C  C   . PHE A 1 188 ? -36.322 -3.183  -2.710  1.00 29.93 ? 264  PHE A C   1 
ATOM   1060 O  O   . PHE A 1 188 ? -37.269 -3.935  -2.970  1.00 30.64 ? 264  PHE A O   1 
ATOM   1061 C  CB  . PHE A 1 188 ? -35.668 -1.531  -4.454  1.00 28.33 ? 264  PHE A CB  1 
ATOM   1062 C  CG  . PHE A 1 188 ? -36.006 -0.247  -5.161  1.00 27.35 ? 264  PHE A CG  1 
ATOM   1063 C  CD1 . PHE A 1 188 ? -37.256 -0.058  -5.730  1.00 27.70 ? 264  PHE A CD1 1 
ATOM   1064 C  CD2 . PHE A 1 188 ? -35.055 0.751   -5.298  1.00 25.34 ? 264  PHE A CD2 1 
ATOM   1065 C  CE1 . PHE A 1 188 ? -37.561 1.115   -6.394  1.00 27.22 ? 264  PHE A CE1 1 
ATOM   1066 C  CE2 . PHE A 1 188 ? -35.350 1.926   -5.967  1.00 25.54 ? 264  PHE A CE2 1 
ATOM   1067 C  CZ  . PHE A 1 188 ? -36.604 2.110   -6.515  1.00 25.41 ? 264  PHE A CZ  1 
ATOM   1068 N  N   . ASP A 1 189 ? -35.217 -3.604  -2.089  1.00 32.10 ? 265  ASP A N   1 
ATOM   1069 C  CA  . ASP A 1 189 ? -34.946 -5.004  -1.759  1.00 32.92 ? 265  ASP A CA  1 
ATOM   1070 C  C   . ASP A 1 189 ? -35.103 -5.907  -2.981  1.00 30.68 ? 265  ASP A C   1 
ATOM   1071 O  O   . ASP A 1 189 ? -35.572 -7.044  -2.886  1.00 28.46 ? 265  ASP A O   1 
ATOM   1072 C  CB  . ASP A 1 189 ? -35.828 -5.489  -0.609  1.00 39.81 ? 265  ASP A CB  1 
ATOM   1073 C  CG  . ASP A 1 189 ? -35.261 -6.723  0.072   1.00 47.25 ? 265  ASP A CG  1 
ATOM   1074 O  OD1 . ASP A 1 189 ? -34.025 -6.917  0.012   1.00 49.12 ? 265  ASP A OD1 1 
ATOM   1075 O  OD2 . ASP A 1 189 ? -36.045 -7.506  0.648   1.00 49.98 ? 265  ASP A OD2 1 
ATOM   1076 N  N   . SER A 1 190 ? -34.694 -5.394  -4.145  1.00 28.32 ? 266  SER A N   1 
ATOM   1077 C  CA  . SER A 1 190 ? -34.769 -6.169  -5.378  1.00 29.79 ? 266  SER A CA  1 
ATOM   1078 C  C   . SER A 1 190 ? -33.851 -7.384  -5.359  1.00 29.85 ? 266  SER A C   1 
ATOM   1079 O  O   . SER A 1 190 ? -34.051 -8.306  -6.156  1.00 29.23 ? 266  SER A O   1 
ATOM   1080 C  CB  . SER A 1 190 ? -34.427 -5.288  -6.579  1.00 26.76 ? 266  SER A CB  1 
ATOM   1081 O  OG  . SER A 1 190 ? -33.031 -5.055  -6.644  1.00 26.47 ? 266  SER A OG  1 
ATOM   1082 N  N   . LEU A 1 191 ? -32.845 -7.399  -4.480  1.00 28.39 ? 267  LEU A N   1 
ATOM   1083 C  CA  . LEU A 1 191 ? -32.016 -8.589  -4.335  1.00 31.27 ? 267  LEU A CA  1 
ATOM   1084 C  C   . LEU A 1 191 ? -32.818 -9.764  -3.798  1.00 35.49 ? 267  LEU A C   1 
ATOM   1085 O  O   . LEU A 1 191 ? -32.520 -10.917 -4.126  1.00 36.65 ? 267  LEU A O   1 
ATOM   1086 C  CB  . LEU A 1 191 ? -30.831 -8.304  -3.414  1.00 30.89 ? 267  LEU A CB  1 
ATOM   1087 C  CG  . LEU A 1 191 ? -29.628 -7.594  -4.031  1.00 29.14 ? 267  LEU A CG  1 
ATOM   1088 C  CD1 . LEU A 1 191 ? -28.648 -7.191  -2.941  1.00 26.73 ? 267  LEU A CD1 1 
ATOM   1089 C  CD2 . LEU A 1 191 ? -28.959 -8.501  -5.052  1.00 26.83 ? 267  LEU A CD2 1 
ATOM   1090 N  N   . THR A 1 192 ? -33.845 -9.496  -2.994  1.00 35.55 ? 268  THR A N   1 
ATOM   1091 C  CA  . THR A 1 192 ? -34.615 -10.549 -2.345  1.00 40.04 ? 268  THR A CA  1 
ATOM   1092 C  C   . THR A 1 192 ? -35.968 -10.801 -2.995  1.00 44.03 ? 268  THR A C   1 
ATOM   1093 O  O   . THR A 1 192 ? -36.369 -11.960 -3.142  1.00 45.46 ? 268  THR A O   1 
ATOM   1094 C  CB  . THR A 1 192 ? -34.825 -10.210 -0.867  1.00 42.37 ? 268  THR A CB  1 
ATOM   1095 O  OG1 . THR A 1 192 ? -33.553 -10.026 -0.236  1.00 42.26 ? 268  THR A OG1 1 
ATOM   1096 C  CG2 . THR A 1 192 ? -35.576 -11.330 -0.160  1.00 46.17 ? 268  THR A CG2 1 
ATOM   1097 N  N   . ASN A 1 193 ? -36.685 -9.753  -3.392  1.00 45.38 ? 269  ASN A N   1 
ATOM   1098 C  CA  . ASN A 1 193 ? -38.064 -9.890  -3.838  1.00 49.10 ? 269  ASN A CA  1 
ATOM   1099 C  C   . ASN A 1 193 ? -38.289 -9.136  -5.141  1.00 48.37 ? 269  ASN A C   1 
ATOM   1100 O  O   . ASN A 1 193 ? -37.442 -8.369  -5.606  1.00 47.29 ? 269  ASN A O   1 
ATOM   1101 C  CB  . ASN A 1 193 ? -39.044 -9.376  -2.774  1.00 53.03 ? 269  ASN A CB  1 
ATOM   1102 C  CG  . ASN A 1 193 ? -38.930 -10.127 -1.465  1.00 58.03 ? 269  ASN A CG  1 
ATOM   1103 O  OD1 . ASN A 1 193 ? -38.848 -11.356 -1.446  1.00 60.37 ? 269  ASN A OD1 1 
ATOM   1104 N  ND2 . ASN A 1 193 ? -38.919 -9.390  -0.360  1.00 58.34 ? 269  ASN A ND2 1 
ATOM   1105 N  N   . ASP A 1 194 ? -39.457 -9.375  -5.726  1.00 49.59 ? 270  ASP A N   1 
ATOM   1106 C  CA  . ASP A 1 194 ? -39.971 -8.598  -6.841  1.00 50.58 ? 270  ASP A CA  1 
ATOM   1107 C  C   . ASP A 1 194 ? -41.241 -7.888  -6.400  1.00 46.85 ? 270  ASP A C   1 
ATOM   1108 O  O   . ASP A 1 194 ? -42.060 -8.456  -5.671  1.00 46.02 ? 270  ASP A O   1 
ATOM   1109 C  CB  . ASP A 1 194 ? -40.257 -9.482  -8.054  1.00 57.33 ? 270  ASP A CB  1 
ATOM   1110 C  CG  . ASP A 1 194 ? -39.000 -9.873  -8.794  1.00 62.85 ? 270  ASP A CG  1 
ATOM   1111 O  OD1 . ASP A 1 194 ? -38.267 -8.965  -9.239  1.00 64.93 ? 270  ASP A OD1 1 
ATOM   1112 O  OD2 . ASP A 1 194 ? -38.738 -11.087 -8.919  1.00 65.69 ? 270  ASP A OD2 1 
ATOM   1113 N  N   . THR A 1 195 ? -41.387 -6.635  -6.824  1.00 42.76 ? 271  THR A N   1 
ATOM   1114 C  CA  . THR A 1 195 ? -42.557 -5.835  -6.500  1.00 41.10 ? 271  THR A CA  1 
ATOM   1115 C  C   . THR A 1 195 ? -43.011 -5.108  -7.754  1.00 37.42 ? 271  THR A C   1 
ATOM   1116 O  O   . THR A 1 195 ? -42.299 -5.055  -8.762  1.00 31.98 ? 271  THR A O   1 
ATOM   1117 C  CB  . THR A 1 195 ? -42.270 -4.819  -5.385  1.00 41.85 ? 271  THR A CB  1 
ATOM   1118 O  OG1 . THR A 1 195 ? -41.299 -3.871  -5.846  1.00 40.70 ? 271  THR A OG1 1 
ATOM   1119 C  CG2 . THR A 1 195 ? -41.742 -5.510  -4.130  1.00 41.99 ? 271  THR A CG2 1 
ATOM   1120 N  N   . GLY A 1 196 ? -44.217 -4.541  -7.683  1.00 37.44 ? 272  GLY A N   1 
ATOM   1121 C  CA  . GLY A 1 196 ? -44.687 -3.696  -8.766  1.00 36.40 ? 272  GLY A CA  1 
ATOM   1122 C  C   . GLY A 1 196 ? -43.812 -2.478  -8.976  1.00 34.92 ? 272  GLY A C   1 
ATOM   1123 O  O   . GLY A 1 196 ? -43.631 -2.027  -10.111 1.00 32.84 ? 272  GLY A O   1 
ATOM   1124 N  N   . VAL A 1 197 ? -43.249 -1.936  -7.892  1.00 34.23 ? 273  VAL A N   1 
ATOM   1125 C  CA  . VAL A 1 197 ? -42.354 -0.790  -8.009  1.00 33.14 ? 273  VAL A CA  1 
ATOM   1126 C  C   . VAL A 1 197 ? -41.094 -1.174  -8.770  1.00 31.00 ? 273  VAL A C   1 
ATOM   1127 O  O   . VAL A 1 197 ? -40.624 -0.429  -9.639  1.00 31.63 ? 273  VAL A O   1 
ATOM   1128 C  CB  . VAL A 1 197 ? -42.014 -0.229  -6.616  1.00 37.02 ? 273  VAL A CB  1 
ATOM   1129 C  CG1 . VAL A 1 197 ? -41.059 0.941   -6.750  1.00 37.64 ? 273  VAL A CG1 1 
ATOM   1130 C  CG2 . VAL A 1 197 ? -43.279 0.191   -5.889  1.00 38.49 ? 273  VAL A CG2 1 
ATOM   1131 N  N   . ILE A 1 198 ? -40.522 -2.337  -8.448  1.00 31.00 ? 274  ILE A N   1 
ATOM   1132 C  CA  . ILE A 1 198 ? -39.323 -2.800  -9.142  1.00 30.46 ? 274  ILE A CA  1 
ATOM   1133 C  C   . ILE A 1 198 ? -39.624 -3.036  -10.616 1.00 33.21 ? 274  ILE A C   1 
ATOM   1134 O  O   . ILE A 1 198 ? -38.874 -2.606  -11.501 1.00 32.80 ? 274  ILE A O   1 
ATOM   1135 C  CB  . ILE A 1 198 ? -38.772 -4.070  -8.468  1.00 31.04 ? 274  ILE A CB  1 
ATOM   1136 C  CG1 . ILE A 1 198 ? -38.163 -3.726  -7.103  1.00 32.47 ? 274  ILE A CG1 1 
ATOM   1137 C  CG2 . ILE A 1 198 ? -37.748 -4.751  -9.362  1.00 29.47 ? 274  ILE A CG2 1 
ATOM   1138 C  CD1 . ILE A 1 198 ? -38.068 -4.907  -6.157  1.00 32.27 ? 274  ILE A CD1 1 
ATOM   1139 N  N   . GLU A 1 199 ? -40.734 -3.718  -10.901 1.00 34.67 ? 275  GLU A N   1 
ATOM   1140 C  CA  . GLU A 1 199 ? -41.102 -3.959  -12.291 1.00 37.22 ? 275  GLU A CA  1 
ATOM   1141 C  C   . GLU A 1 199 ? -41.362 -2.653  -13.030 1.00 37.72 ? 275  GLU A C   1 
ATOM   1142 O  O   . GLU A 1 199 ? -41.059 -2.546  -14.225 1.00 36.31 ? 275  GLU A O   1 
ATOM   1143 C  CB  . GLU A 1 199 ? -42.319 -4.884  -12.351 1.00 40.07 ? 275  GLU A CB  1 
ATOM   1144 C  CG  . GLU A 1 199 ? -42.037 -6.262  -11.768 1.00 43.47 ? 275  GLU A CG  1 
ATOM   1145 C  CD  . GLU A 1 199 ? -43.286 -7.100  -11.584 0.01 49.65 ? 275  GLU A CD  1 
ATOM   1146 O  OE1 . GLU A 1 199 ? -44.348 -6.715  -12.115 0.91 52.44 ? 275  GLU A OE1 1 
ATOM   1147 O  OE2 . GLU A 1 199 ? -43.202 -8.145  -10.903 1.00 52.78 ? 275  GLU A OE2 1 
ATOM   1148 N  N   . ALA A 1 200 ? -41.890 -1.642  -12.334 1.00 37.09 ? 276  ALA A N   1 
ATOM   1149 C  CA  . ALA A 1 200 ? -42.089 -0.340  -12.964 1.00 35.89 ? 276  ALA A CA  1 
ATOM   1150 C  C   . ALA A 1 200 ? -40.758 0.296   -13.346 1.00 34.56 ? 276  ALA A C   1 
ATOM   1151 O  O   . ALA A 1 200 ? -40.625 0.875   -14.433 1.00 32.49 ? 276  ALA A O   1 
ATOM   1152 C  CB  . ALA A 1 200 ? -42.877 0.583   -12.034 1.00 37.60 ? 276  ALA A CB  1 
ATOM   1153 N  N   . VAL A 1 201 ? -39.759 0.198   -12.466 1.00 30.73 ? 277  VAL A N   1 
ATOM   1154 C  CA  . VAL A 1 201 ? -38.457 0.784   -12.768 1.00 30.35 ? 277  VAL A CA  1 
ATOM   1155 C  C   . VAL A 1 201 ? -37.849 0.123   -14.000 1.00 30.46 ? 277  VAL A C   1 
ATOM   1156 O  O   . VAL A 1 201 ? -37.346 0.804   -14.902 1.00 33.57 ? 277  VAL A O   1 
ATOM   1157 C  CB  . VAL A 1 201 ? -37.525 0.688   -11.545 1.00 29.33 ? 277  VAL A CB  1 
ATOM   1158 C  CG1 . VAL A 1 201 ? -36.126 1.148   -11.911 1.00 31.44 ? 277  VAL A CG1 1 
ATOM   1159 C  CG2 . VAL A 1 201 ? -38.072 1.536   -10.405 1.00 29.76 ? 277  VAL A CG2 1 
ATOM   1160 N  N   . TYR A 1 202 ? -37.909 -1.208  -14.078 1.00 30.34 ? 278  TYR A N   1 
ATOM   1161 C  CA  . TYR A 1 202 ? -37.311 -1.888  -15.223 1.00 31.54 ? 278  TYR A CA  1 
ATOM   1162 C  C   . TYR A 1 202 ? -38.105 -1.654  -16.501 1.00 32.74 ? 278  TYR A C   1 
ATOM   1163 O  O   . TYR A 1 202 ? -37.520 -1.607  -17.588 1.00 33.72 ? 278  TYR A O   1 
ATOM   1164 C  CB  . TYR A 1 202 ? -37.162 -3.380  -14.932 1.00 32.24 ? 278  TYR A CB  1 
ATOM   1165 C  CG  . TYR A 1 202 ? -35.961 -3.668  -14.063 1.00 33.32 ? 278  TYR A CG  1 
ATOM   1166 C  CD1 . TYR A 1 202 ? -36.108 -3.980  -12.720 1.00 35.03 ? 278  TYR A CD1 1 
ATOM   1167 C  CD2 . TYR A 1 202 ? -34.674 -3.595  -14.583 1.00 34.29 ? 278  TYR A CD2 1 
ATOM   1168 C  CE1 . TYR A 1 202 ? -35.011 -4.233  -11.922 1.00 34.15 ? 278  TYR A CE1 1 
ATOM   1169 C  CE2 . TYR A 1 202 ? -33.569 -3.844  -13.794 1.00 34.03 ? 278  TYR A CE2 1 
ATOM   1170 C  CZ  . TYR A 1 202 ? -33.743 -4.160  -12.463 1.00 34.35 ? 278  TYR A CZ  1 
ATOM   1171 O  OH  . TYR A 1 202 ? -32.643 -4.409  -11.671 1.00 33.87 ? 278  TYR A OH  1 
ATOM   1172 N  N   . THR A 1 203 ? -39.426 -1.491  -16.396 1.00 32.78 ? 279  THR A N   1 
ATOM   1173 C  CA  . THR A 1 203 ? -40.211 -1.113  -17.569 1.00 34.41 ? 279  THR A CA  1 
ATOM   1174 C  C   . THR A 1 203 ? -39.768 0.244   -18.096 1.00 34.43 ? 279  THR A C   1 
ATOM   1175 O  O   . THR A 1 203 ? -39.598 0.430   -19.307 1.00 34.88 ? 279  THR A O   1 
ATOM   1176 C  CB  . THR A 1 203 ? -41.700 -1.089  -17.226 1.00 34.64 ? 279  THR A CB  1 
ATOM   1177 O  OG1 . THR A 1 203 ? -42.122 -2.399  -16.835 1.00 34.57 ? 279  THR A OG1 1 
ATOM   1178 C  CG2 . THR A 1 203 ? -42.519 -0.637  -18.426 1.00 37.23 ? 279  THR A CG2 1 
ATOM   1179 N  N   . VAL A 1 204 ? -39.568 1.202   -17.193 1.00 31.68 ? 280  VAL A N   1 
ATOM   1180 C  CA  . VAL A 1 204 ? -39.101 2.524   -17.586 1.00 32.66 ? 280  VAL A CA  1 
ATOM   1181 C  C   . VAL A 1 204 ? -37.688 2.451   -18.155 1.00 32.73 ? 280  VAL A C   1 
ATOM   1182 O  O   . VAL A 1 204 ? -37.371 3.124   -19.145 1.00 33.69 ? 280  VAL A O   1 
ATOM   1183 C  CB  . VAL A 1 204 ? -39.189 3.479   -16.384 1.00 33.04 ? 280  VAL A CB  1 
ATOM   1184 C  CG1 . VAL A 1 204 ? -38.301 4.674   -16.591 1.00 34.15 ? 280  VAL A CG1 1 
ATOM   1185 C  CG2 . VAL A 1 204 ? -40.631 3.913   -16.166 1.00 32.62 ? 280  VAL A CG2 1 
ATOM   1186 N  N   . LEU A 1 205 ? -36.817 1.638   -17.538 1.00 32.69 ? 281  LEU A N   1 
ATOM   1187 C  CA  . LEU A 1 205 ? -35.454 1.459   -18.042 1.00 35.69 ? 281  LEU A CA  1 
ATOM   1188 C  C   . LEU A 1 205 ? -35.458 0.901   -19.457 1.00 37.59 ? 281  LEU A C   1 
ATOM   1189 O  O   . LEU A 1 205 ? -34.706 1.370   -20.320 1.00 39.20 ? 281  LEU A O   1 
ATOM   1190 C  CB  . LEU A 1 205 ? -34.654 0.532   -17.120 1.00 37.93 ? 281  LEU A CB  1 
ATOM   1191 C  CG  . LEU A 1 205 ? -33.701 1.137   -16.083 1.00 41.24 ? 281  LEU A CG  1 
ATOM   1192 C  CD1 . LEU A 1 205 ? -33.823 2.648   -16.030 1.00 41.27 ? 281  LEU A CD1 1 
ATOM   1193 C  CD2 . LEU A 1 205 ? -33.965 0.532   -14.718 1.00 40.40 ? 281  LEU A CD2 1 
ATOM   1194 N  N   . ARG A 1 206 ? -36.298 -0.104  -19.713 1.00 37.92 ? 282  ARG A N   1 
ATOM   1195 C  CA  . ARG A 1 206 ? -36.356 -0.706  -21.040 1.00 38.80 ? 282  ARG A CA  1 
ATOM   1196 C  C   . ARG A 1 206 ? -36.832 0.300   -22.081 1.00 37.93 ? 282  ARG A C   1 
ATOM   1197 O  O   . ARG A 1 206 ? -36.323 0.322   -23.208 1.00 38.87 ? 282  ARG A O   1 
ATOM   1198 C  CB  . ARG A 1 206 ? -37.263 -1.934  -21.005 1.00 42.52 ? 282  ARG A CB  1 
ATOM   1199 C  CG  . ARG A 1 206 ? -37.437 -2.649  -22.330 1.00 45.40 ? 282  ARG A CG  1 
ATOM   1200 C  CD  . ARG A 1 206 ? -38.678 -3.511  -22.261 0.48 48.38 ? 282  ARG A CD  1 
ATOM   1201 N  NE  . ARG A 1 206 ? -39.753 -2.769  -21.613 0.01 50.23 ? 282  ARG A NE  1 
ATOM   1202 C  CZ  . ARG A 1 206 ? -40.605 -1.981  -22.257 0.33 52.09 ? 282  ARG A CZ  1 
ATOM   1203 N  NH1 . ARG A 1 206 ? -40.516 -1.844  -23.573 0.31 52.48 ? 282  ARG A NH1 1 
ATOM   1204 N  NH2 . ARG A 1 206 ? -41.545 -1.328  -21.589 1.00 53.67 ? 282  ARG A NH2 1 
ATOM   1205 N  N   . GLU A 1 207 ? -37.795 1.152   -21.718 1.00 36.87 ? 283  GLU A N   1 
ATOM   1206 C  CA  . GLU A 1 207 ? -38.236 2.198   -22.635 1.00 37.24 ? 283  GLU A CA  1 
ATOM   1207 C  C   . GLU A 1 207 ? -37.115 3.191   -22.911 1.00 37.16 ? 283  GLU A C   1 
ATOM   1208 O  O   . GLU A 1 207 ? -36.954 3.657   -24.045 1.00 38.40 ? 283  GLU A O   1 
ATOM   1209 C  CB  . GLU A 1 207 ? -39.468 2.912   -22.073 1.00 40.50 ? 283  GLU A CB  1 
ATOM   1210 C  CG  . GLU A 1 207 ? -39.929 4.127   -22.886 1.00 42.60 ? 283  GLU A CG  1 
ATOM   1211 C  CD  . GLU A 1 207 ? -40.595 3.758   -24.205 1.00 44.48 ? 283  GLU A CD  1 
ATOM   1212 O  OE1 . GLU A 1 207 ? -40.882 2.562   -24.419 1.00 45.29 ? 283  GLU A OE1 1 
ATOM   1213 O  OE2 . GLU A 1 207 ? -40.833 4.667   -25.028 1.00 44.94 ? 283  GLU A OE2 1 
ATOM   1214 N  N   . ALA A 1 208 ? -36.321 3.521   -21.889 1.00 35.37 ? 284  ALA A N   1 
ATOM   1215 C  CA  . ALA A 1 208 ? -35.170 4.392   -22.106 1.00 32.56 ? 284  ALA A CA  1 
ATOM   1216 C  C   . ALA A 1 208 ? -34.162 3.748   -23.050 1.00 32.42 ? 284  ALA A C   1 
ATOM   1217 O  O   . ALA A 1 208 ? -33.538 4.435   -23.866 1.00 30.16 ? 284  ALA A O   1 
ATOM   1218 C  CB  . ALA A 1 208 ? -34.512 4.738   -20.772 1.00 32.37 ? 284  ALA A CB  1 
ATOM   1219 N  N   . GLU A 1 209 ? -33.986 2.428   -22.953 1.00 34.40 ? 285  GLU A N   1 
ATOM   1220 C  CA  . GLU A 1 209 ? -33.125 1.727   -23.902 1.00 37.32 ? 285  GLU A CA  1 
ATOM   1221 C  C   . GLU A 1 209 ? -33.689 1.814   -25.315 1.00 36.65 ? 285  GLU A C   1 
ATOM   1222 O  O   . GLU A 1 209 ? -32.957 2.097   -26.270 1.00 38.85 ? 285  GLU A O   1 
ATOM   1223 C  CB  . GLU A 1 209 ? -32.945 0.270   -23.476 1.00 42.53 ? 285  GLU A CB  1 
ATOM   1224 C  CG  . GLU A 1 209 ? -32.061 0.081   -22.247 1.00 47.32 ? 285  GLU A CG  1 
ATOM   1225 C  CD  . GLU A 1 209 ? -30.627 0.554   -22.463 1.00 52.52 ? 285  GLU A CD  1 
ATOM   1226 O  OE1 . GLU A 1 209 ? -30.353 1.754   -22.262 1.00 54.15 ? 285  GLU A OE1 1 
ATOM   1227 O  OE2 . GLU A 1 209 ? -29.771 -0.275  -22.839 1.00 55.02 ? 285  GLU A OE2 1 
ATOM   1228 N  N   . ASP A 1 210 ? -34.999 1.592   -25.464 1.00 34.89 ? 286  ASP A N   1 
ATOM   1229 C  CA  . ASP A 1 210 ? -35.619 1.679   -26.783 1.00 38.68 ? 286  ASP A CA  1 
ATOM   1230 C  C   . ASP A 1 210 ? -35.471 3.075   -27.375 1.00 38.04 ? 286  ASP A C   1 
ATOM   1231 O  O   . ASP A 1 210 ? -35.230 3.224   -28.579 1.00 37.54 ? 286  ASP A O   1 
ATOM   1232 C  CB  . ASP A 1 210 ? -37.094 1.286   -26.704 1.00 43.74 ? 286  ASP A CB  1 
ATOM   1233 C  CG  . ASP A 1 210 ? -37.293 -0.173  -26.328 1.00 46.71 ? 286  ASP A CG  1 
ATOM   1234 O  OD1 . ASP A 1 210 ? -36.288 -0.874  -26.084 1.00 46.77 ? 286  ASP A OD1 1 
ATOM   1235 O  OD2 . ASP A 1 210 ? -38.460 -0.614  -26.275 1.00 49.12 ? 286  ASP A OD2 1 
ATOM   1236 N  N   . ARG A 1 211 ? -35.609 4.113   -26.550 1.00 33.13 ? 287  ARG A N   1 
ATOM   1237 C  CA  . ARG A 1 211 ? -35.425 5.465   -27.057 1.00 32.21 ? 287  ARG A CA  1 
ATOM   1238 C  C   . ARG A 1 211 ? -33.968 5.772   -27.371 1.00 28.38 ? 287  ARG A C   1 
ATOM   1239 O  O   . ARG A 1 211 ? -33.697 6.650   -28.195 1.00 29.75 ? 287  ARG A O   1 
ATOM   1240 C  CB  . ARG A 1 211 ? -35.975 6.485   -26.058 1.00 36.81 ? 287  ARG A CB  1 
ATOM   1241 C  CG  . ARG A 1 211 ? -37.442 6.277   -25.737 1.00 42.20 ? 287  ARG A CG  1 
ATOM   1242 C  CD  . ARG A 1 211 ? -38.132 7.569   -25.375 1.00 45.06 ? 287  ARG A CD  1 
ATOM   1243 N  NE  . ARG A 1 211 ? -39.530 7.329   -25.035 1.00 51.47 ? 287  ARG A NE  1 
ATOM   1244 C  CZ  . ARG A 1 211 ? -40.460 8.276   -24.980 1.00 55.06 ? 287  ARG A CZ  1 
ATOM   1245 N  NH1 . ARG A 1 211 ? -40.143 9.535   -25.251 1.00 56.87 ? 287  ARG A NH1 1 
ATOM   1246 N  NH2 . ARG A 1 211 ? -41.709 7.963   -24.659 1.00 55.52 ? 287  ARG A NH2 1 
ATOM   1247 N  N   . SER A 1 212 ? -33.025 5.069   -26.744 1.00 27.31 ? 288  SER A N   1 
ATOM   1248 C  CA  . SER A 1 212 ? -31.619 5.297   -27.055 1.00 30.81 ? 288  SER A CA  1 
ATOM   1249 C  C   . SER A 1 212 ? -31.256 4.727   -28.418 1.00 35.50 ? 288  SER A C   1 
ATOM   1250 O  O   . SER A 1 212 ? -30.462 5.322   -29.156 1.00 37.77 ? 288  SER A O   1 
ATOM   1251 C  CB  . SER A 1 212 ? -30.734 4.686   -25.972 1.00 31.87 ? 288  SER A CB  1 
ATOM   1252 O  OG  . SER A 1 212 ? -30.835 5.424   -24.767 1.00 31.91 ? 288  SER A OG  1 
ATOM   1253 N  N   . VAL A 1 213 ? -31.819 3.570   -28.768 1.00 36.21 ? 289  VAL A N   1 
ATOM   1254 C  CA  . VAL A 1 213 ? -31.502 2.949   -30.047 1.00 38.71 ? 289  VAL A CA  1 
ATOM   1255 C  C   . VAL A 1 213 ? -32.302 3.572   -31.191 1.00 38.97 ? 289  VAL A C   1 
ATOM   1256 O  O   . VAL A 1 213 ? -31.854 3.537   -32.345 1.00 35.27 ? 289  VAL A O   1 
ATOM   1257 C  CB  . VAL A 1 213 ? -31.718 1.430   -29.920 1.00 41.37 ? 289  VAL A CB  1 
ATOM   1258 C  CG1 . VAL A 1 213 ? -33.119 1.128   -29.434 1.00 44.97 ? 289  VAL A CG1 1 
ATOM   1259 C  CG2 . VAL A 1 213 ? -31.435 0.712   -31.226 1.00 43.73 ? 289  VAL A CG2 1 
ATOM   1260 N  N   . SER A 1 214 ? -33.443 4.197   -30.885 1.00 41.06 ? 290  SER A N   1 
ATOM   1261 C  CA  . SER A 1 214 ? -34.346 4.710   -31.918 1.00 43.88 ? 290  SER A CA  1 
ATOM   1262 C  C   . SER A 1 214 ? -33.697 5.677   -32.908 1.00 43.74 ? 290  SER A C   1 
ATOM   1263 O  O   . SER A 1 214 ? -33.920 5.515   -34.121 1.00 43.86 ? 290  SER A O   1 
ATOM   1264 C  CB  . SER A 1 214 ? -35.566 5.346   -31.238 1.00 45.91 ? 290  SER A CB  1 
ATOM   1265 O  OG  . SER A 1 214 ? -36.397 6.005   -32.177 1.00 48.62 ? 290  SER A OG  1 
ATOM   1266 N  N   . PRO A 1 215 ? -32.924 6.687   -32.499 1.00 42.76 ? 291  PRO A N   1 
ATOM   1267 C  CA  . PRO A 1 215 ? -32.343 7.615   -33.479 1.00 41.95 ? 291  PRO A CA  1 
ATOM   1268 C  C   . PRO A 1 215 ? -31.086 7.104   -34.167 1.00 39.63 ? 291  PRO A C   1 
ATOM   1269 O  O   . PRO A 1 215 ? -30.482 7.853   -34.941 1.00 39.85 ? 291  PRO A O   1 
ATOM   1270 C  CB  . PRO A 1 215 ? -32.011 8.855   -32.626 1.00 41.88 ? 291  PRO A CB  1 
ATOM   1271 C  CG  . PRO A 1 215 ? -32.503 8.555   -31.222 1.00 42.99 ? 291  PRO A CG  1 
ATOM   1272 C  CD  . PRO A 1 215 ? -32.554 7.075   -31.128 1.00 41.09 ? 291  PRO A CD  1 
ATOM   1273 N  N   . ILE A 1 216 ? -30.686 5.863   -33.918 1.00 37.36 ? 292  ILE A N   1 
ATOM   1274 C  CA  . ILE A 1 216 ? -29.372 5.355   -34.302 1.00 37.40 ? 292  ILE A CA  1 
ATOM   1275 C  C   . ILE A 1 216 ? -29.527 4.514   -35.565 1.00 39.15 ? 292  ILE A C   1 
ATOM   1276 O  O   . ILE A 1 216 ? -30.278 3.526   -35.545 1.00 36.83 ? 292  ILE A O   1 
ATOM   1277 C  CB  . ILE A 1 216 ? -28.744 4.525   -33.174 1.00 36.63 ? 292  ILE A CB  1 
ATOM   1278 C  CG1 . ILE A 1 216 ? -28.611 5.368   -31.904 1.00 34.52 ? 292  ILE A CG1 1 
ATOM   1279 C  CG2 . ILE A 1 216 ? -27.403 3.969   -33.607 1.00 37.58 ? 292  ILE A CG2 1 
ATOM   1280 C  CD1 . ILE A 1 216 ? -27.897 6.677   -32.114 1.00 35.84 ? 292  ILE A CD1 1 
ATOM   1281 N  N   . PRO A 1 217 ? -28.825 4.834   -36.651 1.00 41.68 ? 293  PRO A N   1 
ATOM   1282 C  CA  . PRO A 1 217 ? -28.919 4.007   -37.858 1.00 44.12 ? 293  PRO A CA  1 
ATOM   1283 C  C   . PRO A 1 217 ? -28.210 2.678   -37.666 1.00 46.06 ? 293  PRO A C   1 
ATOM   1284 O  O   . PRO A 1 217 ? -27.260 2.561   -36.889 1.00 46.12 ? 293  PRO A O   1 
ATOM   1285 C  CB  . PRO A 1 217 ? -28.218 4.859   -38.921 1.00 44.10 ? 293  PRO A CB  1 
ATOM   1286 C  CG  . PRO A 1 217 ? -27.187 5.617   -38.137 1.00 43.32 ? 293  PRO A CG  1 
ATOM   1287 C  CD  . PRO A 1 217 ? -27.840 5.920   -36.802 1.00 40.65 ? 293  PRO A CD  1 
ATOM   1288 N  N   . VAL A 1 218 ? -28.678 1.668   -38.395 1.00 51.01 ? 294  VAL A N   1 
ATOM   1289 C  CA  . VAL A 1 218 ? -28.126 0.319   -38.333 1.00 53.78 ? 294  VAL A CA  1 
ATOM   1290 C  C   . VAL A 1 218 ? -27.625 -0.070  -39.721 1.00 55.63 ? 294  VAL A C   1 
ATOM   1291 O  O   . VAL A 1 218 ? -28.341 0.095   -40.717 1.00 53.18 ? 294  VAL A O   1 
ATOM   1292 C  CB  . VAL A 1 218 ? -29.165 -0.692  -37.811 1.00 55.30 ? 294  VAL A CB  1 
ATOM   1293 C  CG1 . VAL A 1 218 ? -30.519 -0.469  -38.482 1.00 55.61 ? 294  VAL A CG1 1 
ATOM   1294 C  CG2 . VAL A 1 218 ? -28.682 -2.122  -38.024 1.00 55.65 ? 294  VAL A CG2 1 
ATOM   1295 N  N   . TRP A 1 219 ? -26.395 -0.577  -39.782 1.00 57.95 ? 295  TRP A N   1 
ATOM   1296 C  CA  . TRP A 1 219 ? -25.805 -1.022  -41.043 1.00 61.43 ? 295  TRP A CA  1 
ATOM   1297 C  C   . TRP A 1 219 ? -24.835 -2.177  -40.814 1.00 63.94 ? 295  TRP A C   1 
ATOM   1298 O  O   . TRP A 1 219 ? -24.236 -2.693  -41.759 1.00 66.69 ? 295  TRP A O   1 
ATOM   1299 C  CB  . TRP A 1 219 ? -25.090 0.137   -41.746 1.00 60.66 ? 295  TRP A CB  1 
ATOM   1300 C  CG  . TRP A 1 219 ? -23.798 0.565   -41.093 1.00 59.57 ? 295  TRP A CG  1 
ATOM   1301 C  CD1 . TRP A 1 219 ? -22.530 0.269   -41.510 1.00 59.41 ? 295  TRP A CD1 1 
ATOM   1302 C  CD2 . TRP A 1 219 ? -23.652 1.371   -39.912 1.00 57.19 ? 295  TRP A CD2 1 
ATOM   1303 N  NE1 . TRP A 1 219 ? -21.607 0.839   -40.664 1.00 57.67 ? 295  TRP A NE1 1 
ATOM   1304 C  CE2 . TRP A 1 219 ? -22.269 1.519   -39.675 1.00 56.29 ? 295  TRP A CE2 1 
ATOM   1305 C  CE3 . TRP A 1 219 ? -24.555 1.980   -39.034 1.00 56.07 ? 295  TRP A CE3 1 
ATOM   1306 C  CZ2 . TRP A 1 219 ? -21.770 2.252   -38.597 1.00 55.56 ? 295  TRP A CZ2 1 
ATOM   1307 C  CZ3 . TRP A 1 219 ? -24.056 2.706   -37.963 1.00 54.46 ? 295  TRP A CZ3 1 
ATOM   1308 C  CH2 . TRP A 1 219 ? -22.676 2.834   -37.754 1.00 53.92 ? 295  TRP A CH2 1 
ATOM   1309 N  N   . SER A 1 228 ? -52.195 1.171   -27.660 1.00 94.16 ? 304  SER A N   1 
ATOM   1310 C  CA  . SER A 1 228 ? -50.866 1.294   -27.077 1.00 92.02 ? 304  SER A CA  1 
ATOM   1311 C  C   . SER A 1 228 ? -50.054 -0.006  -27.368 1.00 91.47 ? 304  SER A C   1 
ATOM   1312 O  O   . SER A 1 228 ? -49.478 -0.096  -28.451 1.00 91.66 ? 304  SER A O   1 
ATOM   1313 C  CB  . SER A 1 228 ? -50.991 1.659   -25.596 1.00 91.80 ? 304  SER A CB  1 
ATOM   1314 O  OG  . SER A 1 228 ? -49.721 1.806   -24.996 1.00 90.58 ? 304  SER A OG  1 
ATOM   1315 N  N   . PRO A 1 229 ? -49.965 -1.011  -26.455 1.00 91.03 ? 305  PRO A N   1 
ATOM   1316 C  CA  . PRO A 1 229 ? -50.196 -1.337  -25.039 1.00 90.34 ? 305  PRO A CA  1 
ATOM   1317 C  C   . PRO A 1 229 ? -48.935 -1.085  -24.211 1.00 87.66 ? 305  PRO A C   1 
ATOM   1318 O  O   . PRO A 1 229 ? -49.017 -0.854  -23.002 1.00 88.19 ? 305  PRO A O   1 
ATOM   1319 C  CB  . PRO A 1 229 ? -50.545 -2.821  -25.075 1.00 91.25 ? 305  PRO A CB  1 
ATOM   1320 C  CG  . PRO A 1 229 ? -49.725 -3.339  -26.179 1.00 91.07 ? 305  PRO A CG  1 
ATOM   1321 C  CD  . PRO A 1 229 ? -49.661 -2.238  -27.217 1.00 91.18 ? 305  PRO A CD  1 
ATOM   1322 N  N   . ARG A 1 230 ? -47.775 -1.126  -24.874 1.00 83.55 ? 306  ARG A N   1 
ATOM   1323 C  CA  . ARG A 1 230 ? -46.516 -0.857  -24.190 1.00 78.37 ? 306  ARG A CA  1 
ATOM   1324 C  C   . ARG A 1 230 ? -46.433 0.597   -23.743 1.00 74.40 ? 306  ARG A C   1 
ATOM   1325 O  O   . ARG A 1 230 ? -45.976 0.883   -22.629 1.00 73.66 ? 306  ARG A O   1 
ATOM   1326 C  CB  . ARG A 1 230 ? -45.338 -1.212  -25.097 1.00 77.37 ? 306  ARG A CB  1 
ATOM   1327 N  N   . GLN A 1 231 ? -46.870 1.532   -24.595 1.00 69.81 ? 307  GLN A N   1 
ATOM   1328 C  CA  . GLN A 1 231 ? -46.881 2.939   -24.207 1.00 65.64 ? 307  GLN A CA  1 
ATOM   1329 C  C   . GLN A 1 231 ? -47.789 3.178   -23.006 1.00 63.91 ? 307  GLN A C   1 
ATOM   1330 O  O   . GLN A 1 231 ? -47.556 4.109   -22.226 1.00 61.62 ? 307  GLN A O   1 
ATOM   1331 C  CB  . GLN A 1 231 ? -47.313 3.811   -25.390 1.00 64.35 ? 307  GLN A CB  1 
ATOM   1332 N  N   . ARG A 1 232 ? -48.822 2.345   -22.837 1.00 62.94 ? 308  ARG A N   1 
ATOM   1333 C  CA  . ARG A 1 232 ? -49.688 2.447   -21.667 1.00 61.07 ? 308  ARG A CA  1 
ATOM   1334 C  C   . ARG A 1 232 ? -49.036 1.824   -20.438 1.00 59.12 ? 308  ARG A C   1 
ATOM   1335 O  O   . ARG A 1 232 ? -49.174 2.350   -19.328 1.00 58.99 ? 308  ARG A O   1 
ATOM   1336 C  CB  . ARG A 1 232 ? -51.039 1.788   -21.949 1.00 60.88 ? 308  ARG A CB  1 
ATOM   1337 N  N   . LYS A 1 233 ? -48.326 0.704   -20.617 1.00 56.13 ? 309  LYS A N   1 
ATOM   1338 C  CA  . LYS A 1 233 ? -47.570 0.121   -19.514 1.00 50.69 ? 309  LYS A CA  1 
ATOM   1339 C  C   . LYS A 1 233 ? -46.476 1.064   -19.036 1.00 47.92 ? 309  LYS A C   1 
ATOM   1340 O  O   . LYS A 1 233 ? -46.134 1.066   -17.848 1.00 45.53 ? 309  LYS A O   1 
ATOM   1341 C  CB  . LYS A 1 233 ? -46.965 -1.219  -19.930 1.00 49.90 ? 309  LYS A CB  1 
ATOM   1342 N  N   . VAL A 1 234 ? -45.921 1.872   -19.942 1.00 46.70 ? 310  VAL A N   1 
ATOM   1343 C  CA  . VAL A 1 234 ? -44.926 2.866   -19.549 1.00 45.27 ? 310  VAL A CA  1 
ATOM   1344 C  C   . VAL A 1 234 ? -45.568 3.951   -18.691 1.00 47.07 ? 310  VAL A C   1 
ATOM   1345 O  O   . VAL A 1 234 ? -45.060 4.296   -17.617 1.00 47.29 ? 310  VAL A O   1 
ATOM   1346 C  CB  . VAL A 1 234 ? -44.238 3.461   -20.791 1.00 43.27 ? 310  VAL A CB  1 
ATOM   1347 C  CG1 . VAL A 1 234 ? -43.442 4.707   -20.421 1.00 40.15 ? 310  VAL A CG1 1 
ATOM   1348 C  CG2 . VAL A 1 234 ? -43.330 2.425   -21.441 1.00 42.72 ? 310  VAL A CG2 1 
ATOM   1349 N  N   . ALA A 1 235 ? -46.697 4.503   -19.151 1.00 46.99 ? 311  ALA A N   1 
ATOM   1350 C  CA  . ALA A 1 235 ? -47.371 5.558   -18.398 1.00 46.28 ? 311  ALA A CA  1 
ATOM   1351 C  C   . ALA A 1 235 ? -47.782 5.076   -17.012 1.00 45.36 ? 311  ALA A C   1 
ATOM   1352 O  O   . ALA A 1 235 ? -47.694 5.827   -16.033 1.00 45.39 ? 311  ALA A O   1 
ATOM   1353 C  CB  . ALA A 1 235 ? -48.588 6.062   -19.174 1.00 46.26 ? 311  ALA A CB  1 
ATOM   1354 N  N   . THR A 1 236 ? -48.225 3.821   -16.908 1.00 43.83 ? 312  THR A N   1 
ATOM   1355 C  CA  . THR A 1 236 ? -48.571 3.260   -15.606 1.00 44.52 ? 312  THR A CA  1 
ATOM   1356 C  C   . THR A 1 236 ? -47.339 3.120   -14.722 1.00 40.29 ? 312  THR A C   1 
ATOM   1357 O  O   . THR A 1 236 ? -47.377 3.461   -13.534 1.00 39.40 ? 312  THR A O   1 
ATOM   1358 C  CB  . THR A 1 236 ? -49.259 1.909   -15.788 1.00 47.82 ? 312  THR A CB  1 
ATOM   1359 O  OG1 . THR A 1 236 ? -50.548 2.108   -16.377 1.00 52.56 ? 312  THR A OG1 1 
ATOM   1360 C  CG2 . THR A 1 236 ? -49.425 1.207   -14.453 1.00 48.97 ? 312  THR A CG2 1 
ATOM   1361 N  N   . SER A 1 237 ? -46.236 2.624   -15.284 1.00 36.78 ? 313  SER A N   1 
ATOM   1362 C  CA  . SER A 1 237 ? -45.011 2.484   -14.505 1.00 35.15 ? 313  SER A CA  1 
ATOM   1363 C  C   . SER A 1 237 ? -44.494 3.839   -14.040 1.00 35.76 ? 313  SER A C   1 
ATOM   1364 O  O   . SER A 1 237 ? -44.047 3.981   -12.896 1.00 36.40 ? 313  SER A O   1 
ATOM   1365 C  CB  . SER A 1 237 ? -43.952 1.754   -15.329 1.00 35.52 ? 313  SER A CB  1 
ATOM   1366 O  OG  . SER A 1 237 ? -44.370 0.431   -15.626 1.00 35.58 ? 313  SER A OG  1 
ATOM   1367 N  N   . LEU A 1 238 ? -44.544 4.848   -14.915 1.00 35.75 ? 314  LEU A N   1 
ATOM   1368 C  CA  . LEU A 1 238 ? -44.132 6.193   -14.526 1.00 36.67 ? 314  LEU A CA  1 
ATOM   1369 C  C   . LEU A 1 238 ? -45.001 6.731   -13.400 1.00 39.03 ? 314  LEU A C   1 
ATOM   1370 O  O   . LEU A 1 238 ? -44.502 7.387   -12.477 1.00 39.92 ? 314  LEU A O   1 
ATOM   1371 C  CB  . LEU A 1 238 ? -44.198 7.136   -15.725 1.00 37.25 ? 314  LEU A CB  1 
ATOM   1372 C  CG  . LEU A 1 238 ? -43.066 7.095   -16.743 1.00 37.54 ? 314  LEU A CG  1 
ATOM   1373 C  CD1 . LEU A 1 238 ? -43.334 8.115   -17.838 1.00 39.52 ? 314  LEU A CD1 1 
ATOM   1374 C  CD2 . LEU A 1 238 ? -41.742 7.375   -16.058 1.00 36.30 ? 314  LEU A CD2 1 
ATOM   1375 N  N   . LYS A 1 239 ? -46.307 6.470   -13.466 1.00 39.94 ? 315  LYS A N   1 
ATOM   1376 C  CA  . LYS A 1 239 ? -47.218 6.941   -12.429 1.00 42.05 ? 315  LYS A CA  1 
ATOM   1377 C  C   . LYS A 1 239 ? -46.915 6.288   -11.085 1.00 38.70 ? 315  LYS A C   1 
ATOM   1378 O  O   . LYS A 1 239 ? -46.925 6.956   -10.045 1.00 37.95 ? 315  LYS A O   1 
ATOM   1379 C  CB  . LYS A 1 239 ? -48.662 6.666   -12.850 1.00 47.47 ? 315  LYS A CB  1 
ATOM   1380 C  CG  . LYS A 1 239 ? -49.695 6.949   -11.772 1.00 53.28 ? 315  LYS A CG  1 
ATOM   1381 C  CD  . LYS A 1 239 ? -50.009 8.432   -11.673 1.00 57.08 ? 315  LYS A CD  1 
ATOM   1382 C  CE  . LYS A 1 239 ? -51.059 8.691   -10.606 1.00 59.49 ? 315  LYS A CE  1 
ATOM   1383 N  NZ  . LYS A 1 239 ? -52.149 7.681   -10.669 1.00 61.16 ? 315  LYS A NZ  1 
ATOM   1384 N  N   . LEU A 1 240 ? -46.641 4.981   -11.087 1.00 36.26 ? 316  LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 240 ? -46.362 4.281   -9.838  1.00 37.15 ? 316  LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 240 ? -45.085 4.798   -9.188  1.00 35.66 ? 316  LEU A C   1 
ATOM   1387 O  O   . LEU A 1 240 ? -45.037 5.000   -7.969  1.00 35.96 ? 316  LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 240 ? -46.263 2.777   -10.087 1.00 36.96 ? 316  LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 240 ? -45.991 1.941   -8.835  1.00 36.36 ? 316  LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 240 ? -47.067 2.195   -7.791  1.00 38.09 ? 316  LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 240 ? -45.900 0.462   -9.172  1.00 35.22 ? 316  LEU A CD2 1 
ATOM   1392 N  N   . ILE A 1 241 ? -44.041 5.022   -9.985  1.00 33.79 ? 317  ILE A N   1 
ATOM   1393 C  CA  . ILE A 1 241 ? -42.787 5.524   -9.434  1.00 33.88 ? 317  ILE A CA  1 
ATOM   1394 C  C   . ILE A 1 241 ? -42.961 6.946   -8.918  1.00 36.13 ? 317  ILE A C   1 
ATOM   1395 O  O   . ILE A 1 241 ? -42.474 7.289   -7.834  1.00 37.50 ? 317  ILE A O   1 
ATOM   1396 C  CB  . ILE A 1 241 ? -41.668 5.432   -10.483 1.00 32.92 ? 317  ILE A CB  1 
ATOM   1397 C  CG1 . ILE A 1 241 ? -41.473 3.977   -10.919 1.00 34.80 ? 317  ILE A CG1 1 
ATOM   1398 C  CG2 . ILE A 1 241 ? -40.368 6.000   -9.928  1.00 32.31 ? 317  ILE A CG2 1 
ATOM   1399 C  CD1 . ILE A 1 241 ? -40.649 3.824   -12.181 1.00 32.69 ? 317  ILE A CD1 1 
ATOM   1400 N  N   . ASN A 1 242 ? -43.666 7.793   -9.677  1.00 35.55 ? 318  ASN A N   1 
ATOM   1401 C  CA  . ASN A 1 242 ? -43.909 9.162   -9.229  1.00 38.89 ? 318  ASN A CA  1 
ATOM   1402 C  C   . ASN A 1 242 ? -44.747 9.189   -7.956  1.00 40.27 ? 318  ASN A C   1 
ATOM   1403 O  O   . ASN A 1 242 ? -44.469 9.973   -7.041  1.00 38.91 ? 318  ASN A O   1 
ATOM   1404 C  CB  . ASN A 1 242 ? -44.592 9.969   -10.333 1.00 42.71 ? 318  ASN A CB  1 
ATOM   1405 C  CG  . ASN A 1 242 ? -43.608 10.524  -11.347 1.00 46.02 ? 318  ASN A CG  1 
ATOM   1406 O  OD1 . ASN A 1 242 ? -42.475 10.873  -11.010 1.00 44.05 ? 318  ASN A OD1 1 
ATOM   1407 N  ND2 . ASN A 1 242 ? -44.040 10.612  -12.599 1.00 51.92 ? 318  ASN A ND2 1 
ATOM   1408 N  N   . ASP A 1 243 ? -45.783 8.349   -7.882  1.00 40.81 ? 319  ASP A N   1 
ATOM   1409 C  CA  . ASP A 1 243 ? -46.565 8.252   -6.653  1.00 43.55 ? 319  ASP A CA  1 
ATOM   1410 C  C   . ASP A 1 243 ? -45.705 7.768   -5.495  1.00 41.47 ? 319  ASP A C   1 
ATOM   1411 O  O   . ASP A 1 243 ? -45.816 8.280   -4.373  1.00 42.93 ? 319  ASP A O   1 
ATOM   1412 C  CB  . ASP A 1 243 ? -47.755 7.312   -6.847  1.00 47.49 ? 319  ASP A CB  1 
ATOM   1413 C  CG  . ASP A 1 243 ? -48.841 7.914   -7.713  1.00 51.78 ? 319  ASP A CG  1 
ATOM   1414 O  OD1 . ASP A 1 243 ? -48.919 9.158   -7.799  1.00 52.42 ? 319  ASP A OD1 1 
ATOM   1415 O  OD2 . ASP A 1 243 ? -49.621 7.137   -8.302  1.00 52.89 ? 319  ASP A OD2 1 
ATOM   1416 N  N   . THR A 1 244 ? -44.851 6.773   -5.748  1.00 38.27 ? 320  THR A N   1 
ATOM   1417 C  CA  . THR A 1 244 ? -43.958 6.268   -4.711  1.00 37.98 ? 320  THR A CA  1 
ATOM   1418 C  C   . THR A 1 244 ? -43.021 7.364   -4.223  1.00 37.11 ? 320  THR A C   1 
ATOM   1419 O  O   . THR A 1 244 ? -42.837 7.549   -3.013  1.00 36.95 ? 320  THR A O   1 
ATOM   1420 C  CB  . THR A 1 244 ? -43.166 5.072   -5.241  1.00 37.49 ? 320  THR A CB  1 
ATOM   1421 O  OG1 . THR A 1 244 ? -44.069 4.008   -5.558  1.00 40.78 ? 320  THR A OG1 1 
ATOM   1422 C  CG2 . THR A 1 244 ? -42.174 4.582   -4.201  1.00 37.72 ? 320  THR A CG2 1 
ATOM   1423 N  N   . LEU A 1 245 ? -42.428 8.113   -5.155  1.00 34.67 ? 321  LEU A N   1 
ATOM   1424 C  CA  . LEU A 1 245 ? -41.577 9.233   -4.772  1.00 35.45 ? 321  LEU A CA  1 
ATOM   1425 C  C   . LEU A 1 245 ? -42.362 10.279  -3.989  1.00 36.99 ? 321  LEU A C   1 
ATOM   1426 O  O   . LEU A 1 245 ? -41.853 10.837  -3.010  1.00 37.21 ? 321  LEU A O   1 
ATOM   1427 C  CB  . LEU A 1 245 ? -40.936 9.854   -6.012  1.00 34.89 ? 321  LEU A CB  1 
ATOM   1428 C  CG  . LEU A 1 245 ? -39.937 8.978   -6.772  1.00 32.18 ? 321  LEU A CG  1 
ATOM   1429 C  CD1 . LEU A 1 245 ? -39.471 9.684   -8.035  1.00 30.88 ? 321  LEU A CD1 1 
ATOM   1430 C  CD2 . LEU A 1 245 ? -38.751 8.625   -5.891  1.00 33.62 ? 321  LEU A CD2 1 
ATOM   1431 N  N   . ASP A 1 246 ? -43.605 10.554  -4.400  1.00 36.34 ? 322  ASP A N   1 
ATOM   1432 C  CA  . ASP A 1 246 ? -44.423 11.525  -3.676  1.00 37.83 ? 322  ASP A CA  1 
ATOM   1433 C  C   . ASP A 1 246 ? -44.614 11.112  -2.222  1.00 38.95 ? 322  ASP A C   1 
ATOM   1434 O  O   . ASP A 1 246 ? -44.564 11.956  -1.321  1.00 39.35 ? 322  ASP A O   1 
ATOM   1435 C  CB  . ASP A 1 246 ? -45.777 11.701  -4.362  1.00 40.48 ? 322  ASP A CB  1 
ATOM   1436 C  CG  . ASP A 1 246 ? -45.727 12.693  -5.513  1.00 44.25 ? 322  ASP A CG  1 
ATOM   1437 O  OD1 . ASP A 1 246 ? -44.831 13.565  -5.518  1.00 44.30 ? 322  ASP A OD1 1 
ATOM   1438 O  OD2 . ASP A 1 246 ? -46.589 12.602  -6.412  1.00 45.64 ? 322  ASP A OD2 1 
ATOM   1439 N  N   . ASP A 1 247 ? -44.827 9.816   -1.974  1.00 41.61 ? 323  ASP A N   1 
ATOM   1440 C  CA  . ASP A 1 247 ? -44.962 9.335   -0.601  1.00 44.96 ? 323  ASP A CA  1 
ATOM   1441 C  C   . ASP A 1 247 ? -43.683 9.571   0.194   1.00 42.07 ? 323  ASP A C   1 
ATOM   1442 O  O   . ASP A 1 247 ? -43.731 10.026  1.343   1.00 40.35 ? 323  ASP A O   1 
ATOM   1443 C  CB  . ASP A 1 247 ? -45.326 7.850   -0.593  1.00 50.35 ? 323  ASP A CB  1 
ATOM   1444 C  CG  . ASP A 1 247 ? -46.672 7.572   -1.237  1.00 57.78 ? 323  ASP A CG  1 
ATOM   1445 O  OD1 . ASP A 1 247 ? -47.499 8.504   -1.325  1.00 60.37 ? 323  ASP A OD1 1 
ATOM   1446 O  OD2 . ASP A 1 247 ? -46.906 6.416   -1.649  1.00 60.80 ? 323  ASP A OD2 1 
ATOM   1447 N  N   . LEU A 1 248 ? -42.529 9.271   -0.409  1.00 39.18 ? 324  LEU A N   1 
ATOM   1448 C  CA  . LEU A 1 248 ? -41.253 9.468   0.272   1.00 38.11 ? 324  LEU A CA  1 
ATOM   1449 C  C   . LEU A 1 248 ? -40.990 10.942  0.541   1.00 36.53 ? 324  LEU A C   1 
ATOM   1450 O  O   . LEU A 1 248 ? -40.472 11.299  1.605   1.00 38.36 ? 324  LEU A O   1 
ATOM   1451 C  CB  . LEU A 1 248 ? -40.118 8.875   -0.560  1.00 37.64 ? 324  LEU A CB  1 
ATOM   1452 C  CG  . LEU A 1 248 ? -40.106 7.358   -0.727  1.00 39.78 ? 324  LEU A CG  1 
ATOM   1453 C  CD1 . LEU A 1 248 ? -39.224 6.972   -1.901  1.00 37.39 ? 324  LEU A CD1 1 
ATOM   1454 C  CD2 . LEU A 1 248 ? -39.623 6.696   0.558   1.00 40.16 ? 324  LEU A CD2 1 
ATOM   1455 N  N   . ILE A 1 249 ? -41.332 11.811  -0.414  1.00 32.81 ? 325  ILE A N   1 
ATOM   1456 C  CA  . ILE A 1 249 ? -41.123 13.242  -0.222  1.00 35.78 ? 325  ILE A CA  1 
ATOM   1457 C  C   . ILE A 1 249 ? -41.981 13.750  0.927   1.00 39.75 ? 325  ILE A C   1 
ATOM   1458 O  O   . ILE A 1 249 ? -41.529 14.555  1.752   1.00 39.33 ? 325  ILE A O   1 
ATOM   1459 C  CB  . ILE A 1 249 ? -41.412 14.005  -1.527  1.00 38.71 ? 325  ILE A CB  1 
ATOM   1460 C  CG1 . ILE A 1 249 ? -40.411 13.612  -2.612  1.00 36.68 ? 325  ILE A CG1 1 
ATOM   1461 C  CG2 . ILE A 1 249 ? -41.367 15.507  -1.290  1.00 43.10 ? 325  ILE A CG2 1 
ATOM   1462 C  CD1 . ILE A 1 249 ? -40.813 14.071  -3.995  1.00 36.00 ? 325  ILE A CD1 1 
ATOM   1463 N  N   . ALA A 1 250 ? -43.230 13.281  1.005   1.00 41.75 ? 326  ALA A N   1 
ATOM   1464 C  CA  . ALA A 1 250 ? -44.115 13.693  2.088   1.00 42.64 ? 326  ALA A CA  1 
ATOM   1465 C  C   . ALA A 1 250 ? -43.593 13.204  3.433   1.00 44.14 ? 326  ALA A C   1 
ATOM   1466 O  O   . ALA A 1 250 ? -43.525 13.970  4.403   1.00 45.82 ? 326  ALA A O   1 
ATOM   1467 C  CB  . ALA A 1 250 ? -45.532 13.178  1.833   1.00 44.05 ? 326  ALA A CB  1 
ATOM   1468 N  N   . THR A 1 251 ? -43.216 11.924  3.508   1.00 42.42 ? 327  THR A N   1 
ATOM   1469 C  CA  . THR A 1 251 ? -42.625 11.390  4.732   1.00 43.60 ? 327  THR A CA  1 
ATOM   1470 C  C   . THR A 1 251 ? -41.396 12.190  5.142   1.00 40.84 ? 327  THR A C   1 
ATOM   1471 O  O   . THR A 1 251 ? -41.230 12.536  6.319   1.00 37.29 ? 327  THR A O   1 
ATOM   1472 C  CB  . THR A 1 251 ? -42.255 9.917   4.541   1.00 44.15 ? 327  THR A CB  1 
ATOM   1473 O  OG1 . THR A 1 251 ? -43.424 9.166   4.196   1.00 47.30 ? 327  THR A OG1 1 
ATOM   1474 C  CG2 . THR A 1 251 ? -41.647 9.347   5.814   1.00 44.70 ? 327  THR A CG2 1 
ATOM   1475 N  N   . CYS A 1 252 ? -40.531 12.510  4.177   1.00 39.19 ? 328  CYS A N   1 
ATOM   1476 C  CA  . CYS A 1 252 ? -39.287 13.193  4.503   1.00 39.19 ? 328  CYS A CA  1 
ATOM   1477 C  C   . CYS A 1 252 ? -39.543 14.613  4.997   1.00 40.54 ? 328  CYS A C   1 
ATOM   1478 O  O   . CYS A 1 252 ? -38.879 15.072  5.934   1.00 42.41 ? 328  CYS A O   1 
ATOM   1479 C  CB  . CYS A 1 252 ? -38.362 13.197  3.289   1.00 39.45 ? 328  CYS A CB  1 
ATOM   1480 S  SG  . CYS A 1 252 ? -36.710 13.814  3.643   1.00 41.15 ? 328  CYS A SG  1 
ATOM   1481 N  N   . LYS A 1 253 ? -40.499 15.322  4.386   1.00 40.15 ? 329  LYS A N   1 
ATOM   1482 C  CA  . LYS A 1 253 ? -40.838 16.663  4.856   1.00 43.09 ? 329  LYS A CA  1 
ATOM   1483 C  C   . LYS A 1 253 ? -41.313 16.632  6.302   1.00 47.05 ? 329  LYS A C   1 
ATOM   1484 O  O   . LYS A 1 253 ? -40.916 17.477  7.113   1.00 48.25 ? 329  LYS A O   1 
ATOM   1485 C  CB  . LYS A 1 253 ? -41.908 17.289  3.959   1.00 44.37 ? 329  LYS A CB  1 
ATOM   1486 C  CG  . LYS A 1 253 ? -41.418 17.696  2.576   1.00 44.89 ? 329  LYS A CG  1 
ATOM   1487 C  CD  . LYS A 1 253 ? -42.534 18.358  1.779   1.00 48.85 ? 329  LYS A CD  1 
ATOM   1488 C  CE  . LYS A 1 253 ? -42.091 18.680  0.360   1.00 51.85 ? 329  LYS A CE  1 
ATOM   1489 N  NZ  . LYS A 1 253 ? -43.192 19.249  -0.469  1.00 54.88 ? 329  LYS A NZ  1 
ATOM   1490 N  N   . ARG A 1 254 ? -42.163 15.660  6.641   1.00 50.39 ? 330  ARG A N   1 
ATOM   1491 C  CA  . ARG A 1 254 ? -42.609 15.494  8.021   1.00 52.60 ? 330  ARG A CA  1 
ATOM   1492 C  C   . ARG A 1 254 ? -41.425 15.276  8.957   1.00 49.91 ? 330  ARG A C   1 
ATOM   1493 O  O   . ARG A 1 254 ? -41.377 15.846  10.055  1.00 48.82 ? 330  ARG A O   1 
ATOM   1494 C  CB  . ARG A 1 254 ? -43.586 14.319  8.106   1.00 58.95 ? 330  ARG A CB  1 
ATOM   1495 C  CG  . ARG A 1 254 ? -44.833 14.565  8.940   1.00 68.04 ? 330  ARG A CG  1 
ATOM   1496 C  CD  . ARG A 1 254 ? -45.719 13.317  8.993   1.00 74.09 ? 330  ARG A CD  1 
ATOM   1497 N  NE  . ARG A 1 254 ? -45.985 12.753  7.667   1.00 77.63 ? 330  ARG A NE  1 
ATOM   1498 C  CZ  . ARG A 1 254 ? -45.580 11.549  7.263   1.00 78.14 ? 330  ARG A CZ  1 
ATOM   1499 N  NH1 . ARG A 1 254 ? -44.892 10.765  8.083   1.00 77.97 ? 330  ARG A NH1 1 
ATOM   1500 N  NH2 . ARG A 1 254 ? -45.870 11.124  6.039   1.00 77.67 ? 330  ARG A NH2 1 
ATOM   1501 N  N   . MET A 1 255 ? -40.456 14.459  8.533   1.00 45.15 ? 331  MET A N   1 
ATOM   1502 C  CA  . MET A 1 255 ? -39.266 14.217  9.345   1.00 45.53 ? 331  MET A CA  1 
ATOM   1503 C  C   . MET A 1 255 ? -38.431 15.485  9.498   1.00 44.35 ? 331  MET A C   1 
ATOM   1504 O  O   . MET A 1 255 ? -37.936 15.781  10.594  1.00 43.24 ? 331  MET A O   1 
ATOM   1505 C  CB  . MET A 1 255 ? -38.436 13.092  8.724   1.00 44.63 ? 331  MET A CB  1 
ATOM   1506 C  CG  . MET A 1 255 ? -37.255 12.636  9.565   1.00 47.22 ? 331  MET A CG  1 
ATOM   1507 S  SD  . MET A 1 255 ? -36.347 11.264  8.804   1.00 48.58 ? 331  MET A SD  1 
ATOM   1508 C  CE  . MET A 1 255 ? -35.130 10.941  10.078  1.00 47.18 ? 331  MET A CE  1 
ATOM   1509 N  N   . VAL A 1 256 ? -38.271 16.250  8.413   1.00 41.62 ? 332  VAL A N   1 
ATOM   1510 C  CA  . VAL A 1 256 ? -37.527 17.507  8.479   1.00 42.53 ? 332  VAL A CA  1 
ATOM   1511 C  C   . VAL A 1 256 ? -38.215 18.489  9.421   1.00 45.12 ? 332  VAL A C   1 
ATOM   1512 O  O   . VAL A 1 256 ? -37.559 19.171  10.217  1.00 45.95 ? 332  VAL A O   1 
ATOM   1513 C  CB  . VAL A 1 256 ? -37.356 18.106  7.070   1.00 40.96 ? 332  VAL A CB  1 
ATOM   1514 C  CG1 . VAL A 1 256 ? -36.784 19.515  7.153   1.00 42.57 ? 332  VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A 1 256 ? -36.462 17.223  6.214   1.00 39.95 ? 332  VAL A CG2 1 
ATOM   1516 N  N   . GLU A 1 257 ? -39.546 18.581  9.345   1.00 46.90 ? 333  GLU A N   1 
ATOM   1517 C  CA  . GLU A 1 257 ? -40.264 19.542  10.176  1.00 48.45 ? 333  GLU A CA  1 
ATOM   1518 C  C   . GLU A 1 257 ? -40.126 19.218  11.656  1.00 50.67 ? 333  GLU A C   1 
ATOM   1519 O  O   . GLU A 1 257 ? -40.121 20.129  12.492  1.00 53.12 ? 333  GLU A O   1 
ATOM   1520 C  CB  . GLU A 1 257 ? -41.741 19.584  9.782   1.00 50.03 ? 333  GLU A CB  1 
ATOM   1521 N  N   . GLU A 1 258 ? -39.999 17.938  11.999  1.00 49.35 ? 334  GLU A N   1 
ATOM   1522 C  CA  . GLU A 1 258 ? -39.965 17.513  13.391  1.00 51.68 ? 334  GLU A CA  1 
ATOM   1523 C  C   . GLU A 1 258 ? -38.554 17.369  13.950  1.00 51.58 ? 334  GLU A C   1 
ATOM   1524 O  O   . GLU A 1 258 ? -38.401 17.249  15.172  1.00 51.38 ? 334  GLU A O   1 
ATOM   1525 C  CB  . GLU A 1 258 ? -40.717 16.186  13.548  1.00 56.35 ? 334  GLU A CB  1 
ATOM   1526 C  CG  . GLU A 1 258 ? -42.192 16.272  13.183  1.00 62.58 ? 334  GLU A CG  1 
ATOM   1527 C  CD  . GLU A 1 258 ? -42.915 14.948  13.338  0.80 66.05 ? 334  GLU A CD  1 
ATOM   1528 O  OE1 . GLU A 1 258 ? -42.293 13.981  13.828  1.00 66.41 ? 334  GLU A OE1 1 
ATOM   1529 O  OE2 . GLU A 1 258 ? -44.107 14.875  12.969  0.93 67.83 ? 334  GLU A OE2 1 
ATOM   1530 N  N   . GLU A 1 259 ? -37.527 17.389  13.103  1.00 49.31 ? 335  GLU A N   1 
ATOM   1531 C  CA  . GLU A 1 259 ? -36.158 17.221  13.567  1.00 50.61 ? 335  GLU A CA  1 
ATOM   1532 C  C   . GLU A 1 259 ? -35.619 18.534  14.137  1.00 56.19 ? 335  GLU A C   1 
ATOM   1533 O  O   . GLU A 1 259 ? -36.180 19.614  13.934  1.00 57.44 ? 335  GLU A O   1 
ATOM   1534 C  CB  . GLU A 1 259 ? -35.258 16.726  12.430  1.00 46.79 ? 335  GLU A CB  1 
ATOM   1535 C  CG  . GLU A 1 259 ? -34.806 17.815  11.470  1.00 45.20 ? 335  GLU A CG  1 
ATOM   1536 C  CD  . GLU A 1 259 ? -33.933 17.282  10.341  1.00 46.20 ? 335  GLU A CD  1 
ATOM   1537 O  OE1 . GLU A 1 259 ? -34.082 16.098  9.971   1.00 44.34 ? 335  GLU A OE1 1 
ATOM   1538 O  OE2 . GLU A 1 259 ? -33.093 18.050  9.828   1.00 46.25 ? 335  GLU A OE2 1 
ATOM   1539 N  N   . GLU A 1 260 ? -34.501 18.428  14.863  1.00 61.50 ? 336  GLU A N   1 
ATOM   1540 C  CA  . GLU A 1 260 ? -33.831 19.576  15.483  1.00 67.14 ? 336  GLU A CA  1 
ATOM   1541 C  C   . GLU A 1 260 ? -32.352 19.523  15.097  1.00 71.60 ? 336  GLU A C   1 
ATOM   1542 O  O   . GLU A 1 260 ? -31.508 19.059  15.867  1.00 73.90 ? 336  GLU A O   1 
ATOM   1543 C  CB  . GLU A 1 260 ? -34.029 19.568  16.998  1.00 67.12 ? 336  GLU A CB  1 
ATOM   1544 C  CG  . GLU A 1 260 ? -35.484 19.485  17.429  1.00 67.70 ? 336  GLU A CG  1 
ATOM   1545 C  CD  . GLU A 1 260 ? -35.643 19.304  18.926  1.00 68.14 ? 336  GLU A CD  1 
ATOM   1546 O  OE1 . GLU A 1 260 ? -34.680 19.601  19.663  1.00 68.27 ? 336  GLU A OE1 1 
ATOM   1547 O  OE2 . GLU A 1 260 ? -36.726 18.860  19.364  1.00 68.23 ? 336  GLU A OE2 1 
ATOM   1548 N  N   . LEU A 1 261 ? -32.041 19.999  13.893  1.00 72.25 ? 337  LEU A N   1 
ATOM   1549 C  CA  . LEU A 1 261 ? -30.678 19.977  13.372  1.00 73.16 ? 337  LEU A CA  1 
ATOM   1550 C  C   . LEU A 1 261 ? -30.440 21.242  12.567  1.00 75.76 ? 337  LEU A C   1 
ATOM   1551 O  O   . LEU A 1 261 ? -31.103 21.462  11.549  1.00 76.17 ? 337  LEU A O   1 
ATOM   1552 C  CB  . LEU A 1 261 ? -30.434 18.744  12.494  1.00 70.25 ? 337  LEU A CB  1 
ATOM   1553 C  CG  . LEU A 1 261 ? -30.443 17.355  13.133  1.00 67.99 ? 337  LEU A CG  1 
ATOM   1554 C  CD1 . LEU A 1 261 ? -30.320 16.287  12.055  1.00 65.57 ? 337  LEU A CD1 1 
ATOM   1555 C  CD2 . LEU A 1 261 ? -29.323 17.221  14.153  1.00 67.60 ? 337  LEU A CD2 1 
ATOM   1556 N  N   . GLN A 1 262 ? -29.495 22.066  13.014  1.00 78.14 ? 338  GLN A N   1 
ATOM   1557 C  CA  . GLN A 1 262 ? -29.107 23.245  12.251  1.00 79.83 ? 338  GLN A CA  1 
ATOM   1558 C  C   . GLN A 1 262 ? -28.401 22.810  10.972  1.00 79.31 ? 338  GLN A C   1 
ATOM   1559 O  O   . GLN A 1 262 ? -27.408 22.077  11.022  1.00 78.94 ? 338  GLN A O   1 
ATOM   1560 C  CB  . GLN A 1 262 ? -28.206 24.152  13.085  1.00 80.77 ? 338  GLN A CB  1 
ATOM   1561 N  N   . PHE A 1 263 ? -28.922 23.250  9.829   1.00 79.19 ? 339  PHE A N   1 
ATOM   1562 C  CA  . PHE A 1 263 ? -28.343 22.886  8.542   1.00 77.33 ? 339  PHE A CA  1 
ATOM   1563 C  C   . PHE A 1 263 ? -27.010 23.599  8.336   1.00 80.71 ? 339  PHE A C   1 
ATOM   1564 O  O   . PHE A 1 263 ? -26.895 24.807  8.574   1.00 81.77 ? 339  PHE A O   1 
ATOM   1565 C  CB  . PHE A 1 263 ? -29.318 23.235  7.415   1.00 74.23 ? 339  PHE A CB  1 
ATOM   1566 C  CG  . PHE A 1 263 ? -28.776 22.979  6.034   1.00 72.25 ? 339  PHE A CG  1 
ATOM   1567 C  CD1 . PHE A 1 263 ? -28.905 21.731  5.444   1.00 70.77 ? 339  PHE A CD1 1 
ATOM   1568 C  CD2 . PHE A 1 263 ? -28.152 23.991  5.319   1.00 71.32 ? 339  PHE A CD2 1 
ATOM   1569 C  CE1 . PHE A 1 263 ? -28.409 21.492  4.172   1.00 69.18 ? 339  PHE A CE1 1 
ATOM   1570 C  CE2 . PHE A 1 263 ? -27.655 23.758  4.049   1.00 70.97 ? 339  PHE A CE2 1 
ATOM   1571 C  CZ  . PHE A 1 263 ? -27.782 22.507  3.475   1.00 69.05 ? 339  PHE A CZ  1 
ATOM   1572 N  N   . HIS A 1 264 ? -26.000 22.848  7.897   1.00 81.62 ? 340  HIS A N   1 
ATOM   1573 C  CA  . HIS A 1 264 ? -24.694 23.402  7.561   1.00 83.75 ? 340  HIS A CA  1 
ATOM   1574 C  C   . HIS A 1 264 ? -24.185 22.718  6.299   1.00 83.15 ? 340  HIS A C   1 
ATOM   1575 O  O   . HIS A 1 264 ? -24.885 21.910  5.680   1.00 83.51 ? 340  HIS A O   1 
ATOM   1576 C  CB  . HIS A 1 264 ? -23.701 23.256  8.724   1.00 85.30 ? 340  HIS A CB  1 
ATOM   1577 C  CG  . HIS A 1 264 ? -23.752 21.928  9.414   1.00 85.05 ? 340  HIS A CG  1 
ATOM   1578 N  ND1 . HIS A 1 264 ? -22.986 20.852  9.020   1.00 83.91 ? 340  HIS A ND1 1 
ATOM   1579 C  CD2 . HIS A 1 264 ? -24.468 21.506  10.483  1.00 85.97 ? 340  HIS A CD2 1 
ATOM   1580 C  CE1 . HIS A 1 264 ? -23.233 19.824  9.812   1.00 84.02 ? 340  HIS A CE1 1 
ATOM   1581 N  NE2 . HIS A 1 264 ? -24.129 20.194  10.709  1.00 84.92 ? 340  HIS A NE2 1 
ATOM   1582 N  N   . GLU A 1 265 ? -22.949 23.048  5.913   1.00 82.98 ? 341  GLU A N   1 
ATOM   1583 C  CA  . GLU A 1 265 ? -22.406 22.532  4.658   1.00 80.92 ? 341  GLU A CA  1 
ATOM   1584 C  C   . GLU A 1 265 ? -22.175 21.027  4.718   1.00 79.00 ? 341  GLU A C   1 
ATOM   1585 O  O   . GLU A 1 265 ? -22.204 20.355  3.682   1.00 78.24 ? 341  GLU A O   1 
ATOM   1586 C  CB  . GLU A 1 265 ? -21.109 23.262  4.305   1.00 80.38 ? 341  GLU A CB  1 
ATOM   1587 N  N   . GLU A 1 266 ? -21.947 20.482  5.913   1.00 77.23 ? 342  GLU A N   1 
ATOM   1588 C  CA  . GLU A 1 266 ? -21.807 19.045  6.109   1.00 73.19 ? 342  GLU A CA  1 
ATOM   1589 C  C   . GLU A 1 266 ? -23.059 18.431  6.728   1.00 65.80 ? 342  GLU A C   1 
ATOM   1590 O  O   . GLU A 1 266 ? -22.966 17.463  7.491   1.00 65.13 ? 342  GLU A O   1 
ATOM   1591 C  CB  . GLU A 1 266 ? -20.580 18.747  6.972   1.00 77.52 ? 342  GLU A CB  1 
ATOM   1592 C  CG  . GLU A 1 266 ? -19.261 19.211  6.366   1.00 79.30 ? 342  GLU A CG  1 
ATOM   1593 C  CD  . GLU A 1 266 ? -18.820 18.350  5.197   1.00 78.97 ? 342  GLU A CD  1 
ATOM   1594 O  OE1 . GLU A 1 266 ? -18.977 17.113  5.272   0.54 78.01 ? 342  GLU A OE1 1 
ATOM   1595 O  OE2 . GLU A 1 266 ? -18.319 18.912  4.201   0.65 78.70 ? 342  GLU A OE2 1 
ATOM   1596 N  N   . TYR A 1 267 ? -24.230 18.981  6.411   1.00 58.75 ? 343  TYR A N   1 
ATOM   1597 C  CA  . TYR A 1 267 ? -25.466 18.516  7.025   1.00 54.56 ? 343  TYR A CA  1 
ATOM   1598 C  C   . TYR A 1 267 ? -25.753 17.066  6.655   1.00 51.33 ? 343  TYR A C   1 
ATOM   1599 O  O   . TYR A 1 267 ? -25.625 16.666  5.494   1.00 50.16 ? 343  TYR A O   1 
ATOM   1600 C  CB  . TYR A 1 267 ? -26.646 19.389  6.596   1.00 52.20 ? 343  TYR A CB  1 
ATOM   1601 C  CG  . TYR A 1 267 ? -27.985 18.778  6.958   1.00 50.67 ? 343  TYR A CG  1 
ATOM   1602 C  CD1 . TYR A 1 267 ? -28.555 18.997  8.208   1.00 53.12 ? 343  TYR A CD1 1 
ATOM   1603 C  CD2 . TYR A 1 267 ? -28.672 17.969  6.057   1.00 46.81 ? 343  TYR A CD2 1 
ATOM   1604 C  CE1 . TYR A 1 267 ? -29.771 18.430  8.548   1.00 53.71 ? 343  TYR A CE1 1 
ATOM   1605 C  CE2 . TYR A 1 267 ? -29.880 17.394  6.390   1.00 47.68 ? 343  TYR A CE2 1 
ATOM   1606 C  CZ  . TYR A 1 267 ? -30.428 17.627  7.634   1.00 52.48 ? 343  TYR A CZ  1 
ATOM   1607 O  OH  . TYR A 1 267 ? -31.639 17.062  7.965   1.00 52.24 ? 343  TYR A OH  1 
ATOM   1608 N  N   . MET A 1 268 ? -26.186 16.290  7.647   1.00 48.25 ? 344  MET A N   1 
ATOM   1609 C  CA  . MET A 1 268 ? -26.618 14.918  7.402   1.00 45.52 ? 344  MET A CA  1 
ATOM   1610 C  C   . MET A 1 268 ? -27.393 14.416  8.610   1.00 47.28 ? 344  MET A C   1 
ATOM   1611 O  O   . MET A 1 268 ? -26.834 14.314  9.708   1.00 47.60 ? 344  MET A O   1 
ATOM   1612 C  CB  . MET A 1 268 ? -25.428 14.010  7.115   1.00 42.06 ? 344  MET A CB  1 
ATOM   1613 C  CG  . MET A 1 268 ? -25.806 12.764  6.345   1.00 40.47 ? 344  MET A CG  1 
ATOM   1614 S  SD  . MET A 1 268 ? -24.415 11.647  6.147   1.00 39.72 ? 344  MET A SD  1 
ATOM   1615 C  CE  . MET A 1 268 ? -24.196 11.071  7.832   1.00 38.99 ? 344  MET A CE  1 
ATOM   1616 N  N   . ASN A 1 269 ? -28.674 14.114  8.414   1.00 45.29 ? 345  ASN A N   1 
ATOM   1617 C  CA  . ASN A 1 269 ? -29.448 13.428  9.441   1.00 44.14 ? 345  ASN A CA  1 
ATOM   1618 C  C   . ASN A 1 269 ? -29.048 11.958  9.442   1.00 42.77 ? 345  ASN A C   1 
ATOM   1619 O  O   . ASN A 1 269 ? -29.171 11.273  8.419   1.00 38.30 ? 345  ASN A O   1 
ATOM   1620 C  CB  . ASN A 1 269 ? -30.945 13.596  9.182   1.00 43.98 ? 345  ASN A CB  1 
ATOM   1621 C  CG  . ASN A 1 269 ? -31.813 13.018  10.298  1.00 45.78 ? 345  ASN A CG  1 
ATOM   1622 O  OD1 . ASN A 1 269 ? -31.544 11.936  10.824  1.00 44.70 ? 345  ASN A OD1 1 
ATOM   1623 N  ND2 . ASN A 1 269 ? -32.870 13.742  10.655  1.00 46.20 ? 345  ASN A ND2 1 
ATOM   1624 N  N   . GLU A 1 270 ? -28.552 11.474  10.583  1.00 42.85 ? 346  GLU A N   1 
ATOM   1625 C  CA  . GLU A 1 270 ? -28.043 10.109  10.633  1.00 44.67 ? 346  GLU A CA  1 
ATOM   1626 C  C   . GLU A 1 270 ? -29.147 9.070   10.486  1.00 41.27 ? 346  GLU A C   1 
ATOM   1627 O  O   . GLU A 1 270 ? -28.863 7.945   10.065  1.00 40.43 ? 346  GLU A O   1 
ATOM   1628 C  CB  . GLU A 1 270 ? -27.256 9.882   11.927  1.00 50.61 ? 346  GLU A CB  1 
ATOM   1629 C  CG  . GLU A 1 270 ? -25.826 10.414  11.863  1.00 55.73 ? 346  GLU A CG  1 
ATOM   1630 C  CD  . GLU A 1 270 ? -25.033 10.137  13.126  0.69 61.74 ? 346  GLU A CD  1 
ATOM   1631 O  OE1 . GLU A 1 270 ? -23.866 10.576  13.201  0.94 64.24 ? 346  GLU A OE1 1 
ATOM   1632 O  OE2 . GLU A 1 270 ? -25.573 9.483   14.043  0.58 63.68 ? 346  GLU A OE2 1 
ATOM   1633 N  N   . ARG A 1 271 ? -30.396 9.422   10.797  1.00 41.08 ? 347  ARG A N   1 
ATOM   1634 C  CA  . ARG A 1 271 ? -31.501 8.489   10.605  1.00 42.74 ? 347  ARG A CA  1 
ATOM   1635 C  C   . ARG A 1 271 ? -31.993 8.445   9.159   1.00 41.59 ? 347  ARG A C   1 
ATOM   1636 O  O   . ARG A 1 271 ? -32.621 7.458   8.762   1.00 43.47 ? 347  ARG A O   1 
ATOM   1637 C  CB  . ARG A 1 271 ? -32.660 8.847   11.541  1.00 43.36 ? 347  ARG A CB  1 
ATOM   1638 N  N   . ASP A 1 272 ? -31.719 9.480   8.369   1.00 38.31 ? 348  ASP A N   1 
ATOM   1639 C  CA  . ASP A 1 272 ? -32.109 9.516   6.957   1.00 33.94 ? 348  ASP A CA  1 
ATOM   1640 C  C   . ASP A 1 272 ? -31.060 10.326  6.212   1.00 31.59 ? 348  ASP A C   1 
ATOM   1641 O  O   . ASP A 1 272 ? -31.231 11.525  5.964   1.00 30.55 ? 348  ASP A O   1 
ATOM   1642 C  CB  . ASP A 1 272 ? -33.508 10.117  6.787   1.00 36.09 ? 348  ASP A CB  1 
ATOM   1643 C  CG  . ASP A 1 272 ? -33.917 10.295  5.325   1.00 36.78 ? 348  ASP A CG  1 
ATOM   1644 O  OD1 . ASP A 1 272 ? -33.254 9.735   4.425   1.00 35.96 ? 348  ASP A OD1 1 
ATOM   1645 O  OD2 . ASP A 1 272 ? -34.918 11.012  5.085   1.00 38.39 ? 348  ASP A OD2 1 
ATOM   1646 N  N   . PRO A 1 273 ? -29.935 9.703   5.860   1.00 29.64 ? 349  PRO A N   1 
ATOM   1647 C  CA  . PRO A 1 273 ? -28.847 10.435  5.200   1.00 29.80 ? 349  PRO A CA  1 
ATOM   1648 C  C   . PRO A 1 273 ? -29.008 10.598  3.697   1.00 34.15 ? 349  PRO A C   1 
ATOM   1649 O  O   . PRO A 1 273 ? -28.038 10.977  3.034   1.00 38.11 ? 349  PRO A O   1 
ATOM   1650 C  CB  . PRO A 1 273 ? -27.620 9.569   5.523   1.00 28.74 ? 349  PRO A CB  1 
ATOM   1651 C  CG  . PRO A 1 273 ? -28.161 8.188   5.638   1.00 29.43 ? 349  PRO A CG  1 
ATOM   1652 C  CD  . PRO A 1 273 ? -29.553 8.322   6.203   1.00 28.77 ? 349  PRO A CD  1 
ATOM   1653 N  N   . SER A 1 274 ? -30.194 10.351  3.147   1.00 32.03 ? 350  SER A N   1 
ATOM   1654 C  CA  . SER A 1 274 ? -30.382 10.367  1.703   1.00 27.91 ? 350  SER A CA  1 
ATOM   1655 C  C   . SER A 1 274 ? -30.226 11.775  1.133   1.00 27.75 ? 350  SER A C   1 
ATOM   1656 O  O   . SER A 1 274 ? -30.352 12.784  1.835   1.00 28.23 ? 350  SER A O   1 
ATOM   1657 C  CB  . SER A 1 274 ? -31.761 9.824   1.338   1.00 25.36 ? 350  SER A CB  1 
ATOM   1658 O  OG  . SER A 1 274 ? -32.773 10.645  1.895   1.00 27.81 ? 350  SER A OG  1 
ATOM   1659 N  N   . ILE A 1 275 ? -29.948 11.823  -0.173  1.00 27.47 ? 351  ILE A N   1 
ATOM   1660 C  CA  . ILE A 1 275 ? -29.844 13.097  -0.881  1.00 27.90 ? 351  ILE A CA  1 
ATOM   1661 C  C   . ILE A 1 275 ? -31.156 13.863  -0.795  1.00 28.37 ? 351  ILE A C   1 
ATOM   1662 O  O   . ILE A 1 275 ? -31.167 15.086  -0.604  1.00 29.68 ? 351  ILE A O   1 
ATOM   1663 C  CB  . ILE A 1 275 ? -29.421 12.856  -2.342  1.00 25.10 ? 351  ILE A CB  1 
ATOM   1664 C  CG1 . ILE A 1 275 ? -27.964 12.396  -2.404  1.00 22.68 ? 351  ILE A CG1 1 
ATOM   1665 C  CG2 . ILE A 1 275 ? -29.633 14.113  -3.186  1.00 25.77 ? 351  ILE A CG2 1 
ATOM   1666 C  CD1 . ILE A 1 275 ? -27.627 11.640  -3.681  1.00 22.54 ? 351  ILE A CD1 1 
ATOM   1667 N  N   . LEU A 1 276 ? -32.282 13.155  -0.924  1.00 24.59 ? 352  LEU A N   1 
ATOM   1668 C  CA  . LEU A 1 276 ? -33.585 13.798  -0.784  1.00 25.62 ? 352  LEU A CA  1 
ATOM   1669 C  C   . LEU A 1 276 ? -33.711 14.506  0.560   1.00 27.95 ? 352  LEU A C   1 
ATOM   1670 O  O   . LEU A 1 276 ? -34.262 15.610  0.637   1.00 29.16 ? 352  LEU A O   1 
ATOM   1671 C  CB  . LEU A 1 276 ? -34.701 12.766  -0.946  1.00 27.28 ? 352  LEU A CB  1 
ATOM   1672 C  CG  . LEU A 1 276 ? -36.094 13.218  -0.487  1.00 31.06 ? 352  LEU A CG  1 
ATOM   1673 C  CD1 . LEU A 1 276 ? -36.585 14.394  -1.321  1.00 30.45 ? 352  LEU A CD1 1 
ATOM   1674 C  CD2 . LEU A 1 276 ? -37.090 12.067  -0.524  1.00 29.98 ? 352  LEU A CD2 1 
ATOM   1675 N  N   . HIS A 1 277 ? -33.205 13.892  1.630   1.00 29.35 ? 353  HIS A N   1 
ATOM   1676 C  CA  . HIS A 1 277 ? -33.314 14.525  2.940   1.00 33.20 ? 353  HIS A CA  1 
ATOM   1677 C  C   . HIS A 1 277 ? -32.445 15.771  3.019   1.00 34.19 ? 353  HIS A C   1 
ATOM   1678 O  O   . HIS A 1 277 ? -32.862 16.790  3.582   1.00 37.09 ? 353  HIS A O   1 
ATOM   1679 C  CB  . HIS A 1 277 ? -32.937 13.540  4.045   1.00 33.73 ? 353  HIS A CB  1 
ATOM   1680 C  CG  . HIS A 1 277 ? -33.364 13.982  5.412   1.00 36.62 ? 353  HIS A CG  1 
ATOM   1681 N  ND1 . HIS A 1 277 ? -34.390 13.373  6.103   1.00 37.32 ? 353  HIS A ND1 1 
ATOM   1682 C  CD2 . HIS A 1 277 ? -32.914 14.981  6.207   1.00 37.10 ? 353  HIS A CD2 1 
ATOM   1683 C  CE1 . HIS A 1 277 ? -34.546 13.974  7.270   1.00 39.19 ? 353  HIS A CE1 1 
ATOM   1684 N  NE2 . HIS A 1 277 ? -33.664 14.954  7.357   1.00 39.06 ? 353  HIS A NE2 1 
ATOM   1685 N  N   . PHE A 1 278 ? -31.233 15.707  2.459   1.00 32.38 ? 354  PHE A N   1 
ATOM   1686 C  CA  . PHE A 1 278 ? -30.368 16.881  2.425   1.00 33.53 ? 354  PHE A CA  1 
ATOM   1687 C  C   . PHE A 1 278 ? -31.036 18.025  1.674   1.00 34.36 ? 354  PHE A C   1 
ATOM   1688 O  O   . PHE A 1 278 ? -31.029 19.172  2.133   1.00 37.98 ? 354  PHE A O   1 
ATOM   1689 C  CB  . PHE A 1 278 ? -29.022 16.530  1.780   1.00 31.69 ? 354  PHE A CB  1 
ATOM   1690 C  CG  . PHE A 1 278 ? -28.071 17.700  1.680   1.00 32.61 ? 354  PHE A CG  1 
ATOM   1691 C  CD1 . PHE A 1 278 ? -28.191 18.634  0.658   1.00 34.40 ? 354  PHE A CD1 1 
ATOM   1692 C  CD2 . PHE A 1 278 ? -27.052 17.857  2.602   1.00 33.74 ? 354  PHE A CD2 1 
ATOM   1693 C  CE1 . PHE A 1 278 ? -27.326 19.704  0.570   1.00 35.73 ? 354  PHE A CE1 1 
ATOM   1694 C  CE2 . PHE A 1 278 ? -26.179 18.928  2.516   1.00 36.18 ? 354  PHE A CE2 1 
ATOM   1695 C  CZ  . PHE A 1 278 ? -26.318 19.851  1.500   1.00 35.52 ? 354  PHE A CZ  1 
ATOM   1696 N  N   . LEU A 1 279 ? -31.594 17.734  0.495   1.00 31.34 ? 355  LEU A N   1 
ATOM   1697 C  CA  . LEU A 1 279 ? -32.225 18.784  -0.297  1.00 34.30 ? 355  LEU A CA  1 
ATOM   1698 C  C   . LEU A 1 279 ? -33.375 19.428  0.464   1.00 37.88 ? 355  LEU A C   1 
ATOM   1699 O  O   . LEU A 1 279 ? -33.500 20.657  0.489   1.00 43.42 ? 355  LEU A O   1 
ATOM   1700 C  CB  . LEU A 1 279 ? -32.710 18.222  -1.636  1.00 31.38 ? 355  LEU A CB  1 
ATOM   1701 C  CG  . LEU A 1 279 ? -31.654 17.667  -2.597  1.00 31.79 ? 355  LEU A CG  1 
ATOM   1702 C  CD1 . LEU A 1 279 ? -32.327 17.008  -3.789  1.00 31.54 ? 355  LEU A CD1 1 
ATOM   1703 C  CD2 . LEU A 1 279 ? -30.706 18.768  -3.058  1.00 32.15 ? 355  LEU A CD2 1 
ATOM   1704 N  N   . LEU A 1 280 ? -34.216 18.618  1.111   1.00 36.72 ? 356  LEU A N   1 
ATOM   1705 C  CA  . LEU A 1 280 ? -35.370 19.178  1.811   1.00 40.08 ? 356  LEU A CA  1 
ATOM   1706 C  C   . LEU A 1 280 ? -34.948 19.995  3.027   1.00 43.67 ? 356  LEU A C   1 
ATOM   1707 O  O   . LEU A 1 280 ? -35.530 21.051  3.302   1.00 45.59 ? 356  LEU A O   1 
ATOM   1708 C  CB  . LEU A 1 280 ? -36.333 18.064  2.214   1.00 39.94 ? 356  LEU A CB  1 
ATOM   1709 C  CG  . LEU A 1 280 ? -37.097 17.424  1.053   1.00 39.41 ? 356  LEU A CG  1 
ATOM   1710 C  CD1 . LEU A 1 280 ? -38.078 16.381  1.562   1.00 38.66 ? 356  LEU A CD1 1 
ATOM   1711 C  CD2 . LEU A 1 280 ? -37.822 18.486  0.239   1.00 39.69 ? 356  LEU A CD2 1 
ATOM   1712 N  N   . ALA A 1 281 ? -33.939 19.533  3.767   1.00 43.33 ? 357  ALA A N   1 
ATOM   1713 C  CA  . ALA A 1 281 ? -33.467 20.299  4.913   1.00 44.97 ? 357  ALA A CA  1 
ATOM   1714 C  C   . ALA A 1 281 ? -32.662 21.530  4.514   1.00 46.03 ? 357  ALA A C   1 
ATOM   1715 O  O   . ALA A 1 281 ? -32.432 22.397  5.363   1.00 44.85 ? 357  ALA A O   1 
ATOM   1716 C  CB  . ALA A 1 281 ? -32.631 19.410  5.829   1.00 44.62 ? 357  ALA A CB  1 
ATOM   1717 N  N   . SER A 1 282 ? -32.229 21.632  3.256   1.00 46.37 ? 358  SER A N   1 
ATOM   1718 C  CA  . SER A 1 282 ? -31.486 22.801  2.807   1.00 48.13 ? 358  SER A CA  1 
ATOM   1719 C  C   . SER A 1 282 ? -32.383 23.982  2.469   1.00 51.21 ? 358  SER A C   1 
ATOM   1720 O  O   . SER A 1 282 ? -31.864 25.061  2.162   1.00 51.85 ? 358  SER A O   1 
ATOM   1721 C  CB  . SER A 1 282 ? -30.640 22.455  1.580   1.00 47.71 ? 358  SER A CB  1 
ATOM   1722 O  OG  . SER A 1 282 ? -31.441 22.429  0.413   1.00 47.39 ? 358  SER A OG  1 
ATOM   1723 N  N   . GLY A 1 283 ? -33.700 23.808  2.511   1.00 55.82 ? 359  GLY A N   1 
ATOM   1724 C  CA  . GLY A 1 283 ? -34.608 24.867  2.111   1.00 60.75 ? 359  GLY A CA  1 
ATOM   1725 C  C   . GLY A 1 283 ? -34.689 25.059  0.613   1.00 64.16 ? 359  GLY A C   1 
ATOM   1726 O  O   . GLY A 1 283 ? -34.701 26.203  0.137   1.00 64.34 ? 359  GLY A O   1 
ATOM   1727 N  N   . ASP A 1 284 ? -34.749 23.966  -0.144  1.00 65.71 ? 360  ASP A N   1 
ATOM   1728 C  CA  . ASP A 1 284 ? -34.666 24.010  -1.600  1.00 66.27 ? 360  ASP A CA  1 
ATOM   1729 C  C   . ASP A 1 284 ? -35.817 24.799  -2.226  1.00 69.80 ? 360  ASP A C   1 
ATOM   1730 O  O   . ASP A 1 284 ? -36.987 24.451  -2.065  1.00 72.44 ? 360  ASP A O   1 
ATOM   1731 C  CB  . ASP A 1 284 ? -34.639 22.587  -2.163  1.00 63.65 ? 360  ASP A CB  1 
ATOM   1732 C  CG  . ASP A 1 284 ? -33.813 22.476  -3.428  0.29 60.37 ? 360  ASP A CG  1 
ATOM   1733 O  OD1 . ASP A 1 284 ? -33.100 23.445  -3.762  0.58 60.31 ? 360  ASP A OD1 1 
ATOM   1734 O  OD2 . ASP A 1 284 ? -33.877 21.419  -4.089  1.00 57.31 ? 360  ASP A OD2 1 
ATOM   1735 N  N   . VAL A 1 286 ? -38.003 24.125  -4.569  1.00 47.55 ? 362  VAL A N   1 
ATOM   1736 C  CA  . VAL A 1 286 ? -38.462 23.902  -5.936  1.00 47.80 ? 362  VAL A CA  1 
ATOM   1737 C  C   . VAL A 1 286 ? -39.750 23.085  -5.954  1.00 46.38 ? 362  VAL A C   1 
ATOM   1738 O  O   . VAL A 1 286 ? -40.209 22.606  -4.917  1.00 43.93 ? 362  VAL A O   1 
ATOM   1739 C  CB  . VAL A 1 286 ? -37.379 23.215  -6.782  1.00 47.36 ? 362  VAL A CB  1 
ATOM   1740 C  CG1 . VAL A 1 286 ? -36.111 24.049  -6.788  1.00 50.03 ? 362  VAL A CG1 1 
ATOM   1741 C  CG2 . VAL A 1 286 ? -37.107 21.807  -6.266  1.00 46.03 ? 362  VAL A CG2 1 
ATOM   1742 N  N   . SER A 1 287 ? -40.314 22.918  -7.148  1.00 45.67 ? 363  SER A N   1 
ATOM   1743 C  CA  . SER A 1 287 ? -41.605 22.267  -7.310  1.00 46.91 ? 363  SER A CA  1 
ATOM   1744 C  C   . SER A 1 287 ? -41.492 20.755  -7.128  1.00 47.48 ? 363  SER A C   1 
ATOM   1745 O  O   . SER A 1 287 ? -40.408 20.168  -7.195  1.00 45.56 ? 363  SER A O   1 
ATOM   1746 C  CB  . SER A 1 287 ? -42.189 22.577  -8.687  1.00 45.21 ? 363  SER A CB  1 
ATOM   1747 O  OG  . SER A 1 287 ? -41.396 22.004  -9.712  1.00 42.09 ? 363  SER A OG  1 
ATOM   1748 N  N   . SER A 1 288 ? -42.649 20.124  -6.901  1.00 48.80 ? 364  SER A N   1 
ATOM   1749 C  CA  . SER A 1 288 ? -42.689 18.674  -6.746  1.00 48.94 ? 364  SER A CA  1 
ATOM   1750 C  C   . SER A 1 288 ? -42.252 17.967  -8.021  1.00 44.78 ? 364  SER A C   1 
ATOM   1751 O  O   . SER A 1 288 ? -41.545 16.953  -7.967  1.00 45.44 ? 364  SER A O   1 
ATOM   1752 C  CB  . SER A 1 288 ? -44.092 18.223  -6.344  1.00 54.14 ? 364  SER A CB  1 
ATOM   1753 O  OG  . SER A 1 288 ? -44.294 18.379  -4.951  1.00 58.76 ? 364  SER A OG  1 
ATOM   1754 N  N   . LYS A 1 289 ? -42.677 18.474  -9.180  1.00 43.03 ? 365  LYS A N   1 
ATOM   1755 C  CA  . LYS A 1 289 ? -42.245 17.881  -10.441 1.00 42.81 ? 365  LYS A CA  1 
ATOM   1756 C  C   . LYS A 1 289 ? -40.731 17.950  -10.584 1.00 40.80 ? 365  LYS A C   1 
ATOM   1757 O  O   . LYS A 1 289 ? -40.093 16.972  -10.988 1.00 39.67 ? 365  LYS A O   1 
ATOM   1758 C  CB  . LYS A 1 289 ? -42.929 18.578  -11.615 1.00 43.87 ? 365  LYS A CB  1 
ATOM   1759 N  N   . GLN A 1 290 ? -40.137 19.094  -10.236 1.00 41.23 ? 366  GLN A N   1 
ATOM   1760 C  CA  . GLN A 1 290 ? -38.693 19.252  -10.369 1.00 39.49 ? 366  GLN A CA  1 
ATOM   1761 C  C   . GLN A 1 290 ? -37.947 18.306  -9.436  1.00 36.27 ? 366  GLN A C   1 
ATOM   1762 O  O   . GLN A 1 290 ? -36.980 17.650  -9.843  1.00 37.44 ? 366  GLN A O   1 
ATOM   1763 C  CB  . GLN A 1 290 ? -38.291 20.700  -10.093 1.00 41.48 ? 366  GLN A CB  1 
ATOM   1764 C  CG  . GLN A 1 290 ? -36.798 20.947  -10.220 1.00 42.88 ? 366  GLN A CG  1 
ATOM   1765 C  CD  . GLN A 1 290 ? -36.304 20.790  -11.646 1.00 46.66 ? 366  GLN A CD  1 
ATOM   1766 O  OE1 . GLN A 1 290 ? -36.958 21.231  -12.593 1.00 50.36 ? 366  GLN A OE1 1 
ATOM   1767 N  NE2 . GLN A 1 290 ? -35.148 20.154  -11.809 1.00 44.79 ? 366  GLN A NE2 1 
ATOM   1768 N  N   . LEU A 1 291 ? -38.382 18.224  -8.176  1.00 33.64 ? 367  LEU A N   1 
ATOM   1769 C  CA  . LEU A 1 291 ? -37.710 17.348  -7.222  1.00 32.67 ? 367  LEU A CA  1 
ATOM   1770 C  C   . LEU A 1 291 ? -37.781 15.892  -7.665  1.00 31.53 ? 367  LEU A C   1 
ATOM   1771 O  O   . LEU A 1 291 ? -36.778 15.173  -7.606  1.00 32.01 ? 367  LEU A O   1 
ATOM   1772 C  CB  . LEU A 1 291 ? -38.312 17.517  -5.825  1.00 32.87 ? 367  LEU A CB  1 
ATOM   1773 C  CG  . LEU A 1 291 ? -37.596 16.753  -4.705  1.00 32.13 ? 367  LEU A CG  1 
ATOM   1774 C  CD1 . LEU A 1 291 ? -36.121 17.116  -4.662  1.00 30.27 ? 367  LEU A CD1 1 
ATOM   1775 C  CD2 . LEU A 1 291 ? -38.251 17.028  -3.356  1.00 33.47 ? 367  LEU A CD2 1 
ATOM   1776 N  N   . ARG A 1 292 ? -38.955 15.444  -8.123  1.00 33.29 ? 368  ARG A N   1 
ATOM   1777 C  CA  . ARG A 1 292 ? -39.073 14.079  -8.628  1.00 32.83 ? 368  ARG A CA  1 
ATOM   1778 C  C   . ARG A 1 292 ? -38.157 13.857  -9.822  1.00 33.33 ? 368  ARG A C   1 
ATOM   1779 O  O   . ARG A 1 292 ? -37.520 12.803  -9.937  1.00 35.57 ? 368  ARG A O   1 
ATOM   1780 C  CB  . ARG A 1 292 ? -40.522 13.769  -9.010  1.00 33.08 ? 368  ARG A CB  1 
ATOM   1781 C  CG  . ARG A 1 292 ? -41.466 13.580  -7.839  1.00 35.40 ? 368  ARG A CG  1 
ATOM   1782 C  CD  . ARG A 1 292 ? -42.793 12.998  -8.305  1.00 39.73 ? 368  ARG A CD  1 
ATOM   1783 N  NE  . ARG A 1 292 ? -43.346 13.745  -9.433  1.00 41.60 ? 368  ARG A NE  1 
ATOM   1784 C  CZ  . ARG A 1 292 ? -44.233 14.730  -9.319  1.00 44.97 ? 368  ARG A CZ  1 
ATOM   1785 N  NH1 . ARG A 1 292 ? -44.680 15.088  -8.123  1.00 46.23 ? 368  ARG A NH1 1 
ATOM   1786 N  NH2 . ARG A 1 292 ? -44.676 15.355  -10.402 1.00 45.94 ? 368  ARG A NH2 1 
ATOM   1787 N  N   . ASP A 1 293 ? -38.076 14.840  -10.724 1.00 33.59 ? 369  ASP A N   1 
ATOM   1788 C  CA  . ASP A 1 293 ? -37.172 14.717  -11.864 1.00 33.22 ? 369  ASP A CA  1 
ATOM   1789 C  C   . ASP A 1 293 ? -35.721 14.619  -11.406 1.00 30.41 ? 369  ASP A C   1 
ATOM   1790 O  O   . ASP A 1 293 ? -34.960 13.787  -11.913 1.00 30.34 ? 369  ASP A O   1 
ATOM   1791 C  CB  . ASP A 1 293 ? -37.357 15.899  -12.816 1.00 38.58 ? 369  ASP A CB  1 
ATOM   1792 C  CG  . ASP A 1 293 ? -38.709 15.887  -13.507 1.00 42.34 ? 369  ASP A CG  1 
ATOM   1793 O  OD1 . ASP A 1 293 ? -39.453 14.897  -13.347 1.00 42.78 ? 369  ASP A OD1 1 
ATOM   1794 O  OD2 . ASP A 1 293 ? -39.028 16.874  -14.203 1.00 43.78 ? 369  ASP A OD2 1 
ATOM   1795 N  N   . ASP A 1 294 ? -35.322 15.456  -10.444 1.00 30.84 ? 370  ASP A N   1 
ATOM   1796 C  CA  . ASP A 1 294 ? -33.965 15.381  -9.909  1.00 30.53 ? 370  ASP A CA  1 
ATOM   1797 C  C   . ASP A 1 294 ? -33.679 13.996  -9.342  1.00 28.43 ? 370  ASP A C   1 
ATOM   1798 O  O   . ASP A 1 294 ? -32.640 13.395  -9.636  1.00 27.39 ? 370  ASP A O   1 
ATOM   1799 C  CB  . ASP A 1 294 ? -33.757 16.449  -8.832  1.00 33.17 ? 370  ASP A CB  1 
ATOM   1800 C  CG  . ASP A 1 294 ? -33.851 17.863  -9.378  1.00 39.94 ? 370  ASP A CG  1 
ATOM   1801 O  OD1 . ASP A 1 294 ? -33.673 18.046  -10.598 1.00 41.35 ? 370  ASP A OD1 1 
ATOM   1802 O  OD2 . ASP A 1 294 ? -34.100 18.793  -8.584  1.00 42.73 ? 370  ASP A OD2 1 
ATOM   1803 N  N   . LEU A 1 295 ? -34.600 13.474  -8.526  1.00 28.65 ? 371  LEU A N   1 
ATOM   1804 C  CA  . LEU A 1 295 ? -34.410 12.154  -7.929  1.00 26.54 ? 371  LEU A CA  1 
ATOM   1805 C  C   . LEU A 1 295 ? -34.380 11.066  -8.993  1.00 27.37 ? 371  LEU A C   1 
ATOM   1806 O  O   . LEU A 1 295 ? -33.534 10.164  -8.949  1.00 27.14 ? 371  LEU A O   1 
ATOM   1807 C  CB  . LEU A 1 295 ? -35.522 11.875  -6.920  1.00 25.82 ? 371  LEU A CB  1 
ATOM   1808 C  CG  . LEU A 1 295 ? -35.612 12.827  -5.722  1.00 28.94 ? 371  LEU A CG  1 
ATOM   1809 C  CD1 . LEU A 1 295 ? -36.785 12.457  -4.833  1.00 30.64 ? 371  LEU A CD1 1 
ATOM   1810 C  CD2 . LEU A 1 295 ? -34.318 12.822  -4.928  1.00 28.46 ? 371  LEU A CD2 1 
ATOM   1811 N  N   . MET A 1 296 ? -35.304 11.133  -9.953  1.00 26.46 ? 372  MET A N   1 
ATOM   1812 C  CA  . MET A 1 296 ? -35.375 10.112  -10.992 1.00 31.84 ? 372  MET A CA  1 
ATOM   1813 C  C   . MET A 1 296 ? -34.105 10.087  -11.833 1.00 27.87 ? 372  MET A C   1 
ATOM   1814 O  O   . MET A 1 296 ? -33.630 9.016   -12.228 1.00 29.41 ? 372  MET A O   1 
ATOM   1815 C  CB  . MET A 1 296 ? -36.591 10.361  -11.879 1.00 40.85 ? 372  MET A CB  1 
ATOM   1816 C  CG  . MET A 1 296 ? -36.935 9.194   -12.767 1.00 50.50 ? 372  MET A CG  1 
ATOM   1817 S  SD  . MET A 1 296 ? -37.930 8.010   -11.861 1.00 59.91 ? 372  MET A SD  1 
ATOM   1818 C  CE  . MET A 1 296 ? -39.367 9.026   -11.534 1.00 62.88 ? 372  MET A CE  1 
ATOM   1819 N  N   . THR A 1 297 ? -33.543 11.261  -12.117 1.00 25.90 ? 373  THR A N   1 
ATOM   1820 C  CA  . THR A 1 297 ? -32.303 11.335  -12.879 1.00 24.64 ? 373  THR A CA  1 
ATOM   1821 C  C   . THR A 1 297 ? -31.172 10.623  -12.149 1.00 24.50 ? 373  THR A C   1 
ATOM   1822 O  O   . THR A 1 297 ? -30.415 9.854   -12.753 1.00 23.25 ? 373  THR A O   1 
ATOM   1823 C  CB  . THR A 1 297 ? -31.951 12.800  -13.145 1.00 29.23 ? 373  THR A CB  1 
ATOM   1824 O  OG1 . THR A 1 297 ? -32.999 13.406  -13.912 1.00 32.23 ? 373  THR A OG1 1 
ATOM   1825 C  CG2 . THR A 1 297 ? -30.641 12.921  -13.908 1.00 25.44 ? 373  THR A CG2 1 
ATOM   1826 N  N   . MET A 1 298 ? -31.048 10.856  -10.837 1.00 23.06 ? 374  MET A N   1 
ATOM   1827 C  CA  . MET A 1 298 ? -29.976 10.216  -10.083 1.00 23.94 ? 374  MET A CA  1 
ATOM   1828 C  C   . MET A 1 298 ? -30.236 8.728   -9.896  1.00 24.90 ? 374  MET A C   1 
ATOM   1829 O  O   . MET A 1 298 ? -29.288 7.934   -9.869  1.00 26.84 ? 374  MET A O   1 
ATOM   1830 C  CB  . MET A 1 298 ? -29.788 10.916  -8.735  1.00 27.07 ? 374  MET A CB  1 
ATOM   1831 C  CG  . MET A 1 298 ? -29.093 12.263  -8.875  1.00 27.88 ? 374  MET A CG  1 
ATOM   1832 S  SD  . MET A 1 298 ? -28.927 13.175  -7.333  1.00 33.10 ? 374  MET A SD  1 
ATOM   1833 C  CE  . MET A 1 298 ? -30.630 13.641  -7.040  1.00 33.18 ? 374  MET A CE  1 
ATOM   1834 N  N   . LEU A 1 299 ? -31.505 8.332   -9.783  1.00 25.60 ? 375  LEU A N   1 
ATOM   1835 C  CA  . LEU A 1 299 ? -31.842 6.913   -9.736  1.00 25.75 ? 375  LEU A CA  1 
ATOM   1836 C  C   . LEU A 1 299 ? -31.384 6.195   -11.005 1.00 26.46 ? 375  LEU A C   1 
ATOM   1837 O  O   . LEU A 1 299 ? -30.709 5.162   -10.936 1.00 25.23 ? 375  LEU A O   1 
ATOM   1838 C  CB  . LEU A 1 299 ? -33.347 6.742   -9.534  1.00 26.60 ? 375  LEU A CB  1 
ATOM   1839 C  CG  . LEU A 1 299 ? -33.913 5.340   -9.770  1.00 30.64 ? 375  LEU A CG  1 
ATOM   1840 C  CD1 . LEU A 1 299 ? -33.574 4.407   -8.621  1.00 32.27 ? 375  LEU A CD1 1 
ATOM   1841 C  CD2 . LEU A 1 299 ? -35.412 5.395   -10.005 1.00 31.82 ? 375  LEU A CD2 1 
ATOM   1842 N  N   . ILE A 1 300 ? -31.748 6.728   -12.176 1.00 25.81 ? 376  ILE A N   1 
ATOM   1843 C  CA  . ILE A 1 300 ? -31.357 6.100   -13.440 1.00 24.61 ? 376  ILE A CA  1 
ATOM   1844 C  C   . ILE A 1 300 ? -29.840 6.108   -13.591 1.00 23.57 ? 376  ILE A C   1 
ATOM   1845 O  O   . ILE A 1 300 ? -29.229 5.093   -13.945 1.00 24.61 ? 376  ILE A O   1 
ATOM   1846 C  CB  . ILE A 1 300 ? -32.024 6.804   -14.638 1.00 26.50 ? 376  ILE A CB  1 
ATOM   1847 C  CG1 . ILE A 1 300 ? -33.538 6.956   -14.452 1.00 32.18 ? 376  ILE A CG1 1 
ATOM   1848 C  CG2 . ILE A 1 300 ? -31.717 6.052   -15.925 1.00 24.39 ? 376  ILE A CG2 1 
ATOM   1849 C  CD1 . ILE A 1 300 ? -34.288 5.677   -14.367 1.00 35.96 ? 376  ILE A CD1 1 
ATOM   1850 N  N   . ALA A 1 301 ? -29.212 7.258   -13.333 1.00 21.12 ? 377  ALA A N   1 
ATOM   1851 C  CA  . ALA A 1 301 ? -27.779 7.394   -13.575 1.00 23.77 ? 377  ALA A CA  1 
ATOM   1852 C  C   . ALA A 1 301 ? -26.969 6.441   -12.701 1.00 24.69 ? 377  ALA A C   1 
ATOM   1853 O  O   . ALA A 1 301 ? -26.051 5.767   -13.182 1.00 24.68 ? 377  ALA A O   1 
ATOM   1854 C  CB  . ALA A 1 301 ? -27.344 8.841   -13.343 1.00 26.96 ? 377  ALA A CB  1 
ATOM   1855 N  N   . GLY A 1 302 ? -27.299 6.364   -11.412 1.00 23.73 ? 378  GLY A N   1 
ATOM   1856 C  CA  . GLY A 1 302 ? -26.517 5.560   -10.491 1.00 24.21 ? 378  GLY A CA  1 
ATOM   1857 C  C   . GLY A 1 302 ? -26.807 4.077   -10.511 1.00 24.82 ? 378  GLY A C   1 
ATOM   1858 O  O   . GLY A 1 302 ? -26.046 3.303   -9.923  1.00 27.38 ? 378  GLY A O   1 
ATOM   1859 N  N   . HIS A 1 303 ? -27.884 3.666   -11.178 1.00 23.08 ? 379  HIS A N   1 
ATOM   1860 C  CA  . HIS A 1 303 ? -28.263 2.260   -11.286 1.00 22.77 ? 379  HIS A CA  1 
ATOM   1861 C  C   . HIS A 1 303 ? -27.607 1.598   -12.495 1.00 25.50 ? 379  HIS A C   1 
ATOM   1862 O  O   . HIS A 1 303 ? -26.811 0.667   -12.343 1.00 25.06 ? 379  HIS A O   1 
ATOM   1863 C  CB  . HIS A 1 303 ? -29.791 2.153   -11.356 1.00 23.04 ? 379  HIS A CB  1 
ATOM   1864 C  CG  . HIS A 1 303 ? -30.306 0.781   -11.672 1.00 28.14 ? 379  HIS A CG  1 
ATOM   1865 N  ND1 . HIS A 1 303 ? -29.630 -0.374  -11.339 1.00 29.05 ? 379  HIS A ND1 1 
ATOM   1866 C  CD2 . HIS A 1 303 ? -31.448 0.384   -12.282 1.00 29.41 ? 379  HIS A CD2 1 
ATOM   1867 C  CE1 . HIS A 1 303 ? -30.327 -1.422  -11.740 1.00 28.72 ? 379  HIS A CE1 1 
ATOM   1868 N  NE2 . HIS A 1 303 ? -31.437 -0.990  -12.311 1.00 31.44 ? 379  HIS A NE2 1 
ATOM   1869 N  N   . GLU A 1 304 ? -27.918 2.097   -13.697 1.00 27.06 ? 380  GLU A N   1 
ATOM   1870 C  CA  . GLU A 1 304 ? -27.519 1.426   -14.932 1.00 30.54 ? 380  GLU A CA  1 
ATOM   1871 C  C   . GLU A 1 304 ? -26.005 1.379   -15.087 1.00 24.53 ? 380  GLU A C   1 
ATOM   1872 O  O   . GLU A 1 304 ? -25.449 0.363   -15.520 1.00 23.70 ? 380  GLU A O   1 
ATOM   1873 C  CB  . GLU A 1 304 ? -28.140 2.139   -16.136 1.00 36.63 ? 380  GLU A CB  1 
ATOM   1874 C  CG  . GLU A 1 304 ? -29.651 2.010   -16.249 1.00 42.09 ? 380  GLU A CG  1 
ATOM   1875 C  CD  . GLU A 1 304 ? -30.082 0.636   -16.717 0.50 42.42 ? 380  GLU A CD  1 
ATOM   1876 O  OE1 . GLU A 1 304 ? -30.035 -0.312  -15.907 0.61 42.47 ? 380  GLU A OE1 1 
ATOM   1877 O  OE2 . GLU A 1 304 ? -30.457 0.503   -17.901 0.60 42.97 ? 380  GLU A OE2 1 
ATOM   1878 N  N   . THR A 1 305 ? -25.327 2.476   -14.756 1.00 21.78 ? 381  THR A N   1 
ATOM   1879 C  CA  . THR A 1 305 ? -23.893 2.567   -14.986 1.00 19.55 ? 381  THR A CA  1 
ATOM   1880 C  C   . THR A 1 305 ? -23.139 1.500   -14.203 1.00 20.39 ? 381  THR A C   1 
ATOM   1881 O  O   . THR A 1 305 ? -22.423 0.679   -14.783 1.00 20.76 ? 381  THR A O   1 
ATOM   1882 C  CB  . THR A 1 305 ? -23.398 3.962   -14.616 1.00 22.04 ? 381  THR A CB  1 
ATOM   1883 O  OG1 . THR A 1 305 ? -23.860 4.299   -13.298 1.00 25.07 ? 381  THR A OG1 1 
ATOM   1884 C  CG2 . THR A 1 305 ? -23.908 4.995   -15.625 1.00 22.07 ? 381  THR A CG2 1 
ATOM   1885 N  N   . SER A 1 306 ? -23.303 1.486   -12.875 1.00 18.91 ? 382  SER A N   1 
ATOM   1886 C  CA  . SER A 1 306 ? -22.529 0.562   -12.057 1.00 18.72 ? 382  SER A CA  1 
ATOM   1887 C  C   . SER A 1 306 ? -22.962 -0.881  -12.264 1.00 17.16 ? 382  SER A C   1 
ATOM   1888 O  O   . SER A 1 306 ? -22.143 -1.792  -12.110 1.00 18.78 ? 382  SER A O   1 
ATOM   1889 C  CB  . SER A 1 306 ? -22.631 0.944   -10.580 1.00 19.82 ? 382  SER A CB  1 
ATOM   1890 O  OG  . SER A 1 306 ? -21.862 2.103   -10.315 1.00 21.87 ? 382  SER A OG  1 
ATOM   1891 N  N   . ALA A 1 307 ? -24.232 -1.115  -12.605 1.00 18.09 ? 383  ALA A N   1 
ATOM   1892 C  CA  . ALA A 1 307 ? -24.645 -2.468  -12.958 1.00 21.72 ? 383  ALA A CA  1 
ATOM   1893 C  C   . ALA A 1 307 ? -23.775 -3.013  -14.084 1.00 23.81 ? 383  ALA A C   1 
ATOM   1894 O  O   . ALA A 1 307 ? -23.320 -4.162  -14.032 1.00 22.23 ? 383  ALA A O   1 
ATOM   1895 C  CB  . ALA A 1 307 ? -26.122 -2.488  -13.357 1.00 22.47 ? 383  ALA A CB  1 
ATOM   1896 N  N   . ALA A 1 308 ? -23.497 -2.179  -15.091 1.00 22.10 ? 384  ALA A N   1 
ATOM   1897 C  CA  . ALA A 1 308 ? -22.669 -2.607  -16.212 1.00 19.07 ? 384  ALA A CA  1 
ATOM   1898 C  C   . ALA A 1 308 ? -21.189 -2.643  -15.838 1.00 18.09 ? 384  ALA A C   1 
ATOM   1899 O  O   . ALA A 1 308 ? -20.465 -3.545  -16.271 1.00 19.50 ? 384  ALA A O   1 
ATOM   1900 C  CB  . ALA A 1 308 ? -22.900 -1.686  -17.415 1.00 17.87 ? 384  ALA A CB  1 
ATOM   1901 N  N   . VAL A 1 309 ? -20.720 -1.678  -15.038 1.00 17.67 ? 385  VAL A N   1 
ATOM   1902 C  CA  . VAL A 1 309 ? -19.317 -1.679  -14.624 1.00 19.36 ? 385  VAL A CA  1 
ATOM   1903 C  C   . VAL A 1 309 ? -18.986 -2.979  -13.904 1.00 20.63 ? 385  VAL A C   1 
ATOM   1904 O  O   . VAL A 1 309 ? -17.970 -3.630  -14.181 1.00 20.90 ? 385  VAL A O   1 
ATOM   1905 C  CB  . VAL A 1 309 ? -19.009 -0.458  -13.738 1.00 19.57 ? 385  VAL A CB  1 
ATOM   1906 C  CG1 . VAL A 1 309 ? -17.595 -0.547  -13.201 1.00 18.72 ? 385  VAL A CG1 1 
ATOM   1907 C  CG2 . VAL A 1 309 ? -19.204 0.838   -14.508 1.00 18.94 ? 385  VAL A CG2 1 
ATOM   1908 N  N   . LEU A 1 310 ? -19.852 -3.383  -12.974 1.00 17.30 ? 386  LEU A N   1 
ATOM   1909 C  CA  . LEU A 1 310 ? -19.620 -4.622  -12.242 1.00 18.59 ? 386  LEU A CA  1 
ATOM   1910 C  C   . LEU A 1 310 ? -19.686 -5.831  -13.168 1.00 19.55 ? 386  LEU A C   1 
ATOM   1911 O  O   . LEU A 1 310 ? -18.853 -6.739  -13.071 1.00 22.71 ? 386  LEU A O   1 
ATOM   1912 C  CB  . LEU A 1 310 ? -20.631 -4.746  -11.102 1.00 19.67 ? 386  LEU A CB  1 
ATOM   1913 C  CG  . LEU A 1 310 ? -20.432 -3.745  -9.956  1.00 18.53 ? 386  LEU A CG  1 
ATOM   1914 C  CD1 . LEU A 1 310 ? -21.529 -3.879  -8.913  1.00 18.50 ? 386  LEU A CD1 1 
ATOM   1915 C  CD2 . LEU A 1 310 ? -19.063 -3.926  -9.320  1.00 18.39 ? 386  LEU A CD2 1 
ATOM   1916 N  N   . THR A 1 311 ? -20.649 -5.850  -14.091 1.00 19.80 ? 387  THR A N   1 
ATOM   1917 C  CA  . THR A 1 311 ? -20.748 -6.966  -15.028 1.00 21.61 ? 387  THR A CA  1 
ATOM   1918 C  C   . THR A 1 311 ? -19.468 -7.114  -15.840 1.00 20.29 ? 387  THR A C   1 
ATOM   1919 O  O   . THR A 1 311 ? -18.889 -8.202  -15.916 1.00 19.62 ? 387  THR A O   1 
ATOM   1920 C  CB  . THR A 1 311 ? -21.951 -6.774  -15.950 1.00 24.44 ? 387  THR A CB  1 
ATOM   1921 O  OG1 . THR A 1 311 ? -23.150 -6.734  -15.166 1.00 23.92 ? 387  THR A OG1 1 
ATOM   1922 C  CG2 . THR A 1 311 ? -22.036 -7.914  -16.972 1.00 22.42 ? 387  THR A CG2 1 
ATOM   1923 N  N   . TRP A 1 312 ? -18.996 -6.016  -16.439 1.00 20.93 ? 388  TRP A N   1 
ATOM   1924 C  CA  . TRP A 1 312 ? -17.820 -6.102  -17.297 1.00 22.46 ? 388  TRP A CA  1 
ATOM   1925 C  C   . TRP A 1 312 ? -16.539 -6.299  -16.494 1.00 21.40 ? 388  TRP A C   1 
ATOM   1926 O  O   . TRP A 1 312 ? -15.592 -6.916  -16.993 1.00 22.58 ? 388  TRP A O   1 
ATOM   1927 C  CB  . TRP A 1 312 ? -17.740 -4.865  -18.193 1.00 21.02 ? 388  TRP A CB  1 
ATOM   1928 C  CG  . TRP A 1 312 ? -18.819 -4.907  -19.238 1.00 20.89 ? 388  TRP A CG  1 
ATOM   1929 C  CD1 . TRP A 1 312 ? -19.914 -4.094  -19.326 1.00 20.57 ? 388  TRP A CD1 1 
ATOM   1930 C  CD2 . TRP A 1 312 ? -18.937 -5.859  -20.307 1.00 18.34 ? 388  TRP A CD2 1 
ATOM   1931 N  NE1 . TRP A 1 312 ? -20.694 -4.468  -20.401 1.00 21.45 ? 388  TRP A NE1 1 
ATOM   1932 C  CE2 . TRP A 1 312 ? -20.115 -5.547  -21.017 1.00 19.15 ? 388  TRP A CE2 1 
ATOM   1933 C  CE3 . TRP A 1 312 ? -18.152 -6.934  -20.742 1.00 20.41 ? 388  TRP A CE3 1 
ATOM   1934 C  CZ2 . TRP A 1 312 ? -20.530 -6.275  -22.134 1.00 19.27 ? 388  TRP A CZ2 1 
ATOM   1935 C  CZ3 . TRP A 1 312 ? -18.568 -7.658  -21.853 1.00 22.19 ? 388  TRP A CZ3 1 
ATOM   1936 C  CH2 . TRP A 1 312 ? -19.745 -7.324  -22.535 1.00 21.51 ? 388  TRP A CH2 1 
ATOM   1937 N  N   . THR A 1 313 ? -16.490 -5.800  -15.256 1.00 21.79 ? 389  THR A N   1 
ATOM   1938 C  CA  . THR A 1 313 ? -15.335 -6.060  -14.403 1.00 17.51 ? 389  THR A CA  1 
ATOM   1939 C  C   . THR A 1 313 ? -15.155 -7.555  -14.170 1.00 19.23 ? 389  THR A C   1 
ATOM   1940 O  O   . THR A 1 313 ? -14.050 -8.092  -14.305 1.00 21.26 ? 389  THR A O   1 
ATOM   1941 C  CB  . THR A 1 313 ? -15.488 -5.332  -13.066 1.00 19.88 ? 389  THR A CB  1 
ATOM   1942 O  OG1 . THR A 1 313 ? -15.555 -3.920  -13.295 1.00 19.88 ? 389  THR A OG1 1 
ATOM   1943 C  CG2 . THR A 1 313 ? -14.311 -5.647  -12.153 1.00 20.93 ? 389  THR A CG2 1 
ATOM   1944 N  N   . PHE A 1 314 ? -16.237 -8.252  -13.827 1.00 19.26 ? 390  PHE A N   1 
ATOM   1945 C  CA  . PHE A 1 314 ? -16.095 -9.672  -13.534 1.00 22.53 ? 390  PHE A CA  1 
ATOM   1946 C  C   . PHE A 1 314 ? -15.922 -10.498 -14.804 1.00 22.99 ? 390  PHE A C   1 
ATOM   1947 O  O   . PHE A 1 314 ? -15.282 -11.555 -14.765 1.00 22.92 ? 390  PHE A O   1 
ATOM   1948 C  CB  . PHE A 1 314 ? -17.276 -10.153 -12.698 1.00 24.69 ? 390  PHE A CB  1 
ATOM   1949 C  CG  . PHE A 1 314 ? -17.118 -9.852  -11.236 1.00 24.86 ? 390  PHE A CG  1 
ATOM   1950 C  CD1 . PHE A 1 314 ? -16.725 -10.842 -10.346 1.00 28.14 ? 390  PHE A CD1 1 
ATOM   1951 C  CD2 . PHE A 1 314 ? -17.310 -8.564  -10.760 1.00 22.46 ? 390  PHE A CD2 1 
ATOM   1952 C  CE1 . PHE A 1 314 ? -16.559 -10.554 -8.992  1.00 27.31 ? 390  PHE A CE1 1 
ATOM   1953 C  CE2 . PHE A 1 314 ? -17.144 -8.269  -9.412  1.00 24.14 ? 390  PHE A CE2 1 
ATOM   1954 C  CZ  . PHE A 1 314 ? -16.770 -9.265  -8.530  1.00 25.11 ? 390  PHE A CZ  1 
ATOM   1955 N  N   . TYR A 1 315 ? -16.457 -10.034 -15.937 1.00 23.17 ? 391  TYR A N   1 
ATOM   1956 C  CA  . TYR A 1 315 ? -16.101 -10.663 -17.206 1.00 22.13 ? 391  TYR A CA  1 
ATOM   1957 C  C   . TYR A 1 315 ? -14.605 -10.545 -17.464 1.00 23.53 ? 391  TYR A C   1 
ATOM   1958 O  O   . TYR A 1 315 ? -13.943 -11.526 -17.829 1.00 25.01 ? 391  TYR A O   1 
ATOM   1959 C  CB  . TYR A 1 315 ? -16.874 -10.048 -18.373 1.00 23.26 ? 391  TYR A CB  1 
ATOM   1960 C  CG  . TYR A 1 315 ? -16.293 -10.485 -19.711 1.00 26.97 ? 391  TYR A CG  1 
ATOM   1961 C  CD1 . TYR A 1 315 ? -16.493 -11.778 -20.189 1.00 28.23 ? 391  TYR A CD1 1 
ATOM   1962 C  CD2 . TYR A 1 315 ? -15.510 -9.620  -20.472 1.00 28.84 ? 391  TYR A CD2 1 
ATOM   1963 C  CE1 . TYR A 1 315 ? -15.949 -12.192 -21.403 1.00 30.96 ? 391  TYR A CE1 1 
ATOM   1964 C  CE2 . TYR A 1 315 ? -14.962 -10.024 -21.688 1.00 31.09 ? 391  TYR A CE2 1 
ATOM   1965 C  CZ  . TYR A 1 315 ? -15.184 -11.310 -22.143 1.00 32.03 ? 391  TYR A CZ  1 
ATOM   1966 O  OH  . TYR A 1 315 ? -14.639 -11.713 -23.339 1.00 32.68 ? 391  TYR A OH  1 
ATOM   1967 N  N   . LEU A 1 316 ? -14.058 -9.338  -17.289 1.00 21.45 ? 392  LEU A N   1 
ATOM   1968 C  CA  . LEU A 1 316 ? -12.634 -9.128  -17.526 1.00 22.88 ? 392  LEU A CA  1 
ATOM   1969 C  C   . LEU A 1 316 ? -11.787 -9.962  -16.575 1.00 24.19 ? 392  LEU A C   1 
ATOM   1970 O  O   . LEU A 1 316 ? -10.735 -10.483 -16.966 1.00 23.29 ? 392  LEU A O   1 
ATOM   1971 C  CB  . LEU A 1 316 ? -12.294 -7.645  -17.393 1.00 23.17 ? 392  LEU A CB  1 
ATOM   1972 C  CG  . LEU A 1 316 ? -12.750 -6.758  -18.559 1.00 23.41 ? 392  LEU A CG  1 
ATOM   1973 C  CD1 . LEU A 1 316 ? -12.596 -5.281  -18.216 1.00 19.98 ? 392  LEU A CD1 1 
ATOM   1974 C  CD2 . LEU A 1 316 ? -11.978 -7.100  -19.814 1.00 25.74 ? 392  LEU A CD2 1 
ATOM   1975 N  N   . LEU A 1 317 ? -12.234 -10.109 -15.325 1.00 22.55 ? 393  LEU A N   1 
ATOM   1976 C  CA  . LEU A 1 317 ? -11.481 -10.912 -14.367 1.00 23.05 ? 393  LEU A CA  1 
ATOM   1977 C  C   . LEU A 1 317 ? -11.334 -12.355 -14.845 1.00 26.16 ? 393  LEU A C   1 
ATOM   1978 O  O   . LEU A 1 317 ? -10.287 -12.979 -14.637 1.00 28.04 ? 393  LEU A O   1 
ATOM   1979 C  CB  . LEU A 1 317 ? -12.148 -10.850 -12.990 1.00 20.36 ? 393  LEU A CB  1 
ATOM   1980 C  CG  . LEU A 1 317 ? -11.958 -9.518  -12.255 1.00 24.24 ? 393  LEU A CG  1 
ATOM   1981 C  CD1 . LEU A 1 317 ? -12.722 -9.506  -10.942 1.00 23.44 ? 393  LEU A CD1 1 
ATOM   1982 C  CD2 . LEU A 1 317 ? -10.479 -9.225  -12.018 1.00 23.47 ? 393  LEU A CD2 1 
ATOM   1983 N  N   . THR A 1 318 ? -12.360 -12.902 -15.508 1.00 26.40 ? 394  THR A N   1 
ATOM   1984 C  CA  . THR A 1 318 ? -12.219 -14.255 -16.038 1.00 26.21 ? 394  THR A CA  1 
ATOM   1985 C  C   . THR A 1 318 ? -11.176 -14.332 -17.145 1.00 28.66 ? 394  THR A C   1 
ATOM   1986 O  O   . THR A 1 318 ? -10.643 -15.416 -17.397 1.00 28.43 ? 394  THR A O   1 
ATOM   1987 C  CB  . THR A 1 318 ? -13.549 -14.798 -16.575 1.00 26.53 ? 394  THR A CB  1 
ATOM   1988 O  OG1 . THR A 1 318 ? -13.927 -14.077 -17.750 1.00 26.24 ? 394  THR A OG1 1 
ATOM   1989 C  CG2 . THR A 1 318 ? -14.653 -14.693 -15.528 1.00 25.46 ? 394  THR A CG2 1 
ATOM   1990 N  N   . THR A 1 319 ? -10.860 -13.211 -17.800 1.00 28.37 ? 395  THR A N   1 
ATOM   1991 C  CA  . THR A 1 319 ? -9.914  -13.251 -18.908 1.00 30.25 ? 395  THR A CA  1 
