data_6JM9
# 
_entry.id   6JM9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6JM9         
WWPDB D_1300011354 
EMDB  EMD-9843     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'cryo-EM structure of DOT1L bound to unmodified nucleosome' EMD-9843 'associated EM volume' 
EMDB .                                                           EMD-9844 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6JM9 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jang, S.'   1 0000-0002-9822-6790 
'Song, J.J.' 2 0000-0001-7120-6311 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_id_ASTM           GEDEEP 
_citation.journal_id_CSD            2056 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            33 
_citation.language                  ? 
_citation.page_first                620 
_citation.page_last                 625 
_citation.title                     
;Structural basis of recognition and destabilization of the histone H2B ubiquitinated nucleosome by the DOT1L histone H3 Lys79 methyltransferase.
;
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1101/gad.323790.118 
_citation.pdbx_database_id_PubMed   30923167 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jang, S.'    1 ? 
primary 'Kang, C.'    2 ? 
primary 'Yang, H.S.'  3 ? 
primary 'Jung, T.'    4 ? 
primary 'Hebert, H.'  5 ? 
primary 'Chung, K.Y.' 6 ? 
primary 'Kim, S.J.'   7 ? 
primary 'Hohng, S.'   8 ? 
primary 'Song, J.J.'  9 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6JM9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6JM9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA strand I'                                              37890.262 1 ?        ? ? ? 
2 polymer     man 'DNA strand J'                                              38010.340 1 ?        ? ? ? 
3 polymer     man 'Histone H3.2'                                              11488.410 2 ?        ? ? ? 
4 polymer     man 'Histone H4'                                                9990.770  2 ?        ? ? ? 
5 polymer     man 'Histone H2A'                                               11724.677 2 ?        ? ? ? 
6 polymer     man 'Histone H2B 1.1'                                           10478.032 2 ?        ? ? ? 
7 polymer     man 'Histone-lysine N-methyltransferase, H3 lysine-79 specific' 37930.039 1 2.1.1.43 ? ? ? 
8 non-polymer syn S-ADENOSYLMETHIONINE                                        398.437   1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
6 H2B1.1              
7 'DOT1-like protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)
(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)
(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)
(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)
(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)
(DT)(DG)(DC)
;
;CACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATTCAGCTGAACATGCC
TTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGC
;
I   ? 
2 polydeoxyribonucleotide no no 
;(DG)(DC)(DA)(DG)(DA)(DT)(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)
(DA)(DT)(DT)(DT)(DG)(DG)(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)
(DA)(DA)(DA)(DG)(DG)(DC)(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)
(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)
(DA)(DT)(DG)(DG)(DA)(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)
(DA)(DC)(DT)(DT)(DT)(DT)(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)
(DG)(DT)(DG)
;
;GCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATTCAGCTGAACATGCCTTTTG
ATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTG
;
J   ? 
3 'polypeptide(L)'        no no 
;PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERA
;
;PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERA
;
A,E ? 
4 'polypeptide(L)'        no no 
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
B,F ? 
5 'polypeptide(L)'        no no 
;AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLPKKT
;
;AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLPKKT
;
C,G ? 
6 'polypeptide(L)'        no no 
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSAK
;
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSAK
;
D,H ? 
7 'polypeptide(L)'        no no 
;LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDS
IHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGS
GVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFA
FGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILEN
YFSSLKNP
;
;LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDS
IHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGS
GVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFA
FGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILEN
YFSSLKNP
;
X   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DA  n 
1 3   DC  n 
1 4   DC  n 
1 5   DT  n 
1 6   DG  n 
1 7   DC  n 
1 8   DA  n 
1 9   DG  n 
1 10  DA  n 
1 11  DT  n 
1 12  DT  n 
1 13  DC  n 
1 14  DT  n 
1 15  DA  n 
1 16  DC  n 
1 17  DC  n 
1 18  DA  n 
1 19  DA  n 
1 20  DA  n 
1 21  DA  n 
1 22  DG  n 
1 23  DT  n 
1 24  DG  n 
1 25  DT  n 
1 26  DA  n 
1 27  DT  n 
1 28  DT  n 
1 29  DT  n 
1 30  DG  n 
1 31  DG  n 
1 32  DA  n 
1 33  DA  n 
1 34  DA  n 
1 35  DC  n 
1 36  DT  n 
1 37  DG  n 
1 38  DC  n 
1 39  DT  n 
1 40  DC  n 
1 41  DC  n 
1 42  DA  n 
1 43  DT  n 
1 44  DC  n 
1 45  DA  n 
1 46  DA  n 
1 47  DA  n 
1 48  DA  n 
1 49  DG  n 
1 50  DG  n 
1 51  DC  n 
1 52  DA  n 
1 53  DT  n 
1 54  DG  n 
1 55  DT  n 
1 56  DT  n 
1 57  DC  n 
1 58  DA  n 
1 59  DG  n 
1 60  DC  n 
1 61  DT  n 
1 62  DG  n 
1 63  DA  n 
1 64  DA  n 
1 65  DT  n 
1 66  DT  n 
1 67  DC  n 
1 68  DA  n 
1 69  DG  n 
1 70  DC  n 
1 71  DT  n 
1 72  DG  n 
1 73  DA  n 
1 74  DA  n 
1 75  DC  n 
1 76  DA  n 
1 77  DT  n 
1 78  DG  n 
1 79  DC  n 
1 80  DC  n 
1 81  DT  n 
1 82  DT  n 
1 83  DT  n 
1 84  DT  n 
1 85  DG  n 
1 86  DA  n 
1 87  DT  n 
1 88  DG  n 
1 89  DG  n 
1 90  DA  n 
1 91  DG  n 
1 92  DC  n 
1 93  DA  n 
1 94  DG  n 
1 95  DT  n 
1 96  DT  n 
1 97  DT  n 
1 98  DC  n 
1 99  DC  n 
1 100 DA  n 
1 101 DA  n 
1 102 DA  n 
1 103 DT  n 
1 104 DA  n 
1 105 DC  n 
1 106 DA  n 
1 107 DC  n 
1 108 DT  n 
1 109 DT  n 
1 110 DT  n 
1 111 DT  n 
1 112 DG  n 
1 113 DG  n 
1 114 DT  n 
1 115 DA  n 
1 116 DG  n 
1 117 DA  n 
1 118 DA  n 
1 119 DT  n 
1 120 DC  n 
1 121 DT  n 
1 122 DG  n 
1 123 DC  n 
2 1   DG  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DT  n 
2 8   DC  n 
2 9   DT  n 
2 10  DA  n 
2 11  DC  n 
2 12  DC  n 
2 13  DA  n 
2 14  DA  n 
2 15  DA  n 
2 16  DA  n 
2 17  DG  n 
2 18  DT  n 
2 19  DG  n 
2 20  DT  n 
2 21  DA  n 
2 22  DT  n 
2 23  DT  n 
2 24  DT  n 
2 25  DG  n 
2 26  DG  n 
2 27  DA  n 
2 28  DA  n 
2 29  DA  n 
2 30  DC  n 
2 31  DT  n 
2 32  DG  n 
2 33  DC  n 
2 34  DT  n 
2 35  DC  n 
2 36  DC  n 
2 37  DA  n 
2 38  DT  n 
2 39  DC  n 
2 40  DA  n 
2 41  DA  n 
2 42  DA  n 
2 43  DA  n 
2 44  DG  n 
2 45  DG  n 
2 46  DC  n 
2 47  DA  n 
2 48  DT  n 
2 49  DG  n 
2 50  DT  n 
2 51  DT  n 
2 52  DC  n 
2 53  DA  n 
2 54  DG  n 
2 55  DC  n 
2 56  DT  n 
2 57  DG  n 
2 58  DA  n 
2 59  DA  n 
2 60  DT  n 
2 61  DT  n 
2 62  DC  n 
2 63  DA  n 
2 64  DG  n 
2 65  DC  n 
2 66  DT  n 
2 67  DG  n 
2 68  DA  n 
2 69  DA  n 
2 70  DC  n 
2 71  DA  n 
2 72  DT  n 
2 73  DG  n 
2 74  DC  n 
2 75  DC  n 
2 76  DT  n 
2 77  DT  n 
2 78  DT  n 
2 79  DT  n 
2 80  DG  n 
2 81  DA  n 
2 82  DT  n 
2 83  DG  n 
2 84  DG  n 
2 85  DA  n 
2 86  DG  n 
2 87  DC  n 
2 88  DA  n 
2 89  DG  n 
2 90  DT  n 
2 91  DT  n 
2 92  DT  n 
2 93  DC  n 
2 94  DC  n 
2 95  DA  n 
2 96  DA  n 
2 97  DA  n 
2 98  DT  n 
2 99  DA  n 
2 100 DC  n 
2 101 DA  n 
2 102 DC  n 
2 103 DT  n 
2 104 DT  n 
2 105 DT  n 
2 106 DT  n 
2 107 DG  n 
2 108 DG  n 
2 109 DT  n 
2 110 DA  n 
2 111 DG  n 
2 112 DA  n 
2 113 DA  n 
2 114 DT  n 
2 115 DC  n 
2 116 DT  n 
2 117 DG  n 
2 118 DC  n 
2 119 DA  n 
2 120 DG  n 
2 121 DG  n 
2 122 DT  n 
2 123 DG  n 
3 1   PRO n 
3 2   HIS n 
3 3   ARG n 
3 4   TYR n 
3 5   ARG n 
3 6   PRO n 
3 7   GLY n 
3 8   THR n 
3 9   VAL n 
3 10  ALA n 
3 11  LEU n 
3 12  ARG n 
3 13  GLU n 
3 14  ILE n 
3 15  ARG n 
3 16  ARG n 
3 17  TYR n 
3 18  GLN n 
3 19  LYS n 
3 20  SER n 
3 21  THR n 
3 22  GLU n 
3 23  LEU n 
3 24  LEU n 
3 25  ILE n 
3 26  ARG n 
3 27  LYS n 
3 28  LEU n 
3 29  PRO n 
3 30  PHE n 
3 31  GLN n 
3 32  ARG n 
3 33  LEU n 
3 34  VAL n 
3 35  ARG n 
3 36  GLU n 
3 37  ILE n 
3 38  ALA n 
3 39  GLN n 
3 40  ASP n 
3 41  PHE n 
3 42  LYS n 
3 43  THR n 
3 44  ASP n 
3 45  LEU n 
3 46  ARG n 
3 47  PHE n 
3 48  GLN n 
3 49  SER n 
3 50  SER n 
3 51  ALA n 
3 52  VAL n 
3 53  MET n 
3 54  ALA n 
3 55  LEU n 
3 56  GLN n 
3 57  GLU n 
3 58  ALA n 
3 59  SER n 
3 60  GLU n 
3 61  ALA n 
3 62  TYR n 
3 63  LEU n 
3 64  VAL n 
3 65  GLY n 
3 66  LEU n 
3 67  PHE n 
3 68  GLU n 
3 69  ASP n 
3 70  THR n 
3 71  ASN n 
3 72  LEU n 
3 73  CYS n 
3 74  ALA n 
3 75  ILE n 
3 76  HIS n 
3 77  ALA n 
3 78  LYS n 
3 79  ARG n 
3 80  VAL n 
3 81  THR n 
3 82  ILE n 
3 83  MET n 
3 84  PRO n 
3 85  LYS n 
3 86  ASP n 
3 87  ILE n 
3 88  GLN n 
3 89  LEU n 
3 90  ALA n 
3 91  ARG n 
3 92  ARG n 
3 93  ILE n 
3 94  ARG n 
3 95  GLY n 
3 96  GLU n 
3 97  ARG n 
3 98  ALA n 
4 1   LYS n 
4 2   ARG n 
4 3   HIS n 
4 4   ARG n 
4 5   LYS n 
4 6   VAL n 
4 7   LEU n 
4 8   ARG n 
4 9   ASP n 
4 10  ASN n 
4 11  ILE n 
4 12  GLN n 
4 13  GLY n 
4 14  ILE n 
4 15  THR n 
4 16  LYS n 
4 17  PRO n 
4 18  ALA n 
4 19  ILE n 
4 20  ARG n 
4 21  ARG n 
4 22  LEU n 
4 23  ALA n 
4 24  ARG n 
4 25  ARG n 
4 26  GLY n 
4 27  GLY n 
4 28  VAL n 
4 29  LYS n 
4 30  ARG n 
4 31  ILE n 
4 32  SER n 
4 33  GLY n 
4 34  LEU n 
4 35  ILE n 
4 36  TYR n 
4 37  GLU n 
4 38  GLU n 
4 39  THR n 
4 40  ARG n 
4 41  GLY n 
4 42  VAL n 
4 43  LEU n 
4 44  LYS n 
4 45  VAL n 
4 46  PHE n 
4 47  LEU n 
4 48  GLU n 
4 49  ASN n 
4 50  VAL n 
4 51  ILE n 
4 52  ARG n 
4 53  ASP n 
4 54  ALA n 
4 55  VAL n 
4 56  THR n 
4 57  TYR n 
4 58  THR n 
4 59  GLU n 
4 60  HIS n 
4 61  ALA n 
4 62  LYS n 
4 63  ARG n 
4 64  LYS n 
4 65  THR n 
4 66  VAL n 
4 67  THR n 
4 68  ALA n 
4 69  MET n 
4 70  ASP n 
4 71  VAL n 
4 72  VAL n 
4 73  TYR n 
4 74  ALA n 
4 75  LEU n 
4 76  LYS n 
4 77  ARG n 
4 78  GLN n 
4 79  GLY n 
4 80  ARG n 
4 81  THR n 
4 82  LEU n 
4 83  TYR n 
4 84  GLY n 
4 85  PHE n 
4 86  GLY n 
4 87  GLY n 
5 1   ALA n 
5 2   LYS n 
5 3   THR n 
5 4   ARG n 
5 5   SER n 
5 6   SER n 
5 7   ARG n 
5 8   ALA n 
5 9   GLY n 
5 10  LEU n 
5 11  GLN n 
5 12  PHE n 
5 13  PRO n 
5 14  VAL n 
5 15  GLY n 
5 16  ARG n 
5 17  VAL n 
5 18  HIS n 
5 19  ARG n 
5 20  LEU n 
5 21  LEU n 
5 22  ARG n 
5 23  LYS n 
5 24  GLY n 
5 25  ASN n 
5 26  TYR n 
5 27  ALA n 
5 28  GLU n 
5 29  ARG n 
5 30  VAL n 
5 31  GLY n 
5 32  ALA n 
5 33  GLY n 
5 34  ALA n 
5 35  PRO n 
5 36  VAL n 
5 37  TYR n 
5 38  LEU n 
5 39  ALA n 
5 40  ALA n 
5 41  VAL n 
5 42  LEU n 
5 43  GLU n 
5 44  TYR n 
5 45  LEU n 
5 46  THR n 
5 47  ALA n 
5 48  GLU n 
5 49  ILE n 
5 50  LEU n 
5 51  GLU n 
5 52  LEU n 
5 53  ALA n 
5 54  GLY n 
5 55  ASN n 
5 56  ALA n 
5 57  ALA n 
5 58  ARG n 
5 59  ASP n 
5 60  ASN n 
5 61  LYS n 
5 62  LYS n 
5 63  THR n 
5 64  ARG n 
5 65  ILE n 
5 66  ILE n 
5 67  PRO n 
5 68  ARG n 
5 69  HIS n 
5 70  LEU n 
5 71  GLN n 
5 72  LEU n 
5 73  ALA n 
5 74  VAL n 
5 75  ARG n 
5 76  ASN n 
5 77  ASP n 
5 78  GLU n 
5 79  GLU n 
5 80  LEU n 
5 81  ASN n 
5 82  LYS n 
5 83  LEU n 
5 84  LEU n 
5 85  GLY n 
5 86  ARG n 
5 87  VAL n 
5 88  THR n 
5 89  ILE n 
5 90  ALA n 
5 91  GLN n 
5 92  GLY n 
5 93  GLY n 
5 94  VAL n 
5 95  LEU n 
5 96  PRO n 
5 97  ASN n 
5 98  ILE n 
5 99  GLN n 
5 100 SER n 
5 101 VAL n 
5 102 LEU n 
5 103 LEU n 
5 104 PRO n 
5 105 LYS n 
5 106 LYS n 
5 107 THR n 
6 1   THR n 
6 2   ARG n 
6 3   LYS n 
6 4   GLU n 
6 5   SER n 
6 6   TYR n 
6 7   ALA n 
6 8   ILE n 
6 9   TYR n 
6 10  VAL n 
6 11  TYR n 
6 12  LYS n 
6 13  VAL n 
6 14  LEU n 
6 15  LYS n 
6 16  GLN n 
6 17  VAL n 
6 18  HIS n 
6 19  PRO n 
6 20  ASP n 
6 21  THR n 
6 22  GLY n 
6 23  ILE n 
6 24  SER n 
6 25  SER n 
6 26  LYS n 
6 27  ALA n 
6 28  MET n 
6 29  SER n 
6 30  ILE n 
6 31  MET n 
6 32  ASN n 
6 33  SER n 
6 34  PHE n 
6 35  VAL n 
6 36  ASN n 
6 37  ASP n 
6 38  VAL n 
6 39  PHE n 
6 40  GLU n 
6 41  ARG n 
6 42  ILE n 
6 43  ALA n 
6 44  GLY n 
6 45  GLU n 
6 46  ALA n 
6 47  SER n 
6 48  ARG n 
6 49  LEU n 
6 50  ALA n 
6 51  HIS n 
6 52  TYR n 
6 53  ASN n 
6 54  LYS n 
6 55  ARG n 
6 56  SER n 
6 57  THR n 
6 58  ILE n 
6 59  THR n 
6 60  SER n 
6 61  ARG n 
6 62  GLU n 
6 63  ILE n 
6 64  GLN n 
6 65  THR n 
6 66  ALA n 
6 67  VAL n 
6 68  ARG n 
6 69  LEU n 
6 70  LEU n 
6 71  LEU n 
6 72  PRO n 
6 73  GLY n 
6 74  GLU n 
6 75  LEU n 
6 76  ALA n 
6 77  LYS n 
6 78  HIS n 
6 79  ALA n 
6 80  VAL n 
6 81  SER n 
6 82  GLU n 
6 83  GLY n 
6 84  THR n 
6 85  LYS n 
6 86  ALA n 
6 87  VAL n 
6 88  THR n 
6 89  LYS n 
6 90  TYR n 
6 91  THR n 
6 92  SER n 
6 93  ALA n 
6 94  LYS n 
7 1   LEU n 
7 2   GLU n 
7 3   LEU n 
7 4   ARG n 
7 5   LEU n 
7 6   LYS n 
7 7   SER n 
7 8   PRO n 
7 9   VAL n 
7 10  GLY n 
7 11  ALA n 
7 12  GLU n 
7 13  PRO n 
7 14  ALA n 
7 15  VAL n 
7 16  TYR n 
7 17  PRO n 
7 18  TRP n 
7 19  PRO n 
7 20  LEU n 
7 21  PRO n 
7 22  VAL n 
7 23  TYR n 
7 24  ASP n 
7 25  LYS n 
7 26  HIS n 
7 27  HIS n 
7 28  ASP n 
7 29  ALA n 
7 30  ALA n 
7 31  HIS n 
7 32  GLU n 
7 33  ILE n 
7 34  ILE n 
7 35  GLU n 
7 36  THR n 
7 37  ILE n 
7 38  ARG n 
7 39  TRP n 
7 40  VAL n 
7 41  CYS n 
7 42  GLU n 
7 43  GLU n 
7 44  ILE n 
7 45  PRO n 
7 46  ASP n 
7 47  LEU n 
7 48  LYS n 
7 49  LEU n 
7 50  ALA n 
7 51  MET n 
7 52  GLU n 
7 53  ASN n 
7 54  TYR n 
7 55  VAL n 
7 56  LEU n 
7 57  ILE n 
7 58  ASP n 
7 59  TYR n 
7 60  ASP n 
7 61  THR n 
7 62  LYS n 
7 63  SER n 
7 64  PHE n 
7 65  GLU n 
7 66  SER n 
7 67  MET n 
7 68  GLN n 
7 69  ARG n 
7 70  LEU n 
7 71  CYS n 
7 72  ASP n 
7 73  LYS n 
7 74  TYR n 
7 75  ASN n 
7 76  ARG n 
7 77  ALA n 
7 78  ILE n 
7 79  ASP n 
7 80  SER n 
7 81  ILE n 
7 82  HIS n 
7 83  GLN n 
7 84  LEU n 
7 85  TRP n 
7 86  LYS n 
7 87  GLY n 
7 88  THR n 
7 89  THR n 
7 90  GLN n 
7 91  PRO n 
7 92  MET n 
7 93  LYS n 
7 94  LEU n 
7 95  ASN n 
7 96  THR n 
7 97  ARG n 
7 98  PRO n 
7 99  SER n 
7 100 THR n 
7 101 GLY n 
7 102 LEU n 
7 103 LEU n 
7 104 ARG n 
7 105 HIS n 
7 106 ILE n 
7 107 LEU n 
7 108 GLN n 
7 109 GLN n 
7 110 VAL n 
7 111 TYR n 
7 112 ASN n 
7 113 HIS n 
7 114 SER n 
7 115 VAL n 
7 116 THR n 
7 117 ASP n 
7 118 PRO n 
7 119 GLU n 
7 120 LYS n 
7 121 LEU n 
7 122 ASN n 
7 123 ASN n 
7 124 TYR n 
7 125 GLU n 
7 126 PRO n 
7 127 PHE n 
7 128 SER n 
7 129 PRO n 
7 130 GLU n 
7 131 VAL n 
7 132 TYR n 
7 133 GLY n 
7 134 GLU n 
7 135 THR n 
7 136 SER n 
7 137 PHE n 
7 138 ASP n 
7 139 LEU n 
7 140 VAL n 
7 141 ALA n 
7 142 GLN n 
7 143 MET n 
7 144 ILE n 
7 145 ASP n 
7 146 GLU n 
7 147 ILE n 
7 148 LYS n 
7 149 MET n 
7 150 THR n 
7 151 ASP n 
7 152 ASP n 
7 153 ASP n 
7 154 LEU n 
7 155 PHE n 
7 156 VAL n 
7 157 ASP n 
7 158 LEU n 
7 159 GLY n 
7 160 SER n 
7 161 GLY n 
7 162 VAL n 
7 163 GLY n 
7 164 GLN n 
7 165 VAL n 
7 166 VAL n 
7 167 LEU n 
7 168 GLN n 
7 169 VAL n 
7 170 ALA n 
7 171 ALA n 
7 172 ALA n 
7 173 THR n 
7 174 ASN n 
7 175 CYS n 
7 176 LYS n 
7 177 HIS n 
7 178 HIS n 
7 179 TYR n 
7 180 GLY n 
7 181 VAL n 
7 182 GLU n 
7 183 LYS n 
7 184 ALA n 
7 185 ASP n 
7 186 ILE n 
7 187 PRO n 
7 188 ALA n 
7 189 LYS n 
7 190 TYR n 
7 191 ALA n 
7 192 GLU n 
7 193 THR n 
7 194 MET n 
7 195 ASP n 
7 196 ARG n 
7 197 GLU n 
7 198 PHE n 
7 199 ARG n 
7 200 LYS n 
7 201 TRP n 
7 202 MET n 
7 203 LYS n 
7 204 TRP n 
7 205 TYR n 
7 206 GLY n 
7 207 LYS n 
7 208 LYS n 
7 209 HIS n 
7 210 ALA n 
7 211 GLU n 
7 212 TYR n 
7 213 THR n 
7 214 LEU n 
7 215 GLU n 
7 216 ARG n 
7 217 GLY n 
7 218 ASP n 
7 219 PHE n 
7 220 LEU n 
7 221 SER n 
7 222 GLU n 
7 223 GLU n 
7 224 TRP n 
7 225 ARG n 
7 226 GLU n 
7 227 ARG n 
7 228 ILE n 
7 229 ALA n 
7 230 ASN n 
7 231 THR n 
7 232 SER n 
7 233 VAL n 
7 234 ILE n 
7 235 PHE n 
7 236 VAL n 
7 237 ASN n 
7 238 ASN n 
7 239 PHE n 
7 240 ALA n 
7 241 PHE n 
7 242 GLY n 
7 243 PRO n 
7 244 GLU n 
7 245 VAL n 
7 246 ASP n 
7 247 HIS n 
7 248 GLN n 
7 249 LEU n 
7 250 LYS n 
7 251 GLU n 
7 252 ARG n 
7 253 PHE n 
7 254 ALA n 
7 255 ASN n 
7 256 MET n 
7 257 LYS n 
7 258 GLU n 
7 259 GLY n 
7 260 GLY n 
7 261 ARG n 
7 262 ILE n 
7 263 VAL n 
7 264 SER n 
7 265 SER n 
7 266 LYS n 
7 267 PRO n 
7 268 PHE n 
7 269 ALA n 
7 270 PRO n 
7 271 LEU n 
7 272 ASN n 
7 273 PHE n 
7 274 ARG n 
7 275 ILE n 
7 276 ASN n 
7 277 SER n 
7 278 ARG n 
7 279 ASN n 
7 280 LEU n 
7 281 SER n 
7 282 ASP n 
7 283 ILE n 
7 284 GLY n 
7 285 THR n 
7 286 ILE n 
7 287 MET n 
7 288 ARG n 
7 289 VAL n 
7 290 VAL n 
7 291 GLU n 
7 292 LEU n 
7 293 SER n 
7 294 PRO n 
7 295 LEU n 
7 296 LYS n 
7 297 GLY n 
7 298 SER n 
7 299 VAL n 
7 300 SER n 
7 301 TRP n 
7 302 THR n 
7 303 GLY n 
7 304 LYS n 
7 305 PRO n 
7 306 VAL n 
7 307 SER n 
7 308 TYR n 
7 309 TYR n 
7 310 LEU n 
7 311 HIS n 
7 312 THR n 
7 313 ILE n 
7 314 ASP n 
7 315 ARG n 
7 316 THR n 
7 317 ILE n 
7 318 LEU n 
7 319 GLU n 
7 320 ASN n 
7 321 TYR n 
7 322 PHE n 
7 323 SER n 
7 324 SER n 
7 325 LEU n 
7 326 LYS n 
7 327 ASN n 
7 328 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 123 ?                     ? ?                                         ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli DH5[alpha]' 668369 ? ? ? ? ? ? 'DH5[alpha]' ? ? ? ? ? ? ? ? ? ? ? ? 
? ? 
2 1 sample 'Biological sequence' 1 123 ?                     ? ?                                         ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli DH5[alpha]' 668369 ? ? ? ? ? ? 'DH5[alpha]' ? ? ? ? ? ? ? ? ? ? ? ? 
? ? 
3 1 sample 'Biological sequence' 1 98  'African clawed frog' ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli BL21'       511693 ? ? ? ? ? ? BL21         ? ? ? ? ? ? ? ? ? ? ? ? 
? ? 
4 1 sample 'Biological sequence' 1 87  'African clawed frog' ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli BL21'       511693 ? ? ? ? ? ? BL21         ? ? ? ? ? ? ? ? ? ? ? ? 
? ? 
5 1 sample 'Biological sequence' 1 107 'African clawed frog' ? 'hist1h2aj, LOC494591, XELAEV_18003602mg' ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli BL21'       511693 ? ? ? ? ? ? BL21         ? ? ? ? ? ? ? ? ? ? ? ? 
? ? 
6 1 sample 'Biological sequence' 1 94  'African clawed frog' ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli BL21'       511693 ? ? ? ? ? ? BL21         ? ? ? ? ? ? ? ? ? ? ? ? 