ATOM   1992 C  C   . THR A 1 319 ? -8.456  -13.191 -18.459 1.00 31.20 ? 395  THR A C   1 
ATOM   1993 O  O   . THR A 1 319 ? -7.570  -13.510 -19.260 1.00 30.35 ? 395  THR A O   1 
ATOM   1994 C  CB  . THR A 1 319 ? -10.193 -12.112 -19.898 1.00 30.39 ? 395  THR A CB  1 
ATOM   1995 O  OG1 . THR A 1 319 ? -9.841  -10.851 -19.313 1.00 29.45 ? 395  THR A OG1 1 
ATOM   1996 C  CG2 . THR A 1 319 ? -11.668 -12.094 -20.284 1.00 27.92 ? 395  THR A CG2 1 
ATOM   1997 N  N   . GLU A 1 320 ? -8.176  -12.811 -17.210 1.00 28.83 ? 396  GLU A N   1 
ATOM   1998 C  CA  . GLU A 1 320 ? -6.796  -12.665 -16.743 1.00 29.20 ? 396  GLU A CA  1 
ATOM   1999 C  C   . GLU A 1 320 ? -6.633  -13.252 -15.347 1.00 30.37 ? 396  GLU A C   1 
ATOM   2000 O  O   . GLU A 1 320 ? -6.829  -12.560 -14.339 1.00 27.14 ? 396  GLU A O   1 
ATOM   2001 C  CB  . GLU A 1 320 ? -6.351  -11.201 -16.767 1.00 28.17 ? 396  GLU A CB  1 
ATOM   2002 C  CG  . GLU A 1 320 ? -6.285  -10.569 -18.164 1.00 29.03 ? 396  GLU A CG  1 
ATOM   2003 C  CD  . GLU A 1 320 ? -5.227  -11.198 -19.069 1.00 32.98 ? 396  GLU A CD  1 
ATOM   2004 O  OE1 . GLU A 1 320 ? -4.364  -11.956 -18.568 1.00 33.25 ? 396  GLU A OE1 1 
ATOM   2005 O  OE2 . GLU A 1 320 ? -5.257  -10.930 -20.290 1.00 31.21 ? 396  GLU A OE2 1 
ATOM   2006 N  N   . PRO A 1 321 ? -6.253  -14.531 -15.251 1.00 32.97 ? 397  PRO A N   1 
ATOM   2007 C  CA  . PRO A 1 321 ? -6.049  -15.141 -13.924 1.00 34.06 ? 397  PRO A CA  1 
ATOM   2008 C  C   . PRO A 1 321 ? -5.017  -14.423 -13.070 1.00 33.92 ? 397  PRO A C   1 
ATOM   2009 O  O   . PRO A 1 321 ? -5.181  -14.369 -11.845 1.00 32.93 ? 397  PRO A O   1 
ATOM   2010 C  CB  . PRO A 1 321 ? -5.599  -16.572 -14.260 1.00 37.17 ? 397  PRO A CB  1 
ATOM   2011 C  CG  . PRO A 1 321 ? -6.123  -16.830 -15.642 1.00 36.16 ? 397  PRO A CG  1 
ATOM   2012 C  CD  . PRO A 1 321 ? -6.100  -15.502 -16.349 1.00 32.64 ? 397  PRO A CD  1 
ATOM   2013 N  N   . SER A 1 322 ? -3.961  -13.866 -13.669 1.00 33.77 ? 398  SER A N   1 
ATOM   2014 C  CA  . SER A 1 322 ? -2.944  -13.196 -12.863 1.00 33.59 ? 398  SER A CA  1 
ATOM   2015 C  C   . SER A 1 322 ? -3.490  -11.942 -12.191 1.00 31.29 ? 398  SER A C   1 
ATOM   2016 O  O   . SER A 1 322 ? -3.026  -11.573 -11.107 1.00 31.61 ? 398  SER A O   1 
ATOM   2017 C  CB  . SER A 1 322 ? -1.728  -12.849 -13.719 1.00 37.85 ? 398  SER A CB  1 
ATOM   2018 O  OG  . SER A 1 322 ? -2.026  -11.801 -14.624 1.00 40.40 ? 398  SER A OG  1 
ATOM   2019 N  N   . VAL A 1 323 ? -4.468  -11.277 -12.809 1.00 27.94 ? 399  VAL A N   1 
ATOM   2020 C  CA  . VAL A 1 323 ? -5.090  -10.122 -12.169 1.00 26.76 ? 399  VAL A CA  1 
ATOM   2021 C  C   . VAL A 1 323 ? -5.952  -10.566 -10.991 1.00 26.84 ? 399  VAL A C   1 
ATOM   2022 O  O   . VAL A 1 323 ? -5.956  -9.929  -9.929  1.00 26.79 ? 399  VAL A O   1 
ATOM   2023 C  CB  . VAL A 1 323 ? -5.903  -9.316  -13.196 1.00 27.75 ? 399  VAL A CB  1 
ATOM   2024 C  CG1 . VAL A 1 323 ? -6.689  -8.212  -12.498 1.00 24.23 ? 399  VAL A CG1 1 
ATOM   2025 C  CG2 . VAL A 1 323 ? -4.980  -8.735  -14.269 1.00 27.47 ? 399  VAL A CG2 1 
ATOM   2026 N  N   . VAL A 1 324 ? -6.688  -11.669 -11.156 1.00 27.63 ? 400  VAL A N   1 
ATOM   2027 C  CA  . VAL A 1 324 ? -7.512  -12.192 -10.067 1.00 28.06 ? 400  VAL A CA  1 
ATOM   2028 C  C   . VAL A 1 324 ? -6.641  -12.589 -8.880  1.00 29.03 ? 400  VAL A C   1 
ATOM   2029 O  O   . VAL A 1 324 ? -6.985  -12.318 -7.722  1.00 30.05 ? 400  VAL A O   1 
ATOM   2030 C  CB  . VAL A 1 324 ? -8.368  -13.372 -10.564 1.00 27.74 ? 400  VAL A CB  1 
ATOM   2031 C  CG1 . VAL A 1 324 ? -8.944  -14.158 -9.388  1.00 30.86 ? 400  VAL A CG1 1 
ATOM   2032 C  CG2 . VAL A 1 324 ? -9.484  -12.870 -11.481 1.00 26.45 ? 400  VAL A CG2 1 
ATOM   2033 N  N   . ALA A 1 325 ? -5.503  -13.235 -9.146  1.00 29.20 ? 401  ALA A N   1 
ATOM   2034 C  CA  . ALA A 1 325 ? -4.608  -13.626 -8.059  1.00 31.90 ? 401  ALA A CA  1 
ATOM   2035 C  C   . ALA A 1 325 ? -4.106  -12.406 -7.295  1.00 29.85 ? 401  ALA A C   1 
ATOM   2036 O  O   . ALA A 1 325 ? -4.086  -12.401 -6.059  1.00 30.01 ? 401  ALA A O   1 
ATOM   2037 C  CB  . ALA A 1 325 ? -3.432  -14.434 -8.606  1.00 32.35 ? 401  ALA A CB  1 
ATOM   2038 N  N   . LYS A 1 326 ? -3.708  -11.357 -8.019  1.00 29.77 ? 402  LYS A N   1 
ATOM   2039 C  CA  . LYS A 1 326 ? -3.217  -10.145 -7.374  1.00 32.38 ? 402  LYS A CA  1 
ATOM   2040 C  C   . LYS A 1 326 ? -4.336  -9.419  -6.634  1.00 31.00 ? 402  LYS A C   1 
ATOM   2041 O  O   . LYS A 1 326 ? -4.111  -8.839  -5.565  1.00 32.37 ? 402  LYS A O   1 
ATOM   2042 C  CB  . LYS A 1 326 ? -2.566  -9.237  -8.419  1.00 34.49 ? 402  LYS A CB  1 
ATOM   2043 C  CG  . LYS A 1 326 ? -1.693  -8.149  -7.837  1.00 42.25 ? 402  LYS A CG  1 
ATOM   2044 C  CD  . LYS A 1 326 ? -0.660  -7.672  -8.844  1.00 46.77 ? 402  LYS A CD  1 
ATOM   2045 C  CE  . LYS A 1 326 ? 0.238   -6.606  -8.231  1.00 50.62 ? 402  LYS A CE  1 
ATOM   2046 N  NZ  . LYS A 1 326 ? 1.351   -6.211  -9.139  1.00 52.64 ? 402  LYS A NZ  1 
ATOM   2047 N  N   . LEU A 1 327 ? -5.551  -9.455  -7.182  1.00 28.22 ? 403  LEU A N   1 
ATOM   2048 C  CA  . LEU A 1 327 ? -6.695  -8.857  -6.503  1.00 24.85 ? 403  LEU A CA  1 
ATOM   2049 C  C   . LEU A 1 327 ? -7.042  -9.618  -5.228  1.00 26.53 ? 403  LEU A C   1 
ATOM   2050 O  O   . LEU A 1 327 ? -7.295  -9.006  -4.183  1.00 25.48 ? 403  LEU A O   1 
ATOM   2051 C  CB  . LEU A 1 327 ? -7.889  -8.815  -7.457  1.00 24.46 ? 403  LEU A CB  1 
ATOM   2052 C  CG  . LEU A 1 327 ? -9.182  -8.140  -7.001  1.00 24.39 ? 403  LEU A CG  1 
ATOM   2053 C  CD1 . LEU A 1 327 ? -8.910  -6.722  -6.532  1.00 23.58 ? 403  LEU A CD1 1 
ATOM   2054 C  CD2 . LEU A 1 327 ? -10.199 -8.147  -8.133  1.00 22.53 ? 403  LEU A CD2 1 
ATOM   2055 N  N   . GLN A 1 328 ? -7.049  -10.954 -5.290  1.00 26.45 ? 404  GLN A N   1 
ATOM   2056 C  CA  . GLN A 1 328 ? -7.321  -11.751 -4.097  1.00 25.01 ? 404  GLN A CA  1 
ATOM   2057 C  C   . GLN A 1 328 ? -6.287  -11.483 -3.013  1.00 30.00 ? 404  GLN A C   1 
ATOM   2058 O  O   . GLN A 1 328 ? -6.615  -11.446 -1.821  1.00 29.77 ? 404  GLN A O   1 
ATOM   2059 C  CB  . GLN A 1 328 ? -7.345  -13.239 -4.451  1.00 26.01 ? 404  GLN A CB  1 
ATOM   2060 C  CG  . GLN A 1 328 ? -8.589  -13.687 -5.202  1.00 28.18 ? 404  GLN A CG  1 
ATOM   2061 C  CD  . GLN A 1 328 ? -8.453  -15.087 -5.772  1.00 31.41 ? 404  GLN A CD  1 
ATOM   2062 O  OE1 . GLN A 1 328 ? -7.347  -15.618 -5.895  1.00 31.97 ? 404  GLN A OE1 1 
ATOM   2063 N  NE2 . GLN A 1 328 ? -9.581  -15.693 -6.122  1.00 33.22 ? 404  GLN A NE2 1 
ATOM   2064 N  N   . GLU A 1 329 ? -5.030  -11.293 -3.414  1.00 33.00 ? 405  GLU A N   1 
ATOM   2065 C  CA  . GLU A 1 329 ? -3.965  -11.034 -2.452  1.00 34.71 ? 405  GLU A CA  1 
ATOM   2066 C  C   . GLU A 1 329 ? -4.210  -9.734  -1.693  1.00 32.46 ? 405  GLU A C   1 
ATOM   2067 O  O   . GLU A 1 329 ? -4.008  -9.670  -0.473  1.00 32.20 ? 405  GLU A O   1 
ATOM   2068 C  CB  . GLU A 1 329 ? -2.623  -10.999 -3.181  1.00 39.48 ? 405  GLU A CB  1 
ATOM   2069 C  CG  . GLU A 1 329 ? -1.418  -10.786 -2.300  1.00 50.06 ? 405  GLU A CG  1 
ATOM   2070 C  CD  . GLU A 1 329 ? -0.163  -11.375 -2.912  1.00 59.66 ? 405  GLU A CD  1 
ATOM   2071 O  OE1 . GLU A 1 329 ? 0.947   -10.966 -2.510  1.00 63.74 ? 405  GLU A OE1 1 
ATOM   2072 O  OE2 . GLU A 1 329 ? -0.291  -12.251 -3.796  1.00 62.34 ? 405  GLU A OE2 1 
ATOM   2073 N  N   . GLU A 1 330 ? -4.657  -8.691  -2.396  1.00 28.90 ? 406  GLU A N   1 
ATOM   2074 C  CA  . GLU A 1 330 ? -4.900  -7.410  -1.741  1.00 27.76 ? 406  GLU A CA  1 
ATOM   2075 C  C   . GLU A 1 330 ? -6.103  -7.478  -0.807  1.00 27.56 ? 406  GLU A C   1 
ATOM   2076 O  O   . GLU A 1 330 ? -6.036  -7.011  0.336   1.00 29.44 ? 406  GLU A O   1 
ATOM   2077 C  CB  . GLU A 1 330 ? -5.100  -6.306  -2.782  1.00 27.50 ? 406  GLU A CB  1 
ATOM   2078 C  CG  . GLU A 1 330 ? -5.601  -5.003  -2.172  1.00 25.56 ? 406  GLU A CG  1 
ATOM   2079 C  CD  . GLU A 1 330 ? -5.746  -3.883  -3.184  1.00 24.28 ? 406  GLU A CD  1 
ATOM   2080 O  OE1 . GLU A 1 330 ? -6.871  -3.676  -3.691  1.00 24.35 ? 406  GLU A OE1 1 
ATOM   2081 O  OE2 . GLU A 1 330 ? -4.735  -3.206  -3.468  1.00 25.40 ? 406  GLU A OE2 1 
ATOM   2082 N  N   . VAL A 1 331 ? -7.220  -8.047  -1.272  1.00 25.76 ? 407  VAL A N   1 
ATOM   2083 C  CA  . VAL A 1 331 ? -8.428  -8.035  -0.449  1.00 29.72 ? 407  VAL A CA  1 
ATOM   2084 C  C   . VAL A 1 331 ? -8.246  -8.903  0.793   1.00 29.30 ? 407  VAL A C   1 
ATOM   2085 O  O   . VAL A 1 331 ? -8.700  -8.541  1.885   1.00 30.47 ? 407  VAL A O   1 
ATOM   2086 C  CB  . VAL A 1 331 ? -9.662  -8.456  -1.269  1.00 30.46 ? 407  VAL A CB  1 
ATOM   2087 C  CG1 . VAL A 1 331 ? -9.886  -7.477  -2.425  1.00 30.83 ? 407  VAL A CG1 1 
ATOM   2088 C  CG2 . VAL A 1 331 ? -9.525  -9.881  -1.789  1.00 33.90 ? 407  VAL A CG2 1 
ATOM   2089 N  N   . ASP A 1 332 ? -7.572  -10.049 0.657   1.00 28.98 ? 408  ASP A N   1 
ATOM   2090 C  CA  . ASP A 1 332 ? -7.284  -10.875 1.826   1.00 29.24 ? 408  ASP A CA  1 
ATOM   2091 C  C   . ASP A 1 332 ? -6.429  -10.116 2.828   1.00 30.13 ? 408  ASP A C   1 
ATOM   2092 O  O   . ASP A 1 332 ? -6.614  -10.246 4.043   1.00 34.07 ? 408  ASP A O   1 
ATOM   2093 C  CB  . ASP A 1 332 ? -6.573  -12.161 1.412   1.00 30.87 ? 408  ASP A CB  1 
ATOM   2094 C  CG  . ASP A 1 332 ? -7.490  -13.140 0.718   1.00 32.49 ? 408  ASP A CG  1 
ATOM   2095 O  OD1 . ASP A 1 332 ? -8.719  -12.920 0.726   1.00 32.13 ? 408  ASP A OD1 1 
ATOM   2096 O  OD2 . ASP A 1 332 ? -6.970  -14.128 0.158   1.00 32.73 ? 408  ASP A OD2 1 
ATOM   2097 N  N   . SER A 1 333 ? -5.490  -9.315  2.332   1.00 28.43 ? 409  SER A N   1 
ATOM   2098 C  CA  . SER A 1 333 ? -4.550  -8.630  3.206   1.00 33.24 ? 409  SER A CA  1 
ATOM   2099 C  C   . SER A 1 333 ? -5.154  -7.364  3.807   1.00 32.22 ? 409  SER A C   1 
ATOM   2100 O  O   . SER A 1 333 ? -4.919  -7.063  4.983   1.00 30.76 ? 409  SER A O   1 
ATOM   2101 C  CB  . SER A 1 333 ? -3.275  -8.305  2.428   1.00 37.37 ? 409  SER A CB  1 
ATOM   2102 O  OG  . SER A 1 333 ? -2.387  -7.518  3.196   1.00 44.41 ? 409  SER A OG  1 
ATOM   2103 N  N   . VAL A 1 334 ? -5.943  -6.628  3.028   1.00 27.16 ? 410  VAL A N   1 
ATOM   2104 C  CA  . VAL A 1 334 ? -6.392  -5.295  3.433   1.00 27.75 ? 410  VAL A CA  1 
ATOM   2105 C  C   . VAL A 1 334 ? -7.697  -5.351  4.217   1.00 27.29 ? 410  VAL A C   1 
ATOM   2106 O  O   . VAL A 1 334 ? -7.811  -4.750  5.287   1.00 29.57 ? 410  VAL A O   1 
ATOM   2107 C  CB  . VAL A 1 334 ? -6.521  -4.377  2.197   1.00 26.68 ? 410  VAL A CB  1 
ATOM   2108 C  CG1 . VAL A 1 334 ? -7.213  -3.069  2.574   1.00 24.14 ? 410  VAL A CG1 1 
ATOM   2109 C  CG2 . VAL A 1 334 ? -5.147  -4.096  1.608   1.00 26.15 ? 410  VAL A CG2 1 
ATOM   2110 N  N   . ILE A 1 335 ? -8.713  -6.044  3.709   1.00 25.37 ? 411  ILE A N   1 
ATOM   2111 C  CA  . ILE A 1 335 ? -10.017 -6.037  4.360   1.00 26.79 ? 411  ILE A CA  1 
ATOM   2112 C  C   . ILE A 1 335 ? -10.419 -7.391  4.936   1.00 27.38 ? 411  ILE A C   1 
ATOM   2113 O  O   . ILE A 1 335 ? -11.223 -7.420  5.880   1.00 25.65 ? 411  ILE A O   1 
ATOM   2114 C  CB  . ILE A 1 335 ? -11.126 -5.514  3.419   1.00 26.10 ? 411  ILE A CB  1 
ATOM   2115 C  CG1 . ILE A 1 335 ? -11.263 -6.403  2.182   1.00 24.45 ? 411  ILE A CG1 1 
ATOM   2116 C  CG2 . ILE A 1 335 ? -10.878 -4.055  3.044   1.00 25.95 ? 411  ILE A CG2 1 
ATOM   2117 C  CD1 . ILE A 1 335 ? -12.608 -6.245  1.469   1.00 24.88 ? 411  ILE A CD1 1 
ATOM   2118 N  N   . GLY A 1 336 ? -9.899  -8.501  4.417   1.00 28.20 ? 412  GLY A N   1 
ATOM   2119 C  CA  . GLY A 1 336 ? -10.400 -9.795  4.858   1.00 28.68 ? 412  GLY A CA  1 
ATOM   2120 C  C   . GLY A 1 336 ? -11.914 -9.850  4.742   1.00 29.41 ? 412  GLY A C   1 
ATOM   2121 O  O   . GLY A 1 336 ? -12.490 -9.506  3.704   1.00 28.92 ? 412  GLY A O   1 
ATOM   2122 N  N   . ASP A 1 337 ? -12.579 -10.229 5.835   1.00 28.51 ? 413  ASP A N   1 
ATOM   2123 C  CA  . ASP A 1 337 ? -14.034 -10.335 5.879   1.00 26.20 ? 413  ASP A CA  1 
ATOM   2124 C  C   . ASP A 1 337 ? -14.727 -9.030  6.265   1.00 25.84 ? 413  ASP A C   1 
ATOM   2125 O  O   . ASP A 1 337 ? -15.948 -9.026  6.456   1.00 26.53 ? 413  ASP A O   1 
ATOM   2126 C  CB  . ASP A 1 337 ? -14.448 -11.440 6.856   1.00 24.39 ? 413  ASP A CB  1 
ATOM   2127 C  CG  . ASP A 1 337 ? -13.968 -12.808 6.415   1.00 28.99 ? 413  ASP A CG  1 
ATOM   2128 O  OD1 . ASP A 1 337 ? -13.924 -13.050 5.189   1.00 28.01 ? 413  ASP A OD1 1 
ATOM   2129 O  OD2 . ASP A 1 337 ? -13.631 -13.637 7.289   1.00 31.82 ? 413  ASP A OD2 1 
ATOM   2130 N  N   . ARG A 1 338 ? -13.988 -7.931  6.378   1.00 21.86 ? 414  ARG A N   1 
ATOM   2131 C  CA  . ARG A 1 338 ? -14.570 -6.689  6.867   1.00 23.42 ? 414  ARG A CA  1 
ATOM   2132 C  C   . ARG A 1 338 ? -15.447 -6.013  5.815   1.00 25.56 ? 414  ARG A C   1 
ATOM   2133 O  O   . ARG A 1 338 ? -15.237 -6.154  4.605   1.00 22.55 ? 414  ARG A O   1 
ATOM   2134 C  CB  . ARG A 1 338 ? -13.473 -5.711  7.290   1.00 23.23 ? 414  ARG A CB  1 
ATOM   2135 C  CG  . ARG A 1 338 ? -12.806 -6.024  8.622   1.00 27.80 ? 414  ARG A CG  1 
ATOM   2136 C  CD  . ARG A 1 338 ? -11.989 -4.832  9.124   1.00 31.38 ? 414  ARG A CD  1 
ATOM   2137 N  NE  . ARG A 1 338 ? -10.867 -4.504  8.248   1.00 33.61 ? 414  ARG A NE  1 
ATOM   2138 C  CZ  . ARG A 1 338 ? -10.856 -3.495  7.380   1.00 34.59 ? 414  ARG A CZ  1 
ATOM   2139 N  NH1 . ARG A 1 338 ? -11.914 -2.698  7.266   1.00 31.84 ? 414  ARG A NH1 1 
ATOM   2140 N  NH2 . ARG A 1 338 ? -9.783  -3.277  6.626   1.00 32.60 ? 414  ARG A NH2 1 
ATOM   2141 N  N   . PHE A 1 339 ? -16.436 -5.266  6.299   1.00 26.16 ? 415  PHE A N   1 
ATOM   2142 C  CA  . PHE A 1 339 ? -17.074 -4.227  5.493   1.00 24.68 ? 415  PHE A CA  1 
ATOM   2143 C  C   . PHE A 1 339 ? -16.054 -3.123  5.252   1.00 23.13 ? 415  PHE A C   1 
ATOM   2144 O  O   . PHE A 1 339 ? -15.530 -2.564  6.226   1.00 24.18 ? 415  PHE A O   1 
ATOM   2145 C  CB  . PHE A 1 339 ? -18.293 -3.632  6.200   1.00 22.45 ? 415  PHE A CB  1 
ATOM   2146 C  CG  . PHE A 1 339 ? -19.369 -4.624  6.528   1.00 24.94 ? 415  PHE A CG  1 
ATOM   2147 C  CD1 . PHE A 1 339 ? -20.264 -5.046  5.556   1.00 24.23 ? 415  PHE A CD1 1 
ATOM   2148 C  CD2 . PHE A 1 339 ? -19.514 -5.104  7.822   1.00 26.46 ? 415  PHE A CD2 1 
ATOM   2149 C  CE1 . PHE A 1 339 ? -21.268 -5.946  5.862   1.00 26.19 ? 415  PHE A CE1 1 
ATOM   2150 C  CE2 . PHE A 1 339 ? -20.517 -6.005  8.138   1.00 26.83 ? 415  PHE A CE2 1 
ATOM   2151 C  CZ  . PHE A 1 339 ? -21.396 -6.429  7.155   1.00 27.02 ? 415  PHE A CZ  1 
ATOM   2152 N  N   . PRO A 1 340 ? -15.741 -2.772  4.005   1.00 22.77 ? 416  PRO A N   1 
ATOM   2153 C  CA  . PRO A 1 340 ? -14.784 -1.682  3.773   1.00 23.88 ? 416  PRO A CA  1 
ATOM   2154 C  C   . PRO A 1 340 ? -15.250 -0.382  4.414   1.00 25.77 ? 416  PRO A C   1 
ATOM   2155 O  O   . PRO A 1 340 ? -16.447 -0.127  4.567   1.00 24.73 ? 416  PRO A O   1 
ATOM   2156 C  CB  . PRO A 1 340 ? -14.737 -1.561  2.245   1.00 23.33 ? 416  PRO A CB  1 
ATOM   2157 C  CG  . PRO A 1 340 ? -15.214 -2.894  1.738   1.00 22.31 ? 416  PRO A CG  1 
ATOM   2158 C  CD  . PRO A 1 340 ? -16.223 -3.371  2.748   1.00 20.40 ? 416  PRO A CD  1 
ATOM   2159 N  N   . THR A 1 341 ? -14.284 0.438   4.797   1.00 23.69 ? 417  THR A N   1 
ATOM   2160 C  CA  . THR A 1 341 ? -14.549 1.770   5.315   1.00 27.51 ? 417  THR A CA  1 
ATOM   2161 C  C   . THR A 1 341 ? -13.953 2.799   4.364   1.00 27.91 ? 417  THR A C   1 
ATOM   2162 O  O   . THR A 1 341 ? -13.287 2.459   3.383   1.00 27.14 ? 417  THR A O   1 
ATOM   2163 C  CB  . THR A 1 341 ? -13.971 1.943   6.721   1.00 30.16 ? 417  THR A CB  1 
ATOM   2164 O  OG1 . THR A 1 341 ? -12.540 1.947   6.640   1.00 34.97 ? 417  THR A OG1 1 
ATOM   2165 C  CG2 . THR A 1 341 ? -14.429 0.809   7.628   1.00 29.46 ? 417  THR A CG2 1 
ATOM   2166 N  N   . ILE A 1 342 ? -14.195 4.073   4.676   1.00 30.10 ? 418  ILE A N   1 
ATOM   2167 C  CA  . ILE A 1 342 ? -13.606 5.152   3.890   1.00 31.63 ? 418  ILE A CA  1 
ATOM   2168 C  C   . ILE A 1 342 ? -12.084 5.035   3.884   1.00 30.50 ? 418  ILE A C   1 
ATOM   2169 O  O   . ILE A 1 342 ? -11.435 5.269   2.857   1.00 27.51 ? 418  ILE A O   1 
ATOM   2170 C  CB  . ILE A 1 342 ? -14.090 6.517   4.420   1.00 32.20 ? 418  ILE A CB  1 
ATOM   2171 C  CG1 . ILE A 1 342 ? -13.486 7.663   3.609   1.00 33.36 ? 418  ILE A CG1 1 
ATOM   2172 C  CG2 . ILE A 1 342 ? -13.793 6.666   5.902   1.00 33.29 ? 418  ILE A CG2 1 
ATOM   2173 C  CD1 . ILE A 1 342 ? -13.886 7.636   2.152   1.00 33.24 ? 418  ILE A CD1 1 
ATOM   2174 N  N   . GLN A 1 343 ? -11.492 4.621   5.012   1.00 28.68 ? 419  GLN A N   1 
ATOM   2175 C  CA  . GLN A 1 343 ? -10.039 4.459   5.063   1.00 31.76 ? 419  GLN A CA  1 
ATOM   2176 C  C   . GLN A 1 343 ? -9.557  3.366   4.117   1.00 31.05 ? 419  GLN A C   1 
ATOM   2177 O  O   . GLN A 1 343 ? -8.446  3.455   3.581   1.00 33.03 ? 419  GLN A O   1 
ATOM   2178 C  CB  . GLN A 1 343 ? -9.580  4.148   6.490   1.00 37.92 ? 419  GLN A CB  1 
ATOM   2179 C  CG  . GLN A 1 343 ? -9.673  5.317   7.461   1.00 41.92 ? 419  GLN A CG  1 
ATOM   2180 C  CD  . GLN A 1 343 ? -11.083 5.556   7.963   0.27 42.53 ? 419  GLN A CD  1 
ATOM   2181 O  OE1 . GLN A 1 343 ? -11.954 4.695   7.839   0.89 40.63 ? 419  GLN A OE1 1 
ATOM   2182 N  NE2 . GLN A 1 343 ? -11.315 6.733   8.536   0.82 44.90 ? 419  GLN A NE2 1 
ATOM   2183 N  N   . ASP A 1 344 ? -10.368 2.328   3.905   1.00 28.92 ? 420  ASP A N   1 
ATOM   2184 C  CA  . ASP A 1 344 ? -9.986  1.250   3.001   1.00 27.71 ? 420  ASP A CA  1 
ATOM   2185 C  C   . ASP A 1 344 ? -9.954  1.686   1.541   1.00 28.43 ? 420  ASP A C   1 
ATOM   2186 O  O   . ASP A 1 344 ? -9.288  1.035   0.729   1.00 28.44 ? 420  ASP A O   1 
ATOM   2187 C  CB  . ASP A 1 344 ? -10.943 0.070   3.159   1.00 26.12 ? 420  ASP A CB  1 
ATOM   2188 C  CG  . ASP A 1 344 ? -10.839 -0.583  4.524   1.00 30.08 ? 420  ASP A CG  1 
ATOM   2189 O  OD1 . ASP A 1 344 ? -9.700  -0.766  5.007   1.00 30.52 ? 420  ASP A OD1 1 
ATOM   2190 O  OD2 . ASP A 1 344 ? -11.894 -0.910  5.110   1.00 30.00 ? 420  ASP A OD2 1 
ATOM   2191 N  N   . MET A 1 345 ? -10.661 2.761   1.185   1.00 28.75 ? 421  MET A N   1 
ATOM   2192 C  CA  . MET A 1 345 ? -10.690 3.177   -0.214  1.00 29.15 ? 421  MET A CA  1 
ATOM   2193 C  C   . MET A 1 345 ? -9.302  3.562   -0.713  1.00 30.31 ? 421  MET A C   1 
ATOM   2194 O  O   . MET A 1 345 ? -8.984  3.343   -1.886  1.00 29.70 ? 421  MET A O   1 
ATOM   2195 C  CB  . MET A 1 345 ? -11.668 4.337   -0.403  1.00 29.07 ? 421  MET A CB  1 
ATOM   2196 C  CG  . MET A 1 345 ? -13.125 4.012   -0.066  1.00 27.18 ? 421  MET A CG  1 
ATOM   2197 S  SD  . MET A 1 345 ? -13.826 2.683   -1.073  1.00 28.05 ? 421  MET A SD  1 
ATOM   2198 C  CE  . MET A 1 345 ? -13.768 1.310   0.086   1.00 24.76 ? 421  MET A CE  1 
ATOM   2199 N  N   . LYS A 1 346 ? -8.460  4.132   0.153   1.00 28.33 ? 422  LYS A N   1 
ATOM   2200 C  CA  . LYS A 1 346 ? -7.099  4.462   -0.260  1.00 33.89 ? 422  LYS A CA  1 
ATOM   2201 C  C   . LYS A 1 346 ? -6.180  3.248   -0.230  1.00 31.58 ? 422  LYS A C   1 
ATOM   2202 O  O   . LYS A 1 346 ? -5.189  3.212   -0.967  1.00 32.10 ? 422  LYS A O   1 
ATOM   2203 C  CB  . LYS A 1 346 ? -6.524  5.568   0.628   1.00 42.75 ? 422  LYS A CB  1 
ATOM   2204 C  CG  . LYS A 1 346 ? -7.039  6.960   0.291   1.00 50.76 ? 422  LYS A CG  1 
ATOM   2205 C  CD  . LYS A 1 346 ? -6.469  8.013   1.235   1.00 58.24 ? 422  LYS A CD  1 
ATOM   2206 C  CE  . LYS A 1 346 ? -7.048  9.394   0.947   1.00 62.24 ? 422  LYS A CE  1 
ATOM   2207 N  NZ  . LYS A 1 346 ? -6.793  9.838   -0.455  1.00 63.73 ? 422  LYS A NZ  1 
ATOM   2208 N  N   . LYS A 1 347 ? -6.491  2.253   0.601   1.00 28.37 ? 423  LYS A N   1 
ATOM   2209 C  CA  . LYS A 1 347 ? -5.635  1.078   0.717   1.00 30.23 ? 423  LYS A CA  1 
ATOM   2210 C  C   . LYS A 1 347 ? -5.946  0.022   -0.342  1.00 30.47 ? 423  LYS A C   1 
ATOM   2211 O  O   . LYS A 1 347 ? -5.069  -0.781  -0.682  1.00 29.22 ? 423  LYS A O   1 
ATOM   2212 C  CB  . LYS A 1 347 ? -5.762  0.484   2.122   1.00 31.89 ? 423  LYS A CB  1 
ATOM   2213 C  CG  . LYS A 1 347 ? -5.220  1.398   3.211   1.00 29.98 ? 423  LYS A CG  1 
ATOM   2214 C  CD  . LYS A 1 347 ? -5.988  1.245   4.527   0.75 35.45 ? 423  LYS A CD  1 
ATOM   2215 C  CE  . LYS A 1 347 ? -5.799  -0.124  5.153   0.55 37.25 ? 423  LYS A CE  1 
ATOM   2216 N  NZ  . LYS A 1 347 ? -6.526  -0.244  6.457   0.94 38.88 ? 423  LYS A NZ  1 
ATOM   2217 N  N   . LEU A 1 348 ? -7.173  -0.006  -0.868  1.00 27.32 ? 424  LEU A N   1 
ATOM   2218 C  CA  . LEU A 1 348 ? -7.554  -0.972  -1.898  1.00 25.96 ? 424  LEU A CA  1 
ATOM   2219 C  C   . LEU A 1 348 ? -7.088  -0.483  -3.275  1.00 27.03 ? 424  LEU A C   1 
ATOM   2220 O  O   . LEU A 1 348 ? -7.870  -0.240  -4.194  1.00 23.27 ? 424  LEU A O   1 
ATOM   2221 C  CB  . LEU A 1 348 ? -9.059  -1.217  -1.860  1.00 23.85 ? 424  LEU A CB  1 
ATOM   2222 C  CG  . LEU A 1 348 ? -9.602  -2.015  -0.664  1.00 25.06 ? 424  LEU A CG  1 
ATOM   2223 C  CD1 . LEU A 1 348 ? -11.129 -2.080  -0.700  1.00 24.10 ? 424  LEU A CD1 1 
ATOM   2224 C  CD2 . LEU A 1 348 ? -9.013  -3.422  -0.612  1.00 23.83 ? 424  LEU A CD2 1 
ATOM   2225 N  N   . LYS A 1 349 ? -5.765  -0.340  -3.394  1.00 27.50 ? 425  LYS A N   1 
ATOM   2226 C  CA  . LYS A 1 349 ? -5.181  0.293   -4.572  1.00 27.98 ? 425  LYS A CA  1 
ATOM   2227 C  C   . LYS A 1 349 ? -5.367  -0.563  -5.817  1.00 27.59 ? 425  LYS A C   1 
ATOM   2228 O  O   . LYS A 1 349 ? -5.720  -0.044  -6.882  1.00 27.59 ? 425  LYS A O   1 
ATOM   2229 C  CB  . LYS A 1 349 ? -3.697  0.575   -4.339  1.00 30.09 ? 425  LYS A CB  1 
ATOM   2230 C  CG  . LYS A 1 349 ? -3.419  1.574   -3.226  0.88 33.36 ? 425  LYS A CG  1 
ATOM   2231 C  CD  . LYS A 1 349 ? -1.935  1.888   -3.123  1.00 36.91 ? 425  LYS A CD  1 
ATOM   2232 C  CE  . LYS A 1 349 ? -1.674  2.961   -2.073  0.76 40.65 ? 425  LYS A CE  1 
ATOM   2233 N  NZ  . LYS A 1 349 ? -0.238  3.361   -2.018  0.87 44.08 ? 425  LYS A NZ  1 
ATOM   2234 N  N   . TYR A 1 350 ? -5.133  -1.872  -5.711  1.00 27.37 ? 426  TYR A N   1 
ATOM   2235 C  CA  . TYR A 1 350 ? -5.288  -2.726  -6.884  1.00 26.57 ? 426  TYR A CA  1 
ATOM   2236 C  C   . TYR A 1 350 ? -6.755  -2.863  -7.273  1.00 26.79 ? 426  TYR A C   1 
ATOM   2237 O  O   . TYR A 1 350 ? -7.085  -2.878  -8.465  1.00 28.11 ? 426  TYR A O   1 
ATOM   2238 C  CB  . TYR A 1 350 ? -4.662  -4.098  -6.639  1.00 27.36 ? 426  TYR A CB  1 
ATOM   2239 C  CG  . TYR A 1 350 ? -4.429  -4.872  -7.919  1.00 28.11 ? 426  TYR A CG  1 
ATOM   2240 C  CD1 . TYR A 1 350 ? -3.318  -4.615  -8.715  1.00 30.76 ? 426  TYR A CD1 1 
ATOM   2241 C  CD2 . TYR A 1 350 ? -5.328  -5.845  -8.341  1.00 24.54 ? 426  TYR A CD2 1 
ATOM   2242 C  CE1 . TYR A 1 350 ? -3.101  -5.311  -9.894  1.00 30.16 ? 426  TYR A CE1 1 
ATOM   2243 C  CE2 . TYR A 1 350 ? -5.119  -6.552  -9.517  1.00 24.55 ? 426  TYR A CE2 1 
ATOM   2244 C  CZ  . TYR A 1 350 ? -4.003  -6.277  -10.289 1.00 28.26 ? 426  TYR A CZ  1 
ATOM   2245 O  OH  . TYR A 1 350 ? -3.789  -6.970  -11.454 1.00 29.43 ? 426  TYR A OH  1 
ATOM   2246 N  N   . THR A 1 351 ? -7.651  -2.960  -6.285  1.00 24.83 ? 427  THR A N   1 
ATOM   2247 C  CA  . THR A 1 351 ? -9.079  -2.971  -6.588  1.00 23.01 ? 427  THR A CA  1 
ATOM   2248 C  C   . THR A 1 351 ? -9.481  -1.717  -7.356  1.00 24.33 ? 427  THR A C   1 
ATOM   2249 O  O   . THR A 1 351 ? -10.245 -1.789  -8.326  1.00 23.09 ? 427  THR A O   1 
ATOM   2250 C  CB  . THR A 1 351 ? -9.901  -3.088  -5.303  1.00 22.54 ? 427  THR A CB  1 
ATOM   2251 O  OG1 . THR A 1 351 ? -9.406  -4.172  -4.505  1.00 23.16 ? 427  THR A OG1 1 
ATOM   2252 C  CG2 . THR A 1 351 ? -11.362 -3.344  -5.637  1.00 22.96 ? 427  THR A CG2 1 
ATOM   2253 N  N   . THR A 1 352 ? -8.965  -0.559  -6.942  1.00 24.91 ? 428  THR A N   1 
ATOM   2254 C  CA  . THR A 1 352 ? -9.258  0.681   -7.654  1.00 23.03 ? 428  THR A CA  1 
ATOM   2255 C  C   . THR A 1 352 ? -8.803  0.598   -9.110  1.00 21.10 ? 428  THR A C   1 
ATOM   2256 O  O   . THR A 1 352 ? -9.544  0.976   -10.025 1.00 21.23 ? 428  THR A O   1 
ATOM   2257 C  CB  . THR A 1 352 ? -8.593  1.858   -6.939  1.00 27.12 ? 428  THR A CB  1 
ATOM   2258 O  OG1 . THR A 1 352 ? -9.040  1.904   -5.577  1.00 25.24 ? 428  THR A OG1 1 
ATOM   2259 C  CG2 . THR A 1 352 ? -8.939  3.175   -7.626  1.00 28.77 ? 428  THR A CG2 1 
ATOM   2260 N  N   . ARG A 1 353 ? -7.590  0.087   -9.343  1.00 22.06 ? 429  ARG A N   1 
ATOM   2261 C  CA  . ARG A 1 353 ? -7.063  0.003   -10.703 1.00 24.25 ? 429  ARG A CA  1 
ATOM   2262 C  C   . ARG A 1 353 ? -7.877  -0.956  -11.565 1.00 24.85 ? 429  ARG A C   1 
ATOM   2263 O  O   . ARG A 1 353 ? -8.066  -0.712  -12.764 1.00 24.59 ? 429  ARG A O   1 
ATOM   2264 C  CB  . ARG A 1 353 ? -5.601  -0.431  -10.675 1.00 25.97 ? 429  ARG A CB  1 
ATOM   2265 C  CG  . ARG A 1 353 ? -4.656  0.616   -10.142 1.00 29.03 ? 429  ARG A CG  1 
ATOM   2266 C  CD  . ARG A 1 353 ? -4.433  1.752   -11.135 1.00 30.65 ? 429  ARG A CD  1 
ATOM   2267 N  NE  . ARG A 1 353 ? -3.536  2.746   -10.554 1.00 31.27 ? 429  ARG A NE  1 
ATOM   2268 C  CZ  . ARG A 1 353 ? -3.946  3.768   -9.812  1.00 29.32 ? 429  ARG A CZ  1 
ATOM   2269 N  NH1 . ARG A 1 353 ? -5.241  3.943   -9.582  1.00 27.46 ? 429  ARG A NH1 1 
ATOM   2270 N  NH2 . ARG A 1 353 ? -3.063  4.616   -9.302  1.00 29.41 ? 429  ARG A NH2 1 
ATOM   2271 N  N   . VAL A 1 354 ? -8.341  -2.061  -10.981 1.00 24.69 ? 430  VAL A N   1 
ATOM   2272 C  CA  . VAL A 1 354 ? -9.211  -2.982  -11.711 1.00 24.36 ? 430  VAL A CA  1 
ATOM   2273 C  C   . VAL A 1 354 ? -10.474 -2.261  -12.161 1.00 25.57 ? 430  VAL A C   1 
ATOM   2274 O  O   . VAL A 1 354 ? -10.917 -2.393  -13.309 1.00 21.90 ? 430  VAL A O   1 
ATOM   2275 C  CB  . VAL A 1 354 ? -9.540  -4.209  -10.840 1.00 23.63 ? 430  VAL A CB  1 
ATOM   2276 C  CG1 . VAL A 1 354 ? -10.767 -4.929  -11.370 1.00 22.24 ? 430  VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A 1 354 ? -8.338  -5.150  -10.765 1.00 23.42 ? 430  VAL A CG2 1 
ATOM   2278 N  N   . MET A 1 355 ? -11.065 -1.473  -11.259 1.00 25.12 ? 431  MET A N   1 
ATOM   2279 C  CA  . MET A 1 355 ? -12.225 -0.666  -11.618 1.00 25.47 ? 431  MET A CA  1 
ATOM   2280 C  C   . MET A 1 355 ? -11.869 0.382   -12.664 1.00 22.24 ? 431  MET A C   1 
ATOM   2281 O  O   . MET A 1 355 ? -12.621 0.582   -13.627 1.00 20.72 ? 431  MET A O   1 
ATOM   2282 C  CB  . MET A 1 355 ? -12.810 0.005   -10.378 1.00 24.69 ? 431  MET A CB  1 
ATOM   2283 C  CG  . MET A 1 355 ? -13.945 0.948   -10.705 1.00 33.05 ? 431  MET A CG  1 
ATOM   2284 S  SD  . MET A 1 355 ? -14.224 2.161   -9.420  1.00 43.99 ? 431  MET A SD  1 
ATOM   2285 C  CE  . MET A 1 355 ? -12.653 3.025   -9.432  1.00 41.57 ? 431  MET A CE  1 
ATOM   2286 N  N   . ASN A 1 356 ? -10.736 1.073   -12.486 1.00 22.56 ? 432  ASN A N   1 
ATOM   2287 C  CA  . ASN A 1 356 ? -10.302 2.051   -13.484 1.00 23.14 ? 432  ASN A CA  1 
ATOM   2288 C  C   . ASN A 1 356 ? -10.202 1.409   -14.861 1.00 23.69 ? 432  ASN A C   1 
ATOM   2289 O  O   . ASN A 1 356 ? -10.692 1.956   -15.858 1.00 26.08 ? 432  ASN A O   1 
ATOM   2290 C  CB  . ASN A 1 356 ? -8.944  2.650   -13.115 1.00 23.33 ? 432  ASN A CB  1 
ATOM   2291 C  CG  . ASN A 1 356 ? -8.943  3.376   -11.788 1.00 23.37 ? 432  ASN A CG  1 
ATOM   2292 O  OD1 . ASN A 1 356 ? -7.945  3.344   -11.071 1.00 26.14 ? 432  ASN A OD1 1 
ATOM   2293 N  ND2 . ASN A 1 356 ? -10.045 4.044   -11.459 1.00 22.47 ? 432  ASN A ND2 1 
ATOM   2294 N  N   . GLU A 1 357 ? -9.554  0.245   -14.932 1.00 23.07 ? 433  GLU A N   1 
ATOM   2295 C  CA  . GLU A 1 357 ? -9.305  -0.402  -16.217 1.00 24.31 ? 433  GLU A CA  1 
ATOM   2296 C  C   . GLU A 1 357 ? -10.584 -0.970  -16.823 1.00 24.10 ? 433  GLU A C   1 
ATOM   2297 O  O   . GLU A 1 357 ? -10.730 -0.993  -18.052 1.00 25.60 ? 433  GLU A O   1 
ATOM   2298 C  CB  . GLU A 1 357 ? -8.246  -1.494  -16.040 1.00 23.36 ? 433  GLU A CB  1 
ATOM   2299 C  CG  . GLU A 1 357 ? -7.927  -2.312  -17.285 1.00 23.37 ? 433  GLU A CG  1 
ATOM   2300 C  CD  . GLU A 1 357 ? -7.062  -1.576  -18.294 1.00 25.80 ? 433  GLU A CD  1 
ATOM   2301 O  OE1 . GLU A 1 357 ? -7.133  -0.327  -18.371 1.00 26.20 ? 433  GLU A OE1 1 
ATOM   2302 O  OE2 . GLU A 1 357 ? -6.300  -2.256  -19.014 1.00 27.39 ? 433  GLU A OE2 1 
ATOM   2303 N  N   . SER A 1 358 ? -11.514 -1.438  -15.987 1.00 20.51 ? 434  SER A N   1 
ATOM   2304 C  CA  . SER A 1 358 ? -12.806 -1.884  -16.498 1.00 21.06 ? 434  SER A CA  1 
ATOM   2305 C  C   . SER A 1 358 ? -13.552 -0.734  -17.167 1.00 21.38 ? 434  SER A C   1 
ATOM   2306 O  O   . SER A 1 358 ? -14.109 -0.890  -18.261 1.00 21.59 ? 434  SER A O   1 
ATOM   2307 C  CB  . SER A 1 358 ? -13.647 -2.476  -15.369 1.00 21.54 ? 434  SER A CB  1 
ATOM   2308 O  OG  . SER A 1 358 ? -14.900 -2.926  -15.859 1.00 21.57 ? 434  SER A OG  1 
ATOM   2309 N  N   . LEU A 1 359 ? -13.572 0.433   -16.520 1.00 22.14 ? 435  LEU A N   1 
ATOM   2310 C  CA  . LEU A 1 359 ? -14.251 1.582   -17.111 1.00 22.30 ? 435  LEU A CA  1 
ATOM   2311 C  C   . LEU A 1 359 ? -13.551 2.062   -18.377 1.00 22.38 ? 435  LEU A C   1 
ATOM   2312 O  O   . LEU A 1 359 ? -14.207 2.609   -19.273 1.00 20.60 ? 435  LEU A O   1 
ATOM   2313 C  CB  . LEU A 1 359 ? -14.365 2.715   -16.089 1.00 21.67 ? 435  LEU A CB  1 
ATOM   2314 C  CG  . LEU A 1 359 ? -15.668 2.673   -15.284 1.00 21.78 ? 435  LEU A CG  1 
ATOM   2315 C  CD1 . LEU A 1 359 ? -15.567 3.513   -14.022 1.00 22.36 ? 435  LEU A CD1 1 
ATOM   2316 C  CD2 . LEU A 1 359 ? -16.843 3.129   -16.149 1.00 17.83 ? 435  LEU A CD2 1 
ATOM   2317 N  N   . ARG A 1 360 ? -12.235 1.863   -18.484 1.00 21.49 ? 436  ARG A N   1 
ATOM   2318 C  CA  . ARG A 1 360 ? -11.570 2.170   -19.745 1.00 23.76 ? 436  ARG A CA  1 
ATOM   2319 C  C   . ARG A 1 360 ? -12.076 1.256   -20.853 1.00 23.82 ? 436  ARG A C   1 
ATOM   2320 O  O   . ARG A 1 360 ? -12.502 1.722   -21.917 1.00 21.18 ? 436  ARG A O   1 
ATOM   2321 C  CB  . ARG A 1 360 ? -10.050 2.052   -19.611 1.00 24.28 ? 436  ARG A CB  1 
ATOM   2322 C  CG  . ARG A 1 360 ? -9.313  2.432   -20.909 1.00 23.41 ? 436  ARG A CG  1 
ATOM   2323 C  CD  . ARG A 1 360 ? -7.802  2.205   -20.842 1.00 21.68 ? 436  ARG A CD  1 
ATOM   2324 N  NE  . ARG A 1 360 ? -7.458  0.786   -20.819 1.00 22.91 ? 436  ARG A NE  1 
ATOM   2325 C  CZ  . ARG A 1 360 ? -7.320  0.031   -21.902 1.00 25.32 ? 436  ARG A CZ  1 
ATOM   2326 N  NH1 . ARG A 1 360 ? -7.498  0.558   -23.107 1.00 23.27 ? 436  ARG A NH1 1 
ATOM   2327 N  NH2 . ARG A 1 360 ? -7.006  -1.253  -21.783 1.00 25.48 ? 436  ARG A NH2 1 
ATOM   2328 N  N   . LEU A 1 361 ? -12.062 -0.054  -20.609 1.00 21.31 ? 437  LEU A N   1 
ATOM   2329 C  CA  . LEU A 1 361 ? -12.410 -1.002  -21.662 1.00 21.90 ? 437  LEU A CA  1 
ATOM   2330 C  C   . LEU A 1 361 ? -13.905 -1.005  -21.972 1.00 22.57 ? 437  LEU A C   1 
ATOM   2331 O  O   . LEU A 1 361 ? -14.292 -1.264  -23.118 1.00 22.82 ? 437  LEU A O   1 
ATOM   2332 C  CB  . LEU A 1 361 ? -11.930 -2.399  -21.274 1.00 21.61 ? 437  LEU A CB  1 
ATOM   2333 C  CG  . LEU A 1 361 ? -10.415 -2.588  -21.419 1.00 21.57 ? 437  LEU A CG  1 
ATOM   2334 C  CD1 . LEU A 1 361 ? -9.900  -3.714  -20.542 1.00 22.27 ? 437  LEU A CD1 1 
ATOM   2335 C  CD2 . LEU A 1 361 ? -10.057 -2.836  -22.892 1.00 20.60 ? 437  LEU A CD2 1 
ATOM   2336 N  N   . TYR A 1 362 ? -14.760 -0.725  -20.985 1.00 20.88 ? 438  TYR A N   1 
ATOM   2337 C  CA  . TYR A 1 362 ? -16.214 -0.740  -21.176 1.00 22.24 ? 438  TYR A CA  1 
ATOM   2338 C  C   . TYR A 1 362 ? -16.827 0.509   -20.554 1.00 22.13 ? 438  TYR A C   1 
ATOM   2339 O  O   . TYR A 1 362 ? -17.437 0.452   -19.474 1.00 19.24 ? 438  TYR A O   1 
ATOM   2340 C  CB  . TYR A 1 362 ? -16.829 -2.020  -20.608 1.00 22.09 ? 438  TYR A CB  1 
ATOM   2341 C  CG  . TYR A 1 362 ? -16.296 -3.254  -21.302 1.00 23.48 ? 438  TYR A CG  1 
ATOM   2342 C  CD1 . TYR A 1 362 ? -16.867 -3.712  -22.485 1.00 21.98 ? 438  TYR A CD1 1 
ATOM   2343 C  CD2 . TYR A 1 362 ? -15.200 -3.939  -20.796 1.00 22.76 ? 438  TYR A CD2 1 
ATOM   2344 C  CE1 . TYR A 1 362 ? -16.369 -4.826  -23.130 1.00 22.38 ? 438  TYR A CE1 1 
ATOM   2345 C  CE2 . TYR A 1 362 ? -14.700 -5.057  -21.434 1.00 22.94 ? 438  TYR A CE2 1 
ATOM   2346 C  CZ  . TYR A 1 362 ? -15.285 -5.492  -22.601 1.00 23.11 ? 438  TYR A CZ  1 
ATOM   2347 O  OH  . TYR A 1 362 ? -14.786 -6.603  -23.238 1.00 26.06 ? 438  TYR A OH  1 
ATOM   2348 N  N   . PRO A 1 363 ? -16.702 1.654   -21.224 1.00 19.03 ? 439  PRO A N   1 
ATOM   2349 C  CA  . PRO A 1 363 ? -17.251 2.898   -20.674 1.00 18.38 ? 439  PRO A CA  1 
ATOM   2350 C  C   . PRO A 1 363 ? -18.769 2.867   -20.641 1.00 20.14 ? 439  PRO A C   1 
ATOM   2351 O  O   . PRO A 1 363 ? -19.420 2.210   -21.455 1.00 20.06 ? 439  PRO A O   1 
ATOM   2352 C  CB  . PRO A 1 363 ? -16.738 3.972   -21.642 1.00 18.82 ? 439  PRO A CB  1 
ATOM   2353 C  CG  . PRO A 1 363 ? -16.508 3.230   -22.938 1.00 19.62 ? 439  PRO A CG  1 
ATOM   2354 C  CD  . PRO A 1 363 ? -16.034 1.859   -22.522 1.00 19.35 ? 439  PRO A CD  1 
ATOM   2355 N  N   . GLN A 1 364 ? -19.328 3.592   -19.675 1.00 20.37 ? 440  GLN A N   1 
ATOM   2356 C  CA  . GLN A 1 364 ? -20.774 3.654   -19.463 1.00 22.19 ? 440  GLN A CA  1 
ATOM   2357 C  C   . GLN A 1 364 ? -21.158 5.116   -19.279 1.00 22.60 ? 440  GLN A C   1 
ATOM   2358 O  O   . GLN A 1 364 ? -20.945 5.679   -18.191 1.00 26.25 ? 440  GLN A O   1 
ATOM   2359 C  CB  . GLN A 1 364 ? -21.191 2.832   -18.246 1.00 22.59 ? 440  GLN A CB  1 
ATOM   2360 C  CG  . GLN A 1 364 ? -20.531 1.462   -18.144 1.00 21.80 ? 440  GLN A CG  1 
ATOM   2361 C  CD  . GLN A 1 364 ? -20.987 0.512   -19.234 1.00 21.00 ? 440  GLN A CD  1 
ATOM   2362 O  OE1 . GLN A 1 364 ? -22.088 0.648   -19.768 1.00 19.28 ? 440  GLN A OE1 1 
ATOM   2363 N  NE2 . GLN A 1 364 ? -20.140 -0.460  -19.573 1.00 18.27 ? 440  GLN A NE2 1 
ATOM   2364 N  N   . PRO A 1 365 ? -21.711 5.777   -20.308 1.00 22.36 ? 441  PRO A N   1 
ATOM   2365 C  CA  . PRO A 1 365 ? -22.010 5.291   -21.660 1.00 19.47 ? 441  PRO A CA  1 
ATOM   2366 C  C   . PRO A 1 365 ? -20.777 5.219   -22.555 1.00 22.49 ? 441  PRO A C   1 
ATOM   2367 O  O   . PRO A 1 365 ? -19.773 5.864   -22.257 1.00 22.08 ? 441  PRO A O   1 
ATOM   2368 C  CB  . PRO A 1 365 ? -22.988 6.338   -22.189 1.00 22.37 ? 441  PRO A CB  1 
ATOM   2369 C  CG  . PRO A 1 365 ? -22.578 7.600   -21.485 1.00 21.67 ? 441  PRO A CG  1 
ATOM   2370 C  CD  . PRO A 1 365 ? -22.149 7.173   -20.116 1.00 22.67 ? 441  PRO A CD  1 
ATOM   2371 N  N   . PRO A 1 366 ? -20.848 4.434   -23.635 1.00 23.15 ? 442  PRO A N   1 
ATOM   2372 C  CA  . PRO A 1 366 ? -19.740 4.404   -24.599 1.00 22.26 ? 442  PRO A CA  1 
ATOM   2373 C  C   . PRO A 1 366 ? -19.671 5.626   -25.508 1.00 23.58 ? 442  PRO A C   1 
ATOM   2374 O  O   . PRO A 1 366 ? -18.647 5.809   -26.182 1.00 24.25 ? 442  PRO A O   1 
ATOM   2375 C  CB  . PRO A 1 366 ? -20.022 3.132   -25.410 1.00 22.11 ? 442  PRO A CB  1 
ATOM   2376 C  CG  . PRO A 1 366 ? -21.508 2.941   -25.296 1.00 21.37 ? 442  PRO A CG  1 
ATOM   2377 C  CD  . PRO A 1 366 ? -21.865 3.405   -23.920 1.00 21.95 ? 442  PRO A CD  1 
ATOM   2378 N  N   . VAL A 1 367 ? -20.717 6.454   -25.564 1.00 21.46 ? 443  VAL A N   1 
ATOM   2379 C  CA  . VAL A 1 367 ? -20.681 7.710   -26.306 1.00 23.02 ? 443  VAL A CA  1 
ATOM   2380 C  C   . VAL A 1 367 ? -21.306 8.815   -25.461 1.00 25.59 ? 443  VAL A C   1 
ATOM   2381 O  O   . VAL A 1 367 ? -22.210 8.576   -24.653 1.00 26.45 ? 443  VAL A O   1 
ATOM   2382 C  CB  . VAL A 1 367 ? -21.404 7.625   -27.676 1.00 23.84 ? 443  VAL A CB  1 
ATOM   2383 C  CG1 . VAL A 1 367 ? -20.886 6.458   -28.518 1.00 22.71 ? 443  VAL A CG1 1 
ATOM   2384 C  CG2 . VAL A 1 367 ? -22.908 7.528   -27.493 1.00 27.65 ? 443  VAL A CG2 1 
ATOM   2385 N  N   . LEU A 1 368 ? -20.804 10.033  -25.648 1.00 21.47 ? 444  LEU A N   1 
ATOM   2386 C  CA  . LEU A 1 368 ? -21.406 11.240  -25.103 1.00 19.66 ? 444  LEU A CA  1 
ATOM   2387 C  C   . LEU A 1 368 ? -22.007 12.042  -26.249 1.00 23.23 ? 444  LEU A C   1 
ATOM   2388 O  O   . LEU A 1 368 ? -21.474 12.051  -27.361 1.00 25.37 ? 444  LEU A O   1 
ATOM   2389 C  CB  . LEU A 1 368 ? -20.379 12.089  -24.349 1.00 19.62 ? 444  LEU A CB  1 
ATOM   2390 C  CG  . LEU A 1 368 ? -19.705 11.424  -23.147 1.00 23.50 ? 444  LEU A CG  1 
ATOM   2391 C  CD1 . LEU A 1 368 ? -18.609 12.321  -22.591 1.00 23.44 ? 444  LEU A CD1 1 
ATOM   2392 C  CD2 . LEU A 1 368 ? -20.737 11.102  -22.069 1.00 21.71 ? 444  LEU A CD2 1 
ATOM   2393 N  N   . ILE A 1 369 ? -23.120 12.718  -25.975 1.00 20.73 ? 445  ILE A N   1 
ATOM   2394 C  CA  . ILE A 1 369 ? -23.937 13.333  -27.015 1.00 19.71 ? 445  ILE A CA  1 
ATOM   2395 C  C   . ILE A 1 369 ? -23.988 14.834  -26.779 1.00 21.82 ? 445  ILE A C   1 
ATOM   2396 O  O   . ILE A 1 369 ? -24.230 15.281  -25.652 1.00 19.00 ? 445  ILE A O   1 
ATOM   2397 C  CB  . ILE A 1 369 ? -25.354 12.729  -27.043 1.00 21.47 ? 445  ILE A CB  1 
ATOM   2398 C  CG1 . ILE A 1 369 ? -25.274 11.225  -27.334 1.00 22.20 ? 445  ILE A CG1 1 
ATOM   2399 C  CG2 . ILE A 1 369 ? -26.230 13.429  -28.078 1.00 19.83 ? 445  ILE A CG2 1 
ATOM   2400 C  CD1 . ILE A 1 369 ? -26.608 10.524  -27.294 1.00 24.76 ? 445  ILE A CD1 1 
ATOM   2401 N  N   . ARG A 1 370 ? -23.767 15.607  -27.844 1.00 21.61 ? 446  ARG A N   1 
ATOM   2402 C  CA  . ARG A 1 370 ? -23.870 17.060  -27.805 1.00 20.31 ? 446  ARG A CA  1 
ATOM   2403 C  C   . ARG A 1 370 ? -24.484 17.549  -29.111 1.00 23.98 ? 446  ARG A C   1 
ATOM   2404 O  O   . ARG A 1 370 ? -24.588 16.809  -30.096 1.00 20.45 ? 446  ARG A O   1 
ATOM   2405 C  CB  . ARG A 1 370 ? -22.505 17.732  -27.591 1.00 20.38 ? 446  ARG A CB  1 
ATOM   2406 C  CG  . ARG A 1 370 ? -21.806 17.405  -26.258 1.00 19.83 ? 446  ARG A CG  1 
ATOM   2407 C  CD  . ARG A 1 370 ? -22.544 18.020  -25.089 1.00 21.06 ? 446  ARG A CD  1 
ATOM   2408 N  NE  . ARG A 1 370 ? -21.818 17.908  -23.822 1.00 22.28 ? 446  ARG A NE  1 
ATOM   2409 C  CZ  . ARG A 1 370 ? -21.904 16.869  -22.995 1.00 22.28 ? 446  ARG A CZ  1 
ATOM   2410 N  NH1 . ARG A 1 370 ? -22.671 15.829  -23.305 1.00 20.32 ? 446  ARG A NH1 1 
ATOM   2411 N  NH2 . ARG A 1 370 ? -21.223 16.869  -21.854 1.00 20.60 ? 446  ARG A NH2 1 
ATOM   2412 N  N   . ARG A 1 371 ? -24.893 18.815  -29.111 1.00 23.71 ? 447  ARG A N   1 
ATOM   2413 C  CA  . ARG A 1 371 ? -25.288 19.507  -30.329 1.00 21.60 ? 447  ARG A CA  1 
ATOM   2414 C  C   . ARG A 1 371 ? -24.710 20.910  -30.279 1.00 23.71 ? 447  ARG A C   1 
ATOM   2415 O  O   . ARG A 1 371 ? -24.799 21.573  -29.243 1.00 24.22 ? 447  ARG A O   1 
ATOM   2416 C  CB  . ARG A 1 371 ? -26.813 19.570  -30.485 1.00 19.73 ? 447  ARG A CB  1 
ATOM   2417 C  CG  . ARG A 1 371 ? -27.262 20.246  -31.778 1.00 23.84 ? 447  ARG A CG  1 
ATOM   2418 C  CD  . ARG A 1 371 ? -28.767 20.427  -31.792 1.00 26.23 ? 447  ARG A CD  1 
ATOM   2419 N  NE  . ARG A 1 371 ? -29.475 19.153  -31.891 1.00 26.81 ? 447  ARG A NE  1 
ATOM   2420 C  CZ  . ARG A 1 371 ? -30.627 18.891  -31.282 1.00 29.56 ? 447  ARG A CZ  1 
ATOM   2421 N  NH1 . ARG A 1 371 ? -31.194 19.805  -30.504 1.00 28.50 ? 447  ARG A NH1 1 
ATOM   2422 N  NH2 . ARG A 1 371 ? -31.209 17.710  -31.438 1.00 29.69 ? 447  ARG A NH2 1 
ATOM   2423 N  N   . SER A 1 372 ? -24.115 21.362  -31.382 1.00 23.23 ? 448  SER A N   1 
ATOM   2424 C  CA  . SER A 1 372 ? -23.603 22.724  -31.426 1.00 22.93 ? 448  SER A CA  1 
ATOM   2425 C  C   . SER A 1 372 ? -24.763 23.713  -31.426 1.00 23.14 ? 448  SER A C   1 
ATOM   2426 O  O   . SER A 1 372 ? -25.759 23.526  -32.130 1.00 24.09 ? 448  SER A O   1 
ATOM   2427 C  CB  . SER A 1 372 ? -22.710 22.934  -32.655 1.00 22.71 ? 448  SER A CB  1 
ATOM   2428 O  OG  . SER A 1 372 ? -23.404 22.702  -33.872 1.00 21.71 ? 448  SER A OG  1 
ATOM   2429 N  N   . ILE A 1 373 ? -24.650 24.753  -30.602 1.00 22.47 ? 449  ILE A N   1 
ATOM   2430 C  CA  . ILE A 1 373 ? -25.601 25.858  -30.617 1.00 23.39 ? 449  ILE A CA  1 
ATOM   2431 C  C   . ILE A 1 373 ? -24.971 27.137  -31.128 1.00 27.56 ? 449  ILE A C   1 
ATOM   2432 O  O   . ILE A 1 373 ? -25.632 28.187  -31.137 1.00 30.85 ? 449  ILE A O   1 
ATOM   2433 C  CB  . ILE A 1 373 ? -26.228 26.084  -29.229 1.00 23.47 ? 449  ILE A CB  1 
ATOM   2434 C  CG1 . ILE A 1 373 ? -25.150 26.469  -28.213 1.00 24.87 ? 449  ILE A CG1 1 
ATOM   2435 C  CG2 . ILE A 1 373 ? -26.980 24.835  -28.774 1.00 20.50 ? 449  ILE A CG2 1 
ATOM   2436 C  CD1 . ILE A 1 373 ? -25.711 26.993  -26.893 1.00 27.73 ? 449  ILE A CD1 1 
ATOM   2437 N  N   . ASP A 1 374 ? -23.713 27.083  -31.560 1.00 26.41 ? 450  ASP A N   1 
ATOM   2438 C  CA  . ASP A 1 374 ? -23.015 28.230  -32.118 1.00 28.86 ? 450  ASP A CA  1 
ATOM   2439 C  C   . ASP A 1 374 ? -21.961 27.704  -33.081 1.00 27.38 ? 450  ASP A C   1 
ATOM   2440 O  O   . ASP A 1 374 ? -21.684 26.503  -33.129 1.00 26.44 ? 450  ASP A O   1 
ATOM   2441 C  CB  . ASP A 1 374 ? -22.385 29.087  -31.009 1.00 27.93 ? 450  ASP A CB  1 
ATOM   2442 C  CG  . ASP A 1 374 ? -22.010 30.482  -31.480 0.58 30.08 ? 450  ASP A CG  1 
ATOM   2443 O  OD1 . ASP A 1 374 ? -22.349 30.850  -32.623 0.81 30.37 ? 450  ASP A OD1 1 
ATOM   2444 O  OD2 . ASP A 1 374 ? -21.371 31.215  -30.701 0.85 32.33 ? 450  ASP A OD2 1 
ATOM   2445 N  N   . ASN A 1 375 ? -21.376 28.612  -33.860 1.00 29.19 ? 451  ASN A N   1 
ATOM   2446 C  CA  . ASN A 1 375 ? -20.232 28.236  -34.682 1.00 30.48 ? 451  ASN A CA  1 
ATOM   2447 C  C   . ASN A 1 375 ? -19.079 27.777  -33.798 1.00 30.80 ? 451  ASN A C   1 
ATOM   2448 O  O   . ASN A 1 375 ? -18.945 28.195  -32.643 1.00 29.40 ? 451  ASN A O   1 
ATOM   2449 C  CB  . ASN A 1 375 ? -19.776 29.410  -35.549 1.00 33.03 ? 451  ASN A CB  1 
ATOM   2450 C  CG  . ASN A 1 375 ? -20.886 29.963  -36.406 1.00 34.44 ? 451  ASN A CG  1 
ATOM   2451 O  OD1 . ASN A 1 375 ? -21.349 29.306  -37.331 1.00 35.18 ? 451  ASN A OD1 1 
ATOM   2452 N  ND2 . ASN A 1 375 ? -21.324 31.178  -36.100 1.00 36.83 ? 451  ASN A ND2 1 
ATOM   2453 N  N   . ASP A 1 376 ? -18.243 26.904  -34.349 1.00 27.55 ? 452  ASP A N   1 
ATOM   2454 C  CA  . ASP A 1 376 ? -17.055 26.439  -33.646 1.00 28.89 ? 452  ASP A CA  1 
ATOM   2455 C  C   . ASP A 1 376 ? -16.066 25.913  -34.679 1.00 28.59 ? 452  ASP A C   1 
ATOM   2456 O  O   . ASP A 1 376 ? -16.337 25.904  -35.884 1.00 26.14 ? 452  ASP A O   1 
ATOM   2457 C  CB  . ASP A 1 376 ? -17.407 25.372  -32.601 1.00 27.31 ? 452  ASP A CB  1 
ATOM   2458 C  CG  . ASP A 1 376 ? -16.362 25.260  -31.500 1.00 25.46 ? 452  ASP A CG  1 
ATOM   2459 O  OD1 . ASP A 1 376 ? -15.337 25.968  -31.567 1.00 27.40 ? 452  ASP A OD1 1 
ATOM   2460 O  OD2 . ASP A 1 376 ? -16.562 24.459  -30.565 1.00 25.49 ? 452  ASP A OD2 1 
ATOM   2461 N  N   . ILE A 1 377 ? -14.903 25.492  -34.191 1.00 29.65 ? 453  ILE A N   1 
ATOM   2462 C  CA  . ILE A 1 377 ? -13.899 24.807  -34.994 1.00 31.13 ? 453  ILE A CA  1 
ATOM   2463 C  C   . ILE A 1 377 ? -13.537 23.523  -34.261 1.00 30.55 ? 453  ILE A C   1 
ATOM   2464 O  O   . ILE A 1 377 ? -13.170 23.562  -33.080 1.00 28.24 ? 453  ILE A O   1 
ATOM   2465 C  CB  . ILE A 1 377 ? -12.651 25.673  -35.227 1.00 34.42 ? 453  ILE A CB  1 
ATOM   2466 C  CG1 . ILE A 1 377 ? -13.026 26.951  -35.982 1.00 37.76 ? 453  ILE A CG1 1 
ATOM   2467 C  CG2 . ILE A 1 377 ? -11.599 24.889  -35.991 1.00 35.73 ? 453  ILE A CG2 1 
ATOM   2468 C  CD1 . ILE A 1 377 ? -11.844 27.842  -36.298 1.00 39.56 ? 453  ILE A CD1 1 
ATOM   2469 N  N   . LEU A 1 378 ? -13.669 22.389  -34.943 1.00 27.76 ? 454  LEU A N   1 
ATOM   2470 C  CA  . LEU A 1 378 ? -13.364 21.084  -34.365 1.00 25.29 ? 454  LEU A CA  1 
ATOM   2471 C  C   . LEU A 1 378 ? -12.170 20.507  -35.116 1.00 26.88 ? 454  LEU A C   1 
ATOM   2472 O  O   . LEU A 1 378 ? -12.279 20.167  -36.299 1.00 26.31 ? 454  LEU A O   1 
ATOM   2473 C  CB  . LEU A 1 378 ? -14.573 20.155  -34.435 1.00 24.95 ? 454  LEU A CB  1 
ATOM   2474 C  CG  . LEU A 1 378 ? -15.801 20.593  -33.627 1.00 24.38 ? 454  LEU A CG  1 
ATOM   2475 C  CD1 . LEU A 1 378 ? -16.870 19.509  -33.635 1.00 21.87 ? 454  LEU A CD1 1 
ATOM   2476 C  CD2 . LEU A 1 378 ? -15.404 20.940  -32.203 1.00 22.09 ? 454  LEU A CD2 1 
ATOM   2477 N  N   . GLY A 1 379 ? -11.039 20.393  -34.426 1.00 29.47 ? 455  GLY A N   1 
ATOM   2478 C  CA  . GLY A 1 379 ? -9.796  20.053  -35.088 1.00 36.49 ? 455  GLY A CA  1 
ATOM   2479 C  C   . GLY A 1 379 ? -9.367  21.196  -35.986 1.00 44.09 ? 455  GLY A C   1 
ATOM   2480 O  O   . GLY A 1 379 ? -8.959  22.257  -35.507 1.00 48.56 ? 455  GLY A O   1 
ATOM   2481 N  N   . GLU A 1 380 ? -9.470  20.999  -37.294 1.00 44.36 ? 456  GLU A N   1 
ATOM   2482 C  CA  . GLU A 1 380 ? -9.239  22.070  -38.250 1.00 44.47 ? 456  GLU A CA  1 
ATOM   2483 C  C   . GLU A 1 380 ? -10.514 22.454  -38.988 1.00 37.79 ? 456  GLU A C   1 
ATOM   2484 O  O   . GLU A 1 380 ? -10.468 23.279  -39.903 1.00 39.03 ? 456  GLU A O   1 
ATOM   2485 C  CB  . GLU A 1 380 ? -8.150  21.659  -39.244 1.00 50.81 ? 456  GLU A CB  1 
ATOM   2486 C  CG  . GLU A 1 380 ? -6.812  21.297  -38.608 1.00 56.95 ? 456  GLU A CG  1 
ATOM   2487 C  CD  . GLU A 1 380 ? -5.908  22.501  -38.407 1.00 61.42 ? 456  GLU A CD  1 
ATOM   2488 O  OE1 . GLU A 1 380 ? -5.180  22.539  -37.393 1.00 62.50 ? 456  GLU A OE1 1 
ATOM   2489 O  OE2 . GLU A 1 380 ? -5.921  23.407  -39.266 1.00 63.81 ? 456  GLU A OE2 1 
ATOM   2490 N  N   . TYR A 1 381 ? -11.655 21.886  -38.598 1.00 31.04 ? 457  TYR A N   1 
ATOM   2491 C  CA  . TYR A 1 381 ? -12.865 21.945  -39.402 1.00 28.49 ? 457  TYR A CA  1 
ATOM   2492 C  C   . TYR A 1 381 ? -13.863 22.926  -38.810 1.00 29.89 ? 457  TYR A C   1 
ATOM   2493 O  O   . TYR A 1 381 ? -14.306 22.727  -37.667 1.00 27.62 ? 457  TYR A O   1 
ATOM   2494 C  CB  . TYR A 1 381 ? -13.492 20.558  -39.507 1.00 27.69 ? 457  TYR A CB  1 
ATOM   2495 C  CG  . TYR A 1 381 ? -12.656 19.561  -40.275 1.00 29.20 ? 457  TYR A CG  1 
ATOM   2496 C  CD1 . TYR A 1 381 ? -12.606 19.595  -41.660 1.00 31.20 ? 457  TYR A CD1 1 
ATOM   2497 C  CD2 . TYR A 1 381 ? -11.927 18.579  -39.615 1.00 29.93 ? 457  TYR A CD2 1 
ATOM   2498 C  CE1 . TYR A 1 381 ? -11.847 18.681  -42.373 1.00 33.65 ? 457  TYR A CE1 1 
ATOM   2499 C  CE2 . TYR A 1 381 ? -11.165 17.659  -40.320 1.00 31.64 ? 457  TYR A CE2 1 
ATOM   2500 C  CZ  . TYR A 1 381 ? -11.128 17.719  -41.696 1.00 33.34 ? 457  TYR A CZ  1 
ATOM   2501 O  OH  . TYR A 1 381 ? -10.375 16.810  -42.399 1.00 37.47 ? 457  TYR A OH  1 
ATOM   2502 N  N   . PRO A 1 382 ? -14.268 23.964  -39.545 1.00 29.72 ? 458  PRO A N   1 
ATOM   2503 C  CA  . PRO A 1 382 ? -15.311 24.859  -39.033 1.00 31.17 ? 458  PRO A CA  1 
ATOM   2504 C  C   . PRO A 1 382 ? -16.664 24.174  -39.085 1.00 31.51 ? 458  PRO A C   1 
ATOM   2505 O  O   . PRO A 1 382 ? -16.984 23.479  -40.051 1.00 32.17 ? 458  PRO A O   1 
ATOM   2506 C  CB  . PRO A 1 382 ? -15.265 26.062  -39.989 1.00 32.53 ? 458  PRO A CB  1 
ATOM   2507 C  CG  . PRO A 1 382 ? -14.104 25.804  -40.935 1.00 33.86 ? 458  PRO A CG  1 
ATOM   2508 C  CD  . PRO A 1 382 ? -13.842 24.334  -40.903 1.00 30.59 ? 458  PRO A CD  1 
ATOM   2509 N  N   . ILE A 1 383 ? -17.461 24.368  -38.033 1.00 27.47 ? 459  ILE A N   1 
ATOM   2510 C  CA  . ILE A 1 383 ? -18.832 23.877  -38.006 1.00 25.36 ? 459  ILE A CA  1 
ATOM   2511 C  C   . ILE A 1 383 ? -19.767 25.026  -37.656 1.00 27.85 ? 459  ILE A C   1 
ATOM   2512 O  O   . ILE A 1 383 ? -19.382 26.010  -37.017 1.00 26.71 ? 459  ILE A O   1 
ATOM   2513 C  CB  . ILE A 1 383 ? -19.040 22.714  -37.010 1.00 26.00 ? 459  ILE A CB  1 
ATOM   2514 C  CG1 . ILE A 1 383 ? -18.841 23.194  -35.569 1.00 23.61 ? 459  ILE A CG1 1 
ATOM   2515 C  CG2 . ILE A 1 383 ? -18.116 21.544  -37.341 1.00 25.41 ? 459  ILE A CG2 1 
ATOM   2516 C  CD1 . ILE A 1 383 ? -19.285 22.178  -34.526 1.00 21.40 ? 459  ILE A CD1 1 
ATOM   2517 N  N   . LYS A 1 384 ? -21.012 24.881  -38.087 1.00 26.19 ? 460  LYS A N   1 
ATOM   2518 C  CA  . LYS A 1 384 ? -22.089 25.777  -37.707 1.00 28.46 ? 460  LYS A CA  1 
ATOM   2519 C  C   . LYS A 1 384 ? -22.888 25.168  -36.559 1.00 28.62 ? 460  LYS A C   1 
ATOM   2520 O  O   . LYS A 1 384 ? -22.666 24.027  -36.147 1.00 26.26 ? 460  LYS A O   1 
ATOM   2521 C  CB  . LYS A 1 384 ? -22.990 26.063  -38.913 1.00 32.14 ? 460  LYS A CB  1 
ATOM   2522 C  CG  . LYS A 1 384 ? -22.217 26.568  -40.123 1.00 35.30 ? 460  LYS A CG  1 
ATOM   2523 C  CD  . LYS A 1 384 ? -23.131 27.078  -41.221 1.00 44.04 ? 460  LYS A CD  1 
ATOM   2524 C  CE  . LYS A 1 384 ? -22.308 27.649  -42.368 1.00 50.06 ? 460  LYS A CE  1 
ATOM   2525 N  NZ  . LYS A 1 384 ? -23.126 28.387  -43.374 1.00 55.75 ? 460  LYS A NZ  1 
ATOM   2526 N  N   . ARG A 1 385 ? -23.819 25.957  -36.031 1.00 26.41 ? 461  ARG A N   1 
ATOM   2527 C  CA  . ARG A 1 385 ? -24.763 25.437  -35.056 1.00 25.29 ? 461  ARG A CA  1 
ATOM   2528 C  C   . ARG A 1 385 ? -25.619 24.341  -35.683 1.00 26.85 ? 461  ARG A C   1 
ATOM   2529 O  O   . ARG A 1 385 ? -25.813 24.294  -36.901 1.00 28.32 ? 461  ARG A O   1 
ATOM   2530 C  CB  . ARG A 1 385 ? -25.655 26.560  -34.530 1.00 25.71 ? 461  ARG A CB  1 
ATOM   2531 C  CG  . ARG A 1 385 ? -26.580 27.142  -35.585 1.00 25.81 ? 461  ARG A CG  1 
ATOM   2532 C  CD  . ARG A 1 385 ? -27.319 28.368  -35.072 1.00 27.03 ? 461  ARG A CD  1 
ATOM   2533 N  NE  . ARG A 1 385 ? -28.227 28.921  -36.077 1.00 27.14 ? 461  ARG A NE  1 
ATOM   2534 C  CZ  . ARG A 1 385 ? -28.974 30.002  -35.883 1.00 30.18 ? 461  ARG A CZ  1 
ATOM   2535 N  NH1 . ARG A 1 385 ? -28.918 30.646  -34.723 1.00 28.37 ? 461  ARG A NH1 1 
ATOM   2536 N  NH2 . ARG A 1 385 ? -29.775 30.444  -36.845 1.00 29.02 ? 461  ARG A NH2 1 
ATOM   2537 N  N   . GLY A 1 386 ? -26.124 23.446  -34.838 1.00 27.06 ? 462  GLY A N   1 
ATOM   2538 C  CA  . GLY A 1 386 ? -27.036 22.414  -35.277 1.00 29.20 ? 462  GLY A CA  1 
ATOM   2539 C  C   . GLY A 1 386 ? -26.409 21.073  -35.586 1.00 28.07 ? 462  GLY A C   1 
ATOM   2540 O  O   . GLY A 1 386 ? -27.128 20.158  -36.010 1.00 28.09 ? 462  GLY A O   1 
ATOM   2541 N  N   . GLU A 1 387 ? -25.102 20.921  -35.400 1.00 23.82 ? 463  GLU A N   1 
ATOM   2542 C  CA  . GLU A 1 387 ? -24.461 19.635  -35.631 1.00 23.77 ? 463  GLU A CA  1 
ATOM   2543 C  C   . GLU A 1 387 ? -24.706 18.711  -34.444 1.00 25.00 ? 463  GLU A C   1 
ATOM   2544 O  O   . GLU A 1 387 ? -24.446 19.081  -33.292 1.00 24.41 ? 463  GLU A O   1 
ATOM   2545 C  CB  . GLU A 1 387 ? -22.959 19.812  -35.857 1.00 22.60 ? 463  GLU A CB  1 
ATOM   2546 C  CG  . GLU A 1 387 ? -22.583 20.581  -37.121 1.00 23.47 ? 463  GLU A CG  1 
ATOM   2547 C  CD  . GLU A 1 387 ? -22.668 19.741  -38.396 1.00 27.38 ? 463  GLU A CD  1 
ATOM   2548 O  OE1 . GLU A 1 387 ? -23.157 18.588  -38.345 1.00 26.16 ? 463  GLU A OE1 1 
ATOM   2549 O  OE2 . GLU A 1 387 ? -22.235 20.243  -39.455 1.00 26.05 ? 463  GLU A OE2 1 
ATOM   2550 N  N   . ASP A 1 388 ? -25.211 17.512  -34.725 1.00 22.52 ? 464  ASP A N   1 
ATOM   2551 C  CA  . ASP A 1 388 ? -25.360 16.475  -33.712 1.00 21.24 ? 464  ASP A CA  1 
ATOM   2552 C  C   . ASP A 1 388 ? -24.048 15.711  -33.618 1.00 24.08 ? 464  ASP A C   1 
ATOM   2553 O  O   . ASP A 1 388 ? -23.576 15.149  -34.614 1.00 26.29 ? 464  ASP A O   1 
ATOM   2554 C  CB  . ASP A 1 388 ? -26.516 15.538  -34.053 1.00 20.54 ? 464  ASP A CB  1 
ATOM   2555 C  CG  . ASP A 1 388 ? -27.861 16.233  -33.991 1.00 25.17 ? 464  ASP A CG  1 
ATOM   2556 O  OD1 . ASP A 1 388 ? -28.140 16.886  -32.965 1.00 25.50 ? 464  ASP A OD1 1 
ATOM   2557 O  OD2 . ASP A 1 388 ? -28.633 16.139  -34.967 1.00 26.36 ? 464  ASP A OD2 1 
ATOM   2558 N  N   . ILE A 1 389 ? -23.462 15.696  -32.425 1.00 20.08 ? 465  ILE A N   1 
ATOM   2559 C  CA  . ILE A 1 389 ? -22.110 15.200  -32.213 1.00 21.97 ? 465  ILE A CA  1 
ATOM   2560 C  C   . ILE A 1 389 ? -22.150 14.016  -31.261 1.00 22.98 ? 465  ILE A C   1 
ATOM   2561 O  O   . ILE A 1 389 ? -22.784 14.083  -30.199 1.00 22.18 ? 465  ILE A O   1 
ATOM   2562 C  CB  . ILE A 1 389 ? -21.196 16.309  -31.664 1.00 23.20 ? 465  ILE A CB  1 
ATOM   2563 C  CG1 . ILE A 1 389 ? -21.102 17.453  -32.677 1.00 22.08 ? 465  ILE A CG1 1 
ATOM   2564 C  CG2 . ILE A 1 389 ? -19.822 15.756  -31.301 1.00 22.25 ? 465  ILE A CG2 1 
ATOM   2565 C  CD1 . ILE A 1 389 ? -20.794 18.778  -32.042 1.00 24.17 ? 465  ILE A CD1 1 
ATOM   2566 N  N   . PHE A 1 390 ? -21.461 12.944  -31.638 1.00 19.50 ? 466  PHE A N   1 
ATOM   2567 C  CA  . PHE A 1 390 ? -21.195 11.813  -30.759 1.00 20.73 ? 466  PHE A CA  1 
ATOM   2568 C  C   . PHE A 1 390 ? -19.702 11.746  -30.484 1.00 19.59 ? 466  PHE A C   1 
ATOM   2569 O  O   . PHE A 1 390 ? -18.907 11.517  -31.402 1.00 19.71 ? 466  PHE A O   1 
ATOM   2570 C  CB  . PHE A 1 390 ? -21.678 10.502  -31.377 1.00 21.64 ? 466  PHE A CB  1 
ATOM   2571 C  CG  . PHE A 1 390 ? -23.157 10.313  -31.299 1.00 28.57 ? 466  PHE A CG  1 
ATOM   2572 C  CD1 . PHE A 1 390 ? -24.005 11.085  -32.070 1.00 32.53 ? 466  PHE A CD1 1 
ATOM   2573 C  CD2 . PHE A 1 390 ? -23.703 9.372   -30.441 1.00 33.15 ? 466  PHE A CD2 1 
ATOM   2574 C  CE1 . PHE A 1 390 ? -25.375 10.918  -31.995 1.00 36.16 ? 466  PHE A CE1 1 
ATOM   2575 C  CE2 . PHE A 1 390 ? -25.072 9.197   -30.362 1.00 34.26 ? 466  PHE A CE2 1 
ATOM   2576 C  CZ  . PHE A 1 390 ? -25.910 9.972   -31.143 1.00 34.84 ? 466  PHE A CZ  1 
ATOM   2577 N  N   . ILE A 1 391 ? -19.328 11.954  -29.229 1.00 17.60 ? 467  ILE A N   1 
ATOM   2578 C  CA  . ILE A 1 391 ? -17.965 11.713  -28.776 1.00 20.31 ? 467  ILE A CA  1 
ATOM   2579 C  C   . ILE A 1 391 ? -17.869 10.243  -28.406 1.00 21.75 ? 467  ILE A C   1 
ATOM   2580 O  O   . ILE A 1 391 ? -18.560 9.783   -27.490 1.00 21.25 ? 467  ILE A O   1 
ATOM   2581 C  CB  . ILE A 1 391 ? -17.606 12.610  -27.580 1.00 20.06 ? 467  ILE A CB  1 
ATOM   2582 C  CG1 . ILE A 1 391 ? -17.656 14.089  -27.983 1.00 19.55 ? 467  ILE A CG1 1 
ATOM   2583 C  CG2 . ILE A 1 391 ? -16.233 12.247  -27.034 1.00 19.13 ? 467  ILE A CG2 1 
ATOM   2584 C  CD1 . ILE A 1 391 ? -17.579 15.051  -26.793 1.00 19.59 ? 467  ILE A CD1 1 
ATOM   2585 N  N   . SER A 1 392 ? -17.027 9.498   -29.118 1.00 17.53 ? 468  SER A N   1 
ATOM   2586 C  CA  . SER A 1 392 ? -16.895 8.066   -28.862 1.00 18.53 ? 468  SER A CA  1 
ATOM   2587 C  C   . SER A 1 392 ? -15.900 7.861   -27.729 1.00 17.91 ? 468  SER A C   1 
ATOM   2588 O  O   . SER A 1 392 ? -14.684 7.849   -27.945 1.00 18.96 ? 468  SER A O   1 
ATOM   2589 C  CB  . SER A 1 392 ? -16.454 7.319   -30.113 1.00 20.93 ? 468  SER A CB  1 
ATOM   2590 O  OG  . SER A 1 392 ? -16.258 5.947   -29.805 1.00 20.93 ? 468  SER A OG  1 
ATOM   2591 N  N   . VAL A 1 393 ? -16.422 7.707   -26.510 1.00 15.68 ? 469  VAL A N   1 
ATOM   2592 C  CA  . VAL A 1 393 ? -15.571 7.381   -25.370 1.00 17.13 ? 469  VAL A CA  1 
ATOM   2593 C  C   . VAL A 1 393 ? -14.890 6.039   -25.596 1.00 18.76 ? 469  VAL A C   1 
ATOM   2594 O  O   . VAL A 1 393 ? -13.720 5.846   -25.236 1.00 20.83 ? 469  VAL A O   1 
ATOM   2595 C  CB  . VAL A 1 393 ? -16.400 7.389   -24.073 1.00 18.58 ? 469  VAL A CB  1 
ATOM   2596 C  CG1 . VAL A 1 393 ? -15.508 7.107   -22.871 1.00 18.36 ? 469  VAL A CG1 1 
ATOM   2597 C  CG2 . VAL A 1 393 ? -17.130 8.723   -23.909 1.00 18.86 ? 469  VAL A CG2 1 
ATOM   2598 N  N   . TRP A 1 394 ? -15.613 5.098   -26.211 1.00 17.08 ? 470  TRP A N   1 
ATOM   2599 C  CA  . TRP A 1 394 ? -15.041 3.811   -26.590 1.00 18.06 ? 470  TRP A CA  1 
ATOM   2600 C  C   . TRP A 1 394 ? -13.758 3.996   -27.396 1.00 21.35 ? 470  TRP A C   1 
ATOM   2601 O  O   . TRP A 1 394 ? -12.716 3.415   -27.069 1.00 19.17 ? 470  TRP A O   1 
ATOM   2602 C  CB  . TRP A 1 394 ? -16.083 3.016   -27.385 1.00 17.98 ? 470  TRP A CB  1 
ATOM   2603 C  CG  . TRP A 1 394 ? -15.648 1.656   -27.867 1.00 19.66 ? 470  TRP A CG  1 
ATOM   2604 C  CD1 . TRP A 1 394 ? -15.039 1.361   -29.056 1.00 22.58 ? 470  TRP A CD1 1 
ATOM   2605 C  CD2 . TRP A 1 394 ? -15.823 0.404   -27.187 1.00 20.30 ? 470  TRP A CD2 1 
ATOM   2606 N  NE1 . TRP A 1 394 ? -14.814 0.007   -29.151 1.00 22.35 ? 470  TRP A NE1 1 
ATOM   2607 C  CE2 . TRP A 1 394 ? -15.286 -0.602  -28.017 1.00 22.08 ? 470  TRP A CE2 1 
ATOM   2608 C  CE3 . TRP A 1 394 ? -16.373 0.038   -25.950 1.00 21.05 ? 470  TRP A CE3 1 
ATOM   2609 C  CZ2 . TRP A 1 394 ? -15.284 -1.952  -27.654 1.00 22.43 ? 470  TRP A CZ2 1 
ATOM   2610 C  CZ3 . TRP A 1 394 ? -16.368 -1.307  -25.588 1.00 21.52 ? 470  TRP A CZ3 1 
ATOM   2611 C  CH2 . TRP A 1 394 ? -15.827 -2.283  -26.440 1.00 20.76 ? 470  TRP A CH2 1 
ATOM   2612 N  N   . ASN A 1 395 ? -13.815 4.817   -28.454 1.00 19.00 ? 471  ASN A N   1 
ATOM   2613 C  CA  . ASN A 1 395 ? -12.634 5.045   -29.285 1.00 19.00 ? 471  ASN A CA  1 
ATOM   2614 C  C   . ASN A 1 395 ? -11.528 5.743   -28.507 1.00 19.52 ? 471  ASN A C   1 
ATOM   2615 O  O   . ASN A 1 395 ? -10.350 5.390   -28.641 1.00 19.97 ? 471  ASN A O   1 
ATOM   2616 C  CB  . ASN A 1 395 ? -12.998 5.871   -30.517 1.00 18.82 ? 471  ASN A CB  1 
ATOM   2617 C  CG  . ASN A 1 395 ? -13.859 5.108   -31.497 1.00 21.19 ? 471  ASN A CG  1 
ATOM   2618 O  OD1 . ASN A 1 395 ? -14.092 3.911   -31.328 1.00 21.34 ? 471  ASN A OD1 1 
ATOM   2619 N  ND2 . ASN A 1 395 ? -14.323 5.794   -32.543 1.00 19.24 ? 471  ASN A ND2 1 
ATOM   2620 N  N   . LEU A 1 396 ? -11.885 6.759   -27.716 1.00 18.93 ? 472  LEU A N   1 
ATOM   2621 C  CA  . LEU A 1 396 ? -10.887 7.466   -26.921 1.00 23.30 ? 472  LEU A CA  1 
ATOM   2622 C  C   . LEU A 1 396 ? -10.183 6.518   -25.961 1.00 21.87 ? 472  LEU A C   1 
ATOM   2623 O  O   . LEU A 1 396 ? -8.957  6.573   -25.805 1.00 20.51 ? 472  LEU A O   1 
ATOM   2624 C  CB  . LEU A 1 396 ? -11.548 8.610   -26.150 1.00 22.21 ? 472  LEU A CB  1 
ATOM   2625 C  CG  . LEU A 1 396 ? -11.980 9.818   -26.981 1.00 22.15 ? 472  LEU A CG  1 
ATOM   2626 C  CD1 . LEU A 1 396 ? -12.944 10.683  -26.193 1.00 21.03 ? 472  LEU A CD1 1 
ATOM   2627 C  CD2 . LEU A 1 396 ? -10.756 10.614  -27.399 1.00 20.13 ? 472  LEU A CD2 1 
ATOM   2628 N  N   . HIS A 1 397 ? -10.950 5.628   -25.328 1.00 19.79 ? 473  HIS A N   1 
ATOM   2629 C  CA  . HIS A 1 397 ? -10.419 4.701   -24.338 1.00 19.07 ? 473  HIS A CA  1 
ATOM   2630 C  C   . HIS A 1 397 ? -9.587  3.593   -24.954 1.00 20.22 ? 473  HIS A C   1 
ATOM   2631 O  O   . HIS A 1 397 ? -8.749  3.005   -24.261 1.00 21.73 ? 473  HIS A O   1 
ATOM   2632 C  CB  . HIS A 1 397 ? -11.570 4.079   -23.555 1.00 17.53 ? 473  HIS A CB  1 
ATOM   2633 C  CG  . HIS A 1 397 ? -12.149 4.980   -22.510 1.00 19.57 ? 473  HIS A CG  1 
ATOM   2634 N  ND1 . HIS A 1 397 ? -12.997 4.525   -21.523 1.00 20.06 ? 473  HIS A ND1 1 
ATOM   2635 C  CD2 . HIS A 1 397 ? -11.994 6.306   -22.291 1.00 20.35 ? 473  HIS A CD2 1 
ATOM   2636 C  CE1 . HIS A 1 397 ? -13.338 5.533   -20.738 1.00 20.94 ? 473  HIS A CE1 1 
ATOM   2637 N  NE2 . HIS A 1 397 ? -12.743 6.625   -21.183 1.00 22.32 ? 473  HIS A NE2 1 
ATOM   2638 N  N   . ARG A 1 398 ? -9.817  3.271   -26.225 1.00 19.82 ? 474  ARG A N   1 
ATOM   2639 C  CA  . ARG A 1 398 ? -9.156  2.144   -26.862 1.00 20.73 ? 474  ARG A CA  1 
ATOM   2640 C  C   . ARG A 1 398 ? -8.246  2.578   -28.001 1.00 21.86 ? 474  ARG A C   1 
ATOM   2641 O  O   . ARG A 1 398 ? -7.739  1.722   -28.732 1.00 23.76 ? 474  ARG A O   1 
ATOM   2642 C  CB  . ARG A 1 398 ? -10.200 1.137   -27.356 1.00 20.95 ? 474  ARG A CB  1 
ATOM   2643 C  CG  . ARG A 1 398 ? -10.932 0.426   -26.217 1.00 20.68 ? 474  ARG A CG  1 
ATOM   2644 C  CD  . ARG A 1 398 ? -12.183 -0.286  -26.706 1.00 22.69 ? 474  ARG A CD  1 
ATOM   2645 N  NE  . ARG A 1 398 ? -12.757 -1.181  -25.699 1.00 21.05 ? 474  ARG A NE  1 
ATOM   2646 C  CZ  . ARG A 1 398 ? -12.503 -2.485  -25.635 1.00 23.53 ? 474  ARG A CZ  1 
ATOM   2647 N  NH1 . ARG A 1 398 ? -11.683 -3.044  -26.519 1.00 22.41 ? 474  ARG A NH1 1 
ATOM   2648 N  NH2 . ARG A 1 398 ? -13.073 -3.234  -24.698 1.00 19.96 ? 474  ARG A NH2 1 
ATOM   2649 N  N   . SER A 1 399 ? -8.008  3.874   -28.146 1.00 23.52 ? 475  SER A N   1 
ATOM   2650 C  CA  . SER A 1 399 ? -7.181  4.399   -29.221 1.00 27.89 ? 475  SER A CA  1 
ATOM   2651 C  C   . SER A 1 399 ? -5.769  3.835   -29.136 1.00 31.19 ? 475  SER A C   1 
ATOM   2652 O  O   . SER A 1 399 ? -5.079  4.061   -28.128 1.00 30.66 ? 475  SER A O   1 
ATOM   2653 C  CB  . SER A 1 399 ? -7.139  5.921   -29.159 1.00 28.62 ? 475  SER A CB  1 
ATOM   2654 O  OG  . SER A 1 399 ? -6.257  6.431   -30.140 1.00 31.70 ? 475  SER A OG  1 
ATOM   2655 N  N   . PRO A 1 400 ? -5.302  3.102   -30.149 1.00 33.42 ? 476  PRO A N   1 
ATOM   2656 C  CA  . PRO A 1 400 ? -3.920  2.601   -30.114 1.00 39.36 ? 476  PRO A CA  1 
ATOM   2657 C  C   . PRO A 1 400 ? -2.888  3.711   -30.089 1.00 43.98 ? 476  PRO A C   1 
ATOM   2658 O  O   . PRO A 1 400 ? -1.750  3.475   -29.663 1.00 46.29 ? 476  PRO A O   1 
ATOM   2659 C  CB  . PRO A 1 400 ? -3.813  1.764   -31.396 1.00 39.39 ? 476  PRO A CB  1 
ATOM   2660 C  CG  . PRO A 1 400 ? -5.224  1.481   -31.800 1.00 36.93 ? 476  PRO A CG  1 
ATOM   2661 C  CD  . PRO A 1 400 ? -6.017  2.670   -31.359 1.00 33.51 ? 476  PRO A CD  1 
ATOM   2662 N  N   . LEU A 1 401 ? -3.253  4.919   -30.520 1.00 46.11 ? 477  LEU A N   1 
ATOM   2663 C  CA  . LEU A 1 401 ? -2.324  6.041   -30.468 1.00 49.07 ? 477  LEU A CA  1 
ATOM   2664 C  C   . LEU A 1 401 ? -2.025  6.468   -29.037 1.00 49.50 ? 477  LEU A C   1 
ATOM   2665 O  O   . LEU A 1 401 ? -0.922  6.952   -28.758 1.00 53.29 ? 477  LEU A O   1 
ATOM   2666 C  CB  . LEU A 1 401 ? -2.886  7.219   -31.263 1.00 50.81 ? 477  LEU A CB  1 
ATOM   2667 C  CG  . LEU A 1 401 ? -2.280  7.442   -32.647 1.00 55.00 ? 477  LEU A CG  1 
ATOM   2668 C  CD1 . LEU A 1 401 ? -0.831  7.887   -32.515 1.00 55.96 ? 477  LEU A CD1 1 
ATOM   2669 C  CD2 . LEU A 1 401 ? -2.383  6.179   -33.495 1.00 56.55 ? 477  LEU A CD2 1 
ATOM   2670 N  N   . HIS A 1 402 ? -2.977  6.297   -28.119 1.00 44.73 ? 478  HIS A N   1 
ATOM   2671 C  CA  . HIS A 1 402 ? -2.841  6.821   -26.765 1.00 42.46 ? 478  HIS A CA  1 
ATOM   2672 C  C   . HIS A 1 402 ? -2.829  5.736   -25.698 1.00 43.04 ? 478  HIS A C   1 
ATOM   2673 O  O   . HIS A 1 402 ? -2.859  6.060   -24.505 1.00 44.35 ? 478  HIS A O   1 
ATOM   2674 C  CB  . HIS A 1 402 ? -3.962  7.820   -26.467 1.00 42.16 ? 478  HIS A CB  1 
ATOM   2675 C  CG  . HIS A 1 402 ? -3.866  9.086   -27.260 1.00 48.11 ? 478  HIS A CG  1 
ATOM   2676 N  ND1 . HIS A 1 402 ? -4.456  9.238   -28.497 1.00 49.39 ? 478  HIS A ND1 1 
ATOM   2677 C  CD2 . HIS A 1 402 ? -3.238  10.257  -26.996 1.00 49.80 ? 478  HIS A CD2 1 
ATOM   2678 C  CE1 . HIS A 1 402 ? -4.200  10.449  -28.958 1.00 49.44 ? 478  HIS A CE1 1 
ATOM   2679 N  NE2 . HIS A 1 402 ? -3.462  11.088  -28.067 1.00 49.91 ? 478  HIS A NE2 1 
ATOM   2680 N  N   . TRP A 1 403 ? -2.793  4.463   -26.083 1.00 40.74 ? 479  TRP A N   1 
ATOM   2681 C  CA  . TRP A 1 403 ? -2.807  3.381   -25.109 1.00 37.05 ? 479  TRP A CA  1 
ATOM   2682 C  C   . TRP A 1 403 ? -1.896  2.263   -25.579 1.00 38.36 ? 479  TRP A C   1 
ATOM   2683 O  O   . TRP A 1 403 ? -2.036  1.779   -26.705 1.00 35.56 ? 479  TRP A O   1 
ATOM   2684 C  CB  . TRP A 1 403 ? -4.227  2.847   -24.891 1.00 31.82 ? 479  TRP A CB  1 
ATOM   2685 C  CG  . TRP A 1 403 ? -5.169  3.865   -24.332 1.00 27.13 ? 479  TRP A CG  1 
ATOM   2686 C  CD1 . TRP A 1 403 ? -6.141  4.541   -25.007 1.00 27.01 ? 479  TRP A CD1 1 
ATOM   2687 C  CD2 . TRP A 1 403 ? -5.227  4.327   -22.977 1.00 28.13 ? 479  TRP A CD2 1 
ATOM   2688 N  NE1 . TRP A 1 403 ? -6.802  5.397   -24.158 1.00 26.02 ? 479  TRP A NE1 1 
ATOM   2689 C  CE2 . TRP A 1 403 ? -6.260  5.282   -22.904 1.00 27.25 ? 479  TRP A CE2 1 
ATOM   2690 C  CE3 . TRP A 1 403 ? -4.506  4.023   -21.817 1.00 28.82 ? 479  TRP A CE3 1 
ATOM   2691 C  CZ2 . TRP A 1 403 ? -6.591  5.934   -21.717 1.00 27.12 ? 479  TRP A CZ2 1 
ATOM   2692 C  CZ3 . TRP A 1 403 ? -4.835  4.675   -20.640 1.00 26.28 ? 479  TRP A CZ3 1 
ATOM   2693 C  CH2 . TRP A 1 403 ? -5.868  5.618   -20.599 1.00 26.28 ? 479  TRP A CH2 1 
ATOM   2694 N  N   . ASP A 1 404 ? -0.970  1.857   -24.715 1.00 41.75 ? 480  ASP A N   1 
ATOM   2695 C  CA  . ASP A 1 404 ? -0.107  0.717   -24.994 1.00 45.44 ? 480  ASP A CA  1 
ATOM   2696 C  C   . ASP A 1 404 ? -0.903  -0.564  -24.813 1.00 39.18 ? 480  ASP A C   1 
ATOM   2697 O  O   . ASP A 1 404 ? -1.476  -0.793  -23.741 1.00 37.98 ? 480  ASP A O   1 
ATOM   2698 C  CB  . ASP A 1 404 ? 1.105   0.724   -24.067 1.00 55.29 ? 480  ASP A CB  1 
ATOM   2699 C  CG  . ASP A 1 404 ? 2.384   1.077   -24.787 1.00 66.11 ? 480  ASP A CG  1 
ATOM   2700 O  OD1 . ASP A 1 404 ? 2.586   2.273   -25.093 1.00 69.94 ? 480  ASP A OD1 1 
ATOM   2701 O  OD2 . ASP A 1 404 ? 3.186   0.156   -25.052 1.00 69.71 ? 480  ASP A OD2 1 
ATOM   2702 N  N   . ASP A 1 405 ? -0.939  -1.401  -25.851 1.00 34.78 ? 481  ASP A N   1 
ATOM   2703 C  CA  . ASP A 1 405 ? -1.651  -2.677  -25.790 1.00 35.22 ? 481  ASP A CA  1 
ATOM   2704 C  C   . ASP A 1 405 ? -3.109  -2.438  -25.387 1.00 31.22 ? 481  ASP A C   1 
ATOM   2705 O  O   . ASP A 1 405 ? -3.616  -2.988  -24.410 1.00 30.12 ? 481  ASP A O   1 
ATOM   2706 C  CB  . ASP A 1 405 ? -0.946  -3.635  -24.823 1.00 40.59 ? 481  ASP A CB  1 
ATOM   2707 C  CG  . ASP A 1 405 ? -1.188  -5.093  -25.152 1.00 47.99 ? 481  ASP A CG  1 
ATOM   2708 O  OD1 . ASP A 1 405 ? -2.064  -5.383  -25.993 1.00 50.02 ? 481  ASP A OD1 1 
ATOM   2709 O  OD2 . ASP A 1 405 ? -0.489  -5.953  -24.571 1.00 52.51 ? 481  ASP A OD2 1 
ATOM   2710 N  N   . ALA A 1 406 ? -3.768  -1.580  -26.174 1.00 29.48 ? 482  ALA A N   1 
ATOM   2711 C  CA  . ALA A 1 406 ? -5.029  -0.965  -25.765 1.00 28.04 ? 482  ALA A CA  1 
ATOM   2712 C  C   . ALA A 1 406 ? -6.115  -1.988  -25.467 1.00 26.53 ? 482  ALA A C   1 
ATOM   2713 O  O   . ALA A 1 406 ? -7.013  -1.720  -24.660 1.00 25.51 ? 482  ALA A O   1 
ATOM   2714 C  CB  . ALA A 1 406 ? -5.504  0.005   -26.849 1.00 27.11 ? 482  ALA A CB  1 
ATOM   2715 N  N   . GLU A 1 407 ? -6.070  -3.151  -26.107 1.00 25.48 ? 483  GLU A N   1 
ATOM   2716 C  CA  . GLU A 1 407 ? -7.107  -4.148  -25.882 1.00 29.42 ? 483  GLU A CA  1 
ATOM   2717 C  C   . GLU A 1 407 ? -6.814  -5.053  -24.693 1.00 30.36 ? 483  GLU A C   1 
ATOM   2718 O  O   . GLU A 1 407 ? -7.679  -5.853  -24.323 1.00 27.29 ? 483  GLU A O   1 
ATOM   2719 C  CB  . GLU A 1 407 ? -7.313  -5.005  -27.137 1.00 34.86 ? 483  GLU A CB  1 
ATOM   2720 C  CG  . GLU A 1 407 ? -7.828  -4.225  -28.339 1.00 38.77 ? 483  GLU A CG  1 
ATOM   2721 C  CD  . GLU A 1 407 ? -8.008  -5.096  -29.569 0.39 44.08 ? 483  GLU A CD  1 
ATOM   2722 O  OE1 . GLU A 1 407 ? -8.361  -6.284  -29.415 1.00 46.26 ? 483  GLU A OE1 1 
ATOM   2723 O  OE2 . GLU A 1 407 ? -7.784  -4.593  -30.691 0.75 46.80 ? 483  GLU A OE2 1 
ATOM   2724 N  N   . LYS A 1 408 ? -5.638  -4.946  -24.080 1.00 31.39 ? 484  LYS A N   1 
ATOM   2725 C  CA  . LYS A 1 408 ? -5.311  -5.819  -22.962 1.00 30.78 ? 484  LYS A CA  1 
ATOM   2726 C  C   . LYS A 1 408 ? -5.891  -5.285  -21.656 1.00 28.55 ? 484  LYS A C   1 
ATOM   2727 O  O   . LYS A 1 408 ? -5.869  -4.080  -21.391 1.00 28.17 ? 484  LYS A O   1 
ATOM   2728 C  CB  . LYS A 1 408 ? -3.798  -5.990  -22.829 1.00 31.77 ? 484  LYS A CB  1 
ATOM   2729 C  CG  . LYS A 1 408 ? -3.414  -7.064  -21.816 1.00 34.98 ? 484  LYS A CG  1 
ATOM   2730 C  CD  . LYS A 1 408 ? -1.941  -7.385  -21.861 0.92 40.72 ? 484  LYS A CD  1 
ATOM   2731 C  CE  . LYS A 1 408 ? -1.711  -8.877  -22.069 0.51 42.72 ? 484  LYS A CE  1 
ATOM   2732 N  NZ  . LYS A 1 408 ? -2.495  -9.716  -21.118 1.00 41.44 ? 484  LYS A NZ  1 
ATOM   2733 N  N   . PHE A 1 409 ? -6.417  -6.202  -20.845 1.00 24.86 ? 485  PHE A N   1 
ATOM   2734 C  CA  . PHE A 1 409 ? -6.901  -5.904  -19.498 1.00 25.64 ? 485  PHE A CA  1 
ATOM   2735 C  C   . PHE A 1 409 ? -5.692  -5.827  -18.573 1.00 24.69 ? 485  PHE A C   1 
ATOM   2736 O  O   . PHE A 1 409 ? -5.176  -6.850  -18.115 1.00 26.06 ? 485  PHE A O   1 
ATOM   2737 C  CB  . PHE A 1 409 ? -7.888  -6.978  -19.052 1.00 24.15 ? 485  PHE A CB  1 
ATOM   2738 C  CG  . PHE A 1 409 ? -8.414  -6.795  -17.657 1.00 23.55 ? 485  PHE A CG  1 
ATOM   2739 C  CD1 . PHE A 1 409 ? -8.912  -5.574  -17.240 1.00 21.52 ? 485  PHE A CD1 1 
ATOM   2740 C  CD2 . PHE A 1 409 ? -8.447  -7.868  -16.774 1.00 24.09 ? 485  PHE A CD2 1 
ATOM   2741 C  CE1 . PHE A 1 409 ? -9.409  -5.415  -15.955 1.00 23.33 ? 485  PHE A CE1 1 
ATOM   2742 C  CE2 . PHE A 1 409 ? -8.945  -7.720  -15.493 1.00 23.69 ? 485  PHE A CE2 1 
ATOM   2743 C  CZ  . PHE A 1 409 ? -9.425  -6.495  -15.081 1.00 25.02 ? 485  PHE A CZ  1 
ATOM   2744 N  N   . ASN A 1 410 ? -5.217  -4.611  -18.314 1.00 22.86 ? 486  ASN A N   1 
ATOM   2745 C  CA  . ASN A 1 410 ? -3.995  -4.388  -17.543 1.00 27.34 ? 486  ASN A CA  1 
ATOM   2746 C  C   . ASN A 1 410 ? -4.254  -3.299  -16.512 1.00 27.13 ? 486  ASN A C   1 
ATOM   2747 O  O   . ASN A 1 410 ? -4.027  -2.110  -16.777 1.00 24.93 ? 486  ASN A O   1 
ATOM   2748 C  CB  . ASN A 1 410 ? -2.827  -4.009  -18.452 1.00 29.71 ? 486  ASN A CB  1 
ATOM   2749 C  CG  . ASN A 1 410 ? -1.556  -3.699  -17.676 1.00 31.91 ? 486  ASN A CG  1 
ATOM   2750 O  OD1 . ASN A 1 410 ? -1.418  -4.067  -16.505 1.00 34.10 ? 486  ASN A OD1 1 
ATOM   2751 N  ND2 . ASN A 1 410 ? -0.619  -3.019  -18.327 1.00 28.78 ? 486  ASN A ND2 1 
ATOM   2752 N  N   . PRO A 1 411 ? -4.713  -3.672  -15.315 1.00 27.85 ? 487  PRO A N   1 
ATOM   2753 C  CA  . PRO A 1 411 ? -4.980  -2.657  -14.284 1.00 26.38 ? 487  PRO A CA  1 
ATOM   2754 C  C   . PRO A 1 411 ? -3.786  -1.775  -13.965 1.00 26.62 ? 487  PRO A C   1 
ATOM   2755 O  O   . PRO A 1 411 ? -3.971  -0.605  -13.613 1.00 28.47 ? 487  PRO A O   1 
ATOM   2756 C  CB  . PRO A 1 411 ? -5.393  -3.501  -13.072 1.00 23.95 ? 487  PRO A CB  1 
ATOM   2757 C  CG  . PRO A 1 411 ? -5.975  -4.743  -13.671 1.00 25.34 ? 487  PRO A CG  1 
ATOM   2758 C  CD  . PRO A 1 411 ? -5.129  -5.020  -14.889 1.00 27.82 ? 487  PRO A CD  1 
ATOM   2759 N  N   . GLU A 1 412 ? -2.565  -2.288  -14.092 1.00 26.66 ? 488  GLU A N   1 
ATOM   2760 C  CA  . GLU A 1 412 ? -1.376  -1.531  -13.736 1.00 29.51 ? 488  GLU A CA  1 
ATOM   2761 C  C   . GLU A 1 412 ? -0.816  -0.716  -14.896 1.00 29.04 ? 488  GLU A C   1 
ATOM   2762 O  O   . GLU A 1 412 ? 0.325   -0.246  -14.810 1.00 31.09 ? 488  GLU A O   1 
ATOM   2763 C  CB  . GLU A 1 412 ? -0.307  -2.470  -13.173 1.00 33.18 ? 488  GLU A CB  1 
ATOM   2764 C  CG  . GLU A 1 412 ? -0.785  -3.216  -11.940 1.00 37.41 ? 488  GLU A CG  1 
ATOM   2765 C  CD  . GLU A 1 412 ? 0.306   -4.026  -11.272 1.00 42.21 ? 488  GLU A CD  1 
ATOM   2766 O  OE1 . GLU A 1 412 ? 1.229   -3.417  -10.689 1.00 43.74 ? 488  GLU A OE1 1 
ATOM   2767 O  OE2 . GLU A 1 412 ? 0.238   -5.272  -11.334 1.00 42.37 ? 488  GLU A OE2 1 
ATOM   2768 N  N   . ARG A 1 413 ? -1.588  -0.520  -15.971 1.00 27.72 ? 489  ARG A N   1 
ATOM   2769 C  CA  . ARG A 1 413 ? -1.147  0.416   -17.000 1.00 29.34 ? 489  ARG A CA  1 
ATOM   2770 C  C   . ARG A 1 413 ? -1.022  1.827   -16.440 1.00 30.85 ? 489  ARG A C   1 
ATOM   2771 O  O   . ARG A 1 413 ? -0.357  2.673   -17.046 1.00 31.50 ? 489  ARG A O   1 
ATOM   2772 C  CB  . ARG A 1 413 ? -2.091  0.386   -18.211 1.00 27.55 ? 489  ARG A CB  1 
ATOM   2773 C  CG  . ARG A 1 413 ? -3.511  0.872   -17.955 1.00 24.98 ? 489  ARG A CG  1 
ATOM   2774 C  CD  . ARG A 1 413 ? -4.321  0.942   -19.262 1.00 25.07 ? 489  ARG A CD  1 
ATOM   2775 N  NE  . ARG A 1 413 ? -4.435  -0.356  -19.930 1.00 26.95 ? 489  ARG A NE  1 
ATOM   2776 C  CZ  . ARG A 1 413 ? -3.788  -0.689  -21.046 1.00 27.80 ? 489  ARG A CZ  1 
ATOM   2777 N  NH1 . ARG A 1 413 ? -2.979  0.181   -21.639 1.00 27.38 ? 489  ARG A NH1 1 
ATOM   2778 N  NH2 . ARG A 1 413 ? -3.952  -1.894  -21.576 1.00 28.20 ? 489  ARG A NH2 1 
ATOM   2779 N  N   . TRP A 1 414 ? -1.644  2.095   -15.293 1.00 29.70 ? 490  TRP A N   1 
ATOM   2780 C  CA  . TRP A 1 414 ? -1.338  3.258   -14.481 1.00 31.62 ? 490  TRP A CA  1 
ATOM   2781 C  C   . TRP A 1 414 ? -0.614  2.793   -13.228 1.00 32.83 ? 490  TRP A C   1 
ATOM   2782 O  O   . TRP A 1 414 ? -1.107  1.879   -12.553 1.00 33.43 ? 490  TRP A O   1 
ATOM   2783 C  CB  . TRP A 1 414 ? -2.610  4.019   -14.087 1.00 29.75 ? 490  TRP A CB  1 
ATOM   2784 C  CG  . TRP A 1 414 ? -3.557  4.328   -15.214 1.00 29.98 ? 490  TRP A CG  1 
ATOM   2785 C  CD1 . TRP A 1 414 ? -3.470  5.363   -16.107 1.00 32.11 ? 490  TRP A CD1 1 
ATOM   2786 C  CD2 . TRP A 1 414 ? -4.756  3.617   -15.542 1.00 25.90 ? 490  TRP A CD2 1 
ATOM   2787 N  NE1 . TRP A 1 414 ? -4.534  5.328   -16.979 1.00 29.27 ? 490  TRP A NE1 1 
ATOM   2788 C  CE2 . TRP A 1 414 ? -5.339  4.267   -16.651 1.00 27.43 ? 490  TRP A CE2 1 
ATOM   2789 C  CE3 . TRP A 1 414 ? -5.389  2.489   -15.010 1.00 24.39 ? 490  TRP A CE3 1 
ATOM   2790 C  CZ2 . TRP A 1 414 ? -6.523  3.825   -17.236 1.00 23.87 ? 490  TRP A CZ2 1 
ATOM   2791 C  CZ3 . TRP A 1 414 ? -6.561  2.054   -15.589 1.00 22.80 ? 490  TRP A CZ3 1 
ATOM   2792 C  CH2 . TRP A 1 414 ? -7.117  2.719   -16.694 1.00 23.46 ? 490  TRP A CH2 1 
ATOM   2793 N  N   . PRO A 1 415 ? 0.554   3.378   -12.893 1.00 33.34 ? 491  PRO A N   1 
ATOM   2794 C  CA  . PRO A 1 415 ? 1.293   2.956   -11.690 1.00 35.52 ? 491  PRO A CA  1 
ATOM   2795 C  C   . PRO A 1 415 ? 0.425   2.783   -10.451 1.00 35.08 ? 491  PRO A C   1 
ATOM   2796 O  O   . PRO A 1 415 ? -0.407  3.640   -10.130 1.00 31.04 ? 491  PRO A O   1 
ATOM   2797 C  CB  . PRO A 1 415 ? 2.312   4.086   -11.505 1.00 36.41 ? 491  PRO A CB  1 
ATOM   2798 C  CG  . PRO A 1 415 ? 2.595   4.537   -12.904 1.00 35.76 ? 491  PRO A CG  1 
ATOM   2799 C  CD  . PRO A 1 415 ? 1.296   4.389   -13.668 1.00 34.33 ? 491  PRO A CD  1 
ATOM   2800 N  N   . LEU A 1 416 ? 0.622   1.659   -9.757  1.00 37.31 ? 492  LEU A N   1 
ATOM   2801 C  CA  . LEU A 1 416 ? -0.232  1.305   -8.626  1.00 37.75 ? 492  LEU A CA  1 
ATOM   2802 C  C   . LEU A 1 416 ? -0.196  2.371   -7.536  1.00 38.29 ? 492  LEU A C   1 
ATOM   2803 O  O   . LEU A 1 416 ? -1.232  2.694   -6.941  1.00 38.04 ? 492  LEU A O   1 
ATOM   2804 C  CB  . LEU A 1 416 ? 0.193   -0.055  -8.065  1.00 39.06 ? 492  LEU A CB  1 
ATOM   2805 C  CG  . LEU A 1 416 ? -0.715  -0.717  -7.030  1.00 40.99 ? 492  LEU A CG  1 
ATOM   2806 C  CD1 . LEU A 1 416 ? -2.086  -1.001  -7.621  1.00 38.98 ? 492  LEU A CD1 1 
ATOM   2807 C  CD2 . LEU A 1 416 ? -0.079  -1.997  -6.510  1.00 44.18 ? 492  LEU A CD2 1 
ATOM   2808 N  N   . ASP A 1 417 ? 0.978   2.935   -7.265  1.00 38.05 ? 493  ASP A N   1 
ATOM   2809 C  CA  . ASP A 1 417 ? 1.132   3.920   -6.201  1.00 41.77 ? 493  ASP A CA  1 
ATOM   2810 C  C   . ASP A 1 417 ? 1.040   5.356   -6.697  1.00 42.23 ? 493  ASP A C   1 
ATOM   2811 O  O   . ASP A 1 417 ? 1.196   6.282   -5.895  1.00 43.44 ? 493  ASP A O   1 
ATOM   2812 C  CB  . ASP A 1 417 ? 2.462   3.702   -5.474  1.00 46.81 ? 493  ASP A CB  1 
ATOM   2813 C  CG  . ASP A 1 417 ? 2.504   2.381   -4.726  1.00 50.47 ? 493  ASP A CG  1 
ATOM   2814 O  OD1 . ASP A 1 417 ? 1.502   2.043   -4.057  1.00 49.30 ? 493  ASP A OD1 1 
ATOM   2815 O  OD2 . ASP A 1 417 ? 3.533   1.676   -4.818  1.00 53.10 ? 493  ASP A OD2 1 
ATOM   2816 N  N   . GLY A 1 418 ? 0.781   5.564   -7.987  1.00 38.93 ? 494  GLY A N   1 
ATOM   2817 C  CA  . GLY A 1 418 ? 0.654   6.893   -8.538  1.00 36.58 ? 494  GLY A CA  1 
ATOM   2818 C  C   . GLY A 1 418 ? -0.777  7.392   -8.510  1.00 36.73 ? 494  GLY A C   1 
ATOM   2819 O  O   . GLY A 1 418 ? -1.680  6.721   -8.001  1.00 37.36 ? 494  GLY A O   1 
ATOM   2820 N  N   . PRO A 1 419 ? -1.007  8.584   -9.065  1.00 37.69 ? 495  PRO A N   1 
ATOM   2821 C  CA  . PRO A 1 419 ? -2.355  9.169   -9.044  1.00 36.33 ? 495  PRO A CA  1 
ATOM   2822 C  C   . PRO A 1 419 ? -3.370  8.304   -9.776  1.00 33.10 ? 495  PRO A C   1 
ATOM   2823 O  O   . PRO A 1 419 ? -3.063  7.671   -10.789 1.00 31.83 ? 495  PRO A O   1 
ATOM   2824 C  CB  . PRO A 1 419 ? -2.167  10.518  -9.748  1.00 38.08 ? 495  PRO A CB  1 
ATOM   2825 C  CG  . PRO A 1 419 ? -0.716  10.827  -9.597  1.00 41.31 ? 495  PRO A CG  1 
ATOM   2826 C  CD  . PRO A 1 419 ? -0.008  9.507   -9.625  1.00 40.55 ? 495  PRO A CD  1 
ATOM   2827 N  N   . ASN A 1 420 ? -4.587  8.278   -9.243  1.00 30.60 ? 496  ASN A N   1 
ATOM   2828 C  CA  . ASN A 1 420 ? -5.678  7.611   -9.931  1.00 27.65 ? 496  ASN A CA  1 
ATOM   2829 C  C   . ASN A 1 420 ? -5.940  8.320   -11.257 1.00 27.88 ? 496  ASN A C   1 
ATOM   2830 O  O   . ASN A 1 420 ? -5.906  9.555   -11.315 1.00 25.31 ? 496  ASN A O   1 
ATOM   2831 C  CB  . ASN A 1 420 ? -6.949  7.617   -9.077  1.00 27.23 ? 496  ASN A CB  1 
ATOM   2832 C  CG  . ASN A 1 420 ? -6.782  6.870   -7.759  1.00 30.15 ? 496  ASN A CG  1 
ATOM   2833 O  OD1 . ASN A 1 420 ? -6.004  5.919   -7.657  1.00 30.02 ? 496  ASN A OD1 1 
ATOM   2834 N  ND2 . ASN A 1 420 ? -7.526  7.295   -6.746  1.00 31.05 ? 496  ASN A ND2 1 
ATOM   2835 N  N   . PRO A 1 421 ? -6.197  7.581   -12.336 1.00 26.42 ? 497  PRO A N   1 
ATOM   2836 C  CA  . PRO A 1 421 ? -6.414  8.230   -13.634 1.00 25.81 ? 497  PRO A CA  1 
ATOM   2837 C  C   . PRO A 1 421 ? -7.748  8.962   -13.676 1.00 26.42 ? 497  PRO A C   1 
ATOM   2838 O  O   . PRO A 1 421 ? -8.764  8.474   -13.175 1.00 25.30 ? 497  PRO A O   1 
ATOM   2839 C  CB  . PRO A 1 421 ? -6.390  7.058   -14.621 1.00 24.36 ? 497  PRO A CB  1 
ATOM   2840 C  CG  . PRO A 1 421 ? -6.913  5.904   -13.817 1.00 22.26 ? 497  PRO A CG  1 
ATOM   2841 C  CD  . PRO A 1 421 ? -6.334  6.117   -12.421 1.00 24.72 ? 497  PRO A CD  1 
ATOM   2842 N  N   . ASN A 1 422 ? -7.735  10.148  -14.279 1.00 26.34 ? 498  ASN A N   1 
ATOM   2843 C  CA  . ASN A 1 422 ? -8.955  10.908  -14.515 1.00 25.20 ? 498  ASN A CA  1 
ATOM   2844 C  C   . ASN A 1 422 ? -8.803  11.639  -15.844 1.00 25.42 ? 498  ASN A C   1 
ATOM   2845 O  O   . ASN A 1 422 ? -7.766  11.544  -16.508 1.00 25.48 ? 498  ASN A O   1 
ATOM   2846 C  CB  . ASN A 1 422 ? -9.255  11.863  -13.351 1.00 25.11 ? 498  ASN A CB  1 
ATOM   2847 C  CG  . ASN A 1 422 ? -8.123  12.832  -13.076 1.00 29.27 ? 498  ASN A CG  1 
ATOM   2848 O  OD1 . ASN A 1 422 ? -7.537  13.410  -13.993 1.00 30.78 ? 498  ASN A OD1 1 
ATOM   2849 N  ND2 . ASN A 1 422 ? -7.804  13.012  -11.800 1.00 31.07 ? 498  ASN A ND2 1 
ATOM   2850 N  N   . GLU A 1 423 ? -9.847  12.381  -16.230 1.00 24.12 ? 499  GLU A N   1 
ATOM   2851 C  CA  . GLU A 1 423 ? -9.831  13.043  -17.531 1.00 26.35 ? 499  GLU A CA  1 
ATOM   2852 C  C   . GLU A 1 423 ? -8.762  14.123  -17.611 1.00 28.46 ? 499  GLU A C   1 
ATOM   2853 O  O   . GLU A 1 423 ? -8.306  14.449  -18.714 1.00 27.60 ? 499  GLU A O   1 
ATOM   2854 C  CB  . GLU A 1 423 ? -11.208 13.634  -17.849 1.00 28.99 ? 499  GLU A CB  1 
ATOM   2855 C  CG  . GLU A 1 423 ? -11.518 14.964  -17.168 1.00 29.88 ? 499  GLU A CG  1 
ATOM   2856 C  CD  . GLU A 1 423 ? -11.994 14.806  -15.731 1.00 33.38 ? 499  GLU A CD  1 
ATOM   2857 O  OE1 . GLU A 1 423 ? -11.953 13.676  -15.197 1.00 32.81 ? 499  GLU A OE1 1 
ATOM   2858 O  OE2 . GLU A 1 423 ? -12.419 15.819  -15.139 1.00 34.70 ? 499  GLU A OE2 1 
ATOM   2859 N  N   . THR A 1 424 ? -8.339  14.671  -16.469 1.00 27.45 ? 500  THR A N   1 
ATOM   2860 C  CA  . THR A 1 424 ? -7.314  15.706  -16.475 1.00 29.47 ? 500  THR A CA  1 
ATOM   2861 C  C   . THR A 1 424 ? -5.924  15.112  -16.677 1.00 26.28 ? 500  THR A C   1 
ATOM   2862 O  O   . THR A 1 424 ? -5.201  15.501  -17.602 1.00 28.15 ? 500  THR A O   1 
ATOM   2863 C  CB  . THR A 1 424 ? -7.371  16.517  -15.177 1.00 31.51 ? 500  THR A CB  1 
ATOM   2864 O  OG1 . THR A 1 424 ? -8.679  17.084  -15.031 1.00 34.78 ? 500  THR A OG1 1 
ATOM   2865 C  CG2 . THR A 1 424 ? -6.344  17.639  -15.213 1.00 30.04 ? 500  THR A CG2 1 
ATOM   2866 N  N   . ASN A 1 425 ? -5.525  14.163  -15.827 1.00 26.27 ? 501  ASN A N   1 
ATOM   2867 C  CA  . ASN A 1 425 ? -4.174  13.633  -15.960 1.00 26.41 ? 501  ASN A CA  1 
ATOM   2868 C  C   . ASN A 1 425 ? -4.031  12.655  -17.122 1.00 26.49 ? 501  ASN A C   1 
ATOM   2869 O  O   . ASN A 1 425 ? -2.899  12.334  -17.498 1.00 27.45 ? 501  ASN A O   1 
ATOM   2870 C  CB  . ASN A 1 425 ? -3.700  12.994  -14.641 1.00 28.45 ? 501  ASN A CB  1 
ATOM   2871 C  CG  . ASN A 1 425 ? -4.578  11.846  -14.172 1.00 31.00 ? 501  ASN A CG  1 
ATOM   2872 O  OD1 . ASN A 1 425 ? -5.067  11.046  -14.967 1.00 29.63 ? 501  ASN A OD1 1 
ATOM   2873 N  ND2 . ASN A 1 425 ? -4.763  11.752  -12.852 1.00 31.69 ? 501  ASN A ND2 1 
ATOM   2874 N  N   . GLN A 1 426 ? -5.132  12.190  -17.712 1.00 27.04 ? 502  GLN A N   1 
ATOM   2875 C  CA  . GLN A 1 426 ? -5.074  11.453  -18.969 1.00 28.53 ? 502  GLN A CA  1 
ATOM   2876 C  C   . GLN A 1 426 ? -5.362  12.342  -20.175 1.00 28.90 ? 502  GLN A C   1 
ATOM   2877 O  O   . GLN A 1 426 ? -5.447  11.831  -21.299 1.00 26.45 ? 502  GLN A O   1 
ATOM   2878 C  CB  . GLN A 1 426 ? -6.044  10.266  -18.937 1.00 27.37 ? 502  GLN A CB  1 
ATOM   2879 C  CG  . GLN A 1 426 ? -5.814  9.311   -17.764 1.00 27.38 ? 502  GLN A CG  1 
ATOM   2880 C  CD  . GLN A 1 426 ? -4.401  8.750   -17.728 1.00 29.51 ? 502  GLN A CD  1 
ATOM   2881 O  OE1 . GLN A 1 426 ? -4.017  7.939   -18.577 1.00 28.19 ? 502  GLN A OE1 1 
ATOM   2882 N  NE2 . GLN A 1 426 ? -3.618  9.183   -16.742 1.00 27.53 ? 502  GLN A NE2 1 
ATOM   2883 N  N   A ASN A 1 427 ? -5.527  13.649  -19.967 0.52 29.00 ? 503  ASN A N   1 
ATOM   2884 N  N   B ASN A 1 427 ? -5.492  13.652  -19.958 0.48 29.01 ? 503  ASN A N   1 
ATOM   2885 C  CA  A ASN A 1 427 ? -5.721  14.614  -21.052 0.52 29.14 ? 503  ASN A CA  1 
ATOM   2886 C  CA  B ASN A 1 427 ? -5.763  14.651  -20.998 0.48 29.13 ? 503  ASN A CA  1 
ATOM   2887 C  C   A ASN A 1 427 ? -6.870  14.201  -21.974 0.52 27.31 ? 503  ASN A C   1 
ATOM   2888 C  C   B ASN A 1 427 ? -6.861  14.190  -21.953 0.48 27.32 ? 503  ASN A C   1 
ATOM   2889 O  O   A ASN A 1 427 ? -6.757  14.231  -23.202 0.52 27.21 ? 503  ASN A O   1 
ATOM   2890 O  O   B ASN A 1 427 ? -6.706  14.180  -23.176 0.48 27.21 ? 503  ASN A O   1 
ATOM   2891 C  CB  A ASN A 1 427 ? -4.427  14.810  -21.844 0.52 31.14 ? 503  ASN A CB  1 
ATOM   2892 C  CB  B ASN A 1 427 ? -4.497  15.019  -21.763 0.48 31.21 ? 503  ASN A CB  1 
ATOM   2893 C  CG  A ASN A 1 427 ? -3.291  15.333  -20.984 0.52 33.65 ? 503  ASN A CG  1 
ATOM   2894 C  CG  B ASN A 1 427 ? -4.617  16.362  -22.464 0.48 33.59 ? 503  ASN A CG  1 
ATOM   2895 O  OD1 A ASN A 1 427 ? -3.269  16.507  -20.613 0.52 35.38 ? 503  ASN A OD1 1 
ATOM   2896 O  OD1 B ASN A 1 427 ? -5.250  17.289  -21.951 0.48 35.29 ? 503  ASN A OD1 1 
ATOM   2897 N  ND2 A ASN A 1 427 ? -2.334  14.464  -20.670 0.52 34.86 ? 503  ASN A ND2 1 
ATOM   2898 N  ND2 B ASN A 1 427 ? -4.021  16.470  -23.645 0.48 34.82 ? 503  ASN A ND2 1 
ATOM   2899 N  N   . PHE A 1 428 ? -7.985  13.795  -21.363 1.00 25.08 ? 504  PHE A N   1 
ATOM   2900 C  CA  . PHE A 1 428 ? -9.225  13.476  -22.070 1.00 25.11 ? 504  PHE A CA  1 
ATOM   2901 C  C   . PHE A 1 428 ? -9.109  12.291  -23.030 1.00 23.40 ? 504  PHE A C   1 
ATOM   2902 O  O   . PHE A 1 428 ? -9.981  12.110  -23.885 1.00 25.06 ? 504  PHE A O   1 
ATOM   2903 C  CB  . PHE A 1 428 ? -9.779  14.706  -22.801 1.00 25.67 ? 504  PHE A CB  1 
ATOM   2904 C  CG  . PHE A 1 428 ? -10.516 15.649  -21.901 1.00 27.73 ? 504  PHE A CG  1 
ATOM   2905 C  CD1 . PHE A 1 428 ? -9.824  16.464  -21.019 1.00 27.45 ? 504  PHE A CD1 1 
ATOM   2906 C  CD2 . PHE A 1 428 ? -11.900 15.707  -21.918 1.00 27.81 ? 504  PHE A CD2 1 
ATOM   2907 C  CE1 . PHE A 1 428 ? -10.500 17.326  -20.174 1.00 29.26 ? 504  PHE A CE1 1 
ATOM   2908 C  CE2 . PHE A 1 428 ? -12.584 16.564  -21.073 1.00 28.34 ? 504  PHE A CE2 1 
ATOM   2909 C  CZ  . PHE A 1 428 ? -11.880 17.377  -20.202 1.00 29.60 ? 504  PHE A CZ  1 
ATOM   2910 N  N   . SER A 1 429 ? -8.071  11.460  -22.908 1.00 22.25 ? 505  SER A N   1 
ATOM   2911 C  CA  . SER A 1 429 ? -8.127  10.123  -23.496 1.00 23.26 ? 505  SER A CA  1 
ATOM   2912 C  C   . SER A 1 429 ? -8.851  9.125   -22.597 1.00 23.33 ? 505  SER A C   1 
ATOM   2913 O  O   . SER A 1 429 ? -9.099  7.993   -23.024 1.00 21.55 ? 505  SER A O   1 
ATOM   2914 C  CB  . SER A 1 429 ? -6.719  9.598   -23.794 1.00 24.19 ? 505  SER A CB  1 
ATOM   2915 O  OG  . SER A 1 429 ? -6.187  10.197  -24.958 1.00 26.59 ? 505  SER A OG  1 
ATOM   2916 N  N   . TYR A 1 430 ? -9.174  9.517   -21.367 1.00 21.33 ? 506  TYR A N   1 
ATOM   2917 C  CA  . TYR A 1 430 ? -9.878  8.678   -20.403 1.00 20.48 ? 506  TYR A CA  1 
ATOM   2918 C  C   . TYR A 1 430 ? -10.976 9.533   -19.791 1.00 21.18 ? 506  TYR A C   1 
ATOM   2919 O  O   . TYR A 1 430 ? -10.682 10.553  -19.166 1.00 25.30 ? 506  TYR A O   1 
ATOM   2920 C  CB  . TYR A 1 430 ? -8.908  8.160   -19.334 1.00 21.98 ? 506  TYR A CB  1 
ATOM   2921 C  CG  . TYR A 1 430 ? -9.484  7.214   -18.295 1.00 23.37 ? 506  TYR A CG  1 
ATOM   2922 C  CD1 . TYR A 1 430 ? -9.980  5.965   -18.655 1.00 22.62 ? 506  TYR A CD1 1 
ATOM   2923 C  CD2 . TYR A 1 430 ? -9.478  7.552   -16.943 1.00 26.38 ? 506  TYR A CD2 1 
ATOM   2924 C  CE1 . TYR A 1 430 ? -10.486 5.090   -17.700 1.00 20.26 ? 506  TYR A CE1 1 