? ? 
7 1 sample 'Biological sequence' 1 328 Human                 ? DOT1L                                     ? ? ? ? ? ? 
'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli BL21'       511693 ? ? ? ? ? ? BL21         ? ? ? ? ? ? ? ? ? ? ? ? 
? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6JM9         6JM9   ? 1 ? 1  
2 PDB 6JM9         6JM9   ? 2 ? 1  
3 UNP H32_XENLA    P84233 ? 3 
;PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERA
;
39 
4 UNP H4_XENLA     P62799 ? 4 
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
17 
5 UNP Q6AZJ8_XENLA Q6AZJ8 ? 5 
;AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLPKKT
;
15 
6 UNP H2B11_XENLA  P02281 ? 6 
;RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS
EGTKAVTKYTSAK
;
34 
7 UNP DOT1L_HUMAN  Q8TEK3 ? 7 
;LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDS
IHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGS
GVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFA
FGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILEN
YFSSLKNP
;
5  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6JM9 I 1 ? 123 ? 6JM9   -63 ? 59  ? -63 59  
2  2 6JM9 J 1 ? 123 ? 6JM9   -59 ? 63  ? -59 63  
3  3 6JM9 A 1 ? 98  ? P84233 39  ? 136 ? 38  135 
4  4 6JM9 B 1 ? 87  ? P62799 17  ? 103 ? 16  102 
5  5 6JM9 C 1 ? 107 ? Q6AZJ8 15  ? 121 ? 14  120 
6  6 6JM9 D 2 ? 94  ? P02281 34  ? 126 ? 30  122 
7  3 6JM9 E 1 ? 98  ? P84233 39  ? 136 ? 38  135 
8  4 6JM9 F 1 ? 87  ? P62799 17  ? 103 ? 16  102 
9  5 6JM9 G 1 ? 107 ? Q6AZJ8 15  ? 121 ? 14  120 
10 6 6JM9 H 2 ? 94  ? P02281 34  ? 126 ? 30  122 
11 7 6JM9 X 1 ? 328 ? Q8TEK3 5   ? 332 ? 5   332 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  6JM9 THR D 1 ? UNP P02281 ? ? 'expression tag' 29 1 
10 6JM9 THR H 1 ? UNP P02281 ? ? 'expression tag' 29 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE                 ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6JM9 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6JM9 
_struct.title                        'cryo-EM structure of DOT1L bound to unmodified nucleosome' 
_struct.pdbx_descriptor              
'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1, Histone-lysine N-methyltransferase, H3 lysine-79 specific/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6JM9 
_struct_keywords.text            'histone, nucleosome, methylation, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY C 7   ? SER C 20  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG C 26  ? ASP C 40  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN C 48  ? ALA C 77  ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET C 83  ? ARG C 94  ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASP D 9   ? ILE D 14  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  AA6 THR D 15  ? GLY D 26  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU D 34  ? ALA D 61  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR D 67  ? GLN D 78  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR E 3   ? GLY E 9   ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 PRO E 13  ? GLY E 24  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 ALA E 32  ? ASN E 60  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 AB3 ILE E 66  ? ASN E 76  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 AB4 ASP E 77  ? LEU E 84  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN E 99  ? LEU E 103 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR F 6   ? HIS F 18  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER F 24  ? ASN F 53  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR F 59  ? LEU F 71  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO F 72  ? ALA F 93  ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 AC1 GLY G 7   ? SER G 20  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG G 26  ? LYS G 42  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN G 48  ? ALA G 77  ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET G 83  ? ARG G 94  ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASP H 9   ? ILE H 14  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 AC6 THR H 15  ? GLY H 26  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU H 34  ? ALA H 61  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR H 67  ? GLN H 78  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR I 3   ? GLY I 9   ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO I 13  ? GLY I 24  ? PRO G 26  GLY G 37  1 ? 12 
HELX_P HELX_P29 AD2 ALA I 32  ? ASN I 60  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P30 AD3 ILE I 66  ? ASN I 76  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 AD4 ASP I 77  ? LEU I 84  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN I 99  ? LEU I 103 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR J 6   ? HIS J 18  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER J 24  ? ASN J 53  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR J 59  ? LEU J 71  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO J 72  ? SER J 92  ? PRO H 100 SER H 120 1 ? 21 
HELX_P HELX_P37 AE1 ALA K 29  ? ILE K 44  ? ALA X 33  ILE X 48  1 ? 16 
HELX_P HELX_P38 AE2 ILE K 44  ? GLU K 52  ? ILE X 48  GLU X 56  1 ? 9  
HELX_P HELX_P39 AE3 SER K 63  ? LYS K 86  ? SER X 67  LYS X 90  1 ? 24 
HELX_P HELX_P40 AE4 SER K 99  ? VAL K 115 ? SER X 103 VAL X 119 1 ? 17 
HELX_P HELX_P41 AE5 PRO K 118 ? ASN K 122 ? PRO X 122 ASN X 126 5 ? 5  
HELX_P HELX_P42 AE6 SER K 136 ? ILE K 147 ? SER X 140 ILE X 151 1 ? 12 
HELX_P HELX_P43 AE7 GLY K 163 ? THR K 173 ? GLY X 167 THR X 177 1 ? 11 
HELX_P HELX_P44 AE8 ALA K 184 ? TYR K 205 ? ALA X 188 TYR X 209 1 ? 22 
HELX_P HELX_P45 AE9 GLU K 222 ? THR K 231 ? GLU X 226 THR X 235 1 ? 10 
HELX_P HELX_P46 AF1 GLY K 242 ? ALA K 254 ? GLY X 246 ALA X 258 1 ? 13 
HELX_P HELX_P47 AF2 ASP K 282 ? THR K 285 ? ASP X 286 THR X 289 5 ? 4  
HELX_P HELX_P48 AF3 ARG K 315 ? LYS K 326 ? ARG X 319 LYS X 330 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DC 1   N3 ? ? ? 1_555 B DG 123 N1 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? A DC 1   N4 ? ? ? 1_555 B DG 123 O6 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? A DC 1   O2 ? ? ? 1_555 B DG 123 N2 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? A DA 2   N1 ? ? ? 1_555 B DT 122 N3 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? A DA 2   N6 ? ? ? 1_555 B DT 122 O4 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 121 O6 ? ? I DC -61 J DG 61  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog7   hydrog ? ? A DC 4   N3 ? ? ? 1_555 B DG 120 N1 ? ? I DC -60 J DG 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? A DC 4   N4 ? ? ? 1_555 B DG 120 O6 ? ? I DC -60 J DG 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? A DC 4   O2 ? ? ? 1_555 B DG 120 N2 ? ? I DC -60 J DG 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? A DT 5   N3 ? ? ? 1_555 B DA 119 N1 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? A DT 5   O4 ? ? ? 1_555 B DA 119 N6 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? A DG 6   N1 ? ? ? 1_555 B DC 118 N3 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? A DG 6   N2 ? ? ? 1_555 B DC 118 O2 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? A DG 6   O6 ? ? ? 1_555 B DC 118 N4 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? A DC 7   N3 ? ? ? 1_555 B DG 117 N1 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? A DC 7   N4 ? ? ? 1_555 B DG 117 O6 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? A DC 7   O2 ? ? ? 1_555 B DG 117 N2 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? A DA 8   N1 ? ? ? 1_555 B DT 116 N3 ? ? I DA -56 J DT 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? A DA 8   N6 ? ? ? 1_555 B DT 116 O4 ? ? I DA -56 J DT 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? A DG 9   N1 ? ? ? 1_555 B DC 115 N3 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? A DG 9   N2 ? ? ? 1_555 B DC 115 O2 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? A DG 9   O6 ? ? ? 1_555 B DC 115 N4 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? A DA 10  N1 ? ? ? 1_555 B DT 114 N3 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? A DA 10  N6 ? ? ? 1_555 B DT 114 O4 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? A DC 13  N3 ? ? ? 1_555 B DG 111 N1 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? A DC 13  N4 ? ? ? 1_555 B DG 111 O6 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 111 N2 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B DG 108 N1 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 108 O6 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? A DC 16  O2 ? ? ? 1_555 B DG 108 N2 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? A DC 17  N3 ? ? ? 1_555 B DG 107 N1 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? A DC 17  N4 ? ? ? 1_555 B DG 107 O6 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? A DC 17  O2 ? ? ? 1_555 B DG 107 N2 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? A DA 18  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA -46 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? A DA 18  N6 ? ? ? 1_555 B DT 106 O4 ? ? I DA -46 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? A DA 19  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? A DA 19  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? A DA 20  N1 ? ? ? 1_555 B DT 104 N3 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? A DA 20  N6 ? ? ? 1_555 B DT 104 O4 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? A DA 21  N1 ? ? ? 1_555 B DT 103 N3 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? A DA 21  N6 ? ? ? 1_555 B DT 103 O4 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? A DG 22  N1 ? ? ? 1_555 B DC 102 N3 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? A DG 22  N2 ? ? ? 1_555 B DC 102 O2 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? A DG 22  O6 ? ? ? 1_555 B DC 102 N4 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? A DT 23  N3 ? ? ? 1_555 B DA 101 N1 ? ? I DT -41 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? A DT 23  O4 ? ? ? 1_555 B DA 101 N6 ? ? I DT -41 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? A DG 24  N2 ? ? ? 1_555 B DC 100 O2 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog50  hydrog ? ? A DT 25  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? A DT 25  O4 ? ? ? 1_555 B DA 99  N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? A DA 26  N1 ? ? ? 1_555 B DT 98  N3 ? ? I DA -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? A DA 26  N6 ? ? ? 1_555 B DT 98  O4 ? ? I DA -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? A DT 27  N3 ? ? ? 1_555 B DA 97  N1 ? ? I DT -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? A DT 27  O4 ? ? ? 1_555 B DA 97  N6 ? ? I DT -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? A DT 28  N3 ? ? ? 1_555 B DA 96  N1 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? A DT 28  O4 ? ? ? 1_555 B DA 96  N6 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? A DT 29  N3 ? ? ? 1_555 B DA 95  N1 ? ? I DT -35 J DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? A DT 29  O4 ? ? ? 1_555 B DA 95  N6 ? ? I DT -35 J DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? A DG 30  N1 ? ? ? 1_555 B DC 94  N3 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? A DG 30  N2 ? ? ? 1_555 B DC 94  O2 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? A DG 30  O6 ? ? ? 1_555 B DC 94  N4 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 93  N3 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B DC 93  O2 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? A DG 31  O6 ? ? ? 1_555 B DC 93  N4 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? A DA 32  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? A DA 32  N6 ? ? ? 1_555 B DT 92  O4 ? ? I DA -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? A DA 33  N1 ? ? ? 1_555 B DT 91  N3 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? A DA 33  N6 ? ? ? 1_555 B DT 91  O4 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? A DA 34  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? A DA 34  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? A DC 35  N3 ? ? ? 1_555 B DG 89  N1 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? A DC 35  N4 ? ? ? 1_555 B DG 89  O6 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? A DC 35  O2 ? ? ? 1_555 B DG 89  N2 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 88  N1 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B DA 88  N6 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? A DG 37  N1 ? ? ? 1_555 B DC 87  N3 ? ? I DG -27 J DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? A DG 37  N2 ? ? ? 1_555 B DC 87  O2 ? ? I DG -27 J DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? A DG 37  O6 ? ? ? 1_555 B DC 87  N4 ? ? I DG -27 J DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? A DC 38  N3 ? ? ? 1_555 B DG 86  N1 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? A DC 38  N4 ? ? ? 1_555 B DG 86  O6 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? A DC 38  O2 ? ? ? 1_555 B DG 86  N2 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? A DT 39  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT -25 J DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? A DT 39  O4 ? ? ? 1_555 B DA 85  N6 ? ? I DT -25 J DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? A DC 40  N3 ? ? ? 1_555 B DG 84  N1 ? ? I DC -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? A DC 40  N4 ? ? ? 1_555 B DG 84  O6 ? ? I DC -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? A DC 40  O2 ? ? ? 1_555 B DG 84  N2 ? ? I DC -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? A DC 41  N3 ? ? ? 1_555 B DG 83  N1 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? A DC 41  N4 ? ? ? 1_555 B DG 83  O6 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? A DC 41  O2 ? ? ? 1_555 B DG 83  N2 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 82  N3 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B DT 82  O4 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? A DT 43  N3 ? ? ? 1_555 B DA 81  N1 ? ? I DT -21 J DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? A DT 43  O4 ? ? ? 1_555 B DA 81  N6 ? ? I DT -21 J DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? A DC 44  N3 ? ? ? 1_555 B DG 80  N1 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? A DC 44  N4 ? ? ? 1_555 B DG 80  O6 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG 80  N2 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? A DA 45  N1 ? ? ? 1_555 B DT 79  N3 ? ? I DA -19 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? A DA 45  N6 ? ? ? 1_555 B DT 79  O4 ? ? I DA -19 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? A DA 46  N1 ? ? ? 1_555 B DT 78  N3 ? ? I DA -18 J DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? A DA 46  N6 ? ? ? 1_555 B DT 78  O4 ? ? I DA -18 J DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? A DA 47  N1 ? ? ? 1_555 B DT 77  N3 ? ? I DA -17 J DT 17  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog103 hydrog ? ? A DA 48  N1 ? ? ? 1_555 B DT 76  N3 ? ? I DA -16 J DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? A DA 48  N6 ? ? ? 1_555 B DT 76  O4 ? ? I DA -16 J DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? A DG 49  O6 ? ? ? 1_555 B DC 74  N4 ? ? I DG -15 J DC 14  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog106 hydrog ? ? A DG 50  N1 ? ? ? 1_555 B DC 74  N3 ? ? I DG -14 J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? A DG 50  N2 ? ? ? 1_555 B DC 74  O2 ? ? I DG -14 J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? A DG 50  O6 ? ? ? 1_555 B DC 74  N4 ? ? I DG -14 J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? A DC 51  N3 ? ? ? 1_555 B DG 73  N1 ? ? I DC -13 J DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? A DC 51  N4 ? ? ? 1_555 B DG 73  O6 ? ? I DC -13 J DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? A DC 51  O2 ? ? ? 1_555 B DG 73  N2 ? ? I DC -13 J DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? A DA 52  N1 ? ? ? 1_555 B DT 72  N3 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? A DA 52  N6 ? ? ? 1_555 B DT 72  O4 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? A DT 53  N3 ? ? ? 1_555 B DA 71  N1 ? ? I DT -11 J DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? A DT 53  O4 ? ? ? 1_555 B DA 71  N6 ? ? I DT -11 J DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? A DG 54  N1 ? ? ? 1_555 B DC 70  N3 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? A DG 54  N2 ? ? ? 1_555 B DC 70  O2 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? A DG 54  O6 ? ? ? 1_555 B DC 70  N4 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? A DT 55  N3 ? ? ? 1_555 B DA 69  N1 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? A DT 55  O4 ? ? ? 1_555 B DA 69  N6 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? A DT 56  N3 ? ? ? 1_555 B DA 68  N1 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? A DT 56  O4 ? ? ? 1_555 B DA 68  N6 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? A DC 57  N3 ? ? ? 1_555 B DG 67  N1 ? ? I DC -7  J DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? A DC 57  N4 ? ? ? 1_555 B DG 67  O6 ? ? I DC -7  J DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? A DC 57  O2 ? ? ? 1_555 B DG 67  N2 ? ? I DC -7  J DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? A DA 58  N1 ? ? ? 1_555 B DT 66  N3 ? ? I DA -6  J DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? A DA 58  N6 ? ? ? 1_555 B DT 66  O4 ? ? I DA -6  J DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC 65  N3 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 65  O2 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC 65  N4 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? A DC 60  N3 ? ? ? 1_555 B DG 64  N1 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? A DC 60  N4 ? ? ? 1_555 B DG 64  O6 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? A DC 60  O2 ? ? ? 1_555 B DG 64  N2 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? A DT 61  N3 ? ? ? 1_555 B DA 63  N1 ? ? I DT -3  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? A DT 61  O4 ? ? ? 1_555 B DA 63  N6 ? ? I DT -3  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? A DG 62  N1 ? ? ? 1_555 B DC 62  N3 ? ? I DG -2  J DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? A DG 62  N2 ? ? ? 