ATOM   2925 C  CE2 . TYR A 1 430 ? -9.981  6.684   -15.981 1.00 24.81 ? 506  TYR A CE2 1 
ATOM   2926 C  CZ  . TYR A 1 430 ? -10.483 5.459   -16.363 1.00 22.39 ? 506  TYR A CZ  1 
ATOM   2927 O  OH  . TYR A 1 430 ? -10.985 4.597   -15.407 1.00 21.72 ? 506  TYR A OH  1 
ATOM   2928 N  N   . LEU A 1 431 ? -12.234 9.148   -20.004 1.00 22.54 ? 507  LEU A N   1 
ATOM   2929 C  CA  . LEU A 1 431 ? -13.368 9.959   -19.566 1.00 25.47 ? 507  LEU A CA  1 
ATOM   2930 C  C   . LEU A 1 431 ? -14.468 9.125   -18.927 1.00 24.73 ? 507  LEU A C   1 
ATOM   2931 O  O   . LEU A 1 431 ? -15.631 9.262   -19.327 1.00 26.88 ? 507  LEU A O   1 
ATOM   2932 C  CB  . LEU A 1 431 ? -14.008 10.702  -20.736 1.00 29.41 ? 507  LEU A CB  1 
ATOM   2933 C  CG  . LEU A 1 431 ? -13.187 11.421  -21.780 1.00 30.95 ? 507  LEU A CG  1 
ATOM   2934 C  CD1 . LEU A 1 431 ? -14.142 12.002  -22.811 1.00 26.22 ? 507  LEU A CD1 1 
ATOM   2935 C  CD2 . LEU A 1 431 ? -12.416 12.503  -21.093 0.18 30.51 ? 507  LEU A CD2 1 
ATOM   2936 N  N   . PRO A 1 432 ? -14.169 8.269   -17.947 1.00 24.16 ? 508  PRO A N   1 
ATOM   2937 C  CA  . PRO A 1 432 ? -15.232 7.410   -17.401 1.00 25.81 ? 508  PRO A CA  1 
ATOM   2938 C  C   . PRO A 1 432 ? -16.420 8.195   -16.872 1.00 25.67 ? 508  PRO A C   1 
ATOM   2939 O  O   . PRO A 1 432 ? -17.563 7.741   -17.009 1.00 27.40 ? 508  PRO A O   1 
ATOM   2940 C  CB  . PRO A 1 432 ? -14.516 6.635   -16.286 1.00 24.88 ? 508  PRO A CB  1 
ATOM   2941 C  CG  . PRO A 1 432 ? -13.375 7.499   -15.898 1.00 24.08 ? 508  PRO A CG  1 
ATOM   2942 C  CD  . PRO A 1 432 ? -12.924 8.164   -17.167 1.00 22.77 ? 508  PRO A CD  1 
ATOM   2943 N  N   . PHE A 1 433 ? -16.190 9.383   -16.313 1.00 22.98 ? 509  PHE A N   1 
ATOM   2944 C  CA  . PHE A 1 433 ? -17.259 10.189  -15.733 1.00 23.42 ? 509  PHE A CA  1 
ATOM   2945 C  C   . PHE A 1 433 ? -17.451 11.509  -16.474 1.00 25.28 ? 509  PHE A C   1 
ATOM   2946 O  O   . PHE A 1 433 ? -18.015 12.458  -15.917 1.00 22.73 ? 509  PHE A O   1 
ATOM   2947 C  CB  . PHE A 1 433 ? -16.980 10.430  -14.249 1.00 23.31 ? 509  PHE A CB  1 
ATOM   2948 C  CG  . PHE A 1 433 ? -16.928 9.167   -13.436 1.00 21.46 ? 509  PHE A CG  1 
ATOM   2949 C  CD1 . PHE A 1 433 ? -18.094 8.526   -13.061 1.00 22.57 ? 509  PHE A CD1 1 
ATOM   2950 C  CD2 . PHE A 1 433 ? -15.718 8.620   -13.052 1.00 24.55 ? 509  PHE A CD2 1 
ATOM   2951 C  CE1 . PHE A 1 433 ? -18.057 7.361   -12.314 1.00 21.54 ? 509  PHE A CE1 1 
ATOM   2952 C  CE2 . PHE A 1 433 ? -15.672 7.455   -12.296 1.00 24.90 ? 509  PHE A CE2 1 
ATOM   2953 C  CZ  . PHE A 1 433 ? -16.845 6.825   -11.934 1.00 21.96 ? 509  PHE A CZ  1 
ATOM   2954 N  N   . GLY A 1 434 ? -17.005 11.584  -17.723 1.00 22.70 ? 510  GLY A N   1 
ATOM   2955 C  CA  . GLY A 1 434 ? -17.126 12.812  -18.478 1.00 23.19 ? 510  GLY A CA  1 
ATOM   2956 C  C   . GLY A 1 434 ? -16.052 13.818  -18.102 1.00 25.57 ? 510  GLY A C   1 
ATOM   2957 O  O   . GLY A 1 434 ? -15.000 13.485  -17.543 1.00 27.31 ? 510  GLY A O   1 
ATOM   2958 N  N   . GLY A 1 435 ? -16.328 15.074  -18.424 1.00 25.73 ? 511  GLY A N   1 
ATOM   2959 C  CA  . GLY A 1 435 ? -15.389 16.141  -18.131 1.00 26.78 ? 511  GLY A CA  1 
ATOM   2960 C  C   . GLY A 1 435 ? -16.070 17.478  -18.295 1.00 26.47 ? 511  GLY A C   1 
ATOM   2961 O  O   . GLY A 1 435 ? -17.186 17.572  -18.813 1.00 26.24 ? 511  GLY A O   1 
ATOM   2962 N  N   . GLY A 1 436 ? -15.378 18.520  -17.840 1.00 25.52 ? 512  GLY A N   1 
ATOM   2963 C  CA  . GLY A 1 436 ? -15.890 19.866  -17.928 1.00 24.62 ? 512  GLY A CA  1 
ATOM   2964 C  C   . GLY A 1 436 ? -17.090 20.085  -17.030 1.00 26.58 ? 512  GLY A C   1 
ATOM   2965 O  O   . GLY A 1 436 ? -17.354 19.305  -16.109 1.00 27.25 ? 512  GLY A O   1 
ATOM   2966 N  N   . PRO A 1 437 ? -17.860 21.144  -17.306 1.00 27.67 ? 513  PRO A N   1 
ATOM   2967 C  CA  . PRO A 1 437 ? -18.939 21.534  -16.379 1.00 28.39 ? 513  PRO A CA  1 
ATOM   2968 C  C   . PRO A 1 437 ? -20.006 20.473  -16.189 1.00 26.31 ? 513  PRO A C   1 
ATOM   2969 O  O   . PRO A 1 437 ? -20.673 20.466  -15.147 1.00 24.52 ? 513  PRO A O   1 
ATOM   2970 C  CB  . PRO A 1 437 ? -19.528 22.796  -17.031 1.00 30.11 ? 513  PRO A CB  1 
ATOM   2971 C  CG  . PRO A 1 437 ? -18.472 23.277  -17.987 1.00 31.91 ? 513  PRO A CG  1 
ATOM   2972 C  CD  . PRO A 1 437 ? -17.754 22.053  -18.461 1.00 27.31 ? 513  PRO A CD  1 
ATOM   2973 N  N   . ARG A 1 438 ? -20.191 19.576  -17.155 1.00 26.15 ? 514  ARG A N   1 
ATOM   2974 C  CA  . ARG A 1 438 ? -21.238 18.567  -17.095 1.00 24.56 ? 514  ARG A CA  1 
ATOM   2975 C  C   . ARG A 1 438 ? -20.734 17.235  -16.560 1.00 24.08 ? 514  ARG A C   1 
ATOM   2976 O  O   . ARG A 1 438 ? -21.432 16.222  -16.689 1.00 22.90 ? 514  ARG A O   1 
ATOM   2977 C  CB  . ARG A 1 438 ? -21.862 18.375  -18.482 1.00 21.67 ? 514  ARG A CB  1 
ATOM   2978 C  CG  . ARG A 1 438 ? -22.385 19.670  -19.089 1.00 23.57 ? 514  ARG A CG  1 
ATOM   2979 C  CD  . ARG A 1 438 ? -23.376 20.353  -18.141 1.00 24.37 ? 514  ARG A CD  1 
ATOM   2980 N  NE  . ARG A 1 438 ? -24.576 19.541  -17.944 1.00 23.84 ? 514  ARG A NE  1 
ATOM   2981 C  CZ  . ARG A 1 438 ? -25.688 19.662  -18.661 1.00 26.46 ? 514  ARG A CZ  1 
ATOM   2982 N  NH1 . ARG A 1 438 ? -25.765 20.572  -19.633 1.00 27.98 ? 514  ARG A NH1 1 
ATOM   2983 N  NH2 . ARG A 1 438 ? -26.725 18.872  -18.413 1.00 23.55 ? 514  ARG A NH2 1 
ATOM   2984 N  N   . LYS A 1 439 ? -19.539 17.216  -15.972 1.00 23.99 ? 515  LYS A N   1 
ATOM   2985 C  CA  . LYS A 1 439 ? -18.968 15.988  -15.436 1.00 24.29 ? 515  LYS A CA  1 
ATOM   2986 C  C   . LYS A 1 439 ? -19.889 15.378  -14.385 1.00 23.53 ? 515  LYS A C   1 
ATOM   2987 O  O   . LYS A 1 439 ? -20.608 16.081  -13.672 1.00 23.69 ? 515  LYS A O   1 
ATOM   2988 C  CB  . LYS A 1 439 ? -17.589 16.267  -14.829 1.00 26.51 ? 515  LYS A CB  1 
ATOM   2989 C  CG  . LYS A 1 439 ? -16.854 15.028  -14.340 1.00 26.47 ? 515  LYS A CG  1 
ATOM   2990 C  CD  . LYS A 1 439 ? -15.569 15.391  -13.621 1.00 28.93 ? 515  LYS A CD  1 
ATOM   2991 C  CE  . LYS A 1 439 ? -14.832 14.139  -13.173 1.00 29.17 ? 515  LYS A CE  1 
ATOM   2992 N  NZ  . LYS A 1 439 ? -13.503 14.464  -12.598 1.00 31.18 ? 515  LYS A NZ  1 
ATOM   2993 N  N   . CYS A 1 440 ? -19.864 14.047  -14.308 1.00 22.56 ? 516  CYS A N   1 
ATOM   2994 C  CA  . CYS A 1 440 ? -20.655 13.302  -13.335 1.00 20.43 ? 516  CYS A CA  1 
ATOM   2995 C  C   . CYS A 1 440 ? -20.474 13.838  -11.916 1.00 20.69 ? 516  CYS A C   1 
ATOM   2996 O  O   . CYS A 1 440 ? -19.350 14.063  -11.460 1.00 21.59 ? 516  CYS A O   1 
ATOM   2997 C  CB  . CYS A 1 440 ? -20.249 11.830  -13.392 1.00 22.67 ? 516  CYS A CB  1 
ATOM   2998 S  SG  . CYS A 1 440 ? -20.939 10.831  -12.090 1.00 24.10 ? 516  CYS A SG  1 
ATOM   2999 N  N   . ILE A 1 441 ? -21.596 14.036  -11.214 1.00 20.15 ? 517  ILE A N   1 
ATOM   3000 C  CA  . ILE A 1 441 ? -21.545 14.423  -9.805  1.00 22.30 ? 517  ILE A CA  1 
ATOM   3001 C  C   . ILE A 1 441 ? -21.461 13.223  -8.873  1.00 23.32 ? 517  ILE A C   1 
ATOM   3002 O  O   . ILE A 1 441 ? -21.198 13.402  -7.676  1.00 24.04 ? 517  ILE A O   1 
ATOM   3003 C  CB  . ILE A 1 441 ? -22.762 15.274  -9.384  1.00 23.95 ? 517  ILE A CB  1 
ATOM   3004 C  CG1 . ILE A 1 441 ? -24.057 14.463  -9.483  1.00 23.73 ? 517  ILE A CG1 1 
ATOM   3005 C  CG2 . ILE A 1 441 ? -22.840 16.544  -10.214 1.00 23.37 ? 517  ILE A CG2 1 
ATOM   3006 C  CD1 . ILE A 1 441 ? -25.265 15.185  -8.925  1.00 26.69 ? 517  ILE A CD1 1 
ATOM   3007 N  N   . GLY A 1 442 ? -21.666 12.008  -9.377  1.00 24.67 ? 518  GLY A N   1 
ATOM   3008 C  CA  . GLY A 1 442 ? -21.603 10.834  -8.529  1.00 24.23 ? 518  GLY A CA  1 
ATOM   3009 C  C   . GLY A 1 442 ? -20.315 10.051  -8.668  1.00 24.38 ? 518  GLY A C   1 
ATOM   3010 O  O   . GLY A 1 442 ? -20.279 8.858   -8.351  1.00 25.59 ? 518  GLY A O   1 
ATOM   3011 N  N   . ASP A 1 443 ? -19.241 10.711  -9.113  1.00 23.73 ? 519  ASP A N   1 
ATOM   3012 C  CA  . ASP A 1 443 ? -18.041 9.975   -9.499  1.00 23.64 ? 519  ASP A CA  1 
ATOM   3013 C  C   . ASP A 1 443 ? -17.320 9.378   -8.293  1.00 23.67 ? 519  ASP A C   1 
ATOM   3014 O  O   . ASP A 1 443 ? -16.800 8.259   -8.377  1.00 23.78 ? 519  ASP A O   1 
ATOM   3015 C  CB  . ASP A 1 443 ? -17.100 10.867  -10.312 1.00 23.71 ? 519  ASP A CB  1 
ATOM   3016 C  CG  . ASP A 1 443 ? -16.695 12.121  -9.580  1.00 26.99 ? 519  ASP A CG  1 
ATOM   3017 O  OD1 . ASP A 1 443 ? -17.491 12.613  -8.752  1.00 28.85 ? 519  ASP A OD1 1 
ATOM   3018 O  OD2 . ASP A 1 443 ? -15.580 12.621  -9.844  1.00 27.04 ? 519  ASP A OD2 1 
ATOM   3019 N  N   . MET A 1 444 ? -17.268 10.095  -7.166  1.00 22.11 ? 520  MET A N   1 
ATOM   3020 C  CA  . MET A 1 444 ? -16.673 9.507   -5.966  1.00 22.69 ? 520  MET A CA  1 
ATOM   3021 C  C   . MET A 1 444 ? -17.583 8.436   -5.377  1.00 23.35 ? 520  MET A C   1 
ATOM   3022 O  O   . MET A 1 444 ? -17.125 7.344   -5.021  1.00 22.69 ? 520  MET A O   1 
ATOM   3023 C  CB  . MET A 1 444 ? -16.376 10.590  -4.926  1.00 26.27 ? 520  MET A CB  1 
ATOM   3024 C  CG  . MET A 1 444 ? -15.329 11.595  -5.367  1.00 36.54 ? 520  MET A CG  1 
ATOM   3025 S  SD  . MET A 1 444 ? -13.856 10.841  -6.097  1.00 47.32 ? 520  MET A SD  1 
ATOM   3026 C  CE  . MET A 1 444 ? -13.112 10.053  -4.671  1.00 49.34 ? 520  MET A CE  1 
ATOM   3027 N  N   . PHE A 1 445 ? -18.877 8.745   -5.255  1.00 22.53 ? 521  PHE A N   1 
ATOM   3028 C  CA  . PHE A 1 445 ? -19.895 7.775   -4.869  1.00 21.95 ? 521  PHE A CA  1 
ATOM   3029 C  C   . PHE A 1 445 ? -19.724 6.451   -5.611  1.00 22.91 ? 521  PHE A C   1 
ATOM   3030 O  O   . PHE A 1 445 ? -19.572 5.386   -4.996  1.00 22.06 ? 521  PHE A O   1 
ATOM   3031 C  CB  . PHE A 1 445 ? -21.276 8.384   -5.149  1.00 21.85 ? 521  PHE A CB  1 
ATOM   3032 C  CG  . PHE A 1 445 ? -22.441 7.546   -4.685  1.00 22.28 ? 521  PHE A CG  1 
ATOM   3033 C  CD1 . PHE A 1 445 ? -22.860 6.443   -5.412  1.00 21.64 ? 521  PHE A CD1 1 
ATOM   3034 C  CD2 . PHE A 1 445 ? -23.150 7.898   -3.543  1.00 24.22 ? 521  PHE A CD2 1 
ATOM   3035 C  CE1 . PHE A 1 445 ? -23.940 5.688   -4.998  1.00 23.06 ? 521  PHE A CE1 1 
ATOM   3036 C  CE2 . PHE A 1 445 ? -24.237 7.146   -3.120  1.00 23.97 ? 521  PHE A CE2 1 
ATOM   3037 C  CZ  . PHE A 1 445 ? -24.631 6.038   -3.849  1.00 23.50 ? 521  PHE A CZ  1 
ATOM   3038 N  N   . ALA A 1 446 ? -19.744 6.515   -6.947  1.00 18.14 ? 522  ALA A N   1 
ATOM   3039 C  CA  . ALA A 1 446 ? -19.746 5.304   -7.761  1.00 18.61 ? 522  ALA A CA  1 
ATOM   3040 C  C   . ALA A 1 446 ? -18.400 4.590   -7.712  1.00 19.30 ? 522  ALA A C   1 
ATOM   3041 O  O   . ALA A 1 446 ? -18.350 3.353   -7.715  1.00 19.98 ? 522  ALA A O   1 
ATOM   3042 C  CB  . ALA A 1 446 ? -20.117 5.649   -9.204  1.00 19.67 ? 522  ALA A CB  1 
ATOM   3043 N  N   . SER A 1 447 ? -17.299 5.347   -7.679  1.00 17.78 ? 523  SER A N   1 
ATOM   3044 C  CA  . SER A 1 447 ? -15.979 4.732   -7.592  1.00 21.32 ? 523  SER A CA  1 
ATOM   3045 C  C   . SER A 1 447 ? -15.849 3.891   -6.326  1.00 22.77 ? 523  SER A C   1 
ATOM   3046 O  O   . SER A 1 447 ? -15.376 2.748   -6.367  1.00 22.30 ? 523  SER A O   1 
ATOM   3047 C  CB  . SER A 1 447 ? -14.894 5.810   -7.641  1.00 22.72 ? 523  SER A CB  1 
ATOM   3048 O  OG  . SER A 1 447 ? -14.882 6.458   -8.908  1.00 27.55 ? 523  SER A OG  1 
ATOM   3049 N  N   . PHE A 1 448 ? -16.279 4.438   -5.189  1.00 21.12 ? 524  PHE A N   1 
ATOM   3050 C  CA  . PHE A 1 448 ? -16.218 3.680   -3.944  1.00 21.29 ? 524  PHE A CA  1 
ATOM   3051 C  C   . PHE A 1 448 ? -17.197 2.517   -3.963  1.00 19.32 ? 524  PHE A C   1 
ATOM   3052 O  O   . PHE A 1 448 ? -16.864 1.414   -3.519  1.00 21.11 ? 524  PHE A O   1 
ATOM   3053 C  CB  . PHE A 1 448 ? -16.499 4.595   -2.753  1.00 23.15 ? 524  PHE A CB  1 
ATOM   3054 C  CG  . PHE A 1 448 ? -15.436 5.626   -2.523  1.00 26.12 ? 524  PHE A CG  1 
ATOM   3055 C  CD1 . PHE A 1 448 ? -14.189 5.499   -3.118  1.00 28.15 ? 524  PHE A CD1 1 
ATOM   3056 C  CD2 . PHE A 1 448 ? -15.679 6.719   -1.715  1.00 25.86 ? 524  PHE A CD2 1 
ATOM   3057 C  CE1 . PHE A 1 448 ? -13.204 6.449   -2.914  1.00 29.58 ? 524  PHE A CE1 1 
ATOM   3058 C  CE2 . PHE A 1 448 ? -14.699 7.672   -1.505  1.00 30.45 ? 524  PHE A CE2 1 
ATOM   3059 C  CZ  . PHE A 1 448 ? -13.460 7.537   -2.104  1.00 30.40 ? 524  PHE A CZ  1 
ATOM   3060 N  N   . GLU A 1 449 ? -18.409 2.752   -4.476  1.00 20.53 ? 525  GLU A N   1 
ATOM   3061 C  CA  . GLU A 1 449 ? -19.419 1.703   -4.550  1.00 19.99 ? 525  GLU A CA  1 
ATOM   3062 C  C   . GLU A 1 449 ? -18.882 0.478   -5.271  1.00 20.21 ? 525  GLU A C   1 
ATOM   3063 O  O   . GLU A 1 449 ? -19.013 -0.652  -4.790  1.00 19.94 ? 525  GLU A O   1 
ATOM   3064 C  CB  . GLU A 1 449 ? -20.671 2.233   -5.252  1.00 20.26 ? 525  GLU A CB  1 
ATOM   3065 C  CG  . GLU A 1 449 ? -21.729 1.183   -5.537  1.00 21.54 ? 525  GLU A CG  1 
ATOM   3066 C  CD  . GLU A 1 449 ? -22.937 1.748   -6.270  1.00 23.99 ? 525  GLU A CD  1 
ATOM   3067 O  OE1 . GLU A 1 449 ? -22.933 2.954   -6.613  1.00 23.73 ? 525  GLU A OE1 1 
ATOM   3068 O  OE2 . GLU A 1 449 ? -23.897 0.986   -6.501  1.00 22.64 ? 525  GLU A OE2 1 
ATOM   3069 N  N   . ASN A 1 450 ? -18.251 0.689   -6.422  1.00 21.66 ? 526  ASN A N   1 
ATOM   3070 C  CA  . ASN A 1 450 ? -17.775 -0.443  -7.205  1.00 20.47 ? 526  ASN A CA  1 
ATOM   3071 C  C   . ASN A 1 450 ? -16.561 -1.100  -6.552  1.00 20.93 ? 526  ASN A C   1 
ATOM   3072 O  O   . ASN A 1 450 ? -16.421 -2.327  -6.592  1.00 20.08 ? 526  ASN A O   1 
ATOM   3073 C  CB  . ASN A 1 450 ? -17.481 0.009   -8.636  1.00 22.02 ? 526  ASN A CB  1 
ATOM   3074 C  CG  . ASN A 1 450 ? -18.753 0.306   -9.409  1.00 23.71 ? 526  ASN A CG  1 
ATOM   3075 O  OD1 . ASN A 1 450 ? -19.536 -0.597  -9.696  1.00 28.37 ? 526  ASN A OD1 1 
ATOM   3076 N  ND2 . ASN A 1 450 ? -18.979 1.576   -9.729  1.00 22.57 ? 526  ASN A ND2 1 
ATOM   3077 N  N   . VAL A 1 451 ? -15.689 -0.310  -5.918  1.00 20.14 ? 527  VAL A N   1 
ATOM   3078 C  CA  . VAL A 1 451 ? -14.565 -0.896  -5.187  1.00 20.92 ? 527  VAL A CA  1 
ATOM   3079 C  C   . VAL A 1 451 ? -15.066 -1.795  -4.060  1.00 20.61 ? 527  VAL A C   1 
ATOM   3080 O  O   . VAL A 1 451 ? -14.548 -2.900  -3.851  1.00 22.01 ? 527  VAL A O   1 
ATOM   3081 C  CB  . VAL A 1 451 ? -13.632 0.212   -4.661  1.00 22.82 ? 527  VAL A CB  1 
ATOM   3082 C  CG1 . VAL A 1 451 ? -12.726 -0.329  -3.560  1.00 23.02 ? 527  VAL A CG1 1 
ATOM   3083 C  CG2 . VAL A 1 451 ? -12.800 0.776   -5.804  1.00 26.06 ? 527  VAL A CG2 1 
ATOM   3084 N  N   . VAL A 1 452 ? -16.095 -1.353  -3.332  1.00 22.55 ? 528  VAL A N   1 
ATOM   3085 C  CA  . VAL A 1 452 ? -16.627 -2.160  -2.233  1.00 19.85 ? 528  VAL A CA  1 
ATOM   3086 C  C   . VAL A 1 452 ? -17.189 -3.477  -2.760  1.00 22.55 ? 528  VAL A C   1 
ATOM   3087 O  O   . VAL A 1 452 ? -16.887 -4.556  -2.234  1.00 23.50 ? 528  VAL A O   1 
ATOM   3088 C  CB  . VAL A 1 452 ? -17.692 -1.373  -1.448  1.00 19.47 ? 528  VAL A CB  1 
ATOM   3089 C  CG1 . VAL A 1 452 ? -18.414 -2.297  -0.463  1.00 18.39 ? 528  VAL A CG1 1 
ATOM   3090 C  CG2 . VAL A 1 452 ? -17.047 -0.209  -0.702  1.00 20.51 ? 528  VAL A CG2 1 
ATOM   3091 N  N   . ALA A 1 453 ? -18.024 -3.407  -3.802  1.00 19.76 ? 529  ALA A N   1 
ATOM   3092 C  CA  . ALA A 1 453 ? -18.642 -4.615  -4.344  1.00 19.86 ? 529  ALA A CA  1 
ATOM   3093 C  C   . ALA A 1 453 ? -17.589 -5.591  -4.852  1.00 21.49 ? 529  ALA A C   1 
ATOM   3094 O  O   . ALA A 1 453 ? -17.624 -6.787  -4.530  1.00 23.25 ? 529  ALA A O   1 
ATOM   3095 C  CB  . ALA A 1 453 ? -19.623 -4.251  -5.460  1.00 18.76 ? 529  ALA A CB  1 
ATOM   3096 N  N   . ILE A 1 454 ? -16.628 -5.094  -5.632  1.00 20.89 ? 530  ILE A N   1 
ATOM   3097 C  CA  . ILE A 1 454 ? -15.582 -5.964  -6.170  1.00 21.12 ? 530  ILE A CA  1 
ATOM   3098 C  C   . ILE A 1 454 ? -14.820 -6.647  -5.042  1.00 20.30 ? 530  ILE A C   1 
ATOM   3099 O  O   . ILE A 1 454 ? -14.620 -7.869  -5.050  1.00 21.30 ? 530  ILE A O   1 
ATOM   3100 C  CB  . ILE A 1 454 ? -14.629 -5.164  -7.074  1.00 21.80 ? 530  ILE A CB  1 
ATOM   3101 C  CG1 . ILE A 1 454 ? -15.364 -4.662  -8.318  1.00 22.57 ? 530  ILE A CG1 1 
ATOM   3102 C  CG2 . ILE A 1 454 ? -13.437 -6.021  -7.476  1.00 21.47 ? 530  ILE A CG2 1 
ATOM   3103 C  CD1 . ILE A 1 454 ? -14.615 -3.562  -9.049  1.00 23.36 ? 530  ILE A CD1 1 
ATOM   3104 N  N   . ALA A 1 455 ? -14.374 -5.862  -4.060  1.00 18.66 ? 531  ALA A N   1 
ATOM   3105 C  CA  . ALA A 1 455 ? -13.508 -6.396  -3.016  1.00 23.07 ? 531  ALA A CA  1 
ATOM   3106 C  C   . ALA A 1 455 ? -14.227 -7.456  -2.191  1.00 24.85 ? 531  ALA A C   1 
ATOM   3107 O  O   . ALA A 1 455 ? -13.672 -8.526  -1.921  1.00 26.90 ? 531  ALA A O   1 
ATOM   3108 C  CB  . ALA A 1 455 ? -13.003 -5.262  -2.123  1.00 21.67 ? 531  ALA A CB  1 
ATOM   3109 N  N   . MET A 1 456 ? -15.470 -7.178  -1.783  1.00 24.27 ? 532  MET A N   1 
ATOM   3110 C  CA  . MET A 1 456 ? -16.190 -8.121  -0.932  1.00 23.23 ? 532  MET A CA  1 
ATOM   3111 C  C   . MET A 1 456 ? -16.525 -9.412  -1.671  1.00 25.32 ? 532  MET A C   1 
ATOM   3112 O  O   . MET A 1 456 ? -16.510 -10.490 -1.066  1.00 24.57 ? 532  MET A O   1 
ATOM   3113 C  CB  . MET A 1 456 ? -17.460 -7.474  -0.376  1.00 24.12 ? 532  MET A CB  1 
ATOM   3114 C  CG  . MET A 1 456 ? -17.188 -6.372  0.652   1.00 26.79 ? 532  MET A CG  1 
ATOM   3115 S  SD  . MET A 1 456 ? -18.663 -5.856  1.568   1.00 27.04 ? 532  MET A SD  1 
ATOM   3116 C  CE  . MET A 1 456 ? -19.016 -7.331  2.518   1.00 26.42 ? 532  MET A CE  1 
ATOM   3117 N  N   . LEU A 1 457 ? -16.824 -9.332  -2.972  1.00 24.42 ? 533  LEU A N   1 
ATOM   3118 C  CA  . LEU A 1 457 ? -17.103 -10.546 -3.734  1.00 23.42 ? 533  LEU A CA  1 
ATOM   3119 C  C   . LEU A 1 457 ? -15.839 -11.361 -3.963  1.00 20.71 ? 533  LEU A C   1 
ATOM   3120 O  O   . LEU A 1 457 ? -15.851 -12.588 -3.813  1.00 20.77 ? 533  LEU A O   1 
ATOM   3121 C  CB  . LEU A 1 457 ? -17.757 -10.199 -5.074  1.00 21.17 ? 533  LEU A CB  1 
ATOM   3122 C  CG  . LEU A 1 457 ? -19.282 -10.286 -5.124  1.00 23.00 ? 533  LEU A CG  1 
ATOM   3123 C  CD1 . LEU A 1 457 ? -19.918 -9.245  -4.209  1.00 24.16 ? 533  LEU A CD1 1 
ATOM   3124 C  CD2 . LEU A 1 457 ? -19.778 -10.130 -6.553  1.00 24.26 ? 533  LEU A CD2 1 
ATOM   3125 N  N   . ILE A 1 458 ? -14.740 -10.699 -4.335  1.00 23.33 ? 534  ILE A N   1 
ATOM   3126 C  CA  . ILE A 1 458 ? -13.506 -11.414 -4.648  1.00 26.12 ? 534  ILE A CA  1 
ATOM   3127 C  C   . ILE A 1 458 ? -12.905 -12.024 -3.387  1.00 27.32 ? 534  ILE A C   1 
ATOM   3128 O  O   . ILE A 1 458 ? -12.240 -13.067 -3.446  1.00 26.42 ? 534  ILE A O   1 
ATOM   3129 C  CB  . ILE A 1 458 ? -12.528 -10.466 -5.372  1.00 26.96 ? 534  ILE A CB  1 
ATOM   3130 C  CG1 . ILE A 1 458 ? -13.054 -10.154 -6.773  1.00 26.02 ? 534  ILE A CG1 1 
ATOM   3131 C  CG2 . ILE A 1 458 ? -11.141 -11.072 -5.481  1.00 28.50 ? 534  ILE A CG2 1 
ATOM   3132 C  CD1 . ILE A 1 458 ? -13.153 -11.385 -7.670  1.00 28.96 ? 534  ILE A CD1 1 
ATOM   3133 N  N   . ARG A 1 459 ? -13.153 -11.407 -2.229  1.00 25.68 ? 535  ARG A N   1 
ATOM   3134 C  CA  . ARG A 1 459 ? -12.732 -11.992 -0.958  1.00 25.87 ? 535  ARG A CA  1 
ATOM   3135 C  C   . ARG A 1 459 ? -13.347 -13.370 -0.746  1.00 25.64 ? 535  ARG A C   1 
ATOM   3136 O  O   . ARG A 1 459 ? -12.682 -14.289 -0.251  1.00 26.74 ? 535  ARG A O   1 
ATOM   3137 C  CB  . ARG A 1 459 ? -13.116 -11.058 0.191   1.00 25.19 ? 535  ARG A CB  1 
ATOM   3138 C  CG  . ARG A 1 459 ? -13.177 -11.727 1.566   1.00 28.31 ? 535  ARG A CG  1 
ATOM   3139 C  CD  . ARG A 1 459 ? -11.800 -12.125 2.056   1.00 27.66 ? 535  ARG A CD  1 
ATOM   3140 N  NE  . ARG A 1 459 ? -11.875 -12.872 3.308   1.00 31.46 ? 535  ARG A NE  1 
ATOM   3141 C  CZ  . ARG A 1 459 ? -10.849 -13.515 3.853   1.00 38.39 ? 535  ARG A CZ  1 
ATOM   3142 N  NH1 . ARG A 1 459 ? -9.667  -13.499 3.255   1.00 41.05 ? 535  ARG A NH1 1 
ATOM   3143 N  NH2 . ARG A 1 459 ? -11.004 -14.169 4.999   1.00 39.50 ? 535  ARG A NH2 1 
ATOM   3144 N  N   . ARG A 1 460 ? -14.609 -13.540 -1.130  1.00 26.60 ? 536  ARG A N   1 
ATOM   3145 C  CA  . ARG A 1 460 ? -15.383 -14.703 -0.716  1.00 27.57 ? 536  ARG A CA  1 
ATOM   3146 C  C   . ARG A 1 460 ? -15.495 -15.791 -1.774  1.00 28.04 ? 536  ARG A C   1 
ATOM   3147 O  O   . ARG A 1 460 ? -15.690 -16.956 -1.415  1.00 28.95 ? 536  ARG A O   1 
ATOM   3148 C  CB  . ARG A 1 460 ? -16.790 -14.264 -0.294  1.00 27.55 ? 536  ARG A CB  1 
ATOM   3149 C  CG  . ARG A 1 460 ? -16.794 -13.478 1.009   1.00 27.00 ? 536  ARG A CG  1 
ATOM   3150 C  CD  . ARG A 1 460 ? -18.059 -12.652 1.197   1.00 25.96 ? 536  ARG A CD  1 
ATOM   3151 N  NE  . ARG A 1 460 ? -18.045 -11.969 2.492   1.00 26.12 ? 536  ARG A NE  1 
ATOM   3152 C  CZ  . ARG A 1 460 ? -17.338 -10.874 2.756   1.00 25.58 ? 536  ARG A CZ  1 
ATOM   3153 N  NH1 . ARG A 1 460 ? -16.581 -10.319 1.815   1.00 23.96 ? 536  ARG A NH1 1 
ATOM   3154 N  NH2 . ARG A 1 460 ? -17.385 -10.337 3.969   1.00 26.47 ? 536  ARG A NH2 1 
ATOM   3155 N  N   . PHE A 1 461 ? -15.376 -15.464 -3.061  1.00 27.13 ? 537  PHE A N   1 
ATOM   3156 C  CA  . PHE A 1 461 ? -15.700 -16.427 -4.104  1.00 28.98 ? 537  PHE A CA  1 
ATOM   3157 C  C   . PHE A 1 461 ? -14.680 -16.397 -5.232  1.00 30.32 ? 537  PHE A C   1 
ATOM   3158 O  O   . PHE A 1 461 ? -14.071 -15.362 -5.518  1.00 29.14 ? 537  PHE A O   1 
ATOM   3159 C  CB  . PHE A 1 461 ? -17.092 -16.165 -4.689  1.00 28.13 ? 537  PHE A CB  1 
ATOM   3160 C  CG  . PHE A 1 461 ? -18.153 -15.956 -3.651  1.00 30.88 ? 537  PHE A CG  1 
ATOM   3161 C  CD1 . PHE A 1 461 ? -18.629 -17.022 -2.905  1.00 31.53 ? 537  PHE A CD1 1 
ATOM   3162 C  CD2 . PHE A 1 461 ? -18.671 -14.690 -3.417  1.00 28.54 ? 537  PHE A CD2 1 
ATOM   3163 C  CE1 . PHE A 1 461 ? -19.606 -16.832 -1.944  1.00 29.17 ? 537  PHE A CE1 1 
ATOM   3164 C  CE2 . PHE A 1 461 ? -19.651 -14.495 -2.463  1.00 28.50 ? 537  PHE A CE2 1 
ATOM   3165 C  CZ  . PHE A 1 461 ? -20.121 -15.569 -1.726  1.00 28.74 ? 537  PHE A CZ  1 
ATOM   3166 N  N   . ASN A 1 462 ? -14.505 -17.559 -5.866  1.00 32.21 ? 538  ASN A N   1 
ATOM   3167 C  CA  . ASN A 1 462 ? -13.851 -17.681 -7.162  1.00 34.43 ? 538  ASN A CA  1 
ATOM   3168 C  C   . ASN A 1 462 ? -14.925 -17.732 -8.237  1.00 31.97 ? 538  ASN A C   1 
ATOM   3169 O  O   . ASN A 1 462 ? -15.915 -18.459 -8.096  1.00 31.38 ? 538  ASN A O   1 
ATOM   3170 C  CB  . ASN A 1 462 ? -12.993 -18.946 -7.254  1.00 41.36 ? 538  ASN A CB  1 
ATOM   3171 C  CG  . ASN A 1 462 ? -12.041 -19.101 -6.089  1.00 48.02 ? 538  ASN A CG  1 
ATOM   3172 O  OD1 . ASN A 1 462 ? -11.022 -18.416 -6.012  1.00 51.80 ? 538  ASN A OD1 1 
ATOM   3173 N  ND2 . ASN A 1 462 ? -12.354 -20.025 -5.186  1.00 49.96 ? 538  ASN A ND2 1 
ATOM   3174 N  N   . PHE A 1 463 ? -14.726 -16.973 -9.309  1.00 29.72 ? 539  PHE A N   1 
ATOM   3175 C  CA  . PHE A 1 463 ? -15.668 -16.919 -10.416 1.00 31.10 ? 539  PHE A CA  1 
ATOM   3176 C  C   . PHE A 1 463 ? -14.997 -17.433 -11.681 1.00 33.43 ? 539  PHE A C   1 
ATOM   3177 O  O   . PHE A 1 463 ? -13.821 -17.148 -11.928 1.00 35.92 ? 539  PHE A O   1 
ATOM   3178 C  CB  . PHE A 1 463 ? -16.177 -15.490 -10.641 1.00 27.81 ? 539  PHE A CB  1 
ATOM   3179 C  CG  . PHE A 1 463 ? -16.908 -14.906 -9.457  1.00 26.54 ? 539  PHE A CG  1 
ATOM   3180 C  CD1 . PHE A 1 463 ? -18.283 -15.036 -9.338  1.00 24.08 ? 539  PHE A CD1 1 
ATOM   3181 C  CD2 . PHE A 1 463 ? -16.220 -14.220 -8.470  1.00 28.12 ? 539  PHE A CD2 1 
ATOM   3182 C  CE1 . PHE A 1 463 ? -18.958 -14.492 -8.256  1.00 24.01 ? 539  PHE A CE1 1 
ATOM   3183 C  CE2 . PHE A 1 463 ? -16.886 -13.675 -7.386  1.00 26.45 ? 539  PHE A CE2 1 
ATOM   3184 C  CZ  . PHE A 1 463 ? -18.258 -13.813 -7.279  1.00 23.63 ? 539  PHE A CZ  1 
ATOM   3185 N  N   . GLN A 1 464 ? -15.747 -18.197 -12.475 1.00 34.20 ? 540  GLN A N   1 
ATOM   3186 C  CA  . GLN A 1 464 ? -15.284 -18.669 -13.774 1.00 35.81 ? 540  GLN A CA  1 
ATOM   3187 C  C   . GLN A 1 464 ? -16.467 -18.718 -14.729 1.00 33.93 ? 540  GLN A C   1 
ATOM   3188 O  O   . GLN A 1 464 ? -17.608 -18.921 -14.306 1.00 32.87 ? 540  GLN A O   1 
ATOM   3189 C  CB  . GLN A 1 464 ? -14.635 -20.062 -13.689 1.00 37.36 ? 540  GLN A CB  1 
ATOM   3190 C  CG  . GLN A 1 464 ? -13.384 -20.152 -12.819 1.00 39.98 ? 540  GLN A CG  1 
ATOM   3191 C  CD  . GLN A 1 464 ? -12.178 -19.446 -13.425 0.24 42.51 ? 540  GLN A CD  1 
ATOM   3192 O  OE1 . GLN A 1 464 ? -12.214 -18.988 -14.569 1.00 43.35 ? 540  GLN A OE1 1 
ATOM   3193 N  NE2 . GLN A 1 464 ? -11.100 -19.360 -12.654 0.93 43.73 ? 540  GLN A NE2 1 
ATOM   3194 N  N   . ILE A 1 465 ? -16.186 -18.536 -16.024 1.00 31.98 ? 541  ILE A N   1 
ATOM   3195 C  CA  . ILE A 1 465 ? -17.215 -18.710 -17.044 1.00 31.03 ? 541  ILE A CA  1 
ATOM   3196 C  C   . ILE A 1 465 ? -17.824 -20.097 -16.912 1.00 32.36 ? 541  ILE A C   1 
ATOM   3197 O  O   . ILE A 1 465 ? -17.106 -21.099 -16.814 1.00 31.59 ? 541  ILE A O   1 
ATOM   3198 C  CB  . ILE A 1 465 ? -16.624 -18.507 -18.447 1.00 29.93 ? 541  ILE A CB  1 
ATOM   3199 C  CG1 . ILE A 1 465 ? -16.123 -17.072 -18.624 1.00 29.84 ? 541  ILE A CG1 1 
ATOM   3200 C  CG2 . ILE A 1 465 ? -17.647 -18.880 -19.517 1.00 30.34 ? 541  ILE A CG2 1 
ATOM   3201 C  CD1 . ILE A 1 465 ? -17.222 -16.026 -18.610 1.00 29.96 ? 541  ILE A CD1 1 
ATOM   3202 N  N   . ALA A 1 466 ? -19.152 -20.164 -16.899 1.00 30.62 ? 542  ALA A N   1 
ATOM   3203 C  CA  . ALA A 1 466 ? -19.821 -21.445 -16.720 1.00 33.07 ? 542  ALA A CA  1 
ATOM   3204 C  C   . ALA A 1 466 ? -19.696 -22.291 -17.987 1.00 33.49 ? 542  ALA A C   1 
ATOM   3205 O  O   . ALA A 1 466 ? -19.735 -21.755 -19.096 1.00 31.65 ? 542  ALA A O   1 
ATOM   3206 C  CB  . ALA A 1 466 ? -21.295 -21.238 -16.379 1.00 31.68 ? 542  ALA A CB  1 
ATOM   3207 N  N   . PRO A 1 467 ? -19.543 -23.609 -17.857 1.00 38.66 ? 543  PRO A N   1 
ATOM   3208 C  CA  . PRO A 1 467 ? -19.493 -24.466 -19.049 1.00 39.37 ? 543  PRO A CA  1 
ATOM   3209 C  C   . PRO A 1 467 ? -20.801 -24.400 -19.822 1.00 40.47 ? 543  PRO A C   1 
ATOM   3210 O  O   . PRO A 1 467 ? -21.886 -24.526 -19.252 1.00 42.32 ? 543  PRO A O   1 
ATOM   3211 C  CB  . PRO A 1 467 ? -19.247 -25.866 -18.472 1.00 41.14 ? 543  PRO A CB  1 
ATOM   3212 C  CG  . PRO A 1 467 ? -18.677 -25.629 -17.109 1.00 42.84 ? 543  PRO A CG  1 
ATOM   3213 C  CD  . PRO A 1 467 ? -19.329 -24.374 -16.617 1.00 41.34 ? 543  PRO A CD  1 
ATOM   3214 N  N   . GLY A 1 468 ? -20.691 -24.196 -21.133 1.00 40.73 ? 544  GLY A N   1 
ATOM   3215 C  CA  . GLY A 1 468 ? -21.868 -24.078 -21.968 1.00 43.64 ? 544  GLY A CA  1 
ATOM   3216 C  C   . GLY A 1 468 ? -22.639 -22.789 -21.807 1.00 45.55 ? 544  GLY A C   1 
ATOM   3217 O  O   . GLY A 1 468 ? -23.761 -22.690 -22.312 1.00 48.34 ? 544  GLY A O   1 
ATOM   3218 N  N   . ALA A 1 469 ? -22.076 -21.800 -21.116 1.00 40.42 ? 545  ALA A N   1 
ATOM   3219 C  CA  . ALA A 1 469 ? -22.755 -20.528 -20.951 1.00 38.20 ? 545  ALA A CA  1 
ATOM   3220 C  C   . ALA A 1 469 ? -22.920 -19.847 -22.308 1.00 40.17 ? 545  ALA A C   1 
ATOM   3221 O  O   . ALA A 1 469 ? -22.092 -20.028 -23.207 1.00 39.78 ? 545  ALA A O   1 
ATOM   3222 C  CB  . ALA A 1 469 ? -21.976 -19.620 -20.003 1.00 36.78 ? 545  ALA A CB  1 
ATOM   3223 N  N   . PRO A 1 470 ? -23.995 -19.084 -22.492 1.00 41.79 ? 546  PRO A N   1 
ATOM   3224 C  CA  . PRO A 1 470 ? -24.144 -18.332 -23.731 1.00 40.90 ? 546  PRO A CA  1 
ATOM   3225 C  C   . PRO A 1 470 ? -22.992 -17.366 -23.907 1.00 39.65 ? 546  PRO A C   1 
ATOM   3226 O  O   . PRO A 1 470 ? -22.393 -16.897 -22.920 1.00 39.98 ? 546  PRO A O   1 
ATOM   3227 C  CB  . PRO A 1 470 ? -25.476 -17.594 -23.537 1.00 41.65 ? 546  PRO A CB  1 
ATOM   3228 C  CG  . PRO A 1 470 ? -26.225 -18.414 -22.548 1.00 42.13 ? 546  PRO A CG  1 
ATOM   3229 C  CD  . PRO A 1 470 ? -25.179 -18.969 -21.622 1.00 42.71 ? 546  PRO A CD  1 
ATOM   3230 N  N   . PRO A 1 471 ? -22.630 -17.050 -25.149 1.00 37.37 ? 547  PRO A N   1 
ATOM   3231 C  CA  . PRO A 1 471 ? -21.514 -16.127 -25.380 1.00 36.11 ? 547  PRO A CA  1 
ATOM   3232 C  C   . PRO A 1 471 ? -21.800 -14.753 -24.796 1.00 32.50 ? 547  PRO A C   1 
ATOM   3233 O  O   . PRO A 1 471 ? -22.949 -14.318 -24.703 1.00 32.58 ? 547  PRO A O   1 
ATOM   3234 C  CB  . PRO A 1 471 ? -21.407 -16.065 -26.911 1.00 36.59 ? 547  PRO A CB  1 
ATOM   3235 C  CG  . PRO A 1 471 ? -22.138 -17.269 -27.407 1.00 39.14 ? 547  PRO A CG  1 
ATOM   3236 C  CD  . PRO A 1 471 ? -23.216 -17.542 -26.408 1.00 39.08 ? 547  PRO A CD  1 
ATOM   3237 N  N   . VAL A 1 472 ? -20.732 -14.066 -24.406 1.00 30.56 ? 548  VAL A N   1 
ATOM   3238 C  CA  . VAL A 1 472 ? -20.824 -12.706 -23.892 1.00 30.12 ? 548  VAL A CA  1 
ATOM   3239 C  C   . VAL A 1 472 ? -20.599 -11.746 -25.057 1.00 33.78 ? 548  VAL A C   1 
ATOM   3240 O  O   . VAL A 1 472 ? -19.481 -11.617 -25.562 1.00 38.59 ? 548  VAL A O   1 
ATOM   3241 C  CB  . VAL A 1 472 ? -19.815 -12.469 -22.762 1.00 27.58 ? 548  VAL A CB  1 
ATOM   3242 C  CG1 . VAL A 1 472 ? -19.860 -11.023 -22.304 1.00 27.68 ? 548  VAL A CG1 1 
ATOM   3243 C  CG2 . VAL A 1 472 ? -20.101 -13.418 -21.603 1.00 24.81 ? 548  VAL A CG2 1 
ATOM   3244 N  N   . LYS A 1 473 ? -21.667 -11.080 -25.488 1.00 31.04 ? 549  LYS A N   1 
ATOM   3245 C  CA  . LYS A 1 473 ? -21.616 -10.086 -26.550 1.00 30.58 ? 549  LYS A CA  1 
ATOM   3246 C  C   . LYS A 1 473 ? -22.314 -8.816  -26.084 1.00 27.96 ? 549  LYS A C   1 
ATOM   3247 O  O   . LYS A 1 473 ? -23.159 -8.850  -25.190 1.00 28.75 ? 549  LYS A O   1 
ATOM   3248 C  CB  . LYS A 1 473 ? -22.277 -10.604 -27.835 1.00 34.54 ? 549  LYS A CB  1 
ATOM   3249 C  CG  . LYS A 1 473 ? -21.656 -11.880 -28.382 1.00 43.92 ? 549  LYS A CG  1 
ATOM   3250 C  CD  . LYS A 1 473 ? -20.204 -11.660 -28.787 1.00 50.55 ? 549  LYS A CD  1 
ATOM   3251 C  CE  . LYS A 1 473 ? -19.604 -12.915 -29.403 1.00 55.27 ? 549  LYS A CE  1 
ATOM   3252 N  NZ  . LYS A 1 473 ? -20.357 -13.348 -30.616 1.00 58.63 ? 549  LYS A NZ  1 
ATOM   3253 N  N   . MET A 1 474 ? -21.974 -7.696  -26.717 1.00 28.54 ? 550  MET A N   1 
ATOM   3254 C  CA  . MET A 1 474 ? -22.467 -6.379  -26.328 1.00 30.90 ? 550  MET A CA  1 
ATOM   3255 C  C   . MET A 1 474 ? -23.690 -5.966  -27.147 1.00 33.10 ? 550  MET A C   1 
ATOM   3256 O  O   . MET A 1 474 ? -23.979 -6.531  -28.203 1.00 29.53 ? 550  MET A O   1 
ATOM   3257 C  CB  . MET A 1 474 ? -21.366 -5.332  -26.491 1.00 29.52 ? 550  MET A CB  1 
ATOM   3258 C  CG  . MET A 1 474 ? -20.072 -5.672  -25.785 1.00 28.76 ? 550  MET A CG  1 
ATOM   3259 S  SD  . MET A 1 474 ? -18.819 -4.403  -26.046 1.00 30.63 ? 550  MET A SD  1 
ATOM   3260 C  CE  . MET A 1 474 ? -18.341 -4.751  -27.732 1.00 31.82 ? 550  MET A CE  1 
ATOM   3261 N  N   . THR A 1 475 ? -24.403 -4.951  -26.647 1.00 35.65 ? 551  THR A N   1 
ATOM   3262 C  CA  . THR A 1 475 ? -25.567 -4.397  -27.334 1.00 39.33 ? 551  THR A CA  1 
ATOM   3263 C  C   . THR A 1 475 ? -25.540 -2.871  -27.297 1.00 40.51 ? 551  THR A C   1 
ATOM   3264 O  O   . THR A 1 475 ? -24.924 -2.253  -26.422 1.00 37.42 ? 551  THR A O   1 
ATOM   3265 C  CB  . THR A 1 475 ? -26.891 -4.871  -26.721 1.00 38.55 ? 551  THR A CB  1 
ATOM   3266 O  OG1 . THR A 1 475 ? -26.954 -4.447  -25.354 1.00 40.50 ? 551  THR A OG1 1 
ATOM   3267 C  CG2 . THR A 1 475 ? -27.019 -6.380  -26.799 1.00 36.22 ? 551  THR A CG2 1 
ATOM   3268 N  N   . THR A 1 476 ? -26.242 -2.274  -28.261 1.00 43.21 ? 552  THR A N   1 
ATOM   3269 C  CA  . THR A 1 476 ? -26.422 -0.826  -28.291 1.00 40.99 ? 552  THR A CA  1 
ATOM   3270 C  C   . THR A 1 476 ? -27.393 -0.406  -27.198 1.00 36.29 ? 552  THR A C   1 
ATOM   3271 O  O   . THR A 1 476 ? -28.428 -1.040  -26.994 1.00 37.92 ? 552  THR A O   1 
ATOM   3272 C  CB  . THR A 1 476 ? -26.957 -0.365  -29.657 1.00 39.97 ? 552  THR A CB  1 
ATOM   3273 O  OG1 . THR A 1 476 ? -26.067 -0.783  -30.698 1.00 38.00 ? 552  THR A OG1 1 
ATOM   3274 C  CG2 . THR A 1 476 ? -27.088 1.158   -29.706 1.00 40.56 ? 552  THR A CG2 1 
ATOM   3275 N  N   . GLY A 1 477 ? -27.054 0.664   -26.493 1.00 37.09 ? 553  GLY A N   1 
ATOM   3276 C  CA  . GLY A 1 477 ? -27.940 1.188   -25.472 1.00 33.78 ? 553  GLY A CA  1 
ATOM   3277 C  C   . GLY A 1 477 ? -27.292 2.373   -24.798 1.00 34.62 ? 553  GLY A C   1 
ATOM   3278 O  O   . GLY A 1 477 ? -26.212 2.827   -25.191 1.00 38.94 ? 553  GLY A O   1 
ATOM   3279 N  N   . ALA A 1 478 ? -27.974 2.879   -23.767 1.00 29.63 ? 554  ALA A N   1 
ATOM   3280 C  CA  . ALA A 1 478 ? -27.370 3.911   -22.933 1.00 27.55 ? 554  ALA A CA  1 
ATOM   3281 C  C   . ALA A 1 478 ? -26.141 3.373   -22.208 1.00 28.40 ? 554  ALA A C   1 
ATOM   3282 O  O   . ALA A 1 478 ? -25.139 4.082   -22.047 1.00 30.22 ? 554  ALA A O   1 
ATOM   3283 C  CB  . ALA A 1 478 ? -28.398 4.447   -21.933 1.00 25.71 ? 554  ALA A CB  1 
ATOM   3284 N  N   . THR A 1 479 ? -26.205 2.129   -21.752 1.00 24.89 ? 555  THR A N   1 
ATOM   3285 C  CA  . THR A 1 479 ? -25.067 1.419   -21.194 1.00 23.39 ? 555  THR A CA  1 
ATOM   3286 C  C   . THR A 1 479 ? -24.849 0.153   -22.009 1.00 23.24 ? 555  THR A C   1 
ATOM   3287 O  O   . THR A 1 479 ? -25.696 -0.243  -22.810 1.00 23.40 ? 555  THR A O   1 
ATOM   3288 C  CB  . THR A 1 479 ? -25.289 1.077   -19.713 1.00 24.41 ? 555  THR A CB  1 
ATOM   3289 O  OG1 . THR A 1 479 ? -26.397 0.178   -19.586 1.00 22.86 ? 555  THR A OG1 1 
ATOM   3290 C  CG2 . THR A 1 479 ? -25.572 2.341   -18.903 1.00 25.40 ? 555  THR A CG2 1 
ATOM   3291 N  N   . ILE A 1 480 ? -23.703 -0.490  -21.800 1.00 21.90 ? 556  ILE A N   1 
ATOM   3292 C  CA  . ILE A 1 480 ? -23.340 -1.690  -22.547 1.00 22.11 ? 556  ILE A CA  1 
ATOM   3293 C  C   . ILE A 1 480 ? -23.892 -2.893  -21.789 1.00 24.26 ? 556  ILE A C   1 
ATOM   3294 O  O   . ILE A 1 480 ? -23.287 -3.369  -20.828 1.00 22.40 ? 556  ILE A O   1 
ATOM   3295 C  CB  . ILE A 1 480 ? -21.829 -1.803  -22.748 1.00 19.89 ? 556  ILE A CB  1 
ATOM   3296 C  CG1 . ILE A 1 480 ? -21.251 -0.495  -23.289 1.00 19.79 ? 556  ILE A CG1 1 
ATOM   3297 C  CG2 . ILE A 1 480 ? -21.512 -2.941  -23.717 1.00 21.27 ? 556  ILE A CG2 1 
ATOM   3298 C  CD1 . ILE A 1 480 ? -19.748 -0.546  -23.523 1.00 20.06 ? 556  ILE A CD1 1 
ATOM   3299 N  N   . HIS A 1 481 ? -25.053 -3.378  -22.214 1.00 23.70 ? 557  HIS A N   1 
ATOM   3300 C  CA  . HIS A 1 481 ? -25.566 -4.636  -21.701 1.00 27.07 ? 557  HIS A CA  1 
ATOM   3301 C  C   . HIS A 1 481 ? -24.958 -5.789  -22.487 1.00 29.00 ? 557  HIS A C   1 
ATOM   3302 O  O   . HIS A 1 481 ? -24.431 -5.607  -23.588 1.00 27.79 ? 557  HIS A O   1 
ATOM   3303 C  CB  . HIS A 1 481 ? -27.093 -4.694  -21.801 1.00 30.43 ? 557  HIS A CB  1 
ATOM   3304 C  CG  . HIS A 1 481 ? -27.797 -3.681  -20.952 1.00 36.36 ? 557  HIS A CG  1 
ATOM   3305 N  ND1 . HIS A 1 481 ? -28.111 -2.420  -21.407 1.00 39.10 ? 557  HIS A ND1 1 
ATOM   3306 C  CD2 . HIS A 1 481 ? -28.251 -3.745  -19.678 1.00 38.46 ? 557  HIS A CD2 1 
ATOM   3307 C  CE1 . HIS A 1 481 ? -28.727 -1.749  -20.449 1.00 38.86 ? 557  HIS A CE1 1 
ATOM   3308 N  NE2 . HIS A 1 481 ? -28.825 -2.531  -19.390 1.00 37.96 ? 557  HIS A NE2 1 
ATOM   3309 N  N   . THR A 1 482 ? -25.029 -6.982  -21.911 1.00 25.33 ? 558  THR A N   1 
ATOM   3310 C  CA  . THR A 1 482 ? -24.701 -8.171  -22.679 1.00 27.85 ? 558  THR A CA  1 
ATOM   3311 C  C   . THR A 1 482 ? -25.940 -8.665  -23.417 1.00 30.20 ? 558  THR A C   1 
ATOM   3312 O  O   . THR A 1 482 ? -27.073 -8.289  -23.103 1.00 30.31 ? 558  THR A O   1 
ATOM   3313 C  CB  . THR A 1 482 ? -24.154 -9.292  -21.794 1.00 25.35 ? 558  THR A CB  1 
ATOM   3314 O  OG1 . THR A 1 482 ? -25.214 -9.816  -20.991 1.00 29.13 ? 558  THR A OG1 1 
ATOM   3315 C  CG2 . THR A 1 482 ? -23.025 -8.783  -20.902 1.00 24.81 ? 558  THR A CG2 1 
ATOM   3316 N  N   . THR A 1 483 ? -25.708 -9.522  -24.412 1.00 28.93 ? 559  THR A N   1 
ATOM   3317 C  CA  . THR A 1 483 ? -26.822 -10.081 -25.165 1.00 28.82 ? 559  THR A CA  1 
ATOM   3318 C  C   . THR A 1 483 ? -27.621 -11.069 -24.326 1.00 27.62 ? 559  THR A C   1 
ATOM   3319 O  O   . THR A 1 483 ? -28.856 -11.066 -24.366 1.00 29.37 ? 559  THR A O   1 
ATOM   3320 C  CB  . THR A 1 483 ? -26.313 -10.761 -26.437 1.00 30.15 ? 559  THR A CB  1 
ATOM   3321 O  OG1 . THR A 1 483 ? -25.186 -11.588 -26.117 1.00 29.64 ? 559  THR A OG1 1 
ATOM   3322 C  CG2 . THR A 1 483 ? -25.906 -9.726  -27.474 1.00 28.22 ? 559  THR A CG2 1 
ATOM   3323 N  N   . GLU A 1 484 ? -26.936 -11.924 -23.558 1.00 25.89 ? 560  GLU A N   1 
ATOM   3324 C  CA  . GLU A 1 484 ? -27.609 -13.021 -22.874 1.00 25.18 ? 560  GLU A CA  1 
ATOM   3325 C  C   . GLU A 1 484 ? -27.169 -13.197 -21.425 1.00 27.97 ? 560  GLU A C   1 
ATOM   3326 O  O   . GLU A 1 484 ? -27.482 -14.234 -20.827 1.00 27.04 ? 560  GLU A O   1 
ATOM   3327 C  CB  . GLU A 1 484 ? -27.381 -14.342 -23.614 1.00 30.71 ? 560  GLU A CB  1 
ATOM   3328 C  CG  . GLU A 1 484 ? -28.021 -14.432 -24.986 1.00 30.33 ? 560  GLU A CG  1 
ATOM   3329 C  CD  . GLU A 1 484 ? -27.806 -15.788 -25.623 1.00 34.26 ? 560  GLU A CD  1 
ATOM   3330 O  OE1 . GLU A 1 484 ? -28.290 -16.799 -25.072 1.00 35.07 ? 560  GLU A OE1 1 
ATOM   3331 O  OE2 . GLU A 1 484 ? -27.136 -15.846 -26.674 1.00 36.59 ? 560  GLU A OE2 1 
ATOM   3332 N  N   . GLY A 1 485 ? -26.448 -12.245 -20.845 1.00 25.22 ? 561  GLY A N   1 
ATOM   3333 C  CA  . GLY A 1 485 ? -26.008 -12.371 -19.470 1.00 27.38 ? 561  GLY A CA  1 
ATOM   3334 C  C   . GLY A 1 485 ? -24.568 -12.838 -19.360 1.00 27.50 ? 561  GLY A C   1 
ATOM   3335 O  O   . GLY A 1 485 ? -23.883 -13.127 -20.346 1.00 24.23 ? 561  GLY A O   1 
ATOM   3336 N  N   . LEU A 1 486 ? -24.115 -12.894 -18.109 1.00 24.70 ? 562  LEU A N   1 
ATOM   3337 C  CA  . LEU A 1 486 ? -22.774 -13.339 -17.737 1.00 26.00 ? 562  LEU A CA  1 
ATOM   3338 C  C   . LEU A 1 486 ? -22.959 -14.500 -16.765 1.00 27.88 ? 562  LEU A C   1 
ATOM   3339 O  O   . LEU A 1 486 ? -23.095 -14.294 -15.555 1.00 26.13 ? 562  LEU A O   1 
ATOM   3340 C  CB  . LEU A 1 486 ? -21.958 -12.197 -17.115 1.00 23.45 ? 562  LEU A CB  1 
ATOM   3341 C  CG  . LEU A 1 486 ? -20.551 -12.547 -16.623 1.00 23.80 ? 562  LEU A CG  1 
ATOM   3342 C  CD1 . LEU A 1 486 ? -19.662 -12.983 -17.781 1.00 24.82 ? 562  LEU A CD1 1 
ATOM   3343 C  CD2 . LEU A 1 486 ? -19.926 -11.375 -15.874 1.00 22.26 ? 562  LEU A CD2 1 
ATOM   3344 N  N   . LYS A 1 487 ? -22.982 -15.717 -17.305 1.00 28.40 ? 563  LYS A N   1 
ATOM   3345 C  CA  . LYS A 1 487 ? -23.258 -16.920 -16.527 1.00 30.34 ? 563  LYS A CA  1 
ATOM   3346 C  C   . LYS A 1 487 ? -21.951 -17.481 -15.980 1.00 31.28 ? 563  LYS A C   1 
ATOM   3347 O  O   . LYS A 1 487 ? -21.077 -17.898 -16.750 1.00 33.26 ? 563  LYS A O   1 
ATOM   3348 C  CB  . LYS A 1 487 ? -23.969 -17.962 -17.392 1.00 34.86 ? 563  LYS A CB  1 
ATOM   3349 C  CG  . LYS A 1 487 ? -24.552 -19.142 -16.628 1.00 38.66 ? 563  LYS A CG  1 
ATOM   3350 C  CD  . LYS A 1 487 ? -25.926 -18.814 -16.067 1.00 43.42 ? 563  LYS A CD  1 
ATOM   3351 C  CE  . LYS A 1 487 ? -26.592 -20.047 -15.458 1.00 47.95 ? 563  LYS A CE  1 
ATOM   3352 N  NZ  . LYS A 1 487 ? -26.767 -21.145 -16.454 1.00 49.14 ? 563  LYS A NZ  1 
ATOM   3353 N  N   . LEU A 1 488 ? -21.826 -17.513 -14.655 1.00 27.70 ? 564  LEU A N   1 
ATOM   3354 C  CA  . LEU A 1 488 ? -20.590 -17.905 -13.999 1.00 28.65 ? 564  LEU A CA  1 
ATOM   3355 C  C   . LEU A 1 488 ? -20.822 -19.068 -13.047 1.00 30.68 ? 564  LEU A C   1 
ATOM   3356 O  O   . LEU A 1 488 ? -21.910 -19.227 -12.486 1.00 31.28 ? 564  LEU A O   1 
ATOM   3357 C  CB  . LEU A 1 488 ? -19.984 -16.736 -13.209 1.00 26.25 ? 564  LEU A CB  1 
ATOM   3358 C  CG  . LEU A 1 488 ? -19.721 -15.444 -13.983 1.00 26.94 ? 564  LEU A CG  1 
ATOM   3359 C  CD1 . LEU A 1 488 ? -18.982 -14.450 -13.114 1.00 25.54 ? 564  LEU A CD1 1 
ATOM   3360 C  CD2 . LEU A 1 488 ? -18.940 -15.735 -15.262 1.00 26.42 ? 564  LEU A CD2 1 
ATOM   3361 N  N   . THR A 1 489 ? -19.784 -19.879 -12.871 1.00 31.04 ? 565  THR A N   1 
ATOM   3362 C  CA  . THR A 1 489 ? -19.698 -20.759 -11.718 1.00 32.79 ? 565  THR A CA  1 
ATOM   3363 C  C   . THR A 1 489 ? -19.070 -19.981 -10.575 1.00 32.78 ? 565  THR A C   1 
ATOM   3364 O  O   . THR A 1 489 ? -18.215 -19.117 -10.788 1.00 32.45 ? 565  THR A O   1 
ATOM   3365 C  CB  . THR A 1 489 ? -18.868 -22.012 -12.009 1.00 37.22 ? 565  THR A CB  1 
ATOM   3366 O  OG1 . THR A 1 489 ? -17.501 -21.641 -12.222 1.00 42.82 ? 565  THR A OG1 1 
ATOM   3367 C  CG2 . THR A 1 489 ? -19.393 -22.733 -13.239 1.00 34.93 ? 565  THR A CG2 1 
ATOM   3368 N  N   . VAL A 1 490 ? -19.520 -20.277 -9.360  1.00 32.53 ? 566  VAL A N   1 
ATOM   3369 C  CA  . VAL A 1 490 ? -19.073 -19.575 -8.166  1.00 33.17 ? 566  VAL A CA  1 
ATOM   3370 C  C   . VAL A 1 490 ? -18.754 -20.612 -7.099  1.00 32.10 ? 566  VAL A C   1 
ATOM   3371 O  O   . VAL A 1 490 ? -19.600 -21.451 -6.765  1.00 34.24 ? 566  VAL A O   1 
ATOM   3372 C  CB  . VAL A 1 490 ? -20.123 -18.561 -7.668  1.00 38.47 ? 566  VAL A CB  1 
ATOM   3373 C  CG1 . VAL A 1 490 ? -21.506 -19.190 -7.612  1.00 40.68 ? 566  VAL A CG1 1 
ATOM   3374 C  CG2 . VAL A 1 490 ? -19.730 -17.995 -6.311  1.00 38.67 ? 566  VAL A CG2 1 
ATOM   3375 N  N   . THR A 1 491 ? -17.527 -20.579 -6.594  1.00 31.89 ? 567  THR A N   1 
ATOM   3376 C  CA  . THR A 1 491 ? -17.092 -21.474 -5.535  1.00 34.20 ? 567  THR A CA  1 
ATOM   3377 C  C   . THR A 1 491 ? -16.553 -20.640 -4.382  1.00 30.85 ? 567  THR A C   1 
ATOM   3378 O  O   . THR A 1 491 ? -15.999 -19.559 -4.589  1.00 30.30 ? 567  THR A O   1 
ATOM   3379 C  CB  . THR A 1 491 ? -16.017 -22.450 -6.024  1.00 39.45 ? 567  THR A CB  1 
ATOM   3380 O  OG1 . THR A 1 491 ? -14.843 -21.714 -6.383  1.00 42.52 ? 567  THR A OG1 1 
ATOM   3381 C  CG2 . THR A 1 491 ? -16.509 -23.219 -7.239  1.00 39.88 ? 567  THR A CG2 1 
ATOM   3382 N  N   . LYS A 1 492 ? -16.724 -21.153 -3.167  1.00 31.57 ? 568  LYS A N   1 
ATOM   3383 C  CA  . LYS A 1 492 ? -16.310 -20.427 -1.973  1.00 34.11 ? 568  LYS A CA  1 
ATOM   3384 C  C   . LYS A 1 492 ? -14.791 -20.423 -1.827  1.00 36.00 ? 568  LYS A C   1 
ATOM   3385 O  O   . LYS A 1 492 ? -14.119 -21.417 -2.114  1.00 34.58 ? 568  LYS A O   1 
ATOM   3386 C  CB  . LYS A 1 492 ? -16.952 -21.044 -0.728  1.00 34.97 ? 568  LYS A CB  1 
ATOM   3387 C  CG  . LYS A 1 492 ? -18.447 -20.769 -0.600  1.00 33.36 ? 568  LYS A CG  1 
ATOM   3388 C  CD  . LYS A 1 492 ? -19.081 -21.604 0.505   1.00 32.29 ? 568  LYS A CD  1 
ATOM   3389 C  CE  . LYS A 1 492 ? -18.501 -21.264 1.870   1.00 30.20 ? 568  LYS A CE  1 
ATOM   3390 N  NZ  . LYS A 1 492 ? -18.663 -19.819 2.192   1.00 30.26 ? 568  LYS A NZ  1 
ATOM   3391 N  N   . ARG A 1 493 ? -14.256 -19.281 -1.381  1.00 35.90 ? 569  ARG A N   1 
ATOM   3392 C  CA  . ARG A 1 493 ? -12.843 -19.131 -1.056  1.00 36.69 ? 569  ARG A CA  1 
ATOM   3393 C  C   . ARG A 1 493 ? -12.554 -19.268 0.428   1.00 37.25 ? 569  ARG A C   1 
ATOM   3394 O  O   . ARG A 1 493 ? -11.392 -19.458 0.799   1.00 41.06 ? 569  ARG A O   1 
ATOM   3395 C  CB  . ARG A 1 493 ? -12.318 -17.757 -1.495  1.00 37.45 ? 569  ARG A CB  1 
ATOM   3396 C  CG  . ARG A 1 493 ? -12.129 -17.565 -2.971  1.00 37.78 ? 569  ARG A CG  1 
ATOM   3397 C  CD  . ARG A 1 493 ? -11.398 -16.258 -3.255  1.00 34.09 ? 569  ARG A CD  1 
ATOM   3398 N  NE  . ARG A 1 493 ? -9.983  -16.320 -2.895  1.00 32.34 ? 569  ARG A NE  1 
ATOM   3399 C  CZ  . ARG A 1 493 ? -9.384  -15.493 -2.045  1.00 33.28 ? 569  ARG A CZ  1 
ATOM   3400 N  NH1 . ARG A 1 493 ? -10.068 -14.521 -1.456  1.00 33.27 ? 569  ARG A NH1 1 
ATOM   3401 N  NH2 . ARG A 1 493 ? -8.091  -15.633 -1.790  1.00 32.59 ? 569  ARG A NH2 1 
ATOM   3402 N  N   . THR A 1 494 ? -13.567 -19.133 1.278   1.00 36.10 ? 570  THR A N   1 
ATOM   3403 C  CA  . THR A 1 494 ? -13.403 -19.195 2.722   1.00 35.57 ? 570  THR A CA  1 
ATOM   3404 C  C   . THR A 1 494 ? -14.329 -20.261 3.288   1.00 35.91 ? 570  THR A C   1 
ATOM   3405 O  O   . THR A 1 494 ? -15.267 -20.714 2.626   1.00 34.59 ? 570  THR A O   1 
ATOM   3406 C  CB  . THR A 1 494 ? -13.692 -17.838 3.385   1.00 34.30 ? 570  THR A CB  1 
ATOM   3407 O  OG1 . THR A 1 494 ? -15.045 -17.449 3.113   1.00 35.32 ? 570  THR A OG1 1 
ATOM   3408 C  CG2 . THR A 1 494 ? -12.747 -16.770 2.847   1.00 32.11 ? 570  THR A CG2 1 
ATOM   3409 N  N   . LYS A 1 495 ? -14.051 -20.663 4.528   1.00 34.18 ? 571  LYS A N   1 
ATOM   3410 C  CA  . LYS A 1 495 ? -14.814 -21.734 5.155   1.00 37.89 ? 571  LYS A CA  1 
ATOM   3411 C  C   . LYS A 1 495 ? -15.872 -21.168 6.095   1.00 38.39 ? 571  LYS A C   1 
ATOM   3412 O  O   . LYS A 1 495 ? -15.602 -20.209 6.828   1.00 37.43 ? 571  LYS A O   1 
ATOM   3413 C  CB  . LYS A 1 495 ? -13.894 -22.670 5.939   1.00 45.12 ? 571  LYS A CB  1 
ATOM   3414 C  CG  . LYS A 1 495 ? -12.837 -23.369 5.099   1.00 50.16 ? 571  LYS A CG  1 
ATOM   3415 C  CD  . LYS A 1 495 ? -11.903 -24.185 5.982   1.00 55.62 ? 571  LYS A CD  1 
ATOM   3416 C  CE  . LYS A 1 495 ? -10.850 -24.924 5.169   1.00 60.52 ? 571  LYS A CE  1 
ATOM   3417 N  NZ  . LYS A 1 495 ? -11.442 -26.011 4.340   1.00 63.63 ? 571  LYS A NZ  1 
ATOM   3418 N  N   . PRO A 1 496 ? -17.078 -21.744 6.087   1.00 40.34 ? 572  PRO A N   1 
ATOM   3419 C  CA  . PRO A 1 496 ? -18.133 -21.238 6.984   1.00 40.27 ? 572  PRO A CA  1 
ATOM   3420 C  C   . PRO A 1 496 ? -17.758 -21.300 8.455   1.00 40.06 ? 572  PRO A C   1 
ATOM   3421 O  O   . PRO A 1 496 ? -18.131 -20.406 9.225   1.00 42.39 ? 572  PRO A O   1 
ATOM   3422 C  CB  . PRO A 1 496 ? -19.327 -22.152 6.667   1.00 40.71 ? 572  PRO A CB  1 
ATOM   3423 C  CG  . PRO A 1 496 ? -19.043 -22.703 5.308   1.00 39.98 ? 572  PRO A CG  1 
ATOM   3424 C  CD  . PRO A 1 496 ? -17.557 -22.825 5.210   1.00 40.66 ? 572  PRO A CD  1 
ATOM   3425 N  N   . LEU A 1 497 ? -17.024 -22.329 8.869   1.00 38.06 ? 573  LEU A N   1 
ATOM   3426 C  CA  . LEU A 1 497 ? -16.642 -22.499 10.263  1.00 38.17 ? 573  LEU A CA  1 
ATOM   3427 C  C   . LEU A 1 497 ? -15.350 -21.774 10.614  1.00 35.44 ? 573  LEU A C   1 
ATOM   3428 O  O   . LEU A 1 497 ? -14.840 -21.945 11.725  1.00 35.87 ? 573  LEU A O   1 
ATOM   3429 C  CB  . LEU A 1 497 ? -16.519 -23.985 10.600  1.00 41.97 ? 573  LEU A CB  1 
ATOM   3430 C  CG  . LEU A 1 497 ? -17.850 -24.739 10.632  1.00 46.27 ? 573  LEU A CG  1 
ATOM   3431 C  CD1 . LEU A 1 497 ? -17.651 -26.161 11.124  1.00 46.43 ? 573  LEU A CD1 1 
ATOM   3432 C  CD2 . LEU A 1 497 ? -18.857 -24.005 11.506  1.00 47.14 ? 573  LEU A CD2 1 
ATOM   3433 N  N   . ASP A 1 498 ? -14.811 -20.976 9.698   1.00 35.00 ? 574  ASP A N   1 
ATOM   3434 C  CA  . ASP A 1 498 ? -13.677 -20.127 10.025  1.00 38.17 ? 574  ASP A CA  1 
ATOM   3435 C  C   . ASP A 1 498 ? -14.156 -18.855 10.710  1.00 33.43 ? 574  ASP A C   1 
ATOM   3436 O  O   . ASP A 1 498 ? -15.186 -18.280 10.346  1.00 31.67 ? 574  ASP A O   1 
ATOM   3437 C  CB  . ASP A 1 498 ? -12.871 -19.788 8.772   1.00 40.68 ? 574  ASP A CB  1 
ATOM   3438 C  CG  . ASP A 1 498 ? -11.885 -20.878 8.407   1.00 46.20 ? 574  ASP A CG  1 
ATOM   3439 O  OD1 . ASP A 1 498 ? -11.564 -21.712 9.281   1.00 50.77 ? 574  ASP A OD1 1 
ATOM   3440 O  OD2 . ASP A 1 498 ? -11.423 -20.902 7.252   1.00 48.14 ? 574  ASP A OD2 1 
ATOM   3441 N  N   . ILE A 1 499 ? -13.412 -18.437 11.719  1.00 32.66 ? 575  ILE A N   1 
ATOM   3442 C  CA  . ILE A 1 499 ? -13.768 -17.239 12.484  1.00 30.65 ? 575  ILE A CA  1 
ATOM   3443 C  C   . ILE A 1 499 ? -13.631 -16.015 11.586  1.00 28.86 ? 575  ILE A C   1 
ATOM   3444 O  O   . ILE A 1 499 ? -12.687 -15.952 10.778  1.00 27.60 ? 575  ILE A O   1 
ATOM   3445 C  CB  . ILE A 1 499 ? -12.876 -17.134 13.721  1.00 31.00 ? 575  ILE A CB  1 
ATOM   3446 C  CG1 . ILE A 1 499 ? -13.229 -18.264 14.693  1.00 27.05 ? 575  ILE A CG1 1 
ATOM   3447 C  CG2 . ILE A 1 499 ? -12.998 -15.777 14.384  1.00 25.85 ? 575  ILE A CG2 1 
ATOM   3448 C  CD1 . ILE A 1 499 ? -12.244 -18.442 15.831  1.00 28.15 ? 575  ILE A CD1 1 
ATOM   3449 N  N   . PRO A 1 500 ? -14.551 -15.051 11.652  1.00 30.11 ? 576  PRO A N   1 
ATOM   3450 C  CA  . PRO A 1 500 ? -14.425 -13.848 10.817  1.00 30.20 ? 576  PRO A CA  1 
ATOM   3451 C  C   . PRO A 1 500 ? -13.068 -13.182 10.999  1.00 27.73 ? 576  PRO A C   1 
ATOM   3452 O  O   . PRO A 1 500 ? -12.632 -12.909 12.120  1.00 26.15 ? 576  PRO A O   1 
ATOM   3453 C  CB  . PRO A 1 500 ? -15.564 -12.955 11.317  1.00 31.58 ? 576  PRO A CB  1 
ATOM   3454 C  CG  . PRO A 1 500 ? -16.581 -13.909 11.852  1.00 32.20 ? 576  PRO A CG  1 
ATOM   3455 C  CD  . PRO A 1 500 ? -15.799 -15.056 12.436  1.00 31.28 ? 576  PRO A CD  1 
ATOM   3456 N  N   . SER A 1 501 ? -12.395 -12.924 9.882   1.00 28.14 ? 577  SER A N   1 
ATOM   3457 C  CA  A SER A 1 501 ? -11.044 -12.377 9.895   0.52 30.26 ? 577  SER A CA  1 
ATOM   3458 C  CA  B SER A 1 501 ? -11.043 -12.377 9.890   0.48 30.24 ? 577  SER A CA  1 
ATOM   3459 C  C   . SER A 1 501 ? -11.113 -10.866 9.718   1.00 27.74 ? 577  SER A C   1 
ATOM   3460 O  O   . SER A 1 501 ? -11.692 -10.373 8.744   1.00 24.97 ? 577  SER A O   1 
ATOM   3461 C  CB  A SER A 1 501 ? -10.183 -13.013 8.804   0.52 31.31 ? 577  SER A CB  1 
ATOM   3462 C  CB  B SER A 1 501 ? -10.190 -13.006 8.789   0.48 31.26 ? 577  SER A CB  1 
ATOM   3463 O  OG  A SER A 1 501 ? -8.813  -12.973 9.170   0.52 33.98 ? 577  SER A OG  1 
ATOM   3464 O  OG  B SER A 1 501 ? -10.223 -12.231 7.606   0.48 29.66 ? 577  SER A OG  1 
ATOM   3465 N  N   . VAL A 1 502 ? -10.517 -10.143 10.658  1.00 27.04 ? 578  VAL A N   1 
ATOM   3466 C  CA  . VAL A 1 502 ? -10.566 -8.685  10.730  1.00 28.72 ? 578  VAL A CA  1 
ATOM   3467 C  C   . VAL A 1 502 ? -9.137  -8.156  10.712  1.00 26.94 ? 578  VAL A C   1 
ATOM   3468 O  O   . VAL A 1 502 ? -8.502  -8.064  11.772  1.00 26.90 ? 578  VAL A O   1 
ATOM   3469 C  CB  . VAL A 1 502 ? -11.310 -8.236  12.001  1.00 32.41 ? 578  VAL A CB  1 
ATOM   3470 C  CG1 . VAL A 1 502 ? -11.420 -6.727  12.068  1.00 33.53 ? 578  VAL A CG1 1 
ATOM   3471 C  CG2 . VAL A 1 502 ? -12.688 -8.892  12.070  1.00 32.12 ? 578  VAL A CG2 1 
ATOM   3472 N  N   . PRO A 1 503 ? -8.584  -7.823  9.551   1.00 27.56 ? 579  PRO A N   1 
ATOM   3473 C  CA  . PRO A 1 503 ? -7.207  -7.324  9.506   1.00 31.07 ? 579  PRO A CA  1 
ATOM   3474 C  C   . PRO A 1 503 ? -7.121  -5.830  9.763   1.00 34.15 ? 579  PRO A C   1 
ATOM   3475 O  O   . PRO A 1 503 ? -8.009  -5.054  9.399   1.00 33.80 ? 579  PRO A O   1 
ATOM   3476 C  CB  . PRO A 1 503 ? -6.760  -7.658  8.076   1.00 31.31 ? 579  PRO A CB  1 
ATOM   3477 C  CG  . PRO A 1 503 ? -8.013  -7.659  7.294   1.00 30.86 ? 579  PRO A CG  1 
ATOM   3478 C  CD  . PRO A 1 503 ? -9.104  -8.141  8.210   1.00 28.43 ? 579  PRO A CD  1 
ATOM   3479 N  N   . ILE A 1 504 ? -6.018  -5.435  10.390  1.00 36.03 ? 580  ILE A N   1 
ATOM   3480 C  CA  . ILE A 1 504 ? -5.749  -4.030  10.678  1.00 40.26 ? 580  ILE A CA  1 
ATOM   3481 C  C   . ILE A 1 504 ? -4.339  -3.646  10.232  1.00 42.22 ? 580  ILE A C   1 
ATOM   3482 O  O   . ILE A 1 504 ? -3.501  -4.512  9.972   1.00 41.78 ? 580  ILE A O   1 
ATOM   3483 C  CB  . ILE A 1 504 ? -5.957  -3.724  12.175  1.00 41.03 ? 580  ILE A CB  1 
ATOM   3484 C  CG1 . ILE A 1 504 ? -5.249  -4.767  13.046  1.00 41.48 ? 580  ILE A CG1 1 
ATOM   3485 C  CG2 . ILE A 1 504 ? -7.444  -3.672  12.505  1.00 40.60 ? 580  ILE A CG2 1 
ATOM   3486 C  CD1 . ILE A 1 504 ? -3.850  -4.378  13.475  1.00 44.32 ? 580  ILE A CD1 1 
HETATM 3487 C  CHA . HEM B 2 .   ? -23.359 12.705  -15.531 1.00 21.81 ? 601  HEM A CHA 1 
HETATM 3488 C  CHB . HEM B 2 .   ? -21.046 8.453   -15.891 1.00 20.64 ? 601  HEM A CHB 1 
HETATM 3489 C  CHC . HEM B 2 .   ? -22.795 7.129   -11.538 1.00 20.84 ? 601  HEM A CHC 1 
HETATM 3490 C  CHD . HEM B 2 .   ? -25.407 11.198  -11.346 1.00 20.32 ? 601  HEM A CHD 1 
HETATM 3491 C  C1A . HEM B 2 .   ? -22.536 11.700  -16.000 1.00 19.39 ? 601  HEM A C1A 1 
HETATM 3492 C  C2A . HEM B 2 .   ? -21.701 11.734  -17.192 1.00 17.97 ? 601  HEM A C2A 1 
HETATM 3493 C  C3A . HEM B 2 .   ? -21.068 10.556  -17.286 1.00 17.26 ? 601  HEM A C3A 1 
HETATM 3494 C  C4A . HEM B 2 .   ? -21.473 9.735   -16.158 1.00 19.93 ? 601  HEM A C4A 1 
HETATM 3495 C  CMA . HEM B 2 .   ? -20.069 10.129  -18.387 1.00 17.26 ? 601  HEM A CMA 1 
HETATM 3496 C  CAA . HEM B 2 .   ? -21.569 12.922  -18.179 1.00 18.26 ? 601  HEM A CAA 1 
HETATM 3497 C  CBA . HEM B 2 .   ? -22.657 12.810  -19.243 1.00 19.10 ? 601  HEM A CBA 1 
HETATM 3498 C  CGA . HEM B 2 .   ? -22.522 13.931  -20.247 1.00 23.46 ? 601  HEM A CGA 1 
HETATM 3499 O  O1A . HEM B 2 .   ? -21.548 14.721  -20.140 1.00 22.64 ? 601  HEM A O1A 1 
HETATM 3500 O  O2A . HEM B 2 .   ? -23.396 14.030  -21.148 1.00 23.99 ? 601  HEM A O2A 1 
HETATM 3501 C  C1B . HEM B 2 .   ? -21.298 7.738   -14.736 1.00 21.85 ? 601  HEM A C1B 1 
HETATM 3502 C  C2B . HEM B 2 .   ? -20.719 6.455   -14.397 1.00 21.73 ? 601  HEM A C2B 1 
HETATM 3503 C  C3B . HEM B 2 .   ? -21.202 6.080   -13.195 1.00 23.57 ? 601  HEM A C3B 1 
HETATM 3504 C  C4B . HEM B 2 .   ? -22.100 7.124   -12.735 1.00 23.36 ? 601  HEM A C4B 1 
HETATM 3505 C  CMB . HEM B 2 .   ? -19.727 5.704   -15.310 1.00 18.89 ? 601  HEM A CMB 1 
HETATM 3506 C  CAB . HEM B 2 .   ? -20.900 4.799   -12.372 1.00 22.03 ? 601  HEM A CAB 1 
HETATM 3507 C  CBB . HEM B 2 .   ? -19.930 3.915   -12.634 1.00 23.93 ? 601  HEM A CBB 1 
HETATM 3508 C  C1C . HEM B 2 .   ? -23.606 8.134   -11.053 1.00 18.18 ? 601  HEM A C1C 1 
HETATM 3509 C  C2C . HEM B 2 .   ? -24.188 8.222   -9.723  1.00 19.74 ? 601  HEM A C2C 1 
HETATM 3510 C  C3C . HEM B 2 .   ? -24.924 9.351   -9.663  1.00 21.57 ? 601  HEM A C3C 1 
HETATM 3511 C  C4C . HEM B 2 .   ? -24.813 10.012  -10.957 1.00 20.77 ? 601  HEM A C4C 1 
HETATM 3512 C  CMC . HEM B 2 .   ? -23.952 7.155   -8.629  1.00 18.52 ? 601  HEM A CMC 1 
HETATM 3513 C  CAC . HEM B 2 .   ? -25.747 9.952   -8.493  1.00 27.12 ? 601  HEM A CAC 1 
HETATM 3514 C  CBC . HEM B 2 .   ? -25.713 9.502   -7.236  1.00 31.15 ? 601  HEM A CBC 1 
HETATM 3515 C  C1D . HEM B 2 .   ? -25.085 11.951  -12.463 1.00 19.36 ? 601  HEM A C1D 1 
HETATM 3516 C  C2D . HEM B 2 .   ? -25.639 13.247  -12.809 1.00 20.64 ? 601  HEM A C2D 1 
HETATM 3517 C  C3D . HEM B 2 .   ? -25.079 13.666  -13.952 1.00 19.91 ? 601  HEM A C3D 1 
HETATM 3518 C  C4D . HEM B 2 .   ? -24.142 12.648  -14.390 1.00 21.80 ? 601  HEM A C4D 1 
HETATM 3519 C  CMD . HEM B 2 .   ? -26.699 14.017  -11.994 1.00 21.01 ? 601  HEM A CMD 1 
HETATM 3520 C  CAD . HEM B 2 .   ? -25.377 15.001  -14.680 1.00 20.22 ? 601  HEM A CAD 1 
HETATM 3521 C  CBD . HEM B 2 .   ? -24.369 16.061  -14.242 1.00 21.58 ? 601  HEM A CBD 1 
HETATM 3522 C  CGD . HEM B 2 .   ? -24.652 17.396  -14.894 1.00 25.56 ? 601  HEM A CGD 1 
HETATM 3523 O  O1D . HEM B 2 .   ? -24.539 18.438  -14.198 1.00 27.36 ? 601  HEM A O1D 1 
HETATM 3524 O  O2D . HEM B 2 .   ? -25.001 17.429  -16.103 1.00 26.66 ? 601  HEM A O2D 1 
HETATM 3525 N  NA  . HEM B 2 .   ? -22.365 10.466  -15.399 1.00 19.54 ? 601  HEM A NA  1 
HETATM 3526 N  NB  . HEM B 2 .   ? -22.136 8.117   -13.704 1.00 21.88 ? 601  HEM A NB  1 
HETATM 3527 N  NC  . HEM B 2 .   ? -24.009 9.242   -11.764 1.00 20.73 ? 601  HEM A NC  1 
HETATM 3528 N  ND  . HEM B 2 .   ? -24.171 11.616  -13.457 1.00 22.20 ? 601  HEM A ND  1 
HETATM 3529 FE FE  . HEM B 2 .   ? -22.954 9.966   -13.452 1.00 22.12 ? 601  HEM A FE  1 
HETATM 3530 C  C1  . RET C 3 .   ? -26.740 7.353   -18.250 1.00 23.17 ? 602  RET A C1  1 
HETATM 3531 C  C2  . RET C 3 .   ? -26.121 7.785   -16.916 1.00 21.61 ? 602  RET A C2  1 
HETATM 3532 C  C3  . RET C 3 .   ? -24.699 8.309   -17.054 1.00 20.88 ? 602  RET A C3  1 
HETATM 3533 C  C4  . RET C 3 .   ? -24.580 9.444   -18.064 1.00 22.50 ? 602  RET A C4  1 
HETATM 3534 C  C5  . RET C 3 .   ? -25.642 9.440   -19.144 1.00 22.83 ? 602  RET A C5  1 
HETATM 3535 C  C6  . RET C 3 .   ? -26.484 8.408   -19.323 1.00 23.66 ? 602  RET A C6  1 
HETATM 3536 C  C7  . RET C 3 .   ? -27.273 8.249   -20.529 1.00 23.99 ? 602  RET A C7  1 
HETATM 3537 C  C8  . RET C 3 .   ? -26.747 7.918   -21.680 1.00 23.19 ? 602  RET A C8  1 
HETATM 3538 C  C9  . RET C 3 .   ? -27.397 7.713   -22.955 1.00 23.11 ? 602  RET A C9  1 
HETATM 3539 C  C10 . RET C 3 .   ? -26.634 7.282   -23.981 1.00 25.56 ? 602  RET A C10 1 
HETATM 3540 C  C11 . RET C 3 .   ? -27.023 6.979   -25.329 1.00 31.18 ? 602  RET A C11 1 
HETATM 3541 C  C12 . RET C 3 .   ? -26.134 6.372   -26.109 1.00 34.13 ? 602  RET A C12 1 
HETATM 3542 C  C13 . RET C 3 .   ? -26.249 5.942   -27.484 1.00 38.34 ? 602  RET A C13 1 
HETATM 3543 C  C14 . RET C 3 .   ? -25.343 5.044   -27.936 1.00 43.27 ? 602  RET A C14 1 
HETATM 3544 C  C15 . RET C 3 .   ? -25.232 4.470   -29.248 1.00 49.16 ? 602  RET A C15 1 
HETATM 3545 O  O1  . RET C 3 .   ? -24.373 3.665   -29.548 1.00 53.49 ? 602  RET A O1  1 
HETATM 3546 C  C16 . RET C 3 .   ? -26.113 6.021   -18.676 1.00 21.43 ? 602  RET A C16 1 
HETATM 3547 C  C17 . RET C 3 .   ? -28.246 7.149   -18.064 1.00 23.83 ? 602  RET A C17 1 
HETATM 3548 C  C18 . RET C 3 .   ? -25.487 10.576  -20.119 1.00 22.27 ? 602  RET A C18 1 
HETATM 3549 C  C19 . RET C 3 .   ? -28.871 7.988   -23.063 1.00 21.80 ? 602  RET A C19 1 
HETATM 3550 C  C20 . RET C 3 .   ? -27.347 6.524   -28.333 1.00 35.64 ? 602  RET A C20 1 
HETATM 3551 O  O   . HOH D 4 .   ? -29.521 -2.386  -15.537 1.00 43.41 ? 701  HOH A O   1 
HETATM 3552 O  O   . HOH D 4 .   ? -11.612 -19.476 5.600   1.00 43.36 ? 702  HOH A O   1 
HETATM 3553 O  O   . HOH D 4 .   ? -40.676 0.399   -24.067 1.00 52.98 ? 703  HOH A O   1 
HETATM 3554 O  O   . HOH D 4 .   ? -31.717 18.001  -11.614 1.00 44.45 ? 704  HOH A O   1 
HETATM 3555 O  O   . HOH D 4 .   ? -37.992 -12.576 -10.375 1.00 49.32 ? 705  HOH A O   1 
HETATM 3556 O  O   . HOH D 4 .   ? -41.034 -1.810  -2.397  1.00 70.15 ? 706  HOH A O   1 
HETATM 3557 O  O   . HOH D 4 .   ? -44.437 -1.752  -14.985 1.00 55.26 ? 707  HOH A O   1 
HETATM 3558 O  O   . HOH D 4 .   ? -9.024  23.602  -33.656 1.00 45.98 ? 708  HOH A O   1 
HETATM 3559 O  O   . HOH D 4 .   ? -30.646 20.071  -23.379 1.00 33.62 ? 709  HOH A O   1 
HETATM 3560 O  O   . HOH D 4 .   ? -22.049 20.378  1.381   1.00 51.64 ? 710  HOH A O   1 
HETATM 3561 O  O   . HOH D 4 .   ? -9.940  0.606   -40.020 1.00 45.18 ? 711  HOH A O   1 
HETATM 3562 O  O   . HOH D 4 .   ? -27.050 -1.968  -32.445 1.00 65.94 ? 712  HOH A O   1 
HETATM 3563 O  O   . HOH D 4 .   ? -5.431  4.989   -38.138 1.00 59.68 ? 713  HOH A O   1 
HETATM 3564 O  O   . HOH D 4 .   ? -9.708  6.506   1.885   1.00 42.17 ? 714  HOH A O   1 
HETATM 3565 O  O   . HOH D 4 .   ? -21.645 -22.396 -9.208  1.00 37.65 ? 715  HOH A O   1 
HETATM 3566 O  O   . HOH D 4 .   ? -12.466 -15.275 -12.421 1.00 43.53 ? 716  HOH A O   1 
HETATM 3567 O  O   . HOH D 4 .   ? -35.838 3.027   4.130   1.00 47.84 ? 717  HOH A O   1 
HETATM 3568 O  O   . HOH D 4 .   ? -29.085 1.254   -19.681 1.00 47.20 ? 718  HOH A O   1 
HETATM 3569 O  O   . HOH D 4 .   ? -10.402 24.781  -20.579 1.00 51.07 ? 719  HOH A O   1 
HETATM 3570 O  O   . HOH D 4 .   ? -21.156 -20.417 3.790   1.00 35.72 ? 720  HOH A O   1 
HETATM 3571 O  O   . HOH D 4 .   ? -31.637 9.141   -42.513 1.00 50.66 ? 721  HOH A O   1 
HETATM 3572 O  O   . HOH D 4 .   ? -31.759 7.022   4.193   1.00 47.02 ? 722  HOH A O   1 
HETATM 3573 O  O   . HOH D 4 .   ? -29.685 -13.807 -11.747 1.00 45.93 ? 723  HOH A O   1 
HETATM 3574 O  O   . HOH D 4 .   ? -11.681 -14.515 -6.376  1.00 33.71 ? 724  HOH A O   1 
HETATM 3575 O  O   . HOH D 4 .   ? -13.370 -18.522 -16.650 1.00 33.55 ? 725  HOH A O   1 
HETATM 3576 O  O   . HOH D 4 .   ? -46.596 6.347   -22.297 1.00 61.38 ? 726  HOH A O   1 
HETATM 3577 O  O   . HOH D 4 .   ? -39.704 12.518  -12.858 1.00 54.09 ? 727  HOH A O   1 
HETATM 3578 O  O   . HOH D 4 .   ? -9.074  -0.291  7.322   1.00 45.67 ? 728  HOH A O   1 
HETATM 3579 O  O   . HOH D 4 .   ? -13.744 4.320   9.462   1.00 49.15 ? 729  HOH A O   1 
HETATM 3580 O  O   . HOH D 4 .   ? -16.698 32.400  -22.370 1.00 62.34 ? 730  HOH A O   1 
HETATM 3581 O  O   . HOH D 4 .   ? 0.648   -5.117  -15.698 1.00 62.07 ? 731  HOH A O   1 
HETATM 3582 O  O   . HOH D 4 .   ? -30.974 16.635  -34.379 1.00 35.18 ? 732  HOH A O   1 
HETATM 3583 O  O   . HOH D 4 .   ? -16.881 -17.803 8.620   1.00 23.35 ? 733  HOH A O   1 
HETATM 3584 O  O   . HOH D 4 .   ? -10.810 13.062  -39.283 1.00 26.85 ? 734  HOH A O   1 
HETATM 3585 O  O   . HOH D 4 .   ? -26.193 1.760   5.826   1.00 44.27 ? 735  HOH A O   1 
HETATM 3586 O  O   . HOH D 4 .   ? -16.764 21.655  -41.717 1.00 37.76 ? 736  HOH A O   1 
HETATM 3587 O  O   . HOH D 4 .   ? -10.736 1.477   8.281   1.00 45.87 ? 737  HOH A O   1 
HETATM 3588 O  O   . HOH D 4 .   ? -26.007 1.985   -7.361  1.00 24.95 ? 738  HOH A O   1 
HETATM 3589 O  O   . HOH D 4 .   ? -9.118  -18.186 -7.602  1.00 45.10 ? 739  HOH A O   1 
HETATM 3590 O  O   . HOH D 4 .   ? -34.574 6.290   7.748   1.00 47.90 ? 740  HOH A O   1 
HETATM 3591 O  O   . HOH D 4 .   ? -14.170 -14.134 -23.703 1.00 50.48 ? 741  HOH A O   1 
HETATM 3592 O  O   . HOH D 4 .   ? -47.759 8.302   -16.332 1.00 42.97 ? 742  HOH A O   1 
HETATM 3593 O  O   . HOH D 4 .   ? -21.348 -25.347 -13.454 1.00 57.66 ? 743  HOH A O   1 
HETATM 3594 O  O   . HOH D 4 .   ? -41.266 11.789  -25.192 1.00 61.79 ? 744  HOH A O   1 
HETATM 3595 O  O   . HOH D 4 .   ? -10.984 23.903  -31.865 1.00 37.87 ? 745  HOH A O   1 
HETATM 3596 O  O   . HOH D 4 .   ? -29.572 26.568  -6.990  1.00 43.59 ? 746  HOH A O   1 
HETATM 3597 O  O   . HOH D 4 .   ? -21.562 22.667  -39.718 1.00 31.35 ? 747  HOH A O   1 
HETATM 3598 O  O   . HOH D 4 .   ? -2.817  -1.121  0.438   1.00 36.70 ? 748  HOH A O   1 
HETATM 3599 O  O   . HOH D 4 .   ? -9.353  18.648  -16.914 1.00 48.66 ? 749  HOH A O   1 
HETATM 3600 O  O   . HOH D 4 .   ? -32.733 3.140   -34.998 1.00 50.00 ? 750  HOH A O   1 
HETATM 3601 O  O   . HOH D 4 .   ? -1.813  -6.187  -12.866 1.00 39.97 ? 751  HOH A O   1 
HETATM 3602 O  O   . HOH D 4 .   ? -31.099 1.476   -34.260 1.00 43.11 ? 752  HOH A O   1 
HETATM 3603 O  O   . HOH D 4 .   ? -43.740 1.053   -1.863  1.00 55.39 ? 753  HOH A O   1 
HETATM 3604 O  O   . HOH D 4 .   ? -33.249 0.581   -2.365  1.00 32.53 ? 754  HOH A O   1 
HETATM 3605 O  O   . HOH D 4 .   ? -12.759 18.008  -16.450 1.00 32.58 ? 755  HOH A O   1 
HETATM 3606 O  O   . HOH D 4 .   ? -9.887  23.884  -27.105 1.00 33.57 ? 756  HOH A O   1 
HETATM 3607 O  O   . HOH D 4 .   ? -16.720 3.833   -31.237 1.00 20.93 ? 757  HOH A O   1 
HETATM 3608 O  O   . HOH D 4 .   ? -26.010 -15.894 -19.498 1.00 34.58 ? 758  HOH A O   1 
HETATM 3609 O  O   . HOH D 4 .   ? -21.347 -12.607 4.166   1.00 46.74 ? 759  HOH A O   1 
HETATM 3610 O  O   . HOH D 4 .   ? -18.513 3.054   6.906   1.00 43.42 ? 760  HOH A O   1 
HETATM 3611 O  O   . HOH D 4 .   ? -17.750 28.759  -30.411 1.00 29.55 ? 761  HOH A O   1 
HETATM 3612 O  O   . HOH D 4 .   ? -13.030 -16.065 7.977   1.00 35.24 ? 762  HOH A O   1 
HETATM 3613 O  O   . HOH D 4 .   ? -23.149 29.571  -26.769 1.00 46.85 ? 763  HOH A O   1 
HETATM 3614 O  O   . HOH D 4 .   ? -13.744 10.015  -34.997 1.00 23.17 ? 764  HOH A O   1 
HETATM 3615 O  O   . HOH D 4 .   ? -44.029 -8.645  -8.493  1.00 59.14 ? 765  HOH A O   1 
HETATM 3616 O  O   . HOH D 4 .   ? -24.057 15.669  -17.769 1.00 21.88 ? 766  HOH A O   1 
HETATM 3617 O  O   . HOH D 4 .   ? -28.756 -17.762 -4.235  1.00 43.71 ? 767  HOH A O   1 
HETATM 3618 O  O   . HOH D 4 .   ? -32.938 -8.080  -12.663 1.00 51.15 ? 768  HOH A O   1 
HETATM 3619 O  O   . HOH D 4 .   ? -4.844  12.376  -24.490 1.00 26.14 ? 769  HOH A O   1 
HETATM 3620 O  O   . HOH D 4 .   ? -23.837 28.733  -36.819 1.00 33.41 ? 770  HOH A O   1 
HETATM 3621 O  O   . HOH D 4 .   ? -7.066  -1.806  -33.515 1.00 48.83 ? 771  HOH A O   1 
HETATM 3622 O  O   . HOH D 4 .   ? -10.250 3.853   -4.333  1.00 38.21 ? 772  HOH A O   1 
HETATM 3623 O  O   . HOH D 4 .   ? -28.513 -7.944  -20.953 1.00 31.58 ? 773  HOH A O   1 
HETATM 3624 O  O   . HOH D 4 .   ? -9.324  9.191   -6.807  1.00 64.00 ? 774  HOH A O   1 
HETATM 3625 O  O   . HOH D 4 .   ? -45.317 -2.580  -12.031 1.00 42.20 ? 775  HOH A O   1 
HETATM 3626 O  O   . HOH D 4 .   ? -48.604 11.009  -5.915  1.00 54.00 ? 776  HOH A O   1 
HETATM 3627 O  O   . HOH D 4 .   ? -8.676  -8.192  -31.181 1.00 63.41 ? 777  HOH A O   1 
HETATM 3628 O  O   . HOH D 4 .   ? -38.390 15.236  16.851  1.00 75.24 ? 778  HOH A O   1 
HETATM 3629 O  O   . HOH D 4 .   ? -30.541 -13.013 -16.289 1.00 21.18 ? 779  HOH A O   1 
HETATM 3630 O  O   . HOH D 4 .   ? -37.455 10.360  5.338   1.00 42.35 ? 780  HOH A O   1 
HETATM 3631 O  O   . HOH D 4 .   ? -7.036  3.519   -3.651  1.00 63.31 ? 781  HOH A O   1 
HETATM 3632 O  O   . HOH D 4 .   ? -25.013 -14.166 -26.633 1.00 36.56 ? 782  HOH A O   1 
HETATM 3633 O  O   . HOH D 4 .   ? -10.249 -16.956 10.861  1.00 29.17 ? 783  HOH A O   1 
HETATM 3634 O  O   . HOH D 4 .   ? -35.155 15.214  -37.788 1.00 64.13 ? 784  HOH A O   1 
HETATM 3635 O  O   . HOH D 4 .   ? -43.018 6.985   2.766   1.00 59.58 ? 785  HOH A O   1 
HETATM 3636 O  O   . HOH D 4 .   ? -30.064 21.937  -28.832 1.00 32.59 ? 786  HOH A O   1 
HETATM 3637 O  O   . HOH D 4 .   ? -24.282 0.235   -25.811 1.00 39.28 ? 787  HOH A O   1 
HETATM 3638 O  O   . HOH D 4 .   ? -14.843 -8.442  3.139   1.00 25.46 ? 788  HOH A O   1 
HETATM 3639 O  O   . HOH D 4 .   ? -16.661 -17.829 1.054   1.00 28.73 ? 789  HOH A O   1 
HETATM 3640 O  O   . HOH D 4 .   ? -31.762 -11.907 -0.748  1.00 54.51 ? 790  HOH A O   1 
HETATM 3641 O  O   . HOH D 4 .   ? -1.548  -5.492  1.711   1.00 52.46 ? 791  HOH A O   1 
HETATM 3642 O  O   . HOH D 4 .   ? -26.541 -3.826  -30.387 1.00 44.84 ? 792  HOH A O   1 
HETATM 3643 O  O   . HOH D 4 .   ? -38.285 21.206  14.176  1.00 64.66 ? 793  HOH A O   1 
HETATM 3644 O  O   . HOH D 4 .   ? -29.238 -12.070 0.645   1.00 36.52 ? 794  HOH A O   1 
HETATM 3645 O  O   . HOH D 4 .   ? -31.163 24.986  -2.807  1.00 50.47 ? 795  HOH A O   1 
HETATM 3646 O  O   . HOH D 4 .   ? -26.688 14.091  1.360   1.00 36.63 ? 796  HOH A O   1 
HETATM 3647 O  O   . HOH D 4 .   ? 3.337   2.704   -8.459  1.00 39.91 ? 797  HOH A O   1 
HETATM 3648 O  O   . HOH D 4 .   ? -9.968  -17.417 -15.789 1.00 38.03 ? 798  HOH A O   1 
HETATM 3649 O  O   . HOH D 4 .   ? -29.822 6.748   2.679   1.00 31.37 ? 799  HOH A O   1 
HETATM 3650 O  O   . HOH D 4 .   ? -39.690 -2.731  -4.067  1.00 31.53 ? 800  HOH A O   1 
HETATM 3651 O  O   . HOH D 4 .   ? -28.543 14.363  -36.940 1.00 32.35 ? 801  HOH A O   1 
HETATM 3652 O  O   . HOH D 4 .   ? -24.013 12.491  -23.225 1.00 21.21 ? 802  HOH A O   1 
HETATM 3653 O  O   . HOH D 4 .   ? -45.642 -9.045  -12.121 1.00 59.29 ? 803  HOH A O   1 
HETATM 3654 O  O   . HOH D 4 .   ? -19.124 19.075  -20.261 1.00 22.56 ? 804  HOH A O   1 
HETATM 3655 O  O   . HOH D 4 .   ? -41.952 19.194  -2.836  1.00 60.40 ? 805  HOH A O   1 
HETATM 3656 O  O   . HOH D 4 .   ? -19.167 15.474  -19.183 1.00 22.54 ? 806  HOH A O   1 
HETATM 3657 O  O   . HOH D 4 .   ? -40.657 17.005  -19.475 1.00 56.58 ? 807  HOH A O   1 
HETATM 3658 O  O   . HOH D 4 .   ? -8.427  14.471  -35.325 1.00 40.94 ? 808  HOH A O   1 
HETATM 3659 O  O   . HOH D 4 .   ? -24.162 -12.549 -23.100 1.00 30.52 ? 809  HOH A O   1 
HETATM 3660 O  O   . HOH D 4 .   ? -23.402 -10.698 7.199   1.00 48.97 ? 810  HOH A O   1 
HETATM 3661 O  O   . HOH D 4 .   ? -2.815  8.636   -13.278 1.00 36.80 ? 811  HOH A O   1 
HETATM 3662 O  O   . HOH D 4 .   ? -15.446 -15.300 4.667   1.00 39.33 ? 812  HOH A O   1 
HETATM 3663 O  O   . HOH D 4 .   ? -2.165  -3.725  -2.901  1.00 38.49 ? 813  HOH A O   1 
HETATM 3664 O  O   . HOH D 4 .   ? -6.571  -9.023  -21.651 1.00 28.70 ? 814  HOH A O   1 
HETATM 3665 O  O   . HOH D 4 .   ? -26.060 24.330  -21.027 1.00 33.74 ? 815  HOH A O   1 
HETATM 3666 O  O   . HOH D 4 .   ? -23.499 3.876   -9.132  1.00 21.47 ? 816  HOH A O   1 
HETATM 3667 O  O   . HOH D 4 .   ? -6.390  5.005   4.354   1.00 50.11 ? 817  HOH A O   1 
HETATM 3668 O  O   . HOH D 4 .   ? -27.306 -23.226 -0.290  1.00 32.55 ? 818  HOH A O   1 
HETATM 3669 O  O   . HOH D 4 .   ? -0.553  -12.278 -10.307 1.00 38.88 ? 819  HOH A O   1 
HETATM 3670 O  O   . HOH D 4 .   ? -24.450 9.735   -23.708 1.00 23.58 ? 820  HOH A O   1 
HETATM 3671 O  O   . HOH D 4 .   ? -6.379  11.181  -9.219  1.00 51.70 ? 821  HOH A O   1 
HETATM 3672 O  O   . HOH D 4 .   ? -14.625 2.605   -46.396 1.00 32.80 ? 822  HOH A O   1 
HETATM 3673 O  O   . HOH D 4 .   ? -46.116 9.929   2.602   1.00 50.88 ? 823  HOH A O   1 
HETATM 3674 O  O   . HOH D 4 .   ? -18.765 -1.100  3.583   1.00 33.08 ? 824  HOH A O   1 
HETATM 3675 O  O   . HOH D 4 .   ? -7.084  17.553  -32.847 1.00 39.31 ? 825  HOH A O   1 
HETATM 3676 O  O   . HOH D 4 .   ? -41.816 11.440  8.720   1.00 62.53 ? 826  HOH A O   1 
HETATM 3677 O  O   . HOH D 4 .   ? -29.421 -16.105 -20.576 1.00 32.78 ? 827  HOH A O   1 
HETATM 3678 O  O   . HOH D 4 .   ? -19.364 15.981  -4.247  1.00 48.16 ? 828  HOH A O   1 
HETATM 3679 O  O   . HOH D 4 .   ? -42.689 22.719  -11.983 1.00 56.61 ? 829  HOH A O   1 
HETATM 3680 O  O   . HOH D 4 .   ? -45.121 14.598  -1.566  1.00 48.05 ? 830  HOH A O   1 
HETATM 3681 O  O   . HOH D 4 .   ? -16.607 -22.874 -14.826 1.00 67.43 ? 831  HOH A O   1 
HETATM 3682 O  O   . HOH D 4 .   ? -26.562 -1.396  -17.384 1.00 29.76 ? 832  HOH A O   1 
HETATM 3683 O  O   . HOH D 4 .   ? -35.225 -2.947  -18.131 1.00 48.51 ? 833  HOH A O   1 
HETATM 3684 O  O   . HOH D 4 .   ? -5.120  15.090  -30.180 1.00 43.29 ? 834  HOH A O   1 
HETATM 3685 O  O   . HOH D 4 .   ? -33.790 -11.061 -13.646 1.00 62.41 ? 835  HOH A O   1 
HETATM 3686 O  O   . HOH D 4 .   ? -13.955 11.252  -16.404 1.00 24.64 ? 836  HOH A O   1 
HETATM 3687 O  O   . HOH D 4 .   ? -44.430 15.541  -3.696  1.00 45.36 ? 837  HOH A O   1 
HETATM 3688 O  O   . HOH D 4 .   ? -2.698  -7.820  -17.563 1.00 32.02 ? 838  HOH A O   1 
HETATM 3689 O  O   . HOH D 4 .   ? -5.029  4.734   -5.413  1.00 30.93 ? 839  HOH A O   1 
HETATM 3690 O  O   . HOH D 4 .   ? -20.234 18.199  -2.556  1.00 54.51 ? 840  HOH A O   1 
HETATM 3691 O  O   . HOH D 4 .   ? -4.225  10.672  -0.095  1.00 63.70 ? 841  HOH A O   1 
HETATM 3692 O  O   . HOH D 4 .   ? -35.522 10.608  2.458   1.00 48.95 ? 842  HOH A O   1 
HETATM 3693 O  O   . HOH D 4 .   ? -29.913 -17.294 -22.938 1.00 26.52 ? 843  HOH A O   1 
HETATM 3694 O  O   . HOH D 4 .   ? -15.125 15.313  -9.779  1.00 53.43 ? 844  HOH A O   1 
HETATM 3695 O  O   . HOH D 4 .   ? -8.274  -3.354  -35.220 1.00 58.31 ? 845  HOH A O   1 
HETATM 3696 O  O   . HOH D 4 .   ? -17.776 5.744   -18.862 1.00 32.35 ? 846  HOH A O   1 
HETATM 3697 O  O   . HOH D 4 .   ? -26.661 -17.860 -28.462 1.00 44.78 ? 847  HOH A O   1 
HETATM 3698 O  O   . HOH D 4 .   ? -11.698 -3.851  -34.834 1.00 51.93 ? 848  HOH A O   1 
HETATM 3699 O  O   . HOH D 4 .   ? -6.433  16.855  -24.878 1.00 47.22 ? 849  HOH A O   1 
HETATM 3700 O  O   . HOH D 4 .   ? -40.355 20.007  6.235   1.00 52.84 ? 850  HOH A O   1 
HETATM 3701 O  O   . HOH D 4 .   ? -16.627 14.622  -7.102  1.00 45.28 ? 851  HOH A O   1 
HETATM 3702 O  O   . HOH D 4 .   ? -49.795 4.501   -9.029  1.00 51.89 ? 852  HOH A O   1 
HETATM 3703 O  O   . HOH D 4 .   ? -12.154 5.104   -12.858 1.00 33.55 ? 853  HOH A O   1 
HETATM 3704 O  O   . HOH D 4 .   ? -18.080 16.334  -10.584 1.00 40.45 ? 854  HOH A O   1 
HETATM 3705 O  O   . HOH D 4 .   ? -36.586 21.287  11.795  1.00 53.52 ? 855  HOH A O   1 
HETATM 3706 O  O   . HOH D 4 .   ? -19.342 -16.143 1.907   1.00 35.39 ? 856  HOH A O   1 
HETATM 3707 O  O   . HOH D 4 .   ? -14.931 -17.544 6.904   1.00 39.96 ? 857  HOH A O   1 
HETATM 3708 O  O   . HOH D 4 .   ? -20.146 22.488  -13.360 1.00 29.64 ? 858  HOH A O   1 
HETATM 3709 O  O   . HOH D 4 .   ? -23.069 -15.904 -20.446 1.00 31.40 ? 859  HOH A O   1 
HETATM 3710 O  O   . HOH D 4 .   ? -27.321 30.064  -32.231 1.00 39.98 ? 860  HOH A O   1 
HETATM 3711 O  O   . HOH D 4 .   ? -31.669 9.934   -36.299 1.00 54.13 ? 861  HOH A O   1 
HETATM 3712 O  O   . HOH D 4 .   ? -9.672  -15.563 -13.909 1.00 33.88 ? 862  HOH A O   1 
HETATM 3713 O  O   . HOH D 4 .   ? -5.910  -3.103  6.411   1.00 48.89 ? 863  HOH A O   1 
HETATM 3714 O  O   . HOH D 4 .   ? -25.136 -19.879 2.492   1.00 34.31 ? 864  HOH A O   1 
HETATM 3715 O  O   . HOH D 4 .   ? -18.038 -23.576 -3.044  1.00 43.30 ? 865  HOH A O   1 
HETATM 3716 O  O   . HOH D 4 .   ? -13.473 11.692  -11.366 1.00 34.84 ? 866  HOH A O   1 
HETATM 3717 O  O   . HOH D 4 .   ? -23.895 -4.783  -18.359 1.00 25.94 ? 867  HOH A O   1 
HETATM 3718 O  O   . HOH D 4 .   ? -7.364  7.597   -36.604 1.00 39.47 ? 868  HOH A O   1 
HETATM 3719 O  O   . HOH D 4 .   ? -18.508 7.453   -20.385 1.00 28.25 ? 869  HOH A O   1 
HETATM 3720 O  O   . HOH D 4 .   ? -4.710  4.973   -3.044  1.00 42.63 ? 870  HOH A O   1 
HETATM 3721 O  O   . HOH D 4 .   ? -2.699  -11.700 0.874   1.00 35.51 ? 871  HOH A O   1 
HETATM 3722 O  O   . HOH D 4 .   ? -0.840  6.009   -11.491 1.00 31.28 ? 872  HOH A O   1 
HETATM 3723 O  O   . HOH D 4 .   ? -27.313 25.485  -38.899 1.00 26.13 ? 873  HOH A O   1 
HETATM 3724 O  O   . HOH D 4 .   ? -4.342  2.356   -7.040  1.00 46.00 ? 874  HOH A O   1 
HETATM 3725 O  O   . HOH D 4 .   ? -25.767 25.056  -23.516 1.00 35.45 ? 875  HOH A O   1 
HETATM 3726 O  O   . HOH D 4 .   ? -7.459  12.502  -36.981 1.00 39.92 ? 876  HOH A O   1 
HETATM 3727 O  O   . HOH D 4 .   ? -3.520  -13.545 -16.453 1.00 35.62 ? 877  HOH A O   1 
HETATM 3728 O  O   . HOH D 4 .   ? -7.843  -0.954  -29.471 1.00 28.79 ? 878  HOH A O   1 
HETATM 3729 O  O   . HOH D 4 .   ? 4.898   -1.416  -23.528 1.00 60.53 ? 879  HOH A O   1 
HETATM 3730 O  O   . HOH D 4 .   ? -13.493 16.795  -11.083 1.00 51.71 ? 880  HOH A O   1 
HETATM 3731 O  O   . HOH D 4 .   ? -28.247 -1.849  4.550   1.00 50.57 ? 881  HOH A O   1 
HETATM 3732 O  O   . HOH D 4 .   ? -20.144 9.830   7.578   1.00 38.68 ? 882  HOH A O   1 
HETATM 3733 O  O   . HOH D 4 .   ? -17.384 -18.944 4.506   1.00 40.12 ? 883  HOH A O   1 
HETATM 3734 O  O   . HOH D 4 .   ? -16.569 0.065   -39.628 1.00 32.82 ? 884  HOH A O   1 
HETATM 3735 O  O   . HOH D 4 .   ? -24.708 27.720  -23.575 1.00 50.50 ? 885  HOH A O   1 
HETATM 3736 O  O   . HOH D 4 .   ? -37.934 9.921   -27.541 1.00 58.63 ? 886  HOH A O   1 
HETATM 3737 O  O   . HOH D 4 .   ? -24.270 0.480   9.770   1.00 65.64 ? 887  HOH A O   1 
HETATM 3738 O  O   . HOH D 4 .   ? -12.494 -15.304 -9.102  1.00 38.31 ? 888  HOH A O   1 
HETATM 3739 O  O   . HOH D 4 .   ? -8.552  21.161  -26.846 1.00 41.92 ? 889  HOH A O   1 
HETATM 3740 O  O   . HOH D 4 .   ? -12.124 -6.178  -23.977 1.00 37.81 ? 890  HOH A O   1 
HETATM 3741 O  O   . HOH D 4 .   ? -33.902 -11.175 -6.542  1.00 56.85 ? 891  HOH A O   1 
HETATM 3742 O  O   . HOH D 4 .   ? -54.914 7.266   -10.741 1.00 56.97 ? 892  HOH A O   1 
HETATM 3743 O  O   . HOH D 4 .   ? -4.197  -4.612  -27.635 1.00 50.00 ? 893  HOH A O   1 
HETATM 3744 O  O   . HOH D 4 .   ? -7.681  6.058   -4.238  1.00 46.01 ? 894  HOH A O   1 
HETATM 3745 O  O   . HOH D 4 .   ? -30.183 0.151   -42.829 1.00 58.80 ? 895  HOH A O   1 
HETATM 3746 O  O   . HOH D 4 .   ? -25.938 -7.090  4.949   1.00 39.28 ? 896  HOH A O   1 
HETATM 3747 O  O   . HOH D 4 .   ? -33.095 25.393  -7.750  1.00 47.02 ? 897  HOH A O   1 
HETATM 3748 O  O   . HOH D 4 .   ? -46.096 9.580   -14.211 1.00 57.64 ? 898  HOH A O   1 
HETATM 3749 O  O   . HOH D 4 .   ? -15.714 -20.712 -9.762  1.00 39.04 ? 899  HOH A O   1 
HETATM 3750 O  O   . HOH D 4 .   ? -38.699 9.566   2.927   1.00 42.68 ? 900  HOH A O   1 
HETATM 3751 O  O   . HOH D 4 .   ? -6.049  17.881  -19.321 1.00 43.21 ? 901  HOH A O   1 
HETATM 3752 O  O   . HOH D 4 .   ? -43.428 11.419  -19.517 1.00 46.05 ? 902  HOH A O   1 
HETATM 3753 O  O   . HOH D 4 .   ? -30.425 -26.708 -6.929  1.00 54.50 ? 903  HOH A O   1 
HETATM 3754 O  O   . HOH D 4 .   ? -24.502 20.732  -22.869 1.00 28.16 ? 904  HOH A O   1 
HETATM 3755 O  O   . HOH D 4 .   ? -25.403 16.857  -37.464 1.00 27.37 ? 905  HOH A O   1 
HETATM 3756 O  O   . HOH D 4 .   ? -18.363 28.037  -38.697 1.00 40.31 ? 906  HOH A O   1 
HETATM 3757 O  O   . HOH D 4 .   ? -13.029 -15.510 -20.013 1.00 32.97 ? 907  HOH A O   1 
HETATM 3758 O  O   . HOH D 4 .   ? -16.078 -7.481  -25.592 1.00 32.95 ? 908  HOH A O   1 
HETATM 3759 O  O   . HOH D 4 .   ? -18.131 -15.010 -24.979 1.00 43.94 ? 909  HOH A O   1 
HETATM 3760 O  O   . HOH D 4 .   ? -9.427  25.905  -39.814 1.00 49.65 ? 910  HOH A O   1 
HETATM 3761 O  O   . HOH D 4 .   ? -28.040 -19.628 -8.787  1.00 45.12 ? 911  HOH A O   1 
HETATM 3762 O  O   . HOH D 4 .   ? -10.353 16.981  -45.221 1.00 40.65 ? 912  HOH A O   1 
HETATM 3763 O  O   . HOH D 4 .   ? -22.035 21.988  -22.674 1.00 29.51 ? 913  HOH A O   1 
HETATM 3764 O  O   . HOH D 4 .   ? -25.383 22.362  -38.925 1.00 42.46 ? 914  HOH A O   1 
HETATM 3765 O  O   . HOH D 4 .   ? -27.217 15.820  -30.510 1.00 21.99 ? 915  HOH A O   1 
HETATM 3766 O  O   . HOH D 4 .   ? -8.616  -18.524 -4.031  1.00 43.98 ? 916  HOH A O   1 
HETATM 3767 O  O   . HOH D 4 .   ? -24.011 -22.617 -18.390 1.00 38.40 ? 917  HOH A O   1 
HETATM 3768 O  O   . HOH D 4 .   ? -40.936 4.373   -27.844 1.00 64.86 ? 918  HOH A O   1 
HETATM 3769 O  O   . HOH D 4 .   ? -37.458 14.017  12.759  1.00 43.11 ? 919  HOH A O   1 
HETATM 3770 O  O   . HOH D 4 .   ? -35.775 8.353   -29.096 1.00 47.14 ? 920  HOH A O   1 
HETATM 3771 O  O   . HOH D 4 .   ? -26.231 -17.551 2.498   1.00 31.72 ? 921  HOH A O   1 
HETATM 3772 O  O   . HOH D 4 .   ? -3.318  13.615  -11.270 1.00 44.53 ? 922  HOH A O   1 
HETATM 3773 O  O   . HOH D 4 .   ? -11.797 -22.129 1.678   1.00 56.21 ? 923  HOH A O   1 
HETATM 3774 O  O   . HOH D 4 .   ? -8.045  20.049  -31.526 1.00 35.24 ? 924  HOH A O   1 
HETATM 3775 O  O   . HOH D 4 .   ? -20.266 15.926  -6.757  1.00 31.62 ? 925  HOH A O   1 
HETATM 3776 O  O   . HOH D 4 .   ? -30.737 -10.846 -26.491 1.00 50.01 ? 926  HOH A O   1 
HETATM 3777 O  O   . HOH D 4 .   ? -40.480 -4.733  -15.956 1.00 51.34 ? 927  HOH A O   1 
HETATM 3778 O  O   . HOH D 4 .   ? -6.834  -13.170 -21.992 1.00 39.84 ? 928  HOH A O   1 
HETATM 3779 O  O   . HOH D 4 .   ? -7.466  8.753   -27.058 1.00 21.38 ? 929  HOH A O   1 
HETATM 3780 O  O   . HOH D 4 .   ? -14.391 28.634  -31.190 1.00 45.36 ? 930  HOH A O   1 
HETATM 3781 O  O   . HOH D 4 .   ? -0.924  -11.615 -19.677 1.00 54.10 ? 931  HOH A O   1 
HETATM 3782 O  O   . HOH D 4 .   ? -38.092 11.528  -24.036 1.00 36.14 ? 932  HOH A O   1 
HETATM 3783 O  O   . HOH D 4 .   ? -32.986 -2.629  -0.594  1.00 30.43 ? 933  HOH A O   1 
HETATM 3784 O  O   . HOH D 4 .   ? -9.226  -9.182  -21.551 1.00 28.17 ? 934  HOH A O   1 
HETATM 3785 O  O   . HOH D 4 .   ? -0.492  -2.378  -21.112 1.00 34.10 ? 935  HOH A O   1 
HETATM 3786 O  O   . HOH D 4 .   ? -20.083 20.105  -23.222 1.00 28.01 ? 936  HOH A O   1 
HETATM 3787 O  O   . HOH D 4 .   ? -19.891 -8.073  -28.650 1.00 40.83 ? 937  HOH A O   1 
HETATM 3788 O  O   . HOH D 4 .   ? -21.128 -1.675  6.085   1.00 54.09 ? 938  HOH A O   1 
HETATM 3789 O  O   . HOH D 4 .   ? -8.560  9.161   -44.082 1.00 63.48 ? 939  HOH A O   1 
HETATM 3790 O  O   . HOH D 4 .   ? -1.579  6.780   -19.548 1.00 43.58 ? 940  HOH A O   1 
HETATM 3791 O  O   . HOH D 4 .   ? -12.569 6.655   -10.594 1.00 35.17 ? 941  HOH A O   1 
HETATM 3792 O  O   . HOH D 4 .   ? -9.261  -20.618 -0.736  1.00 67.72 ? 942  HOH A O   1 
HETATM 3793 O  O   . HOH D 4 .   ? -6.319  -17.272 -8.005  1.00 45.49 ? 943  HOH A O   1 
HETATM 3794 O  O   . HOH D 4 .   ? -11.605 8.454   -12.756 1.00 39.78 ? 944  HOH A O   1 
HETATM 3795 O  O   . HOH D 4 .   ? -2.237  5.175   -5.643  1.00 41.06 ? 945  HOH A O   1 
HETATM 3796 O  O   . HOH D 4 .   ? -6.333  -16.618 -10.474 1.00 31.42 ? 946  HOH A O   1 
HETATM 3797 O  O   . HOH D 4 .   ? -8.555  -2.231  9.351   1.00 36.77 ? 947  HOH A O   1 
HETATM 3798 O  O   . HOH D 4 .   ? -27.763 18.345  -38.151 1.00 42.08 ? 948  HOH A O   1 
HETATM 3799 O  O   . HOH D 4 .   ? -9.912  11.486  -43.246 1.00 35.66 ? 949  HOH A O   1 
HETATM 3800 O  O   . HOH D 4 .   ? -10.756 21.037  -31.636 1.00 31.82 ? 950  HOH A O   1 
HETATM 3801 O  O   . HOH D 4 .   ? -17.012 -0.880  -16.958 1.00 20.96 ? 951  HOH A O   1 
HETATM 3802 O  O   . HOH D 4 .   ? -2.378  -0.410  -28.548 1.00 38.24 ? 952  HOH A O   1 
HETATM 3803 O  O   . HOH D 4 .   ? -24.463 30.533  -34.558 1.00 46.53 ? 953  HOH A O   1 
HETATM 3804 O  O   . HOH D 4 .   ? -18.442 0.321   6.601   1.00 42.64 ? 954  HOH A O   1 
HETATM 3805 O  O   . HOH D 4 .   ? -16.509 4.712   6.280   1.00 50.27 ? 955  HOH A O   1 
HETATM 3806 O  O   . HOH D 4 .   ? -49.743 3.623   -11.885 1.00 40.29 ? 956  HOH A O   1 
HETATM 3807 O  O   . HOH D 4 .   ? -29.701 13.957  5.662   1.00 42.62 ? 957  HOH A O   1 
HETATM 3808 O  O   . HOH D 4 .   ? -3.069  11.308  -22.859 1.00 63.28 ? 958  HOH A O   1 
HETATM 3809 O  O   . HOH D 4 .   ? -30.894 -1.066  -0.001  1.00 34.14 ? 959  HOH A O   1 
HETATM 3810 O  O   . HOH D 4 .   ? -18.986 24.571  -41.844 1.00 53.05 ? 960  HOH A O   1 
HETATM 3811 O  O   . HOH D 4 .   ? -11.810 -5.941  -26.652 1.00 39.80 ? 961  HOH A O   1 
HETATM 3812 O  O   . HOH D 4 .   ? 2.398   -0.447  -10.672 1.00 39.75 ? 962  HOH A O   1 
HETATM 3813 O  O   . HOH D 4 .   ? -33.316 4.514   -36.779 1.00 66.81 ? 963  HOH A O   1 
HETATM 3814 O  O   . HOH D 4 .   ? -14.761 29.320  -25.099 1.00 38.41 ? 964  HOH A O   1 
HETATM 3815 O  O   . HOH D 4 .   ? -12.545 -10.000 -24.404 1.00 41.82 ? 965  HOH A O   1 
HETATM 3816 O  O   . HOH D 4 .   ? -28.495 -16.032 -11.206 1.00 34.17 ? 966  HOH A O   1 
HETATM 3817 O  O   . HOH D 4 .   ? -29.484 -2.779  -29.078 1.00 51.26 ? 967  HOH A O   1 
HETATM 3818 O  O   . HOH D 4 .   ? -18.841 0.659   -41.560 1.00 39.94 ? 968  HOH A O   1 
HETATM 3819 O  O   . HOH D 4 .   ? -0.229  5.571   -17.368 1.00 52.43 ? 969  HOH A O   1 
HETATM 3820 O  O   . HOH D 4 .   ? -9.002  11.281  -9.776  1.00 49.59 ? 970  HOH A O   1 
HETATM 3821 O  O   . HOH D 4 .   ? -7.701  9.099   -29.796 1.00 36.91 ? 971  HOH A O   1 
HETATM 3822 O  O   . HOH D 4 .   ? -19.729 -10.493 5.975   1.00 53.09 ? 972  HOH A O   1 
HETATM 3823 O  O   . HOH D 4 .   ? -45.166 19.996  -9.013  1.00 63.17 ? 973  HOH A O   1 
HETATM 3824 O  O   . HOH D 4 .   ? -1.458  2.667   -21.403 1.00 39.19 ? 974  HOH A O   1 
HETATM 3825 O  O   . HOH D 4 .   ? -9.888  -6.826  -22.670 1.00 25.78 ? 975  HOH A O   1 
HETATM 3826 O  O   . HOH D 4 .   ? -38.486 1.367   1.870   1.00 42.45 ? 976  HOH A O   1 
HETATM 3827 O  O   . HOH D 4 .   ? -47.188 17.957  -5.159  1.00 75.19 ? 977  HOH A O   1 
HETATM 3828 O  O   . HOH D 4 .   ? -31.218 19.311  -26.168 1.00 37.04 ? 978  HOH A O   1 
HETATM 3829 O  O   . HOH D 4 .   ? -10.377 -2.260  -29.030 1.00 32.52 ? 979  HOH A O   1 
HETATM 3830 O  O   . HOH D 4 .   ? -33.033 22.315  -20.254 1.00 36.13 ? 980  HOH A O   1 
HETATM 3831 O  O   . HOH D 4 .   ? -33.115 25.398  -20.535 1.00 55.52 ? 981  HOH A O   1 
HETATM 3832 O  O   . HOH D 4 .   ? -4.270  19.774  -30.041 1.00 60.38 ? 982  HOH A O   1 
HETATM 3833 O  O   . HOH D 4 .   ? -24.396 20.078  -41.452 1.00 41.67 ? 983  HOH A O   1 
HETATM 3834 O  O   . HOH D 4 .   ? -20.533 -16.501 -19.290 1.00 36.18 ? 984  HOH A O   1 
HETATM 3835 O  O   . HOH D 4 .   ? -16.285 28.354  -37.531 1.00 44.37 ? 985  HOH A O   1 
HETATM 3836 O  O   . HOH D 4 .   ? -13.306 -1.933  -30.793 1.00 30.21 ? 986  HOH A O   1 
HETATM 3837 O  O   . HOH D 4 .   ? -22.290 5.080   8.118   1.00 55.17 ? 987  HOH A O   1 
HETATM 3838 O  O   . HOH D 4 .   ? -21.221 30.449  -40.056 1.00 62.78 ? 988  HOH A O   1 
HETATM 3839 O  O   . HOH D 4 .   ? -53.305 5.018   -10.059 1.00 51.88 ? 989  HOH A O   1 
HETATM 3840 O  O   . HOH D 4 .   ? -1.693  -7.569  -4.406  1.00 39.15 ? 990  HOH A O   1 
HETATM 3841 O  O   . HOH D 4 .   ? -19.612 -17.197 -21.922 1.00 37.14 ? 991  HOH A O   1 
HETATM 3842 O  O   . HOH D 4 .   ? -19.553 11.679  -5.900  1.00 26.97 ? 992  HOH A O   1 
HETATM 3843 O  O   . HOH D 4 .   ? -26.299 -24.538 -12.453 1.00 33.03 ? 993  HOH A O   1 
HETATM 3844 O  O   . HOH D 4 .   ? -20.773 33.100  -33.762 1.00 51.23 ? 994  HOH A O   1 
HETATM 3845 O  O   . HOH D 4 .   ? -27.628 13.832  3.763   1.00 51.73 ? 995  HOH A O   1 
HETATM 3846 O  O   . HOH D 4 .   ? -32.351 -23.273 -5.133  1.00 59.46 ? 996  HOH A O   1 
HETATM 3847 O  O   . HOH D 4 .   ? -2.361  -10.235 -17.177 1.00 46.31 ? 997  HOH A O   1 
HETATM 3848 O  O   . HOH D 4 .   ? -34.052 19.354  -29.770 1.00 48.02 ? 998  HOH A O   1 
HETATM 3849 O  O   . HOH D 4 .   ? -18.890 -13.368 4.990   1.00 57.23 ? 999  HOH A O   1 
HETATM 3850 O  O   . HOH D 4 .   ? -15.306 -23.665 -12.140 1.00 65.83 ? 1000 HOH A O   1 
HETATM 3851 O  O   . HOH D 4 .   ? -18.444 -9.823  7.890   1.00 41.05 ? 1001 HOH A O   1 
HETATM 3852 O  O   . HOH D 4 .   ? -38.328 6.716   3.570   1.00 55.05 ? 1002 HOH A O   1 
HETATM 3853 O  O   . HOH D 4 .   ? -28.559 -21.381 -12.611 1.00 47.67 ? 1003 HOH A O   1 
HETATM 3854 O  O   . HOH D 4 .   ? -20.764 30.185  -27.948 1.00 39.69 ? 1004 HOH A O   1 
HETATM 3855 O  O   . HOH D 4 .   ? -18.273 29.978  -28.073 1.00 45.55 ? 1005 HOH A O   1 
HETATM 3856 O  O   . HOH D 4 .   ? -24.437 -26.076 -12.172 1.00 51.98 ? 1006 HOH A O   1 
HETATM 3857 O  O   . HOH D 4 .   ? -26.429 17.343  10.454  1.00 49.53 ? 1007 HOH A O   1 
HETATM 3858 O  O   . HOH D 4 .   ? -7.227  21.893  -33.074 1.00 50.76 ? 1008 HOH A O   1 
HETATM 3859 O  O   . HOH D 4 .   ? -25.638 4.287   5.384   1.00 46.15 ? 1009 HOH A O   1 
HETATM 3860 O  O   . HOH D 4 .   ? -7.457  1.711   -42.788 1.00 55.68 ? 1010 HOH A O   1 
HETATM 3861 O  O   . HOH D 4 .   ? -17.338 27.373  -22.392 1.00 35.18 ? 1011 HOH A O   1 
HETATM 3862 O  O   . HOH D 4 .   ? -10.229 6.081   -9.216  1.00 28.50 ? 1012 HOH A O   1 
HETATM 3863 O  O   . HOH D 4 .   ? -22.357 -2.661  8.343   1.00 49.36 ? 1013 HOH A O   1 
HETATM 3864 O  O   . HOH D 4 .   ? -38.545 4.114   -33.191 1.00 68.10 ? 1014 HOH A O   1 
HETATM 3865 O  O   . HOH D 4 .   ? -12.981 1.642   -42.363 1.00 33.93 ? 1015 HOH A O   1 
HETATM 3866 O  O   . HOH D 4 .   ? -18.575 13.506  -4.025  1.00 40.17 ? 1016 HOH A O   1 
HETATM 3867 O  O   . HOH D 4 .   ? -24.690 -24.657 -24.438 1.00 39.54 ? 1017 HOH A O   1 
HETATM 3868 O  O   . HOH D 4 .   ? -31.029 29.502  -19.927 1.00 48.74 ? 1018 HOH A O   1 
HETATM 3869 O  O   . HOH D 4 .   ? -22.109 -28.188 -10.059 1.00 52.93 ? 1019 HOH A O   1 
HETATM 3870 O  O   . HOH D 4 .   ? -18.920 -8.314  6.402   1.00 43.19 ? 1020 HOH A O   1 
HETATM 3871 O  O   . HOH D 4 .   ? -41.528 15.750  -15.556 1.00 63.07 ? 1021 HOH A O   1 
HETATM 3872 O  O   . HOH D 4 .   ? -3.454  -4.718  6.326   1.00 47.86 ? 1022 HOH A O   1 
HETATM 3873 O  O   . HOH D 4 .   ? -5.117  -5.842  -29.777 1.00 56.78 ? 1023 HOH A O   1 
HETATM 3874 O  O   . HOH D 4 .   ? -16.171 -24.853 7.308   1.00 39.93 ? 1024 HOH A O   1 
HETATM 3875 O  O   . HOH D 4 .   ? -30.832 15.568  -11.398 1.00 39.42 ? 1025 HOH A O   1 
HETATM 3876 O  O   . HOH D 4 .   ? -0.296  -8.793  5.103   1.00 52.29 ? 1026 HOH A O   1 
HETATM 3877 O  O   . HOH D 4 .   ? -10.113 -4.577  -32.749 1.00 56.97 ? 1027 HOH A O   1 
HETATM 3878 O  O   . HOH D 4 .   ? -18.346 19.643  -42.646 1.00 27.21 ? 1028 HOH A O   1 
HETATM 3879 O  O   . HOH D 4 .   ? -46.726 17.387  -8.618  1.00 58.90 ? 1029 HOH A O   1 
HETATM 3880 O  O   . HOH D 4 .   ? -4.824  -11.254 6.388   1.00 52.37 ? 1030 HOH A O   1 
HETATM 3881 O  O   . HOH D 4 .   ? -14.679 -23.604 1.586   1.00 45.85 ? 1031 HOH A O   1 
HETATM 3882 O  O   . HOH D 4 .   ? -8.752  -17.263 -19.068 1.00 55.34 ? 1032 HOH A O   1 
HETATM 3883 O  O   . HOH D 4 .   ? -9.027  15.148  -40.109 1.00 63.36 ? 1033 HOH A O   1 
HETATM 3884 O  O   . HOH D 4 .   ? -10.247 8.924   -10.446 1.00 68.26 ? 1034 HOH A O   1 
HETATM 3885 O  O   . HOH D 4 .   ? -28.267 -28.446 -5.962  1.00 44.99 ? 1035 HOH A O   1 
HETATM 3886 O  O   . HOH D 4 .   ? -45.944 -5.369  -5.192  1.00 49.60 ? 1036 HOH A O   1 
HETATM 3887 O  O   . HOH D 4 .   ? 0.771   3.844   -27.806 1.00 54.39 ? 1037 HOH A O   1 
HETATM 3888 O  O   . HOH D 4 .   ? -28.688 15.749  -39.538 1.00 32.51 ? 1038 HOH A O   1 
HETATM 3889 O  O   . HOH D 4 .   ? -0.300  -9.168  -14.340 1.00 56.38 ? 1039 HOH A O   1 
HETATM 3890 O  O   . HOH D 4 .   ? -34.889 13.030  12.981  1.00 51.54 ? 1040 HOH A O   1 
HETATM 3891 O  O   . HOH D 4 .   ? -26.692 6.681   -46.614 1.00 53.74 ? 1041 HOH A O   1 
HETATM 3892 O  O   . HOH D 4 .   ? -5.300  9.755   -6.515  1.00 44.68 ? 1042 HOH A O   1 
HETATM 3893 O  O   . HOH D 4 .   ? -44.890 -2.547  -5.229  1.00 49.73 ? 1043 HOH A O   1 
HETATM 3894 O  O   . HOH D 4 .   ? -39.679 -4.523  -18.948 1.00 57.05 ? 1044 HOH A O   1 
HETATM 3895 O  O   . HOH D 4 .   ? -17.440 -9.231  -26.144 1.00 44.03 ? 1045 HOH A O   1 
HETATM 3896 O  O   . HOH D 4 .   ? -5.615  -2.252  -30.469 1.00 42.17 ? 1046 HOH A O   1 
HETATM 3897 O  O   . HOH D 4 .   ? -28.245 -20.466 -19.234 1.00 46.82 ? 1047 HOH A O   1 
HETATM 3898 O  O   . HOH D 4 .   ? -25.942 7.660   8.730   1.00 47.53 ? 1048 HOH A O   1 
HETATM 3899 O  O   . HOH D 4 .   ? 0.906   1.730   -19.875 1.00 49.80 ? 1049 HOH A O   1 
HETATM 3900 O  O   . HOH D 4 .   ? -9.005  -17.147 -11.548 1.00 34.25 ? 1050 HOH A O   1 
HETATM 3901 O  O   . HOH D 4 .   ? -24.332 23.467  -19.912 1.00 43.30 ? 1051 HOH A O   1 
HETATM 3902 O  O   . HOH D 4 .   ? -16.305 -15.323 8.012   1.00 40.94 ? 1052 HOH A O   1 
HETATM 3903 O  O   . HOH D 4 .   ? -7.002  -14.408 4.879   1.00 45.22 ? 1053 HOH A O   1 
HETATM 3904 O  O   . HOH D 4 .   ? -11.109 -17.009 6.577   1.00 35.37 ? 1054 HOH A O   1 
HETATM 3905 O  O   . HOH D 4 .   ? 0.386   -5.156  -21.531 1.00 59.97 ? 1055 HOH A O   1 
HETATM 3906 O  O   . HOH D 4 .   ? -12.618 10.747  -13.898 1.00 34.78 ? 1056 HOH A O   1 
HETATM 3907 O  O   . HOH D 4 .   ? -9.077  -17.456 1.962   1.00 46.64 ? 1057 HOH A O   1 
HETATM 3908 O  O   . HOH D 4 .   ? -27.779 20.586  -39.210 1.00 50.66 ? 1058 HOH A O   1 
HETATM 3909 O  O   . HOH D 4 .   ? -18.850 -19.663 -22.654 1.00 44.25 ? 1059 HOH A O   1 
HETATM 3910 O  O   . HOH D 4 .   ? -40.882 1.895   -27.666 1.00 49.38 ? 1060 HOH A O   1 
HETATM 3911 O  O   . HOH D 4 .   ? -34.377 15.117  15.333  1.00 56.70 ? 1061 HOH A O   1 
HETATM 3912 O  O   . HOH D 4 .   ? -41.401 14.550  -17.960 1.00 65.86 ? 1062 HOH A O   1 
HETATM 3913 O  O   . HOH D 4 .   ? -11.019 -17.440 -9.842  1.00 45.34 ? 1063 HOH A O   1 
HETATM 3914 O  O   . HOH D 4 .   ? -5.434  -11.942 -23.539 1.00 66.73 ? 1064 HOH A O   1 
HETATM 3915 O  O   . HOH D 4 .   ? -3.446  13.965  -26.239 1.00 49.73 ? 1065 HOH A O   1 
HETATM 3916 O  O   . HOH D 4 .   ? -45.012 16.434  0.208   1.00 55.25 ? 1066 HOH A O   1 
HETATM 3917 O  O   . HOH D 4 .   ? -26.968 25.781  -2.710  1.00 67.09 ? 1067 HOH A O   1 
HETATM 3918 O  O   . HOH D 4 .   ? -13.661 -21.690 -9.634  1.00 67.95 ? 1068 HOH A O   1 
HETATM 3919 O  O   . HOH D 4 .   ? -10.896 26.887  -26.629 1.00 57.00 ? 1069 HOH A O   1 
HETATM 3920 O  O   . HOH D 4 .   ? -38.656 23.258  12.231  1.00 62.00 ? 1070 HOH A O   1 
HETATM 3921 O  O   . HOH D 4 .   ? -10.597 -1.831  -41.784 1.00 68.17 ? 1071 HOH A O   1 
HETATM 3922 O  O   . HOH D 4 .   ? -7.019  10.500  -31.696 1.00 43.00 ? 1072 HOH A O   1 
HETATM 3923 O  O   . HOH D 4 .   ? -1.606  -7.283  -15.143 1.00 38.54 ? 1073 HOH A O   1 
HETATM 3924 O  O   . HOH D 4 .   ? -8.442  -16.712 3.938   1.00 57.91 ? 1074 HOH A O   1 
HETATM 3925 O  O   . HOH D 4 .   ? -6.330  -0.624  9.949   1.00 43.95 ? 1075 HOH A O   1 
HETATM 3926 O  O   . HOH D 4 .   ? -26.427 -22.124 -20.082 1.00 53.13 ? 1076 HOH A O   1 
HETATM 3927 O  O   . HOH D 4 .   ? -25.951 -3.866  -17.240 1.00 39.85 ? 1077 HOH A O   1 
HETATM 3928 O  O   . HOH D 4 .   ? -7.601  -0.002  -40.480 1.00 56.29 ? 1078 HOH A O   1 
HETATM 3929 O  O   . HOH D 4 .   ? -21.883 -14.521 2.569   1.00 48.14 ? 1079 HOH A O   1 
HETATM 3930 O  O   . HOH D 4 .   ? -7.856  25.623  -35.074 1.00 58.70 ? 1080 HOH A O   1 
HETATM 3931 O  O   . HOH D 4 .   ? -14.038 -2.976  -33.738 1.00 39.88 ? 1081 HOH A O   1 
HETATM 3932 O  O   . HOH D 4 .   ? -25.637 -6.194  -31.350 1.00 65.62 ? 1082 HOH A O   1 
HETATM 3933 O  O   . HOH D 4 .   ? -6.841  -1.840  -38.586 1.00 59.18 ? 1083 HOH A O   1 
HETATM 3934 O  O   . HOH D 4 .   ? -31.766 -7.545  -15.054 1.00 50.65 ? 1084 HOH A O   1 
HETATM 3935 O  O   . HOH D 4 .   ? -23.220 -16.387 3.620   1.00 58.55 ? 1085 HOH A O   1 
HETATM 3936 O  O   . HOH D 4 .   ? -7.047  11.474  -33.748 1.00 45.54 ? 1086 HOH A O   1 
HETATM 3937 O  O   . HOH D 4 .   ? -51.237 6.268   -16.438 1.00 61.37 ? 1087 HOH A O   1 
HETATM 3938 O  O   . HOH D 4 .   ? -12.414 -18.089 -19.035 1.00 34.58 ? 1088 HOH A O   1 
HETATM 3939 O  O   . HOH D 4 .   ? -37.923 8.191   7.464   1.00 56.54 ? 1089 HOH A O   1 
HETATM 3940 O  O   . HOH D 4 .   ? -6.641  -9.357  -24.540 1.00 48.25 ? 1090 HOH A O   1 
HETATM 3941 O  O   . HOH D 4 .   ? -14.731 22.685  -16.132 1.00 44.59 ? 1091 HOH A O   1 
HETATM 3942 O  O   . HOH D 4 .   ? -1.430  -7.097  -1.616  1.00 55.85 ? 1092 HOH A O   1 
HETATM 3943 O  O   . HOH D 4 .   ? -43.036 -6.898  -15.553 1.00 66.30 ? 1093 HOH A O   1 
HETATM 3944 O  O   . HOH D 4 .   ? -23.726 8.241   10.332  1.00 67.10 ? 1094 HOH A O   1 
HETATM 3945 O  O   . HOH D 4 .   ? -0.162  -12.350 -7.523  1.00 47.46 ? 1095 HOH A O   1 
HETATM 3946 O  O   . HOH D 4 .   ? -8.507  17.384  -37.282 1.00 37.46 ? 1096 HOH A O   1 
HETATM 3947 O  O   . HOH D 4 .   ? -51.853 4.927   -18.896 1.00 54.92 ? 1097 HOH A O   1 
HETATM 3948 O  O   . HOH D 4 .   ? -38.794 4.279   -29.064 1.00 53.83 ? 1098 HOH A O   1 
HETATM 3949 O  O   . HOH D 4 .   ? -47.776 10.985  -12.785 1.00 56.78 ? 1099 HOH A O   1 
HETATM 3950 O  O   . HOH D 4 .   ? -17.586 -3.511  -37.125 1.00 42.46 ? 1100 HOH A O   1 
HETATM 3951 O  O   . HOH D 4 .   ? -25.938 32.758  -35.659 1.00 55.74 ? 1101 HOH A O   1 
HETATM 3952 O  O   . HOH D 4 .   ? -3.405  -12.206 3.655   1.00 51.27 ? 1102 HOH A O   1 
HETATM 3953 O  O   . HOH D 4 .   ? -31.847 6.425   -38.283 1.00 58.31 ? 1103 HOH A O   1 
HETATM 3954 O  O   . HOH D 4 .   ? -50.202 8.649   -16.375 1.00 57.99 ? 1104 HOH A O   1 
HETATM 3955 O  O   . HOH D 4 .   ? -44.989 18.173  6.339   1.00 52.77 ? 1105 HOH A O   1 
HETATM 3956 O  O   . HOH D 4 .   ? -10.807 -2.045  11.137  1.00 55.02 ? 1106 HOH A O   1 
HETATM 3957 O  O   . HOH D 4 .   ? -25.738 9.021   -48.299 1.00 46.25 ? 1107 HOH A O   1 
HETATM 3958 O  O   . HOH D 4 .   ? -31.795 -1.321  -41.441 1.00 63.84 ? 1108 HOH A O   1 
HETATM 3959 O  O   . HOH D 4 .   ? -12.608 28.478  -32.499 1.00 54.00 ? 1109 HOH A O   1 
HETATM 3960 O  O   . HOH D 4 .   ? -32.571 14.251  -35.547 1.00 57.10 ? 1110 HOH A O   1 
HETATM 3961 O  O   . HOH D 4 .   ? -33.040 -2.139  -19.723 1.00 50.86 ? 1111 HOH A O   1 
HETATM 3962 O  O   . HOH D 4 .   ? -13.230 1.332   -44.681 1.00 47.21 ? 1112 HOH A O   1 
HETATM 3963 O  O   . HOH D 4 .   ? -19.183 17.438  -8.466  1.00 36.23 ? 1113 HOH A O   1 
HETATM 3964 O  O   . HOH D 4 .   ? -26.552 32.529  -32.330 1.00 45.55 ? 1114 HOH A O   1 
HETATM 3965 O  O   . HOH D 4 .   ? -28.435 -4.872  -16.272 1.00 50.22 ? 1115 HOH A O   1 
HETATM 3966 O  O   . HOH D 4 .   ? -6.503  9.647   -35.922 1.00 50.31 ? 1116 HOH A O   1 
HETATM 3967 O  O   . HOH D 4 .   ? -11.250 6.197   -6.544  1.00 34.26 ? 1117 HOH A O   1 
HETATM 3968 O  O   . HOH D 4 .   ? -18.289 -15.585 4.320   1.00 51.50 ? 1118 HOH A O   1 
HETATM 3969 O  O   . HOH D 4 .   ? -6.574  9.957   -40.769 1.00 51.31 ? 1119 HOH A O   1 
HETATM 3970 O  O   . HOH D 4 .   ? -33.016 -11.492 -16.276 1.00 38.51 ? 1120 HOH A O   1 
HETATM 3971 O  O   . HOH D 4 .   ? -10.403 8.504   0.461   1.00 61.20 ? 1121 HOH A O   1 
HETATM 3972 O  O   . HOH D 4 .   ? -24.405 22.837  -41.530 1.00 60.31 ? 1122 HOH A O   1 
HETATM 3973 O  O   . HOH D 4 .   ? -0.959  10.871  -13.558 1.00 54.94 ? 1123 HOH A O   1 
HETATM 3974 O  O   . HOH D 4 .   ? -0.371  -6.891  -19.176 1.00 43.33 ? 1124 HOH A O   1 
HETATM 3975 O  O   . HOH D 4 .   ? -25.175 5.512   7.758   1.00 45.56 ? 1125 HOH A O   1 
HETATM 3976 O  O   . HOH D 4 .   ? -8.382  13.558  -43.571 1.00 52.13 ? 1126 HOH A O   1 
HETATM 3977 O  O   . HOH D 4 .   ? -17.681 21.921  -12.514 1.00 52.66 ? 1127 HOH A O   1 
HETATM 3978 O  O   . HOH D 4 .   ? -24.941 -20.859 4.851   1.00 47.81 ? 1128 HOH A O   1 
HETATM 3979 O  O   . HOH D 4 .   ? -14.798 0.169   -41.359 1.00 36.58 ? 1129 HOH A O   1 
HETATM 3980 O  O   . HOH D 4 .   ? -52.271 5.170   -14.371 1.00 58.68 ? 1130 HOH A O   1 
HETATM 3981 O  O   . HOH D 4 .   ? -28.129 -17.785 -18.988 1.00 36.01 ? 1131 HOH A O   1 
HETATM 3982 O  O   . HOH D 4 .   ? -29.479 23.344  -38.383 1.00 46.15 ? 1132 HOH A O   1 
HETATM 3983 O  O   . HOH D 4 .   ? -40.263 22.264  7.774   1.00 53.64 ? 1133 HOH A O   1 
HETATM 3984 O  O   . HOH D 4 .   ? -5.717  -17.132 -19.131 1.00 54.77 ? 1134 HOH A O   1 
HETATM 3985 O  O   . HOH D 4 .   ? -49.524 0.913   -11.179 1.00 51.90 ? 1135 HOH A O   1 
HETATM 3986 O  O   . HOH D 4 .   ? -15.284 29.710  -34.086 1.00 46.06 ? 1136 HOH A O   1 
HETATM 3987 O  O   . HOH D 4 .   ? -21.067 25.899  -19.695 1.00 58.09 ? 1137 HOH A O   1 
HETATM 3988 O  O   . HOH D 4 .   ? -30.870 12.543  -36.665 1.00 51.85 ? 1138 HOH A O   1 
HETATM 3989 O  O   . HOH D 4 .   ? -20.949 -18.462 5.668   1.00 50.45 ? 1139 HOH A O   1 
HETATM 3990 O  O   . HOH D 4 .   ? -18.481 -17.335 6.345   1.00 53.00 ? 1140 HOH A O   1 
HETATM 3991 O  O   . HOH D 4 .   ? -28.632 2.298   4.763   1.00 50.31 ? 1141 HOH A O   1 
HETATM 3992 O  O   . HOH D 4 .   ? -18.231 -1.040  8.937   1.00 51.22 ? 1142 HOH A O   1 
HETATM 3993 O  O   . HOH D 4 .   ? -17.748 -11.413 9.313   1.00 49.85 ? 1143 HOH A O   1 
HETATM 3994 O  O   . HOH D 4 .   ? -32.945 0.051   -34.285 1.00 48.22 ? 1144 HOH A O   1 
HETATM 3995 O  O   . HOH D 4 .   ? 1.591   -0.325  -20.560 1.00 66.24 ? 1145 HOH A O   1 
HETATM 3996 O  O   . HOH D 4 .   ? -17.374 -15.618 -22.537 1.00 51.16 ? 1146 HOH A O   1 
HETATM 3997 O  O   . HOH D 4 .   ? -10.133 -15.635 -21.729 1.00 54.31 ? 1147 HOH A O   1 
HETATM 3998 O  O   . HOH D 4 .   ? -44.330 -11.437 -13.172 1.00 60.52 ? 1148 HOH A O   1 
HETATM 3999 O  O   . HOH D 4 .   ? -29.791 -7.053  -16.690 1.00 49.10 ? 1149 HOH A O   1 
HETATM 4000 O  O   . HOH D 4 .   ? -15.965 -21.766 -20.876 1.00 62.28 ? 1150 HOH A O   1 
HETATM 4001 O  O   . HOH D 4 .   ? -22.096 23.571  -20.094 1.00 43.01 ? 1151 HOH A O   1 
HETATM 4002 O  O   . HOH D 4 .   ? -8.192  26.573  -37.743 1.00 58.40 ? 1152 HOH A O   1 
HETATM 4003 O  O   . HOH D 4 .   ? -11.974 -4.573  -30.729 1.00 66.37 ? 1153 HOH A O   1 
HETATM 4004 O  O   . HOH D 4 .   ? -17.800 -13.283 7.606   1.00 47.35 ? 1154 HOH A O   1 
HETATM 4005 O  O   . HOH D 4 .   ? -52.163 3.800   -12.270 1.00 43.82 ? 1155 HOH A O   1 
HETATM 4006 O  O   . HOH D 4 .   ? -32.466 -11.526 -8.358  1.00 46.53 ? 1156 HOH A O   1 
HETATM 4007 O  O   . HOH D 4 .   ? 2.013   -6.252  -17.712 1.00 51.97 ? 1157 HOH A O   1 
HETATM 4008 O  O   . HOH D 4 .   ? -44.053 -2.893  -2.785  1.00 52.99 ? 1158 HOH A O   1 
HETATM 4009 O  O   . HOH D 4 .   ? -2.017  -15.631 -16.990 1.00 47.08 ? 1159 HOH A O   1 
HETATM 4010 O  O   . HOH D 4 .   ? -6.586  18.412  -35.567 1.00 46.21 ? 1160 HOH A O   1 
HETATM 4011 O  O   . HOH D 4 .   ? -35.329 20.893  -18.531 1.00 65.35 ? 1161 HOH A O   1 
HETATM 4012 O  O   . HOH D 4 .   ? -9.848  -10.772 -23.567 1.00 46.80 ? 1162 HOH A O   1 
HETATM 4013 O  O   . HOH D 4 .   ? 2.488   3.826   -29.524 1.00 63.55 ? 1163 HOH A O   1 
HETATM 4014 O  O   . HOH D 4 .   ? -29.914 -17.986 -12.709 1.00 60.48 ? 1164 HOH A O   1 
HETATM 4015 O  O   . HOH D 4 .   ? -29.017 26.317  -3.799  1.00 58.05 ? 1165 HOH A O   1 
HETATM 4016 O  O   . HOH D 4 .   ? -34.554 9.580   -35.386 1.00 64.07 ? 1166 HOH A O   1 
HETATM 4017 O  O   . HOH D 4 .   ? -12.964 20.747  -15.052 1.00 49.65 ? 1167 HOH A O   1 
HETATM 4018 O  O   . HOH D 4 .   ? -45.198 -6.626  -3.344  1.00 65.45 ? 1168 HOH A O   1 
HETATM 4019 O  O   . HOH D 4 .   ? -22.099 -5.491  -34.142 1.00 52.91 ? 1169 HOH A O   1 
HETATM 4020 O  O   . HOH D 4 .   ? -5.565  3.130   -42.716 1.00 73.61 ? 1170 HOH A O   1 
HETATM 4021 O  O   . HOH D 4 .   ? -42.750 5.032   0.554   1.00 57.88 ? 1171 HOH A O   1 
HETATM 4022 O  O   . HOH D 4 .   ? -0.426  -15.047 -10.702 1.00 46.61 ? 1172 HOH A O   1 
HETATM 4023 O  O   . HOH D 4 .   ? -16.222 -2.454  -38.854 1.00 62.36 ? 1173 HOH A O   1 
HETATM 4024 O  O   . HOH D 4 .   ? -13.471 -2.232  -41.209 1.00 56.32 ? 1174 HOH A O   1 
HETATM 4025 O  O   . HOH D 4 .   ? -10.592 -13.436 -23.538 1.00 57.52 ? 1175 HOH A O   1 
HETATM 4026 O  O   . HOH D 4 .   ? -22.521 -22.332 5.374   1.00 45.74 ? 1176 HOH A O   1 
HETATM 4027 O  O   . HOH D 4 .   ? -46.922 9.266   -18.680 1.00 47.90 ? 1177 HOH A O   1 
HETATM 4028 O  O   . HOH D 4 .   ? -40.857 5.674   3.314   1.00 71.67 ? 1178 HOH A O   1 
HETATM 4029 O  O   . HOH D 4 .   ? -21.082 23.377  -42.360 1.00 40.55 ? 1179 HOH A O   1 
HETATM 4030 O  O   . HOH D 4 .   ? -29.269 -3.635  -31.801 1.00 60.40 ? 1180 HOH A O   1 
HETATM 4031 O  O   . HOH D 4 .   ? -14.918 -15.952 -22.045 1.00 39.68 ? 1181 HOH A O   1 
HETATM 4032 O  O   . HOH D 4 .   ? -46.437 16.562  2.252   1.00 51.53 ? 1182 HOH A O   1 
HETATM 4033 O  O   . HOH D 4 .   ? -26.962 -25.756 0.683   1.00 56.21 ? 1183 HOH A O   1 
HETATM 4034 O  O   . HOH D 4 .   ? -8.559  19.030  -45.850 1.00 59.42 ? 1184 HOH A O   1 
HETATM 4035 O  O   . HOH D 4 .   ? -20.870 -0.970  9.782   1.00 57.84 ? 1185 HOH A O   1 
HETATM 4036 O  O   . HOH D 4 .   ? -1.077  -5.220  -5.467  1.00 49.89 ? 1186 HOH A O   1 
HETATM 4037 O  O   . HOH D 4 .   ? -9.263  14.462  -46.090 1.00 49.48 ? 1187 HOH A O   1 
HETATM 4038 O  O   . HOH D 4 .   ? -18.333 26.680  -19.336 1.00 61.69 ? 1188 HOH A O   1 
HETATM 4039 O  O   . HOH D 4 .   ? -25.098 -5.781  7.261   1.00 46.56 ? 1189 HOH A O   1 
HETATM 4040 O  O   . HOH D 4 .   ? -40.114 9.007   8.945   1.00 60.64 ? 1190 HOH A O   1 
HETATM 4041 O  O   . HOH D 4 .   ? -0.673  13.668  -12.280 1.00 56.19 ? 1191 HOH A O   1 
HETATM 4042 O  O   . HOH D 4 .   ? -28.858 -17.006 -8.675  1.00 62.74 ? 1192 HOH A O   1 
HETATM 4043 O  O   . HOH D 4 .   ? -27.720 -21.512 2.105   1.00 49.66 ? 1193 HOH A O   1 
HETATM 4044 O  O   . HOH D 4 .   ? -42.258 -12.442 -12.603 1.00 66.98 ? 1194 HOH A O   1 
HETATM 4045 O  O   . HOH D 4 .   ? -19.189 -26.733 -13.363 1.00 52.12 ? 1195 HOH A O   1 
HETATM 4046 O  O   . HOH D 4 .   ? -16.767 -25.901 -14.167 1.00 70.01 ? 1196 HOH A O   1 
HETATM 4047 O  O   . HOH D 4 .   ? -26.513 24.881  -41.578 1.00 54.33 ? 1197 HOH A O   1 
HETATM 4048 O  O   . HOH D 4 .   ? -16.097 3.455   9.896   1.00 56.16 ? 1198 HOH A O   1 
HETATM 4049 O  O   . HOH D 4 .   ? -18.750 25.134  -14.783 1.00 55.10 ? 1199 HOH A O   1 
HETATM 4050 O  O   . HOH D 4 .   ? -28.253 4.677   4.128   1.00 44.79 ? 1200 HOH A O   1 
HETATM 4051 O  O   . HOH D 4 .   ? -34.478 24.937  11.967  1.00 52.05 ? 1201 HOH A O   1 
HETATM 4052 O  O   . HOH D 4 .   ? -26.710 23.941  0.139   1.00 52.04 ? 1202 HOH A O   1 
HETATM 4053 O  O   . HOH D 4 .   ? -18.782 29.339  -19.974 1.00 63.26 ? 1203 HOH A O   1 
HETATM 4054 O  O   . HOH D 4 .   ? -3.454  5.078   3.598   1.00 59.23 ? 1204 HOH A O   1 
HETATM 4055 O  O   . HOH D 4 .   ? -14.833 -5.334  -29.951 1.00 59.68 ? 1205 HOH A O   1 
HETATM 4056 O  O   . HOH D 4 .   ? -14.240 -20.087 -21.029 1.00 63.92 ? 1206 HOH A O   1 
HETATM 4057 O  O   . HOH D 4 .   ? -24.454 -6.078  -34.202 1.00 58.53 ? 1207 HOH A O   1 
HETATM 4058 O  O   . HOH D 4 .   ? -17.191 1.263   10.570  1.00 57.25 ? 1208 HOH A O   1 
HETATM 4059 O  O   . HOH D 4 .   ? -40.153 -13.343 -13.851 1.00 57.33 ? 1209 HOH A O   1 
HETATM 4060 O  O   . HOH D 4 .   ? -51.557 8.709   -18.962 1.00 68.75 ? 1210 HOH A O   1 
HETATM 4061 O  O   . HOH D 4 .   ? -19.997 26.343  -16.781 1.00 60.35 ? 1211 HOH A O   1 
HETATM 4062 O  O   . HOH D 4 .   ? -36.780 24.671  11.298  1.00 57.17 ? 1212 HOH A O   1 
HETATM 4063 O  O   . HOH D 4 .   ? -15.856 -7.431  -28.929 1.00 75.72 ? 1213 HOH A O   1 
HETATM 4064 O  O   . HOH D 4 .   ? -14.672 -18.289 -22.829 1.00 58.34 ? 1214 HOH A O   1 
HETATM 4065 O  O   . HOH D 4 .   ? -47.530 19.599  5.880   1.00 58.52 ? 1215 HOH A O   1 
HETATM 4066 O  O   . HOH D 4 .   ? -47.610 21.749  4.791   1.00 71.95 ? 1216 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ALA A 51  ? 0.6275 0.5910 0.5912 -0.0057 -0.0326 -0.0254 127  ALA A N   
2    C  CA  . ALA A 51  ? 0.5851 0.5383 0.5379 -0.0006 -0.0275 -0.0282 127  ALA A CA  
3    C  C   . ALA A 51  ? 0.5112 0.4691 0.4652 0.0010  -0.0272 -0.0270 127  ALA A C   
4    O  O   . ALA A 51  ? 0.4486 0.3981 0.3916 0.0038  -0.0236 -0.0288 127  ALA A O   
5    C  CB  . ALA A 51  ? 0.6229 0.5567 0.5546 -0.0036 -0.0281 -0.0307 127  ALA A CB  
6    N  N   . PHE A 52  ? 0.5268 0.4975 0.4939 -0.0003 -0.0305 -0.0238 128  PHE A N   
7    C  CA  . PHE A 52  ? 0.5600 0.5339 0.5274 0.0004  -0.0312 -0.0218 128  PHE A CA  
8    C  C   . PHE A 52  ? 0.4971 0.4711 0.4648 0.0062  -0.0248 -0.0233 128  PHE A C   
9    O  O   . PHE A 52  ? 0.4749 0.4449 0.4345 0.0064  -0.0237 -0.0230 128  PHE A O   
10   C  CB  . PHE A 52  ? 0.5860 0.5732 0.5684 -0.0001 -0.0350 -0.0179 128  PHE A CB  
11   C  CG  . PHE A 52  ? 0.5911 0.5811 0.5752 0.0019  -0.0351 -0.0156 128  PHE A CG  
12   C  CD1 . PHE A 52  ? 0.5851 0.5687 0.5574 -0.0011 -0.0380 -0.0144 128  PHE A CD1 
13   C  CD2 . PHE A 52  ? 0.5730 0.5705 0.5689 0.0062  -0.0325 -0.0145 128  PHE A CD2 
14   C  CE1 . PHE A 52  ? 0.5651 0.5503 0.5381 0.0004  -0.0382 -0.0119 128  PHE A CE1 
15   C  CE2 . PHE A 52  ? 0.5612 0.5589 0.5570 0.0076  -0.0328 -0.0122 128  PHE A CE2 
16   C  CZ  . PHE A 52  ? 0.5665 0.5585 0.5514 0.0047  -0.0356 -0.0107 128  PHE A CZ  
17   N  N   . PHE A 53  ? 0.4663 0.4455 0.4429 0.0103  -0.0207 -0.0244 129  PHE A N   
18   C  CA  . PHE A 53  ? 0.4216 0.4041 0.4008 0.0147  -0.0153 -0.0248 129  PHE A CA  
19   C  C   . PHE A 53  ? 0.4157 0.3901 0.3831 0.0177  -0.0104 -0.0271 129  PHE A C   
20   O  O   . PHE A 53  ? 0.4623 0.4408 0.4310 0.0209  -0.0058 -0.0267 129  PHE A O   
21   C  CB  . PHE A 53  ? 0.3741 0.3651 0.3661 0.0172  -0.0134 -0.0249 129  PHE A CB  
22   C  CG  . PHE A 53  ? 0.3766 0.3650 0.3685 0.0177  -0.0133 -0.0265 129  PHE A CG  
23   C  CD1 . PHE A 53  ? 0.3926 0.3770 0.3798 0.0215  -0.0092 -0.0282 129  PHE A CD1 
24   C  CD2 . PHE A 53  ? 0.4001 0.3905 0.3968 0.0146  -0.0171 -0.0258 129  PHE A CD2 
25   C  CE1 . PHE A 53  ? 0.4138 0.3940 0.3997 0.0221  -0.0093 -0.0293 129  PHE A CE1 
26   C  CE2 . PHE A 53  ? 0.4045 0.3917 0.4002 0.0142  -0.0170 -0.0270 129  PHE A CE2 
27   C  CZ  . PHE A 53  ? 0.3932 0.3743 0.3828 0.0179  -0.0133 -0.0288 129  PHE A CZ  
28   N  N   . ILE A 54  ? 0.3751 0.3380 0.3307 0.0169  -0.0110 -0.0291 130  ILE A N   
29   C  CA  . ILE A 54  ? 0.3715 0.3245 0.3144 0.0214  -0.0055 -0.0315 130  ILE A CA  
30   C  C   . ILE A 54  ? 0.3986 0.3470 0.3305 0.0212  -0.0034 -0.0313 130  ILE A C   
31   O  O   . ILE A 54  ? 0.4507 0.4023 0.3821 0.0263  0.0030  -0.0313 130  ILE A O   
32   C  CB  . ILE A 54  ? 0.4157 0.3535 0.3456 0.0202  -0.0067 -0.0339 130  ILE A CB  
33   C  CG1 . ILE A 54  ? 0.4622 0.4042 0.4019 0.0220  -0.0068 -0.0339 130  ILE A CG1 
34   C  CG2 . ILE A 54  ? 0.4179 0.3415 0.3303 0.0252  -0.0008 -0.0364 130  ILE A CG2 
35   C  CD1 . ILE A 54  ? 0.4827 0.4336 0.4315 0.0296  -0.0009 -0.0334 130  ILE A CD1 
36   N  N   . PRO A 55  ? 0.3924 0.3343 0.3151 0.0152  -0.0085 -0.0308 131  PRO A N   
37   C  CA  . PRO A 55  ? 0.3875 0.3249 0.2989 0.0149  -0.0063 -0.0304 131  PRO A CA  
38   C  C   . PRO A 55  ? 0.3494 0.3005 0.2730 0.0163  -0.0040 -0.0276 131  PRO A C   
39   O  O   . PRO A 55  ? 0.3572 0.3073 0.2737 0.0180  0.0007  -0.0273 131  PRO A O   
40   C  CB  . PRO A 55  ? 0.4434 0.3734 0.3452 0.0071  -0.0141 -0.0295 131  PRO A CB  
41   C  CG  . PRO A 55  ? 0.4556 0.3838 0.3604 0.0036  -0.0192 -0.0299 131  PRO A CG  
42   C  CD  . PRO A 55  ? 0.4181 0.3580 0.3407 0.0083  -0.0165 -0.0298 131  PRO A CD  
43   N  N   . LEU A 56  ? 0.3022 0.2651 0.2426 0.0154  -0.0071 -0.0255 132  LEU A N   
44   C  CA  . LEU A 56  ? 0.3276 0.3009 0.2776 0.0159  -0.0053 -0.0229 132  LEU A CA  
45   C  C   . LEU A 56  ? 0.3228 0.3025 0.2763 0.0207  0.0021  -0.0232 132  LEU A C   
46   O  O   . LEU A 56  ? 0.3050 0.2908 0.2606 0.0202  0.0049  -0.0211 132  LEU A O   
47   C  CB  . LEU A 56  ? 0.3208 0.3025 0.2858 0.0146  -0.0096 -0.0211 132  LEU A CB  
48   C  CG  . LEU A 56  ? 0.3415 0.3213 0.3070 0.0108  -0.0167 -0.0193 132  LEU A CG  
49   C  CD1 . LEU A 56  ? 0.3237 0.3119 0.3039 0.0114  -0.0189 -0.0175 132  LEU A CD1 
50   C  CD2 . LEU A 56  ? 0.3477 0.3227 0.3032 0.0079  -0.0189 -0.0170 132  LEU A CD2 
51   N  N   . TYR A 57  ? 0.3107 0.2897 0.2650 0.0251  0.0052  -0.0253 133  TYR A N   
52   C  CA  . TYR A 57  ? 0.3125 0.3000 0.2717 0.0304  0.0121  -0.0248 133  TYR A CA  
53   C  C   . TYR A 57  ? 0.3565 0.3411 0.3043 0.0329  0.0182  -0.0247 133  TYR A C   
54   O  O   . TYR A 57  ? 0.3923 0.3881 0.3458 0.0335  0.0224  -0.0221 133  TYR A O   
55   C  CB  . TYR A 57  ? 0.3075 0.2931 0.2683 0.0355  0.0138  -0.0267 133  TYR A CB  
56   C  CG  . TYR A 57  ? 0.3199 0.3155 0.2861 0.0421  0.0207  -0.0254 133  TYR A CG  
57   C  CD1 . TYR A 57  ? 0.2901 0.3019 0.2720 0.0417  0.0208  -0.0225 133  TYR A CD1 
58   C  CD2 . TYR A 57  ? 0.3455 0.3344 0.3006 0.0488  0.0271  -0.0266 133  TYR A CD2 
59   C  CE1 . TYR A 57  ? 0.3109 0.3348 0.2992 0.0472  0.0264  -0.0203 133  TYR A CE1 
60   C  CE2 . TYR A 57  ? 0.3495 0.3501 0.3113 0.0559  0.0338  -0.0245 133  TYR A CE2 
61   C  CZ  . TYR A 57  ? 0.3304 0.3499 0.3098 0.0549  0.0331  -0.0210 133  TYR A CZ  
62   O  OH  . TYR A 57  ? 0.3751 0.4091 0.3627 0.0614  0.0390  -0.0179 133  TYR A OH  
63   N  N   . GLU A 58  ? 0.3765 0.3458 0.3072 0.0338  0.0191  -0.0273 134  GLU A N   
64   C  CA  . GLU A 58  ? 0.4111 0.3758 0.3285 0.0367  0.0259  -0.0276 134  GLU A CA  
65   C  C   . GLU A 58  ? 0.3472 0.3143 0.2620 0.0308  0.0242  -0.0251 134  GLU A C   
66   O  O   . GLU A 58  ? 0.3519 0.3242 0.2637 0.0326  0.0306  -0.0234 134  GLU A O   
67   C  CB  . GLU A 58  ? 0.4811 0.4253 0.3775 0.0386  0.0271  -0.0315 134  GLU A CB  
68   C  CG  . GLU A 58  ? 0.5537 0.4933 0.4482 0.0470  0.0322  -0.0336 134  GLU A CG  
69   C  CD  . GLU A 58  ? 0.5714 0.5227 0.4712 0.0560  0.0422  -0.0318 134  GLU A CD  
70   O  OE1 . GLU A 58  ? 0.5775 0.5351 0.4754 0.0557  0.0467  -0.0300 134  GLU A OE1 
71   O  OE2 . GLU A 58  ? 0.5856 0.5407 0.4919 0.0633  0.0456  -0.0317 134  GLU A OE2 
72   N  N   . LEU A 59  ? 0.3410 0.3051 0.2569 0.0242  0.0160  -0.0242 135  LEU A N   
73   C  CA  . LEU A 59  ? 0.3246 0.2910 0.2390 0.0191  0.0139  -0.0211 135  LEU A CA  
74   C  C   . LEU A 59  ? 0.3401 0.3222 0.2695 0.0190  0.0167  -0.0178 135  LEU A C   
75   O  O   . LEU A 59  ? 0.3497 0.3350 0.2758 0.0167  0.0195  -0.0152 135  LEU A O   
76   C  CB  . LEU A 59  ? 0.3238 0.2853 0.2386 0.0134  0.0043  -0.0201 135  LEU A CB  
77   C  CG  . LEU A 59  ? 0.3386 0.2851 0.2366 0.0104  -0.0000 -0.0220 135  LEU A CG  
78   C  CD1 . LEU A 59  ? 0.3402 0.2874 0.2439 0.0054  -0.0098 -0.0198 135  LEU A CD1 
79   C  CD2 . LEU A 59  ? 0.3573 0.2945 0.2363 0.0088  0.0030  -0.0218 135  LEU A CD2 
80   N  N   . PHE A 60  ? 0.3024 0.2937 0.2471 0.0206  0.0157  -0.0177 136  PHE A N   
81   C  CA  . PHE A 60  ? 0.2876 0.2932 0.2454 0.0196  0.0179  -0.0148 136  PHE A CA  
82   C  C   . PHE A 60  ? 0.2901 0.3048 0.2471 0.0232  0.0266  -0.0134 136  PHE A C   
83   O  O   . PHE A 60  ? 0.3147 0.3382 0.2748 0.0198  0.0290  -0.0099 136  PHE A O   
84   C  CB  . PHE A 60  ? 0.2884 0.3002 0.2599 0.0208  0.0151  -0.0155 136  PHE A CB  
85   C  CG  . PHE A 60  ? 0.2817 0.3086 0.2653 0.0214  0.0186  -0.0132 136  PHE A CG  
86   C  CD1 . PHE A 60  ? 0.3224 0.3569 0.3102 0.0162  0.0189  -0.0096 136  PHE A CD1 
87   C  CD2 . PHE A 60  ? 0.3212 0.3544 0.3119 0.0265  0.0208  -0.0141 136  PHE A CD2 
88   C  CE1 . PHE A 60  ? 0.3116 0.3609 0.3105 0.0152  0.0211  -0.0070 136  PHE A CE1 
89   C  CE2 . PHE A 60  ? 0.3019 0.3505 0.3043 0.0265  0.0229  -0.0113 136  PHE A CE2 
90   C  CZ  . PHE A 60  ? 0.3144 0.3717 0.3212 0.0204  0.0229  -0.0077 136  PHE A CZ  
91   N  N   . LEU A 61  ? 0.3324 0.3448 0.2849 0.0301  0.0315  -0.0158 137  LEU A N   
92   C  CA  . LEU A 61  ? 0.3777 0.3999 0.3302 0.0354  0.0407  -0.0141 137  LEU A CA  
93   C  C   . LEU A 61  ? 0.3898 0.4085 0.3296 0.0330  0.0448  -0.0128 137  LEU A C   
94   O  O   . LEU A 61  ? 0.4074 0.4397 0.3516 0.0334  0.0511  -0.0093 137  LEU A O   
95   C  CB  . LEU A 61  ? 0.4141 0.4305 0.3612 0.0447  0.0455  -0.0171 137  LEU A CB  
96   C  CG  . LEU A 61  ? 0.4060 0.4268 0.3650 0.0482  0.0429  -0.0178 137  LEU A CG  
97   C  CD1 . LEU A 61  ? 0.4367 0.4511 0.3885 0.0584  0.0490  -0.0200 137  LEU A CD1 
98   C  CD2 . LEU A 61  ? 0.3926 0.4347 0.3709 0.0462  0.0425  -0.0135 137  LEU A CD2 
99   N  N   . THR A 62  ? 0.3702 0.3717 0.2943 0.0298  0.0410  -0.0151 138  THR A N   
100  C  CA  . THR A 62  ? 0.3696 0.3653 0.2787 0.0275  0.0447  -0.0140 138  THR A CA  
101  C  C   . THR A 62  ? 0.4045 0.4050 0.3174 0.0190  0.0406  -0.0099 138  THR A C   
102  O  O   . THR A 62  ? 0.4125 0.4196 0.3225 0.0170  0.0460  -0.0067 138  THR A O   
103  C  CB  . THR A 62  ? 0.3740 0.3480 0.2622 0.0271  0.0420  -0.0179 138  THR A CB  
104  O  OG1 . THR A 62  ? 0.4161 0.3826 0.2981 0.0348  0.0464  -0.0218 138  THR A OG1 
105  C  CG2 . THR A 62  ? 0.3460 0.3127 0.2162 0.0245  0.0460  -0.0170 138  THR A CG2 
106  N  N   . TYR A 63  ? 0.3881 0.3850 0.3069 0.0142  0.0314  -0.0096 139  TYR A N   
107  C  CA  . TYR A 63  ? 0.3843 0.3799 0.3024 0.0069  0.0267  -0.0059 139  TYR A CA  
108  C  C   . TYR A 63  ? 0.3673 0.3741 0.3016 0.0035  0.0244  -0.0030 139  TYR A C   
109  O  O   . TYR A 63  ? 0.3923 0.3971 0.3252 -0.0024 0.0213  0.0003  139  TYR A O   
110  C  CB  . TYR A 63  ? 0.3394 0.3203 0.2488 0.0042  0.0181  -0.0070 139  TYR A CB  
111  C  CG  . TYR A 63  ? 0.3169 0.2851 0.2071 0.0054  0.0197  -0.0095 139  TYR A CG  
112  C  CD1 . TYR A 63  ? 0.3473 0.3108 0.2226 0.0029  0.0235  -0.0077 139  TYR A CD1 
113  C  CD2 . TYR A 63  ? 0.3385 0.2982 0.2239 0.0085  0.0178  -0.0136 139  TYR A CD2 
114  C  CE1 . TYR A 63  ? 0.3798 0.3295 0.2347 0.0036  0.0253  -0.0104 139  TYR A CE1 
115  C  CE2 . TYR A 63  ? 0.3556 0.3009 0.2204 0.0087  0.0191  -0.0162 139  TYR A CE2 
116  C  CZ  . TYR A 63  ? 0.3976 0.3376 0.2469 0.0065  0.0229  -0.0148 139  TYR A CZ  
117  O  OH  . TYR A 63  ? 0.4362 0.3600 0.2627 0.0063  0.0245  -0.0176 139  TYR A OH  
118  N  N   . GLY A 64  ? 0.3270 0.3439 0.2748 0.0068  0.0256  -0.0041 140  GLY A N   
119  C  CA  . GLY A 64  ? 0.3089 0.3372 0.2698 0.0028  0.0247  -0.0011 140  GLY A CA  
120  C  C   . GLY A 64  ? 0.3210 0.3449 0.2895 0.0014  0.0174  -0.0022 140  GLY A C   
121  O  O   . GLY A 64  ? 0.3512 0.3660 0.3176 0.0040  0.0131  -0.0051 140  GLY A O   
122  N  N   . GLY A 65  ? 0.3020 0.3324 0.2785 -0.0034 0.0161  0.0003  141  GLY A N   
123  C  CA  . GLY A 65  ? 0.3022 0.3298 0.2861 -0.0043 0.0109  -0.0008 141  GLY A CA  
124  C  C   . GLY A 65  ? 0.3017 0.3149 0.2802 -0.0058 0.0049  -0.0010 141  GLY A C   
125  O  O   . GLY A 65  ? 0.2705 0.2805 0.2544 -0.0051 0.0013  -0.0023 141  GLY A O   
126  N  N   . ILE A 66  ? 0.2869 0.2920 0.2551 -0.0075 0.0040  0.0008  142  ILE A N   
127  C  CA  . ILE A 66  ? 0.2975 0.2902 0.2612 -0.0072 -0.0020 0.0012  142  ILE A CA  
128  C  C   . ILE A 66  ? 0.3122 0.2985 0.2641 -0.0071 -0.0026 0.0021  142  ILE A C   
129  O  O   . ILE A 66  ? 0.3299 0.3162 0.2738 -0.0104 0.0006  0.0045  142  ILE A O   
130  C  CB  . ILE A 66  ? 0.3641 0.3499 0.3268 -0.0116 -0.0047 0.0042  142  ILE A CB  
131  C  CG1 . ILE A 66  ? 0.3864 0.3602 0.3450 -0.0092 -0.0105 0.0053  142  ILE A CG1 
132  C  CG2 . ILE A 66  ? 0.3876 0.3741 0.3435 -0.0182 -0.0018 0.0080  142  ILE A CG2 
133  C  CD1 . ILE A 66  ? 0.4341 0.3985 0.3922 -0.0108 -0.0131 0.0072  142  ILE A CD1 
134  N  N   . PHE A 67  ? 0.3139 0.2953 0.2643 -0.0038 -0.0067 0.0004  143  PHE A N   
135  C  CA  . PHE A 67  ? 0.3341 0.3080 0.2722 -0.0045 -0.0090 0.0014  143  PHE A CA  
136  C  C   . PHE A 67  ? 0.3204 0.2893 0.2606 -0.0029 -0.0165 0.0022  143  PHE A C   
137  O  O   . PHE A 67  ? 0.3192 0.2914 0.2703 -0.0001 -0.0184 0.0008  143  PHE A O   
138  C  CB  . PHE A 67  ? 0.3356 0.3104 0.2665 -0.0027 -0.0048 -0.0017 143  PHE A CB  
139  C  CG  . PHE A 67  ? 0.3388 0.3160 0.2761 0.0014  -0.0053 -0.0057 143  PHE A CG  
140  C  CD1 . PHE A 67  ? 0.3260 0.3115 0.2721 0.0043  -0.0003 -0.0080 143  PHE A CD1 
141  C  CD2 . PHE A 67  ? 0.3522 0.3235 0.2862 0.0016  -0.0111 -0.0067 143  PHE A CD2 
142  C  CE1 . PHE A 67  ? 0.3327 0.3189 0.2833 0.0078  -0.0009 -0.0113 143  PHE A CE1 
143  C  CE2 . PHE A 67  ? 0.3152 0.2878 0.2539 0.0042  -0.0116 -0.0100 143  PHE A CE2 
144  C  CZ  . PHE A 67  ? 0.3102 0.2893 0.2565 0.0075  -0.0063 -0.0125 143  PHE A CZ  
145  N  N   . ARG A 68  ? 0.3345 0.2964 0.2642 -0.0047 -0.0207 0.0048  144  ARG A N   
146  C  CA  . ARG A 68  ? 0.3337 0.2931 0.2655 -0.0034 -0.0283 0.0069  144  ARG A CA  
147  C  C   . ARG A 68  ? 0.3716 0.3306 0.2981 -0.0038 -0.0307 0.0045  144  ARG A C   
148  O  O   . ARG A 68  ? 0.3804 0.3335 0.2924 -0.0068 -0.0302 0.0044  144  ARG A O   
149  C  CB  . ARG A 68  ? 0.3468 0.2988 0.2704 -0.0054 -0.0328 0.0123  144  ARG A CB  
150  C  CG  . ARG A 68  ? 0.3407 0.2926 0.2682 -0.0033 -0.0409 0.0157  144  ARG A CG  
151  C  CD  . ARG A 68  ? 0.3790 0.3232 0.2982 -0.0045 -0.0456 0.0218  144  ARG A CD  
152  N  NE  . ARG A 68  ? 0.3775 0.3163 0.2976 -0.0040 -0.0426 0.0237  144  ARG A NE  
153  C  CZ  . ARG A 68  ? 0.3985 0.3362 0.3280 0.0006  -0.0440 0.0253  144  ARG A CZ  
154  N  NH1 . ARG A 68  ? 0.3685 0.3123 0.3091 0.0057  -0.0477 0.0257  144  ARG A NH1 
155  N  NH2 . ARG A 68  ? 0.3789 0.3086 0.3055 -0.0003 -0.0412 0.0267  144  ARG A NH2 
156  N  N   . LEU A 69  ? 0.3357 0.2998 0.2724 -0.0015 -0.0331 0.0027  145  LEU A N   
157  C  CA  . LEU A 69  ? 0.3313 0.2942 0.2630 -0.0031 -0.0366 0.0010  145  LEU A CA  
158  C  C   . LEU A 69  ? 0.3673 0.3304 0.2989 -0.0048 -0.0455 0.0059  145  LEU A C   
159  O  O   . LEU A 69  ? 0.3490 0.3189 0.2940 -0.0019 -0.0488 0.0084  145  LEU A O   
160  C  CB  . LEU A 69  ? 0.3264 0.2953 0.2693 -0.0006 -0.0349 -0.0026 145  LEU A CB  
161  C  CG  . LEU A 69  ? 0.3577 0.3243 0.2954 -0.0031 -0.0383 -0.0046 145  LEU A CG  
162  C  CD1 . LEU A 69  ? 0.3583 0.3155 0.2800 -0.0043 -0.0334 -0.0086 145  LEU A CD1 
163  C  CD2 . LEU A 69  ? 0.3679 0.3418 0.3194 -0.0008 -0.0382 -0.0064 145  LEU A CD2 
164  N  N   . THR A 70  ? 0.4043 0.3605 0.3207 -0.0093 -0.0492 0.0075  146  THR A N   
165  C  CA  . THR A 70  ? 0.4192 0.3766 0.3347 -0.0115 -0.0585 0.0131  146  THR A CA  
166  C  C   . THR A 70  ? 0.4099 0.3675 0.3202 -0.0162 -0.0642 0.0123  146  THR A C   
167  O  O   . THR A 70  ? 0.4378 0.3870 0.3344 -0.0195 -0.0614 0.0078  146  THR A O   
168  C  CB  . THR A 70  ? 0.4509 0.4001 0.3519 -0.0142 -0.0603 0.0170  146  THR A CB  
169  O  OG1 . THR A 70  ? 0.5738 0.5136 0.4551 -0.0196 -0.0600 0.0145  146  THR A OG1 
170  C  CG2 . THR A 70  ? 0.4038 0.3503 0.3055 -0.0117 -0.0532 0.0167  146  THR A CG2 
171  N  N   . PHE A 71  ? 0.3939 0.3609 0.3150 -0.0165 -0.0721 0.0170  147  PHE A N   
172  C  CA  . PHE A 71  ? 0.4150 0.3845 0.3328 -0.0225 -0.0792 0.0177  147  PHE A CA  
173  C  C   . PHE A 71  ? 0.4401 0.4173 0.3619 -0.0241 -0.0893 0.0260  147  PHE A C   
174  O  O   . PHE A 71  ? 0.4486 0.4394 0.3893 -0.0194 -0.0920 0.0304  147  PHE A O   
175  C  CB  . PHE A 71  ? 0.4433 0.4213 0.3753 -0.0211 -0.0775 0.0149  147  PHE A CB  
176  C  CG  . PHE A 71  ? 0.4584 0.4471 0.4110 -0.0131 -0.0735 0.0158  147  PHE A CG  
177  C  CD1 . PHE A 71  ? 0.4553 0.4399 0.4099 -0.0081 -0.0647 0.0115  147  PHE A CD1 
178  C  CD2 . PHE A 71  ? 0.4812 0.4841 0.4507 -0.0106 -0.0785 0.0211  147  PHE A CD2 
179  C  CE1 . PHE A 71  ? 0.4433 0.4351 0.4139 -0.0017 -0.0613 0.0120  147  PHE A CE1 
180  C  CE2 . PHE A 71  ? 0.4474 0.4577 0.4333 -0.0028 -0.0741 0.0214  147  PHE A CE2 
181  C  CZ  . PHE A 71  ? 0.4335 0.4370 0.4188 0.0012  -0.0656 0.0166  147  PHE A CZ  
182  N  N   . GLY A 72  ? 0.4765 0.4451 0.3803 -0.0302 -0.0946 0.0283  148  GLY A N   
183  C  CA  . GLY A 72  ? 0.5061 0.4811 0.4118 -0.0316 -0.1044 0.0369  148  GLY A CA  
184  C  C   . GLY A 72  ? 0.5061 0.4829 0.4206 -0.0235 -0.1021 0.0410  148  GLY A C   
185  O  O   . GLY A 72  ? 0.5264 0.4924 0.4325 -0.0214 -0.0950 0.0381  148  GLY A O   
186  N  N   . PRO A 73  ? 0.4970 0.4873 0.4284 -0.0186 -0.1079 0.0482  149  PRO A N   
187  C  CA  . PRO A 73  ? 0.5048 0.4942 0.4433 -0.0102 -0.1059 0.0525  149  PRO A CA  
188  C  C   . PRO A 73  ? 0.5051 0.4964 0.4580 -0.0020 -0.0968 0.0485  149  PRO A C   
189  O  O   . PRO A 73  ? 0.5444 0.5325 0.5017 0.0049  -0.0947 0.0515  149  PRO A O   
190  C  CB  . PRO A 73  ? 0.5094 0.5128 0.4594 -0.0078 -0.1162 0.0624  149  PRO A CB  
191  C  CG  . PRO A 73  ? 0.4975 0.5157 0.4584 -0.0116 -0.1197 0.0617  149  PRO A CG  
192  C  CD  . PRO A 73  ? 0.4856 0.4925 0.4294 -0.0209 -0.1168 0.0536  149  PRO A CD  
193  N  N   . LYS A 74  ? 0.4443 0.4392 0.4031 -0.0028 -0.0916 0.0420  150  LYS A N   
194  C  CA  . LYS A 74  ? 0.4378 0.4345 0.4092 0.0041  -0.0835 0.0381  150  LYS A CA  
195  C  C   . LYS A 74  ? 0.3943 0.3807 0.3562 0.0016  -0.0750 0.0302  150  LYS A C   
196  O  O   . LYS A 74  ? 0.4019 0.3816 0.3495 -0.0047 -0.0747 0.0270  150  LYS A O   
197  C  CB  . LYS A 74  ? 0.4868 0.4987 0.4756 0.0062  -0.0844 0.0380  150  LYS A CB  
198  C  CG  . LYS A 74  ? 0.5936 0.6198 0.5952 0.0097  -0.0921 0.0466  150  LYS A CG  
199  C  CD  . LYS A 74  ? 0.6698 0.7121 0.6902 0.0127  -0.0909 0.0466  150  LYS A CD  
200  C  CE  . LYS A 74  ? 0.7311 0.7905 0.7669 0.0180  -0.0974 0.0561  150  LYS A CE  
201  N  NZ  . LYS A 74  ? 0.7582 0.8344 0.8133 0.0220  -0.0948 0.0565  150  LYS A NZ  
202  N  N   . SER A 75  ? 0.3686 0.3537 0.3380 0.0068  -0.0680 0.0272  151  SER A N   
203  C  CA  . SER A 75  ? 0.3527 0.3307 0.3152 0.0049  -0.0601 0.0208  151  SER A CA  
204  C  C   . SER A 75  ? 0.3498 0.3308 0.3245 0.0099  -0.0542 0.0178  151  SER A C   
205  O  O   . SER A 75  ? 0.3285 0.3122 0.3131 0.0154  -0.0549 0.0207  151  SER A O   
206  C  CB  . SER A 75  ? 0.3978 0.3647 0.3462 0.0025  -0.0581 0.0219  151  SER A CB  
207  O  OG  . SER A 75  ? 0.4193 0.3822 0.3713 0.0067  -0.0571 0.0250  151  SER A OG  
208  N  N   . PHE A 76  ? 0.3229 0.3028 0.2959 0.0082  -0.0481 0.0120  152  PHE A N   
209  C  CA  . PHE A 76  ? 0.3054 0.2864 0.2864 0.0113  -0.0422 0.0088  152  PHE A CA  
210  C  C   . PHE A 76  ? 0.2909 0.2656 0.2636 0.0088  -0.0368 0.0067  152  PHE A C   
211  O  O   . PHE A 76  ? 0.3269 0.2989 0.2893 0.0052  -0.0355 0.0055  152  PHE A O   
212  C  CB  . PHE A 76  ? 0.3141 0.3019 0.3024 0.0115  -0.0402 0.0045  152  PHE A CB  
213  C  CG  . PHE A 76  ? 0.3826 0.3789 0.3805 0.0130  -0.0448 0.0065  152  PHE A CG  
214  C  CD1 . PHE A 76  ? 0.4113 0.4116 0.4177 0.0175  -0.0477 0.0111  152  PHE A CD1 
215  C  CD2 . PHE A 76  ? 0.4338 0.4342 0.4321 0.0101  -0.0458 0.0040  152  PHE A CD2 
216  C  CE1 . PHE A 76  ? 0.4428 0.4541 0.4598 0.0190  -0.0514 0.0137  152  PHE A CE1 
217  C  CE2 . PHE A 76  ? 0.4334 0.4432 0.4410 0.0102  -0.0501 0.0064  152  PHE A CE2 
218  C  CZ  . PHE A 76  ? 0.4569 0.4738 0.4749 0.0146  -0.0528 0.0114  152  PHE A CZ  
219  N  N   . LEU A 77  ? 0.2772 0.2498 0.2537 0.0104  -0.0332 0.0062  153  LEU A N   
220  C  CA  . LEU A 77  ? 0.2599 0.2307 0.2320 0.0073  -0.0278 0.0041  153  LEU A CA  
221  C  C   . LEU A 77  ? 0.3083 0.2862 0.2876 0.0080  -0.0238 -0.0005 153  LEU A C   
222  O  O   . LEU A 77  ? 0.3014 0.2822 0.2897 0.0109  -0.0240 -0.0017 153  LEU A O   
223  C  CB  . LEU A 77  ? 0.2630 0.2268 0.2339 0.0068  -0.0266 0.0062  153  LEU A CB  
224  C  CG  . LEU A 77  ? 0.2783 0.2327 0.2408 0.0064  -0.0303 0.0113  153  LEU A CG  
225  C  CD1 . LEU A 77  ? 0.2438 0.1884 0.2023 0.0048  -0.0285 0.0130  153  LEU A CD1 
226  C  CD2 . LEU A 77  ? 0.2866 0.2401 0.2382 0.0022  -0.0308 0.0127  153  LEU A CD2 
227  N  N   . ILE A 78  ? 0.3110 0.2915 0.2859 0.0060  -0.0201 -0.0027 154  ILE A N   
228  C  CA  . ILE A 78  ? 0.2786 0.2656 0.2594 0.0073  -0.0164 -0.0064 154  ILE A CA  
229  C  C   . ILE A 78  ? 0.3149 0.3053 0.2971 0.0053  -0.0118 -0.0064 154  ILE A C   
230  O  O   . ILE A 78  ? 0.2905 0.2811 0.2662 0.0027  -0.0089 -0.0050 154  ILE A O   
231  C  CB  . ILE A 78  ? 0.3044 0.2916 0.2789 0.0076  -0.0152 -0.0087 154  ILE A CB  
232  C  CG1 . ILE A 78  ? 0.2784 0.2615 0.2487 0.0071  -0.0209 -0.0078 154  ILE A CG1 
233  C  CG2 . ILE A 78  ? 0.2668 0.2594 0.2476 0.0100  -0.0119 -0.0121 154  ILE A CG2 
234  C  CD1 . ILE A 78  ? 0.2908 0.2777 0.2717 0.0090  -0.0248 -0.0076 154  ILE A CD1 
235  N  N   . VAL A 79  ? 0.2706 0.2641 0.2609 0.0059  -0.0110 -0.0076 155  VAL A N   
236  C  CA  . VAL A 79  ? 0.2768 0.2742 0.2692 0.0028  -0.0079 -0.0070 155  VAL A CA  
237  C  C   . VAL A 79  ? 0.2887 0.2957 0.2876 0.0045  -0.0049 -0.0094 155  VAL A C   
238  O  O   . VAL A 79  ? 0.2554 0.2633 0.2597 0.0073  -0.0060 -0.0116 155  VAL A O   
239  C  CB  . VAL A 79  ? 0.2711 0.2621 0.2649 0.0013  -0.0099 -0.0062 155  VAL A CB  
240  C  CG1 . VAL A 79  ? 0.2555 0.2509 0.2512 -0.0034 -0.0076 -0.0058 155  VAL A CG1 
241  C  CG2 . VAL A 79  ? 0.3076 0.2880 0.2937 0.0000  -0.0124 -0.0030 155  VAL A CG2 
242  N  N   . SER A 80  ? 0.2556 0.2703 0.2540 0.0030  -0.0009 -0.0084 156  SER A N   
243  C  CA  . SER A 80  ? 0.2467 0.2716 0.2515 0.0055  0.0023  -0.0097 156  SER A CA  
244  C  C   . SER A 80  ? 0.2742 0.3095 0.2835 0.0012  0.0047  -0.0070 156  SER A C   
245  O  O   . SER A 80  ? 0.2946 0.3412 0.3096 0.0034  0.0078  -0.0066 156  SER A O   
246  C  CB  . SER A 80  ? 0.2445 0.2705 0.2448 0.0099  0.0056  -0.0109 156  SER A CB  
247  O  OG  . SER A 80  ? 0.2441 0.2598 0.2379 0.0115  0.0026  -0.0126 156  SER A OG  
248  N  N   . ASP A 81  ? 0.2917 0.3233 0.2981 -0.0049 0.0031  -0.0045 157  ASP A N   
249  C  CA  . ASP A 81  ? 0.2773 0.3182 0.2865 -0.0113 0.0046  -0.0012 157  ASP A CA  
250  C  C   . ASP A 81  ? 0.2399 0.2785 0.2523 -0.0150 0.0012  -0.0018 157  ASP A C   
251  O  O   . ASP A 81  ? 0.2696 0.2941 0.2768 -0.0159 -0.0020 -0.0031 157  ASP A O   
252  C  CB  . ASP A 81  ? 0.3421 0.3777 0.3432 -0.0171 0.0048  0.0020  157  ASP A CB  
253  C  CG  . ASP A 81  ? 0.3928 0.4392 0.3963 -0.0254 0.0064  0.0062  157  ASP A CG  
254  O  OD1 . ASP A 81  ? 0.4118 0.4620 0.4198 -0.0298 0.0044  0.0068  157  ASP A OD1 
255  O  OD2 . ASP A 81  ? 0.4390 0.4899 0.4389 -0.0282 0.0096  0.0094  157  ASP A OD2 
256  N  N   . PRO A 82  ? 0.2542 0.3055 0.2741 -0.0169 0.0018  -0.0008 158  PRO A N   
257  C  CA  . PRO A 82  ? 0.2542 0.3014 0.2748 -0.0209 -0.0018 -0.0017 158  PRO A CA  
258  C  C   . PRO A 82  ? 0.2858 0.3217 0.2981 -0.0296 -0.0043 -0.0001 158  PRO A C   
259  O  O   . PRO A 82  ? 0.2892 0.3117 0.2964 -0.0307 -0.0070 -0.0023 158  PRO A O   
260  C  CB  . PRO A 82  ? 0.2577 0.3234 0.2878 -0.0220 -0.0009 0.0004  158  PRO A CB  
261  C  CG  . PRO A 82  ? 0.2811 0.3611 0.3151 -0.0211 0.0035  0.0039  158  PRO A CG  
262  C  CD  . PRO A 82  ? 0.2399 0.3099 0.2675 -0.0152 0.0057  0.0017  158  PRO A CD  
263  N  N   . SER A 83  ? 0.2864 0.3259 0.2957 -0.0358 -0.0031 0.0038  159  SER A N   
264  C  CA  . SER A 83  ? 0.3464 0.3722 0.3454 -0.0447 -0.0056 0.0056  159  SER A CA  
265  C  C   . SER A 83  ? 0.3250 0.3295 0.3145 -0.0404 -0.0070 0.0033  159  SER A C   
266  O  O   . SER A 83  ? 0.3390 0.3268 0.3199 -0.0434 -0.0096 0.0024  159  SER A O   
267  C  CB  . SER A 83  ? 0.3797 0.4151 0.3777 -0.0526 -0.0037 0.0108  159  SER A CB  
268  O  OG  . SER A 83  ? 0.4530 0.4727 0.4390 -0.0619 -0.0063 0.0127  159  SER A OG  
269  N  N   . ILE A 84  ? 0.3091 0.3137 0.2993 -0.0332 -0.0055 0.0026  160  ILE A N   
270  C  CA  . ILE A 84  ? 0.3054 0.2930 0.2886 -0.0285 -0.0074 0.0014  160  ILE A CA  
271  C  C   . ILE A 84  ? 0.3057 0.2872 0.2918 -0.0224 -0.0089 -0.0025 160  ILE A C   
272  O  O   . ILE A 84  ? 0.3266 0.2924 0.3063 -0.0208 -0.0107 -0.0031 160  ILE A O   
273  C  CB  . ILE A 84  ? 0.2795 0.2702 0.2624 -0.0235 -0.0060 0.0020  160  ILE A CB  
274  C  CG1 . ILE A 84  ? 0.3001 0.2972 0.2793 -0.0296 -0.0035 0.0059  160  ILE A CG1 
275  C  CG2 . ILE A 84  ? 0.2491 0.2244 0.2257 -0.0190 -0.0089 0.0019  160  ILE A CG2 
276  C  CD1 . ILE A 84  ? 0.3114 0.3097 0.2873 -0.0255 -0.0018 0.0064  160  ILE A CD1 
277  N  N   . ALA A 85  ? 0.2994 0.2927 0.2946 -0.0184 -0.0078 -0.0048 161  ALA A N   
278  C  CA  . ALA A 85  ? 0.2876 0.2767 0.2858 -0.0135 -0.0088 -0.0082 161  ALA A CA  
279  C  C   . ALA A 85  ? 0.3093 0.2881 0.3015 -0.0184 -0.0101 -0.0088 161  ALA A C   
280  O  O   . ALA A 85  ? 0.2933 0.2594 0.2816 -0.0147 -0.0107 -0.0108 161  ALA A O   
281  C  CB  . ALA A 85  ? 0.2367 0.2398 0.2442 -0.0100 -0.0075 -0.0100 161  ALA A CB  
282  N  N   . LYS A 86  ? 0.3047 0.2884 0.2955 -0.0270 -0.0104 -0.0070 162  LYS A N   
283  C  CA  . LYS A 86  ? 0.3091 0.2810 0.2914 -0.0336 -0.0122 -0.0075 162  LYS A CA  
284  C  C   . LYS A 86  ? 0.3052 0.2553 0.2743 -0.0350 -0.0131 -0.0069 162  LYS A C   
285  O  O   . LYS A 86  ? 0.3131 0.2464 0.2732 -0.0349 -0.0137 -0.0091 162  LYS A O   
286  C  CB  . LYS A 86  ? 0.3640 0.3480 0.3479 -0.0439 -0.0132 -0.0046 162  LYS A CB  
287  C  CG  . LYS A 86  ? 0.4306 0.4027 0.4041 -0.0532 -0.0160 -0.0049 162  LYS A CG  
288  C  CD  . LYS A 86  ? 0.5146 0.5051 0.4938 -0.0628 -0.0176 -0.0014 162  LYS A CD  
289  C  CE  . LYS A 86  ? 0.6124 0.5939 0.5800 -0.0765 -0.0203 0.0018  162  LYS A CE  
290  N  NZ  . LYS A 86  ? 0.6738 0.6316 0.6256 -0.0811 -0.0229 -0.0013 162  LYS A NZ  
291  N  N   . HIS A 87  ? 0.2923 0.2411 0.2588 -0.0359 -0.0129 -0.0039 163  HIS A N   
292  C  CA  . HIS A 87  ? 0.3451 0.2724 0.2985 -0.0365 -0.0139 -0.0026 163  HIS A CA  
293  C  C   . HIS A 87  ? 0.3444 0.2603 0.2972 -0.0255 -0.0136 -0.0050 163  HIS A C   
294  O  O   . HIS A 87  ? 0.3658 0.2614 0.3076 -0.0243 -0.0138 -0.0057 163  HIS A O   
295  C  CB  . HIS A 87  ? 0.3498 0.2798 0.3012 -0.0392 -0.0137 0.0015  163  HIS A CB  
296  C  CG  . HIS A 87  ? 0.3970 0.3046 0.3340 -0.0407 -0.0152 0.0038  163  HIS A CG  
297  N  ND1 . HIS A 87  ? 0.4256 0.3178 0.3492 -0.0507 -0.0165 0.0054  163  HIS A ND1 
298  C  CD2 . HIS A 87  ? 0.3937 0.2911 0.3269 -0.0337 -0.0158 0.0052  163  HIS A CD2 
299  C  CE1 . HIS A 87  ? 0.4371 0.3088 0.3484 -0.0491 -0.0175 0.0074  163  HIS A CE1 
300  N  NE2 . HIS A 87  ? 0.4377 0.3131 0.3553 -0.0385 -0.0171 0.0076  163  HIS A NE2 
301  N  N   . ILE A 88  ? 0.3027 0.2313 0.2669 -0.0173 -0.0128 -0.0060 164  ILE A N   
302  C  CA  . ILE A 88  ? 0.2919 0.2143 0.2582 -0.0071 -0.0127 -0.0072 164  ILE A CA  
303  C  C   . ILE A 88  ? 0.3252 0.2444 0.2927 -0.0038 -0.0113 -0.0109 164  ILE A C   
304  O  O   . ILE A 88  ? 0.3591 0.2644 0.3213 0.0020  -0.0104 -0.0117 164  ILE A O   
305  C  CB  . ILE A 88  ? 0.2946 0.2322 0.2716 -0.0015 -0.0130 -0.0067 164  ILE A CB  
306  C  CG1 . ILE A 88  ? 0.2795 0.2171 0.2525 -0.0040 -0.0142 -0.0031 164  ILE A CG1 
307  C  CG2 . ILE A 88  ? 0.2729 0.2091 0.2550 0.0081  -0.0132 -0.0076 164  ILE A CG2 
308  C  CD1 . ILE A 88  ? 0.2602 0.2122 0.2408 -0.0012 -0.0143 -0.0030 164  ILE A CD1 
309  N  N   . LEU A 89  ? 0.3117 0.2437 0.2857 -0.0068 -0.0107 -0.0130 165  LEU A N   
310  C  CA  . LEU A 89  ? 0.3064 0.2372 0.2820 -0.0036 -0.0094 -0.0165 165  LEU A CA  
311  C  C   . LEU A 89  ? 0.3605 0.2746 0.3228 -0.0091 -0.0092 -0.0180 165  LEU A C   
312  O  O   . LEU A 89  ? 0.3744 0.2788 0.3327 -0.0046 -0.0073 -0.0207 165  LEU A O   
313  C  CB  . LEU A 89  ? 0.2470 0.1965 0.2333 -0.0047 -0.0093 -0.0177 165  LEU A CB  
314  C  CG  . LEU A 89  ? 0.2833 0.2466 0.2806 0.0011  -0.0091 -0.0172 165  LEU A CG  
315  C  CD1 . LEU A 89  ? 0.2837 0.2623 0.2889 -0.0004 -0.0089 -0.0181 165  LEU A CD1 
316  C  CD2 . LEU A 89  ? 0.2753 0.2355 0.2758 0.0094  -0.0083 -0.0183 165  LEU A CD2 
317  N  N   . LYS A 90  ? 0.3401 0.2504 0.2948 -0.0193 -0.0110 -0.0162 166  LYS A N   
318  C  CA  . LYS A 90  ? 0.3956 0.2903 0.3364 -0.0270 -0.0118 -0.0176 166  LYS A CA  
319  C  C   . LYS A 90  ? 0.4061 0.2803 0.3311 -0.0330 -0.0129 -0.0155 166  LYS A C   
320  O  O   . LYS A 90  ? 0.4633 0.3140 0.3743 -0.0304 -0.0118 -0.0172 166  LYS A O   
321  C  CB  . LYS A 90  ? 0.4122 0.3222 0.3574 -0.0363 -0.0138 -0.0172 166  LYS A CB  
322  C  CG  . LYS A 90  ? 0.4723 0.3667 0.4023 -0.0455 -0.0154 -0.0187 166  LYS A CG  
323  C  CD  . LYS A 90  ? 0.5276 0.4393 0.4628 -0.0559 -0.0185 -0.0169 166  LYS A CD  
324  C  CE  . LYS A 90  ? 0.6029 0.4973 0.5206 -0.0664 -0.0211 -0.0183 166  LYS A CE  
325  N  NZ  . LYS A 90  ? 0.6478 0.5601 0.5702 -0.0783 -0.0252 -0.0151 166  LYS A NZ  
326  N  N   . ASP A 91  ? 0.3968 0.2783 0.3228 -0.0408 -0.0148 -0.0116 167  ASP A N   
327  C  CA  . ASP A 91  ? 0.4542 0.3159 0.3634 -0.0496 -0.0165 -0.0092 167  ASP A CA  
328  C  C   . ASP A 91  ? 0.4834 0.3227 0.3827 -0.0411 -0.0152 -0.0090 167  ASP A C   
329  O  O   . ASP A 91  ? 0.4830 0.2960 0.3638 -0.0444 -0.0155 -0.0092 167  ASP A O   
330  C  CB  . ASP A 91  ? 0.4948 0.3716 0.4088 -0.0588 -0.0180 -0.0045 167  ASP A CB  
331  C  CG  . ASP A 91  ? 0.5283 0.4299 0.4541 -0.0658 -0.0190 -0.0037 167  ASP A CG  
332  O  OD1 . ASP A 91  ? 0.5262 0.4277 0.4510 -0.0678 -0.0198 -0.0064 167  ASP A OD1 
333  O  OD2 . ASP A 91  ? 0.5368 0.4579 0.4724 -0.0688 -0.0186 -0.0002 167  ASP A OD2 
334  N  N   . ASN A 92  ? 0.4385 0.2873 0.3490 -0.0302 -0.0140 -0.0080 168  ASN A N   
335  C  CA  . ASN A 92  ? 0.4464 0.2780 0.3498 -0.0220 -0.0136 -0.0062 168  ASN A CA  
336  C  C   . ASN A 92  ? 0.4503 0.2881 0.3647 -0.0076 -0.0115 -0.0079 168  ASN A C   
337  O  O   . ASN A 92  ? 0.4114 0.2512 0.3306 0.0002  -0.0120 -0.0052 168  ASN A O   
338  C  CB  . ASN A 92  ? 0.4492 0.2858 0.3534 -0.0253 -0.0154 -0.0015 168  ASN A CB  
339  C  CG  . ASN A 92  ? 0.4752 0.2894 0.3673 -0.0200 -0.0160 0.0015  168  ASN A CG  
340  O  OD1 . ASN A 92  ? 0.5151 0.3047 0.3929 -0.0178 -0.0151 0.0004  168  ASN A OD1 
341  N  ND2 . ASN A 92  ? 0.4609 0.2824 0.3577 -0.0174 -0.0174 0.0053  168  ASN A ND2 
342  N  N   . ALA A 93  ? 0.4212 0.2630 0.3397 -0.0046 -0.0094 -0.0120 169  ALA A N   
343  C  CA  . ALA A 93  ? 0.4042 0.2550 0.3345 0.0078  -0.0072 -0.0133 169  ALA A CA  
344  C  C   . ALA A 93  ? 0.3994 0.2332 0.3235 0.0187  -0.0055 -0.0117 169  ALA A C   
345  O  O   . ALA A 93  ? 0.3774 0.2222 0.3135 0.0288  -0.0049 -0.0102 169  ALA A O   
346  C  CB  . ALA A 93  ? 0.3836 0.2379 0.3158 0.0080  -0.0048 -0.0178 169  ALA A CB  
347  N  N   . LYS A 94  ? 0.4207 0.2276 0.3260 0.0168  -0.0050 -0.0114 170  LYS A N   
348  C  CA  . LYS A 94  ? 0.4540 0.2426 0.3521 0.0287  -0.0028 -0.0096 170  LYS A CA  
349  C  C   . LYS A 94  ? 0.4694 0.2654 0.3752 0.0342  -0.0056 -0.0041 170  LYS A C   
350  O  O   . LYS A 94  ? 0.4777 0.2660 0.3835 0.0463  -0.0042 -0.0015 170  LYS A O   
351  C  CB  . LYS A 94  ? 0.5296 0.2844 0.4027 0.0244  -0.0020 -0.0104 170  LYS A CB  
352  C  CG  . LYS A 94  ? 0.5972 0.3430 0.4599 0.0131  -0.0061 -0.0069 170  LYS A CG  
353  C  CD  . LYS A 94  ? 0.6997 0.4094 0.5355 0.0080  -0.0055 -0.0077 170  LYS A CD  
354  C  CE  . LYS A 94  ? 0.7690 0.4693 0.5940 -0.0036 -0.0096 -0.0034 170  LYS A CE  
355  N  NZ  . LYS A 94  ? 0.8604 0.5229 0.6571 -0.0096 -0.0093 -0.0040 170  LYS A NZ  
356  N  N   . ALA A 95  ? 0.4411 0.2521 0.3533 0.0260  -0.0093 -0.0019 171  ALA A N   
357  C  CA  . ALA A 95  ? 0.4184 0.2364 0.3363 0.0299  -0.0124 0.0033  171  ALA A CA  
358  C  C   . ALA A 95  ? 0.3971 0.2413 0.3350 0.0363  -0.0133 0.0039  171  ALA A C   
359  O  O   . ALA A 95  ? 0.4059 0.2590 0.3490 0.0376  -0.0166 0.0079  171  ALA A O   
360  C  CB  . ALA A 95  ? 0.3986 0.2177 0.3108 0.0176  -0.0155 0.0056  171  ALA A CB  
361  N  N   . TYR A 96  ? 0.3633 0.2190 0.3110 0.0397  -0.0106 0.0001  172  TYR A N   
362  C  CA  . TYR A 96  ? 0.3552 0.2356 0.3207 0.0429  -0.0117 0.0004  172  TYR A CA  
363  C  C   . TYR A 96  ? 0.3816 0.2667 0.3554 0.0531  -0.0083 -0.0009 172  TYR A C   
364  O  O   . TYR A 96  ? 0.4364 0.3095 0.4033 0.0551  -0.0042 -0.0042 172  TYR A O   
365  C  CB  . TYR A 96  ? 0.3173 0.2128 0.2882 0.0334  -0.0122 -0.0028 172  TYR A CB  
366  C  CG  . TYR A 96  ? 0.3516 0.2465 0.3165 0.0245  -0.0148 -0.0008 172  TYR A CG  
367  C  CD1 . TYR A 96  ? 0.3474 0.2530 0.3174 0.0245  -0.0177 0.0023  172  TYR A CD1 
368  C  CD2 . TYR A 96  ? 0.3649 0.2480 0.3181 0.0156  -0.0142 -0.0017 172  TYR A CD2 
369  C  CE1 . TYR A 96  ? 0.3615 0.2661 0.3249 0.0168  -0.0192 0.0042  172  TYR A CE1 
370  C  CE2 . TYR A 96  ? 0.3558 0.2399 0.3040 0.0073  -0.0160 0.0008  172  TYR A CE2 
371  C  CZ  . TYR A 96  ? 0.3733 0.2682 0.3267 0.0084  -0.0180 0.0036  172  TYR A CZ  
372  O  OH  . TYR A 96  ? 0.3792 0.2752 0.3270 0.0005  -0.0189 0.0061  172  TYR A OH  
373  N  N   . SER A 97  ? 0.3387 0.2412 0.3266 0.0591  -0.0101 0.0021  173  SER A N   
374  C  CA  . SER A 97  ? 0.3504 0.2647 0.3502 0.0673  -0.0072 0.0016  173  SER A CA  
375  C  C   . SER A 97  ? 0.3234 0.2591 0.3353 0.0619  -0.0088 -0.0003 173  SER A C   
376  O  O   . SER A 97  ? 0.2938 0.2344 0.3047 0.0536  -0.0118 -0.0010 173  SER A O   
377  C  CB  . SER A 97  ? 0.3656 0.2841 0.3728 0.0785  -0.0083 0.0075  173  SER A CB  
378  O  OG  . SER A 97  ? 0.3628 0.2984 0.3797 0.0759  -0.0141 0.0114  173  SER A OG  
379  N  N   . LYS A 98  ? 0.2951 0.2430 0.3178 0.0670  -0.0062 -0.0010 174  LYS A N   
380  C  CA  . LYS A 98  ? 0.2587 0.2257 0.2922 0.0623  -0.0079 -0.0022 174  LYS A CA  
381  C  C   . LYS A 98  ? 0.2838 0.2652 0.3264 0.0625  -0.0134 0.0026  174  LYS A C   
382  O  O   . LYS A 98  ? 0.2538 0.2485 0.3029 0.0575  -0.0155 0.0018  174  LYS A O   
383  C  CB  . LYS A 98  ? 0.2452 0.2197 0.2859 0.0665  -0.0033 -0.0042 174  LYS A CB  
384  C  CG  . LYS A 98  ? 0.2671 0.2292 0.2979 0.0637  0.0013  -0.0097 174  LYS A CG  
385  C  CD  . LYS A 98  ? 0.2635 0.2246 0.2889 0.0531  -0.0012 -0.0128 174  LYS A CD  
386  C  CE  . LYS A 98  ? 0.2667 0.2209 0.2852 0.0495  0.0022  -0.0176 174  LYS A CE  
387  N  NZ  . LYS A 98  ? 0.2937 0.2614 0.3211 0.0499  0.0039  -0.0191 174  LYS A NZ  
388  N  N   . GLY A 99  ? 0.3525 0.3304 0.3945 0.0676  -0.0159 0.0077  175  GLY A N   
389  C  CA  . GLY A 99  ? 0.3452 0.3351 0.3935 0.0666  -0.0221 0.0128  175  GLY A CA  
390  C  C   . GLY A 99  ? 0.3141 0.3250 0.3762 0.0659  -0.0242 0.0143  175  GLY A C   
391  O  O   . GLY A 99  ? 0.3035 0.3238 0.3759 0.0726  -0.0215 0.0161  175  GLY A O   
392  N  N   . ILE A 100 ? 0.2558 0.2734 0.3173 0.0575  -0.0286 0.0136  176  ILE A N   
393  C  CA  . ILE A 100 ? 0.2963 0.3317 0.3683 0.0547  -0.0319 0.0154  176  ILE A CA  
394  C  C   . ILE A 100 ? 0.3206 0.3626 0.3991 0.0550  -0.0270 0.0119  176  ILE A C   
395  O  O   . ILE A 100 ? 0.3269 0.3845 0.4165 0.0552  -0.0282 0.0145  176  ILE A O   
396  C  CB  . ILE A 100 ? 0.3168 0.3521 0.3817 0.0452  -0.0368 0.0143  176  ILE A CB  
397  C  CG1 . ILE A 100 ? 0.4021 0.4427 0.4675 0.0446  -0.0440 0.0206  176  ILE A CG1 
398  C  CG2 . ILE A 100 ? 0.3241 0.3681 0.3924 0.0394  -0.0369 0.0114  176  ILE A CG2 
399  C  CD1 . ILE A 100 ? 0.4359 0.4643 0.4932 0.0478  -0.0448 0.0231  176  ILE A CD1 
400  N  N   . LEU A 101 ? 0.3051 0.3358 0.3766 0.0543  -0.0218 0.0063  177  LEU A N   
401  C  CA  . LEU A 101 ? 0.3190 0.3543 0.3949 0.0543  -0.0172 0.0029  177  LEU A CA  
402  C  C   . LEU A 101 ? 0.3160 0.3617 0.4031 0.0624  -0.0143 0.0064  177  LEU A C   
403  O  O   . LEU A 101 ? 0.3392 0.3977 0.4348 0.0612  -0.0131 0.0066  177  LEU A O   
404  C  CB  . LEU A 101 ? 0.3070 0.3275 0.3727 0.0533  -0.0125 -0.0026 177  LEU A CB  
405  C  CG  . LEU A 101 ? 0.3227 0.3457 0.3895 0.0510  -0.0087 -0.0067 177  LEU A CG  
406  C  CD1 . LEU A 101 ? 0.2972 0.3276 0.3652 0.0437  -0.0119 -0.0080 177  LEU A CD1 
407  C  CD2 . LEU A 101 ? 0.3329 0.3411 0.3890 0.0500  -0.0050 -0.0111 177  LEU A CD2 
408  N  N   . ALA A 102 ? 0.3358 0.3762 0.4229 0.0709  -0.0128 0.0096  178  ALA A N   
409  C  CA  . ALA A 102 ? 0.3658 0.4160 0.4637 0.0806  -0.0088 0.0133  178  ALA A CA  
410  C  C   . ALA A 102 ? 0.3750 0.4485 0.4883 0.0803  -0.0138 0.0199  178  ALA A C   
411  O  O   . ALA A 102 ? 0.3530 0.4422 0.4783 0.0834  -0.0108 0.0221  178  ALA A O   
412  C  CB  . ALA A 102 ? 0.3833 0.4195 0.4756 0.0908  -0.0059 0.0153  178  ALA A CB  
413  N  N   . GLU A 103 ? 0.3682 0.4448 0.4811 0.0760  -0.0215 0.0236  179  GLU A N   
414  C  CA  . GLU A 103 ? 0.3447 0.4434 0.4710 0.0738  -0.0274 0.0302  179  GLU A CA  
415  C  C   . GLU A 103 ? 0.3083 0.4180 0.4385 0.0643  -0.0284 0.0280  179  GLU A C   
416  O  O   . GLU A 103 ? 0.3134 0.4436 0.4568 0.0630  -0.0310 0.0332  179  GLU A O   
417  C  CB  . GLU A 103 ? 0.3807 0.4777 0.5024 0.0698  -0.0359 0.0342  179  GLU A CB  
418  C  CG  . GLU A 103 ? 0.4286 0.5232 0.5419 0.0570  -0.0412 0.0309  179  GLU A CG  
419  C  CD  . GLU A 103 ? 0.4724 0.5645 0.5794 0.0530  -0.0492 0.0347  179  GLU A CD  
420  O  OE1 . GLU A 103 ? 0.4902 0.5792 0.5974 0.0601  -0.0505 0.0393  179  GLU A OE1 
421  O  OE2 . GLU A 103 ? 0.4999 0.5915 0.6002 0.0429  -0.0540 0.0332  179  GLU A OE2 
422  N  N   . ILE A 104 ? 0.3035 0.4003 0.4225 0.0578  -0.0265 0.0208  180  ILE A N   
423  C  CA  . ILE A 104 ? 0.2872 0.3908 0.4075 0.0492  -0.0271 0.0184  180  ILE A CA  
424  C  C   . ILE A 104 ? 0.2804 0.3924 0.4092 0.0532  -0.0202 0.0177  180  ILE A C   
425  O  O   . ILE A 104 ? 0.3157 0.4442 0.4543 0.0496  -0.0213 0.0208  180  ILE A O   
426  C  CB  . ILE A 104 ? 0.3014 0.3885 0.4070 0.0422  -0.0272 0.0116  180  ILE A CB  
427  C  CG1 . ILE A 104 ? 0.2968 0.3776 0.3940 0.0374  -0.0337 0.0126  180  ILE A CG1 
428  C  CG2 . ILE A 104 ? 0.2874 0.3781 0.3927 0.0350  -0.0267 0.0087  180  ILE A CG2 
429  C  CD1 . ILE A 104 ? 0.2827 0.3481 0.3660 0.0324  -0.0328 0.0065  180  ILE A CD1 
430  N  N   . LEU A 105 ? 0.2491 0.3493 0.3730 0.0601  -0.0131 0.0139  181  LEU A N   
431  C  CA  . LEU A 105 ? 0.2708 0.3739 0.3976 0.0625  -0.0059 0.0115  181  LEU A CA  
432  C  C   . LEU A 105 ? 0.2935 0.4070 0.4311 0.0737  -0.0002 0.0158  181  LEU A C   
433  O  O   . LEU A 105 ? 0.2977 0.4172 0.4392 0.0757  0.0060  0.0149  181  LEU A O   
434  C  CB  . LEU A 105 ? 0.2736 0.3563 0.3861 0.0621  -0.0015 0.0042  181  LEU A CB  
435  C  CG  . LEU A 105 ? 0.2893 0.3628 0.3917 0.0524  -0.0053 -0.0002 181  LEU A CG  
436  C  CD1 . LEU A 105 ? 0.3022 0.3579 0.3922 0.0527  -0.0014 -0.0060 181  LEU A CD1 
437  C  CD2 . LEU A 105 ? 0.2930 0.3763 0.3991 0.0453  -0.0064 -0.0005 181  LEU A CD2 
438  N  N   . ASP A 106 ? 0.3217 0.4374 0.4638 0.0815  -0.0018 0.0208  182  ASP A N   
439  C  CA  . ASP A 106 ? 0.4026 0.5252 0.5535 0.0946  0.0047  0.0248  182  ASP A CA  
440  C  C   . ASP A 106 ? 0.3622 0.5107 0.5301 0.0954  0.0074  0.0296  182  ASP A C   
441  O  O   . ASP A 106 ? 0.3372 0.4895 0.5095 0.1048  0.0161  0.0301  182  ASP A O   
442  C  CB  . ASP A 106 ? 0.4753 0.5985 0.6296 0.1022  0.0008  0.0309  182  ASP A CB  
443  C  CG  . ASP A 106 ? 0.5836 0.7235 0.7530 0.1155  0.0056  0.0380  182  ASP A CG  
444  O  OD1 . ASP A 106 ? 0.6016 0.7308 0.7666 0.1263  0.0147  0.0358  182  ASP A OD1 
445  O  OD2 . ASP A 106 ? 0.6387 0.8024 0.8241 0.1153  0.0001  0.0461  182  ASP A OD2 
446  N  N   . PHE A 107 ? 0.3442 0.5102 0.5207 0.0853  0.0001  0.0332  183  PHE A N   
447  C  CA  . PHE A 107 ? 0.3453 0.5388 0.5395 0.0848  0.0015  0.0393  183  PHE A CA  
448  C  C   . PHE A 107 ? 0.3216 0.5147 0.5139 0.0837  0.0099  0.0350  183  PHE A C   
449  O  O   . PHE A 107 ? 0.3208 0.5346 0.5272 0.0877  0.0149  0.0397  183  PHE A O   
450  C  CB  . PHE A 107 ? 0.3407 0.5492 0.5407 0.0716  -0.0089 0.0435  183  PHE A CB  
451  C  CG  . PHE A 107 ? 0.3561 0.5560 0.5458 0.0583  -0.0107 0.0376  183  PHE A CG  
452  C  CD1 . PHE A 107 ? 0.3392 0.5554 0.5369 0.0513  -0.0097 0.0397  183  PHE A CD1 
453  C  CD2 . PHE A 107 ? 0.3431 0.5187 0.5150 0.0533  -0.0131 0.0304  183  PHE A CD2 
454  C  CE1 . PHE A 107 ? 0.3544 0.5605 0.5412 0.0397  -0.0114 0.0346  183  PHE A CE1 
455  C  CE2 . PHE A 107 ? 0.3554 0.5229 0.5179 0.0427  -0.0145 0.0254  183  PHE A CE2 
456  C  CZ  . PHE A 107 ? 0.3487 0.5302 0.5179 0.0360  -0.0138 0.0274  183  PHE A CZ  
457  N  N   . VAL A 108 ? 0.2744 0.4456 0.4501 0.0784  0.0115  0.0265  184  VAL A N   
458  C  CA  . VAL A 108 ? 0.3033 0.4722 0.4750 0.0762  0.0185  0.0223  184  VAL A CA  
459  C  C   . VAL A 108 ? 0.3421 0.4882 0.4996 0.0838  0.0264  0.0157  184  VAL A C   
460  O  O   . VAL A 108 ? 0.3494 0.4963 0.5062 0.0882  0.0349  0.0141  184  VAL A O   
461  C  CB  . VAL A 108 ? 0.3023 0.4672 0.4669 0.0617  0.0131  0.0188  184  VAL A CB  
462  C  CG1 . VAL A 108 ? 0.3214 0.4642 0.4707 0.0573  0.0079  0.0133  184  VAL A CG1 
463  C  CG2 . VAL A 108 ? 0.2880 0.4503 0.4479 0.0595  0.0200  0.0150  184  VAL A CG2 
464  N  N   . MET A 109 ? 0.3199 0.4451 0.4647 0.0848  0.0237  0.0118  185  MET A N   
465  C  CA  . MET A 109 ? 0.3062 0.4082 0.4355 0.0899  0.0299  0.0057  185  MET A CA  
466  C  C   . MET A 109 ? 0.3274 0.4236 0.4568 0.1040  0.0356  0.0078  185  MET A C   
467  O  O   . MET A 109 ? 0.3681 0.4452 0.4840 0.1091  0.0424  0.0030  185  MET A O   
468  C  CB  . MET A 109 ? 0.2804 0.3622 0.3949 0.0827  0.0244  0.0005  185  MET A CB  
469  C  CG  . MET A 109 ? 0.2386 0.3206 0.3492 0.0707  0.0205  -0.0028 185  MET A CG  
470  S  SD  . MET A 109 ? 0.2729 0.3324 0.3667 0.0645  0.0165  -0.0088 185  MET A SD  
471  C  CE  . MET A 109 ? 0.2293 0.2929 0.3215 0.0533  0.0131  -0.0111 185  MET A CE  
472  N  N   . GLY A 110 ? 0.3220 0.4332 0.4649 0.1103  0.0330  0.0150  186  GLY A N   
473  C  CA  . GLY A 110 ? 0.3252 0.4305 0.4683 0.1249  0.0380  0.0179  186  GLY A CA  
474  C  C   . GLY A 110 ? 0.3635 0.4369 0.4857 0.1274  0.0396  0.0120  186  GLY A C   
475  O  O   . GLY A 110 ? 0.3473 0.4090 0.4612 0.1199  0.0325  0.0101  186  GLY A O   
476  N  N   . LYS A 111 ? 0.3943 0.4524 0.5065 0.1371  0.0492  0.0090  187  LYS A N   
477  C  CA  . LYS A 111 ? 0.4523 0.4780 0.5426 0.1392  0.0511  0.0036  187  LYS A CA  
478  C  C   . LYS A 111 ? 0.4356 0.4442 0.5091 0.1284  0.0518  -0.0046 187  LYS A C   
479  O  O   . LYS A 111 ? 0.4433 0.4257 0.4975 0.1305  0.0560  -0.0096 187  LYS A O   
480  C  CB  . LYS A 111 ? 0.5079 0.5219 0.5927 0.1552  0.0608  0.0046  187  LYS A CB  
481  N  N   . GLY A 112 ? 0.3907 0.4130 0.4704 0.1169  0.0475  -0.0059 188  GLY A N   
482  C  CA  . GLY A 112 ? 0.3712 0.3799 0.4367 0.1068  0.0472  -0.0126 188  GLY A CA  
483  C  C   . GLY A 112 ? 0.3893 0.3792 0.4415 0.0996  0.0411  -0.0157 188  GLY A C   
484  O  O   . GLY A 112 ? 0.4144 0.4026 0.4685 0.1010  0.0363  -0.0127 188  GLY A O   
485  N  N   . LEU A 113 ? 0.3484 0.3253 0.3871 0.0913  0.0409  -0.0213 189  LEU A N   
486  C  CA  . LEU A 113 ? 0.3569 0.3144 0.3809 0.0848  0.0367  -0.0244 189  LEU A CA  
487  C  C   . LEU A 113 ? 0.3296 0.2960 0.3611 0.0784  0.0283  -0.0217 189  LEU A C   
488  O  O   . LEU A 113 ? 0.3227 0.2781 0.3481 0.0783  0.0253  -0.0208 189  LEU A O   
489  C  CB  . LEU A 113 ? 0.3469 0.2936 0.3575 0.0763  0.0374  -0.0298 189  LEU A CB  
490  C  CG  . LEU A 113 ? 0.3693 0.2948 0.3622 0.0801  0.0445  -0.0339 189  LEU A CG  
491  C  CD1 . LEU A 113 ? 0.3629 0.2813 0.3441 0.0696  0.0431  -0.0384 189  LEU A CD1 
492  C  CD2 . LEU A 113 ? 0.3929 0.2954 0.3719 0.0840  0.0451  -0.0343 189  LEU A CD2 
493  N  N   . ILE A 114 ? 0.2894 0.2744 0.3325 0.0728  0.0246  -0.0206 190  ILE A N   
494  C  CA  . ILE A 114 ? 0.2874 0.2783 0.3343 0.0658  0.0173  -0.0192 190  ILE A CA  
495  C  C   . ILE A 114 ? 0.3157 0.3088 0.3677 0.0705  0.0141  -0.0145 190  ILE A C   
496  O  O   . ILE A 114 ? 0.3183 0.3018 0.3633 0.0670  0.0104  -0.0146 190  ILE A O   
497  C  CB  . ILE A 114 ? 0.2597 0.2676 0.3164 0.0601  0.0146  -0.0188 190  ILE A CB  
498  C  CG1 . ILE A 114 ? 0.2794 0.2824 0.3285 0.0541  0.0160  -0.0232 190  ILE A CG1 
499  C  CG2 . ILE A 114 ? 0.2666 0.2808 0.3274 0.0550  0.0078  -0.0167 190  ILE A CG2 
500  C  CD1 . ILE A 114 ? 0.2751 0.2917 0.3315 0.0490  0.0141  -0.0228 190  ILE A CD1 
501  N  N   . PRO A 115 ? 0.3094 0.3155 0.3735 0.0779  0.0151  -0.0099 191  PRO A N   
502  C  CA  . PRO A 115 ? 0.3250 0.3332 0.3934 0.0821  0.0112  -0.0048 191  PRO A CA  
503  C  C   . PRO A 115 ? 0.3490 0.3396 0.4084 0.0910  0.0147  -0.0040 191  PRO A C   
504  O  O   . PRO A 115 ? 0.3679 0.3571 0.4285 0.0943  0.0111  0.0002  191  PRO A O   
505  C  CB  . PRO A 115 ? 0.2985 0.3302 0.3846 0.0859  0.0105  0.0006  191  PRO A CB  
506  C  CG  . PRO A 115 ? 0.3162 0.3520 0.4048 0.0895  0.0177  -0.0014 191  PRO A CG  
507  C  CD  . PRO A 115 ? 0.2961 0.3184 0.3718 0.0819  0.0191  -0.0082 191  PRO A CD  
508  N  N   . ALA A 116 ? 0.3075 0.2830 0.3563 0.0947  0.0214  -0.0079 192  ALA A N   
509  C  CA  . ALA A 116 ? 0.3416 0.2984 0.3805 0.1046  0.0256  -0.0071 192  ALA A CA  
510  C  C   . ALA A 116 ? 0.3690 0.3036 0.3916 0.0991  0.0221  -0.0088 192  ALA A C   
511  O  O   . ALA A 116 ? 0.3727 0.3056 0.3905 0.0877  0.0178  -0.0115 192  ALA A O   
512  C  CB  . ALA A 116 ? 0.3336 0.2790 0.3636 0.1102  0.0345  -0.0111 192  ALA A CB  
513  N  N   . ASP A 117 ? 0.3581 0.2758 0.3722 0.1078  0.0242  -0.0066 193  ASP A N   
514  C  CA  . ASP A 117 ? 0.4049 0.2974 0.4006 0.1034  0.0220  -0.0080 193  ASP A CA  
515  C  C   . ASP A 117 ? 0.4583 0.3258 0.4392 0.1143  0.0285  -0.0085 193  ASP A C   
516  O  O   . ASP A 117 ? 0.4980 0.3703 0.4853 0.1267  0.0346  -0.0068 193  ASP A O   
517  C  CB  . ASP A 117 ? 0.4143 0.3120 0.4145 0.1007  0.0147  -0.0030 193  ASP A CB  
518  C  CG  . ASP A 117 ? 0.4030 0.3134 0.4076 0.0873  0.0088  -0.0044 193  ASP A CG  
519  O  OD1 . ASP A 117 ? 0.3973 0.2962 0.3902 0.0777  0.0081  -0.0085 193  ASP A OD1 
520  O  OD2 . ASP A 117 ? 0.3745 0.3064 0.3940 0.0865  0.0048  -0.0012 193  ASP A OD2 
521  N  N   . GLY A 118 ? 0.4617 0.3018 0.4221 0.1094  0.0276  -0.0106 194  GLY A N   
522  C  CA  . GLY A 118 ? 0.5143 0.3260 0.4574 0.1196  0.0331  -0.0107 194  GLY A CA  
523  C  C   . GLY A 118 ? 0.5788 0.3766 0.5101 0.1235  0.0415  -0.0163 194  GLY A C   
524  O  O   . GLY A 118 ? 0.5857 0.3867 0.5142 0.1138  0.0418  -0.0213 194  GLY A O   
525  N  N   . GLU A 119 ? 0.6165 0.3981 0.5400 0.1387  0.0486  -0.0151 195  GLU A N   
526  C  CA  . GLU A 119 ? 0.6224 0.3901 0.5319 0.1395  0.0559  -0.0203 195  GLU A CA  
527  C  C   . GLU A 119 ? 0.6283 0.4202 0.5529 0.1415  0.0604  -0.0221 195  GLU A C   
528  O  O   . GLU A 119 ? 0.6575 0.4397 0.5697 0.1357  0.0640  -0.0280 195  GLU A O   
529  C  CB  . GLU A 119 ? 0.6275 0.3825 0.5301 0.1507  0.0606  -0.0177 195  GLU A CB  
530  N  N   . ILE A 120 ? 0.6176 0.4410 0.5682 0.1486  0.0599  -0.0168 196  ILE A N   
531  C  CA  . ILE A 120 ? 0.6236 0.4706 0.5886 0.1496  0.0642  -0.0179 196  ILE A CA  
532  C  C   . ILE A 120 ? 0.5777 0.4305 0.5421 0.1351  0.0599  -0.0223 196  ILE A C   
533  O  O   . ILE A 120 ? 0.5648 0.4221 0.5280 0.1325  0.0641  -0.0262 196  ILE A O   
534  C  CB  . ILE A 120 ? 0.6477 0.5288 0.6410 0.1580  0.0633  -0.0103 196  ILE A CB  
535  C  CG1 . ILE A 120 ? 0.6552 0.5571 0.6604 0.1609  0.0696  -0.0108 196  ILE A CG1 
536  C  CG2 . ILE A 120 ? 0.6258 0.5263 0.6343 0.1511  0.0541  -0.0068 196  ILE A CG2 
537  C  CD1 . ILE A 120 ? 0.6363 0.5595 0.6541 0.1529  0.0673  -0.0118 196  ILE A CD1 
538  N  N   . TRP A 121 ? 0.5213 0.3763 0.4869 0.1235  0.0507  -0.0216 197  TRP A N   
539  C  CA  . TRP A 121 ? 0.4679 0.3280 0.4316 0.1080  0.0459  -0.0257 197  TRP A CA  
540  C  C   . TRP A 121 ? 0.5053 0.3376 0.4441 0.1018  0.0488  -0.0320 197  TRP A C   
541  O  O   . TRP A 121 ? 0.5223 0.3584 0.4586 0.0955  0.0501  -0.0359 197  TRP A O   
542  C  CB  . TRP A 121 ? 0.4080 0.2749 0.3766 0.0978  0.0365  -0.0234 197  TRP A CB  
543  C  CG  . TRP A 121 ? 0.4120 0.2764 0.3731 0.0831  0.0328  -0.0278 197  TRP A CG  
544  C  CD1 . TRP A 121 ? 0.3860 0.2689 0.3568 0.0766  0.0314  -0.0294 197  TRP A CD1 
545  C  CD2 . TRP A 121 ? 0.4320 0.2743 0.3738 0.0734  0.0301  -0.0306 197  TRP A CD2 
546  N  NE1 . TRP A 121 ? 0.3954 0.2704 0.3554 0.0643  0.0279  -0.0328 197  TRP A NE1 
547  C  CE2 . TRP A 121 ? 0.4273 0.2786 0.3701 0.0616  0.0269  -0.0335 197  TRP A CE2 
548  C  CE3 . TRP A 121 ? 0.4455 0.2613 0.3692 0.0730  0.0298  -0.0306 197  TRP A CE3 
549  C  CZ2 . TRP A 121 ? 0.4449 0.2825 0.3729 0.0495  0.0233  -0.0358 197  TRP A CZ2 
550  C  CZ3 . TRP A 121 ? 0.4527 0.2534 0.3604 0.0599  0.0261  -0.0332 197  TRP A CZ3 
551  C  CH2 . TRP A 121 ? 0.4661 0.2791 0.3770 0.0482  0.0229  -0.0356 197  TRP A CH2 
552  N  N   . ARG A 122 ? 0.5309 0.3341 0.4497 0.1027  0.0492  -0.0329 198  ARG A N   
553  C  CA  . ARG A 122 ? 0.5584 0.3330 0.4509 0.0945  0.0505  -0.0388 198  ARG A CA  
554  C  C   . ARG A 122 ? 0.5697 0.3349 0.4523 0.1014  0.0597  -0.0429 198  ARG A C   
555  O  O   . ARG A 122 ? 0.5822 0.3395 0.4522 0.0919  0.0598  -0.0478 198  ARG A O   
556  C  CB  . ARG A 122 ? 0.5834 0.3265 0.4551 0.0949  0.0496  -0.0384 198  ARG A CB  
557  N  N   . ARG A 123 ? 0.5649 0.3343 0.4546 0.1170  0.0669  -0.0404 199  ARG A N   
558  C  CA  . ARG A 123 ? 0.5988 0.3659 0.4822 0.1214  0.0747  -0.0430 199  ARG A CA  
559  C  C   . ARG A 123 ? 0.5877 0.3756 0.4823 0.1182  0.0766  -0.0451 199  ARG A C   
560  O  O   . ARG A 123 ? 0.5896 0.3672 0.4696 0.1127  0.0796  -0.0499 199  ARG A O   
561  C  CB  . ARG A 123 ? 0.5998 0.3746 0.4931 0.1367  0.0805  -0.0382 199  ARG A CB  
562  N  N   . ARG A 124 ? 0.5231 0.3410 0.4432 0.1204  0.0740  -0.0410 200  ARG A N   
563  C  CA  . ARG A 124 ? 0.5204 0.3618 0.4532 0.1153  0.0744  -0.0417 200  ARG A CA  
564  C  C   . ARG A 124 ? 0.5021 0.3411 0.4273 0.0982  0.0670  -0.0454 200  ARG A C   
565  O  O   . ARG A 124 ? 0.4933 0.3364 0.4154 0.0932  0.0690  -0.0483 200  ARG A O   
566  C  CB  . ARG A 124 ? 0.4894 0.3660 0.4521 0.1190  0.0717  -0.0354 200  ARG A CB  
567  C  CG  . ARG A 124 ? 0.4931 0.3784 0.4672 0.1361  0.0789  -0.0306 200  ARG A CG  
568  C  CD  . ARG A 124 ? 0.4977 0.3744 0.4609 0.1412  0.0880  -0.0333 200  ARG A CD  
569  N  NE  . ARG A 124 ? 0.4788 0.3703 0.4473 0.1375  0.0917  -0.0352 200  ARG A NE  
570  C  CZ  . ARG A 124 ? 0.4976 0.3777 0.4511 0.1367  0.0983  -0.0395 200  ARG A CZ  
571  N  NH1 . ARG A 124 ? 0.5063 0.3595 0.4383 0.1393  0.1018  -0.0424 200  ARG A NH1 
572  N  NH2 . ARG A 124 ? 0.5129 0.4073 0.4717 0.1331  0.1012  -0.0406 200  ARG A NH2 
573  N  N   . ARG A 125 ? 0.4671 0.3000 0.3889 0.0893  0.0588  -0.0448 201  ARG A N   
574  C  CA  . ARG A 125 ? 0.4753 0.3068 0.3903 0.0738  0.0521  -0.0476 201  ARG A CA  
575  C  C   . ARG A 125 ? 0.4769 0.2821 0.3656 0.0689  0.0554  -0.0532 201  ARG A C   
576  O  O   . ARG A 125 ? 0.4614 0.2713 0.3470 0.0606  0.0540  -0.0556 201  ARG A O   
577  C  CB  . ARG A 125 ? 0.4978 0.3271 0.4134 0.0661  0.0438  -0.0454 201  ARG A CB  
578  C  CG  . ARG A 125 ? 0.5174 0.3432 0.4240 0.0505  0.0374  -0.0477 201  ARG A CG  
579  C  CD  . ARG A 125 ? 0.4776 0.3283 0.4032 0.0442  0.0302  -0.0444 201  ARG A CD  
580  N  NE  . ARG A 125 ? 0.4798 0.3313 0.3998 0.0307  0.0245  -0.0457 201  ARG A NE  
581  C  CZ  . ARG A 125 ? 0.4504 0.3228 0.3848 0.0249  0.0191  -0.0435 201  ARG A CZ  
582  N  NH1 . ARG A 125 ? 0.4049 0.2964 0.3580 0.0304  0.0185  -0.0405 201  ARG A NH1 
583  N  NH2 . ARG A 125 ? 0.4249 0.2993 0.3549 0.0137  0.0143  -0.0440 201  ARG A NH2 
584  N  N   . ARG A 126 ? 0.5072 0.2829 0.3751 0.0738  0.0597  -0.0552 202  ARG A N   
585  C  CA  . ARG A 126 ? 0.5337 0.2804 0.3728 0.0688  0.0629  -0.0609 202  ARG A CA  
586  C  C   . ARG A 126 ? 0.5731 0.3232 0.4101 0.0746  0.0712  -0.0636 202  ARG A C   
587  O  O   . ARG A 126 ? 0.6099 0.3452 0.4274 0.0665  0.0718  -0.0681 202  ARG A O   
588  C  CB  . ARG A 126 ? 0.5460 0.2615 0.3643 0.0738  0.0659  -0.0616 202  ARG A CB  
589  N  N   . ALA A 127 ? 0.5553 0.3254 0.4116 0.0878  0.0775  -0.0606 203  ALA A N   
590  C  CA  . ALA A 127 ? 0.5623 0.3397 0.4190 0.0928  0.0854  -0.0620 203  ALA A CA  
591  C  C   . ALA A 127 ? 0.5172 0.3181 0.3868 0.0844  0.0819  -0.0619 203  ALA A C   
592  O  O   . ALA A 127 ? 0.4926 0.2901 0.3522 0.0824  0.0865  -0.0650 203  ALA A O   
593  C  CB  . ALA A 127 ? 0.5712 0.3654 0.4459 0.1083  0.0922  -0.0572 203  ALA A CB  
594  N  N   . ILE A 128 ? 0.4996 0.3246 0.3908 0.0786  0.0733  -0.0579 204  ILE A N   
595  C  CA  . ILE A 128 ? 0.4844 0.3348 0.3913 0.0723  0.0701  -0.0564 204  ILE A CA  
596  C  C   . ILE A 128 ? 0.5068 0.3526 0.4040 0.0571  0.0620  -0.0587 204  ILE A C   
597  O  O   . ILE A 128 ? 0.4841 0.3364 0.3797 0.0518  0.0620  -0.0598 204  ILE A O   
598  C  CB  . ILE A 128 ? 0.4696 0.3484 0.4046 0.0754  0.0660  -0.0507 204  ILE A CB  
599  C  CG1 . ILE A 128 ? 0.4844 0.3725 0.4310 0.0901  0.0742  -0.0476 204  ILE A CG1 
600  C  CG2 . ILE A 128 ? 0.4366 0.3379 0.3852 0.0674  0.0614  -0.0493 204  ILE A CG2 
601  C  CD1 . ILE A 128 ? 0.4698 0.3816 0.4408 0.0934  0.0696  -0.0417 204  ILE A CD1 
602  N  N   . VAL A 129 ? 0.5098 0.3453 0.4005 0.0498  0.0550  -0.0588 205  VAL A N   
603  C  CA  . VAL A 129 ? 0.5085 0.3420 0.3917 0.0354  0.0468  -0.0598 205  VAL A CA  
604  C  C   . VAL A 129 ? 0.5159 0.3340 0.3777 0.0296  0.0491  -0.0640 205  VAL A C   
605  O  O   . VAL A 129 ? 0.5129 0.3418 0.3772 0.0209  0.0441  -0.0635 205  VAL A O   
606  C  CB  . VAL A 129 ? 0.5358 0.3562 0.4112 0.0293  0.0408  -0.0593 205  VAL A CB  
607  C  CG1 . VAL A 129 ? 0.5516 0.3656 0.4141 0.0143  0.0337  -0.0606 205  VAL A CG1 
608  C  CG2 . VAL A 129 ? 0.5344 0.3751 0.4321 0.0313  0.0363  -0.0547 205  VAL A CG2 
609  N  N   . PRO A 130 ? 0.5210 0.3133 0.3607 0.0343  0.0565  -0.0680 206  PRO A N   
610  C  CA  . PRO A 130 ? 0.5333 0.3105 0.3510 0.0280  0.0585  -0.0721 206  PRO A CA  
611  C  C   . PRO A 130 ? 0.5193 0.3161 0.3478 0.0294  0.0614  -0.0712 206  PRO A C   
612  O  O   . PRO A 130 ? 0.5223 0.3127 0.3364 0.0210  0.0598  -0.0734 206  PRO A O   
613  C  CB  . PRO A 130 ? 0.5876 0.3341 0.3816 0.0366  0.0682  -0.0763 206  PRO A CB  
614  C  CG  . PRO A 130 ? 0.5956 0.3349 0.3931 0.0416  0.0671  -0.0746 206  PRO A CG  
615  C  CD  . PRO A 130 ? 0.5462 0.3187 0.3766 0.0448  0.0629  -0.0690 206  PRO A CD  
616  N  N   . ALA A 131 ? 0.5145 0.3346 0.3669 0.0388  0.0650  -0.0679 207  ALA A N   
617  C  CA  . ALA A 131 ? 0.5240 0.3620 0.3859 0.0394  0.0678  -0.0667 207  ALA A CA  
618  C  C   . ALA A 131 ? 0.5587 0.4118 0.4285 0.0277  0.0580  -0.0646 207  ALA A C   
619  O  O   . ALA A 131 ? 0.5752 0.4335 0.4421 0.0240  0.0588  -0.0647 207  ALA A O   
620  C  CB  . ALA A 131 ? 0.4892 0.3492 0.3749 0.0508  0.0732  -0.0629 207  ALA A CB  
621  N  N   . LEU A 132 ? 0.5393 0.3994 0.4187 0.0224  0.0493  -0.0623 208  LEU A N   
622  C  CA  . LEU A 132 ? 0.5141 0.3894 0.4024 0.0131  0.0404  -0.0597 208  LEU A CA  
623  C  C   . LEU A 132 ? 0.5375 0.3986 0.4070 0.0013  0.0340  -0.0614 208  LEU A C   
624  O  O   . LEU A 132 ? 0.5411 0.4086 0.4159 -0.0057 0.0258  -0.0591 208  LEU A O   
625  C  CB  . LEU A 132 ? 0.5060 0.3988 0.4157 0.0143  0.0350  -0.0559 208  LEU A CB  
626  C  CG  . LEU A 132 ? 0.4958 0.4064 0.4253 0.0232  0.0391  -0.0533 208  LEU A CG  
627  C  CD1 . LEU A 132 ? 0.5115 0.4183 0.4456 0.0321  0.0430  -0.0529 208  LEU A CD1 
628  C  CD2 . LEU A 132 ? 0.4522 0.3831 0.3996 0.0199  0.0326  -0.0496 208  LEU A CD2 
629  N  N   . HIS A 133 ? 0.5758 0.4182 0.4228 -0.0012 0.0379  -0.0650 209  HIS A N   
630  C  CA  . HIS A 133 ? 0.6042 0.4324 0.4314 -0.0136 0.0313  -0.0664 209  HIS A CA  
631  C  C   . HIS A 133 ? 0.6133 0.4574 0.4462 -0.0213 0.0246  -0.0634 209  HIS A C   
632  O  O   . HIS A 133 ? 0.6050 0.4678 0.4546 -0.0169 0.0257  -0.0609 209  HIS A O   
633  C  CB  . HIS A 133 ? 0.6199 0.4187 0.4173 -0.0140 0.0378  -0.0718 209  HIS A CB  
634  C  CG  . HIS A 133 ? 0.6391 0.4371 0.4321 -0.0069 0.0472  -0.0737 209  HIS A CG  
635  N  ND1 . HIS A 133 ? 0.6344 0.4412 0.4260 -0.0120 0.0453  -0.0726 209  HIS A ND1 
636  C  CD2 . HIS A 133 ? 0.6554 0.4448 0.4443 0.0051  0.0588  -0.0762 209  HIS A CD2 
637  C  CE1 . HIS A 133 ? 0.6426 0.4464 0.4294 -0.0043 0.0555  -0.0745 209  HIS A CE1 
638  N  NE2 . HIS A 133 ? 0.6475 0.4418 0.4333 0.0064  0.0641  -0.0767 209  HIS A NE2 
639  N  N   . GLN A 134 ? 0.6422 0.4785 0.4605 -0.0334 0.0170  -0.0633 210  GLN A N   
640  C  CA  . GLN A 134 ? 0.6479 0.5002 0.4724 -0.0407 0.0091  -0.0594 210  GLN A CA  
641  C  C   . GLN A 134 ? 0.6566 0.5106 0.4770 -0.0381 0.0137  -0.0600 210  GLN A C   
642  O  O   . GLN A 134 ? 0.6789 0.5518 0.5147 -0.0370 0.0110  -0.0561 210  GLN A O   
643  C  CB  . GLN A 134 ? 0.6681 0.5112 0.4759 -0.0546 0.0002  -0.0587 210  GLN A CB  
644  N  N   . LYS A 135 ? 0.6349 0.4680 0.4333 -0.0369 0.0211  -0.0646 211  LYS A N   
645  C  CA  . LYS A 135 ? 0.6146 0.4486 0.4074 -0.0347 0.0263  -0.0652 211  LYS A CA  
646  C  C   . LYS A 135 ? 0.5392 0.3924 0.3555 -0.0240 0.0323  -0.0630 211  LYS A C   
647  O  O   . LYS A 135 ? 0.5146 0.3801 0.3375 -0.0244 0.0318  -0.0604 211  LYS A O   
648  C  CB  . LYS A 135 ? 0.6768 0.4839 0.4412 -0.0340 0.0348  -0.0709 211  LYS A CB  
649  C  CG  . LYS A 135 ? 0.7293 0.5357 0.4844 -0.0331 0.0405  -0.0715 211  LYS A CG  
650  C  CD  . LYS A 135 ? 0.8082 0.5903 0.5394 -0.0277 0.0527  -0.0774 211  LYS A CD  
651  C  CE  . LYS A 135 ? 0.8643 0.6165 0.5635 -0.0367 0.0500  -0.0819 211  LYS A CE  
652  N  NZ  . LYS A 135 ? 0.8834 0.6120 0.5605 -0.0300 0.0621  -0.0868 211  LYS A NZ  
653  N  N   . TYR A 136 ? 0.5166 0.3723 0.3450 -0.0150 0.0374  -0.0638 212  TYR A N   
654  C  CA  . TYR A 136 ? 0.4692 0.3440 0.3202 -0.0060 0.0421  -0.0612 212  TYR A CA  
655  C  C   . TYR A 136 ? 0.4558 0.3519 0.3271 -0.0090 0.0336  -0.0563 212  TYR A C   
656  O  O   . TYR A 136 ? 0.4456 0.3550 0.3272 -0.0074 0.0346  -0.0537 212  TYR A O   
657  C  CB  . TYR A 136 ? 0.4484 0.3218 0.3079 0.0037  0.0479  -0.0623 212  TYR A CB  
658  C  CG  . TYR A 136 ? 0.4107 0.3064 0.2959 0.0112  0.0500  -0.0587 212  TYR A CG  
659  C  CD1 . TYR A 136 ? 0.4427 0.3470 0.3332 0.0168  0.0579  -0.0579 212  TYR A CD1 
660  C  CD2 . TYR A 136 ? 0.3770 0.2852 0.2802 0.0118  0.0441  -0.0559 212  TYR A CD2 
661  C  CE1 . TYR A 136 ? 0.4087 0.3335 0.3220 0.0220  0.0590  -0.0542 212  TYR A CE1 
662  C  CE2 . TYR A 136 ? 0.3891 0.3160 0.3135 0.0175  0.0453  -0.0527 212  TYR A CE2 
663  C  CZ  . TYR A 136 ? 0.3929 0.3282 0.3224 0.0221  0.0524  -0.0517 212  TYR A CZ  
664  O  OH  . TYR A 136 ? 0.3584 0.3126 0.3083 0.0261  0.0529  -0.0480 212  TYR A OH  
665  N  N   . VAL A 137 ? 0.4461 0.3449 0.3226 -0.0132 0.0257  -0.0549 213  VAL A N   
666  C  CA  . VAL A 137 ? 0.4361 0.3538 0.3307 -0.0149 0.0183  -0.0503 213  VAL A CA  
667  C  C   . VAL A 137 ? 0.4293 0.3512 0.3191 -0.0207 0.0139  -0.0479 213  VAL A C   
668  O  O   . VAL A 137 ? 0.3778 0.3132 0.2804 -0.0188 0.0124  -0.0446 213  VAL A O   
669  C  CB  . VAL A 137 ? 0.4716 0.3910 0.3708 -0.0185 0.0114  -0.0491 213  VAL A CB  
670  C  CG1 . VAL A 137 ? 0.4720 0.4101 0.3882 -0.0196 0.0046  -0.0444 213  VAL A CG1 
671  C  CG2 . VAL A 137 ? 0.4806 0.3964 0.3855 -0.0122 0.0157  -0.0508 213  VAL A CG2 
672  N  N   . ALA A 138 ? 0.4632 0.3721 0.3331 -0.0281 0.0116  -0.0494 214  ALA A N   
673  C  CA  . ALA A 138 ? 0.4967 0.4087 0.3603 -0.0338 0.0070  -0.0466 214  ALA A CA  
674  C  C   . ALA A 138 ? 0.4917 0.4062 0.3561 -0.0294 0.0138  -0.0466 214  ALA A C   
675  O  O   . ALA A 138 ? 0.5074 0.4319 0.3782 -0.0304 0.0104  -0.0427 214  ALA A O   
676  C  CB  . ALA A 138 ? 0.5624 0.4581 0.4018 -0.0432 0.0036  -0.0485 214  ALA A CB  
677  N  N   . ALA A 139 ? 0.4889 0.3945 0.3468 -0.0243 0.0237  -0.0504 215  ALA A N   
678  C  CA  . ALA A 139 ? 0.4790 0.3891 0.3390 -0.0203 0.0309  -0.0499 215  ALA A CA  
679  C  C   . ALA A 139 ? 0.4506 0.3792 0.3345 -0.0151 0.0310  -0.0464 215  ALA A C   
680  O  O   . ALA A 139 ? 0.4357 0.3717 0.3235 -0.0153 0.0323  -0.0438 215  ALA A O   
681  C  CB  . ALA A 139 ? 0.5279 0.4258 0.3764 -0.0151 0.0423  -0.0544 215  ALA A CB  
682  N  N   . MET A 140 ? 0.3761 0.3112 0.2746 -0.0111 0.0293  -0.0462 216  MET A N   
683  C  CA  . MET A 140 ? 0.3355 0.2864 0.2544 -0.0069 0.0289  -0.0431 216  MET A CA  
684  C  C   . MET A 140 ? 0.3462 0.3053 0.2715 -0.0107 0.0207  -0.0391 216  MET A C   
685  O  O   . MET A 140 ? 0.3335 0.3024 0.2706 -0.0088 0.0207  -0.0364 216  MET A O   
686  C  CB  . MET A 140 ? 0.3235 0.2780 0.2546 -0.0019 0.0290  -0.0439 216  MET A CB  
687  C  CG  . MET A 140 ? 0.3725 0.3210 0.3008 0.0044  0.0378  -0.0469 216  MET A CG  
688  S  SD  . MET A 140 ? 0.4064 0.3645 0.3412 0.0093  0.0473  -0.0455 216  MET A SD  
689  C  CE  . MET A 140 ? 0.4384 0.3801 0.3487 0.0071  0.0539  -0.0489 216  MET A CE  
690  N  N   . ILE A 141 ? 0.3428 0.2977 0.2598 -0.0161 0.0138  -0.0382 217  ILE A N   
691  C  CA  . ILE A 141 ? 0.4078 0.3705 0.3304 -0.0183 0.0064  -0.0338 217  ILE A CA  
692  C  C   . ILE A 141 ? 0.3884 0.3509 0.3062 -0.0196 0.0082  -0.0316 217  ILE A C   
693  O  O   . ILE A 141 ? 0.3544 0.3236 0.2805 -0.0185 0.0053  -0.0281 217  ILE A O   
694  C  CB  . ILE A 141 ? 0.4534 0.4137 0.3686 -0.0238 -0.0013 -0.0325 217  ILE A CB  
695  C  CG1 . ILE A 141 ? 0.4662 0.4301 0.3900 -0.0227 -0.0039 -0.0333 217  ILE A CG1 
696  C  CG2 . ILE A 141 ? 0.4116 0.3789 0.3295 -0.0254 -0.0082 -0.0273 217  ILE A CG2 
697  C  CD1 . ILE A 141 ? 0.4855 0.4506 0.4048 -0.0288 -0.0118 -0.0311 217  ILE A CD1 
698  N  N   . SER A 142 ? 0.3814 0.3351 0.2846 -0.0220 0.0134  -0.0337 218  SER A N   
699  C  CA  . SER A 142 ? 0.4107 0.3644 0.3090 -0.0235 0.0162  -0.0316 218  SER A CA  
700  C  C   . SER A 142 ? 0.3703 0.3334 0.2832 -0.0194 0.0209  -0.0305 218  SER A C   
701  O  O   . SER A 142 ? 0.3444 0.3113 0.2606 -0.0207 0.0190  -0.0268 218  SER A O   
702  C  CB  . SER A 142 ? 0.4552 0.3977 0.3348 -0.0262 0.0226  -0.0345 218  SER A CB  
703  O  OG  . SER A 142 ? 0.5783 0.5109 0.4422 -0.0317 0.0172  -0.0353 218  SER A OG  
704  N  N   . LEU A 143 ? 0.3341 0.3004 0.2551 -0.0146 0.0267  -0.0331 219  LEU A N   
705  C  CA  . LEU A 143 ? 0.3220 0.2992 0.2580 -0.0114 0.0301  -0.0314 219  LEU A CA  
706  C  C   . LEU A 143 ? 0.3231 0.3064 0.2709 -0.0112 0.0229  -0.0286 219  LEU A C   
707  O  O   . LEU A 143 ? 0.3301 0.3185 0.2838 -0.0123 0.0227  -0.0257 219  LEU A O   
708  C  CB  . LEU A 143 ? 0.3466 0.3269 0.2897 -0.0057 0.0365  -0.0342 219  LEU A CB  
709  C  CG  . LEU A 143 ? 0.3700 0.3635 0.3311 -0.0025 0.0379  -0.0320 219  LEU A CG  
710  C  CD1 . LEU A 143 ? 0.3688 0.3696 0.3320 -0.0050 0.0421  -0.0289 219  LEU A CD1 
711  C  CD2 . LEU A 143 ? 0.3616 0.3578 0.3297 0.0040  0.0428  -0.0342 219  LEU A CD2 
712  N  N   . PHE A 144 ? 0.3123 0.2946 0.2628 -0.0101 0.0172  -0.0293 220  PHE A N   
713  C  CA  . PHE A 144 ? 0.2881 0.2754 0.2484 -0.0089 0.0112  -0.0268 220  PHE A CA  
714  C  C   . PHE A 144 ? 0.2873 0.2723 0.2427 -0.0117 0.0073  -0.0231 220  PHE A C   
715  O  O   . PHE A 144 ? 0.3002 0.2875 0.2617 -0.0109 0.0058  -0.0208 220  PHE A O   
716  C  CB  . PHE A 144 ? 0.2906 0.2778 0.2530 -0.0078 0.0062  -0.0275 220  PHE A CB  
717  C  CG  . PHE A 144 ? 0.3014 0.2884 0.2669 -0.0054 0.0092  -0.0309 220  PHE A CG  
718  C  CD1 . PHE A 144 ? 0.2710 0.2608 0.2425 -0.0022 0.0152  -0.0323 220  PHE A CD1 
719  C  CD2 . PHE A 144 ? 0.2836 0.2676 0.2458 -0.0066 0.0058  -0.0320 220  PHE A CD2 
720  C  CE1 . PHE A 144 ? 0.2931 0.2812 0.2666 0.0009  0.0179  -0.0349 220  PHE A CE1 
721  C  CE2 . PHE A 144 ? 0.2963 0.2775 0.2594 -0.0047 0.0084  -0.0348 220  PHE A CE2 
722  C  CZ  . PHE A 144 ? 0.2844 0.2669 0.2529 -0.0004 0.0146  -0.0364 220  PHE A CZ  
723  N  N   . GLY A 145 ? 0.3118 0.2910 0.2549 -0.0150 0.0054  -0.0222 221  GLY A N   
724  C  CA  . GLY A 145 ? 0.3323 0.3084 0.2697 -0.0171 0.0013  -0.0181 221  GLY A CA  
725  C  C   . GLY A 145 ? 0.3318 0.3063 0.2663 -0.0196 0.0056  -0.0167 221  GLY A C   
726  O  O   . GLY A 145 ? 0.3419 0.3144 0.2767 -0.0201 0.0028  -0.0133 221  GLY A O   
727  N  N   . GLU A 146 ? 0.3276 0.3026 0.2587 -0.0212 0.0128  -0.0189 222  GLU A N   
728  C  CA  . GLU A 146 ? 0.3630 0.3389 0.2921 -0.0243 0.0175  -0.0169 222  GLU A CA  
729  C  C   . GLU A 146 ? 0.3469 0.3297 0.2893 -0.0233 0.0176  -0.0156 222  GLU A C   
730  O  O   . GLU A 146 ? 0.3546 0.3356 0.2955 -0.0267 0.0164  -0.0123 222  GLU A O   
731  C  CB  . GLU A 146 ? 0.4007 0.3777 0.3247 -0.0249 0.0262  -0.0195 222  GLU A CB  
732  C  CG  . GLU A 146 ? 0.4717 0.4389 0.3775 -0.0282 0.0265  -0.0203 222  GLU A CG  
733  C  CD  . GLU A 146 ? 0.5207 0.4851 0.4203 -0.0262 0.0336  -0.0249 222  GLU A CD  
734  O  OE1 . GLU A 146 ? 0.5657 0.5202 0.4486 -0.0292 0.0336  -0.0263 222  GLU A OE1 
735  O  OE2 . GLU A 146 ? 0.5252 0.4963 0.4355 -0.0216 0.0391  -0.0270 222  GLU A OE2 
736  N  N   . ALA A 147 ? 0.3267 0.3163 0.2810 -0.0191 0.0187  -0.0180 223  ALA A N   
737  C  CA  . ALA A 147 ? 0.2823 0.2783 0.2483 -0.0188 0.0181  -0.0167 223  ALA A CA  
738  C  C   . ALA A 147 ? 0.2844 0.2746 0.2502 -0.0184 0.0110  -0.0148 223  ALA A C   
739  O  O   . ALA A 147 ? 0.2701 0.2592 0.2372 -0.0212 0.0097  -0.0124 223  ALA A O   
740  C  CB  . ALA A 147 ? 0.2674 0.2715 0.2450 -0.0141 0.0206  -0.0194 223  ALA A CB  
741  N  N   . SER A 148 ? 0.2924 0.2787 0.2562 -0.0151 0.0065  -0.0156 224  SER A N   
742  C  CA  . SER A 148 ? 0.2966 0.2776 0.2598 -0.0132 0.0006  -0.0134 224  SER A CA  
743  C  C   . SER A 148 ? 0.3207 0.2927 0.2732 -0.0166 -0.0012 -0.0097 224  SER A C   
744  O  O   . SER A 148 ? 0.3164 0.2820 0.2674 -0.0165 -0.0039 -0.0077 224  SER A O   
745  C  CB  . SER A 148 ? 0.3027 0.2841 0.2665 -0.0091 -0.0034 -0.0140 224  SER A CB  
746  O  OG  . SER A 148 ? 0.2933 0.2813 0.2661 -0.0063 -0.0020 -0.0171 224  SER A OG  
747  N  N   . ASP A 149 ? 0.3115 0.2813 0.2548 -0.0200 0.0004  -0.0089 225  ASP A N   
748  C  CA  . ASP A 149 ? 0.3546 0.3152 0.2865 -0.0238 -0.0012 -0.0050 225  ASP A CA  
749  C  C   . ASP A 149 ? 0.3531 0.3128 0.2855 -0.0289 0.0017  -0.0035 225  ASP A C   
750  O  O   . ASP A 149 ? 0.3661 0.3159 0.2914 -0.0311 -0.0012 -0.0002 225  ASP A O   