1_555 B DC 62  O2 ? ? I DG -2  J DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? A DG 62  O6 ? ? ? 1_555 B DC 62  N4 ? ? I DG -2  J DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? A DA 63  N1 ? ? ? 1_555 B DT 61  N3 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? A DA 63  N6 ? ? ? 1_555 B DT 61  O4 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? A DA 64  N1 ? ? ? 1_555 B DT 60  N3 ? ? I DA 0   J DT 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? A DA 64  N6 ? ? ? 1_555 B DT 60  O4 ? ? I DA 0   J DT 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 59  N1 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 59  N6 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? A DT 66  N3 ? ? ? 1_555 B DA 58  N1 ? ? I DT 2   J DA -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? A DT 66  O4 ? ? ? 1_555 B DA 58  N6 ? ? I DT 2   J DA -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? A DC 67  N3 ? ? ? 1_555 B DG 57  N1 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? A DC 67  N4 ? ? ? 1_555 B DG 57  O6 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? A DC 67  O2 ? ? ? 1_555 B DG 57  N2 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? A DA 68  N1 ? ? ? 1_555 B DT 56  N3 ? ? I DA 4   J DT -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? A DA 68  N6 ? ? ? 1_555 B DT 56  O4 ? ? I DA 4   J DT -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? A DG 69  N1 ? ? ? 1_555 B DC 55  N3 ? ? I DG 5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? A DG 69  N2 ? ? ? 1_555 B DC 55  O2 ? ? I DG 5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? A DG 69  O6 ? ? ? 1_555 B DC 55  N4 ? ? I DG 5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? A DC 70  N3 ? ? ? 1_555 B DG 54  N1 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? A DC 70  N4 ? ? ? 1_555 B DG 54  O6 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? A DC 70  O2 ? ? ? 1_555 B DG 54  N2 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? A DT 71  N3 ? ? ? 1_555 B DA 53  N1 ? ? I DT 7   J DA -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? A DT 71  O4 ? ? ? 1_555 B DA 53  N6 ? ? I DT 7   J DA -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160 hydrog ? ? A DG 72  N1 ? ? ? 1_555 B DC 52  N3 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? A DG 72  N2 ? ? ? 1_555 B DC 52  O2 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? A DG 72  O6 ? ? ? 1_555 B DC 52  N4 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 51  N3 ? ? I DA 9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 51  O4 ? ? I DA 9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? A DA 74  N1 ? ? ? 1_555 B DT 50  N3 ? ? I DA 10  J DT -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166 hydrog ? ? A DA 74  N6 ? ? ? 1_555 B DT 50  O4 ? ? I DA 10  J DT -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167 hydrog ? ? A DC 75  N3 ? ? ? 1_555 B DG 49  N1 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? A DC 75  N4 ? ? ? 1_555 B DG 49  O6 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? A DC 75  O2 ? ? ? 1_555 B DG 49  N2 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? A DA 76  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 12  J DT -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? A DA 76  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 12  J DT -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? A DT 77  N3 ? ? ? 1_555 B DA 47  N1 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? A DT 77  O4 ? ? ? 1_555 B DA 47  N6 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 46  N3 ? ? I DG 14  J DC -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 46  O2 ? ? I DG 14  J DC -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 46  N4 ? ? I DG 14  J DC -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 45  N1 ? ? I DC 15  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 45  O6 ? ? I DC 15  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 45  N2 ? ? I DC 15  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? A DC 80  N3 ? ? ? 1_555 B DG 44  N1 ? ? I DC 16  J DG -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? A DC 80  N4 ? ? ? 1_555 B DG 44  O6 ? ? I DC 16  J DG -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182 hydrog ? ? A DC 80  O2 ? ? ? 1_555 B DG 44  N2 ? ? I DC 16  J DG -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183 hydrog ? ? A DT 81  N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 17  J DA -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? A DT 81  O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 17  J DA -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185 hydrog ? ? A DT 82  N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186 hydrog ? ? A DT 82  O4 ? ? ? 1_555 B DA 42  N6 ? ? I DT 18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? A DT 83  N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 19  J DA -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? A DT 83  O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 19  J DA -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? A DT 84  N3 ? ? ? 1_555 B DA 40  N1 ? ? I DT 20  J DA -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? A DT 84  O4 ? ? ? 1_555 B DA 40  N6 ? ? I DT 20  J DA -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? A DG 85  N1 ? ? ? 1_555 B DC 39  N3 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? A DG 85  N2 ? ? ? 1_555 B DC 39  O2 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? A DG 85  O6 ? ? ? 1_555 B DC 39  N4 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? A DA 86  N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? A DA 86  N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? A DT 87  N3 ? ? ? 1_555 B DA 37  N1 ? ? I DT 23  J DA -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197 hydrog ? ? A DT 87  O4 ? ? ? 1_555 B DA 37  N6 ? ? I DT 23  J DA -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198 hydrog ? ? A DG 88  N1 ? ? ? 1_555 B DC 36  N3 ? ? I DG 24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? A DG 88  N2 ? ? ? 1_555 B DC 36  O2 ? ? I DG 24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200 hydrog ? ? A DG 88  O6 ? ? ? 1_555 B DC 36  N4 ? ? I DG 24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201 hydrog ? ? A DG 89  N1 ? ? ? 1_555 B DC 35  N3 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? A DG 89  N2 ? ? ? 1_555 B DC 35  O2 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? A DG 89  O6 ? ? ? 1_555 B DC 35  N4 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? A DA 90  N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? A DA 90  N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? A DG 91  N1 ? ? ? 1_555 B DC 33  N3 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? A DG 91  N2 ? ? ? 1_555 B DC 33  O2 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? A DG 91  O6 ? ? ? 1_555 B DC 33  N4 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? A DC 92  N3 ? ? ? 1_555 B DG 32  N1 ? ? I DC 28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210 hydrog ? ? A DC 92  N4 ? ? ? 1_555 B DG 32  O6 ? ? I DC 28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211 hydrog ? ? A DC 92  O2 ? ? ? 1_555 B DG 32  N2 ? ? I DC 28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? A DA 93  N1 ? ? ? 1_555 B DT 31  N3 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? A DA 93  N6 ? ? ? 1_555 B DT 31  O4 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 30  N3 ? ? I DG 30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 30  O2 ? ? I DG 30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog216 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 30  N4 ? ? I DG 30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? A DT 95  N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? A DT 95  O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 28  N1 ? ? I DT 32  J DA -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 28  N6 ? ? I DT 32  J DA -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? A DT 97  N3 ? ? ? 1_555 B DA 27  N1 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? A DT 97  O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? A DC 98  N3 ? ? ? 1_555 B DG 26  N1 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? A DC 98  N4 ? ? ? 1_555 B DG 26  O6 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? A DC 98  O2 ? ? ? 1_555 B DG 26  N2 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? A DC 99  N3 ? ? ? 1_555 B DG 25  N1 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? A DC 99  N4 ? ? ? 1_555 B DG 25  O6 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? A DC 99  O2 ? ? ? 1_555 B DG 25  N2 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? A DA 100 N1 ? ? ? 1_555 B DT 24  N3 ? ? I DA 36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? A DA 100 N6 ? ? ? 1_555 B DT 24  O4 ? ? I DA 36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? A DA 101 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? A DA 101 N6 ? ? ? 