751  C  CB  . ASP A 149 ? 0.3663 0.3248 0.2872 -0.0270 0.0004  -0.0045 225  ASP A CB  
752  C  CG  . ASP A 149 ? 0.4376 0.3861 0.3455 -0.0312 -0.0015 -0.0000 225  ASP A CG  
753  O  OD1 . ASP A 149 ? 0.4333 0.3744 0.3368 -0.0286 -0.0076 0.0032  225  ASP A OD1 
754  O  OD2 . ASP A 149 ? 0.4667 0.4148 0.3689 -0.0369 0.0033  0.0007  225  ASP A OD2 
755  N  N   . ARG A 150 ? 0.3574 0.3274 0.2979 -0.0308 0.0073  -0.0055 226  ARG A N   
756  C  CA  . ARG A 150 ? 0.3754 0.3480 0.3186 -0.0365 0.0095  -0.0034 226  ARG A CA  
757  C  C   . ARG A 150 ? 0.3735 0.3411 0.3201 -0.0357 0.0048  -0.0028 226  ARG A C   
758  O  O   . ARG A 150 ? 0.3601 0.3209 0.3014 -0.0415 0.0033  0.0000  226  ARG A O   
759  C  CB  . ARG A 150 ? 0.4034 0.3911 0.3572 -0.0373 0.0163  -0.0050 226  ARG A CB  
760  C  CG  . ARG A 150 ? 0.4702 0.4609 0.4177 -0.0395 0.0227  -0.0049 226  ARG A CG  
761  C  CD  . ARG A 150 ? 0.5292 0.5354 0.4875 -0.0393 0.0304  -0.0056 226  ARG A CD  
762  N  NE  . ARG A 150 ? 0.5486 0.5593 0.5123 -0.0320 0.0334  -0.0098 226  ARG A NE  
763  C  CZ  . ARG A 150 ? 0.5867 0.6077 0.5642 -0.0278 0.0348  -0.0112 226  ARG A CZ  
764  N  NH1 . ARG A 150 ? 0.5951 0.6246 0.5831 -0.0306 0.0333  -0.0085 226  ARG A NH1 
765  N  NH2 . ARG A 150 ? 0.6176 0.6394 0.5970 -0.0214 0.0375  -0.0149 226  ARG A NH2 
766  N  N   . LEU A 151 ? 0.3595 0.3292 0.3134 -0.0293 0.0024  -0.0055 227  LEU A N   
767  C  CA  . LEU A 151 ? 0.3242 0.2868 0.2785 -0.0278 -0.0018 -0.0053 227  LEU A CA  
768  C  C   . LEU A 151 ? 0.3649 0.3111 0.3064 -0.0266 -0.0061 -0.0027 227  LEU A C   
769  O  O   . LEU A 151 ? 0.3755 0.3102 0.3102 -0.0294 -0.0083 -0.0010 227  LEU A O   
770  C  CB  . LEU A 151 ? 0.3084 0.2769 0.2725 -0.0209 -0.0028 -0.0085 227  LEU A CB  
771  C  CG  . LEU A 151 ? 0.3010 0.2611 0.2640 -0.0180 -0.0066 -0.0087 227  LEU A CG  
772  C  CD1 . LEU A 151 ? 0.3188 0.2754 0.2800 -0.0248 -0.0071 -0.0075 227  LEU A CD1 
773  C  CD2 . LEU A 151 ? 0.2723 0.2399 0.2450 -0.0117 -0.0069 -0.0117 227  LEU A CD2 
774  N  N   . CYS A 152 ? 0.3820 0.3259 0.3190 -0.0225 -0.0075 -0.0020 228  CYS A N   
775  C  CA  . CYS A 152 ? 0.4066 0.3361 0.3321 -0.0200 -0.0116 0.0013  228  CYS A CA  
776  C  C   . CYS A 152 ? 0.4198 0.3376 0.3331 -0.0274 -0.0115 0.0047  228  CYS A C   
777  O  O   . CYS A 152 ? 0.4207 0.3226 0.3241 -0.0266 -0.0146 0.0072  228  CYS A O   
778  C  CB  . CYS A 152 ? 0.4071 0.3394 0.3306 -0.0159 -0.0135 0.0024  228  CYS A CB  
779  S  SG  . CYS A 152 ? 0.3934 0.3374 0.3294 -0.0078 -0.0149 -0.0005 228  CYS A SG  
780  N  N   . GLN A 153 ? 0.3966 0.3212 0.3096 -0.0347 -0.0076 0.0052  229  GLN A N   
781  C  CA  . GLN A 153 ? 0.4320 0.3468 0.3336 -0.0432 -0.0071 0.0089  229  GLN A CA  
782  C  C   . GLN A 153 ? 0.4114 0.3198 0.3126 -0.0479 -0.0083 0.0093  229  GLN A C   
783  O  O   . GLN A 153 ? 0.4105 0.3020 0.2982 -0.0523 -0.0108 0.0125  229  GLN A O   
784  C  CB  . GLN A 153 ? 0.4508 0.3772 0.3541 -0.0498 -0.0015 0.0092  229  GLN A CB  
785  C  CG  . GLN A 153 ? 0.4930 0.4202 0.3904 -0.0475 -0.0008 0.0093  229  GLN A CG  
786  C  CD  . GLN A 153 ? 0.5764 0.5154 0.4755 -0.0524 0.0062  0.0085  229  GLN A CD  
787  O  OE1 . GLN A 153 ? 0.6380 0.5807 0.5373 -0.0597 0.0100  0.0104  229  GLN A OE1 
788  N  NE2 . GLN A 153 ? 0.5659 0.5107 0.4660 -0.0485 0.0081  0.0058  229  GLN A NE2 
789  N  N   . LYS A 154 ? 0.3806 0.3010 0.2949 -0.0475 -0.0069 0.0063  230  LYS A N   
790  C  CA  . LYS A 154 ? 0.4123 0.3263 0.3252 -0.0523 -0.0090 0.0066  230  LYS A CA  
791  C  C   . LYS A 154 ? 0.4089 0.3031 0.3116 -0.0463 -0.0136 0.0063  230  LYS A C   
792  O  O   . LYS A 154 ? 0.4408 0.3176 0.3308 -0.0514 -0.0161 0.0082  230  LYS A O   
793  C  CB  . LYS A 154 ? 0.4131 0.3448 0.3423 -0.0521 -0.0072 0.0037  230  LYS A CB  
794  C  CG  . LYS A 154 ? 0.4491 0.4007 0.3891 -0.0573 -0.0020 0.0045  230  LYS A CG  
795  C  CD  . LYS A 154 ? 0.4340 0.4024 0.3903 -0.0550 -0.0007 0.0021  230  LYS A CD  
796  C  CE  . LYS A 154 ? 0.4333 0.3990 0.3896 -0.0617 -0.0043 0.0034  230  LYS A CE  
797  N  NZ  . LYS A 154 ? 0.4423 0.4111 0.3957 -0.0739 -0.0034 0.0079  230  LYS A NZ  
798  N  N   . LEU A 155 ? 0.3754 0.2715 0.2828 -0.0354 -0.0144 0.0041  231  LEU A N   
799  C  CA  . LEU A 155 ? 0.4185 0.2977 0.3173 -0.0279 -0.0176 0.0041  231  LEU A CA  
800  C  C   . LEU A 155 ? 0.4397 0.2994 0.3217 -0.0274 -0.0198 0.0082  231  LEU A C   
801  O  O   . LEU A 155 ? 0.4696 0.3084 0.3384 -0.0255 -0.0220 0.0092  231  LEU A O   
802  C  CB  . LEU A 155 ? 0.3532 0.2425 0.2625 -0.0168 -0.0176 0.0018  231  LEU A CB  
803  C  CG  . LEU A 155 ? 0.3278 0.2332 0.2519 -0.0162 -0.0158 -0.0022 231  LEU A CG  
804  C  CD1 . LEU A 155 ? 0.3545 0.2708 0.2882 -0.0070 -0.0156 -0.0037 231  LEU A CD1 
805  C  CD2 . LEU A 155 ? 0.3109 0.2067 0.2312 -0.0175 -0.0170 -0.0037 231  LEU A CD2 
806  N  N   . ASP A 156 ? 0.4081 0.2726 0.2887 -0.0290 -0.0192 0.0106  232  ASP A N   
807  C  CA  . ASP A 156 ? 0.4824 0.3288 0.3466 -0.0289 -0.0217 0.0152  232  ASP A CA  
808  C  C   . ASP A 156 ? 0.5168 0.3458 0.3666 -0.0393 -0.0222 0.0176  232  ASP A C   
809  O  O   . ASP A 156 ? 0.5620 0.3676 0.3953 -0.0375 -0.0249 0.0204  232  ASP A O   
810  C  CB  . ASP A 156 ? 0.5096 0.3659 0.3747 -0.0301 -0.0209 0.0173  232  ASP A CB  
811  C  CG  . ASP A 156 ? 0.5902 0.4307 0.4410 -0.0261 -0.0245 0.0223  232  ASP A CG  
812  O  OD1 . ASP A 156 ? 0.6107 0.4528 0.4645 -0.0156 -0.0271 0.0231  232  ASP A OD1 
813  O  OD2 . ASP A 156 ? 0.6372 0.4643 0.4740 -0.0336 -0.0249 0.0258  232  ASP A OD2 
814  N  N   . ALA A 157 ? 0.4991 0.3391 0.3545 -0.0504 -0.0196 0.0168  233  ALA A N   
815  C  CA  . ALA A 157 ? 0.5238 0.3495 0.3665 -0.0624 -0.0205 0.0194  233  ALA A CA  
816  C  C   . ALA A 157 ? 0.5170 0.3244 0.3513 -0.0613 -0.0235 0.0179  233  ALA A C   
817  O  O   . ALA A 157 ? 0.4973 0.2796 0.3124 -0.0661 -0.0260 0.0204  233  ALA A O   
818  C  CB  . ALA A 157 ? 0.5033 0.3496 0.3573 -0.0738 -0.0170 0.0195  233  ALA A CB  
819  N  N   . ALA A 158 ? 0.4804 0.2980 0.3269 -0.0551 -0.0231 0.0136  234  ALA A N   
820  C  CA  . ALA A 158 ? 0.4978 0.2970 0.3348 -0.0534 -0.0254 0.0116  234  ALA A CA  
821  C  C   . ALA A 158 ? 0.5219 0.2974 0.3441 -0.0417 -0.0271 0.0125  234  ALA A C   
822  O  O   . ALA A 158 ? 0.5220 0.2704 0.3252 -0.0430 -0.0291 0.0131  234  ALA A O   
823  C  CB  . ALA A 158 ? 0.4424 0.2589 0.2957 -0.0491 -0.0244 0.0071  234  ALA A CB  
824  N  N   . ALA A 159 ? 0.5203 0.3053 0.3504 -0.0301 -0.0263 0.0130  235  ALA A N   
825  C  CA  . ALA A 159 ? 0.5297 0.2962 0.3487 -0.0175 -0.0277 0.0149  235  ALA A CA  
826  C  C   . ALA A 159 ? 0.5669 0.3066 0.3636 -0.0216 -0.0298 0.0196  235  ALA A C   
827  O  O   . ALA A 159 ? 0.6240 0.3372 0.4037 -0.0152 -0.0310 0.0206  235  ALA A O   
828  C  CB  . ALA A 159 ? 0.5045 0.2902 0.3376 -0.0067 -0.0272 0.0157  235  ALA A CB  
829  N  N   . LEU A 160 ? 0.5692 0.3143 0.3646 -0.0320 -0.0299 0.0226  236  LEU A N   
830  C  CA  . LEU A 160 ? 0.5887 0.3086 0.3624 -0.0371 -0.0320 0.0276  236  LEU A CA  
831  C  C   . LEU A 160 ? 0.6273 0.3216 0.3826 -0.0469 -0.0334 0.0273  236  LEU A C   
832  O  O   . LEU A 160 ? 0.6282 0.2921 0.3609 -0.0467 -0.0355 0.0306  236  LEU A O   
833  C  CB  . LEU A 160 ? 0.6096 0.3428 0.3862 -0.0471 -0.0312 0.0308  236  LEU A CB  
834  C  CG  . LEU A 160 ? 0.6410 0.3914 0.4281 -0.0386 -0.0310 0.0322  236  LEU A CG  
835  C  CD1 . LEU A 160 ? 0.6382 0.3990 0.4249 -0.0495 -0.0294 0.0350  236  LEU A CD1 
836  C  CD2 . LEU A 160 ? 0.6766 0.4083 0.4518 -0.0258 -0.0342 0.0361  236  LEU A CD2 
837  N  N   . LYS A 161 ? 0.6060 0.3109 0.3693 -0.0559 -0.0326 0.0238  237  LYS A N   
838  C  CA  . LYS A 161 ? 0.6773 0.3585 0.4228 -0.0666 -0.0347 0.0234  237  LYS A CA  
839  C  C   . LYS A 161 ? 0.6756 0.3401 0.4139 -0.0571 -0.0351 0.0193  237  LYS A C   
840  O  O   . LYS A 161 ? 0.6840 0.3261 0.4051 -0.0656 -0.0371 0.0183  237  LYS A O   
841  C  CB  . LYS A 161 ? 0.7247 0.4265 0.4815 -0.0833 -0.0343 0.0229  237  LYS A CB  
842  C  CG  . LYS A 161 ? 0.7728 0.4844 0.5305 -0.0954 -0.0334 0.0277  237  LYS A CG  
843  C  CD  . LYS A 161 ? 0.8319 0.5653 0.6016 -0.1113 -0.0327 0.0281  237  LYS A CD  
844  C  CE  . LYS A 161 ? 0.8971 0.6378 0.6650 -0.1239 -0.0311 0.0334  237  LYS A CE  
845  N  NZ  . LYS A 161 ? 0.9083 0.6739 0.6901 -0.1386 -0.0297 0.0348  237  LYS A NZ  
846  N  N   . GLY A 162 ? 0.6077 0.2821 0.3575 -0.0404 -0.0332 0.0170  238  GLY A N   
847  C  CA  . GLY A 162 ? 0.6052 0.2655 0.3487 -0.0307 -0.0325 0.0131  238  GLY A CA  
848  C  C   . GLY A 162 ? 0.6407 0.3126 0.3927 -0.0385 -0.0325 0.0086  238  GLY A C   
849  O  O   . GLY A 162 ? 0.6660 0.3181 0.4047 -0.0363 -0.0327 0.0056  238  GLY A O   
850  N  N   . GLU A 163 ? 0.5965 0.2992 0.3690 -0.0474 -0.0322 0.0083  239  GLU A N   
851  C  CA  . GLU A 163 ? 0.6393 0.3563 0.4220 -0.0549 -0.0326 0.0050  239  GLU A CA  
852  C  C   . GLU A 163 ? 0.6063 0.3421 0.4067 -0.0419 -0.0301 0.0011  239  GLU A C   
853  O  O   . GLU A 163 ? 0.5989 0.3518 0.4137 -0.0318 -0.0280 0.0016  239  GLU A O   
854  C  CB  . GLU A 163 ? 0.6667 0.4096 0.4647 -0.0690 -0.0328 0.0071  239  GLU A CB  
855  C  CG  . GLU A 163 ? 0.7410 0.4696 0.5236 -0.0845 -0.0351 0.0114  239  GLU A CG  
856  C  CD  . GLU A 163 ? 0.8011 0.5595 0.6015 -0.0963 -0.0339 0.0140  239  GLU A CD  
857  O  OE1 . GLU A 163 ? 0.8046 0.5923 0.6279 -0.0908 -0.0311 0.0123  239  GLU A OE1 
858  O  OE2 . GLU A 163 ? 0.8468 0.5988 0.6376 -0.1110 -0.0356 0.0180  239  GLU A OE2 
859  N  N   . GLU A 164 ? 0.5897 0.3220 0.3882 -0.0430 -0.0308 -0.0025 240  GLU A N   
860  C  CA  . GLU A 164 ? 0.5659 0.3186 0.3822 -0.0336 -0.0286 -0.0060 240  GLU A CA  
861  C  C   . GLU A 164 ? 0.5279 0.3139 0.3677 -0.0407 -0.0283 -0.0058 240  GLU A C   
862  O  O   . GLU A 164 ? 0.5286 0.3213 0.3702 -0.0539 -0.0299 -0.0035 240  GLU A O   
863  C  CB  . GLU A 164 ? 0.6128 0.3486 0.4166 -0.0326 -0.0292 -0.0097 240  GLU A CB  
864  C  CG  . GLU A 164 ? 0.6821 0.3822 0.4603 -0.0244 -0.0284 -0.0101 240  GLU A CG  
865  C  CD  . GLU A 164 ? 0.7345 0.4124 0.4947 -0.0260 -0.0291 -0.0139 240  GLU A CD  
866  O  OE1 . GLU A 164 ? 0.7388 0.4273 0.5044 -0.0366 -0.0315 -0.0156 240  GLU A OE1 
867  O  OE2 . GLU A 164 ? 0.7719 0.4214 0.5120 -0.0162 -0.0270 -0.0151 240  GLU A OE2 
868  N  N   . VAL A 165 ? 0.4776 0.2846 0.3355 -0.0316 -0.0260 -0.0081 241  VAL A N   
869  C  CA  . VAL A 165 ? 0.4508 0.2878 0.3305 -0.0356 -0.0251 -0.0081 241  VAL A CA  
870  C  C   . VAL A 165 ? 0.4410 0.2892 0.3310 -0.0313 -0.0246 -0.0115 241  VAL A C   
871  O  O   . VAL A 165 ? 0.4643 0.3046 0.3505 -0.0211 -0.0234 -0.0137 241  VAL A O   
872  C  CB  . VAL A 165 ? 0.4498 0.3030 0.3419 -0.0298 -0.0225 -0.0067 241  VAL A CB  
873  C  CG1 . VAL A 165 ? 0.4555 0.3000 0.3380 -0.0361 -0.0230 -0.0029 241  VAL A CG1 
874  C  CG2 . VAL A 165 ? 0.4764 0.3275 0.3697 -0.0154 -0.0211 -0.0078 241  VAL A CG2 
875  N  N   . GLU A 166 ? 0.4159 0.2831 0.3189 -0.0388 -0.0253 -0.0114 242  GLU A N   
876  C  CA  . GLU A 166 ? 0.3988 0.2788 0.3128 -0.0356 -0.0252 -0.0140 242  GLU A CA  
877  C  C   . GLU A 166 ? 0.3772 0.2813 0.3110 -0.0294 -0.0220 -0.0142 242  GLU A C   
878  O  O   . GLU A 166 ? 0.3597 0.2810 0.3052 -0.0346 -0.0212 -0.0125 242  GLU A O   
879  C  CB  . GLU A 166 ? 0.4021 0.2867 0.3168 -0.0476 -0.0286 -0.0130 242  GLU A CB  
880  C  CG  . GLU A 166 ? 0.3935 0.2828 0.3122 -0.0451 -0.0297 -0.0155 242  GLU A CG  
881  C  CD  . GLU A 166 ? 0.3645 0.2779 0.3040 -0.0378 -0.0269 -0.0163 242  GLU A CD  
882  O  OE1 . GLU A 166 ? 0.3369 0.2704 0.2908 -0.0427 -0.0271 -0.0142 242  GLU A OE1 
883  O  OE2 . GLU A 166 ? 0.3490 0.2613 0.2901 -0.0272 -0.0244 -0.0186 242  GLU A OE2 
884  N  N   . MET A 167 ? 0.3759 0.2807 0.3127 -0.0182 -0.0200 -0.0161 243  MET A N   
885  C  CA  . MET A 167 ? 0.3439 0.2662 0.2948 -0.0128 -0.0174 -0.0161 243  MET A CA  
886  C  C   . MET A 167 ? 0.3432 0.2852 0.3098 -0.0137 -0.0165 -0.0172 243  MET A C   
887  O  O   . MET A 167 ? 0.3041 0.2602 0.2812 -0.0126 -0.0143 -0.0168 243  MET A O   
888  C  CB  . MET A 167 ? 0.3520 0.2703 0.3015 -0.0017 -0.0162 -0.0169 243  MET A CB  
889  C  CG  . MET A 167 ? 0.4189 0.3223 0.3565 0.0014  -0.0165 -0.0148 243  MET A CG  
890  S  SD  . MET A 167 ? 0.4288 0.3363 0.3667 -0.0051 -0.0165 -0.0117 243  MET A SD  
891  C  CE  . MET A 167 ? 0.3942 0.3256 0.3497 -0.0020 -0.0144 -0.0127 243  MET A CE  
892  N  N   . GLU A 168 ? 0.2940 0.2362 0.2612 -0.0154 -0.0181 -0.0184 244  GLU A N   
893  C  CA  . GLU A 168 ? 0.2743 0.2344 0.2560 -0.0150 -0.0175 -0.0189 244  GLU A CA  
894  C  C   . GLU A 168 ? 0.2965 0.2707 0.2875 -0.0216 -0.0168 -0.0166 244  GLU A C   
895  O  O   . GLU A 168 ? 0.2803 0.2689 0.2830 -0.0186 -0.0140 -0.0167 244  GLU A O   
896  C  CB  . GLU A 168 ? 0.2834 0.2400 0.2623 -0.0163 -0.0199 -0.0201 244  GLU A CB  
897  C  CG  . GLU A 168 ? 0.3173 0.2899 0.3097 -0.0135 -0.0193 -0.0207 244  GLU A CG  
898  C  CD  . GLU A 168 ? 0.3570 0.3254 0.3452 -0.0152 -0.0221 -0.0215 244  GLU A CD  
899  O  OE1 . GLU A 168 ? 0.3887 0.3474 0.3669 -0.0223 -0.0255 -0.0207 244  GLU A OE1 
900  O  OE2 . GLU A 168 ? 0.3514 0.3251 0.3448 -0.0100 -0.0213 -0.0228 244  GLU A OE2 
901  N  N   . SER A 169 ? 0.2984 0.2684 0.2837 -0.0307 -0.0190 -0.0142 245  SER A N   
902  C  CA  A SER A 169 ? 0.3026 0.2884 0.2977 -0.0370 -0.0178 -0.0112 245  SER A CA  
903  C  CA  B SER A 169 ? 0.3024 0.2882 0.2975 -0.0370 -0.0178 -0.0112 245  SER A CA  
904  C  C   . SER A 169 ? 0.2996 0.2894 0.2969 -0.0346 -0.0136 -0.0107 245  SER A C   
905  O  O   . SER A 169 ? 0.2765 0.2825 0.2853 -0.0343 -0.0102 -0.0096 245  SER A O   
906  C  CB  A SER A 169 ? 0.3240 0.3042 0.3114 -0.0487 -0.0214 -0.0082 245  SER A CB  
907  C  CB  B SER A 169 ? 0.3239 0.3043 0.3115 -0.0487 -0.0214 -0.0082 245  SER A CB  
908  O  OG  A SER A 169 ? 0.3258 0.3235 0.3238 -0.0550 -0.0198 -0.0044 245  SER A OG  
909  O  OG  B SER A 169 ? 0.3431 0.3033 0.3143 -0.0510 -0.0223 -0.0081 245  SER A OG  
910  N  N   . LEU A 170 ? 0.3104 0.2852 0.2961 -0.0324 -0.0136 -0.0113 246  LEU A N   
911  C  CA  . LEU A 170 ? 0.3201 0.2973 0.3059 -0.0305 -0.0104 -0.0107 246  LEU A CA  
912  C  C   . LEU A 170 ? 0.2900 0.2777 0.2852 -0.0225 -0.0074 -0.0130 246  LEU A C   
913  O  O   . LEU A 170 ? 0.2972 0.2947 0.2978 -0.0225 -0.0038 -0.0127 246  LEU A O   
914  C  CB  . LEU A 170 ? 0.3460 0.3045 0.3169 -0.0292 -0.0119 -0.0103 246  LEU A CB  
915  C  CG  . LEU A 170 ? 0.4058 0.3509 0.3642 -0.0382 -0.0142 -0.0075 246  LEU A CG  
916  C  CD1 . LEU A 170 ? 0.3992 0.3230 0.3418 -0.0345 -0.0159 -0.0072 246  LEU A CD1 
917  C  CD2 . LEU A 170 ? 0.4278 0.3835 0.3899 -0.0458 -0.0117 -0.0045 246  LEU A CD2 
918  N  N   . PHE A 171 ? 0.2788 0.2637 0.2750 -0.0161 -0.0087 -0.0154 247  PHE A N   
919  C  CA  . PHE A 171 ? 0.2772 0.2710 0.2814 -0.0099 -0.0065 -0.0174 247  PHE A CA  
920  C  C   . PHE A 171 ? 0.2781 0.2862 0.2938 -0.0106 -0.0041 -0.0175 247  PHE A C   
921  O  O   . PHE A 171 ? 0.3131 0.3279 0.3335 -0.0075 -0.0009 -0.0185 247  PHE A O   
922  C  CB  . PHE A 171 ? 0.2816 0.2705 0.2847 -0.0039 -0.0084 -0.0193 247  PHE A CB  
923  C  CG  . PHE A 171 ? 0.2866 0.2656 0.2815 0.0000  -0.0095 -0.0189 247  PHE A CG  
924  C  CD1 . PHE A 171 ? 0.2475 0.2265 0.2397 0.0001  -0.0086 -0.0178 247  PHE A CD1 
925  C  CD2 . PHE A 171 ? 0.2903 0.2603 0.2800 0.0041  -0.0112 -0.0193 247  PHE A CD2 
926  C  CE1 . PHE A 171 ? 0.2730 0.2447 0.2588 0.0041  -0.0102 -0.0166 247  PHE A CE1 
927  C  CE2 . PHE A 171 ? 0.3249 0.2875 0.3083 0.0092  -0.0118 -0.0182 247  PHE A CE2 
928  C  CZ  . PHE A 171 ? 0.3140 0.2782 0.2962 0.0092  -0.0117 -0.0165 247  PHE A CZ  
929  N  N   . SER A 172 ? 0.2637 0.2761 0.2834 -0.0144 -0.0058 -0.0162 248  SER A N   
930  C  CA  . SER A 172 ? 0.2576 0.2852 0.2894 -0.0145 -0.0037 -0.0152 248  SER A CA  
931  C  C   . SER A 172 ? 0.2498 0.2862 0.2851 -0.0169 0.0007  -0.0133 248  SER A C   
932  O  O   . SER A 172 ? 0.2535 0.2996 0.2965 -0.0128 0.0049  -0.0137 248  SER A O   
933  C  CB  . SER A 172 ? 0.2633 0.2946 0.2982 -0.0193 -0.0075 -0.0132 248  SER A CB  
934  O  OG  . SER A 172 ? 0.2805 0.3282 0.3284 -0.0185 -0.0059 -0.0112 248  SER A OG  
935  N  N   . ARG A 173 ? 0.2589 0.2909 0.2876 -0.0233 0.0002  -0.0112 249  ARG A N   
936  C  CA  . ARG A 173 ? 0.2613 0.3012 0.2919 -0.0259 0.0051  -0.0092 249  ARG A CA  
937  C  C   . ARG A 173 ? 0.2803 0.3161 0.3066 -0.0203 0.0089  -0.0119 249  ARG A C   
938  O  O   . ARG A 173 ? 0.2798 0.3243 0.3105 -0.0182 0.0145  -0.0119 249  ARG A O   
939  C  CB  . ARG A 173 ? 0.2736 0.3072 0.2958 -0.0348 0.0033  -0.0062 249  ARG A CB  
940  C  CG  . ARG A 173 ? 0.3353 0.3722 0.3597 -0.0428 -0.0009 -0.0032 249  ARG A CG  
941  C  CD  . ARG A 173 ? 0.3784 0.4371 0.4190 -0.0432 0.0012  -0.0006 249  ARG A CD  
942  N  NE  . ARG A 173 ? 0.4195 0.4831 0.4625 -0.0524 -0.0038 0.0031  249  ARG A NE  
943  C  CZ  . ARG A 173 ? 0.4782 0.5528 0.5248 -0.0618 -0.0034 0.0081  249  ARG A CZ  
944  N  NH1 . ARG A 173 ? 0.5037 0.5857 0.5522 -0.0625 0.0026  0.0098  249  ARG A NH1 
945  N  NH2 . ARG A 173 ? 0.5130 0.5915 0.5608 -0.0711 -0.0090 0.0115  249  ARG A NH2 
946  N  N   . LEU A 174 ? 0.2854 0.3079 0.3024 -0.0179 0.0061  -0.0139 250  LEU A N   
947  C  CA  . LEU A 174 ? 0.2571 0.2757 0.2690 -0.0140 0.0083  -0.0159 250  LEU A CA  
948  C  C   . LEU A 174 ? 0.2398 0.2650 0.2585 -0.0083 0.0114  -0.0184 250  LEU A C   
949  O  O   . LEU A 174 ? 0.2452 0.2722 0.2621 -0.0069 0.0160  -0.0194 250  LEU A O   
950  C  CB  . LEU A 174 ? 0.2684 0.2746 0.2717 -0.0119 0.0038  -0.0166 250  LEU A CB  
951  C  CG  . LEU A 174 ? 0.2838 0.2875 0.2831 -0.0082 0.0044  -0.0184 250  LEU A CG  
952  C  CD1 . LEU A 174 ? 0.2866 0.2880 0.2780 -0.0114 0.0071  -0.0173 250  LEU A CD1 
953  C  CD2 . LEU A 174 ? 0.2659 0.2623 0.2614 -0.0048 -0.0002 -0.0184 250  LEU A CD2 
954  N  N   . THR A 175 ? 0.2234 0.2504 0.2481 -0.0050 0.0090  -0.0195 251  THR A N   
955  C  CA  . THR A 175 ? 0.2399 0.2702 0.2691 0.0003  0.0114  -0.0218 251  THR A CA  
956  C  C   . THR A 175 ? 0.2440 0.2853 0.2815 0.0018  0.0165  -0.0208 251  THR A C   
957  O  O   . THR A 175 ? 0.2365 0.2779 0.2739 0.0062  0.0206  -0.0226 251  THR A O   
958  C  CB  . THR A 175 ? 0.2598 0.2884 0.2922 0.0030  0.0074  -0.0228 251  THR A CB  
959  O  OG1 . THR A 175 ? 0.2875 0.3206 0.3253 0.0006  0.0050  -0.0208 251  THR A OG1 
960  C  CG2 . THR A 175 ? 0.2637 0.2832 0.2887 0.0032  0.0036  -0.0235 251  THR A CG2 
961  N  N   . LEU A 176 ? 0.2495 0.2998 0.2938 -0.0018 0.0163  -0.0176 252  LEU A N   
962  C  CA  . LEU A 176 ? 0.2475 0.3116 0.3013 -0.0002 0.0217  -0.0154 252  LEU A CA  
963  C  C   . LEU A 176 ? 0.2691 0.3328 0.3173 -0.0000 0.0282  -0.0158 252  LEU A C   
964  O  O   . LEU A 176 ? 0.2619 0.3295 0.3124 0.0055  0.0344  -0.0168 252  LEU A O   
965  C  CB  . LEU A 176 ? 0.2429 0.3183 0.3048 -0.0061 0.0192  -0.0110 252  LEU A CB  
966  C  CG  . LEU A 176 ? 0.2636 0.3575 0.3379 -0.0047 0.0246  -0.0073 252  LEU A CG  
967  C  CD1 . LEU A 176 ? 0.2553 0.3553 0.3385 0.0039  0.0264  -0.0078 252  LEU A CD1 
968  C  CD2 . LEU A 176 ? 0.2208 0.3265 0.3021 -0.0132 0.0211  -0.0021 252  LEU A CD2 
969  N  N   . ASP A 177 ? 0.2591 0.3167 0.2985 -0.0058 0.0271  -0.0152 253  ASP A N   
970  C  CA  . ASP A 177 ? 0.2579 0.3139 0.2899 -0.0065 0.0331  -0.0154 253  ASP A CA  
971  C  C   . ASP A 177 ? 0.2561 0.3021 0.2795 -0.0011 0.0356  -0.0197 253  ASP A C   
972  O  O   . ASP A 177 ? 0.2914 0.3386 0.3119 0.0019  0.0427  -0.0207 253  ASP A O   
973  C  CB  . ASP A 177 ? 0.3007 0.3490 0.3228 -0.0138 0.0302  -0.0138 253  ASP A CB  
974  C  CG  . ASP A 177 ? 0.3648 0.4224 0.3927 -0.0209 0.0295  -0.0092 253  ASP A CG  
975  O  OD1 . ASP A 177 ? 0.3804 0.4524 0.4212 -0.0203 0.0307  -0.0070 253  ASP A OD1 
976  O  OD2 . ASP A 177 ? 0.3928 0.4433 0.4119 -0.0274 0.0273  -0.0073 253  ASP A OD2 
977  N  N   . ILE A 178 ? 0.2544 0.2903 0.2729 -0.0001 0.0301  -0.0221 254  ILE A N   
978  C  CA  . ILE A 178 ? 0.2714 0.2975 0.2809 0.0031  0.0313  -0.0257 254  ILE A CA  
979  C  C   . ILE A 178 ? 0.2862 0.3151 0.3006 0.0095  0.0361  -0.0275 254  ILE A C   
980  O  O   . ILE A 178 ? 0.2924 0.3158 0.2989 0.0122  0.0418  -0.0298 254  ILE A O   
981  C  CB  . ILE A 178 ? 0.2729 0.2911 0.2787 0.0023  0.0240  -0.0268 254  ILE A CB  
982  C  CG1 . ILE A 178 ? 0.2518 0.2643 0.2494 -0.0024 0.0202  -0.0252 254  ILE A CG1 
983  C  CG2 . ILE A 178 ? 0.2732 0.2836 0.2723 0.0050  0.0244  -0.0302 254  ILE A CG2 
984  C  CD1 . ILE A 178 ? 0.2283 0.2358 0.2245 -0.0020 0.0133  -0.0251 254  ILE A CD1 
985  N  N   . ILE A 179 ? 0.2513 0.2873 0.2773 0.0123  0.0340  -0.0264 255  ILE A N   
986  C  CA  . ILE A 179 ? 0.2533 0.2893 0.2826 0.0190  0.0373  -0.0279 255  ILE A CA  
987  C  C   . ILE A 179 ? 0.2476 0.2920 0.2814 0.0236  0.0459  -0.0266 255  ILE A C   
988  O  O   . ILE A 179 ? 0.2664 0.3047 0.2954 0.0297  0.0514  -0.0289 255  ILE A O   
989  C  CB  . ILE A 179 ? 0.2681 0.3089 0.3076 0.0206  0.0322  -0.0267 255  ILE A CB  
990  C  CG1 . ILE A 179 ? 0.2799 0.3152 0.3188 0.0270  0.0341  -0.0287 255  ILE A CG1 
991  C  CG2 . ILE A 179 ? 0.2481 0.3044 0.3011 0.0197  0.0319  -0.0224 255  ILE A CG2 
992  C  CD1 . ILE A 179 ? 0.2670 0.2870 0.2927 0.0259  0.0325  -0.0324 255  ILE A CD1 
993  N  N   . GLY A 180 ? 0.2390 0.2971 0.2813 0.0207  0.0475  -0.0227 256  GLY A N   
994  C  CA  . GLY A 180 ? 0.2809 0.3500 0.3289 0.0252  0.0563  -0.0207 256  GLY A CA  
995  C  C   . GLY A 180 ? 0.3160 0.3746 0.3494 0.0269  0.0637  -0.0238 256  GLY A C   
996  O  O   . GLY A 180 ? 0.3289 0.3885 0.3618 0.0344  0.0722  -0.0245 256  GLY A O   
997  N  N   . LYS A 181 ? 0.3155 0.3632 0.3360 0.0203  0.0607  -0.0256 257  LYS A N   
998  C  CA  . LYS A 181 ? 0.2892 0.3250 0.2931 0.0205  0.0666  -0.0286 257  LYS A CA  
999  C  C   . LYS A 181 ? 0.2741 0.2929 0.2660 0.0248  0.0669  -0.0335 257  LYS A C   
1000 O  O   . LYS A 181 ? 0.2976 0.3081 0.2790 0.0295  0.0749  -0.0362 257  LYS A O   
1001 C  CB  . LYS A 181 ? 0.3067 0.3364 0.3004 0.0117  0.0621  -0.0282 257  LYS A CB  
1002 C  CG  . LYS A 181 ? 0.3498 0.3678 0.3252 0.0103  0.0676  -0.0306 257  LYS A CG  
1003 C  CD  . LYS A 181 ? 0.3758 0.4037 0.3535 0.0132  0.0784  -0.0289 257  LYS A CD  
1004 C  CE  . LYS A 181 ? 0.4010 0.4171 0.3588 0.0101  0.0835  -0.0309 257  LYS A CE  
1005 N  NZ  . LYS A 181 ? 0.4602 0.4878 0.4208 0.0125  0.0947  -0.0285 257  LYS A NZ  
1006 N  N   . ALA A 182 ? 0.2745 0.2871 0.2666 0.0229  0.0586  -0.0347 258  ALA A N   
1007 C  CA  . ALA A 182 ? 0.2979 0.2940 0.2777 0.0248  0.0577  -0.0389 258  ALA A CA  
1008 C  C   . ALA A 182 ? 0.3431 0.3374 0.3258 0.0339  0.0638  -0.0401 258  ALA A C   
1009 O  O   . ALA A 182 ? 0.3390 0.3172 0.3069 0.0367  0.0677  -0.0438 258  ALA A O   
1010 C  CB  . ALA A 182 ? 0.2802 0.2735 0.2619 0.0205  0.0477  -0.0390 258  ALA A CB  
1011 N  N   . VAL A 183 ? 0.3360 0.3457 0.3365 0.0385  0.0643  -0.0366 259  VAL A N   
1012 C  CA  . VAL A 183 ? 0.3451 0.3534 0.3497 0.0478  0.0686  -0.0368 259  VAL A CA  
1013 C  C   . VAL A 183 ? 0.3587 0.3717 0.3638 0.0560  0.0801  -0.0361 259  VAL A C   
1014 O  O   . VAL A 183 ? 0.3890 0.3884 0.3837 0.0634  0.0864  -0.0389 259  VAL A O   
1015 C  CB  . VAL A 183 ? 0.2952 0.3174 0.3180 0.0491  0.0628  -0.0330 259  VAL A CB  
1016 C  CG1 . VAL A 183 ? 0.3322 0.3554 0.3608 0.0595  0.0675  -0.0320 259  VAL A CG1 
1017 C  CG2 . VAL A 183 ? 0.2431 0.2577 0.2629 0.0430  0.0531  -0.0344 259  VAL A CG2 
1018 N  N   . PHE A 184 ? 0.3402 0.3719 0.3568 0.0550  0.0834  -0.0321 260  PHE A N   
1019 C  CA  . PHE A 184 ? 0.3639 0.4034 0.3834 0.0637  0.0951  -0.0305 260  PHE A CA  
1020 C  C   . PHE A 184 ? 0.3722 0.4205 0.3899 0.0588  0.1002  -0.0289 260  PHE A C   
1021 O  O   . PHE A 184 ? 0.3640 0.4292 0.3922 0.0640  0.1085  -0.0251 260  PHE A O   
1022 C  CB  . PHE A 184 ? 0.3853 0.4456 0.4270 0.0715  0.0965  -0.0250 260  PHE A CB  
1023 C  CG  . PHE A 184 ? 0.3888 0.4664 0.4475 0.0642  0.0866  -0.0205 260  PHE A CG  
1024 C  CD1 . PHE A 184 ? 0.4118 0.4880 0.4768 0.0650  0.0789  -0.0199 260  PHE A CD1 
1025 C  CD2 . PHE A 184 ? 0.3918 0.4853 0.4586 0.0561  0.0852  -0.0167 260  PHE A CD2 
1026 C  CE1 . PHE A 184 ? 0.4045 0.4943 0.4826 0.0582  0.0701  -0.0162 260  PHE A CE1 
1027 C  CE2 . PHE A 184 ? 0.3772 0.4834 0.4567 0.0489  0.0761  -0.0129 260  PHE A CE2 
1028 C  CZ  . PHE A 184 ? 0.3963 0.5003 0.4811 0.0501  0.0687  -0.0128 260  PHE A CZ  
1029 N  N   . ASN A 185 ? 0.3575 0.3954 0.3622 0.0490  0.0954  -0.0312 261  ASN A N   
1030 C  CA  . ASN A 185 ? 0.4015 0.4416 0.3985 0.0441  0.1006  -0.0306 261  ASN A CA  
1031 C  C   . ASN A 185 ? 0.3836 0.4492 0.3993 0.0405  0.1012  -0.0240 261  ASN A C   
1032 O  O   . ASN A 185 ? 0.3742 0.4485 0.3894 0.0406  0.1096  -0.0219 261  ASN A O   
1033 C  CB  . ASN A 185 ? 0.4177 0.4475 0.4001 0.0517  0.1131  -0.0337 261  ASN A CB  
1034 C  CG  . ASN A 185 ? 0.4958 0.5206 0.4633 0.0453  0.1174  -0.0345 261  ASN A CG  
1035 O  OD1 . ASN A 185 ? 0.5167 0.5359 0.4772 0.0351  0.1093  -0.0347 261  ASN A OD1 
1036 N  ND2 . ASN A 185 ? 0.5099 0.5370 0.4723 0.0517  0.1303  -0.0345 261  ASN A ND2 
1037 N  N   . TYR A 186 ? 0.3449 0.4221 0.3761 0.0367  0.0924  -0.0207 262  TYR A N   
1038 C  CA  . TYR A 186 ? 0.3358 0.4351 0.3830 0.0311  0.0912  -0.0144 262  TYR A CA  
1039 C  C   . TYR A 186 ? 0.3353 0.4290 0.3774 0.0193  0.0815  -0.0139 262  TYR A C   
1040 O  O   . TYR A 186 ? 0.3468 0.4272 0.3831 0.0172  0.0732  -0.0168 262  TYR A O   
1041 C  CB  . TYR A 186 ? 0.3133 0.4308 0.3815 0.0356  0.0888  -0.0100 262  TYR A CB  
1042 C  CG  . TYR A 186 ? 0.3312 0.4743 0.4167 0.0300  0.0887  -0.0028 262  TYR A CG  
1043 C  CD1 . TYR A 186 ? 0.3496 0.5108 0.4434 0.0339  0.0992  0.0013  262  TYR A CD1 
1044 C  CD2 . TYR A 186 ? 0.3155 0.4644 0.4084 0.0205  0.0783  0.0002  262  TYR A CD2 
1045 C  CE1 . TYR A 186 ? 0.3711 0.5576 0.4813 0.0275  0.0988  0.0087  262  TYR A CE1 
1046 C  CE2 . TYR A 186 ? 0.3386 0.5098 0.4457 0.0138  0.0775  0.0071  262  TYR A CE2 
1047 C  CZ  . TYR A 186 ? 0.3739 0.5649 0.4904 0.0167  0.0875  0.0116  262  TYR A CZ  
1048 O  OH  . TYR A 186 ? 0.4140 0.6289 0.5453 0.0087  0.0863  0.0191  262  TYR A OH  
1049 N  N   . ASP A 187 ? 0.3466 0.4502 0.3905 0.0118  0.0829  -0.0100 263  ASP A N   
1050 C  CA  . ASP A 187 ? 0.3595 0.4569 0.3976 0.0009  0.0745  -0.0088 263  ASP A CA  
1051 C  C   . ASP A 187 ? 0.3230 0.4377 0.3775 -0.0047 0.0695  -0.0032 263  ASP A C   
1052 O  O   . ASP A 187 ? 0.3261 0.4565 0.3878 -0.0096 0.0732  0.0018  263  ASP A O   
1053 C  CB  . ASP A 187 ? 0.4270 0.5191 0.4515 -0.0048 0.0791  -0.0084 263  ASP A CB  
1054 C  CG  . ASP A 187 ? 0.5059 0.5783 0.5112 -0.0012 0.0821  -0.0140 263  ASP A CG  
1055 O  OD1 . ASP A 187 ? 0.5356 0.5919 0.5302 -0.0040 0.0744  -0.0169 263  ASP A OD1 
1056 O  OD2 . ASP A 187 ? 0.5306 0.6038 0.5312 0.0045  0.0923  -0.0154 263  ASP A OD2 
1057 N  N   . PHE A 188 ? 0.3125 0.4242 0.3722 -0.0047 0.0610  -0.0039 264  PHE A N   
1058 C  CA  . PHE A 188 ? 0.2874 0.4118 0.3591 -0.0113 0.0549  0.0010  264  PHE A CA  
1059 C  C   . PHE A 188 ? 0.3179 0.4377 0.3817 -0.0231 0.0510  0.0034  264  PHE A C   
1060 O  O   . PHE A 188 ? 0.3194 0.4533 0.3916 -0.0307 0.0499  0.0088  264  PHE A O   
1061 C  CB  . PHE A 188 ? 0.2948 0.4125 0.3691 -0.0095 0.0464  -0.0010 264  PHE A CB  
1062 C  CG  . PHE A 188 ? 0.2759 0.4019 0.3613 0.0003  0.0487  -0.0014 264  PHE A CG  
1063 C  CD1 . PHE A 188 ? 0.2672 0.4154 0.3700 0.0014  0.0503  0.0040  264  PHE A CD1 
1064 C  CD2 . PHE A 188 ? 0.2574 0.3692 0.3360 0.0078  0.0486  -0.0065 264  PHE A CD2 
1065 C  CE1 . PHE A 188 ? 0.2555 0.4105 0.3681 0.0112  0.0521  0.0043  264  PHE A CE1 
1066 C  CE2 . PHE A 188 ? 0.2554 0.3724 0.3426 0.0166  0.0504  -0.0066 264  PHE A CE2 
1067 C  CZ  . PHE A 188 ? 0.2411 0.3793 0.3452 0.0189  0.0522  -0.0012 264  PHE A CZ  
1068 N  N   . ASP A 189 ? 0.3576 0.4574 0.4048 -0.0250 0.0485  -0.0000 265  ASP A N   
1069 C  CA  . ASP A 189 ? 0.3746 0.4648 0.4113 -0.0350 0.0438  0.0019  265  ASP A CA  
1070 C  C   . ASP A 189 ? 0.3445 0.4355 0.3858 -0.0416 0.0355  0.0046  265  ASP A C   
1071 O  O   . ASP A 189 ? 0.3173 0.4085 0.3554 -0.0515 0.0331  0.0085  265  ASP A O   
1072 C  CB  . ASP A 189 ? 0.4600 0.5583 0.4942 -0.0409 0.0504  0.0057  265  ASP A CB  
1073 C  CG  . ASP A 189 ? 0.5652 0.6472 0.5830 -0.0492 0.0467  0.0066  265  ASP A CG  
1074 O  OD1 . ASP A 189 ? 0.5987 0.6623 0.6054 -0.0473 0.0411  0.0032  265  ASP A OD1 
1075 O  OD2 . ASP A 189 ? 0.5981 0.6863 0.6144 -0.0577 0.0491  0.0112  265  ASP A OD2 
1076 N  N   . SER A 190 ? 0.3130 0.4029 0.3602 -0.0366 0.0311  0.0024  266  SER A N   
1077 C  CA  . SER A 190 ? 0.3314 0.4197 0.3807 -0.0424 0.0231  0.0042  266  SER A CA  
1078 C  C   . SER A 190 ? 0.3447 0.4116 0.3778 -0.0477 0.0172  0.0031  266  SER A C   
1079 O  O   . SER A 190 ? 0.3391 0.4017 0.3697 -0.0549 0.0114  0.0051  266  SER A O   
1080 C  CB  . SER A 190 ? 0.2900 0.3799 0.3469 -0.0352 0.0202  0.0017  266  SER A CB  
1081 O  OG  . SER A 190 ? 0.2954 0.3680 0.3425 -0.0297 0.0178  -0.0032 266  SER A OG  
1082 N  N   . LEU A 191 ? 0.3347 0.3877 0.3561 -0.0443 0.0183  0.0002  267  LEU A N   
1083 C  CA  . LEU A 191 ? 0.3828 0.4163 0.3891 -0.0483 0.0133  0.0002  267  LEU A CA  
1084 C  C   . LEU A 191 ? 0.4386 0.4710 0.4387 -0.0592 0.0132  0.0048  267  LEU A C   
1085 O  O   . LEU A 191 ? 0.4621 0.4792 0.4512 -0.0647 0.0078  0.0059  267  LEU A O   
1086 C  CB  . LEU A 191 ? 0.3851 0.4070 0.3815 -0.0425 0.0144  -0.0028 267  LEU A CB  
1087 C  CG  . LEU A 191 ? 0.3647 0.3807 0.3618 -0.0339 0.0117  -0.0069 267  LEU A CG  
1088 C  CD1 . LEU A 191 ? 0.3393 0.3482 0.3280 -0.0298 0.0131  -0.0088 267  LEU A CD1 
1089 C  CD2 . LEU A 191 ? 0.3414 0.3450 0.3332 -0.0344 0.0051  -0.0070 267  LEU A CD2 
1090 N  N   . THR A 192 ? 0.4323 0.4800 0.4386 -0.0625 0.0194  0.0077  268  THR A N   
1091 C  CA  . THR A 192 ? 0.4910 0.5390 0.4913 -0.0736 0.0202  0.0125  268  THR A CA  
1092 C  C   . THR A 192 ? 0.5314 0.5975 0.5439 -0.0822 0.0197  0.0174  268  THR A C   
1093 O  O   . THR A 192 ? 0.5540 0.6139 0.5592 -0.0935 0.0156  0.0211  268  THR A O   
1094 C  CB  . THR A 192 ? 0.5201 0.5728 0.5170 -0.0728 0.0280  0.0132  268  THR A CB  
1095 O  OG1 . THR A 192 ? 0.5285 0.5643 0.5130 -0.0663 0.0273  0.0092  268  THR A OG1 
1096 C  CG2 . THR A 192 ? 0.5707 0.6231 0.5603 -0.0850 0.0290  0.0186  268  THR A CG2 
1097 N  N   . ASN A 193 ? 0.5353 0.6234 0.5656 -0.0773 0.0234  0.0179  269  ASN A N   
1098 C  CA  . ASN A 193 ? 0.5701 0.6807 0.6146 -0.0851 0.0238  0.0238  269  ASN A CA  
1099 C  C   . ASN A 193 ? 0.5523 0.6745 0.6111 -0.0801 0.0205  0.0233  269  ASN A C   
1100 O  O   . ASN A 193 ? 0.5412 0.6555 0.5999 -0.0698 0.0195  0.0183  269  ASN A O   
1101 C  CB  . ASN A 193 ? 0.6094 0.7418 0.6638 -0.0845 0.0337  0.0274  269  ASN A CB  
1102 C  CG  . ASN A 193 ? 0.6810 0.8031 0.7207 -0.0906 0.0372  0.0286  269  ASN A CG  
1103 O  OD1 . ASN A 193 ? 0.7193 0.8279 0.7467 -0.1016 0.0319  0.0309  269  ASN A OD1 
1104 N  ND2 . ASN A 193 ? 0.6836 0.8102 0.7227 -0.0836 0.0462  0.0270  269  ASN A ND2 
1105 N  N   . ASP A 194 ? 0.5571 0.6989 0.6282 -0.0883 0.0185  0.0292  270  ASP A N   
1106 C  CA  . ASP A 194 ? 0.5583 0.7174 0.6460 -0.0842 0.0162  0.0307  270  ASP A CA  
1107 C  C   . ASP A 194 ? 0.4937 0.6849 0.6016 -0.0820 0.0237  0.0363  270  ASP A C   
1108 O  O   . ASP A 194 ? 0.4782 0.6817 0.5885 -0.0907 0.0272  0.0416  270  ASP A O   
1109 C  CB  . ASP A 194 ? 0.6459 0.8016 0.7309 -0.0958 0.0060  0.0335  270  ASP A CB  
1110 C  CG  . ASP A 194 ? 0.7311 0.8575 0.7992 -0.0938 -0.0007 0.0274  270  ASP A CG  
1111 O  OD1 . ASP A 194 ? 0.7581 0.8803 0.8287 -0.0820 -0.0001 0.0227  270  ASP A OD1 
1112 O  OD2 . ASP A 194 ? 0.7790 0.8862 0.8308 -0.1037 -0.0060 0.0276  270  ASP A OD2 
1113 N  N   . THR A 195 ? 0.4329 0.6370 0.5547 -0.0699 0.0268  0.0355  271  THR A N   
1114 C  CA  . THR A 195 ? 0.3949 0.6297 0.5370 -0.0648 0.0346  0.0409  271  THR A CA  
1115 C  C   . THR A 195 ? 0.3376 0.5882 0.4959 -0.0599 0.0302  0.0435  271  THR A C   
1116 O  O   . THR A 195 ? 0.2758 0.5113 0.4280 -0.0588 0.0226  0.0399  271  THR A O   
1117 C  CB  . THR A 195 ? 0.4056 0.6383 0.5461 -0.0512 0.0460  0.0368  271  THR A CB  
1118 O  OG1 . THR A 195 ? 0.3979 0.6147 0.5338 -0.0394 0.0449  0.0302  271  THR A OG1 
1119 C  CG2 . THR A 195 ? 0.4190 0.6346 0.5417 -0.0560 0.0497  0.0341  271  THR A CG2 
1120 N  N   . GLY A 196 ? 0.3205 0.6024 0.4996 -0.0565 0.0355  0.0504  272  GLY A N   
1121 C  CA  . GLY A 196 ? 0.2963 0.5949 0.4920 -0.0496 0.0324  0.0535  272  GLY A CA  
1122 C  C   . GLY A 196 ? 0.2841 0.5671 0.4756 -0.0335 0.0350  0.0466  272  GLY A C   
1123 O  O   . GLY A 196 ? 0.2570 0.5386 0.4523 -0.0301 0.0286  0.0463  272  GLY A O   
1124 N  N   . VAL A 197 ? 0.2827 0.5527 0.4650 -0.0243 0.0442  0.0410  273  VAL A N   
1125 C  CA  . VAL A 197 ? 0.2769 0.5296 0.4527 -0.0105 0.0466  0.0342  273  VAL A CA  
1126 C  C   . VAL A 197 ? 0.2638 0.4900 0.4241 -0.0145 0.0372  0.0282  273  VAL A C   
1127 O  O   . VAL A 197 ? 0.2738 0.4932 0.4347 -0.0076 0.0337  0.0258  273  VAL A O   
1128 C  CB  . VAL A 197 ? 0.3326 0.5752 0.4988 -0.0022 0.0579  0.0295  273  VAL A CB  
1129 C  CG1 . VAL A 197 ? 0.3499 0.5728 0.5074 0.0102  0.0595  0.0226  273  VAL A CG1 
1130 C  CG2 . VAL A 197 ? 0.3373 0.6065 0.5185 0.0033  0.0687  0.0355  273  VAL A CG2 
1131 N  N   . ILE A 198 ? 0.2737 0.4843 0.4196 -0.0252 0.0332  0.0261  274  ILE A N   
1132 C  CA  . ILE A 198 ? 0.2801 0.4661 0.4112 -0.0285 0.0250  0.0209  274  ILE A CA  
1133 C  C   . ILE A 198 ? 0.3108 0.5026 0.4482 -0.0334 0.0157  0.0239  274  ILE A C   
1134 O  O   . ILE A 198 ? 0.3111 0.4910 0.4443 -0.0289 0.0113  0.0203  274  ILE A O   
1135 C  CB  . ILE A 198 ? 0.2985 0.4677 0.4133 -0.0384 0.0231  0.0191  274  ILE A CB  
1136 C  CG1 . ILE A 198 ? 0.3234 0.4818 0.4284 -0.0325 0.0309  0.0149  274  ILE A CG1 
1137 C  CG2 . ILE A 198 ? 0.2902 0.4376 0.3918 -0.0426 0.0141  0.0155  274  ILE A CG2 
1138 C  CD1 . ILE A 198 ? 0.3279 0.4776 0.4208 -0.0421 0.0312  0.0157  274  ILE A CD1 
1139 N  N   . GLU A 199 ? 0.3199 0.5305 0.4670 -0.0435 0.0125  0.0310  275  GLU A N   
1140 C  CA  . GLU A 199 ? 0.3484 0.5652 0.5005 -0.0497 0.0031  0.0344  275  GLU A CA  
1141 C  C   . GLU A 199 ? 0.3460 0.5754 0.5119 -0.0381 0.0036  0.0357  275  GLU A C   
1142 O  O   . GLU A 199 ? 0.3310 0.5541 0.4946 -0.0388 -0.0038 0.0350  275  GLU A O   
1143 C  CB  . GLU A 199 ? 0.3752 0.6119 0.5355 -0.0638 -0.0005 0.0425  275  GLU A CB  
1144 C  CG  . GLU A 199 ? 0.4292 0.6496 0.5729 -0.0767 -0.0024 0.0414  275  GLU A CG  
1145 C  CD  . GLU A 199 ? 0.4978 0.7391 0.6497 -0.0911 -0.0043 0.0499  275  GLU A CD  
1146 O  OE1 . GLU A 199 ? 0.5175 0.7868 0.6883 -0.0926 -0.0061 0.0570  275  GLU A OE1 
1147 O  OE2 . GLU A 199 ? 0.5453 0.7754 0.6847 -0.1013 -0.0043 0.0499  275  GLU A OE2 
1148 N  N   . ALA A 200 ? 0.3285 0.5737 0.5071 -0.0270 0.0127  0.0375  276  ALA A N   
1149 C  CA  . ALA A 200 ? 0.3065 0.5606 0.4965 -0.0145 0.0139  0.0387  276  ALA A CA  
1150 C  C   . ALA A 200 ? 0.3032 0.5308 0.4793 -0.0069 0.0127  0.0307  276  ALA A C   
1151 O  O   . ALA A 200 ? 0.2763 0.5029 0.4552 -0.0030 0.0077  0.0311  276  ALA A O   
1152 C  CB  . ALA A 200 ? 0.3173 0.5902 0.5210 -0.0030 0.0252  0.0418  276  ALA A CB  
1153 N  N   . VAL A 201 ? 0.2667 0.4733 0.4278 -0.0051 0.0170  0.0239  277  VAL A N   
1154 C  CA  . VAL A 201 ? 0.2737 0.4570 0.4222 0.0011  0.0158  0.0169  277  VAL A CA  
1155 C  C   . VAL A 201 ? 0.2816 0.4534 0.4224 -0.0062 0.0058  0.0157  277  VAL A C   
1156 O  O   . VAL A 201 ? 0.3238 0.4886 0.4631 -0.0012 0.0027  0.0139  277  VAL A O   
1157 C  CB  . VAL A 201 ? 0.2716 0.4369 0.4058 0.0027  0.0213  0.0108  277  VAL A CB  
1158 C  CG1 . VAL A 201 ? 0.3099 0.4529 0.4316 0.0068  0.0189  0.0044  277  VAL A CG1 
1159 C  CG2 . VAL A 201 ? 0.2726 0.4463 0.4119 0.0113  0.0318  0.0113  277  VAL A CG2 
1160 N  N   . TYR A 202 ? 0.2833 0.4518 0.4177 -0.0182 0.0009  0.0167  278  TYR A N   
1161 C  CA  . TYR A 202 ? 0.3066 0.4611 0.4307 -0.0248 -0.0078 0.0150  278  TYR A CA  
1162 C  C   . TYR A 202 ? 0.3138 0.4823 0.4478 -0.0272 -0.0142 0.0202  278  TYR A C   
1163 O  O   . TYR A 202 ? 0.3324 0.4896 0.4593 -0.0275 -0.0198 0.0180  278  TYR A O   
1164 C  CB  . TYR A 202 ? 0.3230 0.4668 0.4350 -0.0366 -0.0110 0.0147  278  TYR A CB  
1165 C  CG  . TYR A 202 ? 0.3485 0.4715 0.4461 -0.0338 -0.0075 0.0087  278  TYR A CG  
1166 C  CD1 . TYR A 202 ? 0.3702 0.4946 0.4663 -0.0349 -0.0019 0.0089  278  TYR A CD1 
1167 C  CD2 . TYR A 202 ? 0.3711 0.4746 0.4572 -0.0298 -0.0097 0.0033  278  TYR A CD2 
1168 C  CE1 . TYR A 202 ? 0.3694 0.4757 0.4525 -0.0325 0.0006  0.0041  278  TYR A CE1 
1169 C  CE2 . TYR A 202 ? 0.3770 0.4642 0.4516 -0.0270 -0.0070 -0.0012 278  TYR A CE2 
1170 C  CZ  . TYR A 202 ? 0.3812 0.4697 0.4543 -0.0284 -0.0023 -0.0007 278  TYR A CZ  
1171 O  OH  . TYR A 202 ? 0.3840 0.4571 0.4456 -0.0259 -0.0004 -0.0045 278  TYR A OH  
1172 N  N   . THR A 203 ? 0.3002 0.4943 0.4509 -0.0288 -0.0134 0.0273  279  THR A N   
1173 C  CA  . THR A 203 ? 0.3118 0.5220 0.4738 -0.0298 -0.0197 0.0331  279  THR A CA  
1174 C  C   . THR A 203 ? 0.3121 0.5188 0.4772 -0.0166 -0.0180 0.0311  279  THR A C   
1175 O  O   . THR A 203 ? 0.3201 0.5228 0.4825 -0.0176 -0.0248 0.0316  279  THR A O   
1176 C  CB  . THR A 203 ? 0.2975 0.5393 0.4794 -0.0322 -0.0181 0.0420  279  THR A CB  
1177 O  OG1 . THR A 203 ? 0.2971 0.5414 0.4750 -0.0466 -0.0206 0.0444  279  THR A OG1 
1178 C  CG2 . THR A 203 ? 0.3196 0.5802 0.5146 -0.0326 -0.0251 0.0489  279  THR A CG2 
1179 N  N   . VAL A 204 ? 0.2763 0.4826 0.4449 -0.0048 -0.0090 0.0287  280  VAL A N   
1180 C  CA  . VAL A 204 ? 0.2908 0.4905 0.4598 0.0075  -0.0069 0.0265  280  VAL A CA  
1181 C  C   . VAL A 204 ? 0.3061 0.4798 0.4577 0.0065  -0.0104 0.0195  280  VAL A C   
1182 O  O   . VAL A 204 ? 0.3204 0.4890 0.4707 0.0104  -0.0140 0.0194  280  VAL A O   
1183 C  CB  . VAL A 204 ? 0.2935 0.4952 0.4666 0.0192  0.0039  0.0250  280  VAL A CB  
1184 C  CG1 . VAL A 204 ? 0.3158 0.5003 0.4815 0.0296  0.0062  0.0202  280  VAL A CG1 
1185 C  CG2 . VAL A 204 ? 0.2721 0.5020 0.4652 0.0242  0.0077  0.0330  280  VAL A CG2 
1186 N  N   . LEU A 205 ? 0.3154 0.4728 0.4537 0.0016  -0.0093 0.0142  281  LEU A N   
1187 C  CA  . LEU A 205 ? 0.3661 0.5011 0.4890 0.0008  -0.0122 0.0083  281  LEU A CA  
1188 C  C   . LEU A 205 ? 0.3925 0.5246 0.5110 -0.0063 -0.0209 0.0098  281  LEU A C   
1189 O  O   . LEU A 205 ? 0.4186 0.5399 0.5307 -0.0032 -0.0233 0.0074  281  LEU A O   
1190 C  CB  . LEU A 205 ? 0.4031 0.5241 0.5140 -0.0034 -0.0100 0.0038  281  LEU A CB  
1191 C  CG  . LEU A 205 ? 0.4509 0.5605 0.5556 0.0036  -0.0036 -0.0013 281  LEU A CG  
1192 C  CD1 . LEU A 205 ? 0.4478 0.5613 0.5591 0.0138  0.0007  -0.0013 281  LEU A CD1 
1193 C  CD2 . LEU A 205 ? 0.4398 0.5516 0.5434 0.0008  0.0011  -0.0013 281  LEU A CD2 
1194 N  N   . ARG A 206 ? 0.3931 0.5340 0.5136 -0.0164 -0.0257 0.0139  282  ARG A N   
1195 C  CA  . ARG A 206 ? 0.4081 0.5444 0.5217 -0.0245 -0.0344 0.0153  282  ARG A CA  
1196 C  C   . ARG A 206 ? 0.3905 0.5377 0.5132 -0.0200 -0.0379 0.0193  282  ARG A C   
1197 O  O   . ARG A 206 ? 0.4092 0.5453 0.5225 -0.0215 -0.0429 0.0178  282  ARG A O   
1198 C  CB  . ARG A 206 ? 0.4526 0.5966 0.5662 -0.0375 -0.0390 0.0195  282  ARG A CB  
1199 C  CG  . ARG A 206 ? 0.4943 0.6323 0.5984 -0.0478 -0.0484 0.0211  282  ARG A CG  
1200 C  CD  . ARG A 206 ? 0.5251 0.6785 0.6347 -0.0605 -0.0533 0.0276  282  ARG A CD  
1201 N  NE  . ARG A 206 ? 0.5314 0.7136 0.6637 -0.0559 -0.0495 0.0340  282  ARG A NE  
1202 C  CZ  . ARG A 206 ? 0.5427 0.7461 0.6904 -0.0532 -0.0527 0.0404  282  ARG A CZ  
1203 N  NH1 . ARG A 206 ? 0.5512 0.7497 0.6932 -0.0558 -0.0604 0.0412  282  ARG A NH1 
1204 N  NH2 . ARG A 206 ? 0.5471 0.7765 0.7154 -0.0474 -0.0480 0.0461  282  ARG A NH2 
1205 N  N   . GLU A 207 ? 0.3641 0.5323 0.5043 -0.0138 -0.0350 0.0245  283  GLU A N   
1206 C  CA  . GLU A 207 ? 0.3625 0.5407 0.5116 -0.0077 -0.0379 0.0289  283  GLU A CA  
1207 C  C   . GLU A 207 ? 0.3702 0.5307 0.5109 0.0017  -0.0351 0.0236  283  GLU A C   
1208 O  O   . GLU A 207 ? 0.3881 0.5450 0.5259 0.0027  -0.0400 0.0248  283  GLU A O   
1209 C  CB  . GLU A 207 ? 0.3883 0.5924 0.5581 -0.0010 -0.0340 0.0358  283  GLU A CB  
1210 C  CG  . GLU A 207 ? 0.4082 0.6224 0.5881 0.0080  -0.0360 0.0408  283  GLU A CG  
1211 C  CD  . GLU A 207 ? 0.4274 0.6525 0.6102 -0.0006 -0.0470 0.0472  283  GLU A CD  
1212 O  OE1 . GLU A 207 ? 0.4383 0.6657 0.6169 -0.0141 -0.0528 0.0484  283  GLU A OE1 
1213 O  OE2 . GLU A 207 ? 0.4298 0.6598 0.6178 0.0058  -0.0501 0.0511  283  GLU A OE2 
1214 N  N   . ALA A 208 ? 0.3528 0.5022 0.4890 0.0079  -0.0275 0.0181  284  ALA A N   
1215 C  CA  . ALA A 208 ? 0.3260 0.4581 0.4531 0.0149  -0.0251 0.0131  284  ALA A CA  
1216 C  C   . ALA A 208 ? 0.3348 0.4502 0.4467 0.0086  -0.0302 0.0093  284  ALA A C   
1217 O  O   . ALA A 208 ? 0.3110 0.4175 0.4174 0.0119  -0.0316 0.0081  284  ALA A O   
1218 C  CB  . ALA A 208 ? 0.3275 0.4510 0.4512 0.0205  -0.0169 0.0081  284  ALA A CB  
1219 N  N   . GLU A 209 ? 0.3642 0.4742 0.4684 -0.0002 -0.0324 0.0075  285  GLU A N   
1220 C  CA  . GLU A 209 ? 0.4117 0.5056 0.5007 -0.0056 -0.0367 0.0043  285  GLU A CA  
1221 C  C   . GLU A 209 ? 0.4020 0.5001 0.4905 -0.0096 -0.0442 0.0083  285  GLU A C   
1222 O  O   . GLU A 209 ? 0.4368 0.5236 0.5158 -0.0086 -0.0461 0.0063  285  GLU A O   
1223 C  CB  . GLU A 209 ? 0.4834 0.5693 0.5631 -0.0137 -0.0375 0.0021  285  GLU A CB  
1224 C  CG  . GLU A 209 ? 0.5483 0.6254 0.6241 -0.0101 -0.0311 -0.0026 285  GLU A CG  
1225 C  CD  . GLU A 209 ? 0.6218 0.6846 0.6889 -0.0043 -0.0286 -0.0074 285  GLU A CD  
1226 O  OE1 . GLU A 209 ? 0.6399 0.7051 0.7124 0.0029  -0.0253 -0.0079 285  GLU A OE1 
1227 O  OE2 . GLU A 209 ? 0.6624 0.7112 0.7169 -0.0069 -0.0297 -0.0105 285  GLU A OE2 
1228 N  N   . ASP A 210 ? 0.3705 0.4859 0.4692 -0.0145 -0.0485 0.0146  286  ASP A N   
1229 C  CA  . ASP A 210 ? 0.4166 0.5378 0.5153 -0.0191 -0.0566 0.0194  286  ASP A CA  
1230 C  C   . ASP A 210 ? 0.4064 0.5294 0.5098 -0.0098 -0.0561 0.0210  286  ASP A C   
1231 O  O   . ASP A 210 ? 0.4052 0.5212 0.5001 -0.0120 -0.0613 0.0215  286  ASP A O   
1232 C  CB  . ASP A 210 ? 0.4688 0.6124 0.5807 -0.0259 -0.0612 0.0269  286  ASP A CB  
1233 C  CG  . ASP A 210 ? 0.5102 0.6500 0.6146 -0.0378 -0.0633 0.0260  286  ASP A CG  
1234 O  OD1 . ASP A 210 ? 0.5231 0.6420 0.6120 -0.0394 -0.0607 0.0194  286  ASP A OD1 
1235 O  OD2 . ASP A 210 ? 0.5315 0.6892 0.6454 -0.0455 -0.0677 0.0323  286  ASP A OD2 
1236 N  N   . ARG A 211 ? 0.3377 0.4683 0.4529 0.0006  -0.0498 0.0218  287  ARG A N   
1237 C  CA  . ARG A 211 ? 0.3258 0.4547 0.4434 0.0097  -0.0491 0.0232  287  ARG A CA  
1238 C  C   . ARG A 211 ? 0.2896 0.3967 0.3921 0.0118  -0.0466 0.0167  287  ARG A C   
1239 O  O   . ARG A 211 ? 0.3097 0.4118 0.4090 0.0156  -0.0483 0.0179  287  ARG A O   
1240 C  CB  . ARG A 211 ? 0.3756 0.5156 0.5074 0.0206  -0.0424 0.0255  287  ARG A CB  
1241 C  CG  . ARG A 211 ? 0.4297 0.5947 0.5789 0.0199  -0.0438 0.0328  287  ARG A CG  
1242 C  CD  . ARG A 211 ? 0.4574 0.6341 0.6204 0.0328  -0.0392 0.0374  287  ARG A CD  
1243 N  NE  . ARG A 211 ? 0.5234 0.7272 0.7049 0.0326  -0.0398 0.0451  287  ARG A NE  
1244 C  CZ  . ARG A 211 ? 0.5581 0.7788 0.7550 0.0431  -0.0377 0.0519  287  ARG A CZ  
1245 N  NH1 . ARG A 211 ? 0.5853 0.7959 0.7797 0.0545  -0.0353 0.0517  287  ARG A NH1 
1246 N  NH2 . ARG A 211 ? 0.5489 0.7969 0.7637 0.0423  -0.0380 0.0594  287  ARG A NH2 
1247 N  N   . SER A 212 ? 0.2831 0.3781 0.3764 0.0094  -0.0428 0.0105  288  SER A N   
1248 C  CA  . SER A 212 ? 0.3376 0.4149 0.4181 0.0110  -0.0405 0.0052  288  SER A CA  
1249 C  C   . SER A 212 ? 0.4043 0.4727 0.4721 0.0046  -0.0461 0.0048  288  SER A C   
1250 O  O   . SER A 212 ? 0.4387 0.4975 0.4988 0.0068  -0.0459 0.0034  288  SER A O   
1251 C  CB  . SER A 212 ? 0.3555 0.4245 0.4311 0.0107  -0.0351 -0.0004 288  SER A CB  
1252 O  OG  . SER A 212 ? 0.3519 0.4250 0.4355 0.0171  -0.0293 -0.0009 288  SER A OG  
1253 N  N   . VAL A 213 ? 0.4137 0.4841 0.4779 -0.0038 -0.0510 0.0060  289  VAL A N   
1254 C  CA  . VAL A 213 ? 0.4541 0.5135 0.5031 -0.0104 -0.0561 0.0052  289  VAL A CA  
1255 C  C   . VAL A 213 ? 0.4540 0.5211 0.5055 -0.0118 -0.0629 0.0110  289  VAL A C   
1256 O  O   . VAL A 213 ? 0.4152 0.4716 0.4535 -0.0147 -0.0661 0.0103  289  VAL A O   
1257 C  CB  . VAL A 213 ? 0.4923 0.5466 0.5329 -0.0194 -0.0585 0.0036  289  VAL A CB  
1258 C  CG1 . VAL A 213 ? 0.5277 0.5997 0.5812 -0.0242 -0.0622 0.0090  289  VAL A CG1 
1259 C  CG2 . VAL A 213 ? 0.5331 0.5732 0.5551 -0.0265 -0.0635 0.0023  289  VAL A CG2 
1260 N  N   . SER A 214 ? 0.4689 0.5544 0.5370 -0.0091 -0.0648 0.0171  290  SER A N   
1261 C  CA  . SER A 214 ? 0.4997 0.5954 0.5720 -0.0106 -0.0723 0.0240  290  SER A CA  
1262 C  C   . SER A 214 ? 0.5040 0.5896 0.5682 -0.0063 -0.0730 0.0240  290  SER A C   
1263 O  O   . SER A 214 ? 0.5094 0.5924 0.5646 -0.0121 -0.0801 0.0268  290  SER A O   
1264 C  CB  . SER A 214 ? 0.5106 0.6292 0.6045 -0.0052 -0.0721 0.0307  290  SER A CB  
1265 O  OG  . SER A 214 ? 0.5391 0.6691 0.6392 -0.0044 -0.0790 0.0383  290  SER A OG  
1266 N  N   . PRO A 215 ? 0.4934 0.5724 0.5588 0.0027  -0.0665 0.0214  291  PRO A N   
1267 C  CA  . PRO A 215 ? 0.4893 0.5585 0.5462 0.0057  -0.0675 0.0221  291  PRO A CA  
1268 C  C   . PRO A 215 ? 0.4722 0.5232 0.5102 0.0012  -0.0662 0.0164  291  PRO A C   
1269 O  O   . PRO A 215 ? 0.4806 0.5229 0.5106 0.0031  -0.0660 0.0166  291  PRO A O   
1270 C  CB  . PRO A 215 ? 0.4860 0.5543 0.5508 0.0162  -0.0607 0.0214  291  PRO A CB  
1271 C  CG  . PRO A 215 ? 0.4925 0.5710 0.5700 0.0189  -0.0562 0.0205  291  PRO A CG  
1272 C  CD  . PRO A 215 ? 0.4695 0.5488 0.5427 0.0099  -0.0583 0.0181  291  PRO A CD  
1273 N  N   . ILE A 216 ? 0.4481 0.4930 0.4784 -0.0043 -0.0648 0.0117  292  ILE A N   
1274 C  CA  . ILE A 216 ? 0.4595 0.4878 0.4736 -0.0060 -0.0610 0.0058  292  ILE A CA  
1275 C  C   . ILE A 216 ? 0.4899 0.5099 0.4878 -0.0144 -0.0669 0.0061  292  ILE A C   
1276 O  O   . ILE A 216 ? 0.4602 0.4827 0.4565 -0.0212 -0.0714 0.0069  292  ILE A O   
1277 C  CB  . ILE A 216 ? 0.4509 0.4755 0.4654 -0.0053 -0.0551 0.0004  292  ILE A CB  
1278 C  CG1 . ILE A 216 ? 0.4171 0.4489 0.4457 0.0021  -0.0496 0.0001  292  ILE A CG1 
1279 C  CG2 . ILE A 216 ? 0.4733 0.4826 0.4722 -0.0059 -0.0510 -0.0049 292  ILE A CG2 
1280 C  CD1 . ILE A 216 ? 0.4353 0.4630 0.4636 0.0077  -0.0466 0.0002  292  ILE A CD1 
1281 N  N   . PRO A 217 ? 0.5301 0.5392 0.5144 -0.0148 -0.0669 0.0053  293  PRO A N   
1282 C  CA  . PRO A 217 ? 0.5708 0.5692 0.5364 -0.0229 -0.0720 0.0049  293  PRO A CA  
1283 C  C   . PRO A 217 ? 0.6044 0.5892 0.5565 -0.0257 -0.0679 -0.0014 293  PRO A C   
1284 O  O   . PRO A 217 ? 0.6054 0.5870 0.5599 -0.0203 -0.0602 -0.0057 293  PRO A O   
1285 C  CB  . PRO A 217 ? 0.5766 0.5670 0.5319 -0.0210 -0.0710 0.0055  293  PRO A CB  
1286 C  CG  . PRO A 217 ? 0.5639 0.5547 0.5272 -0.0128 -0.0625 0.0029  293  PRO A CG  
1287 C  CD  . PRO A 217 ? 0.5189 0.5234 0.5023 -0.0087 -0.0618 0.0044  293  PRO A CD  
1288 N  N   . VAL A 218 ? 0.6751 0.6511 0.6119 -0.0344 -0.0733 -0.0017 294  VAL A N   
1289 C  CA  . VAL A 218 ? 0.7212 0.6807 0.6416 -0.0374 -0.0701 -0.0074 294  VAL A CA  
1290 C  C   . VAL A 218 ? 0.7593 0.7000 0.6543 -0.0413 -0.0708 -0.0097 294  VAL A C   
1291 O  O   . VAL A 218 ? 0.7312 0.6713 0.6183 -0.0481 -0.0785 -0.0060 294  VAL A O   
1292 C  CB  . VAL A 218 ? 0.7389 0.7011 0.6610 -0.0453 -0.0756 -0.0062 294  VAL A CB  
1293 C  CG1 . VAL A 218 ? 0.7384 0.7113 0.6633 -0.0538 -0.0864 0.0005  294  VAL A CG1 
1294 C  CG2 . VAL A 218 ? 0.7585 0.6984 0.6577 -0.0498 -0.0737 -0.0118 294  VAL A CG2 
1295 N  N   . TRP A 219 ? 0.7978 0.7238 0.6800 -0.0367 -0.0625 -0.0154 295  TRP A N   
1296 C  CA  . TRP A 219 ? 0.8571 0.7636 0.7134 -0.0390 -0.0610 -0.0184 295  TRP A CA  
1297 C  C   . TRP A 219 ? 0.8997 0.7885 0.7412 -0.0354 -0.0530 -0.0248 295  TRP A C   
1298 O  O   . TRP A 219 ? 0.9485 0.8188 0.7667 -0.0357 -0.0497 -0.0282 295  TRP A O   
1299 C  CB  . TRP A 219 ? 0.8462 0.7557 0.7029 -0.0342 -0.0575 -0.0170 295  TRP A CB  
1300 C  CG  . TRP A 219 ? 0.8278 0.7415 0.6941 -0.0241 -0.0471 -0.0196 295  TRP A CG  
1301 C  CD1 . TRP A 219 ? 0.8336 0.7365 0.6871 -0.0192 -0.0384 -0.0235 295  TRP A CD1 
1302 C  CD2 . TRP A 219 ? 0.7840 0.7145 0.6745 -0.0182 -0.0446 -0.0180 295  TRP A CD2 
1303 N  NE1 . TRP A 219 ? 0.8026 0.7164 0.6721 -0.0113 -0.0313 -0.0239 295  TRP A NE1 
1304 C  CE2 . TRP A 219 ? 0.7727 0.7022 0.6638 -0.0110 -0.0352 -0.0209 295  TRP A CE2 
1305 C  CE3 . TRP A 219 ? 0.7577 0.7039 0.6687 -0.0182 -0.0491 -0.0143 295  TRP A CE3 
1306 C  CZ2 . TRP A 219 ? 0.7528 0.6953 0.6630 -0.0053 -0.0312 -0.0202 295  TRP A CZ2 
1307 C  CZ3 . TRP A 219 ? 0.7279 0.6850 0.6564 -0.0116 -0.0442 -0.0142 295  TRP A CZ3 
1308 C  CH2 . TRP A 219 ? 0.7222 0.6769 0.6497 -0.0059 -0.0358 -0.0172 295  TRP A CH2 
1309 N  N   . SER A 228 ? 0.9582 1.3829 1.2367 -0.0610 -0.0942 0.1263  304  SER A N   
1310 C  CA  . SER A 228 ? 0.9417 1.3441 1.2105 -0.0548 -0.0881 0.1161  304  SER A CA  
1311 C  C   . SER A 228 ? 0.9501 1.3289 1.1964 -0.0719 -0.0945 0.1101  304  SER A C   
1312 O  O   . SER A 228 ? 0.9630 1.3251 1.1947 -0.0769 -0.1023 0.1077  304  SER A O   
1313 C  CB  . SER A 228 ? 0.9314 1.3435 1.2131 -0.0435 -0.0752 0.1147  304  SER A CB  
1314 O  OG  . SER A 228 ? 0.9258 1.3174 1.1985 -0.0375 -0.0692 0.1054  304  SER A OG  
1315 N  N   . PRO A 229 ? 0.9474 1.3226 1.1889 -0.0810 -0.0913 0.1075  305  PRO A N   
1316 C  CA  . PRO A 229 ? 0.9329 1.3171 1.1825 -0.0797 -0.0821 0.1069  305  PRO A CA  
1317 C  C   . PRO A 229 ? 0.9065 1.2734 1.1508 -0.0710 -0.0741 0.0978  305  PRO A C   
1318 O  O   . PRO A 229 ? 0.9073 1.2823 1.1611 -0.0634 -0.0641 0.0969  305  PRO A O   
1319 C  CB  . PRO A 229 ? 0.9502 1.3297 1.1874 -0.1001 -0.0883 0.1085  305  PRO A CB  
1320 C  CG  . PRO A 229 ? 0.9640 1.3174 1.1789 -0.1095 -0.0975 0.1037  305  PRO A CG  
1321 C  CD  . PRO A 229 ? 0.9629 1.3189 1.1825 -0.0995 -0.1010 0.1054  305  PRO A CD  
1322 N  N   . ARG A 230 ? 0.8676 1.2109 1.0962 -0.0723 -0.0786 0.0913  306  ARG A N   
1323 C  CA  . ARG A 230 ? 0.8090 1.1362 1.0324 -0.0643 -0.0720 0.0831  306  ARG A CA  
1324 C  C   . ARG A 230 ? 0.7511 1.0868 0.9889 -0.0441 -0.0631 0.0830  306  ARG A C   
1325 O  O   . ARG A 230 ? 0.7412 1.0751 0.9825 -0.0357 -0.0534 0.0792  306  ARG A O   
1326 C  CB  . ARG A 230 ? 0.8120 1.1128 1.0151 -0.0704 -0.0794 0.0769  306  ARG A CB  
1327 N  N   . GLN A 231 ? 0.6882 1.0314 0.9329 -0.0361 -0.0660 0.0873  307  GLN A N   
1328 C  CA  . GLN A 231 ? 0.6298 0.9783 0.8860 -0.0167 -0.0575 0.0875  307  GLN A CA  
1329 C  C   . GLN A 231 ? 0.5967 0.9638 0.8678 -0.0096 -0.0474 0.0907  307  GLN A C   
1330 O  O   . GLN A 231 ? 0.5667 0.9319 0.8427 0.0055  -0.0373 0.0880  307  GLN A O   
1331 C  CB  . GLN A 231 ? 0.6106 0.9639 0.8706 -0.0109 -0.0634 0.0925  307  GLN A CB  
1332 N  N   . ARG A 232 ? 0.5769 0.9609 0.8538 -0.0206 -0.0497 0.0963  308  ARG A N   
1333 C  CA  . ARG A 232 ? 0.5426 0.9448 0.8329 -0.0154 -0.0401 0.0996  308  ARG A CA  
1334 C  C   . ARG A 232 ? 0.5232 0.9160 0.8071 -0.0184 -0.0328 0.0935  308  ARG A C   
1335 O  O   . ARG A 232 ? 0.5177 0.9155 0.8083 -0.0075 -0.0215 0.0923  308  ARG A O   
1336 C  CB  . ARG A 232 ? 0.5297 0.9545 0.8288 -0.0265 -0.0455 0.1086  308  ARG A CB  
1337 N  N   . LYS A 233 ? 0.4951 0.8731 0.7646 -0.0331 -0.0389 0.0897  309  LYS A N   
1338 C  CA  . LYS A 233 ? 0.4324 0.7993 0.6944 -0.0360 -0.0326 0.0838  309  LYS A CA  
1339 C  C   . LYS A 233 ? 0.4028 0.7557 0.6621 -0.0210 -0.0248 0.0769  309  LYS A C   
1340 O  O   . LYS A 233 ? 0.3737 0.7238 0.6323 -0.0166 -0.0154 0.0733  309  LYS A O   
1341 C  CB  . LYS A 233 ? 0.4336 0.7840 0.6786 -0.0542 -0.0416 0.0808  309  LYS A CB  
1342 N  N   . VAL A 234 ? 0.3915 0.7347 0.6480 -0.0133 -0.0285 0.0751  310  VAL A N   
1343 C  CA  . VAL A 234 ? 0.3802 0.7076 0.6322 0.0015  -0.0211 0.0687  310  VAL A CA  
1344 C  C   . VAL A 234 ? 0.3954 0.7339 0.6592 0.0176  -0.0096 0.0705  310  VAL A C   
1345 O  O   . VAL A 234 ? 0.4020 0.7324 0.6625 0.0257  0.0004  0.0657  310  VAL A O   
1346 C  CB  . VAL A 234 ? 0.3636 0.6741 0.6063 0.0049  -0.0279 0.0662  310  VAL A CB  
1347 C  CG1 . VAL A 234 ? 0.3321 0.6246 0.5689 0.0213  -0.0197 0.0601  310  VAL A CG1 
1348 C  CG2 . VAL A 234 ? 0.3717 0.6580 0.5934 -0.0088 -0.0360 0.0602  310  VAL A CG2 
1349 N  N   . ALA A 235 ? 0.3852 0.7398 0.6603 0.0223  -0.0109 0.0771  311  ALA A N   
1350 C  CA  . ALA A 235 ? 0.3706 0.7331 0.6547 0.0378  -0.0002 0.0786  311  ALA A CA  
1351 C  C   . ALA A 235 ? 0.3551 0.7260 0.6423 0.0364  0.0093  0.0782  311  ALA A C   
1352 O  O   . ALA A 235 ? 0.3576 0.7231 0.6438 0.0489  0.0205  0.0748  311  ALA A O   
1353 C  CB  . ALA A 235 ? 0.3599 0.7410 0.6567 0.0412  -0.0043 0.0869  311  ALA A CB  
1354 N  N   . THR A 236 ? 0.3313 0.7137 0.6204 0.0207  0.0048  0.0814  312  THR A N   
1355 C  CA  . THR A 236 ? 0.3370 0.7268 0.6278 0.0175  0.0132  0.0813  312  THR A CA  
1356 C  C   . THR A 236 ? 0.2944 0.6642 0.5722 0.0190  0.0195  0.0729  312  THR A C   
1357 O  O   . THR A 236 ? 0.2837 0.6524 0.5608 0.0269  0.0309  0.0705  312  THR A O   
1358 C  CB  . THR A 236 ? 0.3734 0.7770 0.6666 -0.0011 0.0058  0.0867  312  THR A CB  
1359 O  OG1 . THR A 236 ? 0.4215 0.8471 0.7283 -0.0012 0.0021  0.0953  312  THR A OG1 
1360 C  CG2 . THR A 236 ? 0.3869 0.7946 0.6789 -0.0063 0.0138  0.0860  312  THR A CG2 
1361 N  N   . SER A 237 ? 0.2591 0.6126 0.5259 0.0115  0.0123  0.0687  313  SER A N   
1362 C  CA  . SER A 237 ? 0.2527 0.5807 0.5023 0.0125  0.0173  0.0596  313  SER A CA  
1363 C  C   . SER A 237 ? 0.2664 0.5806 0.5118 0.0303  0.0264  0.0543  313  SER A C   
1364 O  O   . SER A 237 ? 0.2820 0.5833 0.5176 0.0346  0.0354  0.0488  313  SER A O   
1365 C  CB  . SER A 237 ? 0.2721 0.5743 0.5032 0.0018  0.0069  0.0538  313  SER A CB  
1366 O  OG  . SER A 237 ? 0.2707 0.5802 0.5012 -0.0154 -0.0008 0.0576  313  SER A OG  
1367 N  N   . LEU A 238 ? 0.2640 0.5793 0.5150 0.0403  0.0241  0.0561  314  LEU A N   
1368 C  CA  . LEU A 238 ? 0.2820 0.5831 0.5281 0.0571  0.0326  0.0518  314  LEU A CA  
1369 C  C   . LEU A 238 ? 0.3064 0.6177 0.5588 0.0669  0.0446  0.0534  314  LEU A C   
1370 O  O   . LEU A 238 ? 0.3264 0.6218 0.5686 0.0764  0.0542  0.0477  314  LEU A O   
1371 C  CB  . LEU A 238 ? 0.2881 0.5886 0.5387 0.0651  0.0271  0.0546  314  LEU A CB  
1372 C  CG  . LEU A 238 ? 0.3045 0.5814 0.5403 0.0599  0.0179  0.0494  314  LEU A CG  
1373 C  CD1 . LEU A 238 ? 0.3259 0.6068 0.5688 0.0690  0.0138  0.0539  314  LEU A CD1 
1374 C  CD2 . LEU A 238 ? 0.3064 0.5515 0.5212 0.0622  0.0227  0.0389  314  LEU A CD2 
1375 N  N   . LYS A 239 ? 0.3056 0.6402 0.5718 0.0639  0.0437  0.0606  315  LYS A N   
1376 C  CA  . LYS A 239 ? 0.3275 0.6715 0.5988 0.0725  0.0548  0.0623  315  LYS A CA  
1377 C  C   . LYS A 239 ? 0.2888 0.6291 0.5526 0.0681  0.0631  0.0584  315  LYS A C   
1378 O  O   . LYS A 239 ? 0.2843 0.6161 0.5417 0.0783  0.0743  0.0547  315  LYS A O   
1379 C  CB  . LYS A 239 ? 0.3809 0.7532 0.6697 0.0688  0.0512  0.0717  315  LYS A CB  
1380 C  CG  . LYS A 239 ? 0.4473 0.8336 0.7433 0.0758  0.0623  0.0744  315  LYS A CG  
1381 C  CD  . LYS A 239 ? 0.4974 0.8775 0.7937 0.0944  0.0696  0.0738  315  LYS A CD  
1382 C  CE  . LYS A 239 ? 0.5208 0.9154 0.8241 0.1015  0.0810  0.0767  315  LYS A CE  
1383 N  NZ  . LYS A 239 ? 0.5266 0.9513 0.8458 0.0900  0.0774  0.0852  315  LYS A NZ  
1384 N  N   . LEU A 240 ? 0.2567 0.6017 0.5194 0.0524  0.0574  0.0592  316  LEU A N   
1385 C  CA  . LEU A 240 ? 0.2715 0.6135 0.5266 0.0469  0.0647  0.0564  316  LEU A CA  
1386 C  C   . LEU A 240 ? 0.2676 0.5823 0.5048 0.0543  0.0708  0.0473  316  LEU A C   
1387 O  O   . LEU A 240 ? 0.2762 0.5847 0.5056 0.0592  0.0816  0.0440  316  LEU A O   
1388 C  CB  . LEU A 240 ? 0.2664 0.6159 0.5219 0.0277  0.0560  0.0591  316  LEU A CB  
1389 C  CG  . LEU A 240 ? 0.2647 0.6076 0.5093 0.0198  0.0619  0.0562  316  LEU A CG  
1390 C  CD1 . LEU A 240 ? 0.2780 0.6382 0.5309 0.0254  0.0733  0.0599  316  LEU A CD1 
1391 C  CD2 . LEU A 240 ? 0.2525 0.5939 0.4918 0.0001  0.0516  0.0578  316  LEU A CD2 
1392 N  N   . ILE A 241 ? 0.2558 0.5469 0.4810 0.0535  0.0628  0.0417  317  ILE A N   
1393 C  CA  . ILE A 241 ? 0.2752 0.5335 0.4785 0.0580  0.0659  0.0318  317  ILE A CA  
1394 C  C   . ILE A 241 ? 0.3059 0.5590 0.5080 0.0754  0.0768  0.0302  317  ILE A C   
1395 O  O   . ILE A 241 ? 0.3342 0.5697 0.5212 0.0795  0.0850  0.0241  317  ILE A O   
1396 C  CB  . ILE A 241 ? 0.2737 0.5111 0.4661 0.0529  0.0549  0.0273  317  ILE A CB  
1397 C  CG1 . ILE A 241 ? 0.2977 0.5365 0.4880 0.0363  0.0451  0.0283  317  ILE A CG1 
1398 C  CG2 . ILE A 241 ? 0.2834 0.4896 0.4548 0.0570  0.0577  0.0180  317  ILE A CG2 
1399 C  CD1 . ILE A 241 ? 0.2779 0.5026 0.4615 0.0316  0.0342  0.0259  317  ILE A CD1 
1400 N  N   . ASN A 242 ? 0.2889 0.5562 0.5057 0.0860  0.0771  0.0356  318  ASN A N   
1401 C  CA  . ASN A 242 ? 0.3375 0.5924 0.5480 0.1011  0.0857  0.0329  318  ASN A CA  
1402 C  C   . ASN A 242 ? 0.3522 0.6149 0.5630 0.1045  0.0968  0.0335  318  ASN A C   
1403 O  O   . ASN A 242 ? 0.3462 0.5898 0.5422 0.1131  0.1060  0.0278  318  ASN A O   
1404 C  CB  . ASN A 242 ? 0.3796 0.6421 0.6009 0.1080  0.0806  0.0379  318  ASN A CB  
1405 C  CG  . ASN A 242 ? 0.4304 0.6742 0.6441 0.1103  0.0735  0.0349  318  ASN A CG  
1406 O  OD1 . ASN A 242 ? 0.4193 0.6383 0.6162 0.1125  0.0759  0.0278  318  ASN A OD1 
1407 N  ND2 . ASN A 242 ? 0.4974 0.7529 0.7225 0.1093  0.0646  0.0405  318  ASN A ND2 
1408 N  N   . ASP A 243 ? 0.3448 0.6346 0.5711 0.0971  0.0959  0.0404  319  ASP A N   
1409 C  CA  . ASP A 243 ? 0.3763 0.6751 0.6032 0.0991  0.1065  0.0413  319  ASP A CA  
1410 C  C   . ASP A 243 ? 0.3611 0.6439 0.5708 0.0946  0.1129  0.0349  319  ASP A C   
1411 O  O   . ASP A 243 ? 0.3866 0.6593 0.5854 0.1016  0.1237  0.0311  319  ASP A O   
1412 C  CB  . ASP A 243 ? 0.4092 0.7399 0.6554 0.0897  0.1032  0.0502  319  ASP A CB  
1413 C  CG  . ASP A 243 ? 0.4520 0.8006 0.7148 0.0962  0.0997  0.0572  319  ASP A CG  
1414 O  OD1 . ASP A 243 ? 0.4647 0.8026 0.7243 0.1105  0.1039  0.0554  319  ASP A OD1 
1415 O  OD2 . ASP A 243 ? 0.4529 0.8255 0.7311 0.0865  0.0927  0.0647  319  ASP A OD2 
1416 N  N   . THR A 244 ? 0.3227 0.6026 0.5289 0.0828  0.1061  0.0339  320  THR A N   
1417 C  CA  . THR A 244 ? 0.3317 0.5927 0.5187 0.0769  0.1099  0.0275  320  THR A CA  
1418 C  C   . THR A 244 ? 0.3385 0.5675 0.5042 0.0869  0.1150  0.0186  320  THR A C   
1419 O  O   . THR A 244 ? 0.3457 0.5619 0.4964 0.0895  0.1243  0.0143  320  THR A O   
1420 C  CB  . THR A 244 ? 0.3306 0.5826 0.5113 0.0600  0.0966  0.0258  320  THR A CB  
1421 O  OG1 . THR A 244 ? 0.3576 0.6369 0.5548 0.0492  0.0924  0.0338  320  THR A OG1 
1422 C  CG2 . THR A 244 ? 0.3494 0.5766 0.5072 0.0533  0.0979  0.0186  320  THR A CG2 
1423 N  N   . LEU A 245 ? 0.3131 0.5281 0.4760 0.0920  0.1089  0.0161  321  LEU A N   
1424 C  CA  . LEU A 245 ? 0.3399 0.5244 0.4825 0.1008  0.1131  0.0083  321  LEU A CA  
1425 C  C   . LEU A 245 ? 0.3607 0.5439 0.5006 0.1146  0.1257  0.0081  321  LEU A C   
1426 O  O   . LEU A 245 ? 0.3785 0.5379 0.4974 0.1184  0.1328  0.0015  321  LEU A O   
1427 C  CB  . LEU A 245 ? 0.3371 0.5095 0.4790 0.1031  0.1040  0.0070  321  LEU A CB  
1428 C  CG  . LEU A 245 ? 0.3069 0.4713 0.4447 0.0890  0.0905  0.0048  321  LEU A CG  
1429 C  CD1 . LEU A 245 ? 0.2928 0.4487 0.4317 0.0926  0.0830  0.0045  321  LEU A CD1 
1430 C  CD2 . LEU A 245 ? 0.3405 0.4806 0.4563 0.0814  0.0899  -0.0027 321  LEU A CD2 
1431 N  N   . ASP A 246 ? 0.3395 0.5441 0.4973 0.1196  0.1260  0.0146  322  ASP A N   
1432 C  CA  . ASP A 246 ? 0.3606 0.5622 0.5147 0.1309  0.1358  0.0142  322  ASP A CA  
1433 C  C   . ASP A 246 ? 0.3784 0.5791 0.5226 0.1286  0.1459  0.0118  322  ASP A C   
1434 O  O   . ASP A 246 ? 0.3955 0.5769 0.5227 0.1364  0.1545  0.0067  322  ASP A O   
1435 C  CB  . ASP A 246 ? 0.3772 0.6063 0.5545 0.1357  0.1343  0.0228  322  ASP A CB  
1436 C  CG  . ASP A 246 ? 0.4263 0.6482 0.6067 0.1438  0.1283  0.0240  322  ASP A CG  
1437 O  OD1 . ASP A 246 ? 0.4428 0.6356 0.6050 0.1490  0.1288  0.0176  322  ASP A OD1 
1438 O  OD2 . ASP A 246 ? 0.4297 0.6747 0.6299 0.1443  0.1230  0.0316  322  ASP A OD2 
1439 N  N   . ASP A 247 ? 0.4024 0.6227 0.5557 0.1172  0.1447  0.0154  323  ASP A N   
1440 C  CA  . ASP A 247 ? 0.4487 0.6680 0.5916 0.1136  0.1540  0.0135  323  ASP A CA  
1441 C  C   . ASP A 247 ? 0.4325 0.6186 0.5472 0.1128  0.1570  0.0044  323  ASP A C   
1442 O  O   . ASP A 247 ? 0.4212 0.5930 0.5191 0.1169  0.1663  0.0000  323  ASP A O   
1443 C  CB  . ASP A 247 ? 0.5040 0.7486 0.6606 0.0997  0.1507  0.0196  323  ASP A CB  
1444 C  CG  . ASP A 247 ? 0.5784 0.8558 0.7612 0.0987  0.1479  0.0288  323  ASP A CG  
1445 O  OD1 . ASP A 247 ? 0.6072 0.8900 0.7968 0.1101  0.1520  0.0306  323  ASP A OD1 
1446 O  OD2 . ASP A 247 ? 0.6059 0.9030 0.8013 0.0860  0.1412  0.0344  323  ASP A OD2 
1447 N  N   . LEU A 248 ? 0.4023 0.5755 0.5110 0.1073  0.1491  0.0016  324  LEU A N   
1448 C  CA  . LEU A 248 ? 0.4087 0.5492 0.4900 0.1045  0.1495  -0.0069 324  LEU A CA  
1449 C  C   . LEU A 248 ? 0.4034 0.5174 0.4671 0.1159  0.1543  -0.0130 324  LEU A C   
1450 O  O   . LEU A 248 ? 0.4426 0.5328 0.4822 0.1158  0.1598  -0.0193 324  LEU A O   
1451 C  CB  . LEU A 248 ? 0.4071 0.5372 0.4857 0.0922  0.1338  -0.0092 324  LEU A CB  
1452 C  CG  . LEU A 248 ? 0.4262 0.5716 0.5139 0.0772  0.1254  -0.0054 324  LEU A CG  
1453 C  CD1 . LEU A 248 ? 0.3972 0.5363 0.4873 0.0695  0.1110  -0.0063 324  LEU A CD1 
1454 C  CD2 . LEU A 248 ? 0.4413 0.5742 0.5105 0.0687  0.1281  -0.0090 324  LEU A CD2 
1455 N  N   . ILE A 249 ? 0.3524 0.4683 0.4261 0.1241  0.1508  -0.0110 325  ILE A N   
1456 C  CA  . ILE A 249 ? 0.4045 0.4939 0.4610 0.1338  0.1539  -0.0161 325  ILE A CA  
1457 C  C   . ILE A 249 ? 0.4578 0.5457 0.5069 0.1407  0.1652  -0.0168 325  ILE A C   
1458 O  O   . ILE A 249 ? 0.4700 0.5299 0.4945 0.1438  0.1700  -0.0231 325  ILE A O   
1459 C  CB  . ILE A 249 ? 0.4357 0.5295 0.5056 0.1410  0.1480  -0.0126 325  ILE A CB  
1460 C  CG1 . ILE A 249 ? 0.4101 0.5004 0.4831 0.1343  0.1372  -0.0130 325  ILE A CG1 
1461 C  CG2 . ILE A 249 ? 0.5058 0.5734 0.5584 0.1514  0.1522  -0.0166 325  ILE A CG2 
1462 C  CD1 . ILE A 249 ? 0.3922 0.4934 0.4821 0.1394  0.1303  -0.0079 325  ILE A CD1 
1463 N  N   . ALA A 250 ? 0.4662 0.5842 0.5358 0.1425  0.1693  -0.0100 326  ALA A N   
1464 C  CA  . ALA A 250 ? 0.4786 0.5983 0.5431 0.1494  0.1807  -0.0101 326  ALA A CA  
1465 C  C   . ALA A 250 ? 0.5096 0.6150 0.5526 0.1424  0.1865  -0.0155 326  ALA A C   
1466 O  O   . ALA A 250 ? 0.5452 0.6288 0.5669 0.1476  0.1940  -0.0206 326  ALA A O   
1467 C  CB  . ALA A 250 ? 0.4746 0.6321 0.5672 0.1512  0.1831  -0.0011 326  ALA A CB  
1468 N  N   . THR A 251 ? 0.4827 0.5994 0.5299 0.1303  0.1829  -0.0141 327  THR A N   
1469 C  CA  . THR A 251 ? 0.5096 0.6118 0.5351 0.1225  0.1873  -0.0187 327  THR A CA  
1470 C  C   . THR A 251 ? 0.4978 0.5608 0.4930 0.1226  0.1857  -0.0276 327  THR A C   
1471 O  O   . THR A 251 ? 0.4669 0.5107 0.4392 0.1228  0.1922  -0.0324 327  THR A O   
1472 C  CB  . THR A 251 ? 0.5087 0.6260 0.5427 0.1093  0.1820  -0.0154 327  THR A CB  
1473 O  OG1 . THR A 251 ? 0.5276 0.6810 0.5888 0.1072  0.1827  -0.0068 327  THR A OG1 
1474 C  CG2 . THR A 251 ? 0.5289 0.6303 0.5393 0.1009  0.1864  -0.0196 327  THR A CG2 
1475 N  N   . CYS A 252 ? 0.4813 0.5321 0.4757 0.1219  0.1768  -0.0295 328  CYS A N   
1476 C  CA  . CYS A 252 ? 0.5028 0.5174 0.4689 0.1195  0.1738  -0.0374 328  CYS A CA  
1477 C  C   . CYS A 252 ? 0.5325 0.5254 0.4823 0.1294  0.1796  -0.0411 328  CYS A C   
1478 O  O   . CYS A 252 ? 0.5748 0.5396 0.4968 0.1265  0.1815  -0.0473 328  CYS A O   
1479 C  CB  . CYS A 252 ? 0.5064 0.5154 0.4772 0.1164  0.1632  -0.0380 328  CYS A CB  
1480 S  SG  . CYS A 252 ? 0.5527 0.5204 0.4903 0.1097  0.1576  -0.0470 328  CYS A SG  
1481 N  N   . LYS A 253 ? 0.5184 0.5232 0.4841 0.1406  0.1821  -0.0370 329  LYS A N   
1482 C  CA  . LYS A 253 ? 0.5675 0.5519 0.5179 0.1510  0.1886  -0.0397 329  LYS A CA  
1483 C  C   . LYS A 253 ? 0.6240 0.6038 0.5599 0.1520  0.1992  -0.0418 329  LYS A C   
1484 O  O   . LYS A 253 ? 0.6581 0.6080 0.5671 0.1537  0.2030  -0.0475 329  LYS A O   
1485 C  CB  . LYS A 253 ? 0.5705 0.5725 0.5429 0.1632  0.1900  -0.0337 329  LYS A CB  
1486 C  CG  . LYS A 253 ? 0.5754 0.5740 0.5561 0.1641  0.1802  -0.0324 329  LYS A CG  
1487 C  CD  . LYS A 253 ? 0.6135 0.6285 0.6140 0.1765  0.1819  -0.0261 329  LYS A CD  
1488 C  CE  . LYS A 253 ? 0.6489 0.6626 0.6584 0.1767  0.1718  -0.0241 329  LYS A CE  
1489 N  NZ  . LYS A 253 ? 0.6748 0.7062 0.7043 0.1881  0.1725  -0.0171 329  LYS A NZ  
1490 N  N   . ARG A 254 ? 0.6509 0.6599 0.6037 0.1503  0.2040  -0.0371 330  ARG A N   
1491 C  CA  . ARG A 254 ? 0.6840 0.6909 0.6237 0.1501  0.2142  -0.0388 330  ARG A CA  
1492 C  C   . ARG A 254 ? 0.6694 0.6481 0.5789 0.1394  0.2121  -0.0457 330  ARG A C   
1493 O  O   . ARG A 254 ? 0.6708 0.6279 0.5562 0.1411  0.2187  -0.0502 330  ARG A O   
1494 C  CB  . ARG A 254 ? 0.7437 0.7884 0.7078 0.1469  0.2178  -0.0320 330  ARG A CB  
1495 C  CG  . ARG A 254 ? 0.8533 0.9108 0.8210 0.1552  0.2302  -0.0295 330  ARG A CG  
1496 C  CD  . ARG A 254 ? 0.9093 1.0047 0.9011 0.1494  0.2326  -0.0224 330  ARG A CD  
1497 N  NE  . ARG A 254 ? 0.9354 1.0576 0.9566 0.1469  0.2241  -0.0157 330  ARG A NE  
1498 C  CZ  . ARG A 254 ? 0.9341 1.0699 0.9650 0.1344  0.2167  -0.0130 330  ARG A CZ  
1499 N  NH1 . ARG A 254 ? 0.9409 1.0666 0.9549 0.1235  0.2171  -0.0161 330  ARG A NH1 
1500 N  NH2 . ARG A 254 ? 0.9118 1.0707 0.9685 0.1325  0.2088  -0.0067 330  ARG A NH2 
1501 N  N   . MET A 255 ? 0.6092 0.5873 0.5190 0.1281  0.2028  -0.0465 331  MET A N   
1502 C  CA  . MET A 255 ? 0.6321 0.5840 0.5138 0.1171  0.1993  -0.0524 331  MET A CA  
1503 C  C   . MET A 255 ? 0.6380 0.5533 0.4937 0.1187  0.1964  -0.0588 331  MET A C   
1504 O  O   . MET A 255 ? 0.6413 0.5322 0.4694 0.1142  0.1984  -0.0638 331  MET A O   
1505 C  CB  . MET A 255 ? 0.6153 0.5755 0.5048 0.1058  0.1899  -0.0512 331  MET A CB  
1506 C  CG  . MET A 255 ? 0.6644 0.6023 0.5275 0.0932  0.1857  -0.0561 331  MET A CG  
1507 S  SD  . MET A 255 ? 0.6748 0.6232 0.5479 0.0809  0.1757  -0.0541 331  MET A SD  
1508 C  CE  . MET A 255 ? 0.6781 0.5982 0.5162 0.0673  0.1719  -0.0598 331  MET A CE  
1509 N  N   . VAL A 256 ? 0.6023 0.5133 0.4659 0.1243  0.1914  -0.0584 332  VAL A N   
1510 C  CA  . VAL A 256 ? 0.6332 0.5098 0.4728 0.1254  0.1887  -0.0637 332  VAL A CA  
1511 C  C   . VAL A 256 ? 0.6765 0.5377 0.4999 0.1344  0.1991  -0.0655 332  VAL A C   
1512 O  O   . VAL A 256 ? 0.7074 0.5372 0.5013 0.1307  0.1993  -0.0708 332  VAL A O   
1513 C  CB  . VAL A 256 ? 0.6086 0.4861 0.4618 0.1302  0.1820  -0.0618 332  VAL A CB  
1514 C  CG1 . VAL A 256 ? 0.6486 0.4913 0.4775 0.1324  0.1807  -0.0663 332  VAL A CG1 
1515 C  CG2 . VAL A 256 ? 0.5894 0.4757 0.4530 0.1204  0.1713  -0.0612 332  VAL A CG2 
1516 N  N   . GLU A 257 ? 0.6855 0.5687 0.5277 0.1462  0.2079  -0.0609 333  GLU A N   
1517 C  CA  . GLU A 257 ? 0.7146 0.5839 0.5424 0.1564  0.2188  -0.0623 333  GLU A CA  
1518 C  C   . GLU A 257 ? 0.7544 0.6114 0.5592 0.1503  0.2247  -0.0661 333  GLU A C   
1519 O  O   . GLU A 257 ? 0.8028 0.6331 0.5825 0.1541  0.2306  -0.0701 333  GLU A O   
1520 C  CB  . GLU A 257 ? 0.7155 0.6148 0.5705 0.1698  0.2268  -0.0558 333  GLU A CB  
1521 N  N   . GLU A 258 ? 0.7297 0.6044 0.5412 0.1405  0.2230  -0.0649 334  GLU A N   
1522 C  CA  . GLU A 258 ? 0.7684 0.6351 0.5600 0.1345  0.2287  -0.0676 334  GLU A CA  
1523 C  C   . GLU A 258 ? 0.7858 0.6245 0.5495 0.1203  0.2202  -0.0730 334  GLU A C   
1524 O  O   . GLU A 258 ? 0.7953 0.6201 0.5367 0.1151  0.2241  -0.0759 334  GLU A O   
1525 C  CB  . GLU A 258 ? 0.8084 0.7107 0.6219 0.1316  0.2325  -0.0623 334  GLU A CB  
1526 C  CG  . GLU A 258 ? 0.8682 0.8007 0.7089 0.1443  0.2414  -0.0564 334  GLU A CG  
1527 C  CD  . GLU A 258 ? 0.8932 0.8612 0.7552 0.1394  0.2446  -0.0507 334  GLU A CD  
1528 O  OE1 . GLU A 258 ? 0.9011 0.8679 0.7541 0.1268  0.2409  -0.0516 334  GLU A OE1 
1529 O  OE2 . GLU A 258 ? 0.8977 0.8945 0.7849 0.1476  0.2504  -0.0448 334  GLU A OE2 
1530 N  N   . GLU A 259 ? 0.7597 0.5901 0.5238 0.1136  0.2086  -0.0742 335  GLU A N   
1531 C  CA  . GLU A 259 ? 0.7922 0.5988 0.5321 0.0994  0.1995  -0.0786 335  GLU A CA  
1532 C  C   . GLU A 259 ? 0.8856 0.6547 0.5947 0.0993  0.1994  -0.0837 335  GLU A C   
1533 O  O   . GLU A 259 ? 0.9050 0.6648 0.6126 0.1106  0.2051  -0.0840 335  GLU A O   
1534 C  CB  . GLU A 259 ? 0.7372 0.5506 0.4899 0.0921  0.1873  -0.0776 335  GLU A CB  
1535 C  CG  . GLU A 259 ? 0.7223 0.5207 0.4743 0.0959  0.1817  -0.0789 335  GLU A CG  
1536 C  CD  . GLU A 259 ? 0.7280 0.5344 0.4931 0.0888  0.1702  -0.0779 335  GLU A CD  
1537 O  OE1 . GLU A 259 ? 0.6896 0.5210 0.4741 0.0859  0.1687  -0.0746 335  GLU A OE1 
1538 O  OE2 . GLU A 259 ? 0.7382 0.5255 0.4937 0.0858  0.1629  -0.0803 335  GLU A OE2 
1539 N  N   . GLU A 260 ? 0.9686 0.7157 0.6525 0.0858  0.1924  -0.0874 336  GLU A N   
1540 C  CA  . GLU A 260 ? 1.0629 0.7731 0.7150 0.0822  0.1907  -0.0919 336  GLU A CA  
1541 C  C   . GLU A 260 ? 1.1269 0.8239 0.7697 0.0678  0.1761  -0.0936 336  GLU A C   
1542 O  O   . GLU A 260 ? 1.1651 0.8523 0.7907 0.0546  0.1699  -0.0951 336  GLU A O   
1543 C  CB  . GLU A 260 ? 1.0757 0.7714 0.7032 0.0793  0.1977  -0.0943 336  GLU A CB  
1544 C  CG  . GLU A 260 ? 1.0740 0.7862 0.7120 0.0926  0.2123  -0.0924 336  GLU A CG  
1545 C  CD  . GLU A 260 ? 1.0915 0.7918 0.7060 0.0886  0.2190  -0.0946 336  GLU A CD  
1546 O  OE1 . GLU A 260 ? 1.1120 0.7843 0.6977 0.0775  0.2131  -0.0982 336  GLU A OE1 
1547 O  OE2 . GLU A 260 ? 1.0826 0.8022 0.7075 0.0961  0.2298  -0.0924 336  GLU A OE2 
1548 N  N   . LEU A 261 ? 1.1309 0.8288 0.7856 0.0703  0.1703  -0.0928 337  LEU A N   
1549 C  CA  . LEU A 261 ? 1.1473 0.8359 0.7965 0.0575  0.1566  -0.0938 337  LEU A CA  
1550 C  C   . LEU A 261 ? 1.1872 0.8587 0.8325 0.0617  0.1541  -0.0945 337  LEU A C   
1551 O  O   . LEU A 261 ? 1.1808 0.8660 0.8472 0.0729  0.1571  -0.0921 337  LEU A O   
1552 C  CB  . LEU A 261 ? 1.0924 0.8094 0.7675 0.0539  0.1501  -0.0908 337  LEU A CB  
1553 C  CG  . LEU A 261 ? 1.0569 0.7907 0.7359 0.0471  0.1499  -0.0894 337  LEU A CG  
1554 C  CD1 . LEU A 261 ? 1.0085 0.7688 0.7140 0.0459  0.1446  -0.0862 337  LEU A CD1 
1555 C  CD2 . LEU A 261 ? 1.0673 0.7817 0.7196 0.0318  0.1421  -0.0918 337  LEU A CD2 
1556 N  N   . GLN A 262 ? 1.2363 0.8782 0.8544 0.0521  0.1484  -0.0973 338  GLN A N   
1557 C  CA  . GLN A 262 ? 1.2659 0.8896 0.8777 0.0534  0.1447  -0.0977 338  GLN A CA  
1558 C  C   . GLN A 262 ? 1.2473 0.8868 0.8792 0.0483  0.1342  -0.0958 338  GLN A C   
1559 O  O   . GLN A 262 ? 1.2411 0.8859 0.8725 0.0351  0.1244  -0.0958 338  GLN A O   
1560 C  CB  . GLN A 262 ? 1.3010 0.8900 0.8780 0.0421  0.1405  -0.1006 338  GLN A CB  
1561 N  N   . PHE A 263 ? 1.2373 0.8847 0.8869 0.0591  0.1362  -0.0938 339  PHE A N   
1562 C  CA  . PHE A 263 ? 1.2023 0.8645 0.8714 0.0557  0.1271  -0.0919 339  PHE A CA  
1563 C  C   . PHE A 263 ? 1.2586 0.8986 0.9094 0.0425  0.1164  -0.0932 339  PHE A C   
1564 O  O   . PHE A 263 ? 1.2879 0.9013 0.9176 0.0427  0.1178  -0.0945 339  PHE A O   
1565 C  CB  . PHE A 263 ? 1.1510 0.8266 0.8427 0.0710  0.1323  -0.0889 339  PHE A CB  
1566 C  CG  . PHE A 263 ? 1.1154 0.8037 0.8259 0.0684  0.1236  -0.0869 339  PHE A CG  
1567 C  CD1 . PHE A 263 ? 1.0785 0.7960 0.8143 0.0686  0.1213  -0.0847 339  PHE A CD1 
1568 C  CD2 . PHE A 263 ? 1.1125 0.7829 0.8144 0.0658  0.1179  -0.0871 339  PHE A CD2 
1569 C  CE1 . PHE A 263 ? 1.0494 0.7775 0.8015 0.0665  0.1137  -0.0829 339  PHE A CE1 
1570 C  CE2 . PHE A 263 ? 1.0988 0.7806 0.8173 0.0633  0.1102  -0.0852 339  PHE A CE2 
1571 C  CZ  . PHE A 263 ? 1.0565 0.7671 0.8001 0.0639  0.1082  -0.0832 339  PHE A CZ  
1572 N  N   . HIS A 264 ? 1.2639 0.9150 0.9224 0.0308  0.1056  -0.0926 340  HIS A N   
1573 C  CA  . HIS A 264 ? 1.2999 0.9362 0.9460 0.0174  0.0945  -0.0928 340  HIS A CA  
1574 C  C   . HIS A 264 ? 1.2774 0.9349 0.9470 0.0147  0.0865  -0.0908 340  HIS A C   
1575 O  O   . HIS A 264 ? 1.2663 0.9470 0.9599 0.0237  0.0901  -0.0893 340  HIS A O   
1576 C  CB  . HIS A 264 ? 1.3314 0.9549 0.9546 0.0014  0.0879  -0.0941 340  HIS A CB  
1577 C  CG  . HIS A 264 ? 1.3200 0.9617 0.9500 -0.0019 0.0877  -0.0939 340  HIS A CG  
1578 N  ND1 . HIS A 264 ? 1.2944 0.9557 0.9382 -0.0106 0.0784  -0.0923 340  HIS A ND1 
1579 C  CD2 . HIS A 264 ? 1.3335 0.9758 0.9571 0.0021  0.0957  -0.0949 340  HIS A CD2 
1580 C  CE1 . HIS A 264 ? 1.2914 0.9641 0.9367 -0.0118 0.0805  -0.0922 340  HIS A CE1 
1581 N  NE2 . HIS A 264 ? 1.3105 0.9723 0.9437 -0.0045 0.0910  -0.0938 340  HIS A NE2 
1582 N  N   . GLU A 265 ? 1.2804 0.9299 0.9427 0.0016  0.0757  -0.0903 341  GLU A N   
1583 C  CA  . GLU A 265 ? 1.2416 0.9087 0.9243 -0.0012 0.0682  -0.0884 341  GLU A CA  
1584 C  C   . GLU A 265 ? 1.2041 0.8956 0.9022 -0.0052 0.0645  -0.0877 341  GLU A C   
1585 O  O   . GLU A 265 ? 1.1810 0.8913 0.9006 -0.0020 0.0624  -0.0863 341  GLU A O   
1586 C  CB  . GLU A 265 ? 1.2432 0.8971 0.9139 -0.0152 0.0575  -0.0875 341  GLU A CB  
1587 N  N   . GLU A 266 ? 1.1858 0.8764 0.8723 -0.0122 0.0637  -0.0885 342  GLU A N   
1588 C  CA  . GLU A 266 ? 1.1236 0.8354 0.8219 -0.0156 0.0610  -0.0877 342  GLU A CA  
1589 C  C   . GLU A 266 ? 1.0254 0.7457 0.7288 -0.0046 0.0723  -0.0882 342  GLU A C   
1590 O  O   . GLU A 266 ? 1.0148 0.7435 0.7162 -0.0095 0.0714  -0.0879 342  GLU A O   
1591 C  CB  . GLU A 266 ? 1.1846 0.8927 0.8680 -0.0323 0.0505  -0.0869 342  GLU A CB  
1592 C  CG  . GLU A 266 ? 1.2086 0.9141 0.8902 -0.0447 0.0383  -0.0850 342  GLU A CG  
1593 C  CD  . GLU A 266 ? 1.1861 0.9187 0.8957 -0.0451 0.0315  -0.0813 342  GLU A CD  
1594 O  OE1 . GLU A 266 ? 1.1591 0.9165 0.8884 -0.0428 0.0304  -0.0778 342  GLU A OE1 
1595 O  OE2 . GLU A 266 ? 1.1803 0.9132 0.8967 -0.0472 0.0268  -0.0798 342  GLU A OE2 
1596 N  N   . TYR A 267 ? 0.9340 0.6535 0.6445 0.0099  0.0827  -0.0884 343  TYR A N   
1597 C  CA  . TYR A 267 ? 0.8760 0.6050 0.5920 0.0202  0.0940  -0.0882 343  TYR A CA  
1598 C  C   . TYR A 267 ? 0.8190 0.5748 0.5565 0.0217  0.0943  -0.0861 343  TYR A C   
1599 O  O   . TYR A 267 ? 0.7891 0.5649 0.5518 0.0229  0.0885  -0.0823 343  TYR A O   
1600 C  CB  . TYR A 267 ? 0.8443 0.5713 0.5677 0.0358  0.1039  -0.0875 343  TYR A CB  
1601 C  CG  . TYR A 267 ? 0.8145 0.5594 0.5514 0.0472  0.1150  -0.0859 343  TYR A CG  
1602 C  CD1 . TYR A 267 ? 0.8538 0.5893 0.5752 0.0495  0.1230  -0.0872 343  TYR A CD1 
1603 C  CD2 . TYR A 267 ? 0.7471 0.5193 0.5123 0.0549  0.1175  -0.0825 343  TYR A CD2 
1604 C  CE1 . TYR A 267 ? 0.8508 0.6046 0.5853 0.0591  0.1332  -0.0852 343  TYR A CE1 
1605 C  CE2 . TYR A 267 ? 0.7474 0.5383 0.5260 0.0638  0.1271  -0.0801 343  TYR A CE2 
1606 C  CZ  . TYR A 267 ? 0.8161 0.5983 0.5796 0.0658  0.1350  -0.0815 343  TYR A CZ  
1607 O  OH  . TYR A 267 ? 0.8016 0.6042 0.5792 0.0742  0.1447  -0.0786 343  TYR A OH  
1608 N  N   . MET A 268 ? 0.7791 0.5413 0.5128 0.0210  0.0992  -0.0859 344  MET A N   
1609 C  CA  . MET A 268 ? 0.7252 0.5187 0.4856 0.0220  0.0981  -0.0808 344  MET A CA  
1610 C  C   . MET A 268 ? 0.7506 0.5446 0.5011 0.0239  0.1078  -0.0816 344  MET A C   
1611 O  O   . MET A 268 ? 0.7674 0.5467 0.4945 0.0148  0.1060  -0.0839 344  MET A O   
1612 C  CB  . MET A 268 ? 0.6737 0.4804 0.4442 0.0095  0.0835  -0.0773 344  MET A CB  
1613 C  CG  . MET A 268 ? 0.6325 0.4706 0.4347 0.0119  0.0806  -0.0715 344  MET A CG  
1614 S  SD  . MET A 268 ? 0.6156 0.4668 0.4267 -0.0010 0.0650  -0.0674 344  MET A SD  
1615 C  CE  . MET A 268 ? 0.6171 0.4590 0.4052 -0.0093 0.0657  -0.0682 344  MET A CE  
1616 N  N   . ASN A 269 ? 0.7138 0.5253 0.4819 0.0351  0.1179  -0.0791 345  ASN A N   
1617 C  CA  . ASN A 269 ? 0.6981 0.5167 0.4623 0.0363  0.1268  -0.0783 345  ASN A CA  
1618 C  C   . ASN A 269 ? 0.6684 0.5087 0.4481 0.0264  0.1173  -0.0733 345  ASN A C   
1619 O  O   . ASN A 269 ? 0.5949 0.4582 0.4021 0.0274  0.1119  -0.0686 345  ASN A O   
1620 C  CB  . ASN A 269 ? 0.6856 0.5192 0.4663 0.0510  0.1400  -0.0761 345  ASN A CB  
1621 C  CG  . ASN A 269 ? 0.7066 0.5488 0.4842 0.0522  0.1493  -0.0745 345  ASN A CG  
1622 O  OD1 . ASN A 269 ? 0.6914 0.5405 0.4664 0.0432  0.1468  -0.0731 345  ASN A OD1 
1623 N  ND2 . ASN A 269 ? 0.7112 0.5542 0.4901 0.0630  0.1592  -0.0741 345  ASN A ND2 
1624 N  N   . GLU A 270 ? 0.6789 0.5100 0.4391 0.0170  0.1152  -0.0742 346  GLU A N   
1625 C  CA  . GLU A 270 ? 0.6925 0.5404 0.4642 0.0076  0.1054  -0.0694 346  GLU A CA  
1626 C  C   . GLU A 270 ? 0.6337 0.5070 0.4274 0.0117  0.1112  -0.0644 346  GLU A C   
1627 O  O   . GLU A 270 ? 0.6119 0.5020 0.4223 0.0064  0.1028  -0.0597 346  GLU A O   
1628 C  CB  . GLU A 270 ? 0.7825 0.6137 0.5269 -0.0035 0.1015  -0.0710 346  GLU A CB  
1629 C  CG  . GLU A 270 ? 0.8572 0.6725 0.5877 -0.0126 0.0893  -0.0730 346  GLU A CG  
1630 C  CD  . GLU A 270 ? 0.9468 0.7480 0.6513 -0.0243 0.0840  -0.0736 346  GLU A CD  
1631 O  OE1 . GLU A 270 ? 0.9868 0.7757 0.6785 -0.0331 0.0738  -0.0747 346  GLU A OE1 
1632 O  OE2 . GLU A 270 ? 0.9733 0.7763 0.6702 -0.0254 0.0896  -0.0725 346  GLU A OE2 
1633 N  N   . ARG A 271 ? 0.6301 0.5066 0.4243 0.0212  0.1253  -0.0650 347  ARG A N   
1634 C  CA  . ARG A 271 ? 0.6348 0.5377 0.4513 0.0245  0.1308  -0.0595 347  ARG A CA  
1635 C  C   . ARG A 271 ? 0.6031 0.5270 0.4501 0.0311  0.1285  -0.0559 347  ARG A C   
1636 O  O   . ARG A 271 ? 0.6121 0.5593 0.4802 0.0300  0.1278  -0.0505 347  ARG A O   
1637 C  CB  . ARG A 271 ? 0.6466 0.5480 0.4529 0.0319  0.1473  -0.0607 347  ARG A CB  
1638 N  N   . ASP A 272 ? 0.5641 0.4792 0.4125 0.0370  0.1268  -0.0586 348  ASP A N   
1639 C  CA  . ASP A 272 ? 0.4937 0.4268 0.3691 0.0430  0.1238  -0.0552 348  ASP A CA  
1640 C  C   . ASP A 272 ? 0.4708 0.3885 0.3411 0.0420  0.1151  -0.0583 348  ASP A C   
1641 O  O   . ASP A 272 ? 0.4641 0.3689 0.3278 0.0501  0.1200  -0.0614 348  ASP A O   
1642 C  CB  . ASP A 272 ? 0.5137 0.4577 0.3999 0.0564  0.1369  -0.0538 348  ASP A CB  
1643 C  CG  . ASP A 272 ? 0.5080 0.4691 0.4202 0.0629  0.1334  -0.0501 348  ASP A CG  
1644 O  OD1 . ASP A 272 ? 0.4914 0.4593 0.4155 0.0563  0.1214  -0.0482 348  ASP A OD1 
1645 O  OD2 . ASP A 272 ? 0.5237 0.4911 0.4439 0.0752  0.1431  -0.0490 348  ASP A OD2 
1646 N  N   . PRO A 273 ? 0.4452 0.3634 0.3176 0.0321  0.1023  -0.0574 349  PRO A N   
1647 C  CA  . PRO A 273 ? 0.4533 0.3583 0.3206 0.0297  0.0938  -0.0599 349  PRO A CA  
1648 C  C   . PRO A 273 ? 0.4967 0.4146 0.3865 0.0348  0.0899  -0.0573 349  PRO A C   
1649 O  O   . PRO A 273 ? 0.5494 0.4603 0.4382 0.0313  0.0816  -0.0583 349  PRO A O   
1650 C  CB  . PRO A 273 ? 0.4421 0.3460 0.3040 0.0174  0.0824  -0.0589 349  PRO A CB  
1651 C  CG  . PRO A 273 ? 0.4395 0.3631 0.3156 0.0153  0.0824  -0.0542 349  PRO A CG  
1652 C  CD  . PRO A 273 ? 0.4294 0.3580 0.3057 0.0225  0.0956  -0.0541 349  PRO A CD  
1653 N  N   . SER A 274 ? 0.4569 0.3937 0.3664 0.0425  0.0955  -0.0538 350  SER A N   
1654 C  CA  . SER A 274 ? 0.3929 0.3436 0.3240 0.0463  0.0908  -0.0507 350  SER A CA  
1655 C  C   . SER A 274 ? 0.3979 0.3335 0.3229 0.0532  0.0922  -0.0535 350  SER A C   
1656 O  O   . SER A 274 ? 0.4166 0.3329 0.3229 0.0579  0.0996  -0.0574 350  SER A O   
1657 C  CB  . SER A 274 ? 0.3453 0.3203 0.2979 0.0523  0.0965  -0.0457 350  SER A CB  
1658 O  OG  . SER A 274 ? 0.3788 0.3511 0.3267 0.0627  0.1091  -0.0466 350  SER A OG  
1659 N  N   . ILE A 275 ? 0.3871 0.3302 0.3267 0.0535  0.0850  -0.0513 351  ILE A N   
1660 C  CA  . ILE A 275 ? 0.3980 0.3283 0.3339 0.0599  0.0856  -0.0529 351  ILE A CA  
1661 C  C   . ILE A 275 ? 0.4026 0.3340 0.3413 0.0734  0.0971  -0.0522 351  ILE A C   
1662 O  O   . ILE A 275 ? 0.4314 0.3419 0.3545 0.0798  0.1023  -0.0555 351  ILE A O   
1663 C  CB  . ILE A 275 ? 0.3532 0.2945 0.3059 0.0578  0.0761  -0.0498 351  ILE A CB  
1664 C  CG1 . ILE A 275 ? 0.3264 0.2623 0.2729 0.0461  0.0658  -0.0511 351  ILE A CG1 
1665 C  CG2 . ILE A 275 ? 0.3649 0.2969 0.3175 0.0660  0.0777  -0.0501 351  ILE A CG2 
1666 C  CD1 . ILE A 275 ? 0.3131 0.2653 0.2781 0.0430  0.0573  -0.0474 351  ILE A CD1 
1667 N  N   . LEU A 276 ? 0.3401 0.2958 0.2982 0.0779  0.1013  -0.0475 352  LEU A N   
1668 C  CA  . LEU A 276 ? 0.3495 0.3109 0.3130 0.0914  0.1129  -0.0457 352  LEU A CA  
1669 C  C   . LEU A 276 ? 0.3943 0.3343 0.3335 0.0958  0.1238  -0.0506 352  LEU A C   
1670 O  O   . LEU A 276 ? 0.4160 0.3442 0.3479 0.1079  0.1326  -0.0519 352  LEU A O   
1671 C  CB  . LEU A 276 ? 0.3518 0.3451 0.3394 0.0926  0.1152  -0.0394 352  LEU A CB  
1672 C  CG  . LEU A 276 ? 0.3942 0.3981 0.3880 0.1057  0.1287  -0.0368 352  LEU A CG  
1673 C  CD1 . LEU A 276 ? 0.3855 0.3866 0.3851 0.1192  0.1318  -0.0352 352  LEU A CD1 
1674 C  CD2 . LEU A 276 ? 0.3620 0.3986 0.3786 0.1034  0.1300  -0.0301 352  LEU A CD2 
1675 N  N   . HIS A 277 ? 0.4189 0.3523 0.3439 0.0865  0.1234  -0.0534 353  HIS A N   
1676 C  CA  . HIS A 277 ? 0.4834 0.3952 0.3829 0.0898  0.1337  -0.0583 353  HIS A CA  
1677 C  C   . HIS A 277 ? 0.5157 0.3938 0.3897 0.0898  0.1323  -0.0642 353  HIS A C   
1678 O  O   . HIS A 277 ? 0.5618 0.4249 0.4226 0.0959  0.1381  -0.0660 353  HIS A O   
1679 C  CB  . HIS A 277 ? 0.4933 0.4057 0.3826 0.0787  0.1326  -0.0594 353  HIS A CB  
1680 C  CG  . HIS A 277 ? 0.5429 0.4392 0.4092 0.0828  0.1450  -0.0632 353  HIS A CG  
1681 N  ND1 . HIS A 277 ? 0.5439 0.4571 0.4170 0.0862  0.1547  -0.0604 353  HIS A ND1 
1682 C  CD2 . HIS A 277 ? 0.5678 0.4351 0.4068 0.0821  0.1465  -0.0685 353  HIS A CD2 
1683 C  CE1 . HIS A 277 ? 0.5802 0.4765 0.4323 0.0872  0.1604  -0.0636 353  HIS A CE1 
1684 N  NE2 . HIS A 277 ? 0.5951 0.4630 0.4260 0.0847  0.1555  -0.0685 353  HIS A NE2 
1685 N  N   . PHE A 278 ? 0.4958 0.3670 0.3674 0.0793  0.1197  -0.0652 354  PHE A N   
1686 C  CA  . PHE A 278 ? 0.5283 0.3690 0.3769 0.0774  0.1170  -0.0700 354  PHE A CA  
1687 C  C   . PHE A 278 ? 0.5387 0.3745 0.3923 0.0897  0.1210  -0.0686 354  PHE A C   
1688 O  O   . PHE A 278 ? 0.5981 0.4116 0.4333 0.0919  0.1233  -0.0709 354  PHE A O   
1689 C  CB  . PHE A 278 ? 0.5037 0.3453 0.3553 0.0642  0.1023  -0.0695 354  PHE A CB  
1690 C  CG  . PHE A 278 ? 0.5325 0.3448 0.3616 0.0600  0.0983  -0.0736 354  PHE A CG  
1691 C  CD1 . PHE A 278 ? 0.5565 0.3616 0.3891 0.0668  0.0981  -0.0729 354  PHE A CD1 
1692 C  CD2 . PHE A 278 ? 0.5619 0.3540 0.3661 0.0483  0.0942  -0.0776 354  PHE A CD2 
1693 C  CE1 . PHE A 278 ? 0.5898 0.3671 0.4007 0.0618  0.0944  -0.0764 354  PHE A CE1 
1694 C  CE2 . PHE A 278 ? 0.6088 0.3742 0.3917 0.0428  0.0900  -0.0809 354  PHE A CE2 
1695 C  CZ  . PHE A 278 ? 0.6018 0.3597 0.3882 0.0493  0.0901  -0.0802 354  PHE A CZ  
1696 N  N   . LEU A 279 ? 0.4847 0.3422 0.3640 0.0965  0.1199  -0.0639 355  LEU A N   
1697 C  CA  . LEU A 279 ? 0.5202 0.3763 0.4069 0.1070  0.1211  -0.0611 355  LEU A CA  
1698 C  C   . LEU A 279 ? 0.5668 0.4221 0.4505 0.1172  0.1311  -0.0601 355  LEU A C   
1699 O  O   . LEU A 279 ? 0.6476 0.4835 0.5187 0.1226  0.1331  -0.0611 355  LEU A O   
1700 C  CB  . LEU A 279 ? 0.4644 0.3475 0.3805 0.1118  0.1179  -0.0553 355  LEU A CB  
1701 C  CG  . LEU A 279 ? 0.4649 0.3537 0.3892 0.1005  0.1048  -0.0544 355  LEU A CG  
1702 C  CD1 . LEU A 279 ? 0.4417 0.3607 0.3960 0.1037  0.1007  -0.0477 355  LEU A CD1 
1703 C  CD2 . LEU A 279 ? 0.4843 0.3462 0.3912 0.0979  0.1000  -0.0575 355  LEU A CD2 
1704 N  N   . LEU A 280 ? 0.5418 0.4173 0.4360 0.1196  0.1376  -0.0580 356  LEU A N   
1705 C  CA  . LEU A 280 ? 0.5840 0.4614 0.4773 0.1298  0.1476  -0.0566 356  LEU A CA  
1706 C  C   . LEU A 280 ? 0.6507 0.4964 0.5121 0.1274  0.1515  -0.0624 356  LEU A C   
1707 O  O   . LEU A 280 ? 0.6821 0.5152 0.5348 0.1365  0.1576  -0.0625 356  LEU A O   
1708 C  CB  . LEU A 280 ? 0.5659 0.4736 0.4781 0.1314  0.1533  -0.0526 356  LEU A CB  
1709 C  CG  . LEU A 280 ? 0.5370 0.4783 0.4821 0.1356  0.1507  -0.0455 356  LEU A CG  
1710 C  CD1 . LEU A 280 ? 0.5122 0.4826 0.4741 0.1358  0.1566  -0.0412 356  LEU A CD1 
1711 C  CD2 . LEU A 280 ? 0.5369 0.4796 0.4915 0.1473  0.1514  -0.0419 356  LEU A CD2 
1712 N  N   . ALA A 281 ? 0.6570 0.4892 0.5002 0.1152  0.1480  -0.0669 357  ALA A N   
1713 C  CA  . ALA A 281 ? 0.6984 0.5000 0.5102 0.1112  0.1504  -0.0719 357  ALA A CA  
1714 C  C   . ALA A 281 ? 0.7275 0.5002 0.5211 0.1090  0.1449  -0.0745 357  ALA A C   
1715 O  O   . ALA A 281 ? 0.7302 0.4760 0.4979 0.1075  0.1477  -0.0779 357  ALA A O   
1716 C  CB  . ALA A 281 ? 0.7002 0.4972 0.4981 0.0978  0.1471  -0.0752 357  ALA A CB  
1717 N  N   . SER A 282 ? 0.7264 0.5033 0.5320 0.1082  0.1375  -0.0728 358  SER A N   
1718 C  CA  . SER A 282 ? 0.7631 0.5136 0.5521 0.1055  0.1323  -0.0746 358  SER A CA  
1719 C  C   . SER A 282 ? 0.8046 0.5473 0.5938 0.1191  0.1385  -0.0724 358  SER A C   
1720 O  O   . SER A 282 ? 0.8263 0.5445 0.5992 0.1177  0.1354  -0.0736 358  SER A O   
1721 C  CB  . SER A 282 ? 0.7514 0.5089 0.5523 0.0990  0.1220  -0.0735 358  SER A CB  
1722 O  OG  . SER A 282 ? 0.7322 0.5099 0.5585 0.1096  0.1228  -0.0686 358  SER A OG  
1723 N  N   . GLY A 283 ? 0.8504 0.6133 0.6570 0.1318  0.1469  -0.0687 359  GLY A N   
1724 C  CA  . GLY A 283 ? 0.9135 0.6719 0.7228 0.1456  0.1525  -0.0658 359  GLY A CA  
1725 C  C   . GLY A 283 ? 0.9464 0.7162 0.7751 0.1499  0.1466  -0.0615 359  GLY A C   
1726 O  O   . GLY A 283 ? 0.9579 0.7094 0.7773 0.1553  0.1464  -0.0608 359  GLY A O   
1727 N  N   . ASP A 284 ? 0.9478 0.7466 0.8022 0.1476  0.1418  -0.0583 360  ASP A N   
1728 C  CA  . ASP A 284 ? 0.9454 0.7550 0.8174 0.1494  0.1347  -0.0543 360  ASP A CA  
1729 C  C   . ASP A 284 ? 0.9837 0.8006 0.8679 0.1641  0.1391  -0.0490 360  ASP A C   
1730 O  O   . ASP A 284 ? 1.0033 0.8437 0.9053 0.1729  0.1452  -0.0449 360  ASP A O   
1731 C  CB  . ASP A 284 ? 0.8936 0.7342 0.7906 0.1445  0.1299  -0.0516 360  ASP A CB  
1732 C  CG  . ASP A 284 ? 0.8496 0.6907 0.7534 0.1390  0.1199  -0.0506 360  ASP A CG  
1733 O  OD1 . ASP A 284 ? 0.8629 0.6787 0.7498 0.1366  0.1162  -0.0527 360  ASP A OD1 
1734 O  OD2 . ASP A 284 ? 0.7954 0.6615 0.7207 0.1367  0.1159  -0.0475 360  ASP A OD2 
1735 N  N   . VAL A 286 ? 0.6573 0.5417 0.6078 0.1825  0.1360  -0.0324 362  VAL A N   
1736 C  CA  . VAL A 286 ? 0.6445 0.5519 0.6197 0.1860  0.1299  -0.0257 362  VAL A CA  
1737 C  C   . VAL A 286 ? 0.6048 0.5497 0.6075 0.1912  0.1331  -0.0193 362  VAL A C   
1738 O  O   . VAL A 286 ? 0.5708 0.5243 0.5739 0.1914  0.1400  -0.0203 362  VAL A O   
1739 C  CB  . VAL A 286 ? 0.6370 0.5462 0.6160 0.1747  0.1196  -0.0267 362  VAL A CB  
1740 C  CG1 . VAL A 286 ? 0.6918 0.5651 0.6440 0.1686  0.1161  -0.0325 362  VAL A CG1 
1741 C  CG2 . VAL A 286 ? 0.6118 0.5384 0.5987 0.1654  0.1189  -0.0284 362  VAL A CG2 
1742 N  N   . SER A 287 ? 0.5809 0.5482 0.6062 0.1946  0.1276  -0.0124 363  SER A N   
1743 C  CA  . SER A 287 ? 0.5757 0.5791 0.6278 0.1992  0.1294  -0.0051 363  SER A CA  
1744 C  C   . SER A 287 ? 0.5704 0.5976 0.6362 0.1884  0.1266  -0.0047 363  SER A C   
1745 O  O   . SER A 287 ? 0.5513 0.5701 0.6099 0.1781  0.1215  -0.0089 363  SER A O   
1746 C  CB  . SER A 287 ? 0.5430 0.5616 0.6132 0.2048  0.1231  0.0024  363  SER A CB  
1747 O  OG  . SER A 287 ? 0.5004 0.5224 0.5763 0.1956  0.1126  0.0029  363  SER A OG  
1748 N  N   . SER A 288 ? 0.5703 0.6278 0.6562 0.1909  0.1302  0.0009  364  SER A N   
1749 C  CA  . SER A 288 ? 0.5592 0.6412 0.6592 0.1806  0.1278  0.0024  364  SER A CA  
1750 C  C   . SER A 288 ? 0.4977 0.5925 0.6114 0.1727  0.1162  0.0056  364  SER A C   
1751 O  O   . SER A 288 ? 0.5049 0.6029 0.6186 0.1621  0.1123  0.0034  364  SER A O   
1752 C  CB  . SER A 288 ? 0.6085 0.7211 0.7277 0.1845  0.1335  0.0088  364  SER A CB  
1753 O  OG  . SER A 288 ? 0.6743 0.7778 0.7804 0.1875  0.1443  0.0048  364  SER A OG  
1754 N  N   . LYS A 289 ? 0.4693 0.5714 0.5942 0.1777  0.1106  0.0111  365  LYS A N   
1755 C  CA  . LYS A 289 ? 0.4595 0.5717 0.5953 0.1703  0.0994  0.0141  365  LYS A CA  
1756 C  C   . LYS A 289 ? 0.4492 0.5345 0.5665 0.1641  0.0953  0.0071  365  LYS A C   
1757 O  O   . LYS A 289 ? 0.4310 0.5234 0.5529 0.1544  0.0890  0.0067  365  LYS A O   
1758 C  CB  . LYS A 289 ? 0.4662 0.5869 0.6137 0.1776  0.0944  0.0209  365  LYS A CB  
1759 N  N   . GLN A 290 ? 0.4724 0.5263 0.5679 0.1692  0.0990  0.0017  366  GLN A N   
1760 C  CA  . GLN A 290 ? 0.4653 0.4928 0.5421 0.1628  0.0951  -0.0046 366  GLN A CA  
1761 C  C   . GLN A 290 ? 0.4284 0.4527 0.4971 0.1535  0.0970  -0.0101 366  GLN A C   
1762 O  O   . GLN A 290 ? 0.4446 0.4664 0.5117 0.1451  0.0910  -0.0121 366  GLN A O   
1763 C  CB  . GLN A 290 ? 0.5095 0.5035 0.5632 0.1689  0.0987  -0.0089 366  GLN A CB  
1764 C  CG  . GLN A 290 ? 0.5435 0.5093 0.5766 0.1613  0.0944  -0.0152 366  GLN A CG  
1765 C  CD  . GLN A 290 ? 0.5870 0.5572 0.6286 0.1580  0.0847  -0.0120 366  GLN A CD  
1766 O  OE1 . GLN A 290 ? 0.6271 0.6064 0.6800 0.1642  0.0817  -0.0061 366  GLN A OE1 
1767 N  NE2 . GLN A 290 ? 0.5676 0.5312 0.6032 0.1483  0.0799  -0.0157 366  GLN A NE2 
1768 N  N   . LEU A 291 ? 0.3971 0.4212 0.4600 0.1552  0.1055  -0.0124 367  LEU A N   
1769 C  CA  . LEU A 291 ? 0.3892 0.4093 0.4429 0.1465  0.1077  -0.0173 367  LEU A CA  
1770 C  C   . LEU A 291 ? 0.3590 0.4068 0.4324 0.1387  0.1027  -0.0133 367  LEU A C   
1771 O  O   . LEU A 291 ? 0.3696 0.4108 0.4357 0.1264  0.0963  -0.0170 367  LEU A O   
1772 C  CB  . LEU A 291 ? 0.3957 0.4128 0.4406 0.1501  0.1180  -0.0195 367  LEU A CB  
1773 C  CG  . LEU A 291 ? 0.3937 0.4025 0.4247 0.1414  0.1209  -0.0250 367  LEU A CG  
1774 C  CD1 . LEU A 291 ? 0.3880 0.3661 0.3959 0.1350  0.1167  -0.0319 367  LEU A CD1 
1775 C  CD2 . LEU A 291 ? 0.4153 0.4200 0.4363 0.1456  0.1313  -0.0269 367  LEU A CD2 
1776 N  N   . ARG A 292 ? 0.3635 0.4413 0.4601 0.1409  0.1018  -0.0059 368  ARG A N   
1777 C  CA  . ARG A 292 ? 0.3431 0.4467 0.4577 0.1317  0.0956  -0.0015 368  ARG A CA  
1778 C  C   . ARG A 292 ? 0.3520 0.4487 0.4655 0.1225  0.0827  -0.0023 368  ARG A C   
1779 O  O   . ARG A 292 ? 0.3801 0.4788 0.4926 0.1093  0.0754  -0.0039 368  ARG A O   
1780 C  CB  . ARG A 292 ? 0.3276 0.4632 0.4660 0.1344  0.0955  0.0071  368  ARG A CB  
1781 C  CG  . ARG A 292 ? 0.3523 0.4994 0.4934 0.1367  0.1048  0.0082  368  ARG A CG  
1782 C  CD  . ARG A 292 ? 0.3873 0.5689 0.5532 0.1354  0.1025  0.0172  368  ARG A CD  
1783 N  NE  . ARG A 292 ? 0.4055 0.5932 0.5818 0.1420  0.0974  0.0222  368  ARG A NE  
1784 C  CZ  . ARG A 292 ? 0.4470 0.6359 0.6257 0.1533  0.1027  0.0248  368  ARG A CZ  
1785 N  NH1 . ARG A 292 ? 0.4667 0.6514 0.6384 0.1593  0.1135  0.0226  368  ARG A NH1 
1786 N  NH2 . ARG A 292 ? 0.4545 0.6489 0.6423 0.1588  0.0973  0.0297  368  ARG A NH2 
1787 N  N   . ASP A 293 ? 0.3586 0.4464 0.4713 0.1298  0.0802  -0.0009 369  ASP A N   
1788 C  CA  . ASP A 293 ? 0.3574 0.4374 0.4674 0.1216  0.0689  -0.0018 369  ASP A CA  
1789 C  C   . ASP A 293 ? 0.3370 0.3922 0.4262 0.1120  0.0662  -0.0097 369  ASP A C   
1790 O  O   . ASP A 293 ? 0.3356 0.3922 0.4249 0.1006  0.0578  -0.0108 369  ASP A O   
1791 C  CB  . ASP A 293 ? 0.4274 0.5002 0.5381 0.1317  0.0676  0.0012  369  ASP A CB  
1792 C  CG  . ASP A 293 ? 0.4581 0.5588 0.5918 0.1397  0.0673  0.0104  369  ASP A CG  
1793 O  OD1 . ASP A 293 ? 0.4497 0.5765 0.5994 0.1354  0.0670  0.0146  369  ASP A OD1 
1794 O  OD2 . ASP A 293 ? 0.4781 0.5734 0.6121 0.1474  0.0658  0.0133  369  ASP A OD2 
1795 N  N   . ASP A 294 ? 0.3562 0.3886 0.4271 0.1165  0.0734  -0.0150 370  ASP A N   
1796 C  CA  . ASP A 294 ? 0.3660 0.3767 0.4175 0.1068  0.0707  -0.0219 370  ASP A CA  
1797 C  C   . ASP A 294 ? 0.3347 0.3566 0.3891 0.0957  0.0680  -0.0230 370  ASP A C   
1798 O  O   . ASP A 294 ? 0.3243 0.3419 0.3746 0.0853  0.0604  -0.0251 370  ASP A O   
1799 C  CB  . ASP A 294 ? 0.4150 0.4002 0.4453 0.1129  0.0793  -0.0271 370  ASP A CB  
1800 C  CG  . ASP A 294 ? 0.5091 0.4767 0.5317 0.1231  0.0814  -0.0267 370  ASP A CG  
1801 O  OD1 . ASP A 294 ? 0.5236 0.4942 0.5533 0.1224  0.0743  -0.0237 370  ASP A OD1 
1802 O  OD2 . ASP A 294 ? 0.5556 0.5048 0.5633 0.1318  0.0904  -0.0295 370  ASP A OD2 
1803 N  N   . LEU A 295 ? 0.3303 0.3667 0.3918 0.0982  0.0746  -0.0211 371  LEU A N   
1804 C  CA  . LEU A 295 ? 0.2997 0.3456 0.3630 0.0878  0.0726  -0.0216 371  LEU A CA  
1805 C  C   . LEU A 295 ? 0.2997 0.3626 0.3775 0.0796  0.0629  -0.0178 371  LEU A C   
1806 O  O   . LEU A 295 ? 0.2995 0.3591 0.3726 0.0694  0.0570  -0.0199 371  LEU A O   
1807 C  CB  . LEU A 295 ? 0.2843 0.3437 0.3531 0.0923  0.0821  -0.0195 371  LEU A CB  
1808 C  CG  . LEU A 295 ? 0.3353 0.3770 0.3872 0.1004  0.0931  -0.0237 371  LEU A CG  
1809 C  CD1 . LEU A 295 ? 0.3485 0.4074 0.4082 0.1050  0.1030  -0.0207 371  LEU A CD1 
1810 C  CD2 . LEU A 295 ? 0.3450 0.3623 0.3741 0.0920  0.0910  -0.0306 371  LEU A CD2 
1811 N  N   . MET A 296 ? 0.2767 0.3572 0.3714 0.0841  0.0612  -0.0119 372  MET A N   
1812 C  CA  . MET A 296 ? 0.3358 0.4313 0.4425 0.0760  0.0521  -0.0082 372  MET A CA  
1813 C  C   . MET A 296 ? 0.2935 0.3742 0.3914 0.0699  0.0437  -0.0114 372  MET A C   
1814 O  O   . MET A 296 ? 0.3117 0.3954 0.4103 0.0605  0.0371  -0.0115 372  MET A O   
1815 C  CB  . MET A 296 ? 0.4369 0.5532 0.5621 0.0822  0.0514  -0.0010 372  MET A CB  
1816 C  CG  . MET A 296 ? 0.5490 0.6832 0.6865 0.0727  0.0428  0.0036  372  MET A CG  
1817 S  SD  . MET A 296 ? 0.6576 0.8135 0.8052 0.0669  0.0466  0.0073  372  MET A SD  
1818 C  CE  . MET A 296 ? 0.6841 0.8587 0.8466 0.0814  0.0563  0.0132  372  MET A CE  
1819 N  N   . THR A 297 ? 0.2770 0.3411 0.3658 0.0753  0.0442  -0.0139 373  THR A N   
1820 C  CA  . THR A 297 ? 0.2684 0.3192 0.3488 0.0696  0.0372  -0.0166 373  THR A CA  
1821 C  C   . THR A 297 ? 0.2736 0.3147 0.3427 0.0609  0.0355  -0.0212 373  THR A C   
1822 O  O   . THR A 297 ? 0.2577 0.2993 0.3266 0.0536  0.0289  -0.0216 373  THR A O   
1823 C  CB  . THR A 297 ? 0.3354 0.3688 0.4064 0.0765  0.0390  -0.0182 373  THR A CB  
1824 O  OG1 . THR A 297 ? 0.3664 0.4096 0.4486 0.0852  0.0397  -0.0130 373  THR A OG1 
1825 C  CG2 . THR A 297 ? 0.2945 0.3153 0.3568 0.0700  0.0322  -0.0206 373  THR A CG2 
1826 N  N   . MET A 298 ? 0.2616 0.2938 0.3206 0.0619  0.0416  -0.0245 374  MET A N   
1827 C  CA  . MET A 298 ? 0.2794 0.3029 0.3275 0.0539  0.0396  -0.0283 374  MET A CA  
1828 C  C   . MET A 298 ? 0.2844 0.3216 0.3399 0.0476  0.0372  -0.0263 374  MET A C   
1829 O  O   . MET A 298 ? 0.3119 0.3454 0.3626 0.0405  0.0324  -0.0277 374  MET A O   
1830 C  CB  . MET A 298 ? 0.3289 0.3376 0.3620 0.0560  0.0462  -0.0322 374  MET A CB  
1831 C  CG  . MET A 298 ? 0.3501 0.3390 0.3702 0.0586  0.0465  -0.0352 374  MET A CG  
1832 S  SD  . MET A 298 ? 0.4304 0.3981 0.4292 0.0608  0.0543  -0.0402 374  MET A SD  
1833 C  CE  . MET A 298 ? 0.4261 0.4020 0.4327 0.0737  0.0648  -0.0377 374  MET A CE  
1834 N  N   . LEU A 299 ? 0.2842 0.3373 0.3511 0.0500  0.0406  -0.0226 375  LEU A N   
1835 C  CA  . LEU A 299 ? 0.2797 0.3452 0.3532 0.0429  0.0378  -0.0201 375  LEU A CA  
1836 C  C   . LEU A 299 ? 0.2866 0.3546 0.3643 0.0375  0.0291  -0.0187 375  LEU A C   
1837 O  O   . LEU A 299 ? 0.2737 0.3383 0.3467 0.0306  0.0250  -0.0197 375  LEU A O   
1838 C  CB  . LEU A 299 ? 0.2799 0.3643 0.3665 0.0460  0.0427  -0.0153 375  LEU A CB  
1839 C  CG  . LEU A 299 ? 0.3231 0.4224 0.4185 0.0379  0.0387  -0.0114 375  LEU A CG  
1840 C  CD1 . LEU A 299 ? 0.3485 0.4429 0.4349 0.0314  0.0403  -0.0132 375  LEU A CD1 
1841 C  CD2 . LEU A 299 ? 0.3252 0.4466 0.4371 0.0411  0.0417  -0.0053 375  LEU A CD2 
1842 N  N   . ILE A 300 ? 0.2739 0.3471 0.3595 0.0409  0.0264  -0.0163 376  ILE A N   
1843 C  CA  . ILE A 300 ? 0.2576 0.3321 0.3455 0.0359  0.0185  -0.0151 376  ILE A CA  
1844 C  C   . ILE A 300 ? 0.2535 0.3125 0.3298 0.0332  0.0154  -0.0193 376  ILE A C   
1845 O  O   . ILE A 300 ? 0.2682 0.3252 0.3415 0.0274  0.0108  -0.0198 376  ILE A O   
1846 C  CB  . ILE A 300 ? 0.2759 0.3580 0.3730 0.0404  0.0163  -0.0115 376  ILE A CB  
1847 C  CG1 . ILE A 300 ? 0.3373 0.4374 0.4478 0.0445  0.0199  -0.0064 376  ILE A CG1 
1848 C  CG2 . ILE A 300 ? 0.2486 0.3318 0.3464 0.0343  0.0084  -0.0102 376  ILE A CG2 
1849 C  CD1 . ILE A 300 ? 0.3779 0.4926 0.4957 0.0372  0.0177  -0.0029 376  ILE A CD1 
1850 N  N   . ALA A 301 ? 0.2285 0.2763 0.2978 0.0373  0.0178  -0.0220 377  ALA A N   
1851 C  CA  . ALA A 301 ? 0.2691 0.3049 0.3291 0.0344  0.0145  -0.0250 377  ALA A CA  
1852 C  C   . ALA A 301 ? 0.2842 0.3164 0.3376 0.0291  0.0137  -0.0270 377  ALA A C   
1853 O  O   . ALA A 301 ? 0.2856 0.3156 0.3366 0.0253  0.0094  -0.0274 377  ALA A O   
1854 C  CB  . ALA A 301 ? 0.3160 0.3399 0.3684 0.0384  0.0173  -0.0271 377  ALA A CB  
1855 N  N   . GLY A 302 ? 0.2735 0.3049 0.3234 0.0292  0.0182  -0.0279 378  GLY A N   
1856 C  CA  . GLY A 302 ? 0.2835 0.3104 0.3259 0.0245  0.0173  -0.0294 378  GLY A CA  
1857 C  C   . GLY A 302 ? 0.2879 0.3214 0.3337 0.0202  0.0149  -0.0274 378  GLY A C   
1858 O  O   . GLY A 302 ? 0.3240 0.3530 0.3635 0.0166  0.0132  -0.0281 378  GLY A O   
1859 N  N   . HIS A 303 ? 0.2595 0.3031 0.3145 0.0201  0.0145  -0.0246 379  HIS A N   
1860 C  CA  . HIS A 303 ? 0.2533 0.3016 0.3102 0.0149  0.0118  -0.0224 379  HIS A CA  
1861 C  C   . HIS A 303 ? 0.2894 0.3342 0.3452 0.0125  0.0059  -0.0222 379  HIS A C   
1862 O  O   . HIS A 303 ? 0.2884 0.3264 0.3375 0.0097  0.0035  -0.0230 379  HIS A O   
1863 C  CB  . HIS A 303 ? 0.2489 0.3107 0.3158 0.0146  0.0141  -0.0188 379  HIS A CB  
1864 C  CG  . HIS A 303 ? 0.3112 0.3779 0.3800 0.0077  0.0105  -0.0160 379  HIS A CG  
1865 N  ND1 . HIS A 303 ? 0.3288 0.3865 0.3886 0.0027  0.0079  -0.0169 379  HIS A ND1 
1866 C  CD2 . HIS A 303 ? 0.3203 0.3992 0.3980 0.0045  0.0088  -0.0120 379  HIS A CD2 
1867 C  CE1 . HIS A 303 ? 0.3226 0.3844 0.3841 -0.0034 0.0049  -0.0140 379  HIS A CE1 
1868 N  NE2 . HIS A 303 ? 0.3489 0.4242 0.4213 -0.0032 0.0051  -0.0109 379  HIS A NE2 
1869 N  N   . GLU A 304 ? 0.3060 0.3546 0.3674 0.0143  0.0038  -0.0212 380  GLU A N   
1870 C  CA  . GLU A 304 ? 0.3517 0.3973 0.4114 0.0118  -0.0013 -0.0208 380  GLU A CA  
1871 C  C   . GLU A 304 ? 0.2815 0.3171 0.3335 0.0128  -0.0026 -0.0234 380  GLU A C   
1872 O  O   . GLU A 304 ? 0.2745 0.3048 0.3213 0.0106  -0.0053 -0.0236 380  GLU A O   
1873 C  CB  . GLU A 304 ? 0.4246 0.4761 0.4909 0.0137  -0.0032 -0.0189 380  GLU A CB  
1874 C  CG  . GLU A 304 ? 0.4864 0.5509 0.5621 0.0120  -0.0033 -0.0150 380  GLU A CG  
1875 C  CD  . GLU A 304 ? 0.4908 0.5565 0.5646 0.0046  -0.0076 -0.0131 380  GLU A CD  
1876 O  OE1 . GLU A 304 ? 0.4939 0.5565 0.5632 0.0006  -0.0068 -0.0135 380  GLU A OE1 
1877 O  OE2 . GLU A 304 ? 0.4964 0.5646 0.5717 0.0022  -0.0122 -0.0111 380  GLU A OE2 
1878 N  N   . THR A 305 ? 0.2480 0.2809 0.2988 0.0162  -0.0007 -0.0251 381  THR A N   
1879 C  CA  . THR A 305 ? 0.2235 0.2503 0.2690 0.0167  -0.0021 -0.0267 381  THR A CA  
1880 C  C   . THR A 305 ? 0.2372 0.2602 0.2772 0.0150  -0.0027 -0.0270 381  THR A C   
1881 O  O   . THR A 305 ? 0.2439 0.2638 0.2810 0.0149  -0.0049 -0.0268 381  THR A O   
1882 C  CB  . THR A 305 ? 0.2563 0.2806 0.3006 0.0189  -0.0002 -0.0280 381  THR A CB  
1883 O  OG1 . THR A 305 ? 0.2954 0.3191 0.3380 0.0191  0.0033  -0.0288 381  THR A OG1 
1884 C  CG2 . THR A 305 ? 0.2548 0.2805 0.3031 0.0214  -0.0002 -0.0273 381  THR A CG2 
1885 N  N   . SER A 306 ? 0.2193 0.2420 0.2572 0.0140  -0.0006 -0.0273 382  SER A N   
1886 C  CA  . SER A 306 ? 0.2202 0.2390 0.2523 0.0126  -0.0015 -0.0271 382  SER A CA  
1887 C  C   . SER A 306 ? 0.2018 0.2184 0.2319 0.0105  -0.0031 -0.0257 382  SER A C   
1888 O  O   . SER A 306 ? 0.2257 0.2372 0.2506 0.0108  -0.0048 -0.0251 382  SER A O   
1889 C  CB  . SER A 306 ? 0.2356 0.2534 0.2640 0.0115  0.0010  -0.0277 382  SER A CB  
1890 O  OG  . SER A 306 ? 0.2629 0.2789 0.2890 0.0124  0.0014  -0.0292 382  SER A OG  
1891 N  N   . ALA A 307 ? 0.2112 0.2314 0.2449 0.0083  -0.0027 -0.0247 383  ALA A N   
1892 C  CA  . ALA A 307 ? 0.2596 0.2759 0.2897 0.0048  -0.0049 -0.0232 383  ALA A CA  
1893 C  C   . ALA A 307 ? 0.2900 0.2992 0.3155 0.0065  -0.0077 -0.0238 383  ALA A C   
1894 O  O   . ALA A 307 ? 0.2754 0.2760 0.2933 0.0060  -0.0090 -0.0235 383  ALA A O   
1895 C  CB  . ALA A 307 ? 0.2647 0.2884 0.3007 0.0012  -0.0049 -0.0214 383  ALA A CB  
1896 N  N   . ALA A 308 ? 0.2661 0.2781 0.2954 0.0091  -0.0081 -0.0247 384  ALA A N   
1897 C  CA  . ALA A 308 ? 0.2314 0.2373 0.2560 0.0112  -0.0098 -0.0253 384  ALA A CA  
1898 C  C   . ALA A 308 ? 0.2205 0.2241 0.2425 0.0154  -0.0090 -0.0258 384  ALA A C   
1899 O  O   . ALA A 308 ? 0.2427 0.2395 0.2587 0.0177  -0.0095 -0.0257 384  ALA A O   
1900 C  CB  . ALA A 308 ? 0.2134 0.2234 0.2423 0.0120  -0.0104 -0.0257 384  ALA A CB  
1901 N  N   . VAL A 309 ? 0.2120 0.2213 0.2381 0.0164  -0.0077 -0.0260 385  VAL A N   
1902 C  CA  . VAL A 309 ? 0.2336 0.2435 0.2586 0.0193  -0.0078 -0.0255 385  VAL A CA  
1903 C  C   . VAL A 309 ? 0.2535 0.2577 0.2726 0.0201  -0.0085 -0.0241 385  VAL A C   
1904 O  O   . VAL A 309 ? 0.2586 0.2604 0.2751 0.0241  -0.0089 -0.0231 385  VAL A O   
1905 C  CB  . VAL A 309 ? 0.2334 0.2487 0.2615 0.0182  -0.0071 -0.0258 385  VAL A CB  
1906 C  CG1 . VAL A 309 ? 0.2221 0.2399 0.2493 0.0198  -0.0082 -0.0243 385  VAL A CG1 
1907 C  CG2 . VAL A 309 ? 0.2230 0.2414 0.2552 0.0181  -0.0064 -0.0268 385  VAL A CG2 
1908 N  N   . LEU A 310 ? 0.2129 0.2147 0.2297 0.0167  -0.0084 -0.0238 386  LEU A N   
1909 C  CA  . LEU A 310 ? 0.2340 0.2287 0.2438 0.0169  -0.0092 -0.0222 386  LEU A CA  
1910 C  C   . LEU A 310 ? 0.2518 0.2362 0.2548 0.0181  -0.0101 -0.0220 386  LEU A C   
1911 O  O   . LEU A 310 ? 0.2961 0.2735 0.2932 0.0221  -0.0106 -0.0207 386  LEU A O   
1912 C  CB  . LEU A 310 ? 0.2482 0.2427 0.2564 0.0120  -0.0085 -0.0218 386  LEU A CB  
1913 C  CG  . LEU A 310 ? 0.2311 0.2316 0.2414 0.0111  -0.0073 -0.0221 386  LEU A CG  
1914 C  CD1 . LEU A 310 ? 0.2316 0.2318 0.2396 0.0067  -0.0054 -0.0217 386  LEU A CD1 
1915 C  CD2 . LEU A 310 ? 0.2304 0.2306 0.2379 0.0137  -0.0092 -0.0205 386  LEU A CD2 
1916 N  N   . THR A 311 ? 0.2556 0.2382 0.2585 0.0150  -0.0103 -0.0231 387  THR A N   
1917 C  CA  . THR A 311 ? 0.2857 0.2561 0.2794 0.0150  -0.0114 -0.0233 387  THR A CA  
1918 C  C   . THR A 311 ? 0.2710 0.2379 0.2620 0.0222  -0.0104 -0.0238 387  THR A C   
1919 O  O   . THR A 311 ? 0.2695 0.2248 0.2512 0.0260  -0.0102 -0.0231 387  THR A O   
1920 C  CB  . THR A 311 ? 0.3209 0.2922 0.3156 0.0096  -0.0126 -0.0241 387  THR A CB  
1921 O  OG1 . THR A 311 ? 0.3114 0.2878 0.3096 0.0034  -0.0130 -0.0228 387  THR A OG1 
1922 C  CG2 . THR A 311 ? 0.3046 0.2607 0.2868 0.0085  -0.0141 -0.0246 387  THR A CG2 
1923 N  N   . TRP A 312 ? 0.2732 0.2500 0.2720 0.0245  -0.0095 -0.0246 388  TRP A N   
1924 C  CA  . TRP A 312 ? 0.2935 0.2692 0.2906 0.0310  -0.0079 -0.0246 388  TRP A CA  
1925 C  C   . TRP A 312 ? 0.2779 0.2578 0.2773 0.0367  -0.0070 -0.0224 388  TRP A C   
1926 O  O   . TRP A 312 ? 0.2954 0.2715 0.2909 0.0435  -0.0053 -0.0215 388  TRP A O   
1927 C  CB  . TRP A 312 ? 0.2698 0.2547 0.2740 0.0306  -0.0073 -0.0256 388  TRP A CB  
1928 C  CG  . TRP A 312 ? 0.2714 0.2507 0.2714 0.0264  -0.0085 -0.0271 388  TRP A CG  
1929 C  CD1 . TRP A 312 ? 0.2635 0.2489 0.2693 0.0212  -0.0100 -0.0274 388  TRP A CD1 
1930 C  CD2 . TRP A 312 ? 0.2475 0.2136 0.2359 0.0268  -0.0085 -0.0282 388  TRP A CD2 
1931 N  NE1 . TRP A 312 ? 0.2788 0.2576 0.2785 0.0180  -0.0118 -0.0280 388  TRP A NE1 
1932 C  CE2 . TRP A 312 ? 0.2580 0.2239 0.2459 0.0207  -0.0110 -0.0288 388  TRP A CE2 
1933 C  CE3 . TRP A 312 ? 0.2815 0.2352 0.2588 0.0322  -0.0066 -0.0286 388  TRP A CE3 
1934 C  CZ2 . TRP A 312 ? 0.2677 0.2210 0.2436 0.0183  -0.0123 -0.0299 388  TRP A CZ2 
1935 C  CZ3 . TRP A 312 ? 0.3134 0.2524 0.2774 0.0306  -0.0070 -0.0303 388  TRP A CZ3 
1936 C  CH2 . TRP A 312 ? 0.3052 0.2440 0.2682 0.0229  -0.0102 -0.0310 388  TRP A CH2 
1937 N  N   . THR A 313 ? 0.2784 0.2662 0.2834 0.0345  -0.0082 -0.0211 389  THR A N   
1938 C  CA  . THR A 313 ? 0.2221 0.2144 0.2287 0.0389  -0.0085 -0.0182 389  THR A CA  
1939 C  C   . THR A 313 ? 0.2515 0.2308 0.2483 0.0432  -0.0086 -0.0166 389  THR A C   
1940 O  O   . THR A 313 ? 0.2773 0.2568 0.2735 0.0508  -0.0076 -0.0143 389  THR A O   
1941 C  CB  . THR A 313 ? 0.2481 0.2480 0.2592 0.0342  -0.0102 -0.0174 389  THR A CB  
1942 O  OG1 . THR A 313 ? 0.2426 0.2520 0.2608 0.0310  -0.0099 -0.0189 389  THR A OG1 
1943 C  CG2 . THR A 313 ? 0.2595 0.2644 0.2716 0.0379  -0.0117 -0.0138 389  THR A CG2 
1944 N  N   . PHE A 314 ? 0.2583 0.2261 0.2473 0.0384  -0.0096 -0.0175 390  PHE A N   
1945 C  CA  . PHE A 314 ? 0.3087 0.2612 0.2862 0.0417  -0.0099 -0.0158 390  PHE A CA  
1946 C  C   . PHE A 314 ? 0.3223 0.2610 0.2901 0.0465  -0.0080 -0.0171 390  PHE A C   
1947 O  O   . PHE A 314 ? 0.3283 0.2553 0.2873 0.0534  -0.0071 -0.0154 390  PHE A O   
1948 C  CB  . PHE A 314 ? 0.3406 0.2853 0.3120 0.0339  -0.0116 -0.0158 390  PHE A CB  
1949 C  CG  . PHE A 314 ? 0.3390 0.2914 0.3142 0.0320  -0.0129 -0.0135 390  PHE A CG  
1950 C  CD1 . PHE A 314 ? 0.3861 0.3297 0.3534 0.0344  -0.0143 -0.0103 390  PHE A CD1 
1951 C  CD2 . PHE A 314 ? 0.3004 0.2673 0.2855 0.0281  -0.0129 -0.0144 390  PHE A CD2 
1952 C  CE1 . PHE A 314 ? 0.3727 0.3229 0.3421 0.0321  -0.0158 -0.0080 390  PHE A CE1 
1953 C  CE2 . PHE A 314 ? 0.3197 0.2918 0.3058 0.0259  -0.0141 -0.0126 390  PHE A CE2 
1954 C  CZ  . PHE A 314 ? 0.3372 0.3015 0.3156 0.0276  -0.0157 -0.0094 390  PHE A CZ  
1955 N  N   . TYR A 315 ? 0.3245 0.2632 0.2927 0.0435  -0.0072 -0.0201 391  TYR A N   
1956 C  CA  . TYR A 315 ? 0.3188 0.2451 0.2770 0.0487  -0.0049 -0.0216 391  TYR A CA  
1957 C  C   . TYR A 315 ? 0.3322 0.2664 0.2954 0.0595  -0.0017 -0.0197 391  TYR A C   
1958 O  O   . TYR A 315 ? 0.3583 0.2802 0.3118 0.0679  0.0010  -0.0190 391  TYR A O   
1959 C  CB  . TYR A 315 ? 0.3328 0.2599 0.2911 0.0432  -0.0051 -0.0246 391  TYR A CB  
1960 C  CG  . TYR A 315 ? 0.3866 0.3031 0.3351 0.0493  -0.0020 -0.0262 391  TYR A CG  
1961 C  CD1 . TYR A 315 ? 0.4166 0.3096 0.3463 0.0505  -0.0015 -0.0274 391  TYR A CD1 
1962 C  CD2 . TYR A 315 ? 0.4035 0.3323 0.3599 0.0538  0.0007  -0.0264 391  TYR A CD2 
1963 C  CE1 . TYR A 315 ? 0.4590 0.3401 0.3773 0.0567  0.0022  -0.0293 391  TYR A CE1 
1964 C  CE2 . TYR A 315 ? 0.4385 0.3576 0.3850 0.0597  0.0044  -0.0279 391  TYR A CE2 
1965 C  CZ  . TYR A 315 ? 0.4649 0.3600 0.3921 0.0615  0.0054  -0.0295 391  TYR A CZ  
1966 O  OH  . TYR A 315 ? 0.4810 0.3645 0.3962 0.0678  0.0098  -0.0313 391  TYR A OH  
1967 N  N   . LEU A 316 ? 0.2940 0.2487 0.2722 0.0595  -0.0016 -0.0186 392  LEU A N   
1968 C  CA  . LEU A 316 ? 0.3059 0.2723 0.2912 0.0684  0.0012  -0.0160 392  LEU A CA  
1969 C  C   . LEU A 316 ? 0.3229 0.2888 0.3075 0.0757  0.0010  -0.0118 392  LEU A C   
1970 O  O   . LEU A 316 ? 0.3115 0.2780 0.2954 0.0861  0.0044  -0.0095 392  LEU A O   
1971 C  CB  . LEU A 316 ? 0.2975 0.2850 0.2977 0.0645  0.0003  -0.0153 392  LEU A CB  
1972 C  CG  . LEU A 316 ? 0.2993 0.2892 0.3010 0.0603  0.0014  -0.0184 392  LEU A CG  
1973 C  CD1 . LEU A 316 ? 0.2460 0.2530 0.2602 0.0550  -0.0002 -0.0177 392  LEU A CD1 
1974 C  CD2 . LEU A 316 ? 0.3311 0.3184 0.3286 0.0678  0.0060  -0.0185 392  LEU A CD2 
1975 N  N   . LEU A 317 ? 0.3024 0.2673 0.2870 0.0709  -0.0027 -0.0105 393  LEU A N   
1976 C  CA  . LEU A 317 ? 0.3097 0.2734 0.2928 0.0774  -0.0037 -0.0060 393  LEU A CA  
1977 C  C   . LEU A 317 ? 0.3613 0.3035 0.3293 0.0859  -0.0010 -0.0057 393  LEU A C   
1978 O  O   . LEU A 317 ? 0.3846 0.3278 0.3528 0.0966  0.0005  -0.0015 393  LEU A O   
1979 C  CB  . LEU A 317 ? 0.2758 0.2393 0.2585 0.0696  -0.0079 -0.0051 393  LEU A CB  
1980 C  CG  . LEU A 317 ? 0.3138 0.2976 0.3096 0.0635  -0.0104 -0.0043 393  LEU A CG  
1981 C  CD1 . LEU A 317 ? 0.3059 0.2866 0.2983 0.0558  -0.0136 -0.0040 393  LEU A CD1 
1982 C  CD2 . LEU A 317 ? 0.2949 0.2960 0.3010 0.0701  -0.0109 0.0006  393  LEU A CD2 
1983 N  N   . THR A 318 ? 0.3756 0.2977 0.3298 0.0815  -0.0004 -0.0098 394  THR A N   
1984 C  CA  . THR A 318 ? 0.3872 0.2850 0.3237 0.0891  0.0023  -0.0101 394  THR A CA  
1985 C  C   . THR A 318 ? 0.4175 0.3171 0.3542 0.1007  0.0080  -0.0100 394  THR A C   
1986 O  O   . THR A 318 ? 0.4244 0.3073 0.3486 0.1113  0.0113  -0.0088 394  THR A O   
1987 C  CB  . THR A 318 ? 0.4041 0.2795 0.3244 0.0800  0.0011  -0.0144 394  THR A CB  
1988 O  OG1 . THR A 318 ? 0.3983 0.2780 0.3207 0.0759  0.0025  -0.0183 394  THR A OG1 
1989 C  CG2 . THR A 318 ? 0.3900 0.2659 0.3113 0.0680  -0.0036 -0.0142 394  THR A CG2 
1990 N  N   . THR A 319 ? 0.4032 0.3219 0.3526 0.0995  0.0095  -0.0110 395  THR A N   
1991 C  CA  . THR A 319 ? 0.4263 0.3476 0.3755 0.1100  0.0156  -0.0109 395  THR A CA  
1992 C  C   . THR A 319 ? 0.4272 0.3682 0.3900 0.1214  0.0178  -0.0048 395  THR A C   
1993 O  O   . THR A 319 ? 0.4167 0.3583 0.3780 0.1329  0.0239  -0.0037 395  THR A O   
1994 C  CB  . THR A 319 ? 0.4222 0.3545 0.3779 0.1035  0.0165  -0.0142 395  THR A CB  
1995 O  OG1 . THR A 319 ? 0.3948 0.3539 0.3703 0.0988  0.0139  -0.0117 395  THR A OG1 
1996 C  CG2 . THR A 319 ? 0.3997 0.3164 0.3446 0.0916  0.0133  -0.0191 395  THR A CG2 
1997 N  N   . GLU A 320 ? 0.3875 0.3449 0.3629 0.1188  0.0132  -0.0007 396  GLU A N   
1998 C  CA  . GLU A 320 ? 0.3800 0.3597 0.3700 0.1281  0.0141  0.0060  396  GLU A CA  
1999 C  C   . GLU A 320 ? 0.3949 0.3738 0.3852 0.1297  0.0094  0.0108  396  GLU A C   
2000 O  O   . GLU A 320 ? 0.3468 0.3385 0.3459 0.1205  0.0038  0.0122  396  GLU A O   
2001 C  CB  . GLU A 320 ? 0.3509 0.3594 0.3599 0.1215  0.0126  0.0073  396  GLU A CB  
2002 C  CG  . GLU A 320 ? 0.3603 0.3726 0.3704 0.1212  0.0175  0.0040  396  GLU A CG  
2003 C  CD  . GLU A 320 ? 0.4102 0.4239 0.4190 0.1360  0.0252  0.0065  396  GLU A CD  
2004 O  OE1 . GLU A 320 ? 0.4114 0.4291 0.4229 0.1474  0.0265  0.0119  396  GLU A OE1 
2005 O  OE2 . GLU A 320 ? 0.3900 0.4010 0.3949 0.1367  0.0301  0.0032  396  GLU A OE2 
2006 N  N   . PRO A 321 ? 0.4368 0.3996 0.4162 0.1415  0.0118  0.0135  397  PRO A N   
2007 C  CA  . PRO A 321 ? 0.4514 0.4127 0.4301 0.1437  0.0071  0.0188  397  PRO A CA  
2008 C  C   . PRO A 321 ? 0.4322 0.4251 0.4313 0.1447  0.0034  0.0257  397  PRO A C   
2009 O  O   . PRO A 321 ? 0.4180 0.4143 0.4187 0.1387  -0.0028 0.0285  397  PRO A O   
2010 C  CB  . PRO A 321 ? 0.5030 0.4424 0.4670 0.1593  0.0118  0.0209  397  PRO A CB  
2011 C  CG  . PRO A 321 ? 0.5018 0.4208 0.4515 0.1600  0.0177  0.0141  397  PRO A CG  
2012 C  CD  . PRO A 321 ? 0.4448 0.3862 0.4090 0.1528  0.0187  0.0113  397  PRO A CD  
2013 N  N   . SER A 322 ? 0.4175 0.4339 0.4316 0.1511  0.0067  0.0289  398  SER A N   
2014 C  CA  . SER A 322 ? 0.3985 0.4461 0.4318 0.1508  0.0024  0.0363  398  SER A CA  
2015 C  C   . SER A 322 ? 0.3632 0.4225 0.4033 0.1335  -0.0040 0.0340  398  SER A C   
2016 O  O   . SER A 322 ? 0.3588 0.4345 0.4078 0.1294  -0.0100 0.0392  398  SER A O   
2017 C  CB  . SER A 322 ? 0.4395 0.5111 0.4877 0.1603  0.0077  0.0405  398  SER A CB  
2018 O  OG  . SER A 322 ? 0.4681 0.5465 0.5204 0.1517  0.0101  0.0353  398  SER A OG  
2019 N  N   . VAL A 323 ? 0.3252 0.3758 0.3606 0.1235  -0.0027 0.0265  399  VAL A N   
2020 C  CA  . VAL A 323 ? 0.3065 0.3644 0.3459 0.1082  -0.0079 0.0238  399  VAL A CA  
2021 C  C   . VAL A 323 ? 0.3161 0.3587 0.3451 0.1021  -0.0127 0.0229  399  VAL A C   
2022 O  O   . VAL A 323 ? 0.3108 0.3632 0.3439 0.0937  -0.0181 0.0247  399  VAL A O   
2023 C  CB  . VAL A 323 ? 0.3214 0.3741 0.3587 0.1007  -0.0050 0.0167  399  VAL A CB  
2024 C  CG1 . VAL A 323 ? 0.2753 0.3311 0.3142 0.0863  -0.0097 0.0136  399  VAL A CG1 
2025 C  CG2 . VAL A 323 ? 0.3085 0.3787 0.3566 0.1052  -0.0007 0.0183  399  VAL A CG2 
2026 N  N   . VAL A 324 ? 0.3395 0.3570 0.3533 0.1056  -0.0106 0.0203  400  VAL A N   
2027 C  CA  . VAL A 324 ? 0.3536 0.3559 0.3565 0.0998  -0.0146 0.0199  400  VAL A CA  
2028 C  C   . VAL A 324 ? 0.3618 0.3731 0.3682 0.1043  -0.0191 0.0276  400  VAL A C   
2029 O  O   . VAL A 324 ? 0.3747 0.3874 0.3795 0.0958  -0.0241 0.0286  400  VAL A O   
2030 C  CB  . VAL A 324 ? 0.3652 0.3384 0.3503 0.1025  -0.0116 0.0164  400  VAL A CB  
2031 C  CG1 . VAL A 324 ? 0.4137 0.3716 0.3873 0.0990  -0.0154 0.0181  400  VAL A CG1 
2032 C  CG2 . VAL A 324 ? 0.3529 0.3179 0.3340 0.0941  -0.0093 0.0090  400  VAL A CG2 
2033 N  N   . ALA A 325 ? 0.3602 0.3780 0.3711 0.1179  -0.0173 0.0334  401  ALA A N   
2034 C  CA  . ALA A 325 ? 0.3893 0.4179 0.4049 0.1232  -0.0221 0.0418  401  ALA A CA  
2035 C  C   . ALA A 325 ? 0.3497 0.4049 0.3794 0.1137  -0.0279 0.0449  401  ALA A C   
2036 O  O   . ALA A 325 ? 0.3516 0.4092 0.3793 0.1085  -0.0340 0.0484  401  ALA A O   
2037 C  CB  . ALA A 325 ? 0.3915 0.4257 0.4120 0.1410  -0.0183 0.0480  401  ALA A CB  
2038 N  N   . LYS A 326 ? 0.3383 0.4121 0.3806 0.1107  -0.0261 0.0435  402  LYS A N   
2039 C  CA  . LYS A 326 ? 0.3598 0.4570 0.4137 0.1005  -0.0316 0.0461  402  LYS A CA  
2040 C  C   . LYS A 326 ? 0.3487 0.4355 0.3938 0.0853  -0.0349 0.0402  402  LYS A C   
2041 O  O   . LYS A 326 ? 0.3623 0.4588 0.4090 0.0770  -0.0410 0.0430  402  LYS A O   
2042 C  CB  . LYS A 326 ? 0.3753 0.4923 0.4429 0.1005  -0.0283 0.0459  402  LYS A CB  
2043 C  CG  . LYS A 326 ? 0.4602 0.6043 0.5410 0.0922  -0.0342 0.0510  402  LYS A CG  
2044 C  CD  . LYS A 326 ? 0.5044 0.6718 0.6008 0.0968  -0.0306 0.0546  402  LYS A CD  
2045 C  CE  . LYS A 326 ? 0.5399 0.7346 0.6489 0.0869  -0.0373 0.0604  402  LYS A CE  
2046 N  NZ  . LYS A 326 ? 0.5511 0.7720 0.6768 0.0913  -0.0341 0.0655  402  LYS A NZ  
2047 N  N   . LEU A 327 ? 0.3232 0.3904 0.3585 0.0818  -0.0308 0.0324  403  LEU A N   
2048 C  CA  . LEU A 327 ? 0.2867 0.3438 0.3138 0.0692  -0.0327 0.0272  403  LEU A CA  
2049 C  C   . LEU A 327 ? 0.3154 0.3611 0.3317 0.0676  -0.0365 0.0296  403  LEU A C   
2050 O  O   . LEU A 327 ? 0.3023 0.3503 0.3156 0.0580  -0.0405 0.0295  403  LEU A O   
2051 C  CB  . LEU A 327 ? 0.2891 0.3304 0.3100 0.0669  -0.0275 0.0195  403  LEU A CB  
2052 C  CG  . LEU A 327 ? 0.2933 0.3257 0.3076 0.0553  -0.0278 0.0137  403  LEU A CG  
2053 C  CD1 . LEU A 327 ? 0.2760 0.3229 0.2968 0.0467  -0.0305 0.0133  403  LEU A CD1 
2054 C  CD2 . LEU A 327 ? 0.2747 0.2955 0.2857 0.0547  -0.0230 0.0076  403  LEU A CD2 
2055 N  N   . GLN A 328 ? 0.3215 0.3531 0.3303 0.0767  -0.0352 0.0320  404  GLN A N   
2056 C  CA  . GLN A 328 ? 0.3109 0.3307 0.3085 0.0755  -0.0389 0.0351  404  GLN A CA  
2057 C  C   . GLN A 328 ? 0.3663 0.4036 0.3699 0.0748  -0.0456 0.0426  404  GLN A C   
2058 O  O   . GLN A 328 ? 0.3675 0.4006 0.3631 0.0673  -0.0499 0.0438  404  GLN A O   
2059 C  CB  . GLN A 328 ? 0.3332 0.3340 0.3211 0.0866  -0.0364 0.0371  404  GLN A CB  
2060 C  CG  . GLN A 328 ? 0.3720 0.3502 0.3484 0.0840  -0.0315 0.0302  404  GLN A CG  
2061 C  CD  . GLN A 328 ? 0.4231 0.3815 0.3889 0.0955  -0.0285 0.0318  404  GLN A CD  
2062 O  OE1 . GLN A 328 ? 0.4270 0.3907 0.3969 0.1080  -0.0284 0.0375  404  GLN A OE1 
2063 N  NE2 . GLN A 328 ? 0.4583 0.3936 0.4101 0.0914  -0.0261 0.0270  404  GLN A NE2 
2064 N  N   . GLU A 329 ? 0.3928 0.4507 0.4103 0.0821  -0.0466 0.0480  405  GLU A N   
2065 C  CA  . GLU A 329 ? 0.4054 0.4831 0.4302 0.0810  -0.0537 0.0561  405  GLU A CA  
2066 C  C   . GLU A 329 ? 0.3743 0.4602 0.3988 0.0654  -0.0581 0.0536  405  GLU A C   
2067 O  O   . GLU A 329 ? 0.3719 0.4604 0.3913 0.0595  -0.0646 0.0576  405  GLU A O   
2068 C  CB  . GLU A 329 ? 0.4522 0.5534 0.4942 0.0914  -0.0531 0.0624  405  GLU A CB  
2069 C  CG  . GLU A 329 ? 0.5747 0.7004 0.6270 0.0910  -0.0609 0.0723  405  GLU A CG  
2070 C  CD  . GLU A 329 ? 0.6852 0.8295 0.7522 0.1066  -0.0593 0.0807  405  GLU A CD  
2071 O  OE1 . GLU A 329 ? 0.7231 0.8949 0.8039 0.1060  -0.0650 0.0891  405  GLU A OE1 
2072 O  OE2 . GLU A 329 ? 0.7245 0.8557 0.7886 0.1195  -0.0522 0.0790  405  GLU A OE2 
2073 N  N   . GLU A 330 ? 0.3274 0.4153 0.3553 0.0586  -0.0547 0.0468  406  GLU A N   
2074 C  CA  . GLU A 330 ? 0.3122 0.4048 0.3378 0.0445  -0.0580 0.0439  406  GLU A CA  
2075 C  C   . GLU A 330 ? 0.3218 0.3944 0.3310 0.0366  -0.0581 0.0392  406  GLU A C   
2076 O  O   . GLU A 330 ? 0.3474 0.4214 0.3499 0.0278  -0.0632 0.0407  406  GLU A O   
2077 C  CB  . GLU A 330 ? 0.3049 0.4026 0.3373 0.0404  -0.0539 0.0381  406  GLU A CB  
2078 C  CG  . GLU A 330 ? 0.2833 0.3787 0.3093 0.0264  -0.0559 0.0335  406  GLU A CG  
2079 C  CD  . GLU A 330 ? 0.2636 0.3632 0.2957 0.0226  -0.0522 0.0285  406  GLU A CD  
2080 O  OE1 . GLU A 330 ? 0.2710 0.3564 0.2979 0.0215  -0.0469 0.0215  406  GLU A OE1 
2081 O  OE2 . GLU A 330 ? 0.2685 0.3861 0.3105 0.0203  -0.0549 0.0322  406  GLU A OE2 
2082 N  N   . VAL A 331 ? 0.3076 0.3617 0.3096 0.0391  -0.0523 0.0338  407  VAL A N   
2083 C  CA  . VAL A 331 ? 0.3678 0.4054 0.3559 0.0311  -0.0513 0.0294  407  VAL A CA  
2084 C  C   . VAL A 331 ? 0.3679 0.3994 0.3459 0.0313  -0.0561 0.0350  407  VAL A C   
2085 O  O   . VAL A 331 ? 0.3879 0.4142 0.3556 0.0223  -0.0582 0.0340  407  VAL A O   
2086 C  CB  . VAL A 331 ? 0.3839 0.4057 0.3679 0.0328  -0.0446 0.0232  407  VAL A CB  
2087 C  CG1 . VAL A 331 ? 0.3836 0.4115 0.3765 0.0316  -0.0406 0.0179  407  VAL A CG1 
2088 C  CG2 . VAL A 331 ? 0.4314 0.4435 0.4133 0.0433  -0.0431 0.0261  407  VAL A CG2 
2089 N  N   . ASP A 332 ? 0.3632 0.3946 0.3432 0.0418  -0.0576 0.0412  408  ASP A N   
2090 C  CA  . ASP A 332 ? 0.3713 0.3975 0.3420 0.0427  -0.0629 0.0477  408  ASP A CA  
2091 C  C   . ASP A 332 ? 0.3766 0.4190 0.3493 0.0359  -0.0705 0.0525  408  ASP A C   
2092 O  O   . ASP A 332 ? 0.4325 0.4686 0.3932 0.0296  -0.0747 0.0547  408  ASP A O   
2093 C  CB  . ASP A 332 ? 0.3917 0.4159 0.3652 0.0569  -0.0632 0.0541  408  ASP A CB  
2094 C  CG  . ASP A 332 ? 0.4227 0.4244 0.3875 0.0620  -0.0571 0.0500  408  ASP A CG  
2095 O  OD1 . ASP A 332 ? 0.4250 0.4139 0.3817 0.0536  -0.0535 0.0433  408  ASP A OD1 
2096 O  OD2 . ASP A 332 ? 0.4270 0.4238 0.3927 0.0744  -0.0558 0.0538  408  ASP A OD2 
2097 N  N   . SER A 333 ? 0.3434 0.4066 0.3303 0.0362  -0.0725 0.0544  409  SER A N   
2098 C  CA  . SER A 333 ? 0.3977 0.4780 0.3872 0.0292  -0.0807 0.0601  409  SER A CA  
2099 C  C   . SER A 333 ? 0.3894 0.4653 0.3695 0.0142  -0.0813 0.0538  409  SER A C   
2100 O  O   . SER A 333 ? 0.3737 0.4505 0.3444 0.0057  -0.0877 0.0567  409  SER A O   
2101 C  CB  . SER A 333 ? 0.4352 0.5407 0.4440 0.0348  -0.0827 0.0654  409  SER A CB  
2102 O  OG  . SER A 333 ? 0.5173 0.6408 0.5291 0.0258  -0.0911 0.0708  409  SER A OG  
2103 N  N   . VAL A 334 ? 0.3270 0.3969 0.3082 0.0112  -0.0746 0.0453  410  VAL A N   
2104 C  CA  . VAL A 334 ? 0.3381 0.4047 0.3116 -0.0013 -0.0745 0.0395  410  VAL A CA  
2105 C  C   . VAL A 334 ? 0.3450 0.3908 0.3012 -0.0069 -0.0708 0.0338  410  VAL A C   
2106 O  O   . VAL A 334 ? 0.3797 0.4208 0.3231 -0.0166 -0.0738 0.0330  410  VAL A O   
2107 C  CB  . VAL A 334 ? 0.3194 0.3912 0.3032 -0.0014 -0.0695 0.0340  410  VAL A CB  
2108 C  CG1 . VAL A 334 ? 0.2938 0.3565 0.2671 -0.0128 -0.0678 0.0270  410  VAL A CG1 
2109 C  CG2 . VAL A 334 ? 0.2998 0.3944 0.2995 0.0011  -0.0736 0.0401  410  VAL A CG2 
2110 N  N   . ILE A 335 ? 0.3254 0.3585 0.2801 -0.0015 -0.0640 0.0299  411  ILE A N   
2111 C  CA  . ILE A 335 ? 0.3538 0.3699 0.2942 -0.0070 -0.0595 0.0247  411  ILE A CA  
2112 C  C   . ILE A 335 ? 0.3681 0.3727 0.2997 -0.0036 -0.0596 0.0281  411  ILE A C   
2113 O  O   . ILE A 335 ? 0.3547 0.3477 0.2721 -0.0099 -0.0580 0.0262  411  ILE A O   
2114 C  CB  . ILE A 335 ? 0.3458 0.3561 0.2898 -0.0068 -0.0513 0.0168  411  ILE A CB  
2115 C  CG1 . ILE A 335 ? 0.3216 0.3315 0.2757 0.0028  -0.0480 0.0170  411  ILE A CG1 
2116 C  CG2 . ILE A 335 ? 0.3401 0.3575 0.2885 -0.0117 -0.0509 0.0130  411  ILE A CG2 
2117 C  CD1 . ILE A 335 ? 0.3299 0.3311 0.2842 0.0023  -0.0405 0.0103  411  ILE A CD1 
2118 N  N   . GLY A 336 ? 0.3758 0.3819 0.3138 0.0060  -0.0611 0.0331  412  GLY A N   
2119 C  CA  . GLY A 336 ? 0.3902 0.3816 0.3180 0.0090  -0.0605 0.0357  412  GLY A CA  
2120 C  C   . GLY A 336 ? 0.4066 0.3838 0.3271 0.0046  -0.0532 0.0291  412  GLY A C   
2121 O  O   . GLY A 336 ? 0.3976 0.3753 0.3257 0.0059  -0.0478 0.0238  412  GLY A O   
2122 N  N   . ASP A 337 ? 0.4040 0.3697 0.3096 -0.0013 -0.0529 0.0298  413  ASP A N   
2123 C  CA  . ASP A 337 ? 0.3809 0.3352 0.2795 -0.0063 -0.0461 0.0248  413  ASP A CA  
2124 C  C   . ASP A 337 ? 0.3763 0.3333 0.2723 -0.0143 -0.0419 0.0187  413  ASP A C   
2125 O  O   . ASP A 337 ? 0.3891 0.3391 0.2796 -0.0185 -0.0358 0.0151  413  ASP A O   
2126 C  CB  . ASP A 337 ? 0.3676 0.3080 0.2510 -0.0088 -0.0471 0.0289  413  ASP A CB  
2127 C  CG  . ASP A 337 ? 0.4284 0.3612 0.3118 -0.0003 -0.0499 0.0344  413  ASP A CG  
2128 O  OD1 . ASP A 337 ? 0.4125 0.3460 0.3057 0.0062  -0.0477 0.0326  413  ASP A OD1 
2129 O  OD2 . ASP A 337 ? 0.4707 0.3955 0.3430 0.0000  -0.0543 0.0405  413  ASP A OD2 
2130 N  N   . ARG A 338 ? 0.3215 0.2883 0.2210 -0.0163 -0.0447 0.0177  414  ARG A N   
2131 C  CA  . ARG A 338 ? 0.3435 0.3094 0.2368 -0.0236 -0.0409 0.0122  414  ARG A CA  
2132 C  C   . ARG A 338 ? 0.3669 0.3345 0.2698 -0.0220 -0.0337 0.0057  414  ARG A C   
2133 O  O   . ARG A 338 ? 0.3223 0.2958 0.2386 -0.0162 -0.0335 0.0054  414  ARG A O   
2134 C  CB  . ARG A 338 ? 0.3390 0.3126 0.2310 -0.0274 -0.0469 0.0133  414  ARG A CB  
2135 C  CG  . ARG A 338 ? 0.4023 0.3734 0.2806 -0.0322 -0.0539 0.0188  414  ARG A CG  
2136 C  CD  . ARG A 338 ? 0.4474 0.4239 0.3210 -0.0392 -0.0590 0.0185  414  ARG A CD  
2137 N  NE  . ARG A 338 ? 0.4652 0.4572 0.3548 -0.0357 -0.0641 0.0211  414  ARG A NE  
2138 C  CZ  . ARG A 338 ? 0.4730 0.4700 0.3714 -0.0360 -0.0613 0.0165  414  ARG A CZ  
2139 N  NH1 . ARG A 338 ? 0.4431 0.4307 0.3361 -0.0387 -0.0536 0.0089  414  ARG A NH1 
2140 N  NH2 . ARG A 338 ? 0.4378 0.4501 0.3506 -0.0332 -0.0659 0.0199  414  ARG A NH2 
2141 N  N   . PHE A 339 ? 0.3787 0.3413 0.2741 -0.0270 -0.0276 0.0009  415  PHE A N   
2142 C  CA  . PHE A 339 ? 0.3563 0.3220 0.2596 -0.0261 -0.0218 -0.0050 415  PHE A CA  
2143 C  C   . PHE A 339 ? 0.3336 0.3051 0.2400 -0.0270 -0.0259 -0.0060 415  PHE A C   
2144 O  O   . PHE A 339 ? 0.3519 0.3204 0.2465 -0.0326 -0.0292 -0.0056 415  PHE A O   
2145 C  CB  . PHE A 339 ? 0.3335 0.2924 0.2269 -0.0302 -0.0141 -0.0093 415  PHE A CB  
2146 C  CG  . PHE A 339 ? 0.3677 0.3224 0.2576 -0.0310 -0.0095 -0.0080 415  PHE A CG  
2147 C  CD1 . PHE A 339 ? 0.3537 0.3119 0.2550 -0.0279 -0.0053 -0.0089 415  PHE A CD1 
2148 C  CD2 . PHE A 339 ? 0.3947 0.3418 0.2690 -0.0359 -0.0096 -0.0056 415  PHE A CD2 
2149 C  CE1 . PHE A 339 ? 0.3808 0.3357 0.2787 -0.0302 -0.0015 -0.0072 415  PHE A CE1 
2150 C  CE2 . PHE A 339 ? 0.4017 0.3452 0.2724 -0.0377 -0.0053 -0.0040 415  PHE A CE2 
2151 C  CZ  . PHE A 339 ? 0.3987 0.3464 0.2814 -0.0352 -0.0013 -0.0047 415  PHE A CZ  
2152 N  N   . PRO A 340 ? 0.3219 0.3010 0.2423 -0.0226 -0.0261 -0.0072 416  PRO A N   
2153 C  CA  . PRO A 340 ? 0.3331 0.3180 0.2561 -0.0248 -0.0298 -0.0078 416  PRO A CA  
2154 C  C   . PRO A 340 ? 0.3639 0.3405 0.2748 -0.0306 -0.0263 -0.0129 416  PRO A C   
2155 O  O   . PRO A 340 ? 0.3545 0.3240 0.2610 -0.0303 -0.0189 -0.0170 416  PRO A O   
2156 C  CB  . PRO A 340 ? 0.3182 0.3107 0.2574 -0.0189 -0.0282 -0.0090 416  PRO A CB  
2157 C  CG  . PRO A 340 ? 0.3036 0.2955 0.2485 -0.0132 -0.0266 -0.0071 416  PRO A CG  
2158 C  CD  . PRO A 340 ? 0.2865 0.2689 0.2199 -0.0164 -0.0232 -0.0077 416  PRO A CD  
2159 N  N   . THR A 341 ? 0.3391 0.3166 0.2443 -0.0361 -0.0316 -0.0122 417  THR A N   
2160 C  CA  . THR A 341 ? 0.3954 0.3626 0.2871 -0.0419 -0.0289 -0.0172 417  THR A CA  
2161 C  C   . THR A 341 ? 0.3965 0.3682 0.2958 -0.0425 -0.0306 -0.0187 417  THR A C   
2162 O  O   . THR A 341 ? 0.3773 0.3617 0.2924 -0.0388 -0.0340 -0.0155 417  THR A O   
2163 C  CB  . THR A 341 ? 0.4376 0.3979 0.3105 -0.0504 -0.0341 -0.0155 417  THR A CB  
2164 O  OG1 . THR A 341 ? 0.4933 0.4645 0.3711 -0.0540 -0.0439 -0.0102 417  THR A OG1 
2165 C  CG2 . THR A 341 ? 0.4323 0.3890 0.2979 -0.0500 -0.0333 -0.0129 417  THR A CG2 
2166 N  N   . ILE A 342 ? 0.4323 0.3923 0.3189 -0.0472 -0.0279 -0.0235 418  ILE A N   
2167 C  CA  . ILE A 342 ? 0.4499 0.4113 0.3404 -0.0495 -0.0299 -0.0247 418  ILE A CA  
2168 C  C   . ILE A 342 ? 0.4298 0.4039 0.3250 -0.0550 -0.0401 -0.0188 418  ILE A C   
2169 O  O   . ILE A 342 ? 0.3837 0.3689 0.2925 -0.0537 -0.0425 -0.0169 418  ILE A O   
2170 C  CB  . ILE A 342 ? 0.4699 0.4123 0.3411 -0.0543 -0.0256 -0.0307 418  ILE A CB  
2171 C  CG1 . ILE A 342 ? 0.4843 0.4258 0.3575 -0.0576 -0.0279 -0.0319 418  ILE A CG1 
2172 C  CG2 . ILE A 342 ? 0.4949 0.4260 0.3439 -0.0631 -0.0289 -0.0307 418  ILE A CG2 
2173 C  CD1 . ILE A 342 ? 0.4735 0.4236 0.3659 -0.0492 -0.0241 -0.0324 418  ILE A CD1 
2174 N  N   . GLN A 343 ? 0.4101 0.3844 0.2952 -0.0608 -0.0462 -0.0151 419  GLN A N   
2175 C  CA  . GLN A 343 ? 0.4420 0.4315 0.3332 -0.0658 -0.0564 -0.0083 419  GLN A CA  
2176 C  C   . GLN A 343 ? 0.4190 0.4277 0.3329 -0.0568 -0.0580 -0.0028 419  GLN A C   
2177 O  O   . GLN A 343 ? 0.4350 0.4594 0.3606 -0.0579 -0.0637 0.0021  419  GLN A O   
2178 C  CB  . GLN A 343 ? 0.5263 0.5125 0.4019 -0.0734 -0.0629 -0.0048 419  GLN A CB  
2179 C  CG  . GLN A 343 ? 0.5916 0.5592 0.4420 -0.0847 -0.0637 -0.0091 419  GLN A CG  
2180 C  CD  . GLN A 343 ? 0.6115 0.5582 0.4464 -0.0821 -0.0535 -0.0165 419  GLN A CD  
2181 O  OE1 . GLN A 343 ? 0.5848 0.5324 0.4265 -0.0736 -0.0473 -0.0172 419  GLN A OE1 
2182 N  NE2 . GLN A 343 ? 0.6551 0.5826 0.4683 -0.0896 -0.0514 -0.0219 419  GLN A NE2 
2183 N  N   . ASP A 344 ? 0.3906 0.3979 0.3102 -0.0479 -0.0529 -0.0034 420  ASP A N   
2184 C  CA  . ASP A 344 ? 0.3645 0.3858 0.3025 -0.0388 -0.0536 0.0011  420  ASP A CA  
2185 C  C   . ASP A 344 ? 0.3667 0.3947 0.3190 -0.0342 -0.0502 -0.0008 420  ASP A C   
2186 O  O   . ASP A 344 ? 0.3574 0.3989 0.3244 -0.0280 -0.0519 0.0034  420  ASP A O   
2187 C  CB  . ASP A 344 ? 0.3470 0.3615 0.2840 -0.0321 -0.0490 0.0006  420  ASP A CB  
2188 C  CG  . ASP A 344 ? 0.4030 0.4126 0.3272 -0.0356 -0.0529 0.0040  420  ASP A CG  
2189 O  OD1 . ASP A 344 ? 0.4054 0.4244 0.3299 -0.0384 -0.0610 0.0102  420  ASP A OD1 
2190 O  OD2 . ASP A 344 ? 0.4096 0.4069 0.3236 -0.0358 -0.0480 0.0011  420  ASP A OD2 
2191 N  N   . MET A 345 ? 0.3754 0.3937 0.3231 -0.0366 -0.0453 -0.0070 421  MET A N   
2192 C  CA  . MET A 345 ? 0.3746 0.3982 0.3348 -0.0324 -0.0422 -0.0086 421  MET A CA  
2193 C  C   . MET A 345 ? 0.3812 0.4201 0.3505 -0.0355 -0.0481 -0.0039 421  MET A C   
2194 O  O   . MET A 345 ? 0.3653 0.4146 0.3487 -0.0299 -0.0467 -0.0024 421  MET A O   
2195 C  CB  . MET A 345 ? 0.3810 0.3904 0.3332 -0.0345 -0.0363 -0.0154 421  MET A CB  
2196 C  CG  . MET A 345 ? 0.3630 0.3606 0.3093 -0.0304 -0.0293 -0.0197 421  MET A CG  
2197 S  SD  . MET A 345 ? 0.3667 0.3709 0.3280 -0.0202 -0.0254 -0.0187 421  MET A SD  
2198 C  CE  . MET A 345 ? 0.3272 0.3308 0.2826 -0.0202 -0.0281 -0.0148 421  MET A CE  
2199 N  N   . LYS A 346 ? 0.3581 0.3991 0.3191 -0.0451 -0.0546 -0.0012 422  LYS A N   
2200 C  CA  . LYS A 346 ? 0.4194 0.4781 0.3903 -0.0491 -0.0608 0.0045  422  LYS A CA  
2201 C  C   . LYS A 346 ? 0.3793 0.4571 0.3633 -0.0433 -0.0653 0.0125  422  LYS A C   
2202 O  O   . LYS A 346 ? 0.3750 0.4713 0.3735 -0.0416 -0.0677 0.0176  422  LYS A O   
2203 C  CB  . LYS A 346 ? 0.5379 0.5920 0.4944 -0.0630 -0.0670 0.0049  422  LYS A CB  
2204 C  CG  . LYS A 346 ? 0.6482 0.6863 0.5941 -0.0689 -0.0633 -0.0015 422  LYS A CG  
2205 C  CD  . LYS A 346 ? 0.7518 0.7815 0.6797 -0.0835 -0.0697 -0.0013 422  LYS A CD  
2206 C  CE  . LYS A 346 ? 0.8138 0.8231 0.7281 -0.0885 -0.0654 -0.0081 422  LYS A CE  
2207 N  NZ  . LYS A 346 ? 0.8250 0.8429 0.7534 -0.0860 -0.0633 -0.0075 422  LYS A NZ  
2208 N  N   . LYS A 347 ? 0.3418 0.4152 0.3207 -0.0397 -0.0661 0.0140  423  LYS A N   
2209 C  CA  . LYS A 347 ? 0.3567 0.4458 0.3462 -0.0333 -0.0704 0.0219  423  LYS A CA  
2210 C  C   . LYS A 347 ? 0.3548 0.4463 0.3567 -0.0198 -0.0646 0.0219  423  LYS A C   
2211 O  O   . LYS A 347 ? 0.3298 0.4367 0.3439 -0.0125 -0.0668 0.0285  423  LYS A O   
2212 C  CB  . LYS A 347 ? 0.3844 0.4664 0.3610 -0.0361 -0.0746 0.0242  423  LYS A CB  
2213 C  CG  . LYS A 347 ? 0.3647 0.4460 0.3283 -0.0499 -0.0820 0.0257  423  LYS A CG  
2214 C  CD  . LYS A 347 ? 0.4471 0.5098 0.3901 -0.0546 -0.0821 0.0228  423  LYS A CD  
2215 C  CE  . LYS A 347 ? 0.4683 0.5348 0.4124 -0.0484 -0.0853 0.0290  423  LYS A CE  
2216 N  NZ  . LYS A 347 ? 0.5020 0.5505 0.4249 -0.0540 -0.0852 0.0265  423  LYS A NZ  
2217 N  N   . LEU A 348 ? 0.3211 0.3977 0.3194 -0.0162 -0.0572 0.0150  424  LEU A N   
2218 C  CA  . LEU A 348 ? 0.3010 0.3770 0.3082 -0.0050 -0.0519 0.0144  424  LEU A CA  
2219 C  C   . LEU A 348 ? 0.3069 0.3935 0.3267 -0.0020 -0.0495 0.0141  424  LEU A C   
2220 O  O   . LEU A 348 ? 0.2614 0.3406 0.2823 0.0003  -0.0439 0.0089  424  LEU A O   
2221 C  CB  . LEU A 348 ? 0.2834 0.3409 0.2818 -0.0038 -0.0459 0.0079  424  LEU A CB  
2222 C  CG  . LEU A 348 ? 0.3061 0.3531 0.2929 -0.0047 -0.0469 0.0087  424  LEU A CG  
2223 C  CD1 . LEU A 348 ? 0.3014 0.3330 0.2811 -0.0047 -0.0404 0.0025  424  LEU A CD1 
2224 C  CD2 . LEU A 348 ? 0.2877 0.3391 0.2787 0.0034  -0.0494 0.0149  424  LEU A CD2 
2225 N  N   . LYS A 349 ? 0.3032 0.4088 0.3328 -0.0026 -0.0540 0.0205  425  LYS A N   
2226 C  CA  . LYS A 349 ? 0.3015 0.4191 0.3423 -0.0020 -0.0522 0.0211  425  LYS A CA  
2227 C  C   . LYS A 349 ? 0.2938 0.4116 0.3429 0.0100  -0.0461 0.0203  425  LYS A C   
2228 O  O   . LYS A 349 ? 0.2938 0.4090 0.3454 0.0105  -0.0416 0.0164  425  LYS A O   
2229 C  CB  . LYS A 349 ? 0.3175 0.4580 0.3678 -0.0058 -0.0586 0.0292  425  LYS A CB  
2230 C  CG  . LYS A 349 ? 0.3622 0.5023 0.4029 -0.0199 -0.0654 0.0299  425  LYS A CG  
2231 C  CD  . LYS A 349 ? 0.3952 0.5606 0.4468 -0.0249 -0.0723 0.0386  425  LYS A CD  
2232 C  CE  . LYS A 349 ? 0.4476 0.6101 0.4869 -0.0410 -0.0796 0.0389  425  LYS A CE  
2233 N  NZ  . LYS A 349 ? 0.4786 0.6674 0.5290 -0.0481 -0.0870 0.0479  425  LYS A NZ  
2234 N  N   . TYR A 350 ? 0.2897 0.4090 0.3414 0.0197  -0.0459 0.0241  426  TYR A N   
2235 C  CA  . TYR A 350 ? 0.2789 0.3953 0.3354 0.0310  -0.0400 0.0232  426  TYR A CA  
2236 C  C   . TYR A 350 ? 0.2918 0.3871 0.3389 0.0310  -0.0351 0.0155  426  TYR A C   
2237 O  O   . TYR A 350 ? 0.3089 0.4008 0.3584 0.0350  -0.0302 0.0123  426  TYR A O   
2238 C  CB  . TYR A 350 ? 0.2866 0.4070 0.3459 0.0418  -0.0408 0.0293  426  TYR A CB  
2239 C  CG  . TYR A 350 ? 0.2941 0.4150 0.3591 0.0540  -0.0348 0.0296  426  TYR A CG  
2240 C  CD1 . TYR A 350 ? 0.3166 0.4575 0.3947 0.0584  -0.0333 0.0340  426  TYR A CD1 
2241 C  CD2 . TYR A 350 ? 0.2586 0.3593 0.3145 0.0604  -0.0304 0.0255  426  TYR A CD2 
2242 C  CE1 . TYR A 350 ? 0.3082 0.4481 0.3896 0.0700  -0.0269 0.0340  426  TYR A CE1 
2243 C  CE2 . TYR A 350 ? 0.2588 0.3570 0.3168 0.0711  -0.0248 0.0254  426  TYR A CE2 
2244 C  CZ  . TYR A 350 ? 0.2954 0.4127 0.3657 0.0763  -0.0227 0.0294  426  TYR A CZ  
2245 O  OH  . TYR A 350 ? 0.3114 0.4250 0.3820 0.0874  -0.0163 0.0290  426  TYR A OH  
2246 N  N   . THR A 351 ? 0.2751 0.3570 0.3114 0.0262  -0.0363 0.0127  427  THR A N   
2247 C  CA  . THR A 351 ? 0.2601 0.3252 0.2890 0.0250  -0.0319 0.0061  427  THR A CA  
2248 C  C   . THR A 351 ? 0.2760 0.3413 0.3071 0.0202  -0.0294 0.0016  427  THR A C   
2249 O  O   . THR A 351 ? 0.2626 0.3209 0.2939 0.0229  -0.0252 -0.0022 427  THR A O   
2250 C  CB  . THR A 351 ? 0.2617 0.3154 0.2794 0.0196  -0.0334 0.0045  427  THR A CB  
2251 O  OG1 . THR A 351 ? 0.2704 0.3242 0.2853 0.0233  -0.0366 0.0097  427  THR A OG1 
2252 C  CG2 . THR A 351 ? 0.2738 0.3129 0.2858 0.0195  -0.0286 -0.0009 427  THR A CG2 
2253 N  N   . THR A 352 ? 0.2808 0.3532 0.3125 0.0127  -0.0324 0.0022  428  THR A N   
2254 C  CA  . THR A 352 ? 0.2571 0.3284 0.2897 0.0082  -0.0303 -0.0016 428  THR A CA  
2255 C  C   . THR A 352 ? 0.2268 0.3060 0.2689 0.0137  -0.0275 -0.0007 428  THR A C   
2256 O  O   . THR A 352 ? 0.2308 0.3033 0.2724 0.0144  -0.0238 -0.0048 428  THR A O   
2257 C  CB  . THR A 352 ? 0.3080 0.3846 0.3379 -0.0014 -0.0347 -0.0003 428  THR A CB  
2258 O  OG1 . THR A 352 ? 0.2909 0.3584 0.3096 -0.0064 -0.0369 -0.0014 428  THR A OG1 
2259 C  CG2 . THR A 352 ? 0.3309 0.4030 0.3593 -0.0062 -0.0325 -0.0042 428  THR A CG2 
2260 N  N   . ARG A 353 ? 0.2313 0.3251 0.2818 0.0182  -0.0290 0.0049  429  ARG A N   
2261 C  CA  . ARG A 353 ? 0.2535 0.3556 0.3123 0.0239  -0.0255 0.0060  429  ARG A CA  
2262 C  C   . ARG A 353 ? 0.2662 0.3561 0.3219 0.0320  -0.0206 0.0027  429  ARG A C   
2263 O  O   . ARG A 353 ? 0.2628 0.3513 0.3202 0.0339  -0.0170 0.0005  429  ARG A O   
2264 C  CB  . ARG A 353 ? 0.2653 0.3871 0.3344 0.0283  -0.0274 0.0134  429  ARG A CB  
2265 C  CG  . ARG A 353 ? 0.2973 0.4346 0.3712 0.0190  -0.0324 0.0175  429  ARG A CG  
2266 C  CD  . ARG A 353 ? 0.3148 0.4574 0.3923 0.0139  -0.0305 0.0163  429  ARG A CD  
2267 N  NE  . ARG A 353 ? 0.3173 0.4732 0.3976 0.0032  -0.0360 0.0205  429  ARG A NE  
2268 C  CZ  . ARG A 353 ? 0.2993 0.4452 0.3696 -0.0079 -0.0396 0.0175  429  ARG A CZ  
2269 N  NH1 . ARG A 353 ? 0.2867 0.4111 0.3455 -0.0086 -0.0374 0.0106  429  ARG A NH1 
2270 N  NH2 . ARG A 353 ? 0.2963 0.4534 0.3676 -0.0185 -0.0451 0.0216  429  ARG A NH2 
2271 N  N   . VAL A 354 ? 0.2692 0.3495 0.3193 0.0361  -0.0208 0.0027  430  VAL A N   
2272 C  CA  . VAL A 354 ? 0.2716 0.3377 0.3162 0.0417  -0.0170 -0.0006 430  VAL A CA  
2273 C  C   . VAL A 354 ? 0.2917 0.3478 0.3322 0.0362  -0.0153 -0.0063 430  VAL A C   
2274 O  O   . VAL A 354 ? 0.2472 0.2980 0.2868 0.0388  -0.0122 -0.0088 430  VAL A O   
2275 C  CB  . VAL A 354 ? 0.2681 0.3242 0.3057 0.0450  -0.0183 0.0006  430  VAL A CB  
2276 C  CG1 . VAL A 354 ? 0.2591 0.2977 0.2883 0.0462  -0.0154 -0.0037 430  VAL A CG1 
2277 C  CG2 . VAL A 354 ? 0.2616 0.3253 0.3030 0.0540  -0.0188 0.0065  430  VAL A CG2 
2278 N  N   . MET A 355 ? 0.2878 0.3413 0.3253 0.0289  -0.0172 -0.0082 431  MET A N   
2279 C  CA  . MET A 355 ? 0.2956 0.3416 0.3304 0.0245  -0.0153 -0.0128 431  MET A CA  
2280 C  C   . MET A 355 ? 0.2511 0.3030 0.2908 0.0232  -0.0142 -0.0135 431  MET A C   
2281 O  O   . MET A 355 ? 0.2339 0.2804 0.2730 0.0239  -0.0119 -0.0162 431  MET A O   
2282 C  CB  . MET A 355 ? 0.2888 0.3307 0.3186 0.0181  -0.0168 -0.0144 431  MET A CB  
2283 C  CG  . MET A 355 ? 0.3974 0.4330 0.4253 0.0150  -0.0144 -0.0185 431  MET A CG  
2284 S  SD  . MET A 355 ? 0.5395 0.5711 0.5608 0.0080  -0.0152 -0.0203 431  MET A SD  
2285 C  CE  . MET A 355 ? 0.5048 0.5462 0.5286 0.0041  -0.0188 -0.0173 431  MET A CE  
2286 N  N   . ASN A 356 ? 0.2501 0.3131 0.2941 0.0205  -0.0163 -0.0105 432  ASN A N   
2287 C  CA  . ASN A 356 ? 0.2541 0.3229 0.3021 0.0185  -0.0152 -0.0105 432  ASN A CA  
2288 C  C   . ASN A 356 ? 0.2599 0.3295 0.3108 0.0252  -0.0118 -0.0104 432  ASN A C   
2289 O  O   . ASN A 356 ? 0.2918 0.3574 0.3418 0.0245  -0.0098 -0.0128 432  ASN A O   
2290 C  CB  . ASN A 356 ? 0.2501 0.3331 0.3031 0.0144  -0.0182 -0.0060 432  ASN A CB  
2291 C  CG  . ASN A 356 ? 0.2531 0.3339 0.3009 0.0064  -0.0222 -0.0061 432  ASN A CG  
2292 O  OD1 . ASN A 356 ? 0.2837 0.3753 0.3341 0.0036  -0.0260 -0.0018 432  ASN A OD1 
2293 N  ND2 . ASN A 356 ? 0.2489 0.3161 0.2887 0.0027  -0.0213 -0.0107 432  ASN A ND2 
2294 N  N   . GLU A 357 ? 0.2499 0.3237 0.3030 0.0322  -0.0109 -0.0076 433  GLU A N   
2295 C  CA  . GLU A 357 ? 0.2654 0.3389 0.3192 0.0392  -0.0070 -0.0075 433  GLU A CA  
2296 C  C   . GLU A 357 ? 0.2709 0.3282 0.3167 0.0408  -0.0052 -0.0119 433  GLU A C   
2297 O  O   . GLU A 357 ? 0.2917 0.3456 0.3355 0.0430  -0.0024 -0.0134 433  GLU A O   
2298 C  CB  . GLU A 357 ? 0.2497 0.3310 0.3070 0.0473  -0.0061 -0.0031 433  GLU A CB  
2299 C  CG  . GLU A 357 ? 0.2512 0.3300 0.3069 0.0562  -0.0011 -0.0030 433  GLU A CG  
2300 C  CD  . GLU A 357 ? 0.2753 0.3674 0.3376 0.0565  0.0018  -0.0010 433  GLU A CD  
2301 O  OE1 . GLU A 357 ? 0.2777 0.3749 0.3430 0.0483  0.0001  -0.0016 433  GLU A OE1 
2302 O  OE2 . GLU A 357 ? 0.2934 0.3901 0.3573 0.0651  0.0062  0.0013  433  GLU A OE2 
2303 N  N   . SER A 358 ? 0.2303 0.2779 0.2711 0.0391  -0.0068 -0.0137 434  SER A N   
2304 C  CA  . SER A 358 ? 0.2439 0.2781 0.2780 0.0386  -0.0059 -0.0172 434  SER A CA  
2305 C  C   . SER A 358 ? 0.2479 0.2815 0.2831 0.0338  -0.0057 -0.0197 434  SER A C   
2306 O  O   . SER A 358 ? 0.2536 0.2813 0.2855 0.0346  -0.0044 -0.0214 434  SER A O   
2307 C  CB  . SER A 358 ? 0.2541 0.2807 0.2837 0.0364  -0.0076 -0.0179 434  SER A CB  
2308 O  OG  . SER A 358 ? 0.2600 0.2757 0.2840 0.0348  -0.0071 -0.0206 434  SER A OG  
2309 N  N   . LEU A 359 ? 0.2547 0.2932 0.2931 0.0288  -0.0072 -0.0198 435  LEU A N   
2310 C  CA  . LEU A 359 ? 0.2573 0.2940 0.2961 0.0253  -0.0069 -0.0217 435  LEU A CA  
2311 C  C   . LEU A 359 ? 0.2561 0.2974 0.2969 0.0263  -0.0055 -0.0208 435  LEU A C   
2312 O  O   . LEU A 359 ? 0.2354 0.2727 0.2748 0.0251  -0.0050 -0.0222 435  LEU A O   
2313 C  CB  . LEU A 359 ? 0.2487 0.2865 0.2880 0.0202  -0.0082 -0.0221 435  LEU A CB  
2314 C  CG  . LEU A 359 ? 0.2536 0.2843 0.2898 0.0187  -0.0081 -0.0242 435  LEU A CG  
2315 C  CD1 . LEU A 359 ? 0.2618 0.2921 0.2957 0.0147  -0.0089 -0.0246 435  LEU A CD1 
2316 C  CD2 . LEU A 359 ? 0.2048 0.2313 0.2413 0.0188  -0.0071 -0.0259 435  LEU A CD2 
2317 N  N   . ARG A 360 ? 0.2407 0.2911 0.2849 0.0286  -0.0048 -0.0180 436  ARG A N   
2318 C  CA  . ARG A 360 ? 0.2673 0.3225 0.3130 0.0300  -0.0025 -0.0168 436  ARG A CA  
2319 C  C   . ARG A 360 ? 0.2729 0.3194 0.3128 0.0347  -0.0002 -0.0186 436  ARG A C   
2320 O  O   . ARG A 360 ? 0.2416 0.2843 0.2787 0.0334  0.0006  -0.0198 436  ARG A O   
2321 C  CB  . ARG A 360 ? 0.2670 0.3365 0.3189 0.0321  -0.0016 -0.0127 436  ARG A CB  
2322 C  CG  . ARG A 360 ? 0.2532 0.3295 0.3070 0.0333  0.0016  -0.0110 436  ARG A CG  
2323 C  CD  . ARG A 360 ? 0.2229 0.3162 0.2845 0.0363  0.0032  -0.0061 436  ARG A CD  
2324 N  NE  . ARG A 360 ? 0.2387 0.3319 0.3000 0.0458  0.0058  -0.0050 436  ARG A NE  
2325 C  CZ  . ARG A 360 ? 0.2721 0.3610 0.3290 0.0530  0.0107  -0.0057 436  ARG A CZ  
2326 N  NH1 . ARG A 360 ? 0.2483 0.3342 0.3015 0.0514  0.0133  -0.0072 436  ARG A NH1 
2327 N  NH2 . ARG A 360 ? 0.2758 0.3618 0.3305 0.0621  0.0131  -0.0048 436  ARG A NH2 
2328 N  N   . LEU A 361 ? 0.2438 0.2856 0.2804 0.0397  0.0007  -0.0187 437  LEU A N   
2329 C  CA  . LEU A 361 ? 0.2575 0.2888 0.2859 0.0439  0.0029  -0.0204 437  LEU A CA  
2330 C  C   . LEU A 361 ? 0.2717 0.2915 0.2942 0.0396  0.0008  -0.0234 437  LEU A C   
2331 O  O   . LEU A 361 ? 0.2797 0.2919 0.2953 0.0401  0.0017  -0.0249 437  LEU A O   
2332 C  CB  . LEU A 361 ? 0.2565 0.2834 0.2811 0.0506  0.0045  -0.0194 437  LEU A CB  
2333 C  CG  . LEU A 361 ? 0.2503 0.2890 0.2801 0.0573  0.0078  -0.0158 437  LEU A CG  
2334 C  CD1 . LEU A 361 ? 0.2597 0.2975 0.2891 0.0636  0.0080  -0.0135 437  LEU A CD1 
2335 C  CD2 . LEU A 361 ? 0.2412 0.2764 0.2652 0.0620  0.0126  -0.0165 437  LEU A CD2 
2336 N  N   . TYR A 362 ? 0.2498 0.2689 0.2748 0.0355  -0.0020 -0.0241 438  TYR A N   
2337 C  CA  . TYR A 362 ? 0.2704 0.2822 0.2923 0.0316  -0.0041 -0.0259 438  TYR A CA  
2338 C  C   . TYR A 362 ? 0.2653 0.2823 0.2934 0.0274  -0.0056 -0.0260 438  TYR A C   
2339 O  O   . TYR A 362 ? 0.2281 0.2449 0.2578 0.0255  -0.0065 -0.0262 438  TYR A O   
2340 C  CB  . TYR A 362 ? 0.2734 0.2764 0.2896 0.0317  -0.0050 -0.0265 438  TYR A CB  
2341 C  CG  . TYR A 362 ? 0.2971 0.2908 0.3041 0.0363  -0.0032 -0.0268 438  TYR A CG  
2342 C  CD1 . TYR A 362 ? 0.2846 0.2680 0.2823 0.0352  -0.0033 -0.0284 438  TYR A CD1 
2343 C  CD2 . TYR A 362 ? 0.2880 0.2824 0.2944 0.0421  -0.0012 -0.0253 438  TYR A CD2 
2344 C  CE1 . TYR A 362 ? 0.2974 0.2691 0.2838 0.0398  -0.0011 -0.0291 438  TYR A CE1 
2345 C  CE2 . TYR A 362 ? 0.2969 0.2811 0.2938 0.0479  0.0013  -0.0255 438  TYR A CE2 
2346 C  CZ  . TYR A 362 ? 0.3068 0.2786 0.2928 0.0467  0.0017  -0.0278 438  TYR A CZ  
2347 O  OH  . TYR A 362 ? 0.3526 0.3112 0.3263 0.0528  0.0048  -0.0285 438  TYR A OH  
2348 N  N   . PRO A 363 ? 0.2240 0.2445 0.2545 0.0261  -0.0054 -0.0257 439  PRO A N   
2349 C  CA  . PRO A 363 ? 0.2137 0.2363 0.2482 0.0231  -0.0064 -0.0258 439  PRO A CA  
2350 C  C   . PRO A 363 ? 0.2370 0.2564 0.2718 0.0217  -0.0076 -0.0265 439  PRO A C   
2351 O  O   . PRO A 363 ? 0.2381 0.2541 0.2700 0.0215  -0.0087 -0.0266 439  PRO A O   
2352 C  CB  . PRO A 363 ? 0.2185 0.2431 0.2533 0.0223  -0.0059 -0.0250 439  PRO A CB  
2353 C  CG  . PRO A 363 ? 0.2309 0.2531 0.2613 0.0243  -0.0051 -0.0249 439  PRO A CG  
2354 C  CD  . PRO A 363 ? 0.2287 0.2497 0.2569 0.0275  -0.0040 -0.0252 439  PRO A CD  
2355 N  N   . GLN A 364 ? 0.2385 0.2591 0.2764 0.0206  -0.0074 -0.0268 440  GLN A N   
2356 C  CA  . GLN A 364 ? 0.2608 0.2814 0.3011 0.0200  -0.0079 -0.0267 440  GLN A CA  
2357 C  C   . GLN A 364 ? 0.2650 0.2859 0.3078 0.0205  -0.0070 -0.0266 440  GLN A C   
2358 O  O   . GLN A 364 ? 0.3118 0.3316 0.3539 0.0203  -0.0054 -0.0274 440  GLN A O   
2359 C  CB  . GLN A 364 ? 0.2657 0.2866 0.3061 0.0191  -0.0072 -0.0271 440  GLN A CB  
2360 C  CG  . GLN A 364 ? 0.2581 0.2761 0.2942 0.0192  -0.0078 -0.0271 440  GLN A CG  
2361 C  CD  . GLN A 364 ? 0.2505 0.2645 0.2829 0.0186  -0.0094 -0.0269 440  GLN A CD  
2362 O  OE1 . GLN A 364 ? 0.2277 0.2429 0.2619 0.0166  -0.0108 -0.0263 440  GLN A OE1 
2363 N  NE2 . GLN A 364 ? 0.2196 0.2285 0.2462 0.0203  -0.0093 -0.0272 440  GLN A NE2 
2364 N  N   . PRO A 365 ? 0.2616 0.2824 0.3056 0.0213  -0.0080 -0.0254 441  PRO A N   
2365 C  CA  . PRO A 365 ? 0.2253 0.2463 0.2683 0.0208  -0.0103 -0.0243 441  PRO A CA  
2366 C  C   . PRO A 365 ? 0.2659 0.2844 0.3041 0.0204  -0.0103 -0.0246 441  PRO A C   
2367 O  O   . PRO A 365 ? 0.2610 0.2795 0.2985 0.0204  -0.0089 -0.0248 441  PRO A O   
2368 C  CB  . PRO A 365 ? 0.2605 0.2826 0.3068 0.0222  -0.0113 -0.0225 441  PRO A CB  
2369 C  CG  . PRO A 365 ? 0.2530 0.2718 0.2988 0.0237  -0.0089 -0.0231 441  PRO A CG  
2370 C  CD  . PRO A 365 ? 0.2657 0.2846 0.3109 0.0230  -0.0068 -0.0250 441  PRO A CD  
2371 N  N   . PRO A 366 ? 0.2763 0.2929 0.3105 0.0199  -0.0118 -0.0243 442  PRO A N   
2372 C  CA  . PRO A 366 ? 0.2673 0.2819 0.2964 0.0203  -0.0108 -0.0244 442  PRO A CA  
2373 C  C   . PRO A 366 ? 0.2845 0.2986 0.3128 0.0197  -0.0114 -0.0229 442  PRO A C   
2374 O  O   . PRO A 366 ? 0.2943 0.3081 0.3190 0.0196  -0.0099 -0.0226 442  PRO A O   
2375 C  CB  . PRO A 366 ? 0.2693 0.2791 0.2917 0.0198  -0.0120 -0.0250 442  PRO A CB  
2376 C  CG  . PRO A 366 ? 0.2588 0.2693 0.2837 0.0175  -0.0151 -0.0241 442  PRO A CG  
2377 C  CD  . PRO A 366 ? 0.2619 0.2775 0.2947 0.0182  -0.0141 -0.0241 442  PRO A CD  
2378 N  N   . VAL A 367 ? 0.2566 0.2708 0.2880 0.0196  -0.0133 -0.0216 443  VAL A N   
2379 C  CA  . VAL A 367 ? 0.2776 0.2895 0.3075 0.0196  -0.0139 -0.0197 443  VAL A CA  
2380 C  C   . VAL A 367 ? 0.3088 0.3202 0.3432 0.0212  -0.0136 -0.0191 443  VAL A C   
2381 O  O   . VAL A 367 ? 0.3172 0.3314 0.3565 0.0228  -0.0135 -0.0193 443  VAL A O   
2382 C  CB  . VAL A 367 ? 0.2897 0.3000 0.3160 0.0188  -0.0172 -0.0178 443  VAL A CB  
2383 C  CG1 . VAL A 367 ? 0.2786 0.2866 0.2976 0.0173  -0.0171 -0.0190 443  VAL A CG1 
2384 C  CG2 . VAL A 367 ? 0.3349 0.3488 0.3668 0.0195  -0.0201 -0.0162 443  VAL A CG2 
2385 N  N   . LEU A 368 ? 0.2592 0.2660 0.2907 0.0209  -0.0130 -0.0182 444  LEU A N   
2386 C  CA  . LEU A 368 ? 0.2376 0.2397 0.2699 0.0232  -0.0125 -0.0174 444  LEU A CA  
2387 C  C   . LEU A 368 ? 0.2846 0.2831 0.3149 0.0247  -0.0148 -0.0142 444  LEU A C   
2388 O  O   . LEU A 368 ? 0.3138 0.3110 0.3394 0.0222  -0.0161 -0.0130 444  LEU A O   
2389 C  CB  . LEU A 368 ? 0.2404 0.2367 0.2683 0.0209  -0.0103 -0.0186 444  LEU A CB  
2390 C  CG  . LEU A 368 ? 0.2879 0.2878 0.3172 0.0191  -0.0087 -0.0211 444  LEU A CG  
2391 C  CD1 . LEU A 368 ? 0.2907 0.2854 0.3146 0.0151  -0.0078 -0.0215 444  LEU A CD1 
2392 C  CD2 . LEU A 368 ? 0.2635 0.2646 0.2968 0.0223  -0.0075 -0.0224 444  LEU A CD2 
2393 N  N   . ILE A 369 ? 0.2522 0.2494 0.2859 0.0291  -0.0150 -0.0126 445  ILE A N   
2394 C  CA  . ILE A 369 ? 0.2397 0.2358 0.2734 0.0317  -0.0180 -0.0086 445  ILE A CA  
2395 C  C   . ILE A 369 ? 0.2717 0.2566 0.3009 0.0352  -0.0165 -0.0074 445  ILE A C   
2396 O  O   . ILE A 369 ? 0.2370 0.2181 0.2669 0.0384  -0.0133 -0.0089 445  ILE A O   
2397 C  CB  . ILE A 369 ? 0.2555 0.2619 0.2983 0.0349  -0.0201 -0.0063 445  ILE A CB  
2398 C  CG1 . ILE A 369 ? 0.2618 0.2757 0.3059 0.0303  -0.0220 -0.0077 445  ILE A CG1 
2399 C  CG2 . ILE A 369 ? 0.2343 0.2411 0.2782 0.0380  -0.0239 -0.0013 445  ILE A CG2 
2400 C  CD1 . ILE A 369 ? 0.2878 0.3125 0.3403 0.0311  -0.0246 -0.0053 445  ILE A CD1 
2401 N  N   . ARG A 370 ? 0.2735 0.2514 0.2963 0.0344  -0.0186 -0.0046 446  ARG A N   
2402 C  CA  . ARG A 370 ? 0.2637 0.2281 0.2801 0.0377  -0.0178 -0.0027 446  ARG A CA  
2403 C  C   . ARG A 370 ? 0.3111 0.2740 0.3260 0.0400  -0.0218 0.0024  446  ARG A C   
2404 O  O   . ARG A 370 ? 0.2632 0.2341 0.2797 0.0372  -0.0253 0.0040  446  ARG A O   
2405 C  CB  . ARG A 370 ? 0.2720 0.2247 0.2777 0.0317  -0.0159 -0.0047 446  ARG A CB  
2406 C  CG  . ARG A 370 ? 0.2649 0.2181 0.2706 0.0287  -0.0127 -0.0092 446  ARG A CG  
2407 C  CD  . ARG A 370 ? 0.2831 0.2288 0.2883 0.0345  -0.0097 -0.0105 446  ARG A CD  
2408 N  NE  . ARG A 370 ? 0.3007 0.2435 0.3024 0.0307  -0.0071 -0.0145 446  ARG A NE  
2409 C  CZ  . ARG A 370 ? 0.2948 0.2482 0.3036 0.0306  -0.0058 -0.0170 446  ARG A CZ  
2410 N  NH1 . ARG A 370 ? 0.2619 0.2290 0.2812 0.0336  -0.0069 -0.0160 446  ARG A NH1 
2411 N  NH2 . ARG A 370 ? 0.2763 0.2259 0.2805 0.0269  -0.0040 -0.0201 446  ARG A NH2 
2412 N  N   . ARG A 371 ? 0.3133 0.2641 0.3234 0.0452  -0.0214 0.0051  447  ARG A N   
2413 C  CA  . ARG A 371 ? 0.2897 0.2355 0.2956 0.0472  -0.0253 0.0104  447  ARG A CA  
2414 C  C   . ARG A 371 ? 0.3277 0.2527 0.3202 0.0471  -0.0236 0.0111  447  ARG A C   
2415 O  O   . ARG A 371 ? 0.3387 0.2534 0.3281 0.0510  -0.0198 0.0091  447  ARG A O   
2416 C  CB  . ARG A 371 ? 0.2598 0.2142 0.2757 0.0562  -0.0275 0.0152  447  ARG A CB  
2417 C  CG  . ARG A 371 ? 0.3146 0.2648 0.3265 0.0584  -0.0325 0.0216  447  ARG A CG  
2418 C  CD  . ARG A 371 ? 0.3377 0.2979 0.3611 0.0684  -0.0346 0.0271  447  ARG A CD  
2419 N  NE  . ARG A 371 ? 0.3336 0.3153 0.3700 0.0665  -0.0376 0.0278  447  ARG A NE  
2420 C  CZ  . ARG A 371 ? 0.3589 0.3549 0.4093 0.0732  -0.0369 0.0301  447  ARG A CZ  
2421 N  NH1 . ARG A 371 ? 0.3462 0.3373 0.3995 0.0837  -0.0324 0.0316  447  ARG A NH1 
2422 N  NH2 . ARG A 371 ? 0.3509 0.3656 0.4116 0.0694  -0.0403 0.0310  447  ARG A NH2 
2423 N  N   . SER A 372 ? 0.3274 0.2450 0.3104 0.0422  -0.0262 0.0137  448  SER A N   
2424 C  CA  . SER A 372 ? 0.3353 0.2317 0.3042 0.0411  -0.0253 0.0150  448  SER A CA  
2425 C  C   . SER A 372 ? 0.3418 0.2278 0.3095 0.0521  -0.0258 0.0194  448  SER A C   
2426 O  O   . SER A 372 ? 0.3483 0.2436 0.3235 0.0580  -0.0294 0.0240  448  SER A O   
2427 C  CB  . SER A 372 ? 0.3373 0.2292 0.2963 0.0327  -0.0278 0.0175  448  SER A CB  
2428 O  OG  . SER A 372 ? 0.3217 0.2201 0.2830 0.0351  -0.0324 0.0223  448  SER A OG  
2429 N  N   . ILE A 373 ? 0.3430 0.2097 0.3009 0.0551  -0.0222 0.0180  449  ILE A N   
2430 C  CA  . ILE A 373 ? 0.3612 0.2132 0.3145 0.0663  -0.0218 0.0222  449  ILE A CA  
2431 C  C   . ILE A 373 ? 0.4291 0.2551 0.3629 0.0628  -0.0227 0.0245  449  ILE A C   
2432 O  O   . ILE A 373 ? 0.4791 0.2877 0.4054 0.0722  -0.0220 0.0280  449  ILE A O   
2433 C  CB  . ILE A 373 ? 0.3628 0.2103 0.3187 0.0753  -0.0162 0.0190  449  ILE A CB  
2434 C  CG1 . ILE A 373 ? 0.3907 0.2212 0.3329 0.0677  -0.0122 0.0129  449  ILE A CG1 
2435 C  CG2 . ILE A 373 ? 0.3098 0.1837 0.2853 0.0789  -0.0155 0.0177  449  ILE A CG2 
2436 C  CD1 . ILE A 373 ? 0.4325 0.2505 0.3706 0.0766  -0.0062 0.0099  449  ILE A CD1 
2437 N  N   . ASP A 374 ? 0.4185 0.2413 0.3437 0.0498  -0.0239 0.0231  450  ASP A N   
2438 C  CA  . ASP A 374 ? 0.4636 0.2630 0.3699 0.0439  -0.0250 0.0258  450  ASP A CA  
2439 C  C   . ASP A 374 ? 0.4419 0.2515 0.3471 0.0312  -0.0276 0.0265  450  ASP A C   
2440 O  O   . ASP A 374 ? 0.4185 0.2503 0.3358 0.0274  -0.0276 0.0239  450  ASP A O   
2441 C  CB  . ASP A 374 ? 0.4645 0.2409 0.3559 0.0402  -0.0211 0.0218  450  ASP A CB  
2442 C  CG  . ASP A 374 ? 0.5089 0.2554 0.3785 0.0370  -0.0223 0.0253  450  ASP A CG  
2443 O  OD1 . ASP A 374 ? 0.5148 0.2578 0.3813 0.0395  -0.0258 0.0312  450  ASP A OD1 
2444 O  OD2 . ASP A 374 ? 0.5496 0.2751 0.4038 0.0312  -0.0199 0.0223  450  ASP A OD2 
2445 N  N   . ASN A 375 ? 0.4756 0.2683 0.3652 0.0249  -0.0293 0.0302  451  ASN A N   
2446 C  CA  . ASN A 375 ? 0.4903 0.2912 0.3769 0.0122  -0.0304 0.0308  451  ASN A CA  
2447 C  C   . ASN A 375 ? 0.4910 0.2994 0.3797 0.0024  -0.0271 0.0254  451  ASN A C   
2448 O  O   . ASN A 375 ? 0.4783 0.2758 0.3629 0.0023  -0.0247 0.0219  451  ASN A O   
2449 C  CB  . ASN A 375 ? 0.5359 0.3152 0.4038 0.0063  -0.0323 0.0359  451  ASN A CB  
2450 C  CG  . ASN A 375 ? 0.5581 0.3282 0.4224 0.0162  -0.0361 0.0421  451  ASN A CG  
2451 O  OD1 . ASN A 375 ? 0.5596 0.3452 0.4319 0.0186  -0.0392 0.0449  451  ASN A OD1 
2452 N  ND2 . ASN A 375 ? 0.6013 0.3454 0.4528 0.0222  -0.0360 0.0444  451  ASN A ND2 
2453 N  N   . ASP A 376 ? 0.4418 0.2686 0.3364 -0.0056 -0.0268 0.0248  452  ASP A N   
2454 C  CA  . ASP A 376 ? 0.4544 0.2912 0.3522 -0.0150 -0.0241 0.0210  452  ASP A CA  
2455 C  C   . ASP A 376 ? 0.4456 0.2965 0.3443 -0.0237 -0.0237 0.0230  452  ASP A C   
2456 O  O   . ASP A 376 ? 0.4154 0.2667 0.3109 -0.0227 -0.0255 0.0268  452  ASP A O   
2457 C  CB  . ASP A 376 ? 0.4240 0.2767 0.3369 -0.0094 -0.0223 0.0158  452  ASP A CB  
2458 C  CG  . ASP A 376 ? 0.3995 0.2553 0.3126 -0.0174 -0.0200 0.0122  452  ASP A CG  
2459 O  OD1 . ASP A 376 ? 0.4302 0.2779 0.3330 -0.0280 -0.0200 0.0138  452  ASP A OD1 
2460 O  OD2 . ASP A 376 ? 0.3927 0.2596 0.3163 -0.0138 -0.0185 0.0081  452  ASP A OD2 
2461 N  N   . ILE A 377 ? 0.4537 0.3164 0.3562 -0.0322 -0.0212 0.0209  453  ILE A N   
2462 C  CA  . ILE A 377 ? 0.4654 0.3457 0.3716 -0.0391 -0.0193 0.0222  453  ILE A CA  
2463 C  C   . ILE A 377 ? 0.4459 0.3476 0.3672 -0.0373 -0.0168 0.0179  453  ILE A C   
2464 O  O   . ILE A 377 ? 0.4153 0.3179 0.3397 -0.0397 -0.0162 0.0152  453  ILE A O   
2465 C  CB  . ILE A 377 ? 0.5124 0.3872 0.4081 -0.0523 -0.0185 0.0256  453  ILE A CB  
2466 C  CG1 . ILE A 377 ? 0.5684 0.4193 0.4471 -0.0541 -0.0211 0.0303  453  ILE A CG1 
2467 C  CG2 . ILE A 377 ? 0.5200 0.4163 0.4215 -0.0581 -0.0153 0.0272  453  ILE A CG2 
2468 C  CD1 . ILE A 377 ? 0.5975 0.4416 0.4641 -0.0684 -0.0206 0.0343  453  ILE A CD1 
2469 N  N   . LEU A 378 ? 0.4028 0.3200 0.3320 -0.0332 -0.0157 0.0172  454  LEU A N   
2470 C  CA  . LEU A 378 ? 0.3609 0.2969 0.3031 -0.0306 -0.0132 0.0134  454  LEU A CA  
2471 C  C   . LEU A 378 ? 0.3754 0.3267 0.3192 -0.0360 -0.0096 0.0150  454  LEU A C   
2472 O  O   . LEU A 378 ? 0.3688 0.3220 0.3087 -0.0348 -0.0088 0.0166  454  LEU A O   
2473 C  CB  . LEU A 378 ? 0.3531 0.2928 0.3021 -0.0207 -0.0147 0.0109  454  LEU A CB  
2474 C  CG  . LEU A 378 ? 0.3491 0.2779 0.2995 -0.0139 -0.0173 0.0096  454  LEU A CG  
2475 C  CD1 . LEU A 378 ? 0.3114 0.2488 0.2709 -0.0058 -0.0185 0.0076  454  LEU A CD1 
2476 C  CD2 . LEU A 378 ? 0.3204 0.2463 0.2725 -0.0161 -0.0161 0.0070  454  LEU A CD2 
2477 N  N   . GLY A 379 ? 0.4027 0.3651 0.3518 -0.0418 -0.0072 0.0149  455  GLY A N   
2478 C  CA  . GLY A 379 ? 0.4860 0.4638 0.4368 -0.0474 -0.0030 0.0175  455  GLY A CA  
2479 C  C   . GLY A 379 ? 0.5894 0.5579 0.5280 -0.0559 -0.0032 0.0225  455  GLY A C   
2480 O  O   . GLY A 379 ? 0.6508 0.6106 0.5837 -0.0642 -0.0051 0.0246  455  GLY A O   
2481 N  N   . GLU A 380 ? 0.5947 0.5632 0.5274 -0.0546 -0.0016 0.0245  456  GLU A N   
2482 C  CA  . GLU A 380 ? 0.6044 0.5616 0.5237 -0.0621 -0.0021 0.0294  456  GLU A CA  
2483 C  C   . GLU A 380 ? 0.5293 0.4681 0.4385 -0.0567 -0.0063 0.0300  456  GLU A C   
2484 O  O   . GLU A 380 ? 0.5529 0.4806 0.4495 -0.0616 -0.0072 0.0344  456  GLU A O   
2485 C  CB  . GLU A 380 ? 0.6796 0.6526 0.5985 -0.0666 0.0037  0.0325  456  GLU A CB  
2486 C  CG  . GLU A 380 ? 0.7462 0.7410 0.6767 -0.0718 0.0080  0.0334  456  GLU A CG  
2487 C  CD  . GLU A 380 ? 0.8050 0.7981 0.7306 -0.0853 0.0072  0.0384  456  GLU A CD  
2488 O  OE1 . GLU A 380 ? 0.8121 0.8162 0.7465 -0.0904 0.0070  0.0387  456  GLU A OE1 
2489 O  OE2 . GLU A 380 ? 0.8440 0.8243 0.7562 -0.0916 0.0064  0.0424  456  GLU A OE2 
2490 N  N   . TYR A 381 ? 0.4429 0.3790 0.3576 -0.0469 -0.0090 0.0263  457  TYR A N   
2491 C  CA  . TYR A 381 ? 0.4164 0.3413 0.3246 -0.0409 -0.0129 0.0273  457  TYR A CA  
2492 C  C   . TYR A 381 ? 0.4412 0.3483 0.3461 -0.0373 -0.0177 0.0280  457  TYR A C   
2493 O  O   . TYR A 381 ? 0.4093 0.3174 0.3228 -0.0325 -0.0184 0.0244  457  TYR A O   
2494 C  CB  . TYR A 381 ? 0.4000 0.3358 0.3164 -0.0329 -0.0127 0.0235  457  TYR A CB  
2495 C  CG  . TYR A 381 ? 0.4146 0.3640 0.3308 -0.0344 -0.0075 0.0228  457  TYR A CG  
2496 C  CD1 . TYR A 381 ? 0.4452 0.3908 0.3495 -0.0367 -0.0069 0.0257  457  TYR A CD1 
2497 C  CD2 . TYR A 381 ? 0.4150 0.3801 0.3419 -0.0331 -0.0030 0.0194  457  TYR A CD2 
2498 C  CE1 . TYR A 381 ? 0.4732 0.4298 0.3756 -0.0372 -0.0012 0.0248  457  TYR A CE1 
2499 C  CE2 . TYR A 381 ? 0.4333 0.4098 0.3592 -0.0329 0.0026  0.0189  457  TYR A CE2 
2500 C  CZ  . TYR A 381 ? 0.4605 0.4323 0.3739 -0.0348 0.0039  0.0214  457  TYR A CZ  
2501 O  OH  . TYR A 381 ? 0.5104 0.4920 0.4212 -0.0338 0.0104  0.0206  457  TYR A OH  
2502 N  N   . PRO A 382 ? 0.4489 0.3392 0.3412 -0.0386 -0.0209 0.0325  458  PRO A N   
2503 C  CA  . PRO A 382 ? 0.4743 0.3469 0.3633 -0.0328 -0.0250 0.0334  458  PRO A CA  
2504 C  C   . PRO A 382 ? 0.4743 0.3513 0.3714 -0.0218 -0.0281 0.0322  458  PRO A C   
2505 O  O   . PRO A 382 ? 0.4802 0.3647 0.3774 -0.0203 -0.0295 0.0333  458  PRO A O   
2506 C  CB  . PRO A 382 ? 0.5033 0.3574 0.3754 -0.0374 -0.0273 0.0395  458  PRO A CB  
2507 C  CG  . PRO A 382 ? 0.5186 0.3822 0.3857 -0.0471 -0.0239 0.0416  458  PRO A CG  
2508 C  CD  . PRO A 382 ? 0.4653 0.3516 0.3452 -0.0445 -0.0206 0.0373  458  PRO A CD  
2509 N  N   . ILE A 383 ? 0.4226 0.2951 0.3261 -0.0146 -0.0293 0.0301  459  ILE A N   
2510 C  CA  . ILE A 383 ? 0.3915 0.2685 0.3035 -0.0044 -0.0325 0.0300  459  ILE A CA  
2511 C  C   . ILE A 383 ? 0.4302 0.2899 0.3379 0.0028  -0.0350 0.0330  459  ILE A C   
2512 O  O   . ILE A 383 ? 0.4237 0.2676 0.3234 0.0008  -0.0333 0.0328  459  ILE A O   
2513 C  CB  . ILE A 383 ? 0.3892 0.2823 0.3163 -0.0006 -0.0305 0.0245  459  ILE A CB  
2514 C  CG1 . ILE A 383 ? 0.3603 0.2472 0.2897 0.0002  -0.0278 0.0213  459  ILE A CG1 
2515 C  CG2 . ILE A 383 ? 0.3753 0.2841 0.3059 -0.0061 -0.0276 0.0217  459  ILE A CG2 
2516 C  CD1 . ILE A 383 ? 0.3232 0.2235 0.2666 0.0053  -0.0264 0.0166  459  ILE A CD1 
2517 N  N   . LYS A 384 ? 0.4067 0.2692 0.3192 0.0113  -0.0390 0.0360  460  LYS A N   
2518 C  CA  . LYS A 384 ? 0.4397 0.2900 0.3518 0.0212  -0.0410 0.0390  460  LYS A CA  
2519 C  C   . LYS A 384 ? 0.4329 0.2944 0.3603 0.0294  -0.0393 0.0353  460  LYS A C   
2520 O  O   . LYS A 384 ? 0.3940 0.2722 0.3316 0.0270  -0.0376 0.0308  460  LYS A O   
2521 C  CB  . LYS A 384 ? 0.4880 0.3363 0.3969 0.0259  -0.0468 0.0460  460  LYS A CB  
2522 C  CG  . LYS A 384 ? 0.5368 0.3747 0.4297 0.0172  -0.0485 0.0499  460  LYS A CG  
2523 C  CD  . LYS A 384 ? 0.6513 0.4832 0.5386 0.0223  -0.0548 0.0576  460  LYS A CD  
2524 C  CE  . LYS A 384 ? 0.7376 0.5573 0.6071 0.0130  -0.0559 0.0615  460  LYS A CE  
2525 N  NZ  . LYS A 384 ? 0.8160 0.6251 0.6770 0.0178  -0.0622 0.0698  460  LYS A NZ  
2526 N  N   . ARG A 385 ? 0.4080 0.2595 0.3361 0.0396  -0.0394 0.0375  461  ARG A N   
2527 C  CA  . ARG A 385 ? 0.3850 0.2482 0.3279 0.0485  -0.0378 0.0353  461  ARG A CA  
2528 C  C   . ARG A 385 ? 0.3927 0.2784 0.3492 0.0509  -0.0421 0.0375  461  ARG A C   
2529 O  O   . ARG A 385 ? 0.4116 0.2995 0.3647 0.0490  -0.0471 0.0423  461  ARG A O   
2530 C  CB  . ARG A 385 ? 0.3962 0.2442 0.3364 0.0604  -0.0366 0.0383  461  ARG A CB  
2531 C  CG  . ARG A 385 ? 0.3989 0.2439 0.3378 0.0678  -0.0419 0.0465  461  ARG A CG  
2532 C  CD  . ARG A 385 ? 0.4224 0.2486 0.3560 0.0804  -0.0398 0.0497  461  ARG A CD  
2533 N  NE  . ARG A 385 ? 0.4244 0.2489 0.3578 0.0886  -0.0452 0.0585  461  ARG A NE  
2534 C  CZ  . ARG A 385 ? 0.4697 0.2785 0.3986 0.1015  -0.0442 0.0631  461  ARG A CZ  
2535 N  NH1 . ARG A 385 ? 0.4547 0.2462 0.3773 0.1072  -0.0375 0.0591  461  ARG A NH1 
2536 N  NH2 . ARG A 385 ? 0.4546 0.2638 0.3842 0.1089  -0.0498 0.0719  461  ARG A NH2 
2537 N  N   . GLY A 386 ? 0.3853 0.2868 0.3560 0.0542  -0.0403 0.0342  462  GLY A N   
2538 C  CA  . GLY A 386 ? 0.4012 0.3234 0.3848 0.0559  -0.0445 0.0364  462  GLY A CA  
2539 C  C   . GLY A 386 ? 0.3820 0.3168 0.3676 0.0466  -0.0450 0.0323  462  GLY A C   
2540 O  O   . GLY A 386 ? 0.3746 0.3245 0.3683 0.0464  -0.0490 0.0339  462  GLY A O   
2541 N  N   . GLU A 387 ? 0.3326 0.2617 0.3106 0.0388  -0.0412 0.0275  463  GLU A N   
2542 C  CA  . GLU A 387 ? 0.3278 0.2680 0.3074 0.0316  -0.0407 0.0235  463  GLU A CA  
2543 C  C   . GLU A 387 ? 0.3355 0.2872 0.3271 0.0335  -0.0379 0.0189  463  GLU A C   
2544 O  O   . GLU A 387 ? 0.3289 0.2762 0.3223 0.0355  -0.0336 0.0159  463  GLU A O   
2545 C  CB  . GLU A 387 ? 0.3191 0.2516 0.2879 0.0235  -0.0373 0.0209  463  GLU A CB  
2546 C  CG  . GLU A 387 ? 0.3381 0.2600 0.2937 0.0197  -0.0397 0.0254  463  GLU A CG  
2547 C  CD  . GLU A 387 ? 0.3864 0.3155 0.3384 0.0159  -0.0431 0.0270  463  GLU A CD  
2548 O  OE1 . GLU A 387 ? 0.3644 0.3056 0.3238 0.0165  -0.0444 0.0250  463  GLU A OE1 
2549 O  OE2 . GLU A 387 ? 0.3763 0.2974 0.3163 0.0117  -0.0444 0.0303  463  GLU A OE2 
2550 N  N   . ASP A 388 ? 0.2976 0.2626 0.2956 0.0322  -0.0404 0.0185  464  ASP A N   
2551 C  CA  . ASP A 388 ? 0.2746 0.2502 0.2823 0.0324  -0.0380 0.0142  464  ASP A CA  
2552 C  C   . ASP A 388 ? 0.3123 0.2876 0.3150 0.0259  -0.0345 0.0091  464  ASP A C   
2553 O  O   . ASP A 388 ? 0.3425 0.3181 0.3383 0.0211  -0.0359 0.0091  464  ASP A O   
2554 C  CB  . ASP A 388 ? 0.2585 0.2475 0.2744 0.0330  -0.0427 0.0165  464  ASP A CB  
2555 C  CG  . ASP A 388 ? 0.3127 0.3065 0.3372 0.0405  -0.0458 0.0222  464  ASP A CG  
2556 O  OD1 . ASP A 388 ? 0.3156 0.3075 0.3456 0.0471  -0.0419 0.0218  464  ASP A OD1 
2557 O  OD2 . ASP A 388 ? 0.3256 0.3251 0.3508 0.0402  -0.0519 0.0274  464  ASP A OD2 
2558 N  N   . ILE A 389 ? 0.2609 0.2355 0.2665 0.0261  -0.0299 0.0051  465  ILE A N   
2559 C  CA  . ILE A 389 ? 0.2861 0.2607 0.2879 0.0208  -0.0263 0.0013  465  ILE A CA  
2560 C  C   . ILE A 389 ? 0.2933 0.2770 0.3028 0.0212  -0.0245 -0.0026 465  ILE A C   
2561 O  O   . ILE A 389 ? 0.2802 0.2660 0.2966 0.0249  -0.0235 -0.0035 465  ILE A O   
2562 C  CB  . ILE A 389 ? 0.3066 0.2717 0.3032 0.0191  -0.0233 0.0007  465  ILE A CB  
2563 C  CG1 . ILE A 389 ? 0.2992 0.2535 0.2863 0.0178  -0.0252 0.0048  465  ILE A CG1 
2564 C  CG2 . ILE A 389 ? 0.2936 0.2628 0.2892 0.0138  -0.0198 -0.0025 465  ILE A CG2 
2565 C  CD1 . ILE A 389 ? 0.3320 0.2730 0.3134 0.0178  -0.0235 0.0053  465  ILE A CD1 
2566 N  N   . PHE A 390 ? 0.2486 0.2365 0.2557 0.0177  -0.0235 -0.0047 466  PHE A N   
2567 C  CA  . PHE A 390 ? 0.2606 0.2547 0.2725 0.0176  -0.0213 -0.0084 466  PHE A CA  
2568 C  C   . PHE A 390 ? 0.2470 0.2412 0.2561 0.0149  -0.0173 -0.0104 466  PHE A C   
2569 O  O   . PHE A 390 ? 0.2506 0.2446 0.2537 0.0124  -0.0162 -0.0100 466  PHE A O   
2570 C  CB  . PHE A 390 ? 0.2712 0.2691 0.2820 0.0166  -0.0235 -0.0089 466  PHE A CB  
2571 C  CG  . PHE A 390 ? 0.3556 0.3577 0.3724 0.0184  -0.0275 -0.0069 466  PHE A CG  
2572 C  CD1 . PHE A 390 ? 0.4061 0.4074 0.4226 0.0195  -0.0315 -0.0027 466  PHE A CD1 
2573 C  CD2 . PHE A 390 ? 0.4095 0.4175 0.4326 0.0188  -0.0274 -0.0086 466  PHE A CD2 
2574 C  CE1 . PHE A 390 ? 0.4472 0.4556 0.4711 0.0212  -0.0354 0.0002  466  PHE A CE1 
2575 C  CE2 . PHE A 390 ? 0.4191 0.4335 0.4490 0.0197  -0.0310 -0.0060 466  PHE A CE2 
2576 C  CZ  . PHE A 390 ? 0.4256 0.4414 0.4567 0.0210  -0.0350 -0.0015 466  PHE A CZ  
2577 N  N   . ILE A 391 ? 0.2200 0.2153 0.2334 0.0152  -0.0151 -0.0121 467  ILE A N   
2578 C  CA  . ILE A 391 ? 0.2532 0.2521 0.2664 0.0125  -0.0120 -0.0136 467  ILE A CA  
2579 C  C   . ILE A 391 ? 0.2681 0.2734 0.2848 0.0141  -0.0110 -0.0159 467  ILE A C   
2580 O  O   . ILE A 391 ? 0.2597 0.2665 0.2812 0.0161  -0.0115 -0.0174 467  ILE A O   
2581 C  CB  . ILE A 391 ? 0.2506 0.2466 0.2650 0.0111  -0.0110 -0.0141 467  ILE A CB  
2582 C  CG1 . ILE A 391 ? 0.2495 0.2356 0.2577 0.0093  -0.0120 -0.0118 467  ILE A CG1 
2583 C  CG2 . ILE A 391 ? 0.2362 0.2389 0.2519 0.0078  -0.0088 -0.0149 467  ILE A CG2 
2584 C  CD1 . ILE A 391 ? 0.2532 0.2317 0.2594 0.0082  -0.0113 -0.0127 467  ILE A CD1 
2585 N  N   . SER A 392 ? 0.2148 0.2231 0.2282 0.0136  -0.0091 -0.0161 468  SER A N   
2586 C  CA  . SER A 392 ? 0.2261 0.2376 0.2404 0.0158  -0.0078 -0.0182 468  SER A CA  
2587 C  C   . SER A 392 ? 0.2144 0.2322 0.2339 0.0160  -0.0054 -0.0188 468  SER A C   
2588 O  O   . SER A 392 ? 0.2259 0.2491 0.2453 0.0154  -0.0026 -0.0178 468  SER A O   
2589 C  CB  . SER A 392 ? 0.2595 0.2695 0.2663 0.0164  -0.0061 -0.0182 468  SER A CB  
2590 O  OG  . SER A 392 ? 0.2596 0.2701 0.2657 0.0191  -0.0044 -0.0203 468  SER A OG  
2591 N  N   . VAL A 393 ? 0.1844 0.2026 0.2087 0.0167  -0.0064 -0.0201 469  VAL A N   
2592 C  CA  . VAL A 393 ? 0.1995 0.2234 0.2279 0.0168  -0.0050 -0.0206 469  VAL A CA  
2593 C  C   . VAL A 393 ? 0.2191 0.2467 0.2468 0.0199  -0.0029 -0.0209 469  VAL A C   
2594 O  O   . VAL A 393 ? 0.2419 0.2769 0.2725 0.0205  -0.0009 -0.0198 469  VAL A O   
2595 C  CB  . VAL A 393 ? 0.2175 0.2395 0.2490 0.0171  -0.0064 -0.0220 469  VAL A CB  
2596 C  CG1 . VAL A 393 ? 0.2119 0.2392 0.2464 0.0164  -0.0056 -0.0221 469  VAL A CG1 
2597 C  CG2 . VAL A 393 ? 0.2231 0.2396 0.2539 0.0156  -0.0076 -0.0217 469  VAL A CG2 
2598 N  N   . TRP A 394 ? 0.2013 0.2233 0.2245 0.0221  -0.0033 -0.0222 470  TRP A N   
2599 C  CA  . TRP A 394 ? 0.2153 0.2365 0.2344 0.0258  -0.0007 -0.0229 470  TRP A CA  
2600 C  C   . TRP A 394 ? 0.2556 0.2823 0.2735 0.0271  0.0030  -0.0213 470  TRP A C   
2601 O  O   . TRP A 394 ? 0.2250 0.2581 0.2454 0.0306  0.0060  -0.0203 470  TRP A O   
2602 C  CB  . TRP A 394 ? 0.2202 0.2317 0.2314 0.0259  -0.0024 -0.0245 470  TRP A CB  
2603 C  CG  . TRP A 394 ? 0.2463 0.2518 0.2491 0.0296  0.0003  -0.0258 470  TRP A CG  
2604 C  CD1 . TRP A 394 ? 0.2873 0.2890 0.2816 0.0318  0.0035  -0.0259 470  TRP A CD1 
2605 C  CD2 . TRP A 394 ? 0.2570 0.2572 0.2573 0.0320  0.0003  -0.0271 470  TRP A CD2 
2606 N  NE1 . TRP A 394 ? 0.2898 0.2834 0.2759 0.0360  0.0058  -0.0276 470  TRP A NE1 
2607 C  CE2 . TRP A 394 ? 0.2858 0.2779 0.2753 0.0360  0.0036  -0.0282 470  TRP A CE2 
2608 C  CE3 . TRP A 394 ? 0.2648 0.2654 0.2697 0.0310  -0.0019 -0.0275 470  TRP A CE3 
2609 C  CZ2 . TRP A 394 ? 0.2957 0.2785 0.2783 0.0393  0.0046  -0.0295 470  TRP A CZ2 
2610 C  CZ3 . TRP A 394 ? 0.2754 0.2682 0.2742 0.0336  -0.0012 -0.0285 470  TRP A CZ3 
2611 C  CH2 . TRP A 394 ? 0.2727 0.2559 0.2602 0.0377  0.0018  -0.0295 470  TRP A CH2 
2612 N  N   . ASN A 395 ? 0.2276 0.2526 0.2417 0.0246  0.0031  -0.0203 471  ASN A N   
2613 C  CA  . ASN A 395 ? 0.2262 0.2571 0.2387 0.0252  0.0072  -0.0184 471  ASN A CA  
2614 C  C   . ASN A 395 ? 0.2256 0.2691 0.2471 0.0232  0.0082  -0.0157 471  ASN A C   
2615 O  O   . ASN A 395 ? 0.2270 0.2803 0.2514 0.0258  0.0122  -0.0137 471  ASN A O   
2616 C  CB  . ASN A 395 ? 0.2278 0.2535 0.2336 0.0218  0.0064  -0.0175 471  ASN A CB  
2617 C  CG  . ASN A 395 ? 0.2652 0.2797 0.2604 0.0231  0.0055  -0.0195 471  ASN A CG  
2618 O  OD1 . ASN A 395 ? 0.2699 0.2795 0.2615 0.0264  0.0060  -0.0217 471  ASN A OD1 
2619 N  ND2 . ASN A 395 ? 0.2444 0.2536 0.2330 0.0200  0.0038  -0.0185 471  ASN A ND2 
2620 N  N   . LEU A 396 ? 0.2169 0.2602 0.2424 0.0185  0.0047  -0.0153 472  LEU A N   
2621 C  CA  . LEU A 396 ? 0.2665 0.3200 0.2986 0.0147  0.0046  -0.0128 472  LEU A CA  
2622 C  C   . LEU A 396 ? 0.2434 0.3060 0.2818 0.0183  0.0056  -0.0122 472  LEU A C   
2623 O  O   . LEU A 396 ? 0.2198 0.2956 0.2639 0.0176  0.0075  -0.0090 472  LEU A O   
2624 C  CB  . LEU A 396 ? 0.2550 0.3021 0.2869 0.0096  0.0007  -0.0134 472  LEU A CB  
2625 C  CG  . LEU A 396 ? 0.2588 0.2978 0.2850 0.0056  -0.0004 -0.0125 472  LEU A CG  
2626 C  CD1 . LEU A 396 ? 0.2484 0.2776 0.2729 0.0037  -0.0036 -0.0139 472  LEU A CD1 
2627 C  CD2 . LEU A 396 ? 0.2308 0.2772 0.2571 0.0002  0.0011  -0.0090 472  LEU A CD2 
2628 N  N   . HIS A 397 ? 0.2194 0.2758 0.2570 0.0219  0.0043  -0.0148 473  HIS A N   
2629 C  CA  . HIS A 397 ? 0.2065 0.2692 0.2489 0.0255  0.0047  -0.0142 473  HIS A CA  
2630 C  C   . HIS A 397 ? 0.2194 0.2872 0.2616 0.0325  0.0091  -0.0129 473  HIS A C   
2631 O  O   . HIS A 397 ? 0.2335 0.3107 0.2815 0.0360  0.0100  -0.0107 473  HIS A O   
2632 C  CB  . HIS A 397 ? 0.1911 0.2439 0.2311 0.0267  0.0022  -0.0172 473  HIS A CB  
2633 C  CG  . HIS A 397 ? 0.2172 0.2677 0.2587 0.0216  -0.0012 -0.0179 473  HIS A CG  
2634 N  ND1 . HIS A 397 ? 0.2254 0.2704 0.2663 0.0221  -0.0029 -0.0198 473  HIS A ND1 
2635 C  CD2 . HIS A 397 ? 0.2266 0.2780 0.2688 0.0159  -0.0026 -0.0171 473  HIS A CD2 
2636 C  CE1 . HIS A 397 ? 0.2372 0.2802 0.2784 0.0177  -0.0048 -0.0203 473  HIS A CE1 
2637 N  NE2 . HIS A 397 ? 0.2537 0.2994 0.2950 0.0139  -0.0048 -0.0188 473  HIS A NE2 
2638 N  N   . ARG A 398 ? 0.2191 0.2800 0.2540 0.0352  0.0120  -0.0142 474  ARG A N   
2639 C  CA  . ARG A 398 ? 0.2315 0.2931 0.2630 0.0431  0.0171  -0.0138 474  ARG A CA  
2640 C  C   . ARG A 398 ? 0.2432 0.3130 0.2744 0.0437  0.0220  -0.0114 474  ARG A C   
2641 O  O   . ARG A 398 ? 0.2693 0.3381 0.2956 0.0508  0.0274  -0.0114 474  ARG A O   
2642 C  CB  . ARG A 398 ? 0.2441 0.2879 0.2638 0.0461  0.0170  -0.0178 474  ARG A CB  
2643 C  CG  . ARG A 398 ? 0.2428 0.2800 0.2628 0.0466  0.0135  -0.0195 474  ARG A CG  
2644 C  CD  . ARG A 398 ? 0.2779 0.2978 0.2864 0.0459  0.0117  -0.0230 474  ARG A CD  
2645 N  NE  . ARG A 398 ? 0.2597 0.2730 0.2671 0.0468  0.0094  -0.0241 474  ARG A NE  
2646 C  CZ  . ARG A 398 ? 0.2962 0.3012 0.2965 0.0527  0.0116  -0.0247 474  ARG A CZ  
2647 N  NH1 . ARG A 398 ? 0.2852 0.2874 0.2790 0.0592  0.0168  -0.0245 474  ARG A NH1 
2648 N  NH2 . ARG A 398 ? 0.2538 0.2520 0.2524 0.0523  0.0091  -0.0254 474  ARG A NH2 
2649 N  N   . SER A 399 ? 0.2605 0.3374 0.2958 0.0365  0.0205  -0.0093 475  SER A N   
2650 C  CA  . SER A 399 ? 0.3134 0.3984 0.3481 0.0355  0.0249  -0.0066 475  SER A CA  
2651 C  C   . SER A 399 ? 0.3464 0.4492 0.3893 0.0415  0.0304  -0.0025 475  SER A C   
2652 O  O   . SER A 399 ? 0.3311 0.4484 0.3853 0.0396  0.0284  0.0009  475  SER A O   
2653 C  CB  . SER A 399 ? 0.3202 0.4092 0.3579 0.0256  0.0215  -0.0045 475  SER A CB  
2654 O  OG  . SER A 399 ? 0.3562 0.4545 0.3938 0.0237  0.0259  -0.0011 475  SER A OG  
2655 N  N   . PRO A 400 ? 0.3766 0.4792 0.4139 0.0489  0.0373  -0.0024 476  PRO A N   
2656 C  CA  . PRO A 400 ? 0.4424 0.5642 0.4889 0.0560  0.0435  0.0023  476  PRO A CA  
2657 C  C   . PRO A 400 ? 0.4896 0.6336 0.5479 0.0490  0.0439  0.0082  476  PRO A C   
2658 O  O   . PRO A 400 ? 0.5076 0.6728 0.5783 0.0526  0.0466  0.0134  476  PRO A O   
2659 C  CB  . PRO A 400 ? 0.4500 0.5626 0.4842 0.0647  0.0515  0.0004  476  PRO A CB  
2660 C  CG  . PRO A 400 ? 0.4327 0.5194 0.4511 0.0628  0.0479  -0.0058 476  PRO A CG  
2661 C  CD  . PRO A 400 ? 0.3891 0.4736 0.4107 0.0514  0.0399  -0.0064 476  PRO A CD  
2662 N  N   . LEU A 401 ? 0.5191 0.6591 0.5738 0.0387  0.0409  0.0080  477  LEU A N   
2663 C  CA  . LEU A 401 ? 0.5473 0.7061 0.6113 0.0299  0.0405  0.0137  477  LEU A CA  
2664 C  C   . LEU A 401 ? 0.5454 0.7149 0.6206 0.0239  0.0340  0.0163  477  LEU A C   
2665 O  O   . LEU A 401 ? 0.5825 0.7736 0.6688 0.0191  0.0343  0.0224  477  LEU A O   
2666 C  CB  . LEU A 401 ? 0.5761 0.7236 0.6307 0.0204  0.0385  0.0127  477  LEU A CB  
2667 C  CG  . LEU A 401 ? 0.6289 0.7820 0.6789 0.0205  0.0455  0.0152  477  LEU A CG  
2668 C  CD1 . LEU A 401 ? 0.6273 0.8081 0.6909 0.0166  0.0487  0.0227  477  LEU A CD1 
2669 C  CD2 . LEU A 401 ? 0.6538 0.7995 0.6953 0.0326  0.0527  0.0122  477  LEU A CD2 
2670 N  N   . HIS A 402 ? 0.4908 0.6460 0.5629 0.0234  0.0282  0.0121  478  HIS A N   
2671 C  CA  . HIS A 402 ? 0.4578 0.6188 0.5368 0.0164  0.0216  0.0138  478  HIS A CA  
2672 C  C   . HIS A 402 ? 0.4625 0.6260 0.5466 0.0237  0.0201  0.0134  478  HIS A C   
2673 O  O   . HIS A 402 ? 0.4773 0.6427 0.5650 0.0183  0.0144  0.0140  478  HIS A O   
2674 C  CB  . HIS A 402 ? 0.4632 0.6052 0.5335 0.0080  0.0158  0.0098  478  HIS A CB  
2675 C  CG  . HIS A 402 ? 0.5409 0.6807 0.6064 -0.0010 0.0157  0.0114  478  HIS A CG  
2676 N  ND1 . HIS A 402 ? 0.5643 0.6920 0.6204 0.0005  0.0185  0.0092  478  HIS A ND1 
2677 C  CD2 . HIS A 402 ? 0.5591 0.7062 0.6267 -0.0122 0.0128  0.0152  478  HIS A CD2 
2678 C  CE1 . HIS A 402 ? 0.5659 0.6936 0.6189 -0.0088 0.0175  0.0117  478  HIS A CE1 
2679 N  NE2 . HIS A 402 ? 0.5661 0.7048 0.6256 -0.0168 0.0142  0.0153  478  HIS A NE2 
2680 N  N   . TRP A 403 ? 0.4345 0.5961 0.5173 0.0355  0.0251  0.0123  479  TRP A N   
2681 C  CA  . TRP A 403 ? 0.3868 0.5483 0.4727 0.0429  0.0238  0.0121  479  TRP A CA  