1_555 B DT 23  O4 ? ? I DA 37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 22  N3 ? ? I DA 38  J DT -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT 22  O4 ? ? I DA 38  J DT -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? A DT 103 N3 ? ? ? 1_555 B DA 21  N1 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? A DT 103 O4 ? ? ? 1_555 B DA 21  N6 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? A DA 104 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 40  J DT -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog238 hydrog ? ? A DA 104 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 40  J DT -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog239 hydrog ? ? A DC 105 N3 ? ? ? 1_555 B DG 19  N1 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? A DC 105 N4 ? ? ? 1_555 B DG 19  O6 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? A DC 105 O2 ? ? ? 1_555 B DG 19  N2 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242 hydrog ? ? A DA 106 N1 ? ? ? 1_555 B DT 18  N3 ? ? I DA 42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243 hydrog ? ? A DA 106 N6 ? ? ? 1_555 B DT 18  O4 ? ? I DA 42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244 hydrog ? ? A DC 107 N3 ? ? ? 1_555 B DG 17  N1 ? ? I DC 43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245 hydrog ? ? A DC 107 N4 ? ? ? 1_555 B DG 17  O6 ? ? I DC 43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B DG 17  N2 ? ? I DC 43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247 hydrog ? ? A DT 108 N3 ? ? ? 1_555 B DA 16  N1 ? ? I DT 44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248 hydrog ? ? A DT 108 O4 ? ? ? 1_555 B DA 16  N6 ? ? I DT 44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249 hydrog ? ? A DT 109 N3 ? ? ? 1_555 B DA 15  N1 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250 hydrog ? ? A DT 109 O4 ? ? ? 1_555 B DA 15  N6 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251 hydrog ? ? A DT 110 N3 ? ? ? 1_555 B DA 14  N1 ? ? I DT 46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252 hydrog ? ? A DT 110 O4 ? ? ? 1_555 B DA 14  N6 ? ? I DT 46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253 hydrog ? ? A DT 111 N3 ? ? ? 1_555 B DA 13  N1 ? ? I DT 47  J DA -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog254 hydrog ? ? A DT 111 O4 ? ? ? 1_555 B DA 13  N6 ? ? I DT 47  J DA -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog255 hydrog ? ? A DG 112 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog256 hydrog ? ? A DG 112 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257 hydrog ? ? A DG 112 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258 hydrog ? ? A DG 113 N1 ? ? ? 1_555 B DC 11  N3 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259 hydrog ? ? A DG 113 N2 ? ? ? 1_555 B DC 11  O2 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260 hydrog ? ? A DG 113 O6 ? ? ? 1_555 B DC 11  N4 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261 hydrog ? ? A DT 114 N3 ? ? ? 1_555 B DA 10  N1 ? ? I DT 50  J DA -50 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog262 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 9   N3 ? ? I DA 51  J DT -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 9   O4 ? ? I DA 51  J DT -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264 hydrog ? ? A DG 116 N1 ? ? ? 1_555 B DC 8   N3 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265 hydrog ? ? A DG 116 N2 ? ? ? 1_555 B DC 8   O2 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266 hydrog ? ? A DG 116 O6 ? ? ? 1_555 B DC 8   N4 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267 hydrog ? ? A DA 117 N1 ? ? ? 1_555 B DT 7   N3 ? ? I DA 53  J DT -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268 hydrog ? ? A DA 117 N6 ? ? ? 1_555 B DT 7   O4 ? ? I DA 53  J DT -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269 hydrog ? ? A DA 118 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 54  J DT -54 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog270 hydrog ? ? A DC 120 N3 ? ? ? 1_555 B DG 4   N1 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271 hydrog ? ? A DC 120 N4 ? ? ? 1_555 B DG 4   O6 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272 hydrog ? ? A DC 120 O2 ? ? ? 1_555 B DG 4   N2 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273 hydrog ? ? A DT 121 N3 ? ? ? 1_555 B DC 2   N3 ? ? I DT 57  J DC -58 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog274 hydrog ? ? A DT 121 O4 ? ? ? 1_555 B DC 2   N4 ? ? I DT 57  J DC -58 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog275 hydrog ? ? A DT 121 N3 ? ? ? 1_555 B DA 3   N1 ? ? I DT 57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276 hydrog ? ? A DT 121 O4 ? ? ? 1_555 B DA 3   N6 ? ? I DT 57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277 hydrog ? ? A DG 122 N1 ? ? ? 1_555 B DC 2   N3 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog278 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 2   O2 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279 hydrog ? ? A DG 122 O6 ? ? ? 1_555 B DC 2   N4 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280 hydrog ? ? A DC 123 N3 ? ? ? 1_555 B DG 1   N1 ? ? I DC 59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281 hydrog ? ? A DC 123 N4 ? ? ? 1_555 B DG 1   O6 ? ? I DC 59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282 hydrog ? ? A DC 123 O2 ? ? ? 1_555 B DG 1   N2 ? ? I DC 59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 18  K . ? TRP 22  X PRO 19  K ? PRO 23  X 1 1.36  
2 ASN 327 K . ? ASN 331 X PRO 328 K ? PRO 332 X 1 11.28 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? parallel      
AB1 1 2 ? parallel      
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? parallel      
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB4 5 6 ? anti-parallel 
AB4 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG C 46  ? PHE C 47  ? ARG A 83  PHE A 84  
AA1 2 THR D 65  ? VAL D 66  ? THR B 80  VAL B 81  
AA2 1 THR C 81  ? ILE C 82  ? THR A 118 ILE A 119 
AA2 2 ARG D 30  ? ILE D 31  ? ARG B 45  ILE B 46  
AA3 1 THR D 81  ? TYR D 83  ? THR B 96  TYR B 98  
AA3 2 VAL I 87  ? ILE I 89  ? VAL G 100 ILE G 102 
AA4 1 ARG E 29  ? VAL E 30  ? ARG C 42  VAL C 43  
AA4 2 THR F 57  ? ILE F 58  ? THR D 85  ILE D 86  
AA5 1 ARG E 64  ? ILE E 65  ? ARG C 77  ILE C 78  
AA5 2 GLY F 22  ? ILE F 23  ? GLY D 50  ILE D 51  
AA6 1 VAL E 87  ? ILE E 89  ? VAL C 100 ILE C 102 
AA6 2 THR H 81  ? TYR H 83  ? THR F 96  TYR F 98  
AA7 1 ARG G 46  ? PHE G 47  ? ARG E 83  PHE E 84  
AA7 2 THR H 65  ? VAL H 66  ? THR F 80  VAL F 81  
AA8 1 THR G 81  ? ILE G 82  ? THR E 118 ILE E 119 
AA8 2 ARG H 30  ? ILE H 31  ? ARG F 45  ILE F 46  
AA9 1 ARG I 29  ? VAL I 30  ? ARG G 42  VAL G 43  
AA9 2 THR J 57  ? ILE J 58  ? THR H 85  ILE H 86  
AB1 1 ARG I 64  ? ILE I 65  ? ARG G 77  ILE G 78  
AB1 2 GLY J 22  ? ILE J 23  ? GLY H 50  ILE H 51  
AB2 1 GLU K 2   ? LEU K 5   ? GLU X 6   LEU X 9   
AB2 2 ALA K 14  ? PRO K 17  ? ALA X 18  PRO X 21  
AB3 1 VAL K 22  ? ASP K 24  ? VAL X 26  ASP X 28  
AB3 2 HIS K 27  ? ASP K 28  ? HIS X 31  ASP X 32  
AB4 1 TYR K 212 ? ARG K 216 ? TYR X 216 ARG X 220 
AB4 2 HIS K 178 ? GLU K 182 ? HIS X 182 GLU X 186 
AB4 3 PHE K 155 ? LEU K 158 ? PHE X 159 LEU X 162 
AB4 4 VAL K 233 ? VAL K 236 ? VAL X 237 VAL X 240 
AB4 5 ARG K 261 ? SER K 264 ? ARG X 265 SER X 268 
AB4 6 TYR K 309 ? ILE K 313 ? TYR X 313 ILE X 317 
AB4 7 MET K 287 ? GLU K 291 ? MET X 291 GLU X 295 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG C 46  ? N ARG A 83  O VAL D 66  ? O VAL B 81  
AA2 1 2 N ILE C 82  ? N ILE A 119 O ARG D 30  ? O ARG B 45  
AA3 1 2 N TYR D 83  ? N TYR B 98  O THR I 88  ? O THR G 101 
AA4 1 2 N ARG E 29  ? N ARG C 42  O ILE F 58  ? O ILE D 86  
AA5 1 2 N ILE E 65  ? N ILE C 78  O GLY F 22  ? O GLY D 50  
AA6 1 2 N THR E 88  ? N THR C 101 O TYR H 83  ? O TYR F 98  
AA7 1 2 N ARG G 46  ? N ARG E 83  O VAL H 66  ? O VAL F 81  
AA8 1 2 N ILE G 82  ? N ILE E 119 O ARG H 30  ? O ARG F 45  
AA9 1 2 N ARG I 29  ? N ARG G 42  O ILE J 58  ? O ILE H 86  
AB1 1 2 N ILE I 65  ? N ILE G 78  O GLY J 22  ? O GLY H 50  
AB2 1 2 N LEU K 3   ? N LEU X 7   O TYR K 16  ? O TYR X 20  
AB3 1 2 N TYR K 23  ? N TYR X 27  O HIS K 27  ? O HIS X 31  
AB4 1 2 O GLU K 215 ? O GLU X 219 N GLY K 180 ? N GLY X 184 
AB4 2 3 O TYR K 179 ? O TYR X 183 N PHE K 155 ? N PHE X 159 
AB4 3 4 N VAL K 156 ? N VAL X 160 O PHE K 235 ? O PHE X 239 
AB4 4 5 N ILE K 234 ? N ILE X 238 O VAL K 263 ? O VAL X 267 
AB4 5 6 N ILE K 262 ? N ILE X 266 O HIS K 311 ? O HIS X 315 
AB4 6 7 O LEU K 310 ? O LEU X 314 N VAL K 290 ? N VAL X 294 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software X SAM 500 ? 18 'binding site for Di-peptide SAM X 500 and GLY X 137' 
AC2 Software X SAM 500 ? 19 'binding site for Di-peptide SAM X 500 and PHE X 223' 
AC3 Software X SAM 500 ? 19 'binding site for Di-peptide SAM X 500 and PHE X 223' 
AC4 Software X SAM 500 ? 19 'binding site for Di-peptide SAM X 500 and PHE X 223' 
AC5 Software X SAM 500 ? 20 'binding site for Di-peptide SAM X 500 and LEU X 224' 
AC6 Software X SAM 500 ? 20 'binding site for Di-peptide SAM X 500 and LEU X 224' 
AC7 Software X SAM 500 ? 20 'binding site for Di-peptide SAM X 500 and LEU X 224' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 18 PRO K 129 ? PRO X 133 . ? 1_555 ? 
2   AC1 18 VAL K 131 ? VAL X 135 . ? 1_555 ? 
3   AC1 18 TYR K 132 ? TYR X 136 . ? 1_555 ? 
4   AC1 18 GLU K 134 ? GLU X 138 . ? 1_555 ? 
5   AC1 18 THR K 135 ? THR X 139 . ? 1_555 ? 
6   AC1 18 ASP K 157 ? ASP X 161 . ? 1_555 ? 
7   AC1 18 GLY K 159 ? GLY X 163 . ? 1_555 ? 
8   AC1 18 SER K 160 ? SER X 164 . ? 1_555 ? 
9   AC1 18 GLU K 182 ? GLU X 186 . ? 1_555 ? 
10  AC1 18 LYS K 183 ? LYS X 187 . ? 1_555 ? 
11  AC1 18 ALA K 184 ? ALA X 188 . ? 1_555 ? 
12  AC1 18 ASP K 218 ? ASP X 222 . ? 1_555 ? 
13  AC1 18 PHE K 219 ? PHE X 223 . ? 1_555 ? 
14  AC1 18 LEU K 220 ? LEU X 224 . ? 1_555 ? 
15  AC1 18 SER K 221 ? SER X 225 . ? 1_555 ? 
16  AC1 18 PHE K 235 ? PHE X 239 . ? 1_555 ? 
17  AC1 18 ASN K 237 ? ASN X 241 . ? 1_555 ? 
18  AC1 18 PHE K 241 ? PHE X 245 . ? 1_555 ? 
19  AC2 19 PRO K 129 ? PRO X 133 . ? 1_555 ? 
20  AC2 19 VAL K 131 ? VAL X 135 . ? 1_555 ? 
21  AC2 19 TYR K 132 ? TYR X 136 . ? 1_555 ? 
22  AC2 19 GLY K 133 ? GLY X 137 . ? 1_555 ? 
23  AC2 19 GLU K 134 ? GLU X 138 . ? 1_555 ? 
24  AC2 19 THR K 135 ? THR X 139 . ? 1_555 ? 
25  AC2 19 ASP K 157 ? ASP X 161 . ? 1_555 ? 
26  AC2 19 GLY K 159 ? GLY X 163 . ? 1_555 ? 
27  AC2 19 SER K 160 ? SER X 164 . ? 1_555 ? 
28  AC2 19 VAL K 181 ? VAL X 185 . ? 1_555 ? 
29  AC2 19 GLU K 182 ? GLU X 186 . ? 1_555 ? 
30  AC2 19 LYS K 183 ? LYS X 187 . ? 1_555 ? 
31  AC2 19 ALA K 184 ? ALA X 188 . ? 1_555 ? 
32  AC2 19 ASP K 218 ? ASP X 222 . ? 1_555 ? 
33  AC2 19 LEU K 220 ? LEU X 224 . ? 1_555 ? 
34  AC2 19 SER K 221 ? SER X 225 . ? 1_555 ? 
35  AC2 19 PHE K 235 ? PHE X 239 . ? 1_555 ? 
36  AC2 19 ASN K 237 ? ASN X 241 . ? 1_555 ? 
37  AC2 19 PHE K 241 ? PHE X 245 . ? 1_555 ? 
38  AC3 19 PRO K 129 ? PRO X 133 . ? 1_555 ? 
39  AC3 19 VAL K 131 ? VAL X 135 . ? 1_555 ? 
40  AC3 19 TYR K 132 ? TYR X 136 . ? 1_555 ? 
41  AC3 19 GLY K 133 ? GLY X 137 . ? 1_555 ? 
42  AC3 19 GLU K 134 ? GLU X 138 . ? 1_555 ? 
43  AC3 19 THR K 135 ? THR X 139 . ? 1_555 ? 
44  AC3 19 ASP K 157 ? ASP X 161 . ? 1_555 ? 
45  AC3 19 GLY K 159 ? GLY X 163 . ? 1_555 ? 
46  AC3 19 SER K 160 ? SER X 164 . ? 1_555 ? 
47  AC3 19 VAL K 181 ? VAL X 185 . ? 1_555 ? 
48  AC3 19 GLU K 182 ? GLU X 186 . ? 1_555 ? 
49  AC3 19 LYS K 183 ? LYS X 187 . ? 1_555 ? 
50  AC3 19 ALA K 184 ? ALA X 188 . ? 1_555 ? 
51  AC3 19 ASP K 218 ? ASP X 222 . ? 1_555 ? 
52  AC3 19 LEU K 220 ? LEU X 224 . ? 1_555 ? 
53  AC3 19 SER K 221 ? SER X 225 . ? 1_555 ? 
54  AC3 19 PHE K 235 ? PHE X 239 . ? 1_555 ? 
55  AC3 19 ASN K 237 ? ASN X 241 . ? 1_555 ? 
56  AC3 19 PHE K 241 ? PHE X 245 . ? 1_555 ? 
57  AC4 19 PRO K 129 ? PRO X 133 . ? 1_555 ? 
58  AC4 19 VAL K 131 ? VAL X 135 . ? 1_555 ? 
59  AC4 19 TYR K 132 ? TYR X 136 . ? 1_555 ? 
60  AC4 19 GLY K 133 ? GLY X 137 . ? 1_555 ? 
61  AC4 19 GLU K 134 ? GLU X 138 . ? 1_555 ? 
62  AC4 19 THR K 135 ? THR X 139 . ? 1_555 ? 
63  AC4 19 ASP K 157 ? ASP X 161 . ? 1_555 ? 
64  AC4 19 GLY K 159 ? GLY X 163 . ? 1_555 ? 
65  AC4 19 SER K 160 ? SER X 164 . ? 1_555 ? 
66  AC4 19 VAL K 181 ? VAL X 185 . ? 1_555 ? 
67  AC4 19 GLU K 182 ? GLU X 186 . ? 1_555 ? 
68  AC4 19 LYS K 183 ? LYS X 187 . ? 1_555 ? 
69  AC4 19 ALA K 184 ? ALA X 188 . ? 1_555 ? 
70  AC4 19 ASP K 218 ? ASP X 222 . ? 1_555 ? 
71  AC4 19 LEU K 220 ? LEU X 224 . ? 1_555 ? 
72  AC4 19 SER K 221 ? SER X 225 . ? 1_555 ? 
73  AC4 19 PHE K 235 ? PHE X 239 . ? 1_555 ? 
74  AC4 19 ASN K 237 ? ASN X 241 . ? 1_555 ? 
75  AC4 19 PHE K 241 ? PHE X 245 . ? 1_555 ? 
76  AC5 20 PRO K 129 ? PRO X 133 . ? 1_555 ? 
77  AC5 20 VAL K 131 ? VAL X 135 . ? 1_555 ? 
78  AC5 20 TYR K 132 ? TYR X 136 . ? 1_555 ? 
79  AC5 20 GLY K 133 ? GLY X 137 . ? 1_555 ? 
80  AC5 20 GLU K 134 ? GLU X 138 . ? 1_555 ? 
81  AC5 20 THR K 135 ? THR X 139 . ? 1_555 ? 
82  AC5 20 ASP K 157 ? ASP X 161 . ? 1_555 ? 
83  AC5 20 GLY K 159 ? GLY X 163 . ? 1_555 ? 
84  AC5 20 SER K 160 ? SER X 164 . ? 1_555 ? 
85  AC5 20 GLU K 182 ? GLU X 186 . ? 1_555 ? 
86  AC5 20 LYS K 183 ? LYS X 187 . ? 1_555 ? 
87  AC5 20 ALA K 184 ? ALA X 188 . ? 1_555 ? 
88  AC5 20 ASP K 218 ? ASP X 222 . ? 1_555 ? 
89  AC5 20 PHE K 219 ? PHE X 223 . ? 1_555 ? 
90  AC5 20 SER K 221 ? SER X 225 . ? 1_555 ? 
91  AC5 20 PHE K 235 ? PHE X 239 . ? 1_555 ? 
92  AC5 20 ASN K 237 ? ASN X 241 . ? 1_555 ? 
93  AC5 20 PHE K 241 ? PHE X 245 . ? 1_555 ? 
94  AC5 20 LEU K 249 ? LEU X 253 . ? 1_555 ? 
95  AC5 20 ARG K 252 ? ARG X 256 . ? 1_555 ? 
96  AC6 20 PRO K 129 ? PRO X 133 . ? 1_555 ? 
97  AC6 20 VAL K 131 ? VAL X 135 . ? 1_555 ? 
98  AC6 20 TYR K 132 ? TYR X 136 . ? 1_555 ? 
99  AC6 20 GLY K 133 ? GLY X 137 . ? 1_555 ? 
100 AC6 20 GLU K 134 ? GLU X 138 . ? 1_555 ? 
101 AC6 20 THR K 135 ? THR X 139 . ? 1_555 ? 
102 AC6 20 ASP K 157 ? ASP X 161 . ? 1_555 ? 
103 AC6 20 GLY K 159 ? GLY X 163 . ? 1_555 ? 
104 AC6 20 SER K 160 ? SER X 164 . ? 1_555 ? 
105 AC6 20 GLU K 182 ? GLU X 186 . ? 1_555 ? 
106 AC6 20 LYS K 183 ? LYS X 187 . ? 1_555 ? 
107 AC6 20 ALA K 184 ? ALA X 188 . ? 1_555 ? 
108 AC6 20 ASP K 218 ? ASP X 222 . ? 1_555 ? 
109 AC6 20 PHE K 219 ? PHE X 223 . ? 1_555 ? 
110 AC6 20 SER K 221 ? SER X 225 . ? 1_555 ? 
111 AC6 20 PHE K 235 ? PHE X 239 . ? 1_555 ? 
112 AC6 20 ASN K 237 ? ASN X 241 . ? 1_555 ? 
113 AC6 20 PHE K 241 ? PHE X 245 . ? 1_555 ? 
114 AC6 20 LEU K 249 ? LEU X 253 . ? 1_555 ? 
115 AC6 20 ARG K 252 ? ARG X 256 . ? 1_555 ? 
116 AC7 20 PRO K 129 ? PRO X 133 . ? 1_555 ? 
117 AC7 20 VAL K 131 ? VAL X 135 . ? 1_555 ? 
118 AC7 20 TYR K 132 ? TYR X 136 . ? 1_555 ? 
119 AC7 20 GLY K 133 ? GLY X 137 . ? 1_555 ? 
120 AC7 20 GLU K 134 ? GLU X 138 . ? 1_555 ? 
121 AC7 20 THR K 135 ? THR X 139 . ? 1_555 ? 
122 AC7 20 ASP K 157 ? ASP X 161 . ? 1_555 ? 
123 AC7 20 GLY K 159 ? GLY X 163 . ? 1_555 ? 
124 AC7 20 SER K 160 ? SER X 164 . ? 1_555 ? 
125 AC7 20 GLU K 182 ? GLU X 186 . ? 1_555 ? 
126 AC7 20 LYS K 183 ? LYS X 187 . ? 1_555 ? 
127 AC7 20 ALA K 184 ? ALA X 188 . ? 1_555 ? 
128 AC7 20 ASP K 218 ? ASP X 222 . ? 1_555 ? 
129 AC7 20 PHE K 219 ? PHE X 223 . ? 1_555 ? 
130 AC7 20 SER K 221 ? SER X 225 . ? 1_555 ? 
131 AC7 20 PHE K 235 ? PHE X 239 . ? 1_555 ? 
132 AC7 20 ASN K 237 ? ASN X 241 . ? 1_555 ? 
133 AC7 20 PHE K 241 ? PHE X 245 . ? 1_555 ? 
134 AC7 20 LEU K 249 ? LEU X 253 . ? 1_555 ? 
135 AC7 20 ARG K 252 ? ARG X 256 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          6JM9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    6JM9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     P P     . DC  A 1 1   ? 112.145 93.382  139.530 1.00 93.33  ? -63 DC  I P     1 
ATOM   2     O OP1   . DC  A 1 1   ? 113.325 94.230  139.824 1.00 94.53  ? -63 DC  I OP1   1 
ATOM   3     O OP2   . DC  A 1 1   ? 111.652 93.268  138.131 1.00 93.34  ? -63 DC  I OP2   1 
ATOM   4     O "O5'" . DC  A 1 1   ? 112.432 91.920  140.076 1.00 92.83  ? -63 DC  I "O5'" 1 
ATOM   5     C "C5'" . DC  A 1 1   ? 112.969 91.733  141.376 1.00 93.89  ? -63 DC  I "C5'" 1 
ATOM   6     C "C4'" . DC  A 1 1   ? 113.574 90.356  141.476 1.00 95.75  ? -63 DC  I "C4'" 1 
ATOM   7     O "O4'" . DC  A 1 1   ? 112.588 89.392  141.920 1.00 95.29  ? -63 DC  I "O4'" 1 
ATOM   8     C "C3'" . DC  A 1 1   ? 114.094 89.856  140.126 1.00 96.23  ? -63 DC  I "C3'" 1 
ATOM   9     O "O3'" . DC  A 1 1   ? 115.337 89.183  140.299 1.00 97.45  ? -63 DC  I "O3'" 1 
ATOM   10    C "C2'" . DC  A 1 1   ? 113.027 88.866  139.693 1.00 96.59  ? -63 DC  I "C2'" 1 
ATOM   11    C "C1'" . DC  A 1 1   ? 112.588 88.296  141.029 1.00 95.79  ? -63 DC  I "C1'" 1 
ATOM   12    N N1    . DC  A 1 1   ? 111.254 87.677  141.047 1.00 95.97  ? -63 DC  I N1    1 
ATOM   13    C C2    . DC  A 1 1   ? 110.967 86.736  142.041 1.00 96.75  ? -63 DC  I C2    1 
ATOM   14    O O2    . DC  A 1 1   ? 111.824 86.493  142.904 1.00 99.21  ? -63 DC  I O2    1 
ATOM   15    N N3    . DC  A 1 1   ? 109.766 86.117  142.040 1.00 97.10  ? -63 DC  I N3    1 
ATOM   16    C C4    . DC  A 1 1   ? 108.865 86.414  141.103 1.00 96.52  ? -63 DC  I C4    1 
ATOM   17    N N4    . DC  A 1 1   ? 107.699 85.766  141.134 1.00 96.94  ? -63 DC  I N4    1 
ATOM   18    C C5    . DC  A 1 1   ? 109.120 87.387  140.092 1.00 95.87  ? -63 DC  I C5    1 
ATOM   19    C C6    . DC  A 1 1   ? 110.315 87.990  140.103 1.00 95.51  ? -63 DC  I C6    1 
ATOM   20    P P     . DA  A 1 2   ? 116.668 89.786  139.631 1.00 97.52  ? -62 DA  I P     1 