2682 C  C   . TRP A 403 ? 0.3981 0.5709 0.4884 0.0554  0.0309  0.0153  479  TRP A C   
2683 O  O   . TRP A 403 ? 0.3683 0.5325 0.4504 0.0619  0.0371  0.0130  479  TRP A O   
2684 C  CB  . TRP A 403 ? 0.3325 0.4695 0.4070 0.0448  0.0213  0.0055  479  TRP A CB  
2685 C  CG  . TRP A 403 ? 0.2778 0.4042 0.3487 0.0347  0.0151  0.0025  479  TRP A CG  
2686 C  CD1 . TRP A 403 ? 0.2840 0.3959 0.3463 0.0301  0.0142  -0.0012 479  TRP A CD1 
2687 C  CD2 . TRP A 403 ? 0.2884 0.4173 0.3632 0.0284  0.0092  0.0033  479  TRP A CD2 
2688 N  NE1 . TRP A 403 ? 0.2740 0.3793 0.3352 0.0225  0.0087  -0.0027 479  TRP A NE1 
2689 C  CE2 . TRP A 403 ? 0.2843 0.3990 0.3521 0.0211  0.0058  -0.0004 479  TRP A CE2 
2690 C  CE3 . TRP A 403 ? 0.2903 0.4318 0.3730 0.0286  0.0065  0.0069  479  TRP A CE3 
2691 C  CZ2 . TRP A 403 ? 0.2840 0.3952 0.3513 0.0143  0.0007  -0.0011 479  TRP A CZ2 
2692 C  CZ3 . TRP A 403 ? 0.2595 0.3977 0.3413 0.0206  0.0005  0.0062  479  TRP A CZ3 
2693 C  CH2 . TRP A 403 ? 0.2675 0.3899 0.3411 0.0137  -0.0019 0.0020  479  TRP A CH2 
2694 N  N   . ASP A 404 ? 0.4310 0.6222 0.5333 0.0590  0.0300  0.0207  480  ASP A N   
2695 C  CA  . ASP A 404 ? 0.4724 0.6743 0.5797 0.0730  0.0368  0.0244  480  ASP A CA  
2696 C  C   . ASP A 404 ? 0.4045 0.5838 0.5004 0.0828  0.0377  0.0194  480  ASP A C   
2697 O  O   . ASP A 404 ? 0.3926 0.5635 0.4871 0.0804  0.0316  0.0178  480  ASP A O   
2698 C  CB  . ASP A 404 ? 0.5820 0.8122 0.7067 0.0735  0.0345  0.0327  480  ASP A CB  
2699 C  CG  . ASP A 404 ? 0.7057 0.9634 0.8427 0.0749  0.0404  0.0398  480  ASP A CG  
2700 O  OD1 . ASP A 404 ? 0.7504 1.0168 0.8902 0.0627  0.0386  0.0414  480  ASP A OD1 
2701 O  OD2 . ASP A 404 ? 0.7450 1.0152 0.8884 0.0885  0.0472  0.0439  480  ASP A OD2 
2702 N  N   . ASP A 405 ? 0.3557 0.5240 0.4419 0.0932  0.0454  0.0170  481  ASP A N   
2703 C  CA  . ASP A 405 ? 0.3735 0.5181 0.4465 0.1021  0.0466  0.0124  481  ASP A CA  
2704 C  C   . ASP A 405 ? 0.3337 0.4562 0.3964 0.0927  0.0395  0.0061  481  ASP A C   
2705 O  O   . ASP A 405 ? 0.3233 0.4369 0.3841 0.0932  0.0350  0.0050  481  ASP A O   
2706 C  CB  . ASP A 405 ? 0.4360 0.5896 0.5167 0.1122  0.0466  0.0171  481  ASP A CB  
2707 C  CG  . ASP A 405 ? 0.5417 0.6737 0.6081 0.1257  0.0519  0.0142  481  ASP A CG  
2708 O  OD1 . ASP A 405 ? 0.5811 0.6890 0.6305 0.1252  0.0541  0.0078  481  ASP A OD1 
2709 O  OD2 . ASP A 405 ? 0.5949 0.7337 0.6666 0.1367  0.0536  0.0187  481  ASP A OD2 
2710 N  N   . ALA A 406 ? 0.3162 0.4312 0.3728 0.0844  0.0387  0.0027  482  ALA A N   
2711 C  CA  . ALA A 406 ? 0.3040 0.4057 0.3557 0.0740  0.0317  -0.0016 482  ALA A CA  
2712 C  C   . ALA A 406 ? 0.2963 0.3755 0.3362 0.0768  0.0297  -0.0063 482  ALA A C   
2713 O  O   . ALA A 406 ? 0.2857 0.3582 0.3252 0.0701  0.0237  -0.0084 482  ALA A O   
2714 C  CB  . ALA A 406 ? 0.2958 0.3925 0.3418 0.0669  0.0322  -0.0039 482  ALA A CB  
2715 N  N   . GLU A 407 ? 0.2909 0.3574 0.3199 0.0861  0.0348  -0.0080 483  GLU A N   
2716 C  CA  . GLU A 407 ? 0.3527 0.3963 0.3687 0.0874  0.0327  -0.0122 483  GLU A CA  
2717 C  C   . GLU A 407 ? 0.3636 0.4074 0.3827 0.0932  0.0312  -0.0100 483  GLU A C   
2718 O  O   . GLU A 407 ? 0.3341 0.3596 0.3430 0.0929  0.0287  -0.0129 483  GLU A O   
2719 C  CB  . GLU A 407 ? 0.4338 0.4583 0.4322 0.0934  0.0382  -0.0157 483  GLU A CB  
2720 C  CG  . GLU A 407 ? 0.4871 0.5071 0.4789 0.0867  0.0386  -0.0183 483  GLU A CG  
2721 C  CD  . GLU A 407 ? 0.5677 0.5673 0.5397 0.0920  0.0438  -0.0218 483  GLU A CD  
2722 O  OE1 . GLU A 407 ? 0.6058 0.5867 0.5653 0.0966  0.0442  -0.0241 483  GLU A OE1 
2723 O  OE2 . GLU A 407 ? 0.6031 0.6042 0.5707 0.0910  0.0475  -0.0222 483  GLU A OE2 
2724 N  N   . LYS A 408 ? 0.3652 0.4296 0.3980 0.0978  0.0323  -0.0044 484  LYS A N   
2725 C  CA  . LYS A 408 ? 0.3563 0.4213 0.3918 0.1039  0.0306  -0.0015 484  LYS A CA  
2726 C  C   . LYS A 408 ? 0.3250 0.3932 0.3664 0.0942  0.0227  -0.0014 484  LYS A C   
2727 O  O   . LYS A 408 ? 0.3128 0.3941 0.3633 0.0851  0.0193  -0.0005 484  LYS A O   
2728 C  CB  . LYS A 408 ? 0.3571 0.4445 0.4054 0.1136  0.0347  0.0054  484  LYS A CB  
2729 C  CG  . LYS A 408 ? 0.3980 0.4840 0.4473 0.1224  0.0336  0.0089  484  LYS A CG  
2730 C  CD  . LYS A 408 ? 0.4594 0.5672 0.5207 0.1344  0.0386  0.0162  484  LYS A CD  
2731 C  CE  . LYS A 408 ? 0.4941 0.5852 0.5440 0.1502  0.0444  0.0165  484  LYS A CE  
2732 N  NZ  . LYS A 408 ? 0.4884 0.5583 0.5277 0.1497  0.0392  0.0146  484  LYS A NZ  
2733 N  N   . PHE A 409 ? 0.2852 0.3397 0.3198 0.0962  0.0200  -0.0023 485  PHE A N   
2734 C  CA  . PHE A 409 ? 0.2931 0.3495 0.3316 0.0886  0.0134  -0.0018 485  PHE A CA  
2735 C  C   . PHE A 409 ? 0.2697 0.3470 0.3213 0.0920  0.0117  0.0049  485  PHE A C   
2736 O  O   . PHE A 409 ? 0.2879 0.3638 0.3385 0.1011  0.0125  0.0083  485  PHE A O   
2737 C  CB  . PHE A 409 ? 0.2861 0.3200 0.3115 0.0892  0.0117  -0.0047 485  PHE A CB  
2738 C  CG  . PHE A 409 ? 0.2776 0.3121 0.3053 0.0822  0.0058  -0.0041 485  PHE A CG  
2739 C  CD1 . PHE A 409 ? 0.2473 0.2895 0.2809 0.0717  0.0022  -0.0055 485  PHE A CD1 
2740 C  CD2 . PHE A 409 ? 0.2894 0.3146 0.3114 0.0863  0.0042  -0.0023 485  PHE A CD2 
2741 C  CE1 . PHE A 409 ? 0.2703 0.3118 0.3043 0.0656  -0.0023 -0.0053 485  PHE A CE1 
2742 C  CE2 . PHE A 409 ? 0.2841 0.3093 0.3068 0.0796  -0.0008 -0.0018 485  PHE A CE2 
2743 C  CZ  . PHE A 409 ? 0.2962 0.3297 0.3248 0.0693  -0.0038 -0.0034 485  PHE A CZ  
2744 N  N   . ASN A 410 ? 0.2362 0.3327 0.2995 0.0845  0.0091  0.0073  486  ASN A N   
2745 C  CA  . ASN A 410 ? 0.2808 0.4005 0.3575 0.0858  0.0067  0.0144  486  ASN A CA  
2746 C  C   . ASN A 410 ? 0.2747 0.4007 0.3553 0.0729  -0.0001 0.0144  486  ASN A C   
2747 O  O   . ASN A 410 ? 0.2415 0.3781 0.3275 0.0648  -0.0011 0.0147  486  ASN A O   
2748 C  CB  . ASN A 410 ? 0.3006 0.4406 0.3877 0.0900  0.0115  0.0186  486  ASN A CB  
2749 C  CG  . ASN A 410 ? 0.3140 0.4815 0.4168 0.0898  0.0083  0.0269  486  ASN A CG  
2750 O  OD1 . ASN A 410 ? 0.3403 0.5104 0.4450 0.0898  0.0033  0.0300  486  ASN A OD1 
2751 N  ND2 . ASN A 410 ? 0.2637 0.4525 0.3774 0.0888  0.0110  0.0310  486  ASN A ND2 
2752 N  N   . PRO A 411 ? 0.2878 0.4062 0.3641 0.0706  -0.0047 0.0143  487  PRO A N   
2753 C  CA  . PRO A 411 ? 0.2677 0.3897 0.3450 0.0586  -0.0107 0.0139  487  PRO A CA  
2754 C  C   . PRO A 411 ? 0.2588 0.4046 0.3479 0.0535  -0.0139 0.0198  487  PRO A C   
2755 O  O   . PRO A 411 ? 0.2820 0.4294 0.3705 0.0423  -0.0173 0.0183  487  PRO A O   
2756 C  CB  . PRO A 411 ? 0.2422 0.3544 0.3133 0.0599  -0.0142 0.0144  487  PRO A CB  
2757 C  CG  . PRO A 411 ? 0.2686 0.3632 0.3310 0.0690  -0.0098 0.0117  487  PRO A CG  
2758 C  CD  . PRO A 411 ? 0.2955 0.3984 0.3632 0.0781  -0.0043 0.0138  487  PRO A CD  
2759 N  N   . GLU A 412 ? 0.2498 0.4139 0.3491 0.0613  -0.0128 0.0266  488  GLU A N   
2760 C  CA  . GLU A 412 ? 0.2733 0.4630 0.3851 0.0557  -0.0165 0.0334  488  GLU A CA  
2761 C  C   . GLU A 412 ? 0.2604 0.4634 0.3795 0.0534  -0.0126 0.0344  488  GLU A C   
2762 O  O   . GLU A 412 ? 0.2741 0.5017 0.4055 0.0503  -0.0145 0.0414  488  GLU A O   
2763 C  CB  . GLU A 412 ? 0.3109 0.5176 0.4321 0.0651  -0.0179 0.0417  488  GLU A CB  
2764 C  CG  . GLU A 412 ? 0.3712 0.5655 0.4846 0.0661  -0.0226 0.0416  488  GLU A CG  
2765 C  CD  . GLU A 412 ? 0.4230 0.6351 0.5458 0.0745  -0.0254 0.0509  488  GLU A CD  
2766 O  OE1 . GLU A 412 ? 0.4311 0.6663 0.5644 0.0679  -0.0311 0.0576  488  GLU A OE1 
2767 O  OE2 . GLU A 412 ? 0.4294 0.6318 0.5485 0.0874  -0.0222 0.0517  488  GLU A OE2 
2768 N  N   . ARG A 413 ? 0.2511 0.4391 0.3630 0.0540  -0.0075 0.0282  489  ARG A N   
2769 C  CA  . ARG A 413 ? 0.2665 0.4651 0.3834 0.0496  -0.0046 0.0289  489  ARG A CA  
2770 C  C   . ARG A 413 ? 0.2831 0.4879 0.4012 0.0342  -0.0106 0.0298  489  ARG A C   
2771 O  O   . ARG A 413 ? 0.2847 0.5034 0.4088 0.0285  -0.0097 0.0327  489  ARG A O   
2772 C  CB  . ARG A 413 ? 0.2535 0.4328 0.3604 0.0523  0.0010  0.0221  489  ARG A CB  
2773 C  CG  . ARG A 413 ? 0.2326 0.3890 0.3275 0.0449  -0.0018 0.0148  489  ARG A CG  
2774 C  CD  . ARG A 413 ? 0.2413 0.3829 0.3282 0.0467  0.0030  0.0095  489  ARG A CD  
2775 N  NE  . ARG A 413 ? 0.2695 0.4026 0.3517 0.0586  0.0083  0.0083  489  ARG A NE  
2776 C  CZ  . ARG A 413 ? 0.2777 0.4169 0.3615 0.0658  0.0145  0.0099  489  ARG A CZ  
2777 N  NH1 . ARG A 413 ? 0.2643 0.4201 0.3557 0.0621  0.0163  0.0133  489  ARG A NH1 
2778 N  NH2 . ARG A 413 ? 0.2892 0.4166 0.3655 0.0764  0.0192  0.0081  489  ARG A NH2 
2779 N  N   . TRP A 414 ? 0.2747 0.4683 0.3855 0.0271  -0.0164 0.0273  490  TRP A N   
2780 C  CA  . TRP A 414 ? 0.2972 0.4967 0.4077 0.0131  -0.0230 0.0291  490  TRP A CA  
2781 C  C   . TRP A 414 ? 0.3063 0.5191 0.4220 0.0126  -0.0289 0.0351  490  TRP A C   
2782 O  O   . TRP A 414 ? 0.3189 0.5215 0.4299 0.0187  -0.0297 0.0336  490  TRP A O   
2783 C  CB  . TRP A 414 ? 0.2863 0.4614 0.3825 0.0052  -0.0248 0.0216  490  TRP A CB  
2784 C  CG  . TRP A 414 ? 0.2966 0.4560 0.3866 0.0071  -0.0197 0.0155  490  TRP A CG  
2785 C  CD1 . TRP A 414 ? 0.3236 0.4834 0.4131 0.0013  -0.0181 0.0149  490  TRP A CD1 
2786 C  CD2 . TRP A 414 ? 0.2535 0.3943 0.3363 0.0145  -0.0162 0.0097  490  TRP A CD2 
2787 N  NE1 . TRP A 414 ? 0.2955 0.4385 0.3782 0.0054  -0.0140 0.0092  490  TRP A NE1 
2788 C  CE2 . TRP A 414 ? 0.2772 0.4091 0.3561 0.0131  -0.0129 0.0061  490  TRP A CE2 
2789 C  CE3 . TRP A 414 ? 0.2389 0.3698 0.3179 0.0214  -0.0159 0.0078  490  TRP A CE3 
2790 C  CZ2 . TRP A 414 ? 0.2399 0.3551 0.3121 0.0181  -0.0098 0.0008  490  TRP A CZ2 
2791 C  CZ3 . TRP A 414 ? 0.2269 0.3407 0.2988 0.0258  -0.0125 0.0024  490  TRP A CZ3 
2792 C  CH2 . TRP A 414 ? 0.2385 0.3454 0.3075 0.0241  -0.0097 -0.0010 490  TRP A CH2 
2793 N  N   . PRO A 415 ? 0.3020 0.5378 0.4271 0.0048  -0.0335 0.0424  491  PRO A N   
2794 C  CA  . PRO A 415 ? 0.3228 0.5734 0.4533 0.0036  -0.0402 0.0491  491  PRO A CA  
2795 C  C   . PRO A 415 ? 0.3285 0.5589 0.4454 0.0002  -0.0448 0.0447  491  PRO A C   
2796 O  O   . PRO A 415 ? 0.2880 0.4994 0.3918 -0.0093 -0.0464 0.0385  491  PRO A O   
2797 C  CB  . PRO A 415 ? 0.3252 0.5963 0.4621 -0.0106 -0.0459 0.0552  491  PRO A CB  
2798 C  CG  . PRO A 415 ? 0.3122 0.5910 0.4556 -0.0095 -0.0395 0.0553  491  PRO A CG  
2799 C  CD  . PRO A 415 ? 0.3071 0.5582 0.4390 -0.0031 -0.0328 0.0456  491  PRO A CD  
2800 N  N   . LEU A 416 ? 0.3547 0.5888 0.4741 0.0087  -0.0466 0.0484  492  LEU A N   
2801 C  CA  . LEU A 416 ? 0.3712 0.5858 0.4775 0.0071  -0.0499 0.0445  492  LEU A CA  
2802 C  C   . LEU A 416 ? 0.3818 0.5938 0.4792 -0.0090 -0.0576 0.0444  492  LEU A C   
2803 O  O   . LEU A 416 ? 0.3912 0.5807 0.4735 -0.0141 -0.0580 0.0377  492  LEU A O   
2804 C  CB  . LEU A 416 ? 0.3837 0.6055 0.4949 0.0183  -0.0513 0.0502  492  LEU A CB  
2805 C  CG  . LEU A 416 ? 0.4195 0.6205 0.5172 0.0194  -0.0533 0.0467  492  LEU A CG  
2806 C  CD1 . LEU A 416 ? 0.4060 0.5815 0.4934 0.0238  -0.0465 0.0376  492  LEU A CD1 
2807 C  CD2 . LEU A 416 ? 0.4549 0.6654 0.5584 0.0303  -0.0554 0.0541  492  LEU A CD2 
2808 N  N   . ASP A 417 ? 0.3685 0.6032 0.4742 -0.0174 -0.0636 0.0519  493  ASP A N   
2809 C  CA  . ASP A 417 ? 0.4199 0.6518 0.5154 -0.0338 -0.0717 0.0524  493  ASP A CA  
2810 C  C   . ASP A 417 ? 0.4298 0.6554 0.5192 -0.0464 -0.0715 0.0487  493  ASP A C   
2811 O  O   . ASP A 417 ? 0.4505 0.6712 0.5290 -0.0611 -0.0781 0.0487  493  ASP A O   
2812 C  CB  . ASP A 417 ? 0.4708 0.7306 0.5772 -0.0377 -0.0802 0.0634  493  ASP A CB  
2813 C  CG  . ASP A 417 ? 0.5156 0.7778 0.6241 -0.0268 -0.0820 0.0673  493  ASP A CG  
2814 O  OD1 . ASP A 417 ? 0.5139 0.7520 0.6074 -0.0256 -0.0814 0.0612  493  ASP A OD1 
2815 O  OD2 . ASP A 417 ? 0.5347 0.8229 0.6598 -0.0191 -0.0837 0.0767  493  ASP A OD2 
2816 N  N   . GLY A 418 ? 0.3872 0.6107 0.4814 -0.0414 -0.0643 0.0455  494  GLY A N   
2817 C  CA  . GLY A 418 ? 0.3621 0.5778 0.4498 -0.0524 -0.0636 0.0422  494  GLY A CA  
2818 C  C   . GLY A 418 ? 0.3807 0.5641 0.4508 -0.0532 -0.0599 0.0319  494  GLY A C   
2819 O  O   . GLY A 418 ? 0.3960 0.5643 0.4592 -0.0464 -0.0581 0.0275  494  GLY A O   
2820 N  N   . PRO A 419 ? 0.3988 0.5716 0.4616 -0.0615 -0.0587 0.0285  495  PRO A N   
2821 C  CA  . PRO A 419 ? 0.3969 0.5399 0.4435 -0.0619 -0.0551 0.0195  495  PRO A CA  
2822 C  C   . PRO A 419 ? 0.3577 0.4922 0.4078 -0.0474 -0.0476 0.0147  495  PRO A C   
2823 O  O   . PRO A 419 ? 0.3331 0.4803 0.3958 -0.0387 -0.0437 0.0171  495  PRO A O   
2824 C  CB  . PRO A 419 ? 0.4226 0.5604 0.4640 -0.0718 -0.0550 0.0187  495  PRO A CB  
2825 C  CG  . PRO A 419 ? 0.4527 0.6145 0.5024 -0.0822 -0.0613 0.0272  495  PRO A CG  
2826 C  CD  . PRO A 419 ? 0.4282 0.6160 0.4964 -0.0720 -0.0612 0.0336  495  PRO A CD  
2827 N  N   . ASN A 420 ? 0.3374 0.4500 0.3754 -0.0451 -0.0456 0.0082  496  ASN A N   
2828 C  CA  . ASN A 420 ? 0.3027 0.4057 0.3423 -0.0337 -0.0392 0.0036  496  ASN A CA  
2829 C  C   . ASN A 420 ? 0.3065 0.4055 0.3475 -0.0332 -0.0351 0.0015  496  ASN A C   
2830 O  O   . ASN A 420 ? 0.2792 0.3702 0.3124 -0.0420 -0.0364 0.0003  496  ASN A O   
2831 C  CB  . ASN A 420 ? 0.3087 0.3906 0.3353 -0.0330 -0.0378 -0.0024 496  ASN A CB  
2832 C  CG  . ASN A 420 ? 0.3461 0.4300 0.3695 -0.0335 -0.0415 -0.0005 496  ASN A CG  
2833 O  OD1 . ASN A 420 ? 0.3359 0.4356 0.3690 -0.0294 -0.0437 0.0047  496  ASN A OD1 
2834 N  ND2 . ASN A 420 ? 0.3679 0.4350 0.3770 -0.0379 -0.0418 -0.0046 496  ASN A ND2 
2835 N  N   . PRO A 421 ? 0.2840 0.3869 0.3332 -0.0233 -0.0303 0.0011  497  PRO A N   
2836 C  CA  . PRO A 421 ? 0.2771 0.3766 0.3270 -0.0230 -0.0268 -0.0004 497  PRO A CA  
2837 C  C   . PRO A 421 ? 0.2958 0.3734 0.3346 -0.0237 -0.0248 -0.0066 497  PRO A C   
2838 O  O   . PRO A 421 ? 0.2865 0.3535 0.3211 -0.0191 -0.0233 -0.0102 497  PRO A O   
2839 C  CB  . PRO A 421 ? 0.2528 0.3605 0.3122 -0.0119 -0.0225 0.0005  497  PRO A CB  
2840 C  CG  . PRO A 421 ? 0.2280 0.3315 0.2864 -0.0054 -0.0226 -0.0008 497  PRO A CG  
2841 C  CD  . PRO A 421 ? 0.2585 0.3665 0.3144 -0.0124 -0.0281 0.0018  497  PRO A CD  
2842 N  N   . ASN A 422 ? 0.2985 0.3697 0.3325 -0.0294 -0.0245 -0.0072 498  ASN A N   
2843 C  CA  . ASN A 422 ? 0.2938 0.3452 0.3183 -0.0286 -0.0221 -0.0122 498  ASN A CA  
2844 C  C   . ASN A 422 ? 0.2965 0.3475 0.3219 -0.0299 -0.0204 -0.0112 498  ASN A C   
2845 O  O   . ASN A 422 ? 0.2897 0.3557 0.3226 -0.0319 -0.0207 -0.0069 498  ASN A O   
2846 C  CB  . ASN A 422 ? 0.3024 0.3382 0.3132 -0.0359 -0.0244 -0.0147 498  ASN A CB  
2847 C  CG  . ASN A 422 ? 0.3560 0.3943 0.3617 -0.0479 -0.0288 -0.0115 498  ASN A CG  
2848 O  OD1 . ASN A 422 ? 0.3728 0.4159 0.3809 -0.0519 -0.0289 -0.0089 498  ASN A OD1 
2849 N  ND2 . ASN A 422 ? 0.3827 0.4176 0.3802 -0.0548 -0.0326 -0.0115 498  ASN A ND2 
2850 N  N   . GLU A 423 ? 0.2882 0.3223 0.3060 -0.0285 -0.0184 -0.0147 499  GLU A N   
2851 C  CA  . GLU A 423 ? 0.3173 0.3492 0.3348 -0.0290 -0.0169 -0.0137 499  GLU A CA  
2852 C  C   . GLU A 423 ? 0.3451 0.3782 0.3579 -0.0400 -0.0196 -0.0104 499  GLU A C   
2853 O  O   . GLU A 423 ? 0.3317 0.3699 0.3471 -0.0418 -0.0186 -0.0078 499  GLU A O   
2854 C  CB  . GLU A 423 ? 0.3593 0.3729 0.3695 -0.0247 -0.0147 -0.0174 499  GLU A CB  
2855 C  CG  . GLU A 423 ? 0.3814 0.3761 0.3777 -0.0303 -0.0158 -0.0194 499  GLU A CG  
2856 C  CD  . GLU A 423 ? 0.4301 0.4174 0.4206 -0.0298 -0.0159 -0.0224 499  GLU A CD  
2857 O  OE1 . GLU A 423 ? 0.4168 0.4150 0.4147 -0.0265 -0.0161 -0.0224 499  GLU A OE1 
2858 O  OE2 . GLU A 423 ? 0.4573 0.4263 0.4346 -0.0325 -0.0157 -0.0248 499  GLU A OE2 
2859 N  N   . THR A 424 ? 0.3364 0.3649 0.3416 -0.0483 -0.0231 -0.0103 500  THR A N   
2860 C  CA  . THR A 424 ? 0.3637 0.3927 0.3631 -0.0608 -0.0265 -0.0069 500  THR A CA  
2861 C  C   . THR A 424 ? 0.3099 0.3658 0.3227 -0.0645 -0.0284 -0.0008 500  THR A C   
2862 O  O   . THR A 424 ? 0.3293 0.3944 0.3459 -0.0690 -0.0280 0.0031  500  THR A O   
2863 C  CB  . THR A 424 ? 0.4002 0.4127 0.3842 -0.0694 -0.0300 -0.0091 500  THR A CB  
2864 O  OG1 . THR A 424 ? 0.4539 0.4417 0.4258 -0.0642 -0.0271 -0.0145 500  THR A OG1 
2865 C  CG2 . THR A 424 ? 0.3850 0.3956 0.3607 -0.0840 -0.0342 -0.0054 500  THR A CG2 
2866 N  N   . ASN A 425 ? 0.3028 0.3723 0.3231 -0.0624 -0.0302 0.0007  501  ASN A N   
2867 C  CA  . ASN A 425 ? 0.2910 0.3875 0.3248 -0.0651 -0.0320 0.0073  501  ASN A CA  
2868 C  C   . ASN A 425 ? 0.2824 0.3941 0.3299 -0.0542 -0.0268 0.0091  501  ASN A C   
2869 O  O   . ASN A 425 ? 0.2831 0.4177 0.3423 -0.0553 -0.0267 0.0151  501  ASN A O   
2870 C  CB  . ASN A 425 ? 0.3126 0.4189 0.3493 -0.0668 -0.0364 0.0093  501  ASN A CB  
2871 C  CG  . ASN A 425 ? 0.3459 0.4474 0.3845 -0.0549 -0.0340 0.0055  501  ASN A CG  
2872 O  OD1 . ASN A 425 ? 0.3258 0.4291 0.3711 -0.0439 -0.0293 0.0040  501  ASN A OD1 
2873 N  ND2 . ASN A 425 ? 0.3592 0.4541 0.3907 -0.0579 -0.0376 0.0041  501  ASN A ND2 
2874 N  N   . GLN A 426 ? 0.2938 0.3937 0.3397 -0.0440 -0.0225 0.0044  502  GLN A N   
2875 C  CA  . GLN A 426 ? 0.3068 0.4160 0.3612 -0.0351 -0.0175 0.0054  502  GLN A CA  
2876 C  C   . GLN A 426 ? 0.3164 0.4165 0.3652 -0.0376 -0.0152 0.0047  502  GLN A C   
2877 O  O   . GLN A 426 ? 0.2827 0.3868 0.3354 -0.0308 -0.0109 0.0049  502  GLN A O   
2878 C  CB  . GLN A 426 ? 0.2939 0.3967 0.3495 -0.0232 -0.0148 0.0013  502  GLN A CB  
2879 C  CG  . GLN A 426 ? 0.2901 0.4001 0.3500 -0.0201 -0.0170 0.0022  502  GLN A CG  
2880 C  CD  . GLN A 426 ? 0.3050 0.4394 0.3769 -0.0197 -0.0174 0.0087  502  GLN A CD  
2881 O  OE1 . GLN A 426 ? 0.2822 0.4272 0.3617 -0.0115 -0.0132 0.0106  502  GLN A OE1 
2882 N  NE2 . GLN A 426 ? 0.2766 0.4199 0.3496 -0.0283 -0.0226 0.0123  502  GLN A NE2 
2883 N  N   A ASN A 427 ? 0.3259 0.4121 0.3640 -0.0471 -0.0179 0.0040  503  ASN A N   
2884 N  N   B ASN A 427 ? 0.3258 0.4124 0.3640 -0.0473 -0.0180 0.0041  503  ASN A N   
2885 C  CA  A ASN A 427 ? 0.3331 0.4095 0.3644 -0.0506 -0.0164 0.0041  503  ASN A CA  
2886 C  CA  B ASN A 427 ? 0.3336 0.4088 0.3643 -0.0508 -0.0166 0.0039  503  ASN A CA  
2887 C  C   A ASN A 427 ? 0.3140 0.3799 0.3438 -0.0402 -0.0126 0.0004  503  ASN A C   
2888 C  C   B ASN A 427 ? 0.3140 0.3800 0.3439 -0.0402 -0.0127 0.0004  503  ASN A C   
2889 O  O   A ASN A 427 ? 0.3113 0.3802 0.3422 -0.0385 -0.0098 0.0019  503  ASN A O   
2890 O  O   B ASN A 427 ? 0.3108 0.3808 0.3424 -0.0384 -0.0098 0.0021  503  ASN A O   
2891 C  CB  A ASN A 427 ? 0.3498 0.4453 0.3880 -0.0565 -0.0154 0.0103  503  ASN A CB  
2892 C  CB  B ASN A 427 ? 0.3525 0.4447 0.3885 -0.0580 -0.0160 0.0100  503  ASN A CB  
2893 C  CG  A ASN A 427 ? 0.3773 0.4844 0.4170 -0.0688 -0.0201 0.0150  503  ASN A CG  
2894 C  CG  B ASN A 427 ? 0.3914 0.4688 0.4159 -0.0662 -0.0165 0.0106  503  ASN A CG  
2895 O  OD1 A ASN A 427 ? 0.4077 0.5011 0.4356 -0.0799 -0.0237 0.0149  503  ASN A OD1 
2896 O  OD1 B ASN A 427 ? 0.4246 0.4803 0.4360 -0.0708 -0.0191 0.0077  503  ASN A OD1 
2897 N  ND2 A ASN A 427 ? 0.3798 0.5117 0.4332 -0.0670 -0.0202 0.0194  503  ASN A ND2 
2898 N  ND2 B ASN A 427 ? 0.4022 0.4902 0.4305 -0.0677 -0.0135 0.0144  503  ASN A ND2 
2899 N  N   . PHE A 428 ? 0.2905 0.3448 0.3176 -0.0338 -0.0128 -0.0042 504  PHE A N   
2900 C  CA  . PHE A 428 ? 0.2950 0.3387 0.3202 -0.0253 -0.0104 -0.0075 504  PHE A CA  
2901 C  C   . PHE A 428 ? 0.2670 0.3221 0.2999 -0.0177 -0.0071 -0.0068 504  PHE A C   
2902 O  O   . PHE A 428 ? 0.2914 0.3389 0.3217 -0.0126 -0.0056 -0.0086 504  PHE A O   
2903 C  CB  . PHE A 428 ? 0.3106 0.3386 0.3262 -0.0283 -0.0106 -0.0078 504  PHE A CB  
2904 C  CG  . PHE A 428 ? 0.3462 0.3557 0.3518 -0.0307 -0.0125 -0.0105 504  PHE A CG  
2905 C  CD1 . PHE A 428 ? 0.3463 0.3515 0.3452 -0.0400 -0.0151 -0.0096 504  PHE A CD1 
2906 C  CD2 . PHE A 428 ? 0.3526 0.3490 0.3549 -0.0235 -0.0115 -0.0137 504  PHE A CD2 
2907 C  CE1 . PHE A 428 ? 0.3798 0.3652 0.3669 -0.0417 -0.0161 -0.0126 504  PHE A CE1 
2908 C  CE2 . PHE A 428 ? 0.3682 0.3476 0.3611 -0.0242 -0.0121 -0.0161 504  PHE A CE2 
2909 C  CZ  . PHE A 428 ? 0.3894 0.3617 0.3735 -0.0330 -0.0141 -0.0159 504  PHE A CZ  
2910 N  N   . SER A 429 ? 0.2439 0.3164 0.2853 -0.0164 -0.0060 -0.0041 505  SER A N   
2911 C  CA  . SER A 429 ? 0.2527 0.3318 0.2991 -0.0072 -0.0026 -0.0046 505  SER A CA  
2912 C  C   . SER A 429 ? 0.2546 0.3295 0.3021 -0.0013 -0.0035 -0.0077 505  SER A C   
2913 O  O   . SER A 429 ? 0.2314 0.3070 0.2803 0.0061  -0.0011 -0.0088 505  SER A O   
2914 C  CB  . SER A 429 ? 0.2550 0.3542 0.3099 -0.0064 -0.0000 0.0000  505  SER A CB  
2915 O  OG  . SER A 429 ? 0.2843 0.3878 0.3380 -0.0095 0.0025  0.0027  505  SER A OG  
2916 N  N   . TYR A 430 ? 0.2319 0.3013 0.2774 -0.0049 -0.0066 -0.0090 506  TYR A N   
2917 C  CA  . TYR A 430 ? 0.2225 0.2876 0.2681 -0.0006 -0.0075 -0.0117 506  TYR A CA  
2918 C  C   . TYR A 430 ? 0.2388 0.2888 0.2773 -0.0033 -0.0091 -0.0149 506  TYR A C   
2919 O  O   . TYR A 430 ? 0.2937 0.3399 0.3277 -0.0100 -0.0111 -0.0145 506  TYR A O   
2920 C  CB  . TYR A 430 ? 0.2358 0.3129 0.2866 -0.0017 -0.0093 -0.0090 506  TYR A CB  
2921 C  CG  . TYR A 430 ? 0.2546 0.3281 0.3052 0.0024  -0.0102 -0.0110 506  TYR A CG  
2922 C  CD1 . TYR A 430 ? 0.2454 0.3170 0.2971 0.0103  -0.0079 -0.0124 506  TYR A CD1 
2923 C  CD2 . TYR A 430 ? 0.2946 0.3656 0.3421 -0.0024 -0.0133 -0.0113 506  TYR A CD2 
2924 C  CE1 . TYR A 430 ? 0.2172 0.2848 0.2678 0.0132  -0.0088 -0.0137 506  TYR A CE1 
2925 C  CE2 . TYR A 430 ? 0.2761 0.3439 0.3226 0.0009  -0.0140 -0.0127 506  TYR A CE2 
2926 C  CZ  . TYR A 430 ? 0.2453 0.3117 0.2938 0.0086  -0.0117 -0.0138 506  TYR A CZ  
2927 O  OH  . TYR A 430 ? 0.2388 0.3012 0.2854 0.0110  -0.0124 -0.0148 506  TYR A OH  
2928 N  N   . LEU A 431 ? 0.2594 0.3007 0.2962 0.0018  -0.0081 -0.0178 507  LEU A N   
2929 C  CA  . LEU A 431 ? 0.3028 0.3311 0.3339 0.0011  -0.0085 -0.0204 507  LEU A CA  
2930 C  C   . LEU A 431 ? 0.2941 0.3192 0.3263 0.0058  -0.0080 -0.0228 507  LEU A C   
2931 O  O   . LEU A 431 ? 0.3237 0.3425 0.3551 0.0088  -0.0072 -0.0241 507  LEU A O   
2932 C  CB  . LEU A 431 ? 0.3561 0.3772 0.3843 0.0020  -0.0079 -0.0204 507  LEU A CB  
2933 C  CG  . LEU A 431 ? 0.3754 0.3984 0.4020 -0.0018 -0.0078 -0.0178 507  LEU A CG  
2934 C  CD1 . LEU A 431 ? 0.3198 0.3337 0.3428 0.0004  -0.0076 -0.0181 507  LEU A CD1 
2935 C  CD2 . LEU A 431 ? 0.3723 0.3926 0.3943 -0.0094 -0.0094 -0.0167 507  LEU A CD2 
2936 N  N   . PRO A 432 ? 0.2848 0.3145 0.3188 0.0063  -0.0084 -0.0229 508  PRO A N   
2937 C  CA  . PRO A 432 ? 0.3065 0.3331 0.3410 0.0101  -0.0077 -0.0247 508  PRO A CA  
2938 C  C   . PRO A 432 ? 0.3090 0.3264 0.3398 0.0101  -0.0068 -0.0269 508  PRO A C   
2939 O  O   . PRO A 432 ? 0.3308 0.3467 0.3636 0.0135  -0.0057 -0.0277 508  PRO A O   
2940 C  CB  . PRO A 432 ? 0.2927 0.3246 0.3280 0.0092  -0.0088 -0.0239 508  PRO A CB  
2941 C  CG  . PRO A 432 ? 0.2819 0.3172 0.3157 0.0037  -0.0106 -0.0222 508  PRO A CG  
2942 C  CD  . PRO A 432 ? 0.2642 0.3017 0.2993 0.0026  -0.0101 -0.0208 508  PRO A CD  
2943 N  N   . PHE A 433 ? 0.2791 0.2900 0.3041 0.0064  -0.0069 -0.0274 509  PHE A N   
2944 C  CA  . PHE A 433 ? 0.2897 0.2903 0.3097 0.0077  -0.0050 -0.0295 509  PHE A CA  
2945 C  C   . PHE A 433 ? 0.3175 0.3096 0.3333 0.0075  -0.0046 -0.0293 509  PHE A C   
2946 O  O   . PHE A 433 ? 0.2914 0.2722 0.3002 0.0081  -0.0028 -0.0309 509  PHE A O   
2947 C  CB  . PHE A 433 ? 0.2923 0.2880 0.3052 0.0043  -0.0049 -0.0309 509  PHE A CB  
2948 C  CG  . PHE A 433 ? 0.2658 0.2682 0.2816 0.0049  -0.0053 -0.0308 509  PHE A CG  
2949 C  CD1 . PHE A 433 ? 0.2791 0.2814 0.2971 0.0089  -0.0029 -0.0319 509  PHE A CD1 
2950 C  CD2 . PHE A 433 ? 0.3021 0.3117 0.3188 0.0014  -0.0082 -0.0290 509  PHE A CD2 
2951 C  CE1 . PHE A 433 ? 0.2641 0.2709 0.2834 0.0089  -0.0034 -0.0315 509  PHE A CE1 
2952 C  CE2 . PHE A 433 ? 0.3044 0.3189 0.3229 0.0025  -0.0088 -0.0284 509  PHE A CE2 
2953 C  CZ  . PHE A 433 ? 0.2678 0.2798 0.2868 0.0060  -0.0064 -0.0299 509  PHE A CZ  
2954 N  N   . GLY A 434 ? 0.2826 0.2785 0.3013 0.0070  -0.0058 -0.0274 510  GLY A N   
2955 C  CA  . GLY A 434 ? 0.2934 0.2804 0.3072 0.0063  -0.0058 -0.0267 510  GLY A CA  
2956 C  C   . GLY A 434 ? 0.3285 0.3090 0.3339 -0.0010 -0.0071 -0.0262 510  GLY A C   
2957 O  O   . GLY A 434 ? 0.3482 0.3354 0.3539 -0.0061 -0.0087 -0.0256 510  GLY A O   
2958 N  N   . GLY A 435 ? 0.3377 0.3049 0.3350 -0.0017 -0.0067 -0.0262 511  GLY A N   
2959 C  CA  . GLY A 435 ? 0.3576 0.3155 0.3445 -0.0098 -0.0083 -0.0257 511  GLY A CA  
2960 C  C   . GLY A 435 ? 0.3640 0.3022 0.3397 -0.0082 -0.0070 -0.0264 511  GLY A C   
2961 O  O   . GLY A 435 ? 0.3613 0.2961 0.3396 -0.0003 -0.0051 -0.0264 511  GLY A O   
2962 N  N   . GLY A 436 ? 0.3608 0.2854 0.3232 -0.0160 -0.0082 -0.0266 512  GLY A N   
2963 C  CA  . GLY A 436 ? 0.3617 0.2637 0.3101 -0.0151 -0.0070 -0.0272 512  GLY A CA  
2964 C  C   . GLY A 436 ? 0.3925 0.2820 0.3355 -0.0068 -0.0030 -0.0306 512  GLY A C   
2965 O  O   . GLY A 436 ? 0.3971 0.2938 0.3445 -0.0046 -0.0016 -0.0327 512  GLY A O   
2966 N  N   . PRO A 437 ? 0.4156 0.2864 0.3492 -0.0014 -0.0007 -0.0307 513  PRO A N   
2967 C  CA  . PRO A 437 ? 0.4320 0.2887 0.3581 0.0070  0.0042  -0.0338 513  PRO A CA  
2968 C  C   . PRO A 437 ? 0.3948 0.2684 0.3366 0.0166  0.0071  -0.0341 513  PRO A C   
2969 O  O   . PRO A 437 ? 0.3753 0.2432 0.3130 0.0215  0.0113  -0.0368 513  PRO A O   
2970 C  CB  . PRO A 437 ? 0.4640 0.3003 0.3797 0.0125  0.0058  -0.0324 513  PRO A CB  
2971 C  CG  . PRO A 437 ? 0.4891 0.3229 0.4005 0.0028  0.0012  -0.0295 513  PRO A CG  
2972 C  CD  . PRO A 437 ? 0.4161 0.2770 0.3444 -0.0023 -0.0021 -0.0278 513  PRO A CD  
2973 N  N   . ARG A 438 ? 0.3805 0.2741 0.3389 0.0190  0.0051  -0.0314 514  ARG A N   
2974 C  CA  . ARG A 438 ? 0.3503 0.2597 0.3231 0.0268  0.0071  -0.0310 514  ARG A CA  
2975 C  C   . ARG A 438 ? 0.3360 0.2618 0.3171 0.0223  0.0056  -0.0321 514  ARG A C   
2976 O  O   . ARG A 438 ? 0.3120 0.2525 0.3055 0.0266  0.0061  -0.0313 514  ARG A O   
2977 C  CB  . ARG A 438 ? 0.3067 0.2259 0.2907 0.0318  0.0053  -0.0273 514  ARG A CB  
2978 C  CG  . ARG A 438 ? 0.3386 0.2420 0.3149 0.0371  0.0062  -0.0253 514  ARG A CG  
2979 C  CD  . ARG A 438 ? 0.3551 0.2459 0.3251 0.0459  0.0118  -0.0269 514  ARG A CD  
2980 N  NE  . ARG A 438 ? 0.3378 0.2453 0.3225 0.0540  0.0144  -0.0259 514  ARG A NE  
2981 C  CZ  . ARG A 438 ? 0.3655 0.2800 0.3597 0.0629  0.0148  -0.0220 514  ARG A CZ  
2982 N  NH1 . ARG A 438 ? 0.3894 0.2942 0.3793 0.0657  0.0129  -0.0189 514  ARG A NH1 
2983 N  NH2 . ARG A 438 ? 0.3183 0.2500 0.3264 0.0685  0.0167  -0.0207 514  ARG A NH2 
2984 N  N   . LYS A 439 ? 0.3379 0.2614 0.3121 0.0135  0.0035  -0.0333 515  LYS A N   
2985 C  CA  . LYS A 439 ? 0.3345 0.2727 0.3157 0.0097  0.0018  -0.0337 515  LYS A CA  
2986 C  C   . LYS A 439 ? 0.3233 0.2639 0.3068 0.0147  0.0054  -0.0358 515  LYS A C   
2987 O  O   . LYS A 439 ? 0.3324 0.2604 0.3075 0.0186  0.0094  -0.0377 515  LYS A O   
2988 C  CB  . LYS A 439 ? 0.3668 0.3013 0.3391 -0.0004 -0.0012 -0.0341 515  LYS A CB  
2989 C  CG  . LYS A 439 ? 0.3584 0.3089 0.3384 -0.0039 -0.0035 -0.0335 515  LYS A CG  
2990 C  CD  . LYS A 439 ? 0.3933 0.3412 0.3647 -0.0140 -0.0068 -0.0332 515  LYS A CD  
2991 C  CE  . LYS A 439 ? 0.3878 0.3528 0.3679 -0.0162 -0.0093 -0.0317 515  LYS A CE  
2992 N  NZ  . LYS A 439 ? 0.4147 0.3813 0.3889 -0.0264 -0.0136 -0.0300 515  LYS A NZ  
2993 N  N   . CYS A 440 ? 0.3023 0.2585 0.2963 0.0147  0.0042  -0.0351 516  CYS A N   
2994 C  CA  . CYS A 440 ? 0.2731 0.2335 0.2697 0.0180  0.0072  -0.0364 516  CYS A CA  
2995 C  C   . CYS A 440 ? 0.2852 0.2329 0.2682 0.0153  0.0094  -0.0393 516  CYS A C   
2996 O  O   . CYS A 440 ? 0.3008 0.2440 0.2756 0.0079  0.0064  -0.0398 516  CYS A O   
2997 C  CB  . CYS A 440 ? 0.2933 0.2687 0.2992 0.0159  0.0045  -0.0352 516  CYS A CB  
2998 S  SG  . CYS A 440 ? 0.3097 0.2893 0.3166 0.0173  0.0072  -0.0364 516  CYS A SG  
2999 N  N   . ILE A 441 ? 0.2809 0.2236 0.2612 0.0212  0.0147  -0.0409 517  ILE A N   
3000 C  CA  . ILE A 441 ? 0.3171 0.2471 0.2831 0.0192  0.0177  -0.0439 517  ILE A CA  
3001 C  C   . ILE A 441 ? 0.3259 0.2657 0.2946 0.0166  0.0174  -0.0442 517  ILE A C   
3002 O  O   . ILE A 441 ? 0.3424 0.2726 0.2982 0.0130  0.0187  -0.0464 517  ILE A O   
3003 C  CB  . ILE A 441 ? 0.3441 0.2623 0.3036 0.0277  0.0250  -0.0457 517  ILE A CB  
3004 C  CG1 . ILE A 441 ? 0.3311 0.2650 0.3054 0.0354  0.0289  -0.0438 517  ILE A CG1 
3005 C  CG2 . ILE A 441 ? 0.3429 0.2481 0.2970 0.0309  0.0255  -0.0453 517  ILE A CG2 
3006 C  CD1 . ILE A 441 ? 0.3727 0.2987 0.3425 0.0446  0.0370  -0.0449 517  ILE A CD1 
3007 N  N   . GLY A 442 ? 0.3325 0.2891 0.3158 0.0178  0.0156  -0.0418 518  GLY A N   
3008 C  CA  . GLY A 442 ? 0.3237 0.2881 0.3088 0.0154  0.0151  -0.0415 518  GLY A CA  
3009 C  C   . GLY A 442 ? 0.3225 0.2940 0.3100 0.0093  0.0089  -0.0399 518  GLY A C   
3010 O  O   . GLY A 442 ? 0.3333 0.3134 0.3257 0.0086  0.0077  -0.0386 518  GLY A O   
3011 N  N   . ASP A 443 ? 0.3166 0.2847 0.3006 0.0049  0.0052  -0.0395 519  ASP A N   
3012 C  CA  . ASP A 443 ? 0.3100 0.2886 0.2998 0.0008  -0.0001 -0.0369 519  ASP A CA  
3013 C  C   . ASP A 443 ? 0.3116 0.2918 0.2960 -0.0040 -0.0026 -0.0364 519  ASP A C   
3014 O  O   . ASP A 443 ? 0.3069 0.2980 0.2985 -0.0040 -0.0054 -0.0339 519  ASP A O   
3015 C  CB  . ASP A 443 ? 0.3119 0.2887 0.3003 -0.0030 -0.0030 -0.0359 519  ASP A CB  
3016 C  CG  . ASP A 443 ? 0.3634 0.3255 0.3368 -0.0087 -0.0034 -0.0377 519  ASP A CG  
3017 O  OD1 . ASP A 443 ? 0.3944 0.3441 0.3579 -0.0069 0.0005  -0.0406 519  ASP A OD1 
3018 O  OD2 . ASP A 443 ? 0.3647 0.3273 0.3354 -0.0153 -0.0073 -0.0361 519  ASP A OD2 
3019 N  N   . MET A 444 ? 0.3004 0.2688 0.2709 -0.0080 -0.0018 -0.0385 520  MET A N   
3020 C  CA  . MET A 444 ? 0.3095 0.2791 0.2737 -0.0129 -0.0046 -0.0378 520  MET A CA  
3021 C  C   . MET A 444 ? 0.3158 0.2887 0.2827 -0.0087 -0.0014 -0.0379 520  MET A C   
3022 O  O   . MET A 444 ? 0.3035 0.2846 0.2740 -0.0098 -0.0045 -0.0355 520  MET A O   
3023 C  CB  . MET A 444 ? 0.3661 0.3201 0.3119 -0.0193 -0.0048 -0.0402 520  MET A CB  
3024 C  CG  . MET A 444 ? 0.4990 0.4493 0.4401 -0.0261 -0.0092 -0.0394 520  MET A CG  
3025 S  SD  . MET A 444 ? 0.6235 0.5950 0.5793 -0.0299 -0.0164 -0.0337 520  MET A SD  
3026 C  CE  . MET A 444 ? 0.6493 0.6259 0.5995 -0.0356 -0.0212 -0.0314 520  MET A CE  
3027 N  N   . PHE A 445 ? 0.3080 0.2749 0.2733 -0.0038 0.0048  -0.0404 521  PHE A N   
3028 C  CA  . PHE A 445 ? 0.2975 0.2693 0.2672 0.0000  0.0084  -0.0401 521  PHE A CA  
3029 C  C   . PHE A 445 ? 0.3008 0.2858 0.2837 0.0015  0.0052  -0.0369 521  PHE A C   
3030 O  O   . PHE A 445 ? 0.2891 0.2776 0.2716 0.0000  0.0036  -0.0353 521  PHE A O   
3031 C  CB  . PHE A 445 ? 0.2966 0.2652 0.2684 0.0063  0.0152  -0.0419 521  PHE A CB  
3032 C  CG  . PHE A 445 ? 0.2986 0.2733 0.2748 0.0094  0.0197  -0.0412 521  PHE A CG  
3033 C  CD1 . PHE A 445 ? 0.2820 0.2690 0.2714 0.0110  0.0183  -0.0385 521  PHE A CD1 
3034 C  CD2 . PHE A 445 ? 0.3290 0.2962 0.2950 0.0104  0.0258  -0.0432 521  PHE A CD2 
3035 C  CE1 . PHE A 445 ? 0.2967 0.2896 0.2899 0.0124  0.0221  -0.0374 521  PHE A CE1 
3036 C  CE2 . PHE A 445 ? 0.3218 0.2963 0.2925 0.0127  0.0304  -0.0420 521  PHE A CE2 
3037 C  CZ  . PHE A 445 ? 0.3068 0.2946 0.2915 0.0132  0.0282  -0.0389 521  PHE A CZ  
3038 N  N   . ALA A 446 ? 0.2353 0.2258 0.2283 0.0044  0.0042  -0.0360 522  ALA A N   
3039 C  CA  . ALA A 446 ? 0.2346 0.2346 0.2380 0.0064  0.0021  -0.0336 522  ALA A CA  
3040 C  C   . ALA A 446 ? 0.2417 0.2462 0.2455 0.0040  -0.0029 -0.0313 522  ALA A C   
3041 O  O   . ALA A 446 ? 0.2479 0.2564 0.2548 0.0051  -0.0043 -0.0294 522  ALA A O   
3042 C  CB  . ALA A 446 ? 0.2441 0.2474 0.2559 0.0098  0.0025  -0.0335 522  ALA A CB  
3043 N  N   . SER A 447 ? 0.2236 0.2276 0.2243 0.0006  -0.0058 -0.0309 523  SER A N   
3044 C  CA  . SER A 447 ? 0.2654 0.2766 0.2681 -0.0013 -0.0106 -0.0277 523  SER A CA  
3045 C  C   . SER A 447 ? 0.2859 0.2964 0.2830 -0.0029 -0.0121 -0.0264 523  SER A C   
3046 O  O   . SER A 447 ? 0.2766 0.2928 0.2777 -0.0008 -0.0143 -0.0234 523  SER A O   
3047 C  CB  . SER A 447 ? 0.2838 0.2957 0.2837 -0.0062 -0.0136 -0.0271 523  SER A CB  
3048 O  OG  . SER A 447 ? 0.3428 0.3560 0.3480 -0.0047 -0.0126 -0.0275 523  SER A OG  
3049 N  N   . PHE A 448 ? 0.2713 0.2734 0.2577 -0.0064 -0.0105 -0.0284 524  PHE A N   
3050 C  CA  . PHE A 448 ? 0.2763 0.2767 0.2557 -0.0086 -0.0118 -0.0271 524  PHE A CA  
3051 C  C   . PHE A 448 ? 0.2501 0.2509 0.2329 -0.0047 -0.0089 -0.0267 524  PHE A C   
3052 O  O   . PHE A 448 ? 0.2724 0.2752 0.2545 -0.0045 -0.0114 -0.0238 524  PHE A O   
3053 C  CB  . PHE A 448 ? 0.3084 0.2979 0.2734 -0.0134 -0.0101 -0.0298 524  PHE A CB  
3054 C  CG  . PHE A 448 ? 0.3491 0.3361 0.3072 -0.0196 -0.0142 -0.0297 524  PHE A CG  
3055 C  CD1 . PHE A 448 ? 0.3685 0.3664 0.3346 -0.0211 -0.0199 -0.0260 524  PHE A CD1 
3056 C  CD2 . PHE A 448 ? 0.3554 0.3289 0.2983 -0.0241 -0.0123 -0.0331 524  PHE A CD2 
3057 C  CE1 . PHE A 448 ? 0.3889 0.3861 0.3491 -0.0283 -0.0242 -0.0252 524  PHE A CE1 
3058 C  CE2 . PHE A 448 ? 0.4175 0.3871 0.3522 -0.0314 -0.0168 -0.0329 524  PHE A CE2 
3059 C  CZ  . PHE A 448 ? 0.4096 0.3919 0.3535 -0.0341 -0.0231 -0.0287 524  PHE A CZ  
3060 N  N   . GLU A 449 ? 0.2649 0.2639 0.2512 -0.0019 -0.0040 -0.0291 525  GLU A N   
3061 C  CA  . GLU A 449 ? 0.2566 0.2568 0.2463 0.0003  -0.0015 -0.0284 525  GLU A CA  
3062 C  C   . GLU A 449 ? 0.2559 0.2605 0.2516 0.0025  -0.0050 -0.0255 525  GLU A C   
3063 O  O   . GLU A 449 ? 0.2539 0.2569 0.2469 0.0021  -0.0058 -0.0235 525  GLU A O   
3064 C  CB  . GLU A 449 ? 0.2577 0.2589 0.2532 0.0031  0.0033  -0.0304 525  GLU A CB  
3065 C  CG  . GLU A 449 ? 0.2710 0.2757 0.2716 0.0041  0.0051  -0.0290 525  GLU A CG  
3066 C  CD  . GLU A 449 ? 0.2983 0.3069 0.3063 0.0066  0.0090  -0.0300 525  GLU A CD  
3067 O  OE1 . GLU A 449 ? 0.2950 0.3025 0.3039 0.0088  0.0105  -0.0318 525  GLU A OE1 
3068 O  OE2 . GLU A 449 ? 0.2781 0.2912 0.2908 0.0063  0.0102  -0.0284 525  GLU A OE2 
3069 N  N   . ASN A 450 ? 0.2705 0.2794 0.2731 0.0049  -0.0069 -0.0251 526  ASN A N   
3070 C  CA  . ASN A 450 ? 0.2531 0.2644 0.2602 0.0081  -0.0092 -0.0228 526  ASN A CA  
3071 C  C   . ASN A 450 ? 0.2593 0.2723 0.2635 0.0084  -0.0131 -0.0195 526  ASN A C   
3072 O  O   . ASN A 450 ? 0.2496 0.2605 0.2529 0.0110  -0.0142 -0.0172 526  ASN A O   
3073 C  CB  . ASN A 450 ? 0.2690 0.2842 0.2833 0.0108  -0.0092 -0.0234 526  ASN A CB  
3074 C  CG  . ASN A 450 ? 0.2898 0.3038 0.3074 0.0114  -0.0062 -0.0256 526  ASN A CG  
3075 O  OD1 . ASN A 450 ? 0.3493 0.3614 0.3673 0.0118  -0.0056 -0.0252 526  ASN A OD1 
3076 N  ND2 . ASN A 450 ? 0.2745 0.2892 0.2940 0.0110  -0.0048 -0.0274 526  ASN A ND2 
3077 N  N   . VAL A 451 ? 0.2490 0.2652 0.2510 0.0055  -0.0155 -0.0188 527  VAL A N   
3078 C  CA  . VAL A 451 ? 0.2584 0.2783 0.2583 0.0054  -0.0199 -0.0147 527  VAL A CA  
3079 C  C   . VAL A 451 ? 0.2595 0.2726 0.2512 0.0041  -0.0200 -0.0135 527  VAL A C   
3080 O  O   . VAL A 451 ? 0.2774 0.2906 0.2683 0.0071  -0.0226 -0.0098 527  VAL A O   
3081 C  CB  . VAL A 451 ? 0.2814 0.3061 0.2794 0.0004  -0.0231 -0.0140 527  VAL A CB  
3082 C  CG1 . VAL A 451 ? 0.2842 0.3123 0.2780 -0.0015 -0.0281 -0.0095 527  VAL A CG1 
3083 C  CG2 . VAL A 451 ? 0.3165 0.3502 0.3236 0.0019  -0.0240 -0.0131 527  VAL A CG2 
3084 N  N   . VAL A 452 ? 0.2884 0.2951 0.2733 0.0002  -0.0168 -0.0164 528  VAL A N   
3085 C  CA  . VAL A 452 ? 0.2592 0.2595 0.2353 -0.0018 -0.0164 -0.0152 528  VAL A CA  
3086 C  C   . VAL A 452 ? 0.2938 0.2909 0.2721 0.0015  -0.0153 -0.0139 528  VAL A C   
3087 O  O   . VAL A 452 ? 0.3087 0.3020 0.2821 0.0022  -0.0178 -0.0105 528  VAL A O   
3088 C  CB  . VAL A 452 ? 0.2586 0.2535 0.2274 -0.0060 -0.0117 -0.0188 528  VAL A CB  
3089 C  CG1 . VAL A 452 ? 0.2496 0.2387 0.2102 -0.0081 -0.0101 -0.0174 528  VAL A CG1 
3090 C  CG2 . VAL A 452 ? 0.2747 0.2683 0.2362 -0.0103 -0.0134 -0.0200 528  VAL A CG2 
3091 N  N   . ALA A 453 ? 0.2564 0.2538 0.2408 0.0031  -0.0121 -0.0162 529  ALA A N   
3092 C  CA  . ALA A 453 ? 0.2592 0.2518 0.2437 0.0046  -0.0114 -0.0152 529  ALA A CA  
3093 C  C   . ALA A 453 ? 0.2803 0.2711 0.2651 0.0096  -0.0149 -0.0122 529  ALA A C   
3094 O  O   . ALA A 453 ? 0.3073 0.2904 0.2858 0.0104  -0.0161 -0.0096 529  ALA A O   
3095 C  CB  . ALA A 453 ? 0.2423 0.2370 0.2336 0.0048  -0.0084 -0.0179 529  ALA A CB  
3096 N  N   . ILE A 454 ? 0.2681 0.2657 0.2598 0.0135  -0.0163 -0.0121 530  ILE A N   
3097 C  CA  . ILE A 454 ? 0.2706 0.2681 0.2636 0.0198  -0.0185 -0.0090 530  ILE A CA  
3098 C  C   . ILE A 454 ? 0.2625 0.2587 0.2500 0.0209  -0.0220 -0.0045 530  ILE A C   
3099 O  O   . ILE A 454 ? 0.2794 0.2679 0.2620 0.0251  -0.0229 -0.0018 530  ILE A O   
3100 C  CB  . ILE A 454 ? 0.2728 0.2807 0.2748 0.0231  -0.0189 -0.0091 530  ILE A CB  
3101 C  CG1 . ILE A 454 ? 0.2813 0.2888 0.2876 0.0229  -0.0158 -0.0129 530  ILE A CG1 
3102 C  CG2 . ILE A 454 ? 0.2671 0.2774 0.2712 0.0307  -0.0205 -0.0051 530  ILE A CG2 
3103 C  CD1 . ILE A 454 ? 0.2853 0.3028 0.2994 0.0237  -0.0158 -0.0135 530  ILE A CD1 
3104 N  N   . ALA A 455 ? 0.2399 0.2425 0.2266 0.0169  -0.0242 -0.0036 531  ALA A N   
3105 C  CA  . ALA A 455 ? 0.2969 0.3006 0.2792 0.0177  -0.0286 0.0014  531  ALA A CA  
3106 C  C   . ALA A 455 ? 0.3272 0.3183 0.2985 0.0161  -0.0284 0.0027  531  ALA A C   
3107 O  O   . ALA A 455 ? 0.3560 0.3427 0.3234 0.0206  -0.0310 0.0072  531  ALA A O   
3108 C  CB  . ALA A 455 ? 0.2768 0.2883 0.2582 0.0117  -0.0314 0.0017  531  ALA A CB  
3109 N  N   . MET A 456 ? 0.3236 0.3089 0.2897 0.0099  -0.0251 -0.0007 532  MET A N   
3110 C  CA  . MET A 456 ? 0.3176 0.2920 0.2729 0.0069  -0.0246 0.0009  532  MET A CA  
3111 C  C   . MET A 456 ? 0.3483 0.3124 0.3012 0.0107  -0.0239 0.0020  532  MET A C   
3112 O  O   . MET A 456 ? 0.3454 0.2994 0.2889 0.0109  -0.0256 0.0056  532  MET A O   
3113 C  CB  . MET A 456 ? 0.3305 0.3035 0.2822 -0.0002 -0.0202 -0.0028 532  MET A CB  
3114 C  CG  . MET A 456 ? 0.3643 0.3417 0.3120 -0.0046 -0.0208 -0.0038 532  MET A CG  
3115 S  SD  . MET A 456 ? 0.3715 0.3446 0.3112 -0.0115 -0.0145 -0.0072 532  MET A SD  
3116 C  CE  . MET A 456 ? 0.3710 0.3340 0.2988 -0.0142 -0.0155 -0.0027 532  MET A CE  
3117 N  N   . LEU A 457 ? 0.3345 0.2993 0.2941 0.0132  -0.0216 -0.0009 533  LEU A N   
3118 C  CA  . LEU A 457 ? 0.3275 0.2801 0.2823 0.0161  -0.0212 -0.0001 533  LEU A CA  
3119 C  C   . LEU A 457 ? 0.2950 0.2438 0.2481 0.0251  -0.0239 0.0038  533  LEU A C   
3120 O  O   . LEU A 457 ? 0.3039 0.2383 0.2469 0.0274  -0.0248 0.0066  533  LEU A O   
3121 C  CB  . LEU A 457 ? 0.2964 0.2504 0.2574 0.0158  -0.0184 -0.0042 533  LEU A CB  
3122 C  CG  . LEU A 457 ? 0.3217 0.2720 0.2803 0.0081  -0.0158 -0.0063 533  LEU A CG  
3123 C  CD1 . LEU A 457 ? 0.3321 0.2920 0.2941 0.0026  -0.0137 -0.0077 533  LEU A CD1 
3124 C  CD2 . LEU A 457 ? 0.3358 0.2866 0.2995 0.0085  -0.0145 -0.0092 533  LEU A CD2 
3125 N  N   . ILE A 458 ? 0.3207 0.2822 0.2835 0.0305  -0.0250 0.0045  534  ILE A N   
3126 C  CA  . ILE A 458 ? 0.3559 0.3172 0.3195 0.0405  -0.0268 0.0088  534  ILE A CA  
3127 C  C   . ILE A 458 ? 0.3738 0.3331 0.3313 0.0419  -0.0308 0.0146  534  ILE A C   
3128 O  O   . ILE A 458 ? 0.3663 0.3181 0.3194 0.0503  -0.0320 0.0188  534  ILE A O   
3129 C  CB  . ILE A 458 ? 0.3562 0.3348 0.3333 0.0447  -0.0266 0.0086  534  ILE A CB  
3130 C  CG1 . ILE A 458 ? 0.3437 0.3207 0.3244 0.0451  -0.0226 0.0037  534  ILE A CG1 
3131 C  CG2 . ILE A 458 ? 0.3729 0.3567 0.3534 0.0552  -0.0283 0.0143  534  ILE A CG2 
3132 C  CD1 . ILE A 458 ? 0.3889 0.3499 0.3616 0.0516  -0.0205 0.0036  534  ILE A CD1 
3133 N  N   . ARG A 459 ? 0.3520 0.3163 0.3076 0.0342  -0.0328 0.0148  535  ARG A N   
3134 C  CA  . ARG A 459 ? 0.3582 0.3190 0.3057 0.0340  -0.0371 0.0203  535  ARG A CA  
3135 C  C   . ARG A 459 ? 0.3667 0.3071 0.3005 0.0348  -0.0365 0.0221  535  ARG A C   
3136 O  O   . ARG A 459 ? 0.3849 0.3187 0.3124 0.0405  -0.0397 0.0278  535  ARG A O   
3137 C  CB  . ARG A 459 ? 0.3486 0.3152 0.2933 0.0241  -0.0383 0.0191  535  ARG A CB  
3138 C  CG  . ARG A 459 ? 0.3953 0.3533 0.3270 0.0208  -0.0416 0.0235  535  ARG A CG  
3139 C  CD  . ARG A 459 ? 0.3845 0.3489 0.3175 0.0271  -0.0477 0.0308  535  ARG A CD  
3140 N  NE  . ARG A 459 ? 0.4405 0.3949 0.3599 0.0244  -0.0512 0.0355  535  ARG A NE  
3141 C  CZ  . ARG A 459 ? 0.5284 0.4845 0.4458 0.0303  -0.0569 0.0431  535  ARG A CZ  
3142 N  NH1 . ARG A 459 ? 0.5536 0.5229 0.4833 0.0396  -0.0593 0.0469  535  ARG A NH1 
3143 N  NH2 . ARG A 459 ? 0.5505 0.4962 0.4541 0.0272  -0.0601 0.0474  535  ARG A NH2 
3144 N  N   . ARG A 460 ? 0.3839 0.3140 0.3127 0.0290  -0.0327 0.0177  536  ARG A N   
3145 C  CA  . ARG A 460 ? 0.4075 0.3184 0.3217 0.0257  -0.0324 0.0192  536  ARG A CA  
3146 C  C   . ARG A 460 ? 0.4210 0.3152 0.3290 0.0312  -0.0310 0.0190  536  ARG A C   
3147 O  O   . ARG A 460 ? 0.4434 0.3191 0.3373 0.0313  -0.0320 0.0221  536  ARG A O   
3148 C  CB  . ARG A 460 ? 0.4082 0.3188 0.3197 0.0140  -0.0294 0.0156  536  ARG A CB  
3149 C  CG  . ARG A 460 ? 0.3984 0.3182 0.3090 0.0082  -0.0304 0.0163  536  ARG A CG  
3150 C  CD  . ARG A 460 ? 0.3829 0.3080 0.2955 -0.0008 -0.0258 0.0117  536  ARG A CD  
3151 N  NE  . ARG A 460 ? 0.3846 0.3151 0.2929 -0.0060 -0.0261 0.0123  536  ARG A NE  
3152 C  CZ  . ARG A 460 ? 0.3720 0.3141 0.2859 -0.0052 -0.0276 0.0112  536  ARG A CZ  
3153 N  NH1 . ARG A 460 ? 0.3445 0.2958 0.2700 0.0004  -0.0287 0.0098  536  ARG A NH1 
3154 N  NH2 . ARG A 460 ? 0.3853 0.3288 0.2917 -0.0107 -0.0279 0.0115  536  ARG A NH2 
3155 N  N   . PHE A 461 ? 0.4056 0.3039 0.3215 0.0353  -0.0285 0.0154  537  PHE A N   
3156 C  CA  . PHE A 461 ? 0.4380 0.3180 0.3452 0.0383  -0.0266 0.0139  537  PHE A CA  
3157 C  C   . PHE A 461 ? 0.4516 0.3351 0.3652 0.0498  -0.0253 0.0135  537  PHE A C   
3158 O  O   . PHE A 461 ? 0.4253 0.3286 0.3534 0.0524  -0.0249 0.0125  537  PHE A O   
3159 C  CB  . PHE A 461 ? 0.4282 0.3058 0.3348 0.0281  -0.0242 0.0089  537  PHE A CB  
3160 C  CG  . PHE A 461 ? 0.4631 0.3429 0.3671 0.0167  -0.0242 0.0091  537  PHE A CG  
3161 C  CD1 . PHE A 461 ? 0.4820 0.3449 0.3710 0.0120  -0.0254 0.0123  537  PHE A CD1 
3162 C  CD2 . PHE A 461 ? 0.4236 0.3216 0.3392 0.0109  -0.0225 0.0062  537  PHE A CD2 
3163 C  CE1 . PHE A 461 ? 0.4518 0.3179 0.3385 0.0014  -0.0246 0.0127  537  PHE A CE1 
3164 C  CE2 . PHE A 461 ? 0.4232 0.3235 0.3361 0.0015  -0.0213 0.0063  537  PHE A CE2 
3165 C  CZ  . PHE A 461 ? 0.4359 0.3212 0.3347 -0.0034 -0.0223 0.0097  537  PHE A CZ  
3166 N  N   . ASN A 462 ? 0.4865 0.3495 0.3879 0.0565  -0.0242 0.0144  538  ASN A N   
3167 C  CA  . ASN A 462 ? 0.5147 0.3756 0.4181 0.0665  -0.0212 0.0127  538  ASN A CA  
3168 C  C   . ASN A 462 ? 0.4892 0.3391 0.3865 0.0594  -0.0189 0.0070  538  ASN A C   
3169 O  O   . ASN A 462 ? 0.4924 0.3239 0.3758 0.0514  -0.0197 0.0062  538  ASN A O   
3170 C  CB  . ASN A 462 ? 0.6125 0.4550 0.5039 0.0793  -0.0208 0.0169  538  ASN A CB  
3171 C  CG  . ASN A 462 ? 0.6928 0.5438 0.5879 0.0857  -0.0241 0.0239  538  ASN A CG  
3172 O  OD1 . ASN A 462 ? 0.7280 0.6014 0.6385 0.0922  -0.0247 0.0265  538  ASN A OD1 
3173 N  ND2 . ASN A 462 ? 0.7282 0.5613 0.6087 0.0835  -0.0267 0.0274  538  ASN A ND2 
3174 N  N   . PHE A 463 ? 0.4537 0.3148 0.3608 0.0617  -0.0165 0.0035  539  PHE A N   
3175 C  CA  . PHE A 463 ? 0.4754 0.3285 0.3779 0.0553  -0.0148 -0.0016 539  PHE A CA  
3176 C  C   . PHE A 463 ? 0.5113 0.3524 0.4067 0.0655  -0.0115 -0.0030 539  PHE A C   
3177 O  O   . PHE A 463 ? 0.5361 0.3885 0.4402 0.0766  -0.0095 -0.0013 539  PHE A O   
3178 C  CB  . PHE A 463 ? 0.4208 0.2964 0.3395 0.0481  -0.0147 -0.0047 539  PHE A CB  
3179 C  CG  . PHE A 463 ? 0.3990 0.2856 0.3237 0.0385  -0.0167 -0.0039 539  PHE A CG  
3180 C  CD1 . PHE A 463 ? 0.3713 0.2524 0.2912 0.0272  -0.0173 -0.0055 539  PHE A CD1 
3181 C  CD2 . PHE A 463 ? 0.4102 0.3131 0.3450 0.0405  -0.0179 -0.0014 539  PHE A CD2 
3182 C  CE1 . PHE A 463 ? 0.3651 0.2568 0.2903 0.0193  -0.0180 -0.0047 539  PHE A CE1 
3183 C  CE2 . PHE A 463 ? 0.3854 0.2964 0.3233 0.0320  -0.0191 -0.0011 539  PHE A CE2 
3184 C  CZ  . PHE A 463 ? 0.3531 0.2585 0.2863 0.0220  -0.0186 -0.0028 539  PHE A CZ  
3185 N  N   . GLN A 464 ? 0.5341 0.3524 0.4129 0.0614  -0.0109 -0.0060 540  GLN A N   
3186 C  CA  . GLN A 464 ? 0.5628 0.3664 0.4314 0.0696  -0.0073 -0.0084 540  GLN A CA  
3187 C  C   . GLN A 464 ? 0.5461 0.3380 0.4050 0.0584  -0.0081 -0.0131 540  GLN A C   
3188 O  O   . GLN A 464 ? 0.5363 0.3226 0.3902 0.0457  -0.0114 -0.0133 540  GLN A O   
3189 C  CB  . GLN A 464 ? 0.5978 0.3746 0.4473 0.0803  -0.0057 -0.0059 540  GLN A CB  
3190 C  CG  . GLN A 464 ? 0.6243 0.4121 0.4827 0.0932  -0.0052 -0.0002 540  GLN A CG  
3191 C  CD  . GLN A 464 ? 0.6439 0.4531 0.5182 0.1052  -0.0013 0.0006  540  GLN A CD  
3192 O  OE1 . GLN A 464 ? 0.6530 0.4652 0.5291 0.1054  0.0018  -0.0035 540  GLN A OE1 
3193 N  NE2 . GLN A 464 ? 0.6504 0.4751 0.5360 0.1149  -0.0017 0.0063  540  GLN A NE2 
3194 N  N   . ILE A 465 ? 0.5232 0.3123 0.3795 0.0627  -0.0050 -0.0164 541  ILE A N   
3195 C  CA  . ILE A 465 ? 0.5201 0.2951 0.3640 0.0527  -0.0062 -0.0205 541  ILE A CA  
3196 C  C   . ILE A 465 ? 0.5562 0.2984 0.3748 0.0474  -0.0081 -0.0204 541  ILE A C   
3197 O  O   . ILE A 465 ? 0.5588 0.2793 0.3621 0.0574  -0.0058 -0.0191 541  ILE A O   
3198 C  CB  . ILE A 465 ? 0.5084 0.2803 0.3486 0.0602  -0.0020 -0.0237 541  ILE A CB  
3199 C  CG1 . ILE A 465 ? 0.4883 0.2925 0.3529 0.0631  -0.0006 -0.0237 541  ILE A CG1 
3200 C  CG2 . ILE A 465 ? 0.5259 0.2784 0.3486 0.0497  -0.0039 -0.0277 541  ILE A CG2 
3201 C  CD1 . ILE A 465 ? 0.4795 0.3016 0.3571 0.0499  -0.0044 -0.0250 541  ILE A CD1 
3202 N  N   . ALA A 466 ? 0.5370 0.2754 0.3510 0.0316  -0.0124 -0.0213 542  ALA A N   
3203 C  CA  . ALA A 466 ? 0.5862 0.2941 0.3760 0.0238  -0.0150 -0.0207 542  ALA A CA  
3204 C  C   . ALA A 466 ? 0.6106 0.2870 0.3748 0.0262  -0.0134 -0.0243 542  ALA A C   
3205 O  O   . ALA A 466 ? 0.5849 0.2664 0.3510 0.0259  -0.0123 -0.0277 542  ALA A O   
3206 C  CB  . ALA A 466 ? 0.5647 0.2806 0.3584 0.0053  -0.0201 -0.0200 542  ALA A CB  
3207 N  N   . PRO A 467 ? 0.6961 0.3382 0.4345 0.0286  -0.0130 -0.0237 543  PRO A N   
3208 C  CA  . PRO A 467 ? 0.7261 0.3337 0.4359 0.0300  -0.0113 -0.0275 543  PRO A CA  
3209 C  C   . PRO A 467 ? 0.7446 0.3470 0.4458 0.0112  -0.0164 -0.0302 543  PRO A C   
3210 O  O   . PRO A 467 ? 0.7670 0.3722 0.4690 -0.0046 -0.0220 -0.0281 543  PRO A O   
3211 C  CB  . PRO A 467 ? 0.7650 0.3448 0.4534 0.0334  -0.0108 -0.0246 543  PRO A CB  
3212 C  CG  . PRO A 467 ? 0.7776 0.3694 0.4807 0.0417  -0.0105 -0.0203 543  PRO A CG  
3213 C  CD  . PRO A 467 ? 0.7357 0.3668 0.4681 0.0312  -0.0138 -0.0193 543  PRO A CD  
3214 N  N   . GLY A 468 ? 0.7514 0.3501 0.4461 0.0126  -0.0146 -0.0340 544  GLY A N   
3215 C  CA  . GLY A 468 ? 0.7908 0.3882 0.4789 -0.0047 -0.0199 -0.0358 544  GLY A CA  
3216 C  C   . GLY A 468 ? 0.7941 0.4270 0.5096 -0.0144 -0.0239 -0.0350 544  GLY A C   
3217 O  O   . GLY A 468 ? 0.8301 0.4644 0.5423 -0.0303 -0.0296 -0.0353 544  GLY A O   
3218 N  N   . ALA A 469 ? 0.7089 0.3738 0.4529 -0.0052 -0.0212 -0.0331 545  ALA A N   
3219 C  CA  . ALA A 469 ? 0.6596 0.3607 0.4311 -0.0126 -0.0239 -0.0318 545  ALA A CA  
3220 C  C   . ALA A 469 ? 0.6821 0.3894 0.4548 -0.0145 -0.0244 -0.0348 545  ALA A C   
3221 O  O   . ALA A 469 ? 0.6861 0.3790 0.4465 -0.0048 -0.0203 -0.0380 545  ALA A O   
3222 C  CB  . ALA A 469 ? 0.6234 0.3530 0.4211 -0.0016 -0.0205 -0.0296 545  ALA A CB  
3223 N  N   . PRO A 470 ? 0.6911 0.4193 0.4776 -0.0267 -0.0292 -0.0337 546  PRO A N   
3224 C  CA  . PRO A 470 ? 0.6759 0.4125 0.4654 -0.0282 -0.0301 -0.0359 546  PRO A CA  
3225 C  C   . PRO A 470 ? 0.6490 0.4029 0.4546 -0.0131 -0.0242 -0.0371 546  PRO A C   
3226 O  O   . PRO A 470 ? 0.6416 0.4126 0.4649 -0.0049 -0.0212 -0.0352 546  PRO A O   
3227 C  CB  . PRO A 470 ? 0.6711 0.4330 0.4785 -0.0420 -0.0360 -0.0328 546  PRO A CB  
3228 C  CG  . PRO A 470 ? 0.6811 0.4362 0.4834 -0.0520 -0.0392 -0.0297 546  PRO A CG  
3229 C  CD  . PRO A 470 ? 0.6938 0.4373 0.4918 -0.0401 -0.0341 -0.0299 546  PRO A CD  
3230 N  N   . PRO A 471 ? 0.6237 0.3735 0.4227 -0.0096 -0.0225 -0.0399 547  PRO A N   
3231 C  CA  . PRO A 471 ? 0.5973 0.3638 0.4110 0.0038  -0.0167 -0.0407 547  PRO A CA  
3232 C  C   . PRO A 471 ? 0.5299 0.3314 0.3735 0.0023  -0.0182 -0.0381 547  PRO A C   
3233 O  O   . PRO A 471 ? 0.5240 0.3377 0.3762 -0.0090 -0.0235 -0.0365 547  PRO A O   
3234 C  CB  . PRO A 471 ? 0.6124 0.3669 0.4110 0.0036  -0.0159 -0.0440 547  PRO A CB  
3235 C  CG  . PRO A 471 ? 0.6647 0.3878 0.4346 -0.0065 -0.0198 -0.0457 547  PRO A CG  
3236 C  CD  . PRO A 471 ? 0.6601 0.3886 0.4362 -0.0187 -0.0259 -0.0424 547  PRO A CD  
3237 N  N   . VAL A 472 ? 0.4951 0.3123 0.3538 0.0138  -0.0133 -0.0376 548  VAL A N   
3238 C  CA  . VAL A 472 ? 0.4710 0.3181 0.3553 0.0137  -0.0139 -0.0357 548  VAL A CA  
3239 C  C   . VAL A 472 ? 0.5128 0.3691 0.4016 0.0154  -0.0128 -0.0370 548  VAL A C   
3240 O  O   . VAL A 472 ? 0.5747 0.4298 0.4616 0.0251  -0.0078 -0.0381 548  VAL A O   
3241 C  CB  . VAL A 472 ? 0.4306 0.2895 0.3280 0.0233  -0.0102 -0.0339 548  VAL A CB  
3242 C  CG1 . VAL A 472 ? 0.4149 0.3013 0.3354 0.0228  -0.0106 -0.0324 548  VAL A CG1 
3243 C  CG2 . VAL A 472 ? 0.4005 0.2496 0.2924 0.0209  -0.0117 -0.0322 548  VAL A CG2 
3244 N  N   . LYS A 473 ? 0.4727 0.3389 0.3676 0.0060  -0.0175 -0.0363 549  LYS A N   
3245 C  CA  . LYS A 473 ? 0.4622 0.3378 0.3618 0.0062  -0.0176 -0.0369 549  LYS A CA  
3246 C  C   . LYS A 473 ? 0.4135 0.3138 0.3349 0.0023  -0.0203 -0.0344 549  LYS A C   
3247 O  O   . LYS A 473 ? 0.4185 0.3260 0.3478 -0.0032 -0.0232 -0.0324 549  LYS A O   
3248 C  CB  . LYS A 473 ? 0.5245 0.3831 0.4048 -0.0013 -0.0211 -0.0385 549  LYS A CB  
3249 C  CG  . LYS A 473 ? 0.6614 0.4912 0.5161 0.0024  -0.0180 -0.0416 549  LYS A CG  
3250 C  CD  . LYS A 473 ? 0.7458 0.5752 0.5997 0.0158  -0.0102 -0.0432 549  LYS A CD  
3251 C  CE  . LYS A 473 ? 0.8244 0.6240 0.6516 0.0212  -0.0060 -0.0463 549  LYS A CE  
3252 N  NZ  . LYS A 473 ? 0.8812 0.6608 0.6858 0.0119  -0.0098 -0.0486 549  LYS A NZ  
3253 N  N   . MET A 474 ? 0.4142 0.3262 0.3440 0.0054  -0.0192 -0.0343 550  MET A N   
3254 C  CA  . MET A 474 ? 0.4305 0.3638 0.3798 0.0038  -0.0208 -0.0320 550  MET A CA  
3255 C  C   . MET A 474 ? 0.4568 0.3943 0.4066 -0.0043 -0.0263 -0.0304 550  MET A C   
3256 O  O   . MET A 474 ? 0.4208 0.3455 0.3556 -0.0088 -0.0290 -0.0313 550  MET A O   
3257 C  CB  . MET A 474 ? 0.4068 0.3501 0.3647 0.0114  -0.0166 -0.0322 550  MET A CB  
3258 C  CG  . MET A 474 ? 0.3972 0.3395 0.3561 0.0196  -0.0115 -0.0329 550  MET A CG  
3259 S  SD  . MET A 474 ? 0.4127 0.3689 0.3821 0.0261  -0.0074 -0.0322 550  MET A SD  
3260 C  CE  . MET A 474 ? 0.4372 0.3810 0.3908 0.0282  -0.0050 -0.0340 550  MET A CE  
3261 N  N   . THR A 475 ? 0.4774 0.4329 0.4442 -0.0059 -0.0281 -0.0278 551  THR A N   
3262 C  CA  . THR A 475 ? 0.5199 0.4836 0.4910 -0.0122 -0.0334 -0.0251 551  THR A CA  
3263 C  C   . THR A 475 ? 0.5243 0.5040 0.5108 -0.0078 -0.0323 -0.0234 551  THR A C   
3264 O  O   . THR A 475 ? 0.4798 0.4661 0.4757 -0.0021 -0.0282 -0.0239 551  THR A O   
3265 C  CB  . THR A 475 ? 0.5063 0.4762 0.4823 -0.0201 -0.0376 -0.0223 551  THR A CB  
3266 O  OG1 . THR A 475 ? 0.5221 0.5041 0.5125 -0.0167 -0.0345 -0.0213 551  THR A OG1 
3267 C  CG2 . THR A 475 ? 0.4886 0.4405 0.4472 -0.0263 -0.0395 -0.0236 551  THR A CG2 
3268 N  N   . THR A 476 ? 0.5565 0.5411 0.5443 -0.0110 -0.0365 -0.0210 552  THR A N   
3269 C  CA  . THR A 476 ? 0.5194 0.5174 0.5206 -0.0073 -0.0363 -0.0187 552  THR A CA  
3270 C  C   . THR A 476 ? 0.4499 0.4625 0.4666 -0.0075 -0.0366 -0.0159 552  THR A C   
3271 O  O   . THR A 476 ? 0.4683 0.4853 0.4870 -0.0134 -0.0400 -0.0136 552  THR A O   
3272 C  CB  . THR A 476 ? 0.5077 0.5062 0.5049 -0.0106 -0.0412 -0.0162 552  THR A CB  
3273 O  OG1 . THR A 476 ? 0.4930 0.4769 0.4738 -0.0105 -0.0402 -0.0190 552  THR A OG1 
3274 C  CG2 . THR A 476 ? 0.5072 0.5172 0.5168 -0.0058 -0.0408 -0.0136 552  THR A CG2 
3275 N  N   . GLY A 477 ? 0.4541 0.4739 0.4812 -0.0013 -0.0327 -0.0159 553  GLY A N   
3276 C  CA  . GLY A 477 ? 0.4033 0.4361 0.4442 0.0000  -0.0318 -0.0135 553  GLY A CA  
3277 C  C   . GLY A 477 ? 0.4112 0.4461 0.4582 0.0070  -0.0270 -0.0147 553  GLY A C   
3278 O  O   . GLY A 477 ? 0.4698 0.4980 0.5116 0.0098  -0.0253 -0.0167 553  GLY A O   
3279 N  N   . ALA A 478 ? 0.3415 0.3856 0.3988 0.0094  -0.0248 -0.0133 554  ALA A N   
3280 C  CA  . ALA A 478 ? 0.3145 0.3577 0.3748 0.0151  -0.0200 -0.0149 554  ALA A CA  
3281 C  C   . ALA A 478 ? 0.3300 0.3652 0.3838 0.0151  -0.0171 -0.0187 554  ALA A C   
3282 O  O   . ALA A 478 ? 0.3552 0.3861 0.4067 0.0179  -0.0149 -0.0204 554  ALA A O   
3283 C  CB  . ALA A 478 ? 0.2844 0.3375 0.3550 0.0179  -0.0174 -0.0129 554  ALA A CB  
3284 N  N   . THR A 479 ? 0.2873 0.3207 0.3378 0.0117  -0.0175 -0.0194 555  THR A N   
3285 C  CA  . THR A 479 ? 0.2731 0.2989 0.3169 0.0120  -0.0156 -0.0221 555  THR A CA  
3286 C  C   . THR A 479 ? 0.2770 0.2947 0.3114 0.0088  -0.0181 -0.0227 555  THR A C   
3287 O  O   . THR A 479 ? 0.2795 0.2974 0.3122 0.0048  -0.0216 -0.0211 555  THR A O   
3288 C  CB  . THR A 479 ? 0.2843 0.3125 0.3307 0.0116  -0.0131 -0.0225 555  THR A CB  
3289 O  OG1 . THR A 479 ? 0.2633 0.2945 0.3108 0.0071  -0.0149 -0.0206 555  THR A OG1 
3290 C  CG2 . THR A 479 ? 0.2927 0.3264 0.3458 0.0150  -0.0100 -0.0223 555  THR A CG2 
3291 N  N   . ILE A 480 ? 0.2647 0.2749 0.2923 0.0106  -0.0164 -0.0247 556  ILE A N   
3292 C  CA  . ILE A 480 ? 0.2748 0.2740 0.2910 0.0093  -0.0176 -0.0258 556  ILE A CA  
3293 C  C   . ILE A 480 ? 0.3049 0.2995 0.3172 0.0056  -0.0185 -0.0255 556  ILE A C   
3294 O  O   . ILE A 480 ? 0.2829 0.2746 0.2937 0.0077  -0.0164 -0.0261 556  ILE A O   
3295 C  CB  . ILE A 480 ? 0.2502 0.2442 0.2614 0.0144  -0.0146 -0.0274 556  ILE A CB  
3296 C  CG1 . ILE A 480 ? 0.2452 0.2454 0.2614 0.0170  -0.0135 -0.0272 556  ILE A CG1 
3297 C  CG2 . ILE A 480 ? 0.2764 0.2575 0.2742 0.0143  -0.0150 -0.0286 556  ILE A CG2 
3298 C  CD1 . ILE A 480 ? 0.2502 0.2487 0.2633 0.0215  -0.0104 -0.0279 556  ILE A CD1 
3299 N  N   . HIS A 481 ? 0.2987 0.2929 0.3089 -0.0006 -0.0220 -0.0240 557  HIS A N   
3300 C  CA  . HIS A 481 ? 0.3459 0.3331 0.3494 -0.0058 -0.0234 -0.0235 557  HIS A CA  
3301 C  C   . HIS A 481 ? 0.3822 0.3510 0.3688 -0.0063 -0.0243 -0.0254 557  HIS A C   
3302 O  O   . HIS A 481 ? 0.3705 0.3341 0.3512 -0.0039 -0.0242 -0.0268 557  HIS A O   
3303 C  CB  . HIS A 481 ? 0.3839 0.3797 0.3926 -0.0135 -0.0272 -0.0204 557  HIS A CB  
3304 C  CG  . HIS A 481 ? 0.4480 0.4611 0.4726 -0.0121 -0.0254 -0.0182 557  HIS A CG  
3305 N  ND1 . HIS A 481 ? 0.4756 0.4998 0.5102 -0.0089 -0.0254 -0.0169 557  HIS A ND1 
3306 C  CD2 . HIS A 481 ? 0.4701 0.4901 0.5009 -0.0129 -0.0230 -0.0170 557  HIS A CD2 
3307 C  CE1 . HIS A 481 ? 0.4646 0.5011 0.5107 -0.0071 -0.0228 -0.0152 557  HIS A CE1 
3308 N  NE2 . HIS A 481 ? 0.4545 0.4892 0.4987 -0.0096 -0.0211 -0.0153 557  HIS A NE2 
3309 N  N   . THR A 482 ? 0.3424 0.3003 0.3198 -0.0091 -0.0246 -0.0255 558  THR A N   
3310 C  CA  . THR A 482 ? 0.3874 0.3248 0.3461 -0.0105 -0.0256 -0.0272 558  THR A CA  
3311 C  C   . THR A 482 ? 0.4209 0.3540 0.3724 -0.0212 -0.0311 -0.0259 558  THR A C   
3312 O  O   . THR A 482 ? 0.4140 0.3613 0.3764 -0.0275 -0.0339 -0.0229 558  THR A O   
3313 C  CB  . THR A 482 ? 0.3633 0.2872 0.3125 -0.0084 -0.0237 -0.0278 558  THR A CB  
3314 O  OG1 . THR A 482 ? 0.4105 0.3357 0.3605 -0.0167 -0.0262 -0.0255 558  THR A OG1 
3315 C  CG2 . THR A 482 ? 0.3509 0.2826 0.3093 0.0009  -0.0193 -0.0280 558  THR A CG2 
3316 N  N   . THR A 483 ? 0.4179 0.3311 0.3503 -0.0231 -0.0325 -0.0279 559  THR A N   
3317 C  CA  . THR A 483 ? 0.4220 0.3285 0.3443 -0.0348 -0.0386 -0.0266 559  THR A CA  
3318 C  C   . THR A 483 ? 0.4102 0.3115 0.3279 -0.0436 -0.0412 -0.0245 559  THR A C   
3319 O  O   . THR A 483 ? 0.4274 0.3386 0.3501 -0.0541 -0.0463 -0.0211 559  THR A O   
3320 C  CB  . THR A 483 ? 0.4543 0.3375 0.3538 -0.0348 -0.0391 -0.0298 559  THR A CB  
3321 O  OG1 . THR A 483 ? 0.4583 0.3228 0.3450 -0.0267 -0.0339 -0.0327 559  THR A OG1 
3322 C  CG2 . THR A 483 ? 0.4258 0.3167 0.3298 -0.0300 -0.0381 -0.0306 559  THR A CG2 
3323 N  N   . GLU A 484 ? 0.3962 0.2828 0.3047 -0.0396 -0.0379 -0.0260 560  GLU A N   
3324 C  CA  . GLU A 484 ? 0.3938 0.2700 0.2930 -0.0487 -0.0404 -0.0242 560  GLU A CA  
3325 C  C   . GLU A 484 ? 0.4260 0.3050 0.3316 -0.0434 -0.0365 -0.0234 560  GLU A C   
3326 O  O   . GLU A 484 ? 0.4225 0.2882 0.3169 -0.0494 -0.0377 -0.0222 560  GLU A O   
3327 C  CB  . GLU A 484 ? 0.4841 0.3280 0.3547 -0.0524 -0.0422 -0.0266 560  GLU A CB  
3328 C  CG  . GLU A 484 ? 0.4856 0.3223 0.3445 -0.0615 -0.0475 -0.0271 560  GLU A CG  
3329 C  CD  . GLU A 484 ? 0.5578 0.3588 0.3850 -0.0657 -0.0489 -0.0299 560  GLU A CD  
3330 O  OE1 . GLU A 484 ? 0.5769 0.3635 0.3920 -0.0742 -0.0513 -0.0285 560  GLU A OE1 
3331 O  OE2 . GLU A 484 ? 0.5972 0.3829 0.4100 -0.0604 -0.0471 -0.0335 560  GLU A OE2 
3332 N  N   . GLY A 485 ? 0.3808 0.2753 0.3022 -0.0333 -0.0321 -0.0238 561  GLY A N   
3333 C  CA  . GLY A 485 ? 0.4054 0.3028 0.3320 -0.0288 -0.0289 -0.0229 561  GLY A CA  
3334 C  C   . GLY A 485 ? 0.4151 0.2977 0.3323 -0.0177 -0.0252 -0.0250 561  GLY A C   
3335 O  O   . GLY A 485 ? 0.3818 0.2509 0.2878 -0.0128 -0.0241 -0.0274 561  GLY A O   
3336 N  N   . LEU A 486 ? 0.3766 0.2630 0.2989 -0.0135 -0.0229 -0.0237 562  LEU A N   
3337 C  CA  . LEU A 486 ? 0.3984 0.2747 0.3147 -0.0027 -0.0197 -0.0243 562  LEU A CA  
3338 C  C   . LEU A 486 ? 0.4311 0.2924 0.3357 -0.0060 -0.0206 -0.0222 562  LEU A C   
3339 O  O   . LEU A 486 ? 0.4029 0.2743 0.3157 -0.0071 -0.0203 -0.0200 562  LEU A O   
3340 C  CB  . LEU A 486 ? 0.3536 0.2501 0.2874 0.0052  -0.0169 -0.0239 562  LEU A CB  
3341 C  CG  . LEU A 486 ? 0.3605 0.2522 0.2918 0.0161  -0.0142 -0.0232 562  LEU A CG  
3342 C  CD1 . LEU A 486 ? 0.3809 0.2599 0.3022 0.0240  -0.0120 -0.0250 562  LEU A CD1 
3343 C  CD2 . LEU A 486 ? 0.3280 0.2410 0.2766 0.0205  -0.0128 -0.0223 562  LEU A CD2 
3344 N  N   . LYS A 487 ? 0.4534 0.2889 0.3370 -0.0078 -0.0218 -0.0230 563  LYS A N   
3345 C  CA  . LYS A 487 ? 0.4891 0.3059 0.3579 -0.0124 -0.0232 -0.0209 563  LYS A CA  
3346 C  C   . LYS A 487 ? 0.5070 0.3123 0.3693 0.0003  -0.0201 -0.0201 563  LYS A C   
3347 O  O   . LYS A 487 ? 0.5405 0.3311 0.3921 0.0096  -0.0178 -0.0220 563  LYS A O   
3348 C  CB  . LYS A 487 ? 0.5619 0.3538 0.4087 -0.0217 -0.0264 -0.0219 563  LYS A CB  
3349 C  CG  . LYS A 487 ? 0.6217 0.3946 0.4527 -0.0305 -0.0288 -0.0193 563  LYS A CG  
3350 C  CD  . LYS A 487 ? 0.6722 0.4630 0.5144 -0.0450 -0.0320 -0.0164 563  LYS A CD  
3351 C  CE  . LYS A 487 ? 0.7423 0.5130 0.5667 -0.0562 -0.0348 -0.0135 563  LYS A CE  
3352 N  NZ  . LYS A 487 ? 0.7770 0.5156 0.5745 -0.0622 -0.0378 -0.0152 563  LYS A NZ  
3353 N  N   . LEU A 488 ? 0.4575 0.2694 0.3256 0.0010  -0.0200 -0.0171 564  LEU A N   
3354 C  CA  . LEU A 488 ? 0.4723 0.2784 0.3377 0.0131  -0.0179 -0.0153 564  LEU A CA  
3355 C  C   . LEU A 488 ? 0.5095 0.2964 0.3598 0.0096  -0.0196 -0.0122 564  LEU A C   
3356 O  O   . LEU A 488 ? 0.5173 0.3049 0.3662 -0.0028 -0.0220 -0.0108 564  LEU A O   
3357 C  CB  . LEU A 488 ? 0.4257 0.2592 0.3126 0.0185  -0.0166 -0.0140 564  LEU A CB  
3358 C  CG  . LEU A 488 ? 0.4220 0.2763 0.3253 0.0214  -0.0151 -0.0165 564  LEU A CG  
3359 C  CD1 . LEU A 488 ? 0.3913 0.2675 0.3114 0.0265  -0.0142 -0.0149 564  LEU A CD1 
3360 C  CD2 . LEU A 488 ? 0.4216 0.2649 0.3171 0.0300  -0.0127 -0.0187 564  LEU A CD2 
3361 N  N   . THR A 489 ? 0.5236 0.2935 0.3625 0.0208  -0.0181 -0.0106 565  THR A N   
3362 C  CA  . THR A 489 ? 0.5536 0.3101 0.3821 0.0206  -0.0195 -0.0066 565  THR A CA  
3363 C  C   . THR A 489 ? 0.5396 0.3200 0.3861 0.0257  -0.0193 -0.0036 565  THR A C   
3364 O  O   . THR A 489 ? 0.5240 0.3233 0.3857 0.0345  -0.0175 -0.0042 565  THR A O   
3365 C  CB  . THR A 489 ? 0.6269 0.3531 0.4342 0.0314  -0.0181 -0.0056 565  THR A CB  
3366 O  OG1 . THR A 489 ? 0.6911 0.4278 0.5082 0.0478  -0.0148 -0.0050 565  THR A OG1 
3367 C  CG2 . THR A 489 ? 0.6135 0.3134 0.4003 0.0268  -0.0180 -0.0092 565  THR A CG2 
3368 N  N   . VAL A 490 ? 0.5376 0.3170 0.3813 0.0191  -0.0213 -0.0003 566  VAL A N   
3369 C  CA  . VAL A 490 ? 0.5343 0.3342 0.3919 0.0215  -0.0217 0.0026  566  VAL A CA  
3370 C  C   . VAL A 490 ? 0.5310 0.3139 0.3746 0.0235  -0.0235 0.0075  566  VAL A C   
3371 O  O   . VAL A 490 ? 0.5691 0.3341 0.3977 0.0142  -0.0250 0.0088  566  VAL A O   
3372 C  CB  . VAL A 490 ? 0.5897 0.4111 0.4608 0.0097  -0.0219 0.0014  566  VAL A CB  
3373 C  CG1 . VAL A 490 ? 0.6251 0.4349 0.4855 -0.0042 -0.0230 0.0016  566  VAL A CG1 
3374 C  CG2 . VAL A 490 ? 0.5842 0.4210 0.4640 0.0108  -0.0224 0.0043  566  VAL A CG2 
3375 N  N   . THR A 491 ? 0.5251 0.3135 0.3731 0.0354  -0.0238 0.0108  567  THR A N   
3376 C  CA  . THR A 491 ? 0.5629 0.3375 0.3991 0.0390  -0.0260 0.0164  567  THR A CA  
3377 C  C   . THR A 491 ? 0.5078 0.3060 0.3583 0.0402  -0.0277 0.0195  567  THR A C   
3378 O  O   . THR A 491 ? 0.4873 0.3088 0.3552 0.0441  -0.0270 0.0180  567  THR A O   
3379 C  CB  . THR A 491 ? 0.6397 0.3947 0.4645 0.0541  -0.0251 0.0187  567  THR A CB  
3380 O  OG1 . THR A 491 ? 0.6660 0.4419 0.5077 0.0664  -0.0236 0.0191  567  THR A OG1 
3381 C  CG2 . THR A 491 ? 0.6592 0.3885 0.4675 0.0528  -0.0231 0.0149  567  THR A CG2 
3382 N  N   . LYS A 492 ? 0.5225 0.3132 0.3637 0.0360  -0.0303 0.0239  568  LYS A N   
3383 C  CA  . LYS A 492 ? 0.5450 0.3552 0.3960 0.0353  -0.0324 0.0269  568  LYS A CA  
3384 C  C   . LYS A 492 ? 0.5641 0.3822 0.4216 0.0497  -0.0344 0.0313  568  LYS A C   
3385 O  O   . LYS A 492 ? 0.5549 0.3563 0.4027 0.0604  -0.0347 0.0347  568  LYS A O   
3386 C  CB  . LYS A 492 ? 0.5643 0.3628 0.4016 0.0263  -0.0345 0.0307  568  LYS A CB  
3387 C  CG  . LYS A 492 ? 0.5438 0.3438 0.3797 0.0108  -0.0324 0.0273  568  LYS A CG  
3388 C  CD  . LYS A 492 ? 0.5410 0.3256 0.3604 0.0019  -0.0338 0.0316  568  LYS A CD  
3389 C  CE  . LYS A 492 ? 0.5108 0.3054 0.3314 0.0031  -0.0362 0.0358  568  LYS A CE  
3390 N  NZ  . LYS A 492 ? 0.4972 0.3185 0.3342 -0.0008 -0.0344 0.0324  568  LYS A NZ  
3391 N  N   . ARG A 493 ? 0.5489 0.3927 0.4223 0.0498  -0.0357 0.0316  569  ARG A N   
3392 C  CA  . ARG A 493 ? 0.5518 0.4087 0.4337 0.0610  -0.0385 0.0369  569  ARG A CA  
3393 C  C   . ARG A 493 ? 0.5598 0.4188 0.4367 0.0584  -0.0434 0.0429  569  ARG A C   
3394 O  O   . ARG A 493 ? 0.6045 0.4706 0.4851 0.0680  -0.0469 0.0491  569  ARG A O   
3395 C  CB  . ARG A 493 ? 0.5456 0.4299 0.4475 0.0618  -0.0378 0.0342  569  ARG A CB  
3396 C  CG  . ARG A 493 ? 0.5465 0.4330 0.4558 0.0680  -0.0337 0.0301  569  ARG A CG  
3397 C  CD  . ARG A 493 ? 0.4844 0.3982 0.4128 0.0694  -0.0338 0.0291  569  ARG A CD  
3398 N  NE  . ARG A 493 ? 0.4552 0.3824 0.3914 0.0795  -0.0369 0.0359  569  ARG A NE  
3399 C  CZ  . ARG A 493 ? 0.4572 0.4046 0.4027 0.0761  -0.0412 0.0391  569  ARG A CZ  
3400 N  NH1 . ARG A 493 ? 0.4543 0.4085 0.4011 0.0637  -0.0421 0.0355  569  ARG A NH1 
3401 N  NH2 . ARG A 493 ? 0.4414 0.4021 0.3947 0.0854  -0.0445 0.0462  569  ARG A NH2 
3402 N  N   . THR A 494 ? 0.5492 0.4040 0.4183 0.0457  -0.0437 0.0416  570  THR A N   
3403 C  CA  . THR A 494 ? 0.5444 0.4004 0.4068 0.0415  -0.0480 0.0468  570  THR A CA  
3404 C  C   . THR A 494 ? 0.5634 0.3951 0.4061 0.0346  -0.0478 0.0485  570  THR A C   
3405 O  O   . THR A 494 ? 0.5535 0.3711 0.3896 0.0300  -0.0442 0.0447  570  THR A O   
3406 C  CB  . THR A 494 ? 0.5186 0.3948 0.3896 0.0316  -0.0481 0.0437  570  THR A CB  
3407 O  OG1 . THR A 494 ? 0.5327 0.4065 0.4028 0.0212  -0.0431 0.0373  570  THR A OG1 
3408 C  CG2 . THR A 494 ? 0.4772 0.3763 0.3664 0.0371  -0.0489 0.0425  570  THR A CG2 
3409 N  N   . LYS A 495 ? 0.5464 0.3734 0.3790 0.0332  -0.0520 0.0546  571  LYS A N   
3410 C  CA  . LYS A 495 ? 0.6080 0.4110 0.4204 0.0268  -0.0523 0.0574  571  LYS A CA  
3411 C  C   . LYS A 495 ? 0.6140 0.4222 0.4224 0.0117  -0.0506 0.0552  571  LYS A C   
3412 O  O   . LYS A 495 ? 0.5938 0.4197 0.4088 0.0085  -0.0520 0.0551  571  LYS A O   
3413 C  CB  . LYS A 495 ? 0.7073 0.4986 0.5084 0.0351  -0.0579 0.0664  571  LYS A CB  
3414 C  CG  . LYS A 495 ? 0.7728 0.5570 0.5760 0.0519  -0.0589 0.0697  571  LYS A CG  
3415 C  CD  . LYS A 495 ? 0.8478 0.6237 0.6417 0.0608  -0.0649 0.0795  571  LYS A CD  
3416 C  CE  . LYS A 495 ? 0.9117 0.6804 0.7075 0.0794  -0.0649 0.0834  571  LYS A CE  
3417 N  NZ  . LYS A 495 ? 0.9671 0.7040 0.7464 0.0818  -0.0607 0.0809  571  LYS A NZ  
3418 N  N   . PRO A 496 ? 0.6477 0.4405 0.4445 0.0019  -0.0474 0.0536  572  PRO A N   
3419 C  CA  . PRO A 496 ? 0.6459 0.4448 0.4392 -0.0120 -0.0446 0.0520  572  PRO A CA  
3420 C  C   . PRO A 496 ? 0.6471 0.4451 0.4298 -0.0147 -0.0483 0.0577  572  PRO A C   
3421 O  O   . PRO A 496 ? 0.6715 0.4829 0.4564 -0.0223 -0.0465 0.0557  572  PRO A O   
3422 C  CB  . PRO A 496 ? 0.6619 0.4419 0.4431 -0.0208 -0.0415 0.0514  572  PRO A CB  
3423 C  CG  . PRO A 496 ? 0.6555 0.4247 0.4386 -0.0127 -0.0416 0.0496  572  PRO A CG  
3424 C  CD  . PRO A 496 ? 0.6628 0.4328 0.4493 0.0025  -0.0458 0.0531  572  PRO A CD  
3425 N  N   . LEU A 497 ? 0.6314 0.4133 0.4016 -0.0083 -0.0535 0.0648  573  LEU A N   
3426 C  CA  . LEU A 497 ? 0.6376 0.4169 0.3958 -0.0109 -0.0581 0.0711  573  LEU A CA  
3427 C  C   . LEU A 497 ? 0.5934 0.3911 0.3621 -0.0028 -0.0635 0.0738  573  LEU A C   
3428 O  O   . LEU A 497 ? 0.6026 0.3987 0.3616 -0.0036 -0.0688 0.0800  573  LEU A O   
3429 C  CB  . LEU A 497 ? 0.7016 0.4534 0.4397 -0.0083 -0.0616 0.0784  573  LEU A CB  
3430 C  CG  . LEU A 497 ? 0.7676 0.4999 0.4906 -0.0203 -0.0573 0.0775  573  LEU A CG  
3431 C  CD1 . LEU A 497 ? 0.7868 0.4901 0.4874 -0.0184 -0.0615 0.0855  573  LEU A CD1 
3432 C  CD2 . LEU A 497 ? 0.7751 0.5191 0.4968 -0.0349 -0.0531 0.0749  573  LEU A CD2 
3433 N  N   . ASP A 498 ? 0.5757 0.3908 0.3634 0.0040  -0.0627 0.0696  574  ASP A N   
3434 C  CA  . ASP A 498 ? 0.6052 0.4409 0.4041 0.0088  -0.0676 0.0717  574  ASP A CA  
3435 C  C   . ASP A 498 ? 0.5396 0.3899 0.3406 -0.0025 -0.0656 0.0670  574  ASP A C   
3436 O  O   . ASP A 498 ? 0.5153 0.3682 0.3198 -0.0096 -0.0589 0.0598  574  ASP A O   
3437 C  CB  . ASP A 498 ? 0.6264 0.4750 0.4441 0.0202  -0.0673 0.0697  574  ASP A CB  
3438 C  CG  . ASP A 498 ? 0.7000 0.5392 0.5163 0.0346  -0.0712 0.0768  574  ASP A CG  
3439 O  OD1 . ASP A 498 ? 0.7664 0.5935 0.5690 0.0365  -0.0760 0.0844  574  ASP A OD1 
3440 O  OD2 . ASP A 498 ? 0.7192 0.5627 0.5472 0.0446  -0.0691 0.0750  574  ASP A OD2 
3441 N  N   . ILE A 499 ? 0.5281 0.3870 0.3258 -0.0041 -0.0716 0.0713  575  ILE A N   
3442 C  CA  . ILE A 499 ? 0.4997 0.3692 0.2955 -0.0147 -0.0701 0.0671  575  ILE A CA  
3443 C  C   . ILE A 499 ? 0.4650 0.3524 0.2792 -0.0134 -0.0671 0.0601  575  ILE A C   
3444 O  O   . ILE A 499 ? 0.4408 0.3385 0.2693 -0.0040 -0.0702 0.0617  575  ILE A O   
3445 C  CB  . ILE A 499 ? 0.5061 0.3793 0.2925 -0.0167 -0.0785 0.0739  575  ILE A CB  
3446 C  CG1 . ILE A 499 ? 0.4696 0.3231 0.2351 -0.0201 -0.0804 0.0802  575  ILE A CG1 
3447 C  CG2 . ILE A 499 ? 0.4378 0.3221 0.2223 -0.0265 -0.0777 0.0692  575  ILE A CG2 
3448 C  CD1 . ILE A 499 ? 0.4863 0.3413 0.2418 -0.0201 -0.0902 0.0890  575  ILE A CD1 
3449 N  N   . PRO A 500 ? 0.4793 0.3707 0.2939 -0.0217 -0.0607 0.0528  576  PRO A N   
3450 C  CA  . PRO A 500 ? 0.4701 0.3768 0.3007 -0.0205 -0.0580 0.0464  576  PRO A CA  
3451 C  C   . PRO A 500 ? 0.4317 0.3529 0.2691 -0.0178 -0.0655 0.0496  576  PRO A C   
3452 O  O   . PRO A 500 ? 0.4149 0.3371 0.2417 -0.0232 -0.0706 0.0529  576  PRO A O   
3453 C  CB  . PRO A 500 ? 0.4898 0.3959 0.3141 -0.0305 -0.0509 0.0398  576  PRO A CB  
3454 C  CG  . PRO A 500 ? 0.5072 0.3984 0.3177 -0.0353 -0.0471 0.0415  576  PRO A CG  
3455 C  CD  . PRO A 500 ? 0.5021 0.3838 0.3025 -0.0320 -0.0548 0.0501  576  PRO A CD  
3456 N  N   . SER A 501 ? 0.4272 0.3601 0.2819 -0.0100 -0.0663 0.0489  577  SER A N   
3457 C  CA  A SER A 501 ? 0.4455 0.3948 0.3094 -0.0070 -0.0735 0.0529  577  SER A CA  
3458 C  CA  B SER A 501 ? 0.4452 0.3945 0.3092 -0.0070 -0.0735 0.0529  577  SER A CA  
3459 C  C   . SER A 501 ? 0.4080 0.3682 0.2777 -0.0135 -0.0714 0.0463  577  SER A C   
3460 O  O   . SER A 501 ? 0.3692 0.3312 0.2482 -0.0123 -0.0650 0.0398  577  SER A O   
3461 C  CB  A SER A 501 ? 0.4514 0.4078 0.3304 0.0058  -0.0754 0.0568  577  SER A CB  
3462 C  CB  B SER A 501 ? 0.4508 0.4072 0.3299 0.0058  -0.0753 0.0567  577  SER A CB  
3463 O  OG  A SER A 501 ? 0.4785 0.4493 0.3632 0.0096  -0.0840 0.0646  577  SER A OG  
3464 O  OG  B SER A 501 ? 0.4221 0.3886 0.3164 0.0081  -0.0709 0.0509  577  SER A OG  
3465 N  N   . VAL A 502 ? 0.3993 0.3656 0.2624 -0.0205 -0.0772 0.0484  578  VAL A N   
3466 C  CA  . VAL A 502 ? 0.4187 0.3910 0.2816 -0.0284 -0.0759 0.0425  578  VAL A CA  
3467 C  C   . VAL A 502 ? 0.3874 0.3772 0.2591 -0.0285 -0.0849 0.0476  578  VAL A C   
3468 O  O   . VAL A 502 ? 0.3896 0.3815 0.2512 -0.0345 -0.0926 0.0528  578  VAL A O   
3469 C  CB  . VAL A 502 ? 0.4766 0.4365 0.3183 -0.0392 -0.0739 0.0394  578  VAL A CB  
3470 C  CG1 . VAL A 502 ? 0.4911 0.4531 0.3298 -0.0468 -0.0717 0.0327  578  VAL A CG1 
3471 C  CG2 . VAL A 502 ? 0.4803 0.4256 0.3144 -0.0392 -0.0653 0.0359  578  VAL A CG2 
3472 N  N   . PRO A 503 ? 0.3845 0.3879 0.2748 -0.0227 -0.0844 0.0471  579  PRO A N   
3473 C  CA  . PRO A 503 ? 0.4191 0.4419 0.3194 -0.0233 -0.0928 0.0528  579  PRO A CA  
3474 C  C   . PRO A 503 ? 0.4588 0.4846 0.3542 -0.0349 -0.0939 0.0480  579  PRO A C   
3475 O  O   . PRO A 503 ? 0.4583 0.4754 0.3506 -0.0382 -0.0865 0.0394  579  PRO A O   
3476 C  CB  . PRO A 503 ? 0.4112 0.4458 0.3327 -0.0117 -0.0902 0.0539  579  PRO A CB  
3477 C  CG  . PRO A 503 ? 0.4099 0.4313 0.3312 -0.0096 -0.0801 0.0453  579  PRO A CG  
3478 C  CD  . PRO A 503 ? 0.3916 0.3939 0.2948 -0.0141 -0.0770 0.0430  579  PRO A CD  
3479 N  N   . ILE A 504 ? 0.4788 0.5170 0.3731 -0.0410 -0.1037 0.0542  580  ILE A N   
3480 C  CA  . ILE A 504 ? 0.5338 0.5743 0.4216 -0.0532 -0.1066 0.0508  580  ILE A CA  
3481 C  C   . ILE A 504 ? 0.5450 0.6100 0.4492 -0.0539 -0.1148 0.0577  580  ILE A C   
3482 O  O   . ILE A 504 ? 0.5292 0.6103 0.4480 -0.0451 -0.1194 0.0664  580  ILE A O   
3483 C  CB  . ILE A 504 ? 0.5564 0.5834 0.4189 -0.0652 -0.1108 0.0506  580  ILE A CB  
3484 C  CG1 . ILE A 504 ? 0.5614 0.5942 0.4206 -0.0636 -0.1200 0.0610  580  ILE A CG1 
3485 C  CG2 . ILE A 504 ? 0.5642 0.5680 0.4106 -0.0666 -0.1004 0.0417  580  ILE A CG2 
3486 C  CD1 . ILE A 504 ? 0.5897 0.6417 0.4525 -0.0704 -0.1328 0.0697  580  ILE A CD1 
3487 C  CHA . HEM B .   ? 0.2757 0.2553 0.2977 0.0330  0.0089  -0.0311 601  HEM A CHA 
3488 C  CHB . HEM B .   ? 0.2476 0.2551 0.2815 0.0204  -0.0003 -0.0301 601  HEM A CHB 
3489 C  CHC . HEM B .   ? 0.2529 0.2594 0.2797 0.0202  0.0083  -0.0334 601  HEM A CHC 
3490 C  CHD . HEM B .   ? 0.2555 0.2417 0.2750 0.0373  0.0227  -0.0354 601  HEM A CHD 
3491 C  C1A . HEM B .   ? 0.2410 0.2289 0.2669 0.0281  0.0051  -0.0306 601  HEM A C1A 
3492 C  C2A . HEM B .   ? 0.2222 0.2116 0.2488 0.0252  0.0015  -0.0291 601  HEM A C2A 
3493 C  C3A . HEM B .   ? 0.2093 0.2070 0.2395 0.0222  -0.0006 -0.0290 601  HEM A C3A 
3494 C  C4A . HEM B .   ? 0.2416 0.2427 0.2731 0.0225  0.0010  -0.0302 601  HEM A C4A 
3495 C  CMA . HEM B .   ? 0.2073 0.2095 0.2388 0.0194  -0.0034 -0.0277 601  HEM A CMA 
3496 C  CAA . HEM B .   ? 0.2298 0.2114 0.2526 0.0259  0.0006  -0.0278 601  HEM A CAA 
3497 C  CBA . HEM B .   ? 0.2361 0.2234 0.2663 0.0307  -0.0003 -0.0251 601  HEM A CBA 
3498 C  CGA . HEM B .   ? 0.2956 0.2747 0.3213 0.0314  -0.0016 -0.0232 601  HEM A CGA 
3499 O  O1A . HEM B .   ? 0.2914 0.2607 0.3082 0.0274  -0.0017 -0.0241 601  HEM A O1A 
3500 O  O2A . HEM B .   ? 0.2994 0.2820 0.3301 0.0354  -0.0028 -0.0205 601  HEM A O2A 
3501 C  C1B . HEM B .   ? 0.2626 0.2716 0.2959 0.0198  0.0010  -0.0310 601  HEM A C1B 
3502 C  C2B . HEM B .   ? 0.2595 0.2728 0.2933 0.0178  -0.0007 -0.0306 601  HEM A C2B 
3503 C  C3B . HEM B .   ? 0.2837 0.2963 0.3154 0.0174  0.0012  -0.0313 601  HEM A C3B 
3504 C  C4B . HEM B .   ? 0.2831 0.2915 0.3130 0.0196  0.0048  -0.0324 601  HEM A C4B 
3505 C  CMB . HEM B .   ? 0.2217 0.2388 0.2573 0.0171  -0.0034 -0.0294 601  HEM A CMB 
3506 C  CAB . HEM B .   ? 0.2640 0.2787 0.2943 0.0156  0.0003  -0.0308 601  HEM A CAB 
3507 C  CBB . HEM B .   ? 0.2874 0.3043 0.3178 0.0148  -0.0025 -0.0297 601  HEM A CBB 
3508 C  C1C . HEM B .   ? 0.2218 0.2233 0.2457 0.0236  0.0129  -0.0345 601  HEM A C1C 
3509 C  C2C . HEM B .   ? 0.2445 0.2427 0.2628 0.0243  0.0176  -0.0358 601  HEM A C2C 
3510 C  C3C . HEM B .   ? 0.2703 0.2629 0.2864 0.0294  0.0222  -0.0367 601  HEM A C3C 
3511 C  C4C . HEM B .   ? 0.2589 0.2511 0.2793 0.0316  0.0197  -0.0355 601  HEM A C4C 
3512 C  CMC . HEM B .   ? 0.2297 0.2296 0.2443 0.0203  0.0174  -0.0360 601  HEM A CMC 
3513 C  CAC . HEM B .   ? 0.3450 0.3313 0.3540 0.0333  0.0294  -0.0384 601  HEM A CAC 
3514 C  CBC . HEM B .   ? 0.3994 0.3833 0.4010 0.0306  0.0319  -0.0398 601  HEM A CBC 
3515 C  C1D . HEM B .   ? 0.2444 0.2266 0.2644 0.0384  0.0199  -0.0345 601  HEM A C1D 
3516 C  C2D . HEM B .   ? 0.2647 0.2378 0.2815 0.0447  0.0229  -0.0341 601  HEM A C2D 
3517 C  C3D . HEM B .   ? 0.2562 0.2268 0.2734 0.0432  0.0186  -0.0328 601  HEM A C3D 
3518 C  C4D . HEM B .   ? 0.2762 0.2550 0.2971 0.0362  0.0134  -0.0324 601  HEM A C4D 
3519 C  CMD . HEM B .   ? 0.2730 0.2396 0.2858 0.0527  0.0303  -0.0348 601  HEM A CMD 
3520 C  CAD . HEM B .   ? 0.2651 0.2248 0.2782 0.0484  0.0195  -0.0316 601  HEM A CAD 
3521 C  CBD . HEM B .   ? 0.2948 0.2343 0.2908 0.0443  0.0197  -0.0345 601  HEM A CBD 
3522 C  CGD . HEM B .   ? 0.3521 0.2775 0.3416 0.0494  0.0207  -0.0333 601  HEM A CGD 
3523 O  O1D . HEM B .   ? 0.3867 0.2921 0.3607 0.0506  0.0241  -0.0358 601  HEM A O1D 
3524 O  O2D . HEM B .   ? 0.3609 0.2932 0.3590 0.0523  0.0181  -0.0297 601  HEM A O2D 
3525 N  NA  . HEM B .   ? 0.2393 0.2349 0.2683 0.0257  0.0046  -0.0311 601  HEM A NA  
3526 N  NB  . HEM B .   ? 0.2649 0.2707 0.2959 0.0215  0.0044  -0.0321 601  HEM A NB  
3527 N  NC  . HEM B .   ? 0.2549 0.2528 0.2798 0.0275  0.0142  -0.0343 601  HEM A NC  
3528 N  ND  . HEM B .   ? 0.2786 0.2638 0.3011 0.0339  0.0143  -0.0334 601  HEM A ND  
3529 FE FE  . HEM B .   ? 0.2734 0.2683 0.2989 0.0261  0.0090  -0.0333 601  HEM A FE  
3530 C  C1  . RET C .   ? 0.2595 0.2963 0.3244 0.0308  -0.0013 -0.0207 602  RET A C1  
3531 C  C2  . RET C .   ? 0.2442 0.2738 0.3031 0.0315  0.0027  -0.0237 602  RET A C2  
3532 C  C3  . RET C .   ? 0.2409 0.2609 0.2917 0.0296  0.0017  -0.0259 602  RET A C3  
3533 C  C4  . RET C .   ? 0.2633 0.2787 0.3128 0.0318  0.0006  -0.0248 602  RET A C4  
3534 C  C5  . RET C .   ? 0.2628 0.2850 0.3195 0.0343  -0.0014 -0.0215 602  RET A C5  
3535 C  C6  . RET C .   ? 0.2677 0.3000 0.3311 0.0331  -0.0030 -0.0197 602  RET A C6  
3536 C  C7  . RET C .   ? 0.2679 0.3070 0.3367 0.0332  -0.0067 -0.0162 602  RET A C7  
3537 C  C8  . RET C .   ? 0.2596 0.2965 0.3249 0.0302  -0.0106 -0.0159 602  RET A C8  
3538 C  C9  . RET C .   ? 0.2563 0.2980 0.3240 0.0289  -0.0152 -0.0126 602  RET A C9  
3539 C  C10 . RET C .   ? 0.2912 0.3279 0.3520 0.0254  -0.0181 -0.0133 602  RET A C10 
3540 C  C11 . RET C .   ? 0.3625 0.4007 0.4214 0.0227  -0.0229 -0.0109 602  RET A C11 
3541 C  C12 . RET C .   ? 0.4051 0.4365 0.4551 0.0194  -0.0242 -0.0127 602  RET A C12 
3542 C  C13 . RET C .   ? 0.4614 0.4905 0.5049 0.0158  -0.0285 -0.0113 602  RET A C13 
3543 C  C14 . RET C .   ? 0.5296 0.5511 0.5633 0.0131  -0.0281 -0.0141 602  RET A C14 
3544 C  C15 . RET C .   ? 0.6096 0.6251 0.6329 0.0095  -0.0312 -0.0139 602  RET A C15 
3545 O  O1  . RET C .   ? 0.6703 0.6780 0.6840 0.0085  -0.0294 -0.0167 602  RET A O1  
3546 C  C16 . RET C .   ? 0.2385 0.2753 0.3006 0.0256  -0.0047 -0.0214 602  RET A C16 
3547 C  C17 . RET C .   ? 0.2609 0.3093 0.3353 0.0327  -0.0002 -0.0175 602  RET A C17 
3548 C  C18 . RET C .   ? 0.2585 0.2748 0.3126 0.0365  -0.0027 -0.0200 602  RET A C18 
3549 C  C19 . RET C .   ? 0.2326 0.2855 0.3102 0.0317  -0.0163 -0.0081 602  RET A C19 
3550 C  C20 . RET C .   ? 0.4239 0.4588 0.4714 0.0159  -0.0332 -0.0066 602  RET A C20 
3551 O  O   . HOH D .   ? 0.5154 0.5638 0.5702 -0.0079 -0.0099 -0.0143 701  HOH A O   
3552 O  O   . HOH D .   ? 0.6427 0.5090 0.4956 0.0446  -0.0622 0.0638  702  HOH A O   
3553 O  O   . HOH D .   ? 0.5456 0.7603 0.7071 -0.0349 -0.0569 0.0447  703  HOH A O   
3554 O  O   . HOH D .   ? 0.5725 0.5261 0.5902 0.1058  0.0604  -0.0272 704  HOH A O   
3555 O  O   . HOH D .   ? 0.5922 0.6633 0.6184 -0.1141 -0.0188 0.0250  705  HOH A O   
3556 O  O   . HOH D .   ? 0.7790 0.9868 0.8994 -0.0145 0.0756  0.0217  706  HOH A O   
3557 O  O   . HOH D .   ? 0.5266 0.8297 0.7432 -0.0402 -0.0053 0.0578  707  HOH A O   
3558 O  O   . HOH D .   ? 0.6269 0.5665 0.5535 -0.0713 -0.0101 0.0231  708  HOH A O   
3559 O  O   . HOH D .   ? 0.4211 0.3877 0.4684 0.0973  0.0037  0.0063  709  HOH A O   
3560 O  O   . HOH D .   ? 0.8259 0.5571 0.5791 0.0033  0.0564  -0.0816 710  HOH A O   
3561 O  O   . HOH D .   ? 0.6197 0.5848 0.5121 0.0484  0.0491  -0.0265 711  HOH A O   
3562 O  O   . HOH D .   ? 0.8597 0.8287 0.8172 -0.0231 -0.0494 -0.0180 712  HOH A O   
3563 O  O   . HOH D .   ? 0.7436 0.8105 0.7136 0.0392  0.0593  -0.0035 713  HOH A O   
3564 O  O   . HOH D .   ? 0.5620 0.5609 0.4795 -0.0624 -0.0511 -0.0131 714  HOH A O   
3565 O  O   . HOH D .   ? 0.6311 0.3636 0.4358 -0.0055 -0.0257 0.0015  715  HOH A O   
3566 O  O   . HOH D .   ? 0.6083 0.5029 0.5426 0.0835  -0.0073 -0.0008 716  HOH A O   
3567 O  O   . HOH D .   ? 0.5852 0.6538 0.5786 0.0213  0.1095  -0.0204 717  HOH A O   
3568 O  O   . HOH D .   ? 0.5569 0.6124 0.6242 0.0061  -0.0159 -0.0139 718  HOH A O   
3569 O  O   . HOH D .   ? 0.7265 0.5914 0.6226 -0.0782 -0.0225 -0.0105 719  HOH A O   
3570 O  O   . HOH D .   ? 0.5766 0.3869 0.3936 -0.0279 -0.0304 0.0345  720  HOH A O   
3571 O  O   . HOH D .   ? 0.6464 0.6652 0.6134 -0.0202 -0.1034 0.0390  721  HOH A O   
3572 O  O   . HOH D .   ? 0.6234 0.6058 0.5573 0.0320  0.0988  -0.0431 722  HOH A O   
3573 O  O   . HOH D .   ? 0.6204 0.5559 0.5688 -0.0608 -0.0232 -0.0048 723  HOH A O   
3574 O  O   . HOH D .   ? 0.4660 0.3984 0.4164 0.0702  -0.0244 0.0163  724  HOH A O   
3575 O  O   . HOH D .   ? 0.5360 0.3369 0.4018 0.0946  0.0044  -0.0130 725  HOH A O   
3576 O  O   . HOH D .   ? 0.5709 0.9163 0.8449 0.0336  -0.0286 0.0828  726  HOH A O   
3577 O  O   . HOH D .   ? 0.5787 0.7351 0.7416 0.1146  0.0619  0.0160  727  HOH A O   
3578 O  O   . HOH D .   ? 0.6097 0.6202 0.5055 -0.0543 -0.0709 0.0137  728  HOH A O   
3579 O  O   . HOH D .   ? 0.7098 0.6331 0.5245 -0.0728 -0.0357 -0.0230 729  HOH A O   
3580 O  O   . HOH D .   ? 0.9781 0.6312 0.7595 -0.0265 -0.0087 -0.0123 730  HOH A O   
3581 O  O   . HOH D .   ? 0.6764 0.8812 0.8009 0.1055  0.0027  0.0449  731  HOH A O   
3582 O  O   . HOH D .   ? 0.4228 0.4426 0.4712 0.0533  -0.0555 0.0365  732  HOH A O   
3583 O  O   . HOH D .   ? 0.4045 0.2596 0.2230 -0.0143 -0.0469 0.0478  733  HOH A O   
3584 O  O   . HOH D .   ? 0.3559 0.3620 0.3024 -0.0121 0.0131  0.0055  734  HOH A O   
3585 O  O   . HOH D .   ? 0.6062 0.5681 0.5076 -0.0148 0.0484  -0.0349 735  HOH A O   
3586 O  O   . HOH D .   ? 0.5449 0.4488 0.4409 -0.0221 -0.0282 0.0323  736  HOH A O   
3587 O  O   . HOH D .   ? 0.6336 0.6118 0.4976 -0.0654 -0.0603 -0.0001 737  HOH A O   
3588 O  O   . HOH D .   ? 0.2992 0.3234 0.3254 0.0106  0.0166  -0.0281 738  HOH A O   
3589 O  O   . HOH D .   ? 0.6315 0.5235 0.5586 0.1144  -0.0190 0.0286  739  HOH A O   
3590 O  O   . HOH D .   ? 0.6375 0.6326 0.5500 0.0351  0.1337  -0.0401 740  HOH A O   
3591 O  O   . HOH D .   ? 0.7332 0.5719 0.6129 0.0793  0.0147  -0.0328 741  HOH A O   
3592 O  O   . HOH D .   ? 0.3316 0.6833 0.6178 0.0778  0.0283  0.0735  742  HOH A O   
3593 O  O   . HOH D .   ? 0.9443 0.5732 0.6732 0.0008  -0.0245 -0.0089 743  HOH A O   
3594 O  O   . HOH D .   ? 0.6373 0.8607 0.8498 0.0806  -0.0287 0.0614  744  HOH A O   
3595 O  O   . HOH D .   ? 0.5337 0.4470 0.4582 -0.0580 -0.0144 0.0156  745  HOH A O   
3596 O  O   . HOH D .   ? 0.6931 0.4290 0.5341 0.1161  0.0893  -0.0548 746  HOH A O   
3597 O  O   . HOH D .   ? 0.4590 0.3514 0.3807 0.0097  -0.0437 0.0363  747  HOH A O   
3598 O  O   . HOH D .   ? 0.4101 0.5501 0.4342 -0.0162 -0.0815 0.0446  748  HOH A O   
3599 O  O   . HOH D .   ? 0.6401 0.6063 0.6024 -0.0633 -0.0237 -0.0146 749  HOH A O   
3600 O  O   . HOH D .   ? 0.6099 0.6617 0.6284 -0.0286 -0.0820 0.0168  750  HOH A O   
3601 O  O   . HOH D .   ? 0.4238 0.5767 0.5181 0.0946  -0.0112 0.0364  751  HOH A O   
3602 O  O   . HOH D .   ? 0.5382 0.5635 0.5363 -0.0306 -0.0727 0.0048  752  HOH A O   
3603 O  O   . HOH D .   ? 0.5601 0.8241 0.7203 0.0181  0.1043  0.0304  753  HOH A O   
3604 O  O   . HOH D .   ? 0.3733 0.4496 0.4132 0.0049  0.0549  -0.0149 754  HOH A O   
3605 O  O   . HOH D .   ? 0.4449 0.3870 0.4060 -0.0360 -0.0147 -0.0244 755  HOH A O   
3606 O  O   . HOH D .   ? 0.4777 0.3915 0.4063 -0.0696 -0.0174 0.0063  756  HOH A O   
3607 O  O   . HOH D .   ? 0.2697 0.2672 0.2585 0.0214  -0.0039 -0.0232 757  HOH A O   
3608 O  O   . HOH D .   ? 0.5367 0.3684 0.4087 -0.0392 -0.0326 -0.0234 758  HOH A O   
3609 O  O   . HOH D .   ? 0.6563 0.5749 0.5449 -0.0275 -0.0152 0.0116  759  HOH A O   
3610 O  O   . HOH D .   ? 0.6193 0.5518 0.4787 -0.0398 -0.0003 -0.0322 760  HOH A O   
3611 O  O   . HOH D .   ? 0.4895 0.2706 0.3625 -0.0086 -0.0204 0.0143  761  HOH A O   
3612 O  O   . HOH D .   ? 0.5281 0.4287 0.3821 0.0088  -0.0611 0.0531  762  HOH A O   
3613 O  O   . HOH D .   ? 0.7157 0.4656 0.5987 0.0544  -0.0065 0.0069  763  HOH A O   
3614 O  O   . HOH D .   ? 0.2987 0.3049 0.2768 0.0059  0.0018  -0.0086 764  HOH A O   
3615 O  O   . HOH D .   ? 0.6195 0.8660 0.7617 -0.1064 0.0104  0.0549  765  HOH A O   
3616 O  O   . HOH D .   ? 0.2861 0.2442 0.3009 0.0424  0.0085  -0.0266 766  HOH A O   
3617 O  O   . HOH D .   ? 0.6297 0.5111 0.5200 -0.0732 -0.0165 0.0106  767  HOH A O   
3618 O  O   . HOH D .   ? 0.6216 0.6663 0.6554 -0.0510 -0.0139 -0.0007 768  HOH A O   
3619 O  O   . HOH D .   ? 0.2763 0.3879 0.3289 -0.0300 -0.0023 0.0092  769  HOH A O   
3620 O  O   . HOH D .   ? 0.5234 0.3260 0.4199 0.0433  -0.0417 0.0471  770  HOH A O   
3621 O  O   . HOH D .   ? 0.6217 0.6443 0.5895 0.0788  0.0538  -0.0193 771  HOH A O   
3622 O  O   . HOH D .   ? 0.4704 0.5146 0.4669 -0.0200 -0.0357 -0.0095 772  HOH A O   
3623 O  O   . HOH D .   ? 0.4137 0.3871 0.3991 -0.0330 -0.0330 -0.0177 773  HOH A O   
3624 O  O   . HOH D .   ? 0.8044 0.8355 0.7917 -0.0420 -0.0353 -0.0154 774  HOH A O   
3625 O  O   . HOH D .   ? 0.3537 0.6751 0.5748 -0.0447 0.0137  0.0607  775  HOH A O   
3626 O  O   . HOH D .   ? 0.5061 0.8074 0.7383 0.1338  0.1257  0.0443  776  HOH A O   
3627 O  O   . HOH D .   ? 0.8520 0.7876 0.7696 0.1062  0.0527  -0.0310 777  HOH A O   
3628 O  O   . HOH D .   ? 1.0955 0.9365 0.8270 0.0983  0.2273  -0.0745 778  HOH A O   
3629 O  O   . HOH D .   ? 0.3048 0.2439 0.2559 -0.0665 -0.0342 -0.0083 779  HOH A O   
3630 O  O   . HOH D .   ? 0.5477 0.5617 0.4997 0.0873  0.1615  -0.0391 780  HOH A O   
3631 O  O   . HOH D .   ? 0.7719 0.8525 0.7809 -0.0272 -0.0506 0.0056  781  HOH A O   
3632 O  O   . HOH D .   ? 0.5803 0.3899 0.4190 -0.0323 -0.0348 -0.0364 782  HOH A O   
3633 O  O   . HOH D .   ? 0.4546 0.3626 0.2912 0.0145  -0.0844 0.0774  783  HOH A O   
3634 O  O   . HOH D .   ? 0.7626 0.8401 0.8340 0.0448  -0.0899 0.0648  784  HOH A O   
3635 O  O   . HOH D .   ? 0.6632 0.8484 0.7520 0.0869  0.1665  0.0027  785  HOH A O   
3636 O  O   . HOH D .   ? 0.4202 0.3679 0.4503 0.0916  -0.0200 0.0245  786  HOH A O   
3637 O  O   . HOH D .   ? 0.4907 0.4950 0.5069 0.0068  -0.0238 -0.0227 787  HOH A O   
3638 O  O   . HOH D .   ? 0.3568 0.3267 0.2838 -0.0029 -0.0356 0.0115  788  HOH A O   
3639 O  O   . HOH D .   ? 0.4536 0.3134 0.3246 0.0171  -0.0352 0.0283  789  HOH A O   
3640 O  O   . HOH D .   ? 0.7050 0.7013 0.6647 -0.0688 0.0139  0.0088  790  HOH A O   
3641 O  O   . HOH D .   ? 0.6024 0.7547 0.6361 0.0176  -0.0891 0.0674  791  HOH A O   
3642 O  O   . HOH D .   ? 0.5969 0.5551 0.5518 -0.0218 -0.0433 -0.0226 792  HOH A O   
3643 O  O   . HOH D .   ? 0.9953 0.7544 0.7069 0.1389  0.2265  -0.0818 793  HOH A O   
3644 O  O   . HOH D .   ? 0.4945 0.4622 0.4310 -0.0580 0.0099  0.0059  794  HOH A O   
3645 O  O   . HOH D .   ? 0.7773 0.5312 0.6093 0.1208  0.1119  -0.0622 795  HOH A O   
3646 O  O   . HOH D .   ? 0.5502 0.4208 0.4207 0.0357  0.0756  -0.0646 796  HOH A O   
3647 O  O   . HOH D .   ? 0.3613 0.6528 0.5022 -0.0109 -0.0629 0.0683  797  HOH A O   
3648 O  O   . HOH D .   ? 0.5590 0.4182 0.4679 0.1247  0.0098  -0.0012 798  HOH A O   
3649 O  O   . HOH D .   ? 0.4250 0.4017 0.3653 0.0241  0.0785  -0.0435 799  HOH A O   
3650 O  O   . HOH D .   ? 0.3006 0.4849 0.4123 -0.0236 0.0564  0.0183  800  HOH A O   
3651 O  O   . HOH D .   ? 0.4039 0.4088 0.4166 0.0261  -0.0608 0.0278  801  HOH A O   
3652 O  O   . HOH D .   ? 0.2546 0.2551 0.2961 0.0341  -0.0091 -0.0163 802  HOH A O   
3653 O  O   . HOH D .   ? 0.6037 0.8817 0.7672 -0.1281 -0.0166 0.0678  803  HOH A O   
3654 O  O   . HOH D .   ? 0.3228 0.2380 0.2964 0.0128  -0.0028 -0.0238 804  HOH A O   
3655 O  O   . HOH D .   ? 0.7412 0.7705 0.7830 0.1806  0.1522  -0.0151 805  HOH A O   
3656 O  O   . HOH D .   ? 0.2989 0.2570 0.3004 0.0144  -0.0028 -0.0265 806  HOH A O   
3657 O  O   . HOH D .   ? 0.6078 0.7545 0.7877 0.1462  0.0312  0.0401  807  HOH A O   
3658 O  O   . HOH D .   ? 0.5113 0.5496 0.4946 -0.0226 0.0132  0.0091  808  HOH A O   
3659 O  O   . HOH D .   ? 0.4669 0.3303 0.3624 -0.0161 -0.0270 -0.0310 809  HOH A O   
3660 O  O   . HOH D .   ? 0.6859 0.6161 0.5587 -0.0443 -0.0003 0.0078  810  HOH A O   
3661 O  O   . HOH D .   ? 0.3916 0.5444 0.4622 -0.0381 -0.0361 0.0171  811  HOH A O   
3662 O  O   . HOH D .   ? 0.5725 0.4728 0.4490 0.0065  -0.0428 0.0336  812  HOH A O   
3663 O  O   . HOH D .   ? 0.4140 0.5727 0.4759 0.0256  -0.0653 0.0499  813  HOH A O   
3664 O  O   . HOH D .   ? 0.3575 0.3706 0.3626 0.1162  0.0283  -0.0051 814  HOH A O   
3665 O  O   . HOH D .   ? 0.4936 0.3395 0.4490 0.0784  0.0140  -0.0129 815  HOH A O   
3666 O  O   . HOH D .   ? 0.2591 0.2734 0.2834 0.0143  0.0095  -0.0315 816  HOH A O   
3667 O  O   . HOH D .   ? 0.6510 0.6864 0.5664 -0.0794 -0.0792 0.0085  817  HOH A O   
3668 O  O   . HOH D .   ? 0.5567 0.3282 0.3518 -0.0848 -0.0255 0.0295  818  HOH A O   
3669 O  O   . HOH D .   ? 0.4305 0.5448 0.5020 0.1496  -0.0127 0.0576  819  HOH A O   
3670 O  O   . HOH D .   ? 0.2762 0.2940 0.3257 0.0292  -0.0129 -0.0166 820  HOH A O   
3671 O  O   . HOH D .   ? 0.6333 0.6945 0.6367 -0.0592 -0.0424 -0.0047 821  HOH A O   
3672 O  O   . HOH D .   ? 0.5183 0.4111 0.3167 0.0065  0.0192  -0.0259 822  HOH A O   
3673 O  O   . HOH D .   ? 0.5359 0.7453 0.6519 0.1230  0.1825  0.0081  823  HOH A O   
3674 O  O   . HOH D .   ? 0.4557 0.4259 0.3751 -0.0227 -0.0067 -0.0196 824  HOH A O   
3675 O  O   . HOH D .   ? 0.4900 0.5264 0.4772 -0.0471 0.0049  0.0155  825  HOH A O   
3676 O  O   . HOH D .   ? 0.7917 0.8399 0.7440 0.1139  0.2067  -0.0332 826  HOH A O   
3677 O  O   . HOH D .   ? 0.5092 0.3553 0.3812 -0.0763 -0.0467 -0.0174 827  HOH A O   
3678 O  O   . HOH D .   ? 0.6914 0.5605 0.5781 -0.0078 0.0183  -0.0560 828  HOH A O   
3679 O  O   . HOH D .   ? 0.6657 0.7140 0.7711 0.2071  0.1026  0.0171  829  HOH A O   
3680 O  O   . HOH D .   ? 0.5184 0.6731 0.6343 0.1615  0.1611  0.0044  830  HOH A O   
3681 O  O   . HOH D .   ? 1.0288 0.7204 0.8131 0.0646  -0.0076 -0.0113 831  HOH A O   
3682 O  O   . HOH D .   ? 0.3531 0.3813 0.3964 0.0029  -0.0121 -0.0209 832  HOH A O   
3683 O  O   . HOH D .   ? 0.5467 0.6574 0.6392 -0.0324 -0.0246 0.0073  833  HOH A O   
3684 O  O   . HOH D .   ? 0.5119 0.5986 0.5345 -0.0405 0.0080  0.0149  834  HOH A O   
3685 O  O   . HOH D .   ? 0.7826 0.8001 0.7884 -0.0766 -0.0259 0.0039  835  HOH A O   
3686 O  O   . HOH D .   ? 0.3031 0.3129 0.3202 -0.0060 -0.0104 -0.0245 836  HOH A O   
3687 O  O   . HOH D .   ? 0.4863 0.6291 0.6080 0.1657  0.1462  0.0059  837  HOH A O   
3688 O  O   . HOH D .   ? 0.3468 0.4543 0.4155 0.1214  0.0158  0.0220  838  HOH A O   
3689 O  O   . HOH D .   ? 0.3445 0.4561 0.3745 -0.0325 -0.0537 0.0126  839  HOH A O   
3690 O  O   . HOH D .   ? 0.8060 0.6209 0.6444 -0.0052 0.0300  -0.0650 840  HOH A O   
3691 O  O   . HOH D .   ? 0.8154 0.8594 0.7455 -0.1091 -0.0807 0.0045  841  HOH A O   
3692 O  O   . HOH D .   ? 0.6281 0.6339 0.5978 0.0794  0.1310  -0.0397 842  HOH A O   
3693 O  O   . HOH D .   ? 0.4558 0.2633 0.2884 -0.0911 -0.0555 -0.0203 843  HOH A O   
3694 O  O   . HOH D .   ? 0.7185 0.6492 0.6625 -0.0250 -0.0079 -0.0386 844  HOH A O   
3695 O  O   . HOH D .   ? 0.7706 0.7478 0.6973 0.0817  0.0565  -0.0277 845  HOH A O   
3696 O  O   . HOH D .   ? 0.3895 0.4121 0.4275 0.0180  -0.0064 -0.0264 846  HOH A O   
3697 O  O   . HOH D .   ? 0.7444 0.4624 0.4947 -0.0651 -0.0479 -0.0404 847  HOH A O   
3698 O  O   . HOH D .   ? 0.7085 0.6481 0.6165 0.0626  0.0361  -0.0350 848  HOH A O   
3699 O  O   . HOH D .   ? 0.5773 0.6269 0.5897 -0.0549 -0.0105 0.0064  849  HOH A O   
3700 O  O   . HOH D .   ? 0.7394 0.6423 0.6258 0.1667  0.1995  -0.0517 850  HOH A O   
3701 O  O   . HOH D .   ? 0.6251 0.5420 0.5532 -0.0197 -0.0007 -0.0447 851  HOH A O   
3702 O  O   . HOH D .   ? 0.4286 0.8261 0.7167 0.0521  0.0754  0.0725  852  HOH A O   
3703 O  O   . HOH D .   ? 0.3974 0.4452 0.4322 0.0041  -0.0153 -0.0184 853  HOH A O   
3704 O  O   . HOH D .   ? 0.5614 0.4712 0.5044 -0.0040 0.0047  -0.0428 854  HOH A O   
3705 O  O   . HOH D .   ? 0.8487 0.6065 0.5782 0.1284  0.2026  -0.0809 855  HOH A O   
3706 O  O   . HOH D .   ? 0.5295 0.4084 0.4066 -0.0080 -0.0273 0.0203  856  HOH A O   
3707 O  O   . HOH D .   ? 0.6017 0.4722 0.4446 0.0063  -0.0517 0.0484  857  HOH A O   
3708 O  O   . HOH D .   ? 0.4710 0.2893 0.3661 0.0147  0.0150  -0.0430 858  HOH A O   
3709 O  O   . HOH D .   ? 0.5066 0.3190 0.3675 -0.0096 -0.0231 -0.0291 859  HOH A O   
3710 O  O   . HOH D .   ? 0.6063 0.3897 0.5229 0.0938  -0.0252 0.0410  860  HOH A O   
3711 O  O   . HOH D .   ? 0.6563 0.7071 0.6931 0.0098  -0.0748 0.0293  861  HOH A O   
3712 O  O   . HOH D .   ? 0.4783 0.3868 0.4224 0.1135  0.0016  0.0042  862  HOH A O   
3713 O  O   . HOH D .   ? 0.6183 0.6810 0.5584 -0.0337 -0.0889 0.0399  863  HOH A O   
3714 O  O   . HOH D .   ? 0.5477 0.3774 0.3786 -0.0591 -0.0191 0.0270  864  HOH A O   
3715 O  O   . HOH D .   ? 0.7040 0.4381 0.5030 0.0250  -0.0317 0.0267  865  HOH A O   
3716 O  O   . HOH D .   ? 0.4473 0.4391 0.4375 -0.0200 -0.0145 -0.0288 866  HOH A O   
3717 O  O   . HOH D .   ? 0.3291 0.3181 0.3383 0.0034  -0.0154 -0.0247 867  HOH A O   
3718 O  O   . HOH D .   ? 0.4864 0.5447 0.4686 0.0181  0.0373  -0.0026 868  HOH A O   
3719 O  O   . HOH D .   ? 0.3395 0.3571 0.3766 0.0180  -0.0068 -0.0256 869  HOH A O   
3720 O  O   . HOH D .   ? 0.5012 0.6062 0.5121 -0.0462 -0.0637 0.0150  870  HOH A O   
3721 O  O   . HOH D .   ? 0.4140 0.5050 0.4302 0.0757  -0.0736 0.0749  871  HOH A O   
3722 O  O   . HOH D .   ? 0.2983 0.4968 0.3933 -0.0261 -0.0434 0.0319  872  HOH A O   
3723 O  O   . HOH D .   ? 0.3889 0.2691 0.3349 0.0583  -0.0585 0.0578  873  HOH A O   
3724 O  O   . HOH D .   ? 0.5184 0.6539 0.5755 -0.0077 -0.0475 0.0195  874  HOH A O   
3725 O  O   . HOH D .   ? 0.5169 0.3591 0.4708 0.0756  0.0048  -0.0043 875  HOH A O   
3726 O  O   . HOH D .   ? 0.4947 0.5477 0.4744 -0.0127 0.0251  0.0085  876  HOH A O   
3727 O  O   . HOH D .   ? 0.4416 0.4577 0.4540 0.1612  0.0212  0.0227  877  HOH A O   
3728 O  O   . HOH D .   ? 0.3473 0.3928 0.3537 0.0675  0.0350  -0.0157 878  HOH A O   
3729 O  O   . HOH D .   ? 0.6157 0.9084 0.7757 0.1030  0.0448  0.0551  879  HOH A O   
3730 O  O   . HOH D .   ? 0.6999 0.6266 0.6383 -0.0381 -0.0140 -0.0346 880  HOH A O   
3731 O  O   . HOH D .   ? 0.6635 0.6581 0.5996 -0.0206 0.0467  -0.0220 881  HOH A O   
3732 O  O   . HOH D .   ? 0.6073 0.4630 0.3993 -0.0384 0.0273  -0.0592 882  HOH A O   
3733 O  O   . HOH D .   ? 0.6154 0.4556 0.4532 0.0008  -0.0401 0.0392  883  HOH A O   
3734 O  O   . HOH D .   ? 0.4850 0.4035 0.3586 0.0170  0.0045  -0.0319 884  HOH A O   
3735 O  O   . HOH D .   ? 0.7424 0.5238 0.6528 0.0713  0.0058  -0.0045 885  HOH A O   
3736 O  O   . HOH D .   ? 0.6345 0.8000 0.7932 0.0466  -0.0462 0.0438  886  HOH A O   
3737 O  O   . HOH D .   ? 0.9071 0.8374 0.7494 -0.0352 0.0390  -0.0317 887  HOH A O   
3738 O  O   . HOH D .   ? 0.5369 0.4430 0.4755 0.0751  -0.0164 0.0078  888  HOH A O   
3739 O  O   . HOH D .   ? 0.5528 0.5240 0.5160 -0.0657 -0.0141 0.0064  889  HOH A O   
3740 O  O   . HOH D .   ? 0.4920 0.4698 0.4749 0.0679  0.0140  -0.0247 890  HOH A O   
3741 O  O   . HOH D .   ? 0.7084 0.7395 0.7121 -0.0738 0.0005  0.0089  891  HOH A O   
3742 O  O   . HOH D .   ? 0.4417 0.9265 0.7964 0.0873  0.0779  0.1041  892  HOH A O   
3743 O  O   . HOH D .   ? 0.6021 0.6731 0.6246 0.1093  0.0516  -0.0044 893  HOH A O   
3744 O  O   . HOH D .   ? 0.5636 0.6254 0.5593 -0.0397 -0.0473 -0.0029 894  HOH A O   
3745 O  O   . HOH D .   ? 0.8087 0.7486 0.6769 -0.0667 -0.0989 0.0033  895  HOH A O   
3746 O  O   . HOH D .   ? 0.5359 0.5053 0.4514 -0.0372 0.0195  -0.0070 896  HOH A O   
3747 O  O   . HOH D .   ? 0.6899 0.4996 0.5969 0.1488  0.1010  -0.0412 897  HOH A O   
3748 O  O   . HOH D .   ? 0.5413 0.8483 0.8004 0.0971  0.0497  0.0572  898  HOH A O   
3749 O  O   . HOH D .   ? 0.6191 0.3973 0.4670 0.0623  -0.0164 0.0047  899  HOH A O   
3750 O  O   . HOH D .   ? 0.5146 0.5824 0.5246 0.0902  0.1515  -0.0259 900  HOH A O   
3751 O  O   . HOH D .   ? 0.5399 0.5683 0.5338 -0.0763 -0.0256 0.0011  901  HOH A O   
3752 O  O   . HOH D .   ? 0.4167 0.6763 0.6568 0.0997  0.0133  0.0572  902  HOH A O   
3753 O  O   . HOH D .   ? 0.8833 0.5681 0.6193 -0.1320 -0.0433 0.0224  903  HOH A O   
3754 O  O   . HOH D .   ? 0.3901 0.2991 0.3807 0.0542  0.0001  -0.0116 904  HOH A O   
3755 O  O   . HOH D .   ? 0.3632 0.3297 0.3469 0.0240  -0.0499 0.0244  905  HOH A O   
3756 O  O   . HOH D .   ? 0.6177 0.4288 0.4849 -0.0122 -0.0358 0.0425  906  HOH A O   
3757 O  O   . HOH D .   ? 0.5051 0.3497 0.3980 0.0922  0.0118  -0.0220 907  HOH A O   
3758 O  O   . HOH D .   ? 0.4595 0.3878 0.4046 0.0471  0.0041  -0.0336 908  HOH A O   
3759 O  O   . HOH D .   ? 0.6777 0.4728 0.5190 0.0406  -0.0006 -0.0398 909  HOH A O   
3760 O  O   . HOH D .   ? 0.7036 0.6045 0.5782 -0.0820 -0.0098 0.0427  910  HOH A O   
3761 O  O   . HOH D .   ? 0.6765 0.5018 0.5360 -0.0710 -0.0282 0.0033  911  HOH A O   
3762 O  O   . HOH D .   ? 0.5654 0.5338 0.4451 -0.0387 0.0134  0.0254  912  HOH A O   
3763 O  O   . HOH D .   ? 0.4260 0.3063 0.3891 0.0364  -0.0015 -0.0149 913  HOH A O   
3764 O  O   . HOH D .   ? 0.5835 0.4943 0.5354 0.0348  -0.0539 0.0428  914  HOH A O   
3765 O  O   . HOH D .   ? 0.2680 0.2631 0.3044 0.0450  -0.0316 0.0105  915  HOH A O   
3766 O  O   . HOH D .   ? 0.6144 0.5170 0.5396 0.1079  -0.0331 0.0430  916  HOH A O   
3767 O  O   . HOH D .   ? 0.6791 0.3508 0.4292 -0.0313 -0.0304 -0.0239 917  HOH A O   
3768 O  O   . HOH D .   ? 0.6881 0.9133 0.8630 -0.0080 -0.0706 0.0568  918  HOH A O   
3769 O  O   . HOH D .   ? 0.6494 0.5380 0.4507 0.0947  0.2016  -0.0657 919  HOH A O   
3770 O  O   . HOH D .   ? 0.5129 0.6430 0.6354 0.0258  -0.0547 0.0327  920  HOH A O   
3771 O  O   . HOH D .   ? 0.4900 0.3640 0.3512 -0.0621 -0.0106 0.0207  921  HOH A O   
3772 O  O   . HOH D .   ? 0.5289 0.6209 0.5421 -0.0868 -0.0500 0.0089  922  HOH A O   
3773 O  O   . HOH D .   ? 0.8269 0.6399 0.6688 0.0724  -0.0496 0.0577  923  HOH A O   
3774 O  O   . HOH D .   ? 0.4571 0.4552 0.4266 -0.0584 -0.0046 0.0150  924  HOH A O   
3775 O  O   . HOH D .   ? 0.4651 0.3534 0.3830 0.0052  0.0194  -0.0516 925  HOH A O   
3776 O  O   . HOH D .   ? 0.6879 0.6068 0.6054 -0.0736 -0.0596 -0.0166 926  HOH A O   
3777 O  O   . HOH D .   ? 0.5396 0.7341 0.6770 -0.0633 -0.0227 0.0338  927  HOH A O   
3778 O  O   . HOH D .   ? 0.5400 0.4801 0.4937 0.1427  0.0370  -0.0082 928  HOH A O   
3779 O  O   . HOH D .   ? 0.2263 0.3150 0.2710 0.0052  0.0092  -0.0023 929  HOH A O   
3780 O  O   . HOH D .   ? 0.6858 0.4854 0.5521 -0.0440 -0.0217 0.0174  930  HOH A O   
3781 O  O   . HOH D .   ? 0.6454 0.7206 0.6897 0.1692  0.0393  0.0262  931  HOH A O   
3782 O  O   . HOH D .   ? 0.3472 0.5091 0.5169 0.0727  -0.0193 0.0376  932  HOH A O   
3783 O  O   . HOH D .   ? 0.3570 0.4232 0.3759 -0.0169 0.0500  -0.0097 933  HOH A O   
3784 O  O   . HOH D .   ? 0.3689 0.3476 0.3537 0.0982  0.0204  -0.0143 934  HOH A O   
3785 O  O   . HOH D .   ? 0.3327 0.5206 0.4422 0.0918  0.0244  0.0268  935  HOH A O   
3786 O  O   . HOH D .   ? 0.3931 0.3031 0.3681 0.0200  -0.0061 -0.0159 936  HOH A O   
3787 O  O   . HOH D .   ? 0.5843 0.4760 0.4910 0.0186  -0.0101 -0.0385 937  HOH A O   
3788 O  O   . HOH D .   ? 0.7355 0.6913 0.6283 -0.0295 0.0071  -0.0209 938  HOH A O   
3789 O  O   . HOH D .   ? 0.8382 0.8411 0.7328 0.0026  0.0444  0.0007  939  HOH A O   
3790 O  O   . HOH D .   ? 0.4535 0.6451 0.5574 -0.0023 -0.0076 0.0230  940  HOH A O   
3791 O  O   . HOH D .   ? 0.4284 0.4613 0.4466 -0.0070 -0.0177 -0.0215 941  HOH A O   
3792 O  O   . HOH D .   ? 0.9406 0.8041 0.8283 0.1003  -0.0448 0.0561  942  HOH A O   
3793 O  O   . HOH D .   ? 0.6077 0.5509 0.5697 0.1362  -0.0175 0.0386  943  HOH A O   
3794 O  O   . HOH D .   ? 0.4838 0.5210 0.5065 -0.0115 -0.0177 -0.0198 944  HOH A O   
3795 O  O   . HOH D .   ? 0.4505 0.6079 0.5018 -0.0419 -0.0641 0.0279  945  HOH A O   
3796 O  O   . HOH D .   ? 0.4271 0.3728 0.3941 0.1404  -0.0069 0.0296  946  HOH A O   
3797 O  O   . HOH D .   ? 0.5028 0.5115 0.3827 -0.0552 -0.0813 0.0256  947  HOH A O   
3798 O  O   . HOH D .   ? 0.5459 0.5152 0.5379 0.0360  -0.0604 0.0381  948  HOH A O   
3799 O  O   . HOH D .   ? 0.4841 0.4810 0.3898 -0.0096 0.0276  0.0057  949  HOH A O   
3800 O  O   . HOH D .   ? 0.4328 0.3895 0.3867 -0.0465 -0.0099 0.0108  950  HOH A O   
3801 O  O   . HOH D .   ? 0.2507 0.2668 0.2790 0.0262  -0.0071 -0.0249 951  HOH A O   
3802 O  O   . HOH D .   ? 0.4192 0.5558 0.4781 0.0840  0.0509  0.0069  952  HOH A O   
3803 O  O   . HOH D .   ? 0.7067 0.4702 0.5910 0.0587  -0.0336 0.0435  953  HOH A O   
3804 O  O   . HOH D .   ? 0.5977 0.5469 0.4756 -0.0360 -0.0060 -0.0228 954  HOH A O   
3805 O  O   . HOH D .   ? 0.7073 0.6384 0.5642 -0.0472 -0.0118 -0.0328 955  HOH A O   
3806 O  O   . HOH D .   ? 0.2755 0.6821 0.5731 0.0332  0.0469  0.0799  956  HOH A O   
3807 O  O   . HOH D .   ? 0.6461 0.4997 0.4736 0.0507  0.1152  -0.0709 957  HOH A O   
3808 O  O   . HOH D .   ? 0.7288 0.8754 0.8004 -0.0305 -0.0048 0.0159  958  HOH A O   
3809 O  O   . HOH D .   ? 0.4189 0.4593 0.4188 -0.0080 0.0485  -0.0186 959  HOH A O   
3810 O  O   . HOH D .   ? 0.7565 0.6204 0.6389 -0.0118 -0.0405 0.0438  960  HOH A O   
3811 O  O   . HOH D .   ? 0.5254 0.4938 0.4929 0.0707  0.0208  -0.0278 961  HOH A O   
3812 O  O   . HOH D .   ? 0.3637 0.6358 0.5110 0.0370  -0.0398 0.0623  962  HOH A O   
3813 O  O   . HOH D .   ? 0.8215 0.8786 0.8382 -0.0281 -0.0913 0.0252  963  HOH A O   
3814 O  O   . HOH D .   ? 0.6192 0.3759 0.4644 -0.0427 -0.0166 -0.0027 964  HOH A O   
3815 O  O   . HOH D .   ? 0.5776 0.4964 0.5151 0.0802  0.0183  -0.0288 965  HOH A O   
3816 O  O   . HOH D .   ? 0.4987 0.3879 0.4117 -0.0605 -0.0256 -0.0045 966  HOH A O   
3817 O  O   . HOH D .   ? 0.6513 0.6521 0.6444 -0.0305 -0.0520 -0.0118 967  HOH A O   
3818 O  O   . HOH D .   ? 0.5874 0.4910 0.4390 0.0003  -0.0120 -0.0288 968  HOH A O   
3819 O  O   . HOH D .   ? 0.5511 0.7710 0.6702 0.0006  -0.0152 0.0322  969  HOH A O   
3820 O  O   . HOH D .   ? 0.6201 0.6496 0.6144 -0.0448 -0.0316 -0.0157 970  HOH A O   
3821 O  O   . HOH D .   ? 0.4306 0.5102 0.4617 0.0061  0.0149  -0.0020 971  HOH A O   
3822 O  O   . HOH D .   ? 0.7336 0.6656 0.6179 -0.0268 -0.0186 0.0102  972  HOH A O   
3823 O  O   . HOH D .   ? 0.7122 0.8343 0.8536 0.2022  0.1223  0.0216  973  HOH A O   
3824 O  O   . HOH D .   ? 0.3957 0.5882 0.5050 0.0417  0.0111  0.0220  974  HOH A O   
3825 O  O   . HOH D .   ? 0.3287 0.3257 0.3252 0.0829  0.0183  -0.0175 975  HOH A O   
3826 O  O   . HOH D .   ? 0.4750 0.6099 0.5282 0.0152  0.1050  -0.0028 976  HOH A O   
3827 O  O   . HOH D .   ? 0.8453 1.0137 0.9979 0.1984  0.1505  0.0217  977  HOH A O   
3828 O  O   . HOH D .   ? 0.4516 0.4425 0.5130 0.0917  -0.0114 0.0169  978  HOH A O   
3829 O  O   . HOH D .   ? 0.4134 0.4218 0.4003 0.0631  0.0262  -0.0235 979  HOH A O   
3830 O  O   . HOH D .   ? 0.4617 0.4072 0.5041 0.1350  0.0293  0.0058  980  HOH A O   
3831 O  O   . HOH D .   ? 0.7372 0.6256 0.7466 0.1554  0.0358  0.0081  981  HOH A O   
3832 O  O   . HOH D .   ? 0.7496 0.8028 0.7418 -0.0810 -0.0026 0.0244  982  HOH A O   
3833 O  O   . HOH D .   ? 0.5736 0.4992 0.5104 0.0159  -0.0586 0.0410  983  HOH A O   
3834 O  O   . HOH D .   ? 0.5706 0.3741 0.4300 0.0164  -0.0145 -0.0280 984  HOH A O   
3835 O  O   . HOH D .   ? 0.6714 0.4811 0.5332 -0.0297 -0.0299 0.0378  985  HOH A O   
3836 O  O   . HOH D .   ? 0.4028 0.3800 0.3652 0.0479  0.0167  -0.0298 986  HOH A O   
3837 O  O   . HOH D .   ? 0.7854 0.6916 0.6192 -0.0298 0.0338  -0.0460 987  HOH A O   
3838 O  O   . HOH D .   ? 0.9242 0.6902 0.7711 0.0119  -0.0472 0.0584  988  HOH A O   
3839 O  O   . HOH D .   ? 0.3914 0.8553 0.7244 0.0577  0.0720  0.0951  989  HOH A O   
3840 O  O   . HOH D .   ? 0.4224 0.5717 0.4933 0.0703  -0.0535 0.0581  990  HOH A O   
3841 O  O   . HOH D .   ? 0.6042 0.3739 0.4329 0.0265  -0.0094 -0.0343 991  HOH A O   
3842 O  O   . HOH D .   ? 0.3782 0.3184 0.3282 -0.0005 0.0111  -0.0455 992  HOH A O   
3843 O  O   . HOH D .   ? 0.6094 0.2853 0.3602 -0.0662 -0.0377 -0.0034 993  HOH A O   
3844 O  O   . HOH D .   ? 0.8108 0.5023 0.6333 0.0208  -0.0290 0.0377  994  HOH A O   
3845 O  O   . HOH D .   ? 0.7546 0.6128 0.5983 0.0371  0.0903  -0.0684 995  HOH A O   
3846 O  O   . HOH D .   ? 0.8802 0.6825 0.6966 -0.1378 -0.0321 0.0262  996  HOH A O   
3847 O  O   . HOH D .   ? 0.5404 0.6245 0.5949 0.1438  0.0199  0.0256  997  HOH A O   
3848 O  O   . HOH D .   ? 0.5680 0.6000 0.6566 0.1002  -0.0323 0.0419  998  HOH A O   
3849 O  O   . HOH D .   ? 0.7952 0.7054 0.6738 -0.0177 -0.0269 0.0194  999  HOH A O   
3850 O  O   . HOH D .   ? 1.0055 0.7008 0.7951 0.0790  -0.0100 0.0008  1000 HOH A O   
3851 O  O   . HOH D .   ? 0.5868 0.5182 0.4548 -0.0305 -0.0250 0.0135  1001 HOH A O   
3852 O  O   . HOH D .   ? 0.6638 0.7500 0.6779 0.0620  0.1394  -0.0209 1002 HOH A O   
3853 O  O   . HOH D .   ? 0.7405 0.5117 0.5589 -0.0835 -0.0381 -0.0026 1003 HOH A O   
3854 O  O   . HOH D .   ? 0.6364 0.3731 0.4984 0.0262  -0.0128 0.0090  1004 HOH A O   
3855 O  O   . HOH D .   ? 0.7111 0.4547 0.5648 -0.0028 -0.0160 0.0075  1005 HOH A O   
3856 O  O   . HOH D .   ? 0.8770 0.5029 0.5950 -0.0445 -0.0345 -0.0031 1006 HOH A O   
3857 O  O   . HOH D .   ? 0.8245 0.5485 0.5087 0.0159  0.1077  -0.0900 1007 HOH A O   
3858 O  O   . HOH D .   ? 0.6642 0.6494 0.6150 -0.0742 -0.0046 0.0232  1008 HOH A O   
3859 O  O   . HOH D .   ? 0.6381 0.5845 0.5307 -0.0085 0.0510  -0.0428 1009 HOH A O   
3860 O  O   . HOH D .   ? 0.7531 0.7335 0.6288 0.0518  0.0712  -0.0205 1010 HOH A O   
3861 O  O   . HOH D .   ? 0.5631 0.3390 0.4346 -0.0107 -0.0075 -0.0147 1011 HOH A O   
3862 O  O   . HOH D .   ? 0.3366 0.3891 0.3571 -0.0142 -0.0264 -0.0136 1012 HOH A O   
3863 O  O   . HOH D .   ? 0.6876 0.6327 0.5553 -0.0374 0.0147  -0.0185 1013 HOH A O   
3864 O  O   . HOH D .   ? 0.7752 0.9326 0.8797 -0.0286 -0.0977 0.0498  1014 HOH A O   
3865 O  O   . HOH D .   ? 0.5009 0.4307 0.3575 0.0260  0.0296  -0.0279 1015 HOH A O   
3866 O  O   . HOH D .   ? 0.5699 0.4757 0.4807 -0.0126 0.0105  -0.0506 1016 HOH A O   
3867 O  O   . HOH D .   ? 0.7544 0.3366 0.4111 -0.0473 -0.0341 -0.0369 1017 HOH A O   
3868 O  O   . HOH D .   ? 0.7184 0.4895 0.6438 0.1529  0.0421  -0.0017 1018 HOH A O   
3869 O  O   . HOH D .   ? 0.9182 0.4909 0.6022 -0.0153 -0.0314 0.0056  1019 HOH A O   
3870 O  O   . HOH D .   ? 0.6029 0.5476 0.4906 -0.0272 -0.0189 0.0051  1020 HOH A O   
3871 O  O   . HOH D .   ? 0.6850 0.8459 0.8656 0.1451  0.0563  0.0310  1021 HOH A O   
3872 O  O   . HOH D .   ? 0.5836 0.6851 0.5500 -0.0197 -0.1028 0.0609  1022 HOH A O   
3873 O  O   . HOH D .   ? 0.7150 0.7427 0.6998 0.1159  0.0601  -0.0134 1023 HOH A O   
3874 O  O   . HOH D .   ? 0.6766 0.4118 0.4288 0.0119  -0.0567 0.0710  1024 HOH A O   
3875 O  O   . HOH D .   ? 0.4964 0.4752 0.5260 0.0858  0.0512  -0.0283 1025 HOH A O   
3876 O  O   . HOH D .   ? 0.6066 0.7576 0.6227 0.0319  -0.1101 0.0946  1026 HOH A O   
3877 O  O   . HOH D .   ? 0.7573 0.7180 0.6895 0.0768  0.0416  -0.0310 1027 HOH A O   
3878 O  O   . HOH D .   ? 0.4054 0.3223 0.3061 -0.0143 -0.0337 0.0300  1028 HOH A O   
3879 O  O   . HOH D .   ? 0.6209 0.8128 0.8043 0.1872  0.1213  0.0320  1029 HOH A O   
3880 O  O   . HOH D .   ? 0.6631 0.7118 0.6151 0.0306  -0.0929 0.0746  1030 HOH A O   
3881 O  O   . HOH D .   ? 0.7256 0.4865 0.5300 0.0479  -0.0449 0.0511  1031 HOH A O   
3882 O  O   . HOH D .   ? 0.7824 0.6369 0.6833 0.1435  0.0256  -0.0073 1032 HOH A O   
3883 O  O   . HOH D .   ? 0.8178 0.8307 0.7588 -0.0266 0.0177  0.0148  1033 HOH A O   
3884 O  O   . HOH D .   ? 0.8474 0.8866 0.8593 -0.0247 -0.0251 -0.0170 1034 HOH A O   
3885 O  O   . HOH D .   ? 0.7976 0.4196 0.4923 -0.1099 -0.0431 0.0242  1035 HOH A O   
3886 O  O   . HOH D .   ? 0.4597 0.7769 0.6480 -0.0671 0.0536  0.0608  1036 HOH A O   
3887 O  O   . HOH D .   ? 0.5786 0.8017 0.6862 0.0496  0.0440  0.0287  1037 HOH A O   
3888 O  O   . HOH D .   ? 0.4172 0.4086 0.4095 0.0236  -0.0710 0.0385  1038 HOH A O   
3889 O  O   . HOH D .   ? 0.6337 0.7814 0.7270 0.1369  0.0043  0.0447  1039 HOH A O   
3890 O  O   . HOH D .   ? 0.7757 0.6354 0.5473 0.0685  0.1815  -0.0710 1040 HOH A O   
3891 O  O   . HOH D .   ? 0.7511 0.6843 0.6065 -0.0400 -0.0840 0.0144  1041 HOH A O   
3892 O  O   . HOH D .   ? 0.5399 0.6172 0.5407 -0.0650 -0.0534 0.0020  1042 HOH A O   
3893 O  O   . HOH D .   ? 0.4658 0.7679 0.6558 -0.0295 0.0649  0.0492  1043 HOH A O   
3894 O  O   . HOH D .   ? 0.6235 0.7973 0.7470 -0.0654 -0.0391 0.0309  1044 HOH A O   
3895 O  O   . HOH D .   ? 0.6205 0.5150 0.5375 0.0400  0.0004  -0.0367 1045 HOH A O   
3896 O  O   . HOH D .   ? 0.5133 0.5710 0.5180 0.0873  0.0510  -0.0114 1046 HOH A O   
3897 O  O   . HOH D .   ? 0.7461 0.4919 0.5410 -0.0802 -0.0458 -0.0187 1047 HOH A O   
3898 O  O   . HOH D .   ? 0.7006 0.5873 0.5182 -0.0083 0.0723  -0.0578 1048 HOH A O   
3899 O  O   . HOH D .   ? 0.5053 0.7454 0.6414 0.0493  0.0080  0.0374  1049 HOH A O   
3900 O  O   . HOH D .   ? 0.4896 0.3867 0.4251 0.1221  -0.0045 0.0152  1050 HOH A O   
3901 O  O   . HOH D .   ? 0.6163 0.4642 0.5647 0.0600  0.0127  -0.0201 1051 HOH A O   
3902 O  O   . HOH D .   ? 0.6069 0.4969 0.4518 -0.0129 -0.0450 0.0390  1052 HOH A O   
3903 O  O   . HOH D .   ? 0.5988 0.5882 0.5313 0.0519  -0.0757 0.0679  1053 HOH A O   
3904 O  O   . HOH D .   ? 0.5220 0.4292 0.3926 0.0322  -0.0660 0.0607  1054 HOH A O   
3905 O  O   . HOH D .   ? 0.6649 0.8447 0.7690 0.1250  0.0364  0.0307  1055 HOH A O   
3906 O  O   . HOH D .   ? 0.4312 0.4471 0.4433 -0.0145 -0.0148 -0.0236 1056 HOH A O   
3907 O  O   . HOH D .   ? 0.6452 0.5693 0.5575 0.0718  -0.0565 0.0576  1057 HOH A O   
3908 O  O   . HOH D .   ? 0.6671 0.6135 0.6441 0.0414  -0.0637 0.0473  1058 HOH A O   
3909 O  O   . HOH D .   ? 0.7325 0.4384 0.5103 0.0366  -0.0047 -0.0372 1059 HOH A O   
3910 O  O   . HOH D .   ? 0.5012 0.7166 0.6586 -0.0332 -0.0766 0.0529  1060 HOH A O   
3911 O  O   . HOH D .   ? 0.8835 0.6799 0.5910 0.0675  0.1876  -0.0813 1061 HOH A O   
3912 O  O   . HOH D .   ? 0.7058 0.8918 0.9048 0.1304  0.0351  0.0399  1062 HOH A O   
3913 O  O   . HOH D .   ? 0.6413 0.5194 0.5620 0.0995  -0.0124 0.0133  1063 HOH A O   
3914 O  O   . HOH D .   ? 0.8648 0.8363 0.8345 0.1496  0.0465  -0.0062 1064 HOH A O   
3915 O  O   . HOH D .   ? 0.5722 0.6953 0.6221 -0.0442 0.0007  0.0174  1065 HOH A O   
3916 O  O   . HOH D .   ? 0.6381 0.7471 0.7142 0.1767  0.1778  -0.0056 1066 HOH A O   
3917 O  O   . HOH D .   ? 1.0271 0.7203 0.8017 0.0768  0.0881  -0.0722 1067 HOH A O   
3918 O  O   . HOH D .   ? 0.9904 0.7586 0.8329 0.0881  -0.0140 0.0112  1068 HOH A O   
3919 O  O   . HOH D .   ? 0.8115 0.6570 0.6971 -0.0751 -0.0207 0.0058  1069 HOH A O   
3920 O  O   . HOH D .   ? 0.9621 0.7076 0.6859 0.1584  0.2247  -0.0791 1070 HOH A O   
3921 O  O   . HOH D .   ? 0.9450 0.8602 0.7848 0.0544  0.0548  -0.0358 1071 HOH A O   
3922 O  O   . HOH D .   ? 0.5103 0.5909 0.5325 -0.0021 0.0185  0.0028  1072 HOH A O   
3923 O  O   . HOH D .   ? 0.4113 0.5525 0.5006 0.1144  0.0033  0.0335  1073 HOH A O   
3924 O  O   . HOH D .   ? 0.7821 0.7245 0.6938 0.0624  -0.0662 0.0647  1074 HOH A O   
3925 O  O   . HOH D .   ? 0.5878 0.6170 0.4650 -0.0728 -0.0989 0.0327  1075 HOH A O   
3926 O  O   . HOH D .   ? 0.8624 0.5454 0.6110 -0.0635 -0.0411 -0.0249 1076 HOH A O   
3927 O  O   . HOH D .   ? 0.4932 0.5022 0.5185 -0.0026 -0.0148 -0.0215 1077 HOH A O   
3928 O  O   . HOH D .   ? 0.7547 0.7358 0.6483 0.0635  0.0682  -0.0239 1078 HOH A O   
3929 O  O   . HOH D .   ? 0.6810 0.5813 0.5669 -0.0267 -0.0170 0.0137  1079 HOH A O   
3930 O  O   . HOH D .   ? 0.8018 0.7241 0.7044 -0.0920 -0.0107 0.0331  1080 HOH A O   
3931 O  O   . HOH D .   ? 0.5507 0.4927 0.4719 0.0458  0.0191  -0.0348 1081 HOH A O   
3932 O  O   . HOH D .   ? 0.8881 0.8039 0.8012 -0.0254 -0.0416 -0.0291 1082 HOH A O   
3933 O  O   . HOH D .   ? 0.7849 0.7710 0.6928 0.0804  0.0727  -0.0249 1083 HOH A O   
3934 O  O   . HOH D .   ? 0.6217 0.6527 0.6501 -0.0436 -0.0205 -0.0056 1084 HOH A O   
3935 O  O   . HOH D .   ? 0.8281 0.7059 0.6905 -0.0404 -0.0162 0.0201  1085 HOH A O   
3936 O  O   . HOH D .   ? 0.5503 0.6222 0.5579 -0.0073 0.0214  0.0054  1086 HOH A O   
3937 O  O   . HOH D .   ? 0.5268 0.9537 0.8513 0.0536  0.0204  0.0962  1087 HOH A O   
3938 O  O   . HOH D .   ? 0.5500 0.3512 0.4128 0.1071  0.0138  -0.0179 1088 HOH A O   
3939 O  O   . HOH D .   ? 0.7258 0.7553 0.6674 0.0691  0.1679  -0.0353 1089 HOH A O   
3940 O  O   . HOH D .   ? 0.6204 0.6108 0.6020 0.1231  0.0403  -0.0119 1090 HOH A O   
3941 O  O   . HOH D .   ? 0.6488 0.4967 0.5487 -0.0350 -0.0092 -0.0307 1091 HOH A O   
3942 O  O   . HOH D .   ? 0.6360 0.7905 0.6954 0.0521  -0.0699 0.0652  1092 HOH A O   
3943 O  O   . HOH D .   ? 0.7132 0.9442 0.8617 -0.0974 -0.0302 0.0503  1093 HOH A O   
3944 O  O   . HOH D .   ? 0.9741 0.8282 0.7473 -0.0264 0.0588  -0.0612 1094 HOH A O   
3945 O  O   . HOH D .   ? 0.5338 0.6616 0.6080 0.1402  -0.0295 0.0688  1095 HOH A O   
3946 O  O   . HOH D .   ? 0.4839 0.4975 0.4417 -0.0393 0.0097  0.0178  1096 HOH A O   
3947 O  O   . HOH D .   ? 0.4380 0.8818 0.7669 0.0271  -0.0064 0.1068  1097 HOH A O   
3948 O  O   . HOH D .   ? 0.5758 0.7545 0.7150 -0.0108 -0.0726 0.0446  1098 HOH A O   
3949 O  O   . HOH D .   ? 0.5242 0.8421 0.7909 0.1182  0.0681  0.0604  1099 HOH A O   
3950 O  O   . HOH D .   ? 0.6172 0.5112 0.4847 0.0206  0.0015  -0.0393 1100 HOH A O   
3951 O  O   . HOH D .   ? 0.8433 0.5672 0.7075 0.0787  -0.0381 0.0575  1101 HOH A O   
3952 O  O   . HOH D .   ? 0.6304 0.7003 0.6172 0.0609  -0.0852 0.0795  1102 HOH A O   
3953 O  O   . HOH D .   ? 0.7254 0.7635 0.7266 -0.0187 -0.0881 0.0249  1103 HOH A O   
3954 O  O   . HOH D .   ? 0.4991 0.8925 0.8118 0.0835  0.0306  0.0875  1104 HOH A O   
3955 O  O   . HOH D .   ? 0.6695 0.6926 0.6430 0.1881  0.2228  -0.0288 1105 HOH A O   
3956 O  O   . HOH D .   ? 0.7595 0.7307 0.6003 -0.0639 -0.0693 0.0153  1106 HOH A O   
3957 O  O   . HOH D .   ? 0.6637 0.5887 0.5051 -0.0374 -0.0824 0.0220  1107 HOH A O   
3958 O  O   . HOH D .   ? 0.8636 0.8166 0.7456 -0.0783 -0.1068 0.0057  1108 HOH A O   
3959 O  O   . HOH D .   ? 0.7891 0.6074 0.6552 -0.0621 -0.0218 0.0229  1109 HOH A O   
3960 O  O   . HOH D .   ? 0.6861 0.7382 0.7454 0.0403  -0.0694 0.0420  1110 HOH A O   
3961 O  O   . HOH D .   ? 0.5915 0.6736 0.6672 -0.0222 -0.0271 -0.0011 1111 HOH A O   
3962 O  O   . HOH D .   ? 0.6908 0.5950 0.5081 0.0214  0.0316  -0.0299 1112 HOH A O   
3963 O  O   . HOH D .   ? 0.5286 0.4055 0.4425 -0.0005 0.0134  -0.0495 1113 HOH A O   
3964 O  O   . HOH D .   ? 0.7116 0.4328 0.5862 0.0933  -0.0234 0.0435  1114 HOH A O   
3965 O  O   . HOH D .   ? 0.6191 0.6395 0.6496 -0.0155 -0.0162 -0.0161 1115 HOH A O   
3966 O  O   . HOH D .   ? 0.6140 0.6883 0.6093 0.0050  0.0339  0.0042  1116 HOH A O   
3967 O  O   . HOH D .   ? 0.4238 0.4559 0.4221 -0.0208 -0.0277 -0.0176 1117 HOH A O   
3968 O  O   . HOH D .   ? 0.7339 0.6205 0.6024 -0.0096 -0.0321 0.0262  1118 HOH A O   
3969 O  O   . HOH D .   ? 0.6509 0.7004 0.5981 0.0022  0.0460  0.0062  1119 HOH A O   
3970 O  O   . HOH D .   ? 0.4946 0.4864 0.4822 -0.0771 -0.0355 -0.0006 1120 HOH A O   
3971 O  O   . HOH D .   ? 0.8094 0.7921 0.7240 -0.0630 -0.0434 -0.0212 1121 HOH A O   
3972 O  O   . HOH D .   ? 0.8237 0.7202 0.7477 0.0220  -0.0593 0.0496  1122 HOH A O   
3973 O  O   . HOH D .   ? 0.6149 0.7866 0.6858 -0.0644 -0.0434 0.0259  1123 HOH A O   
3974 O  O   . HOH D .   ? 0.4654 0.6210 0.5599 0.1311  0.0262  0.0313  1124 HOH A O   
3975 O  O   . HOH D .   ? 0.6565 0.5710 0.5038 -0.0146 0.0569  -0.0490 1125 HOH A O   
3976 O  O   . HOH D .   ? 0.6875 0.6969 0.5963 -0.0219 0.0317  0.0148  1126 HOH A O   
3977 O  O   . HOH D .   ? 0.7621 0.5891 0.6498 -0.0107 0.0053  -0.0435 1127 HOH A O   
3978 O  O   . HOH D .   ? 0.7329 0.5454 0.5382 -0.0655 -0.0206 0.0357  1128 HOH A O   
3979 O  O   . HOH D .   ? 0.5415 0.4540 0.3944 0.0229  0.0181  -0.0325 1129 HOH A O   
3980 O  O   . HOH D .   ? 0.4825 0.9322 0.8148 0.0462  0.0339  0.0988  1130 HOH A O   
3981 O  O   . HOH D .   ? 0.5702 0.3798 0.4184 -0.0678 -0.0414 -0.0183 1131 HOH A O   
3982 O  O   . HOH D .   ? 0.6135 0.5430 0.5971 0.0665  -0.0637 0.0589  1132 HOH A O   
3983 O  O   . HOH D .   ? 0.7876 0.6295 0.6210 0.1771  0.2117  -0.0599 1133 HOH A O   
3984 O  O   . HOH D .   ? 0.7510 0.6491 0.6809 0.1723  0.0354  0.0045  1134 HOH A O   
3985 O  O   . HOH D .   ? 0.4248 0.8346 0.7126 -0.0007 0.0403  0.0812  1135 HOH A O   
3986 O  O   . HOH D .   ? 0.7062 0.4869 0.5570 -0.0389 -0.0258 0.0288  1136 HOH A O   
3987 O  O   . HOH D .   ? 0.8410 0.6300 0.7360 0.0299  0.0071  -0.0239 1137 HOH A O   
3988 O  O   . HOH D .   ? 0.6338 0.6695 0.6669 0.0226  -0.0703 0.0326  1138 HOH A O   
3989 O  O   . HOH D .   ? 0.7489 0.5914 0.5767 -0.0318 -0.0284 0.0336  1139 HOH A O   
3990 O  O   . HOH D .   ? 0.7719 0.6323 0.6095 -0.0166 -0.0363 0.0362  1140 HOH A O   
3991 O  O   . HOH D .   ? 0.6670 0.6504 0.5940 -0.0040 0.0631  -0.0344 1141 HOH A O   
3992 O  O   . HOH D .   ? 0.7189 0.6575 0.5699 -0.0446 -0.0101 -0.0169 1142 HOH A O   
3993 O  O   . HOH D .   ? 0.7097 0.6269 0.5576 -0.0324 -0.0329 0.0233  1143 HOH A O   
3994 O  O   . HOH D .   ? 0.5991 0.6351 0.5980 -0.0468 -0.0839 0.0104  1144 HOH A O   
3995 O  O   . HOH D .   ? 0.7104 0.9558 0.8507 0.0751  0.0186  0.0406  1145 HOH A O   
3996 O  O   . HOH D .   ? 0.7619 0.5650 0.6170 0.0495  0.0002  -0.0343 1146 HOH A O   
3997 O  O   . HOH D .   ? 0.7708 0.6259 0.6667 0.1245  0.0278  -0.0194 1147 HOH A O   
3998 O  O   . HOH D .   ? 0.6579 0.8708 0.7706 -0.1523 -0.0340 0.0603  1148 HOH A O   
3999 O  O   . HOH D .   ? 0.6123 0.6232 0.6300 -0.0320 -0.0226 -0.0122 1149 HOH A O   
4000 O  O   . HOH D .   ? 0.9764 0.6513 0.7388 0.0764  0.0071  -0.0305 1150 HOH A O   
4001 O  O   . HOH D .   ? 0.6198 0.4599 0.5544 0.0388  0.0067  -0.0222 1151 HOH A O   
4002 O  O   . HOH D .   ? 0.8114 0.7155 0.6920 -0.0949 -0.0102 0.0413  1152 HOH A O   
4003 O  O   . HOH D .   ? 0.8731 0.8315 0.8173 0.0650  0.0270  -0.0318 1153 HOH A O   
4004 O  O   . HOH D .   ? 0.6782 0.5854 0.5355 -0.0226 -0.0341 0.0268  1154 HOH A O   
4005 O  O   . HOH D .   ? 0.2963 0.7472 0.6215 0.0345  0.0459  0.0949  1155 HOH A O   
4006 O  O   . HOH D .   ? 0.5896 0.5958 0.5824 -0.0676 -0.0082 0.0036  1156 HOH A O   
4007 O  O   . HOH D .   ? 0.5437 0.7580 0.6731 0.1295  0.0192  0.0489  1157 HOH A O   
4008 O  O   . HOH D .   ? 0.5262 0.8006 0.6867 -0.0294 0.0786  0.0415  1158 HOH A O   
4009 O  O   . HOH D .   ? 0.5955 0.5969 0.5966 0.1859  0.0310  0.0287  1159 HOH A O   
4010 O  O   . HOH D .   ? 0.5846 0.6165 0.5548 -0.0539 0.0099  0.0224  1160 HOH A O   
4011 O  O   . HOH D .   ? 0.8044 0.7982 0.8806 0.1479  0.0412  0.0094  1161 HOH A O   
4012 O  O   . HOH D .   ? 0.6309 0.5668 0.5805 0.1047  0.0273  -0.0211 1162 HOH A O   
4013 O  O   . HOH D .   ? 0.6815 0.9354 0.7977 0.0567  0.0588  0.0369  1163 HOH A O   
4014 O  O   . HOH D .   ? 0.8521 0.7099 0.7360 -0.0832 -0.0344 -0.0023 1164 HOH A O   
4015 O  O   . HOH D .   ? 0.8975 0.6089 0.6993 0.1032  0.0976  -0.0653 1165 HOH A O   
4016 O  O   . HOH D .   ? 0.7566 0.8492 0.8284 0.0117  -0.0829 0.0415  1166 HOH A O   
4017 O  O   . HOH D .   ? 0.6930 0.5818 0.6118 -0.0472 -0.0151 -0.0290 1167 HOH A O   
4018 O  O   . HOH D .   ? 0.6802 0.9681 0.8384 -0.0779 0.0591  0.0565  1168 HOH A O   
4019 O  O   . HOH D .   ? 0.7459 0.6366 0.6279 -0.0047 -0.0249 -0.0368 1169 HOH A O   
4020 O  O   . HOH D .   ? 0.9592 0.9784 0.8592 0.0508  0.0803  -0.0115 1170 HOH A O   
4021 O  O   . HOH D .   ? 0.6233 0.8339 0.7421 0.0632  0.1379  0.0111  1171 HOH A O   
4022 O  O   . HOH D .   ? 0.5505 0.6225 0.5979 0.1778  -0.0041 0.0599  1172 HOH A O   
4023 O  O   . HOH D .   ? 0.8715 0.7686 0.7295 0.0249  0.0103  -0.0383 1173 HOH A O   
4024 O  O   . HOH D .   ? 0.8048 0.6976 0.6376 0.0381  0.0327  -0.0390 1174 HOH A O   
4025 O  O   . HOH D .   ? 0.7980 0.6793 0.7083 0.1113  0.0285  -0.0245 1175 HOH A O   
4026 O  O   . HOH D .   ? 0.7262 0.5036 0.5083 -0.0468 -0.0310 0.0433  1176 HOH A O   
4027 O  O   . HOH D .   ? 0.4020 0.7361 0.6819 0.0813  0.0126  0.0743  1177 HOH A O   
4028 O  O   . HOH D .   ? 0.8405 0.9864 0.8963 0.0632  0.1495  -0.0062 1178 HOH A O   
4029 O  O   . HOH D .   ? 0.5889 0.4677 0.4842 0.0003  -0.0487 0.0454  1179 HOH A O   
4030 O  O   . HOH D .   ? 0.7882 0.7612 0.7454 -0.0405 -0.0600 -0.0136 1180 HOH A O   
4031 O  O   . HOH D .   ? 0.6121 0.4215 0.4741 0.0758  0.0098  -0.0307 1181 HOH A O   
4032 O  O   . HOH D .   ? 0.5901 0.7080 0.6596 0.1853  0.1982  -0.0053 1182 HOH A O   
4033 O  O   . HOH D .   ? 0.8911 0.6047 0.6397 -0.0910 -0.0310 0.0383  1183 HOH A O   
4034 O  O   . HOH D .   ? 0.8047 0.7768 0.6764 -0.0556 0.0190  0.0357  1184 HOH A O   
4035 O  O   . HOH D .   ? 0.8093 0.7389 0.6492 -0.0439 0.0095  -0.0223 1185 HOH A O   
4036 O  O   . HOH D .   ? 0.5439 0.7208 0.6310 0.0551  -0.0530 0.0552  1186 HOH A O   
4037 O  O   . HOH D .   ? 0.6740 0.6576 0.5484 -0.0293 0.0283  0.0191  1187 HOH A O   
4038 O  O   . HOH D .   ? 0.9014 0.6722 0.7704 -0.0006 0.0001  -0.0254 1188 HOH A O   
4039 O  O   . HOH D .   ? 0.6401 0.5989 0.5299 -0.0392 0.0223  -0.0099 1189 HOH A O   
4040 O  O   . HOH D .   ? 0.7726 0.8182 0.7134 0.0864  0.1956  -0.0328 1190 HOH A O   
4041 O  O   . HOH D .   ? 0.6502 0.7948 0.6899 -0.0985 -0.0551 0.0247  1191 HOH A O   
4042 O  O   . HOH D .   ? 0.8656 0.7492 0.7690 -0.0683 -0.0231 0.0016  1192 HOH A O   
4043 O  O   . HOH D .   ? 0.7524 0.5669 0.5676 -0.0872 -0.0177 0.0315  1193 HOH A O   
4044 O  O   . HOH D .   ? 0.7735 0.9256 0.8461 -0.1476 -0.0327 0.0474  1194 HOH A O   
4045 O  O   . HOH D .   ? 0.8953 0.4851 0.5998 0.0317  -0.0185 -0.0065 1195 HOH A O   
4046 O  O   . HOH D .   ? 1.1069 0.7200 0.8332 0.0669  -0.0090 -0.0073 1196 HOH A O   
4047 O  O   . HOH D .   ? 0.7520 0.6337 0.6786 0.0412  -0.0674 0.0630  1197 HOH A O   
4048 O  O   . HOH D .   ? 0.8031 0.7165 0.6144 -0.0627 -0.0183 -0.0278 1198 HOH A O   
4049 O  O   . HOH D .   ? 0.8195 0.5931 0.6811 0.0007  0.0089  -0.0399 1199 HOH A O   
4050 O  O   . HOH D .   ? 0.6033 0.5729 0.5254 0.0057  0.0664  -0.0413 1200 HOH A O   
4051 O  O   . HOH D .   ? 0.8914 0.5434 0.5428 0.1217  0.1932  -0.0911 1201 HOH A O   
4052 O  O   . HOH D .   ? 0.8380 0.5410 0.5985 0.0639  0.0928  -0.0787 1202 HOH A O   
4053 O  O   . HOH D .   ? 0.9539 0.6652 0.7843 0.0030  0.0017  -0.0230 1203 HOH A O   
4054 O  O   . HOH D .   ? 0.7395 0.8256 0.6852 -0.0871 -0.0961 0.0257  1204 HOH A O   
4055 O  O   . HOH D .   ? 0.7996 0.7346 0.7335 0.0497  0.0129  -0.0356 1205 HOH A O   
4056 O  O   . HOH D .   ? 0.9670 0.6927 0.7688 0.0945  0.0139  -0.0280 1206 HOH A O   
4057 O  O   . HOH D .   ? 0.8187 0.7082 0.6970 -0.0230 -0.0392 -0.0334 1207 HOH A O   
4058 O  O   . HOH D .   ? 0.8139 0.7326 0.6289 -0.0578 -0.0138 -0.0225 1208 HOH A O   
4059 O  O   . HOH D .   ? 0.6854 0.7751 0.7178 -0.1436 -0.0411 0.0350  1209 HOH A O   
4060 O  O   . HOH D .   ? 0.6195 1.0419 0.9508 0.0763  0.0094  0.1029  1210 HOH A O   
4061 O  O   . HOH D .   ? 0.8900 0.6496 0.7533 0.0164  0.0109  -0.0342 1211 HOH A O   
4062 O  O   . HOH D .   ? 0.9264 0.6239 0.6218 0.1479  0.2086  -0.0837 1212 HOH A O   
4063 O  O   . HOH D .   ? 1.0172 0.9253 0.9345 0.0480  0.0090  -0.0379 1213 HOH A O   
4064 O  O   . HOH D .   ? 0.8828 0.6349 0.6992 0.0853  0.0146  -0.0335 1214 HOH A O   
4065 O  O   . HOH D .   ? 0.7225 0.7754 0.7258 0.2178  0.2371  -0.0175 1215 HOH A O   
4066 O  O   . HOH D .   ? 0.9051 0.9287 0.8999 0.2373  0.2360  -0.0168 1216 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   77  ?   ?   ?   A . n 
A 1 2   SER 2   78  ?   ?   ?   A . n 
A 1 3   PHE 3   79  ?   ?   ?   A . n 
A 1 4   PRO 4   80  ?   ?   ?   A . n 
A 1 5   SER 5   81  ?   ?   ?   A . n 
A 1 6   THR 6   82  ?   ?   ?   A . n 
A 1 7   VAL 7   83  ?   ?   ?   A . n 
A 1 8   LYS 8   84  ?   ?   ?   A . n 
A 1 9   ASN 9   85  ?   ?   ?   A . n 
A 1 10  GLY 10  86  ?   ?   ?   A . n 
A 1 11  LEU 11  87  ?   ?   ?   A . n 
A 1 12  SER 12  88  ?   ?   ?   A . n 
A 1 13  LYS 13  89  ?   ?   ?   A . n 
A 1 14  ILE 14  90  ?   ?   ?   A . n 
A 1 15  GLY 15  91  ?   ?   ?   A . n 
A 1 16  ILE 16  92  ?   ?   ?   A . n 
A 1 17  PRO 17  93  ?   ?   ?   A . n 
A 1 18  SER 18  94  ?   ?   ?   A . n 
A 1 19  ASN 19  95  ?   ?   ?   A . n 
A 1 20  VAL 20  96  ?   ?   ?   A . n 
A 1 21  LEU 21  97  ?   ?   ?   A . n 
A 1 22  ASP 22  98  ?   ?   ?   A . n 
A 1 23  PHE 23  99  ?   ?   ?   A . n 
A 1 24  MET 24  100 ?   ?   ?   A . n 
A 1 25  PHE 25  101 ?   ?   ?   A . n 
A 1 26  ASP 26  102 ?   ?   ?   A . n 
A 1 27  TRP 27  103 ?   ?   ?   A . n 
A 1 28  THR 28  104 ?   ?   ?   A . n 
A 1 29  GLY 29  105 ?   ?   ?   A . n 
A 1 30  SER 30  106 ?   ?   ?   A . n 
A 1 31  ASP 31  107 ?   ?   ?   A . n 
A 1 32  GLN 32  108 ?   ?   ?   A . n 
A 1 33  ASP 33  109 ?   ?   ?   A . n 
A 1 34  TYR 34  110 ?   ?   ?   A . n 
A 1 35  PRO 35  111 ?   ?   ?   A . n 
A 1 36  LYS 36  112 ?   ?   ?   A . n 
A 1 37  VAL 37  113 ?   ?   ?   A . n 
A 1 38  PRO 38  114 ?   ?   ?   A . n 
A 1 39  GLU 39  115 ?   ?   ?   A . n 
A 1 40  ALA 40  116 ?   ?   ?   A . n 
A 1 41  LYS 41  117 ?   ?   ?   A . n 
A 1 42  GLY 42  118 ?   ?   ?   A . n 
A 1 43  SER 43  119 ?   ?   ?   A . n 
A 1 44  ILE 44  120 ?   ?   ?   A . n 
A 1 45  GLN 45  121 ?   ?   ?   A . n 
A 1 46  ALA 46  122 ?   ?   ?   A . n 
A 1 47  VAL 47  123 ?   ?   ?   A . n 
A 1 48  ARG 48  124 ?   ?   ?   A . n 
A 1 49  ASN 49  125 ?   ?   ?   A . n 
A 1 50  GLU 50  126 ?   ?   ?   A . n 
A 1 51  ALA 51  127 127 ALA ALA A . n 
A 1 52  PHE 52  128 128 PHE PHE A . n 
A 1 53  PHE 53  129 129 PHE PHE A . n 
A 1 54  ILE 54  130 130 ILE ILE A . n 
A 1 55  PRO 55  131 131 PRO PRO A . n 
A 1 56  LEU 56  132 132 LEU LEU A . n 
A 1 57  TYR 57  133 133 TYR TYR A . n 
A 1 58  GLU 58  134 134 GLU GLU A . n 
A 1 59  LEU 59  135 135 LEU LEU A . n 
A 1 60  PHE 60  136 136 PHE PHE A . n 
A 1 61  LEU 61  137 137 LEU LEU A . n 
A 1 62  THR 62  138 138 THR THR A . n 
A 1 63  TYR 63  139 139 TYR TYR A . n 
A 1 64  GLY 64  140 140 GLY GLY A . n 
A 1 65  GLY 65  141 141 GLY GLY A . n 
A 1 66  ILE 66  142 142 ILE ILE A . n 
A 1 67  PHE 67  143 143 PHE PHE A . n 
A 1 68  ARG 68  144 144 ARG ARG A . n 
A 1 69  LEU 69  145 145 LEU LEU A . n 
A 1 70  THR 70  146 146 THR THR A . n 
A 1 71  PHE 71  147 147 PHE PHE A . n 
A 1 72  GLY 72  148 148 GLY GLY A . n 
A 1 73  PRO 73  149 149 PRO PRO A . n 
A 1 74  LYS 74  150 150 LYS LYS A . n 
A 1 75  SER 75  151 151 SER SER A . n 
A 1 76  PHE 76  152 152 PHE PHE A . n 
A 1 77  LEU 77  153 153 LEU LEU A . n 
A 1 78  ILE 78  154 154 ILE ILE A . n 
A 1 79  VAL 79  155 155 VAL VAL A . n 
A 1 80  SER 80  156 156 SER SER A . n 
A 1 81  ASP 81  157 157 ASP ASP A . n 
A 1 82  PRO 82  158 158 PRO PRO A . n 
A 1 83  SER 83  159 159 SER SER A . n 
A 1 84  ILE 84  160 160 ILE ILE A . n 
A 1 85  ALA 85  161 161 ALA ALA A . n 
A 1 86  LYS 86  162 162 LYS LYS A . n 
A 1 87  HIS 87  163 163 HIS HIS A . n 
A 1 88  ILE 88  164 164 ILE ILE A . n 
A 1 89  LEU 89  165 165 LEU LEU A . n 
A 1 90  LYS 90  166 166 LYS LYS A . n 
A 1 91  ASP 91  167 167 ASP ASP A . n 
A 1 92  ASN 92  168 168 ASN ASN A . n 
A 1 93  ALA 93  169 169 ALA ALA A . n 
A 1 94  LYS 94  170 170 LYS LYS A . n 
A 1 95  ALA 95  171 171 ALA ALA A . n 
A 1 96  TYR 96  172 172 TYR TYR A . n 
A 1 97  SER 97  173 173 SER SER A . n 
A 1 98  LYS 98  174 174 LYS LYS A . n 
A 1 99  GLY 99  175 175 GLY GLY A . n 
A 1 100 ILE 100 176 176 ILE ILE A . n 
A 1 101 LEU 101 177 177 LEU LEU A . n 
A 1 102 ALA 102 178 178 ALA ALA A . n 
A 1 103 GLU 103 179 179 GLU GLU A . n 
A 1 104 ILE 104 180 180 ILE ILE A . n 
A 1 105 LEU 105 181 181 LEU LEU A . n 
A 1 106 ASP 106 182 182 ASP ASP A . n 
A 1 107 PHE 107 183 183 PHE PHE A . n 
A 1 108 VAL 108 184 184 VAL VAL A . n 
A 1 109 MET 109 185 185 MET MET A . n 
A 1 110 GLY 110 186 186 GLY GLY A . n 
A 1 111 LYS 111 187 187 LYS LYS A . n 
A 1 112 GLY 112 188 188 GLY GLY A . n 
A 1 113 LEU 113 189 189 LEU LEU A . n 
A 1 114 ILE 114 190 190 ILE ILE A . n 
A 1 115 PRO 115 191 191 PRO PRO A . n 
A 1 116 ALA 116 192 192 ALA ALA A . n 
A 1 117 ASP 117 193 193 ASP ASP A . n 
A 1 118 GLY 118 194 194 GLY GLY A . n 
A 1 119 GLU 119 195 195 GLU GLU A . n 
A 1 120 ILE 120 196 196 ILE ILE A . n 
A 1 121 TRP 121 197 197 TRP TRP A . n 
A 1 122 ARG 122 198 198 ARG ARG A . n 
A 1 123 ARG 123 199 199 ARG ARG A . n 
A 1 124 ARG 124 200 200 ARG ARG A . n 
A 1 125 ARG 125 201 201 ARG ARG A . n 
A 1 126 ARG 126 202 202 ARG ARG A . n 
A 1 127 ALA 127 203 203 ALA ALA A . n 
A 1 128 ILE 128 204 204 ILE ILE A . n 
A 1 129 VAL 129 205 205 VAL VAL A . n 
A 1 130 PRO 130 206 206 PRO PRO A . n 
A 1 131 ALA 131 207 207 ALA ALA A . n 
A 1 132 LEU 132 208 208 LEU LEU A . n 
A 1 133 HIS 133 209 209 HIS HIS A . n 
A 1 134 GLN 134 210 210 GLN GLN A . n 
A 1 135 LYS 135 211 211 LYS LYS A . n 
A 1 136 TYR 136 212 212 TYR TYR A . n 
A 1 137 VAL 137 213 213 VAL VAL A . n 
A 1 138 ALA 138 214 214 ALA ALA A . n 
A 1 139 ALA 139 215 215 ALA ALA A . n 
A 1 140 MET 140 216 216 MET MET A . n 
A 1 141 ILE 141 217 217 ILE ILE A . n 
A 1 142 SER 142 218 218 SER SER A . n 
A 1 143 LEU 143 219 219 LEU LEU A . n 
A 1 144 PHE 144 220 220 PHE PHE A . n 
A 1 145 GLY 145 221 221 GLY GLY A . n 
A 1 146 GLU 146 222 222 GLU GLU A . n 
A 1 147 ALA 147 223 223 ALA ALA A . n 
A 1 148 SER 148 224 224 SER SER A . n 
A 1 149 ASP 149 225 225 ASP ASP A . n 
A 1 150 ARG 150 226 226 ARG ARG A . n 
A 1 151 LEU 151 227 227 LEU LEU A . n 
A 1 152 CYS 152 228 228 CYS CYS A . n 
A 1 153 GLN 153 229 229 GLN GLN A . n 
A 1 154 LYS 154 230 230 LYS LYS A . n 
A 1 155 LEU 155 231 231 LEU LEU A . n 
A 1 156 ASP 156 232 232 ASP ASP A . n 
A 1 157 ALA 157 233 233 ALA ALA A . n 
A 1 158 ALA 158 234 234 ALA ALA A . n 
A 1 159 ALA 159 235 235 ALA ALA A . n 
A 1 160 LEU 160 236 236 LEU LEU A . n 
A 1 161 LYS 161 237 237 LYS LYS A . n 
A 1 162 GLY 162 238 238 GLY GLY A . n 
A 1 163 GLU 163 239 239 GLU GLU A . n 
A 1 164 GLU 164 240 240 GLU GLU A . n 
A 1 165 VAL 165 241 241 VAL VAL A . n 
A 1 166 GLU 166 242 242 GLU GLU A . n 
A 1 167 MET 167 243 243 MET MET A . n 
A 1 168 GLU 168 244 244 GLU GLU A . n 
A 1 169 SER 169 245 245 SER SER A . n 
A 1 170 LEU 170 246 246 LEU LEU A . n 
A 1 171 PHE 171 247 247 PHE PHE A . n 
A 1 172 SER 172 248 248 SER SER A . n 
A 1 173 ARG 173 249 249 ARG ARG A . n 
A 1 174 LEU 174 250 250 LEU LEU A . n 
A 1 175 THR 175 251 251 THR THR A . n 
A 1 176 LEU 176 252 252 LEU LEU A . n 
A 1 177 ASP 177 253 253 ASP ASP A . n 
A 1 178 ILE 178 254 254 ILE ILE A . n 
A 1 179 ILE 179 255 255 ILE ILE A . n 
A 1 180 GLY 180 256 256 GLY GLY A . n 
A 1 181 LYS 181 257 257 LYS LYS A . n 
A 1 182 ALA 182 258 258 ALA ALA A . n 
A 1 183 VAL 183 259 259 VAL VAL A . n 
A 1 184 PHE 184 260 260 PHE PHE A . n 
A 1 185 ASN 185 261 261 ASN ASN A . n 
A 1 186 TYR 186 262 262 TYR TYR A . n 
A 1 187 ASP 187 263 263 ASP ASP A . n 
A 1 188 PHE 188 264 264 PHE PHE A . n 
A 1 189 ASP 189 265 265 ASP ASP A . n 
A 1 190 SER 190 266 266 SER SER A . n 
A 1 191 LEU 191 267 267 LEU LEU A . n 
A 1 192 THR 192 268 268 THR THR A . n 
A 1 193 ASN 193 269 269 ASN ASN A . n 
A 1 194 ASP 194 270 270 ASP ASP A . n 
A 1 195 THR 195 271 271 THR THR A . n 
A 1 196 GLY 196 272 272 GLY GLY A . n 
A 1 197 VAL 197 273 273 VAL VAL A . n 
A 1 198 ILE 198 274 274 ILE ILE A . n 
A 1 199 GLU 199 275 275 GLU GLU A . n 
A 1 200 ALA 200 276 276 ALA ALA A . n 
A 1 201 VAL 201 277 277 VAL VAL A . n 
A 1 202 TYR 202 278 278 TYR TYR A . n 
A 1 203 THR 203 279 279 THR THR A . n 
A 1 204 VAL 204 280 280 VAL VAL A . n 
A 1 205 LEU 205 281 281 LEU LEU A . n 
A 1 206 ARG 206 282 282 ARG ARG A . n 
A 1 207 GLU 207 283 283 GLU GLU A . n 
A 1 208 ALA 208 284 284 ALA ALA A . n 
A 1 209 GLU 209 285 285 GLU GLU A . n 
A 1 210 ASP 210 286 286 ASP ASP A . n 
A 1 211 ARG 211 287 287 ARG ARG A . n 
A 1 212 SER 212 288 288 SER SER A . n 
A 1 213 VAL 213 289 289 VAL VAL A . n 
A 1 214 SER 214 290 290 SER SER A . n 
A 1 215 PRO 215 291 291 PRO PRO A . n 
A 1 216 ILE 216 292 292 ILE ILE A . n 
A 1 217 PRO 217 293 293 PRO PRO A . n 
A 1 218 VAL 218 294 294 VAL VAL A . n 
A 1 219 TRP 219 295 295 TRP TRP A . n 
A 1 220 ASP 220 296 ?   ?   ?   A . n 
A 1 221 ILE 221 297 ?   ?   ?   A . n 
A 1 222 PRO 222 298 ?   ?   ?   A . n 
A 1 223 ILE 223 299 ?   ?   ?   A . n 
A 1 224 TRP 224 300 ?   ?   ?   A . n 
A 1 225 LYS 225 301 ?   ?   ?   A . n 
A 1 226 ASP 226 302 ?   ?   ?   A . n 
A 1 227 ILE 227 303 ?   ?   ?   A . n 
A 1 228 SER 228 304 304 SER SER A . n 
A 1 229 PRO 229 305 305 PRO PRO A . n 
A 1 230 ARG 230 306 306 ARG ARG A . n 
A 1 231 GLN 231 307 307 GLN GLN A . n 
A 1 232 ARG 232 308 308 ARG ARG A . n 
A 1 233 LYS 233 309 309 LYS LYS A . n 
A 1 234 VAL 234 310 310 VAL VAL A . n 
A 1 235 ALA 235 311 311 ALA ALA A . n 
A 1 236 THR 236 312 312 THR THR A . n 
A 1 237 SER 237 313 313 SER SER A . n 
A 1 238 LEU 238 314 314 LEU LEU A . n 
A 1 239 LYS 239 315 315 LYS LYS A . n 
A 1 240 LEU 240 316 316 LEU LEU A . n 
A 1 241 ILE 241 317 317 ILE ILE A . n 
A 1 242 ASN 242 318 318 ASN ASN A . n 
A 1 243 ASP 243 319 319 ASP ASP A . n 
A 1 244 THR 244 320 320 THR THR A . n 
A 1 245 LEU 245 321 321 LEU LEU A . n 
A 1 246 ASP 246 322 322 ASP ASP A . n 
A 1 247 ASP 247 323 323 ASP ASP A . n 
A 1 248 LEU 248 324 324 LEU LEU A . n 
A 1 249 ILE 249 325 325 ILE ILE A . n 
A 1 250 ALA 250 326 326 ALA ALA A . n 
A 1 251 THR 251 327 327 THR THR A . n 
A 1 252 CYS 252 328 328 CYS CYS A . n 
A 1 253 LYS 253 329 329 LYS LYS A . n 
A 1 254 ARG 254 330 330 ARG ARG A . n 
A 1 255 MET 255 331 331 MET MET A . n 
A 1 256 VAL 256 332 332 VAL VAL A . n 
A 1 257 GLU 257 333 333 GLU GLU A . n 
A 1 258 GLU 258 334 334 GLU GLU A . n 
A 1 259 GLU 259 335 335 GLU GLU A . n 
A 1 260 GLU 260 336 336 GLU GLU A . n 
A 1 261 LEU 261 337 337 LEU LEU A . n 
A 1 262 GLN 262 338 338 GLN GLN A . n 
A 1 263 PHE 263 339 339 PHE PHE A . n 
A 1 264 HIS 264 340 340 HIS HIS A . n 
A 1 265 GLU 265 341 341 GLU GLU A . n 
A 1 266 GLU 266 342 342 GLU GLU A . n 
A 1 267 TYR 267 343 343 TYR TYR A . n 
A 1 268 MET 268 344 344 MET MET A . n 
A 1 269 ASN 269 345 345 ASN ASN A . n 
A 1 270 GLU 270 346 346 GLU GLU A . n 
A 1 271 ARG 271 347 347 ARG ARG A . n 
A 1 272 ASP 272 348 348 ASP ASP A . n 
A 1 273 PRO 273 349 349 PRO PRO A . n 
A 1 274 SER 274 350 350 SER SER A . n 
A 1 275 ILE 275 351 351 ILE ILE A . n 
A 1 276 LEU 276 352 352 LEU LEU A . n 
A 1 277 HIS 277 353 353 HIS HIS A . n 
A 1 278 PHE 278 354 354 PHE PHE A . n 
A 1 279 LEU 279 355 355 LEU LEU A . n 
A 1 280 LEU 280 356 356 LEU LEU A . n 
A 1 281 ALA 281 357 357 ALA ALA A . n 
A 1 282 SER 282 358 358 SER SER A . n 
A 1 283 GLY 283 359 359 GLY GLY A . n 
A 1 284 ASP 284 360 360 ASP ASP A . n 
A 1 285 ASP 285 361 ?   ?   ?   A . n 
A 1 286 VAL 286 362 362 VAL VAL A . n 
A 1 287 SER 287 363 363 SER SER A . n 
A 1 288 SER 288 364 364 SER SER A . n 
A 1 289 LYS 289 365 365 LYS LYS A . n 
A 1 290 GLN 290 366 366 GLN GLN A . n 
A 1 291 LEU 291 367 367 LEU LEU A . n 
A 1 292 ARG 292 368 368 ARG ARG A . n 
A 1 293 ASP 293 369 369 ASP ASP A . n 
A 1 294 ASP 294 370 370 ASP ASP A . n 
A 1 295 LEU 295 371 371 LEU LEU A . n 
A 1 296 MET 296 372 372 MET MET A . n 
A 1 297 THR 297 373 373 THR THR A . n 
A 1 298 MET 298 374 374 MET MET A . n 
A 1 299 LEU 299 375 375 LEU LEU A . n 
A 1 300 ILE 300 376 376 ILE ILE A . n 
A 1 301 ALA 301 377 377 ALA ALA A . n 
A 1 302 GLY 302 378 378 GLY GLY A . n 
A 1 303 HIS 303 379 379 HIS HIS A . n 
A 1 304 GLU 304 380 380 GLU GLU A . n 
A 1 305 THR 305 381 381 THR THR A . n 
A 1 306 SER 306 382 382 SER SER A . n 
A 1 307 ALA 307 383 383 ALA ALA A . n 
A 1 308 ALA 308 384 384 ALA ALA A . n 
A 1 309 VAL 309 385 385 VAL VAL A . n 
A 1 310 LEU 310 386 386 LEU LEU A . n 
A 1 311 THR 311 387 387 THR THR A . n 
A 1 312 TRP 312 388 388 TRP TRP A . n 
A 1 313 THR 313 389 389 THR THR A . n 
A 1 314 PHE 314 390 390 PHE PHE A . n 
A 1 315 TYR 315 391 391 TYR TYR A . n 
A 1 316 LEU 316 392 392 LEU LEU A . n 
A 1 317 LEU 317 393 393 LEU LEU A . n 
A 1 318 THR 318 394 394 THR THR A . n 
A 1 319 THR 319 395 395 THR THR A . n 
A 1 320 GLU 320 396 396 GLU GLU A . n 
A 1 321 PRO 321 397 397 PRO PRO A . n 
A 1 322 SER 322 398 398 SER SER A . n 
A 1 323 VAL 323 399 399 VAL VAL A . n 
A 1 324 VAL 324 400 400 VAL VAL A . n 
A 1 325 ALA 325 401 401 ALA ALA A . n 
A 1 326 LYS 326 402 402 LYS LYS A . n 
A 1 327 LEU 327 403 403 LEU LEU A . n 
A 1 328 GLN 328 404 404 GLN GLN A . n 
A 1 329 GLU 329 405 405 GLU GLU A . n 
A 1 330 GLU 330 406 406 GLU GLU A . n 
A 1 331 VAL 331 407 407 VAL VAL A . n 
A 1 332 ASP 332 408 408 ASP ASP A . n 
A 1 333 SER 333 409 409 SER SER A . n 
A 1 334 VAL 334 410 410 VAL VAL A . n 
A 1 335 ILE 335 411 411 ILE ILE A . n 
A 1 336 GLY 336 412 412 GLY GLY A . n 
A 1 337 ASP 337 413 413 ASP ASP A . n 
A 1 338 ARG 338 414 414 ARG ARG A . n 
A 1 339 PHE 339 415 415 PHE PHE A . n 
A 1 340 PRO 340 416 416 PRO PRO A . n 
A 1 341 THR 341 417 417 THR THR A . n 
A 1 342 ILE 342 418 418 ILE ILE A . n 
A 1 343 GLN 343 419 419 GLN GLN A . n 
A 1 344 ASP 344 420 420 ASP ASP A . n 
A 1 345 MET 345 421 421 MET MET A . n 
A 1 346 LYS 346 422 422 LYS LYS A . n 
A 1 347 LYS 347 423 423 LYS LYS A . n 
A 1 348 LEU 348 424 424 LEU LEU A . n 
A 1 349 LYS 349 425 425 LYS LYS A . n 
A 1 350 TYR 350 426 426 TYR TYR A . n 
A 1 351 THR 351 427 427 THR THR A . n 
A 1 352 THR 352 428 428 THR THR A . n 
A 1 353 ARG 353 429 429 ARG ARG A . n 
A 1 354 VAL 354 430 430 VAL VAL A . n 
A 1 355 MET 355 431 431 MET MET A . n 
A 1 356 ASN 356 432 432 ASN ASN A . n 
A 1 357 GLU 357 433 433 GLU GLU A . n 
A 1 358 SER 358 434 434 SER SER A . n 
A 1 359 LEU 359 435 435 LEU LEU A . n 
A 1 360 ARG 360 436 436 ARG ARG A . n 
A 1 361 LEU 361 437 437 LEU LEU A . n 
A 1 362 TYR 362 438 438 TYR TYR A . n 
A 1 363 PRO 363 439 439 PRO PRO A . n 
A 1 364 GLN 364 440 440 GLN GLN A . n 
A 1 365 PRO 365 441 441 PRO PRO A . n 
A 1 366 PRO 366 442 442 PRO PRO A . n 
A 1 367 VAL 367 443 443 VAL VAL A . n 
A 1 368 LEU 368 444 444 LEU LEU A . n 
A 1 369 ILE 369 445 445 ILE ILE A . n 
A 1 370 ARG 370 446 446 ARG ARG A . n 
A 1 371 ARG 371 447 447 ARG ARG A . n 
A 1 372 SER 372 448 448 SER SER A . n 
A 1 373 ILE 373 449 449 ILE ILE A . n 
A 1 374 ASP 374 450 450 ASP ASP A . n 
A 1 375 ASN 375 451 451 ASN ASN A . n 
A 1 376 ASP 376 452 452 ASP ASP A . n 
A 1 377 ILE 377 453 453 ILE ILE A . n 
A 1 378 LEU 378 454 454 LEU LEU A . n 
A 1 379 GLY 379 455 455 GLY GLY A . n 
A 1 380 GLU 380 456 456 GLU GLU A . n 
A 1 381 TYR 381 457 457 TYR TYR A . n 
A 1 382 PRO 382 458 458 PRO PRO A . n 
A 1 383 ILE 383 459 459 ILE ILE A . n 
A 1 384 LYS 384 460 460 LYS LYS A . n 
A 1 385 ARG 385 461 461 ARG ARG A . n 
A 1 386 GLY 386 462 462 GLY GLY A . n 
A 1 387 GLU 387 463 463 GLU GLU A . n 
A 1 388 ASP 388 464 464 ASP ASP A . n 
A 1 389 ILE 389 465 465 ILE ILE A . n 
A 1 390 PHE 390 466 466 PHE PHE A . n 
A 1 391 ILE 391 467 467 ILE ILE A . n 
A 1 392 SER 392 468 468 SER SER A . n 
A 1 393 VAL 393 469 469 VAL VAL A . n 
A 1 394 TRP 394 470 470 TRP TRP A . n 
A 1 395 ASN 395 471 471 ASN ASN A . n 
A 1 396 LEU 396 472 472 LEU LEU A . n 
A 1 397 HIS 397 473 473 HIS HIS A . n 
A 1 398 ARG 398 474 474 ARG ARG A . n 
A 1 399 SER 399 475 475 SER SER A . n 
A 1 400 PRO 400 476 476 PRO PRO A . n 
A 1 401 LEU 401 477 477 LEU LEU A . n 
A 1 402 HIS 402 478 478 HIS HIS A . n 
A 1 403 TRP 403 479 479 TRP TRP A . n 
A 1 404 ASP 404 480 480 ASP ASP A . n 
A 1 405 ASP 405 481 481 ASP ASP A . n 
A 1 406 ALA 406 482 482 ALA ALA A . n 
A 1 407 GLU 407 483 483 GLU GLU A . n 
A 1 408 LYS 408 484 484 LYS LYS A . n 
A 1 409 PHE 409 485 485 PHE PHE A . n 
A 1 410 ASN 410 486 486 ASN ASN A . n 
A 1 411 PRO 411 487 487 PRO PRO A . n 
A 1 412 GLU 412 488 488 GLU GLU A . n 
A 1 413 ARG 413 489 489 ARG ARG A . n 
A 1 414 TRP 414 490 490 TRP TRP A . n 
A 1 415 PRO 415 491 491 PRO PRO A . n 
A 1 416 LEU 416 492 492 LEU LEU A . n 
A 1 417 ASP 417 493 493 ASP ASP A . n 
A 1 418 GLY 418 494 494 GLY GLY A . n 
A 1 419 PRO 419 495 495 PRO PRO A . n 
A 1 420 ASN 420 496 496 ASN ASN A . n 
A 1 421 PRO 421 497 497 PRO PRO A . n 
A 1 422 ASN 422 498 498 ASN ASN A . n 
A 1 423 GLU 423 499 499 GLU GLU A . n 
A 1 424 THR 424 500 500 THR THR A . n 
A 1 425 ASN 425 501 501 ASN ASN A . n 
A 1 426 GLN 426 502 502 GLN GLN A . n 
A 1 427 ASN 427 503 503 ASN ASN A . n 
A 1 428 PHE 428 504 504 PHE PHE A . n 
A 1 429 SER 429 505 505 SER SER A . n 
A 1 430 TYR 430 506 506 TYR TYR A . n 
A 1 431 LEU 431 507 507 LEU LEU A . n 
A 1 432 PRO 432 508 508 PRO PRO A . n 
A 1 433 PHE 433 509 509 PHE PHE A . n 
A 1 434 GLY 434 510 510 GLY GLY A . n 
A 1 435 GLY 435 511 511 GLY GLY A . n 
A 1 436 GLY 436 512 512 GLY GLY A . n 
A 1 437 PRO 437 513 513 PRO PRO A . n 
A 1 438 ARG 438 514 514 ARG ARG A . n 
A 1 439 LYS 439 515 515 LYS LYS A . n 
A 1 440 CYS 440 516 516 CYS CYS A . n 
A 1 441 ILE 441 517 517 ILE ILE A . n 
A 1 442 GLY 442 518 518 GLY GLY A . n 
A 1 443 ASP 443 519 519 ASP ASP A . n 
A 1 444 MET 444 520 520 MET MET A . n 
A 1 445 PHE 445 521 521 PHE PHE A . n 
A 1 446 ALA 446 522 522 ALA ALA A . n 
A 1 447 SER 447 523 523 SER SER A . n 
A 1 448 PHE 448 524 524 PHE PHE A . n 
A 1 449 GLU 449 525 525 GLU GLU A . n 
A 1 450 ASN 450 526 526 ASN ASN A . n 
A 1 451 VAL 451 527 527 VAL VAL A . n 
A 1 452 VAL 452 528 528 VAL VAL A . n 
A 1 453 ALA 453 529 529 ALA ALA A . n 
A 1 454 ILE 454 530 530 ILE ILE A . n 
A 1 455 ALA 455 531 531 ALA ALA A . n 
A 1 456 MET 456 532 532 MET MET A . n 
A 1 457 LEU 457 533 533 LEU LEU A . n 
A 1 458 ILE 458 534 534 ILE ILE A . n 
A 1 459 ARG 459 535 535 ARG ARG A . n 
A 1 460 ARG 460 536 536 ARG ARG A . n 
A 1 461 PHE 461 537 537 PHE PHE A . n 
A 1 462 ASN 462 538 538 ASN ASN A . n 
A 1 463 PHE 463 539 539 PHE PHE A . n 
A 1 464 GLN 464 540 540 GLN GLN A . n 
A 1 465 ILE 465 541 541 ILE ILE A . n 
A 1 466 ALA 466 542 542 ALA ALA A . n 
A 1 467 PRO 467 543 543 PRO PRO A . n 
A 1 468 GLY 468 544 544 GLY GLY A . n 
A 1 469 ALA 469 545 545 ALA ALA A . n 
A 1 470 PRO 470 546 546 PRO PRO A . n 
A 1 471 PRO 471 547 547 PRO PRO A . n 
A 1 472 VAL 472 548 548 VAL VAL A . n 
A 1 473 LYS 473 549 549 LYS LYS A . n 
A 1 474 MET 474 550 550 MET MET A . n 
A 1 475 THR 475 551 551 THR THR A . n 
A 1 476 THR 476 552 552 THR THR A . n 
A 1 477 GLY 477 553 553 GLY GLY A . n 
A 1 478 ALA 478 554 554 ALA ALA A . n 
A 1 479 THR 479 555 555 THR THR A . n 
A 1 480 ILE 480 556 556 ILE ILE A . n 
A 1 481 HIS 481 557 557 HIS HIS A . n 
A 1 482 THR 482 558 558 THR THR A . n 
A 1 483 THR 483 559 559 THR THR A . n 
A 1 484 GLU 484 560 560 GLU GLU A . n 
A 1 485 GLY 485 561 561 GLY GLY A . n 
A 1 486 LEU 486 562 562 LEU LEU A . n 
A 1 487 LYS 487 563 563 LYS LYS A . n 
A 1 488 LEU 488 564 564 LEU LEU A . n 
A 1 489 THR 489 565 565 THR THR A . n 
A 1 490 VAL 490 566 566 VAL VAL A . n 
A 1 491 THR 491 567 567 THR THR A . n 
A 1 492 LYS 492 568 568 LYS LYS A . n 
A 1 493 ARG 493 569 569 ARG ARG A . n 
A 1 494 THR 494 570 570 THR THR A . n 
A 1 495 LYS 495 571 571 LYS LYS A . n 
A 1 496 PRO 496 572 572 PRO PRO A . n 
A 1 497 LEU 497 573 573 LEU LEU A . n 
A 1 498 ASP 498 574 574 ASP ASP A . n 
A 1 499 ILE 499 575 575 ILE ILE A . n 
A 1 500 PRO 500 576 576 PRO PRO A . n 
A 1 501 SER 501 577 577 SER SER A . n 
A 1 502 VAL 502 578 578 VAL VAL A . n 
A 1 503 PRO 503 579 579 PRO PRO A . n 
A 1 504 ILE 504 580 580 ILE ILE A . n 
A 1 505 LEU 505 581 ?   ?   ?   A . n 
A 1 506 PRO 506 582 ?   ?   ?   A . n 
A 1 507 MET 507 583 ?   ?   ?   A . n 
A 1 508 ASP 508 584 ?   ?   ?   A . n 
A 1 509 THR 509 585 ?   ?   ?   A . n 
A 1 510 SER 510 586 ?   ?   ?   A . n 
A 1 511 ARG 511 587 ?   ?   ?   A . n 
A 1 512 ASP 512 588 ?   ?   ?   A . n 
A 1 513 GLU 513 589 ?   ?   ?   A . n 
A 1 514 VAL 514 590 ?   ?   ?   A . n 
A 1 515 SER 515 591 ?   ?   ?   A . n 
A 1 516 SER 516 592 ?   ?   ?   A . n 
A 1 517 ALA 517 593 ?   ?   ?   A . n 
A 1 518 LEU 518 594 ?   ?   ?   A . n 
A 1 519 SER 519 595 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HEM 1   601  601 HEM HEM A . 
C 3 RET 1   602  668 RET RET A . 
D 4 HOH 1   701  307 HOH HOH A . 
D 4 HOH 2   702  441 HOH HOH A . 
D 4 HOH 3   703  298 HOH HOH A . 
D 4 HOH 4   704  442 HOH HOH A . 
D 4 HOH 5   705  471 HOH HOH A . 
D 4 HOH 6   706  447 HOH HOH A . 
D 4 HOH 7   707  323 HOH HOH A . 
D 4 HOH 8   708  147 HOH HOH A . 
D 4 HOH 9   709  113 HOH HOH A . 
D 4 HOH 10  710  60  HOH HOH A . 
D 4 HOH 11  711  261 HOH HOH A . 
D 4 HOH 12  712  450 HOH HOH A . 
D 4 HOH 13  713  347 HOH HOH A . 
D 4 HOH 14  714  153 HOH HOH A . 
D 4 HOH 15  715  31  HOH HOH A . 
D 4 HOH 16  716  126 HOH HOH A . 
D 4 HOH 17  717  331 HOH HOH A . 
D 4 HOH 18  718  367 HOH HOH A . 
D 4 HOH 19  719  382 HOH HOH A . 
D 4 HOH 20  720  131 HOH HOH A . 
D 4 HOH 21  721  277 HOH HOH A . 
D 4 HOH 22  722  135 HOH HOH A . 
D 4 HOH 23  723  164 HOH HOH A . 
D 4 HOH 24  724  57  HOH HOH A . 
D 4 HOH 25  725  35  HOH HOH A . 
D 4 HOH 26  726  511 HOH HOH A . 
D 4 HOH 27  727  321 HOH HOH A . 
D 4 HOH 28  728  326 HOH HOH A . 
D 4 HOH 29  729  199 HOH HOH A . 
D 4 HOH 30  730  475 HOH HOH A . 
D 4 HOH 31  731  437 HOH HOH A . 
D 4 HOH 32  732  48  HOH HOH A . 
D 4 HOH 33  733  115 HOH HOH A . 
D 4 HOH 34  734  7   HOH HOH A . 
D 4 HOH 35  735  149 HOH HOH A . 
D 4 HOH 36  736  130 HOH HOH A . 
D 4 HOH 37  737  340 HOH HOH A . 
D 4 HOH 38  738  4   HOH HOH A . 
D 4 HOH 39  739  272 HOH HOH A . 
D 4 HOH 40  740  308 HOH HOH A . 
D 4 HOH 41  741  334 HOH HOH A . 
D 4 HOH 42  742  189 HOH HOH A . 
D 4 HOH 43  743  362 HOH HOH A . 
D 4 HOH 44  744  485 HOH HOH A . 
D 4 HOH 45  745  68  HOH HOH A . 
D 4 HOH 46  746  258 HOH HOH A . 
D 4 HOH 47  747  20  HOH HOH A . 
D 4 HOH 48  748  440 HOH HOH A . 
D 4 HOH 49  749  311 HOH HOH A . 
D 4 HOH 50  750  424 HOH HOH A . 
D 4 HOH 51  751  66  HOH HOH A . 
D 4 HOH 52  752  328 HOH HOH A . 
D 4 HOH 53  753  246 HOH HOH A . 
D 4 HOH 54  754  26  HOH HOH A . 
D 4 HOH 55  755  28  HOH HOH A . 
D 4 HOH 56  756  56  HOH HOH A . 
D 4 HOH 57  757  11  HOH HOH A . 
D 4 HOH 58  758  81  HOH HOH A . 
D 4 HOH 59  759  215 HOH HOH A . 
D 4 HOH 60  760  223 HOH HOH A . 
D 4 HOH 61  761  61  HOH HOH A . 
D 4 HOH 62  762  55  HOH HOH A . 
D 4 HOH 63  763  188 HOH HOH A . 
D 4 HOH 64  764  3   HOH HOH A . 
D 4 HOH 65  765  408 HOH HOH A . 
D 4 HOH 66  766  1   HOH HOH A . 
D 4 HOH 67  767  145 HOH HOH A . 
D 4 HOH 68  768  305 HOH HOH A . 
D 4 HOH 69  769  21  HOH HOH A . 
D 4 HOH 70  770  53  HOH HOH A . 
D 4 HOH 71  771  116 HOH HOH A . 
D 4 HOH 72  772  201 HOH HOH A . 
D 4 HOH 73  773  15  HOH HOH A . 
D 4 HOH 74  774  514 HOH HOH A . 
D 4 HOH 75  775  301 HOH HOH A . 
D 4 HOH 76  776  231 HOH HOH A . 
D 4 HOH 77  777  416 HOH HOH A . 
D 4 HOH 78  778  193 HOH HOH A . 
D 4 HOH 79  779  25  HOH HOH A . 
D 4 HOH 80  780  91  HOH HOH A . 
D 4 HOH 81  781  338 HOH HOH A . 
D 4 HOH 82  782  88  HOH HOH A . 
D 4 HOH 83  783  37  HOH HOH A . 
D 4 HOH 84  784  446 HOH HOH A . 
D 4 HOH 85  785  265 HOH HOH A . 
D 4 HOH 86  786  38  HOH HOH A . 
D 4 HOH 87  787  83  HOH HOH A . 
D 4 HOH 88  788  12  HOH HOH A . 
D 4 HOH 89  789  24  HOH HOH A . 
D 4 HOH 90  790  167 HOH HOH A . 
D 4 HOH 91  791  375 HOH HOH A . 
D 4 HOH 92  792  294 HOH HOH A . 
D 4 HOH 93  793  228 HOH HOH A . 
D 4 HOH 94  794  206 HOH HOH A . 
D 4 HOH 95  795  465 HOH HOH A . 
D 4 HOH 96  796  74  HOH HOH A . 
D 4 HOH 97  797  270 HOH HOH A . 
D 4 HOH 98  798  63  HOH HOH A . 
D 4 HOH 99  799  140 HOH HOH A . 
D 4 HOH 100 800  99  HOH HOH A . 
D 4 HOH 101 801  52  HOH HOH A . 
D 4 HOH 102 802  18  HOH HOH A . 
D 4 HOH 103 803  396 HOH HOH A . 
D 4 HOH 104 804  17  HOH HOH A . 
D 4 HOH 105 805  386 HOH HOH A . 
D 4 HOH 106 806  23  HOH HOH A . 
D 4 HOH 107 807  190 HOH HOH A . 
D 4 HOH 108 808  187 HOH HOH A . 
D 4 HOH 109 809  9   HOH HOH A . 
D 4 HOH 110 810  315 HOH HOH A . 
D 4 HOH 111 811  262 HOH HOH A . 
D 4 HOH 112 812  65  HOH HOH A . 
D 4 HOH 113 813  152 HOH HOH A . 
D 4 HOH 114 814  19  HOH HOH A . 
D 4 HOH 115 815  33  HOH HOH A . 
D 4 HOH 116 816  2   HOH HOH A . 
D 4 HOH 117 817  476 HOH HOH A . 
D 4 HOH 118 818  104 HOH HOH A . 
D 4 HOH 119 819  85  HOH HOH A . 
D 4 HOH 120 820  119 HOH HOH A . 
D 4 HOH 121 821  224 HOH HOH A . 
D 4 HOH 122 822  82  HOH HOH A . 
D 4 HOH 123 823  349 HOH HOH A . 
D 4 HOH 124 824  32  HOH HOH A . 
D 4 HOH 125 825  79  HOH HOH A . 
D 4 HOH 126 826  456 HOH HOH A . 
D 4 HOH 127 827  43  HOH HOH A . 
D 4 HOH 128 828  213 HOH HOH A . 
D 4 HOH 129 829  435 HOH HOH A . 
D 4 HOH 130 830  191 HOH HOH A . 
D 4 HOH 131 831  453 HOH HOH A . 
D 4 HOH 132 832  54  HOH HOH A . 
D 4 HOH 133 833  241 HOH HOH A . 
D 4 HOH 134 834  117 HOH HOH A . 
D 4 HOH 135 835  341 HOH HOH A . 
D 4 HOH 136 836  10  HOH HOH A . 
D 4 HOH 137 837  204 HOH HOH A . 
D 4 HOH 138 838  93  HOH HOH A . 
D 4 HOH 139 839  274 HOH HOH A . 
D 4 HOH 140 840  172 HOH HOH A . 
D 4 HOH 141 841  419 HOH HOH A . 
D 4 HOH 142 842  121 HOH HOH A . 
D 4 HOH 143 843  27  HOH HOH A . 
D 4 HOH 144 844  383 HOH HOH A . 
D 4 HOH 145 845  452 HOH HOH A . 
D 4 HOH 146 846  36  HOH HOH A . 
D 4 HOH 147 847  287 HOH HOH A . 
D 4 HOH 148 848  198 HOH HOH A . 
D 4 HOH 149 849  182 HOH HOH A . 
D 4 HOH 150 850  357 HOH HOH A . 
D 4 HOH 151 851  159 HOH HOH A . 
D 4 HOH 152 852  380 HOH HOH A . 
D 4 HOH 153 853  92  HOH HOH A . 
D 4 HOH 154 854  84  HOH HOH A . 
D 4 HOH 155 855  269 HOH HOH A . 
D 4 HOH 156 856  80  HOH HOH A . 
D 4 HOH 157 857  256 HOH HOH A . 
D 4 HOH 158 858  71  HOH HOH A . 
D 4 HOH 159 859  30  HOH HOH A . 
D 4 HOH 160 860  75  HOH HOH A . 
D 4 HOH 161 861  358 HOH HOH A . 
D 4 HOH 162 862  44  HOH HOH A . 
D 4 HOH 163 863  376 HOH HOH A . 
D 4 HOH 164 864  114 HOH HOH A . 
D 4 HOH 165 865  281 HOH HOH A . 
D 4 HOH 166 866  70  HOH HOH A . 
D 4 HOH 167 867  133 HOH HOH A . 
D 4 HOH 168 868  313 HOH HOH A . 
D 4 HOH 169 869  29  HOH HOH A . 
D 4 HOH 170 870  156 HOH HOH A . 
D 4 HOH 171 871  195 HOH HOH A . 
D 4 HOH 172 872  58  HOH HOH A . 
D 4 HOH 173 873  39  HOH HOH A . 
D 4 HOH 174 874  333 HOH HOH A . 
D 4 HOH 175 875  139 HOH HOH A . 
D 4 HOH 176 876  59  HOH HOH A . 
D 4 HOH 177 877  291 HOH HOH A . 
D 4 HOH 178 878  8   HOH HOH A . 
D 4 HOH 179 879  418 HOH HOH A . 
D 4 HOH 180 880  414 HOH HOH A . 
D 4 HOH 181 881  300 HOH HOH A . 
D 4 HOH 182 882  108 HOH HOH A . 
D 4 HOH 183 883  76  HOH HOH A . 
D 4 HOH 184 884  240 HOH HOH A . 
D 4 HOH 185 885  234 HOH HOH A . 
D 4 HOH 186 886  415 HOH HOH A . 
D 4 HOH 187 887  454 HOH HOH A . 
D 4 HOH 188 888  77  HOH HOH A . 
D 4 HOH 189 889  148 HOH HOH A . 
D 4 HOH 190 890  64  HOH HOH A . 
D 4 HOH 191 891  374 HOH HOH A . 
D 4 HOH 192 892  458 HOH HOH A . 
D 4 HOH 193 893  87  HOH HOH A . 
D 4 HOH 194 894  368 HOH HOH A . 
D 4 HOH 195 895  468 HOH HOH A . 
D 4 HOH 196 896  125 HOH HOH A . 
D 4 HOH 197 897  353 HOH HOH A . 
D 4 HOH 198 898  389 HOH HOH A . 
D 4 HOH 199 899  51  HOH HOH A . 
D 4 HOH 200 900  221 HOH HOH A . 
D 4 HOH 201 901  238 HOH HOH A . 
D 4 HOH 202 902  320 HOH HOH A . 
D 4 HOH 203 903  487 HOH HOH A . 
D 4 HOH 204 904  42  HOH HOH A . 
D 4 HOH 205 905  22  HOH HOH A . 
D 4 HOH 206 906  181 HOH HOH A . 
D 4 HOH 207 907  252 HOH HOH A . 
D 4 HOH 208 908  282 HOH HOH A . 
D 4 HOH 209 909  102 HOH HOH A . 
D 4 HOH 210 910  363 HOH HOH A . 
D 4 HOH 211 911  146 HOH HOH A . 
D 4 HOH 212 912  175 HOH HOH A . 
D 4 HOH 213 913  41  HOH HOH A . 
D 4 HOH 214 914  122 HOH HOH A . 
D 4 HOH 215 915  13  HOH HOH A . 
D 4 HOH 216 916  100 HOH HOH A . 
D 4 HOH 217 917  112 HOH HOH A . 
D 4 HOH 218 918  356 HOH HOH A . 
D 4 HOH 219 919  124 HOH HOH A . 
D 4 HOH 220 920  498 HOH HOH A . 
D 4 HOH 221 921  105 HOH HOH A . 
D 4 HOH 222 922  251 HOH HOH A . 
D 4 HOH 223 923  352 HOH HOH A . 
D 4 HOH 224 924  97  HOH HOH A . 
D 4 HOH 225 925  40  HOH HOH A . 
D 4 HOH 226 926  359 HOH HOH A . 
D 4 HOH 227 927  273 HOH HOH A . 
D 4 HOH 228 928  444 HOH HOH A . 
D 4 HOH 229 929  14  HOH HOH A . 
D 4 HOH 230 930  423 HOH HOH A . 
D 4 HOH 231 931  316 HOH HOH A . 
D 4 HOH 232 932  227 HOH HOH A . 
D 4 HOH 233 933  89  HOH HOH A . 
D 4 HOH 234 934  62  HOH HOH A . 
D 4 HOH 235 935  163 HOH HOH A . 
D 4 HOH 236 936  6   HOH HOH A . 
D 4 HOH 237 937  127 HOH HOH A . 
D 4 HOH 238 938  179 HOH HOH A . 
D 4 HOH 239 939  385 HOH HOH A . 
D 4 HOH 240 940  138 HOH HOH A . 
D 4 HOH 241 941  78  HOH HOH A . 
D 4 HOH 242 942  395 HOH HOH A . 
D 4 HOH 243 943  170 HOH HOH A . 
D 4 HOH 244 944  69  HOH HOH A . 
D 4 HOH 245 945  312 HOH HOH A . 
D 4 HOH 246 946  101 HOH HOH A . 
D 4 HOH 247 947  309 HOH HOH A . 
D 4 HOH 248 948  492 HOH HOH A . 
D 4 HOH 249 949  128 HOH HOH A . 
D 4 HOH 250 950  73  HOH HOH A . 
D 4 HOH 251 951  16  HOH HOH A . 
D 4 HOH 252 952  253 HOH HOH A . 
D 4 HOH 253 953  247 HOH HOH A . 
D 4 HOH 254 954  180 HOH HOH A . 
D 4 HOH 255 955  151 HOH HOH A . 
D 4 HOH 256 956  297 HOH HOH A . 
D 4 HOH 257 957  49  HOH HOH A . 
D 4 HOH 258 958  482 HOH HOH A . 
D 4 HOH 259 959  157 HOH HOH A . 
D 4 HOH 260 960  336 HOH HOH A . 
D 4 HOH 261 961  109 HOH HOH A . 
D 4 HOH 262 962  137 HOH HOH A . 
D 4 HOH 263 963  479 HOH HOH A . 
D 4 HOH 264 964  306 HOH HOH A . 
D 4 HOH 265 965  160 HOH HOH A . 
D 4 HOH 266 966  95  HOH HOH A . 
D 4 HOH 267 967  339 HOH HOH A . 
D 4 HOH 268 968  299 HOH HOH A . 
D 4 HOH 269 969  329 HOH HOH A . 
D 4 HOH 270 970  155 HOH HOH A . 
D 4 HOH 271 971  47  HOH HOH A . 
D 4 HOH 272 972  302 HOH HOH A . 
D 4 HOH 273 973  388 HOH HOH A . 
D 4 HOH 274 974  209 HOH HOH A . 
D 4 HOH 275 975  34  HOH HOH A . 
D 4 HOH 276 976  86  HOH HOH A . 
D 4 HOH 277 977  378 HOH HOH A . 
D 4 HOH 278 978  178 HOH HOH A . 
D 4 HOH 279 979  46  HOH HOH A . 
D 4 HOH 280 980  260 HOH HOH A . 
D 4 HOH 281 981  327 HOH HOH A . 
D 4 HOH 282 982  233 HOH HOH A . 
D 4 HOH 283 983  72  HOH HOH A . 
D 4 HOH 284 984  169 HOH HOH A . 
D 4 HOH 285 985  216 HOH HOH A . 
D 4 HOH 286 986  94  HOH HOH A . 
D 4 HOH 287 987  289 HOH HOH A . 
D 4 HOH 288 988  481 HOH HOH A . 
D 4 HOH 289 989  232 HOH HOH A . 
D 4 HOH 290 990  96  HOH HOH A . 
D 4 HOH 291 991  161 HOH HOH A . 
D 4 HOH 292 992  5   HOH HOH A . 
D 4 HOH 293 993  107 HOH HOH A . 
D 4 HOH 294 994  344 HOH HOH A . 
D 4 HOH 295 995  173 HOH HOH A . 
D 4 HOH 296 996  192 HOH HOH A . 
D 4 HOH 297 997  150 HOH HOH A . 
D 4 HOH 298 998  162 HOH HOH A . 
D 4 HOH 299 999  449 HOH HOH A . 
D 4 HOH 300 1000 432 HOH HOH A . 
D 4 HOH 301 1001 254 HOH HOH A . 
D 4 HOH 302 1002 406 HOH HOH A . 
D 4 HOH 303 1003 278 HOH HOH A . 
D 4 HOH 304 1004 174 HOH HOH A . 
D 4 HOH 305 1005 142 HOH HOH A . 
D 4 HOH 306 1006 236 HOH HOH A . 
D 4 HOH 307 1007 205 HOH HOH A . 
D 4 HOH 308 1008 310 HOH HOH A . 
D 4 HOH 309 1009 229 HOH HOH A . 
D 4 HOH 310 1010 335 HOH HOH A . 
D 4 HOH 311 1011 98  HOH HOH A . 
D 4 HOH 312 1012 50  HOH HOH A . 
D 4 HOH 313 1013 248 HOH HOH A . 
D 4 HOH 314 1014 420 HOH HOH A . 
D 4 HOH 315 1015 106 HOH HOH A . 
D 4 HOH 316 1016 120 HOH HOH A . 
D 4 HOH 317 1017 219 HOH HOH A . 
D 4 HOH 318 1018 410 HOH HOH A . 
D 4 HOH 319 1019 478 HOH HOH A . 
D 4 HOH 320 1020 445 HOH HOH A . 
D 4 HOH 321 1021 412 HOH HOH A . 
D 4 HOH 322 1022 372 HOH HOH A . 
D 4 HOH 323 1023 409 HOH HOH A . 
D 4 HOH 324 1024 235 HOH HOH A . 
D 4 HOH 325 1025 197 HOH HOH A . 
D 4 HOH 326 1026 398 HOH HOH A . 
D 4 HOH 327 1027 276 HOH HOH A . 
D 4 HOH 328 1028 45  HOH HOH A . 
D 4 HOH 329 1029 496 HOH HOH A . 
D 4 HOH 330 1030 225 HOH HOH A . 
D 4 HOH 331 1031 462 HOH HOH A . 
D 4 HOH 332 1032 433 HOH HOH A . 
D 4 HOH 333 1033 457 HOH HOH A . 
D 4 HOH 334 1034 516 HOH HOH A . 
D 4 HOH 335 1035 438 HOH HOH A . 
D 4 HOH 336 1036 401 HOH HOH A . 
D 4 HOH 337 1037 448 HOH HOH A . 
D 4 HOH 338 1038 141 HOH HOH A . 
D 4 HOH 339 1039 384 HOH HOH A . 
D 4 HOH 340 1040 403 HOH HOH A . 
D 4 HOH 341 1041 211 HOH HOH A . 
D 4 HOH 342 1042 154 HOH HOH A . 
D 4 HOH 343 1043 318 HOH HOH A . 
D 4 HOH 344 1044 503 HOH HOH A . 
D 4 HOH 345 1045 283 HOH HOH A . 
D 4 HOH 346 1046 207 HOH HOH A . 
D 4 HOH 347 1047 263 HOH HOH A . 
D 4 HOH 348 1048 264 HOH HOH A . 
D 4 HOH 349 1049 271 HOH HOH A . 
D 4 HOH 350 1050 123 HOH HOH A . 
D 4 HOH 351 1051 118 HOH HOH A . 
D 4 HOH 352 1052 293 HOH HOH A . 
D 4 HOH 353 1053 402 HOH HOH A . 
D 4 HOH 354 1054 158 HOH HOH A . 
D 4 HOH 355 1055 245 HOH HOH A . 
D 4 HOH 356 1056 136 HOH HOH A . 
D 4 HOH 357 1057 495 HOH HOH A . 
D 4 HOH 358 1058 267 HOH HOH A . 
D 4 HOH 359 1059 242 HOH HOH A . 
D 4 HOH 360 1060 370 HOH HOH A . 
D 4 HOH 361 1061 513 HOH HOH A . 
D 4 HOH 362 1062 296 HOH HOH A . 
D 4 HOH 363 1063 144 HOH HOH A . 
D 4 HOH 364 1064 377 HOH HOH A . 
D 4 HOH 365 1065 165 HOH HOH A . 
D 4 HOH 366 1066 337 HOH HOH A . 
D 4 HOH 367 1067 461 HOH HOH A . 
D 4 HOH 368 1068 507 HOH HOH A . 
D 4 HOH 369 1069 490 HOH HOH A . 
D 4 HOH 370 1070 286 HOH HOH A . 
D 4 HOH 371 1071 387 HOH HOH A . 
D 4 HOH 372 1072 196 HOH HOH A . 
D 4 HOH 373 1073 210 HOH HOH A . 
D 4 HOH 374 1074 404 HOH HOH A . 
D 4 HOH 375 1075 354 HOH HOH A . 
D 4 HOH 376 1076 212 HOH HOH A . 
D 4 HOH 377 1077 290 HOH HOH A . 
D 4 HOH 378 1078 399 HOH HOH A . 
D 4 HOH 379 1079 194 HOH HOH A . 
D 4 HOH 380 1080 364 HOH HOH A . 
D 4 HOH 381 1081 319 HOH HOH A . 
D 4 HOH 382 1082 484 HOH HOH A . 
D 4 HOH 383 1083 508 HOH HOH A . 
D 4 HOH 384 1084 259 HOH HOH A . 
D 4 HOH 385 1085 103 HOH HOH A . 
D 4 HOH 386 1086 230 HOH HOH A . 
D 4 HOH 387 1087 421 HOH HOH A . 
D 4 HOH 388 1088 90  HOH HOH A . 
D 4 HOH 389 1089 176 HOH HOH A . 
D 4 HOH 390 1090 171 HOH HOH A . 
D 4 HOH 391 1091 280 HOH HOH A . 
D 4 HOH 392 1092 429 HOH HOH A . 
D 4 HOH 393 1093 502 HOH HOH A . 
D 4 HOH 394 1094 472 HOH HOH A . 
D 4 HOH 395 1095 512 HOH HOH A . 
D 4 HOH 396 1096 266 HOH HOH A . 
D 4 HOH 397 1097 430 HOH HOH A . 
D 4 HOH 398 1098 391 HOH HOH A . 
D 4 HOH 399 1099 480 HOH HOH A . 
D 4 HOH 400 1100 493 HOH HOH A . 
D 4 HOH 401 1101 425 HOH HOH A . 
D 4 HOH 402 1102 428 HOH HOH A . 
D 4 HOH 403 1103 466 HOH HOH A . 
D 4 HOH 404 1104 249 HOH HOH A . 
D 4 HOH 405 1105 292 HOH HOH A . 
D 4 HOH 406 1106 322 HOH HOH A . 
D 4 HOH 407 1107 314 HOH HOH A . 
D 4 HOH 408 1108 515 HOH HOH A . 
D 4 HOH 409 1109 463 HOH HOH A . 
D 4 HOH 410 1110 489 HOH HOH A . 
D 4 HOH 411 1111 381 HOH HOH A . 
D 4 HOH 412 1112 214 HOH HOH A . 
D 4 HOH 413 1113 67  HOH HOH A . 
D 4 HOH 414 1114 304 HOH HOH A . 
D 4 HOH 415 1115 443 HOH HOH A . 
D 4 HOH 416 1116 203 HOH HOH A . 
D 4 HOH 417 1117 111 HOH HOH A . 
D 4 HOH 418 1118 285 HOH HOH A . 
D 4 HOH 419 1119 497 HOH HOH A . 
D 4 HOH 420 1120 110 HOH HOH A . 
D 4 HOH 421 1121 469 HOH HOH A . 
D 4 HOH 422 1122 427 HOH HOH A . 
D 4 HOH 423 1123 360 HOH HOH A . 
D 4 HOH 424 1124 168 HOH HOH A . 
D 4 HOH 425 1125 218 HOH HOH A . 
D 4 HOH 426 1126 365 HOH HOH A . 
D 4 HOH 427 1127 288 HOH HOH A . 
D 4 HOH 428 1128 407 HOH HOH A . 
D 4 HOH 429 1129 200 HOH HOH A . 
D 4 HOH 430 1130 379 HOH HOH A . 
D 4 HOH 431 1131 208 HOH HOH A . 
D 4 HOH 432 1132 217 HOH HOH A . 
D 4 HOH 433 1133 394 HOH HOH A . 
D 4 HOH 434 1134 506 HOH HOH A . 
D 4 HOH 435 1135 324 HOH HOH A . 
D 4 HOH 436 1136 422 HOH HOH A . 
D 4 HOH 437 1137 166 HOH HOH A . 
D 4 HOH 438 1138 317 HOH HOH A . 
D 4 HOH 439 1139 239 HOH HOH A . 
D 4 HOH 440 1140 303 HOH HOH A . 
D 4 HOH 441 1141 202 HOH HOH A . 
D 4 HOH 442 1142 183 HOH HOH A . 
D 4 HOH 443 1143 369 HOH HOH A . 
D 4 HOH 444 1144 390 HOH HOH A . 
D 4 HOH 445 1145 510 HOH HOH A . 
D 4 HOH 446 1146 325 HOH HOH A . 
D 4 HOH 447 1147 268 HOH HOH A . 
D 4 HOH 448 1148 405 HOH HOH A . 
D 4 HOH 449 1149 255 HOH HOH A . 
D 4 HOH 450 1150 504 HOH HOH A . 
D 4 HOH 451 1151 184 HOH HOH A . 
D 4 HOH 452 1152 411 HOH HOH A . 
D 4 HOH 453 1153 393 HOH HOH A . 
D 4 HOH 454 1154 494 HOH HOH A . 
D 4 HOH 455 1155 226 HOH HOH A . 
D 4 HOH 456 1156 366 HOH HOH A . 
D 4 HOH 457 1157 279 HOH HOH A . 
D 4 HOH 458 1158 330 HOH HOH A . 
D 4 HOH 459 1159 345 HOH HOH A . 
D 4 HOH 460 1160 185 HOH HOH A . 
D 4 HOH 461 1161 486 HOH HOH A . 
D 4 HOH 462 1162 129 HOH HOH A . 
D 4 HOH 463 1163 460 HOH HOH A . 
D 4 HOH 464 1164 351 HOH HOH A . 
D 4 HOH 465 1165 439 HOH HOH A . 
D 4 HOH 466 1166 473 HOH HOH A . 
D 4 HOH 467 1167 284 HOH HOH A . 
D 4 HOH 468 1168 509 HOH HOH A . 
D 4 HOH 469 1169 426 HOH HOH A . 
D 4 HOH 470 1170 483 HOH HOH A . 
D 4 HOH 471 1171 342 HOH HOH A . 
D 4 HOH 472 1172 132 HOH HOH A . 
D 4 HOH 473 1173 499 HOH HOH A . 
D 4 HOH 474 1174 332 HOH HOH A . 
D 4 HOH 475 1175 250 HOH HOH A . 
D 4 HOH 476 1176 220 HOH HOH A . 
D 4 HOH 477 1177 222 HOH HOH A . 
D 4 HOH 478 1178 491 HOH HOH A . 
D 4 HOH 479 1179 177 HOH HOH A . 
D 4 HOH 480 1180 343 HOH HOH A . 
D 4 HOH 481 1181 257 HOH HOH A . 
D 4 HOH 482 1182 350 HOH HOH A . 
D 4 HOH 483 1183 237 HOH HOH A . 
D 4 HOH 484 1184 467 HOH HOH A . 
D 4 HOH 485 1185 455 HOH HOH A . 
D 4 HOH 486 1186 134 HOH HOH A . 
D 4 HOH 487 1187 244 HOH HOH A . 
D 4 HOH 488 1188 275 HOH HOH A . 
D 4 HOH 489 1189 348 HOH HOH A . 
D 4 HOH 490 1190 243 HOH HOH A . 
D 4 HOH 491 1191 346 HOH HOH A . 
D 4 HOH 492 1192 505 HOH HOH A . 
D 4 HOH 493 1193 470 HOH HOH A . 
D 4 HOH 494 1194 434 HOH HOH A . 
D 4 HOH 495 1195 417 HOH HOH A . 
D 4 HOH 496 1196 488 HOH HOH A . 
D 4 HOH 497 1197 186 HOH HOH A . 
D 4 HOH 498 1198 355 HOH HOH A . 
D 4 HOH 499 1199 295 HOH HOH A . 
D 4 HOH 500 1200 143 HOH HOH A . 
D 4 HOH 501 1201 501 HOH HOH A . 
D 4 HOH 502 1202 500 HOH HOH A . 
D 4 HOH 503 1203 413 HOH HOH A . 
D 4 HOH 504 1204 477 HOH HOH A . 
D 4 HOH 505 1205 431 HOH HOH A . 
D 4 HOH 506 1206 397 HOH HOH A . 
D 4 HOH 507 1207 436 HOH HOH A . 
D 4 HOH 508 1208 373 HOH HOH A . 
D 4 HOH 509 1209 451 HOH HOH A . 
D 4 HOH 510 1210 474 HOH HOH A . 
D 4 HOH 511 1211 371 HOH HOH A . 
D 4 HOH 512 1212 459 HOH HOH A . 
D 4 HOH 513 1213 400 HOH HOH A . 
D 4 HOH 514 1214 361 HOH HOH A . 
D 4 HOH 515 1215 392 HOH HOH A . 
D 4 HOH 516 1216 464 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1220  ? 
1 MORE         -24   ? 
1 'SSA (A^2)'  18870 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 440 ? A CYS 516 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NA ? B HEM . ? A HEM 601 ? 1_555 101.0 ? 
2  SG ? A CYS 440 ? A CYS 516 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NB ? B HEM . ? A HEM 601 ? 1_555 93.2  ? 
3  NA ? B HEM .   ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NB ? B HEM . ? A HEM 601 ? 1_555 89.4  ? 
4  SG ? A CYS 440 ? A CYS 516 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NC ? B HEM . ? A HEM 601 ? 1_555 94.8  ? 
5  NA ? B HEM .   ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NC ? B HEM . ? A HEM 601 ? 1_555 164.2 ? 
6  NB ? B HEM .   ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NC ? B HEM . ? A HEM 601 ? 1_555 89.3  ? 
7  SG ? A CYS 440 ? A CYS 516 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 101.2 ? 
8  NA ? B HEM .   ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 88.4  ? 
9  NB ? B HEM .   ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 165.5 ? 
10 NC ? B HEM .   ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 88.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-01-22 
2 'Structure model' 1 1 2020-06-10 
3 'Structure model' 1 2 2020-06-24 
4 'Structure model' 1 3 2020-07-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 4 'Structure model' citation        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.pdbx_database_id_DOI'    
7  2 'Structure model' '_citation.title'                   
8  2 'Structure model' '_citation.year'                    
9  3 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 3 'Structure model' '_citation.title'                   
11 4 'Structure model' '_citation.journal_volume'          
12 4 'Structure model' '_citation.page_first'              
13 4 'Structure model' '_citation.page_last'               
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -22.1556 
_pdbx_refine_tls.origin_y         3.9029 
_pdbx_refine_tls.origin_z         -13.9440 
_pdbx_refine_tls.T[1][1]          0.1311 
_pdbx_refine_tls.T[2][2]          0.1516 
_pdbx_refine_tls.T[3][3]          0.1700 
_pdbx_refine_tls.T[1][2]          0.0177 
_pdbx_refine_tls.T[1][3]          -0.0006 
_pdbx_refine_tls.T[2][3]          -0.0291 
_pdbx_refine_tls.L[1][1]          0.4340 
_pdbx_refine_tls.L[2][2]          0.9542 
_pdbx_refine_tls.L[3][3]          1.6499 
_pdbx_refine_tls.L[1][2]          0.2209 
_pdbx_refine_tls.L[1][3]          -0.0227 
_pdbx_refine_tls.L[2][3]          -0.4960 
_pdbx_refine_tls.S[1][1]          0.0350 
_pdbx_refine_tls.S[2][2]          -0.0075 
_pdbx_refine_tls.S[3][3]          -0.0068 
_pdbx_refine_tls.S[1][2]          -0.0365 
_pdbx_refine_tls.S[1][3]          0.0325 
_pdbx_refine_tls.S[2][3]          0.0788 
_pdbx_refine_tls.S[2][1]          0.0721 
_pdbx_refine_tls.S[3][1]          -0.0351 
_pdbx_refine_tls.S[3][2]          -0.0548 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.selection_details   all 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .         1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.12_2829 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24      3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .         5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 380  ? ? O A HOH 701  ? ? 2.17 
2 1 O   A HOH 1001 ? ? O A HOH 1020 ? ? 2.17 
3 1 OD2 A ASP 574  ? ? O A HOH 702  ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A SER 304 ? ? N A PRO 305 ? ? CA A PRO 305 ? ? 143.05 127.00 16.05  2.40 Y 
2 1 C A SER 304 ? ? N A PRO 305 ? ? CD A PRO 305 ? ? 106.32 120.60 -14.28 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 166 ? ? -124.39 -63.09 
2 1 LEU A 208 ? ? -92.38  52.79  
3 1 MET A 344 ? ? -164.91 116.45 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 1213 ? 5.85 . 
2 1 O ? A HOH 1214 ? 6.60 . 
3 1 O ? A HOH 1215 ? 6.70 . 
4 1 O ? A HOH 1216 ? 7.31 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 187 ? CG  ? A LYS 111 CG  
2  1 Y 1 A LYS 187 ? CD  ? A LYS 111 CD  
3  1 Y 1 A LYS 187 ? CE  ? A LYS 111 CE  
4  1 Y 1 A LYS 187 ? NZ  ? A LYS 111 NZ  
5  1 Y 1 A GLU 195 ? CG  ? A GLU 119 CG  
6  1 Y 1 A GLU 195 ? CD  ? A GLU 119 CD  
7  1 Y 1 A GLU 195 ? OE1 ? A GLU 119 OE1 
8  1 Y 1 A GLU 195 ? OE2 ? A GLU 119 OE2 
9  1 Y 1 A ARG 198 ? CG  ? A ARG 122 CG  
10 1 Y 1 A ARG 198 ? CD  ? A ARG 122 CD  
11 1 Y 1 A ARG 198 ? NE  ? A ARG 122 NE  
12 1 Y 1 A ARG 198 ? CZ  ? A ARG 122 CZ  
13 1 Y 1 A ARG 198 ? NH1 ? A ARG 122 NH1 
14 1 Y 1 A ARG 198 ? NH2 ? A ARG 122 NH2 
15 1 Y 1 A ARG 199 ? CG  ? A ARG 123 CG  
16 1 Y 1 A ARG 199 ? CD  ? A ARG 123 CD  
17 1 Y 1 A ARG 199 ? NE  ? A ARG 123 NE  
18 1 Y 1 A ARG 199 ? CZ  ? A ARG 123 CZ  
19 1 Y 1 A ARG 199 ? NH1 ? A ARG 123 NH1 
20 1 Y 1 A ARG 199 ? NH2 ? A ARG 123 NH2 
21 1 Y 1 A ARG 202 ? CG  ? A ARG 126 CG  
22 1 Y 1 A ARG 202 ? CD  ? A ARG 126 CD  
23 1 Y 1 A ARG 202 ? NE  ? A ARG 126 NE  
24 1 Y 1 A ARG 202 ? CZ  ? A ARG 126 CZ  
25 1 Y 1 A ARG 202 ? NH1 ? A ARG 126 NH1 
26 1 Y 1 A ARG 202 ? NH2 ? A ARG 126 NH2 
27 1 Y 1 A GLN 210 ? CG  ? A GLN 134 CG  
28 1 Y 1 A GLN 210 ? CD  ? A GLN 134 CD  
29 1 Y 1 A GLN 210 ? OE1 ? A GLN 134 OE1 
30 1 Y 1 A GLN 210 ? NE2 ? A GLN 134 NE2 
31 1 Y 1 A ARG 306 ? CG  ? A ARG 230 CG  
32 1 Y 1 A ARG 306 ? CD  ? A ARG 230 CD  
33 1 Y 1 A ARG 306 ? NE  ? A ARG 230 NE  
34 1 Y 1 A ARG 306 ? CZ  ? A ARG 230 CZ  
35 1 Y 1 A ARG 306 ? NH1 ? A ARG 230 NH1 
36 1 Y 1 A ARG 306 ? NH2 ? A ARG 230 NH2 
37 1 Y 1 A GLN 307 ? CG  ? A GLN 231 CG  
38 1 Y 1 A GLN 307 ? CD  ? A GLN 231 CD  
39 1 Y 1 A GLN 307 ? OE1 ? A GLN 231 OE1 
40 1 Y 1 A GLN 307 ? NE2 ? A GLN 231 NE2 
41 1 Y 1 A ARG 308 ? CG  ? A ARG 232 CG  
42 1 Y 1 A ARG 308 ? CD  ? A ARG 232 CD  
43 1 Y 1 A ARG 308 ? NE  ? A ARG 232 NE  
44 1 Y 1 A ARG 308 ? CZ  ? A ARG 232 CZ  
45 1 Y 1 A ARG 308 ? NH1 ? A ARG 232 NH1 
46 1 Y 1 A ARG 308 ? NH2 ? A ARG 232 NH2 
47 1 Y 1 A LYS 309 ? CG  ? A LYS 233 CG  
48 1 Y 1 A LYS 309 ? CD  ? A LYS 233 CD  
49 1 Y 1 A LYS 309 ? CE  ? A LYS 233 CE  
50 1 Y 1 A LYS 309 ? NZ  ? A LYS 233 NZ  
51 1 Y 1 A GLU 333 ? CG  ? A GLU 257 CG  
52 1 Y 1 A GLU 333 ? CD  ? A GLU 257 CD  
53 1 Y 1 A GLU 333 ? OE1 ? A GLU 257 OE1 
54 1 Y 1 A GLU 333 ? OE2 ? A GLU 257 OE2 
55 1 Y 1 A GLN 338 ? CG  ? A GLN 262 CG  
56 1 Y 1 A GLN 338 ? CD  ? A GLN 262 CD  
57 1 Y 1 A GLN 338 ? OE1 ? A GLN 262 OE1 
58 1 Y 1 A GLN 338 ? NE2 ? A GLN 262 NE2 
59 1 Y 1 A GLU 341 ? CG  ? A GLU 265 CG  
60 1 Y 1 A GLU 341 ? CD  ? A GLU 265 CD  
61 1 Y 1 A GLU 341 ? OE1 ? A GLU 265 OE1 
62 1 Y 1 A GLU 341 ? OE2 ? A GLU 265 OE2 
63 1 Y 1 A ARG 347 ? CG  ? A ARG 271 CG  
64 1 Y 1 A ARG 347 ? CD  ? A ARG 271 CD  
65 1 Y 1 A ARG 347 ? NE  ? A ARG 271 NE  
66 1 Y 1 A ARG 347 ? CZ  ? A ARG 271 CZ  
67 1 Y 1 A ARG 347 ? NH1 ? A ARG 271 NH1 
68 1 Y 1 A ARG 347 ? NH2 ? A ARG 271 NH2 
69 1 Y 1 A LYS 365 ? CG  ? A LYS 289 CG  
70 1 Y 1 A LYS 365 ? CD  ? A LYS 289 CD  
71 1 Y 1 A LYS 365 ? CE  ? A LYS 289 CE  
72 1 Y 1 A LYS 365 ? NZ  ? A LYS 289 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 77  ? A GLY 1   
2  1 Y 1 A SER 78  ? A SER 2   
3  1 Y 1 A PHE 79  ? A PHE 3   
4  1 Y 1 A PRO 80  ? A PRO 4   
5  1 Y 1 A SER 81  ? A SER 5   
6  1 Y 1 A THR 82  ? A THR 6   
7  1 Y 1 A VAL 83  ? A VAL 7   
8  1 Y 1 A LYS 84  ? A LYS 8   
9  1 Y 1 A ASN 85  ? A ASN 9   
10 1 Y 1 A GLY 86  ? A GLY 10  
11 1 Y 1 A LEU 87  ? A LEU 11  
12 1 Y 1 A SER 88  ? A SER 12  
13 1 Y 1 A LYS 89  ? A LYS 13  
14 1 Y 1 A ILE 90  ? A ILE 14  
15 1 Y 1 A GLY 91  ? A GLY 15  
16 1 Y 1 A ILE 92  ? A ILE 16  
17 1 Y 1 A PRO 93  ? A PRO 17  
18 1 Y 1 A SER 94  ? A SER 18  
19 1 Y 1 A ASN 95  ? A ASN 19  
20 1 Y 1 A VAL 96  ? A VAL 20  
21 1 Y 1 A LEU 97  ? A LEU 21  
22 1 Y 1 A ASP 98  ? A ASP 22  
23 1 Y 1 A PHE 99  ? A PHE 23  
24 1 Y 1 A MET 100 ? A MET 24  
25 1 Y 1 A PHE 101 ? A PHE 25  
26 1 Y 1 A ASP 102 ? A ASP 26  
27 1 Y 1 A TRP 103 ? A TRP 27  
28 1 Y 1 A THR 104 ? A THR 28  
29 1 Y 1 A GLY 105 ? A GLY 29  
30 1 Y 1 A SER 106 ? A SER 30  
31 1 Y 1 A ASP 107 ? A ASP 31  
32 1 Y 1 A GLN 108 ? A GLN 32  
33 1 Y 1 A ASP 109 ? A ASP 33  
34 1 Y 1 A TYR 110 ? A TYR 34  
35 1 Y 1 A PRO 111 ? A PRO 35  
36 1 Y 1 A LYS 112 ? A LYS 36  
37 1 Y 1 A VAL 113 ? A VAL 37  
38 1 Y 1 A PRO 114 ? A PRO 38  
39 1 Y 1 A GLU 115 ? A GLU 39  
40 1 Y 1 A ALA 116 ? A ALA 40  
41 1 Y 1 A LYS 117 ? A LYS 41  
42 1 Y 1 A GLY 118 ? A GLY 42  
43 1 Y 1 A SER 119 ? A SER 43  
44 1 Y 1 A ILE 120 ? A ILE 44  
45 1 Y 1 A GLN 121 ? A GLN 45  
46 1 Y 1 A ALA 122 ? A ALA 46  
47 1 Y 1 A VAL 123 ? A VAL 47  
48 1 Y 1 A ARG 124 ? A ARG 48  
49 1 Y 1 A ASN 125 ? A ASN 49  
50 1 Y 1 A GLU 126 ? A GLU 50  
51 1 Y 1 A ASP 296 ? A ASP 220 
52 1 Y 1 A ILE 297 ? A ILE 221 
53 1 Y 1 A PRO 298 ? A PRO 222 
54 1 Y 1 A ILE 299 ? A ILE 223 
55 1 Y 1 A TRP 300 ? A TRP 224 
56 1 Y 1 A LYS 301 ? A LYS 225 
57 1 Y 1 A ASP 302 ? A ASP 226 
58 1 Y 1 A ILE 303 ? A ILE 227 
59 1 Y 1 A ASP 361 ? A ASP 285 
60 1 Y 1 A LEU 581 ? A LEU 505 
61 1 Y 1 A PRO 582 ? A PRO 506 
62 1 Y 1 A MET 583 ? A MET 507 
63 1 Y 1 A ASP 584 ? A ASP 508 
64 1 Y 1 A THR 585 ? A THR 509 
65 1 Y 1 A SER 586 ? A SER 510 
66 1 Y 1 A ARG 587 ? A ARG 511 
67 1 Y 1 A ASP 588 ? A ASP 512 
68 1 Y 1 A GLU 589 ? A GLU 513 
69 1 Y 1 A VAL 590 ? A VAL 514 
70 1 Y 1 A SER 591 ? A SER 515 
71 1 Y 1 A SER 592 ? A SER 516 
72 1 Y 1 A ALA 593 ? A ALA 517 
73 1 Y 1 A LEU 594 ? A LEU 518 
74 1 Y 1 A SER 595 ? A SER 519 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
3 RETINAL                           RET 
4 water                             HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#