ATOM   21    O OP1   . DA  A 1 2   ? 116.763 91.219  140.015 1.00 95.76  ? -62 DA  I OP1   1 
ATOM   22    O OP2   . DA  A 1 2   ? 116.697 89.408  138.193 1.00 97.24  ? -62 DA  I OP2   1 
ATOM   23    O "O5'" . DA  A 1 2   ? 117.816 88.984  140.384 1.00 93.46  ? -62 DA  I "O5'" 1 
ATOM   24    C "C5'" . DA  A 1 2   ? 117.849 88.938  141.806 1.00 88.17  ? -62 DA  I "C5'" 1 
ATOM   25    C "C4'" . DA  A 1 2   ? 117.865 87.504  142.280 1.00 86.71  ? -62 DA  I "C4'" 1 
ATOM   26    O "O4'" . DA  A 1 2   ? 116.530 86.944  142.314 1.00 85.62  ? -62 DA  I "O4'" 1 
ATOM   27    C "C3'" . DA  A 1 2   ? 118.702 86.558  141.418 1.00 85.56  ? -62 DA  I "C3'" 1 
ATOM   28    O "O3'" . DA  A 1 2   ? 119.461 85.687  142.254 1.00 83.65  ? -62 DA  I "O3'" 1 
ATOM   29    C "C2'" . DA  A 1 2   ? 117.659 85.754  140.665 1.00 86.05  ? -62 DA  I "C2'" 1 
ATOM   30    C "C1'" . DA  A 1 2   ? 116.547 85.672  141.690 1.00 85.63  ? -62 DA  I "C1'" 1 
ATOM   31    N N9    . DA  A 1 2   ? 115.222 85.416  141.127 1.00 85.36  ? -62 DA  I N9    1 
ATOM   32    C C8    . DA  A 1 2   ? 114.621 86.042  140.065 1.00 85.92  ? -62 DA  I C8    1 
ATOM   33    N N7    . DA  A 1 2   ? 113.424 85.580  139.786 1.00 84.84  ? -62 DA  I N7    1 
ATOM   34    C C5    . DA  A 1 2   ? 113.225 84.582  140.730 1.00 83.67  ? -62 DA  I C5    1 
ATOM   35    C C6    . DA  A 1 2   ? 112.153 83.706  140.970 1.00 83.26  ? -62 DA  I C6    1 
ATOM   36    N N6    . DA  A 1 2   ? 111.029 83.693  140.249 1.00 82.78  ? -62 DA  I N6    1 
ATOM   37    N N1    . DA  A 1 2   ? 112.273 82.831  141.990 1.00 82.71  ? -62 DA  I N1    1 
ATOM   38    C C2    . DA  A 1 2   ? 113.398 82.842  142.711 1.00 82.46  ? -62 DA  I C2    1 
ATOM   39    N N3    . DA  A 1 2   ? 114.473 83.612  142.585 1.00 83.68  ? -62 DA  I N3    1 
ATOM   40    C C4    . DA  A 1 2   ? 114.322 84.471  141.563 1.00 84.33  ? -62 DA  I C4    1 
ATOM   41    P P     . DC  A 1 3   ? 120.430 84.596  141.594 1.00 79.50  ? -61 DC  I P     1 
ATOM   42    O OP1   . DC  A 1 3   ? 121.693 84.643  142.365 1.00 83.40  ? -61 DC  I OP1   1 
ATOM   43    O OP2   . DC  A 1 3   ? 120.461 84.786  140.126 1.00 81.40  ? -61 DC  I OP2   1 
ATOM   44    O "O5'" . DC  A 1 3   ? 119.694 83.224  141.910 1.00 81.62  ? -61 DC  I "O5'" 1 
ATOM   45    C "C5'" . DC  A 1 3   ? 119.319 82.899  143.243 1.00 83.48  ? -61 DC  I "C5'" 1 
ATOM   46    C "C4'" . DC  A 1 3   ? 118.654 81.542  143.284 1.00 86.21  ? -61 DC  I "C4'" 1 
ATOM   47    O "O4'" . DC  A 1 3   ? 117.309 81.617  142.752 1.00 86.71  ? -61 DC  I "O4'" 1 
ATOM   48    C "C3'" . DC  A 1 3   ? 119.372 80.459  142.481 1.00 87.22  ? -61 DC  I "C3'" 1 
ATOM   49    O "O3'" . DC  A 1 3   ? 119.346 79.230  143.208 1.00 89.20  ? -61 DC  I "O3'" 1 
ATOM   50    C "C2'" . DC  A 1 3   ? 118.535 80.344  141.218 1.00 86.73  ? -61 DC  I "C2'" 1 
ATOM   51    C "C1'" . DC  A 1 3   ? 117.142 80.625  141.751 1.00 87.09  ? -61 DC  I "C1'" 1 
ATOM   52    N N1    . DC  A 1 3   ? 116.177 81.133  140.757 1.00 84.97  ? -61 DC  I N1    1 
ATOM   53    C C2    . DC  A 1 3   ? 114.930 80.515  140.662 1.00 83.10  ? -61 DC  I C2    1 
ATOM   54    O O2    . DC  A 1 3   ? 114.676 79.565  141.412 1.00 84.56  ? -61 DC  I O2    1 
ATOM   55    N N3    . DC  A 1 3   ? 114.034 80.966  139.761 1.00 81.46  ? -61 DC  I N3    1 
ATOM   56    C C4    . DC  A 1 3   ? 114.342 81.993  138.972 1.00 82.39  ? -61 DC  I C4    1 
ATOM   57    N N4    . DC  A 1 3   ? 113.422 82.406  138.099 1.00 80.62  ? -61 DC  I N4    1 
ATOM   58    C C5    . DC  A 1 3   ? 115.610 82.645  139.045 1.00 83.34  ? -61 DC  I C5    1 
ATOM   59    C C6    . DC  A 1 3   ? 116.489 82.186  139.944 1.00 84.91  ? -61 DC  I C6    1 
ATOM   60    P P     . DC  A 1 4   ? 120.238 77.992  142.712 1.00 89.57  ? -60 DC  I P     1 
ATOM   61    O OP1   . DC  A 1 4   ? 120.741 77.314  143.928 1.00 92.12  ? -60 DC  I OP1   1 
ATOM   62    O OP2   . DC  A 1 4   ? 121.200 78.476  141.691 1.00 90.40  ? -60 DC  I OP2   1 
ATOM   63    O "O5'" . DC  A 1 4   ? 119.180 77.042  142.000 1.00 91.19  ? -60 DC  I "O5'" 1 
ATOM   64    C "C5'" . DC  A 1 4   ? 118.113 76.465  142.742 1.00 95.23  ? -60 DC  I "C5'" 1 
ATOM   65    C "C4'" . DC  A 1 4   ? 117.265 75.588  141.853 1.00 98.97  ? -60 DC  I "C4'" 1 
ATOM   66    O "O4'" . DC  A 1 4   ? 116.409 76.395  141.006 1.00 99.21  ? -60 DC  I "O4'" 1 
ATOM   67    C "C3'" . DC  A 1 4   ? 118.054 74.672  140.913 1.00 101.73 ? -60 DC  I "C3'" 1 
ATOM   68    O "O3'" . DC  A 1 4   ? 117.438 73.383  140.864 1.00 107.37 ? -60 DC  I "O3'" 1 
ATOM   69    C "C2'" . DC  A 1 4   ? 117.917 75.355  139.565 1.00 100.32 ? -60 DC  I "C2'" 1 
ATOM   70    C "C1'" . DC  A 1 4   ? 116.524 75.947  139.665 1.00 98.48  ? -60 DC  I "C1'" 1 
ATOM   71    N N1    . DC  A 1 4   ? 116.251 77.086  138.770 1.00 95.67  ? -60 DC  I N1    1 
ATOM   72    C C2    . DC  A 1 4   ? 114.999 77.167  138.149 1.00 95.24  ? -60 DC  I C2    1 
ATOM   73    O O2    . DC  A 1 4   ? 114.160 76.282  138.372 1.00 96.25  ? -60 DC  I O2    1 
ATOM   74    N N3    . DC  A 1 4   ? 114.736 78.205  137.323 1.00 93.59  ? -60 DC  I N3    1 
ATOM   75    C C4    . DC  A 1 4   ? 115.660 79.141  137.115 1.00 92.84  ? -60 DC  I C4    1 
ATOM   76    N N4    . DC  A 1 4   ? 115.352 80.154  136.306 1.00 90.50  ? -60 DC  I N4    1 
ATOM   77    C C5    . DC  A 1 4   ? 116.943 79.084  137.733 1.00 93.72  ? -60 DC  I C5    1 
ATOM   78    C C6    . DC  A 1 4   ? 117.193 78.049  138.545 1.00 94.88  ? -60 DC  I C6    1 
ATOM   79    P P     . DT  A 1 5   ? 118.239 72.138  140.242 1.00 110.15 ? -59 DT  I P     1 
ATOM   80    O OP1   . DT  A 1 5   ? 118.559 71.218  141.360 1.00 111.56 ? -59 DT  I OP1   1 
ATOM   81    O OP2   . DT  A 1 5   ? 119.336 72.663  139.389 1.00 110.40 ? -59 DT  I OP2   1 
ATOM   82    O "O5'" . DT  A 1 5   ? 117.155 71.430  139.310 1.00 112.33 ? -59 DT  I "O5'" 1 
ATOM   83    C "C5'" . DT  A 1 5   ? 115.882 71.056  139.837 1.00 115.07 ? -59 DT  I "C5'" 1 
ATOM   84    C "C4'" . DT  A 1 5   ? 114.917 70.727  138.721 1.00 117.25 ? -59 DT  I "C4'" 1 
ATOM   85    O "O4'" . DT  A 1 5   ? 114.575 71.927  137.983 1.00 117.76 ? -59 DT  I "O4'" 1 
ATOM   86    C "C3'" . DT  A 1 5   ? 115.427 69.724  137.684 1.00 118.85 ? -59 DT  I "C3'" 1 
ATOM   87    O "O3'" . DT  A 1 5   ? 114.367 68.844  137.298 1.00 120.71 ? -59 DT  I "O3'" 1 
ATOM   88    C "C2'" . DT  A 1 5   ? 115.816 70.601  136.509 1.00 118.28 ? -59 DT  I "C2'" 1 
ATOM   89    C "C1'" . DT  A 1 5   ? 114.794 71.717  136.596 1.00 117.33 ? -59 DT  I "C1'" 1 
ATOM   90    N N1    . DT  A 1 5   ? 115.230 72.996  135.999 1.00 116.39 ? -59 DT  I N1    1 
ATOM   91    C C2    . DT  A 1 5   ? 114.398 73.605  135.084 1.00 115.78 ? -59 DT  I C2    1 
ATOM   92    O O2    . DT  A 1 5   ? 113.328 73.132  134.735 1.00 115.51 ? -59 DT  I O2    1 
ATOM   93    N N3    . DT  A 1 5   ? 114.871 74.793  134.584 1.00 114.62 ? -59 DT  I N3    1 
ATOM   94    C C4    . DT  A 1 5   ? 116.064 75.415  134.898 1.00 114.43 ? -59 DT  I C4    1 
ATOM   95    O O4    . DT  A 1 5   ? 116.350 76.486  134.373 1.00 114.66 ? -59 DT  I O4    1 
ATOM   96    C C5    . DT  A 1 5   ? 116.891 74.718  135.852 1.00 114.51 ? -59 DT  I C5    1 
ATOM   97    C C7    . DT  A 1 5   ? 118.210 75.308  136.237 1.00 114.20 ? -59 DT  I C7    1 
ATOM   98    C C6    . DT  A 1 5   ? 116.437 73.561  136.353 1.00 114.87 ? -59 DT  I C6    1 
ATOM   99    P P     . DG  A 1 6   ? 114.665 67.634  136.281 1.00 122.93 ? -58 DG  I P     1 
ATOM   100   O OP1   . DG  A 1 6   ? 114.131 66.392  136.900 1.00 122.88 ? -58 DG  I OP1   1 
ATOM   101   O OP2   . DG  A 1 6   ? 116.093 67.695  135.873 1.00 122.46 ? -58 DG  I OP2   1 
ATOM   102   O "O5'" . DG  A 1 6   ? 113.768 67.979  135.012 1.00 121.05 ? -58 DG  I "O5'" 1 
ATOM   103   C "C5'" . DG  A 1 6   ? 112.355 68.121  135.137 1.00 120.51 ? -58 DG  I "C5'" 1 
ATOM   104   C "C4'" . DG  A 1 6   ? 111.742 68.421  133.790 1.00 120.01 ? -58 DG  I "C4'" 1 
ATOM   105   O "O4'" . DG  A 1 6   ? 112.181 69.726  133.340 1.00 120.81 ? -58 DG  I "O4'" 1 
ATOM   106   C "C3'" . DG  A 1 6   ? 112.136 67.442  132.686 1.00 119.10 ? -58 DG  I "C3'" 1 
ATOM   107   O "O3'" . DG  A 1 6   ? 111.024 67.227  131.813 1.00 116.91 ? -58 DG  I "O3'" 1 
ATOM   108   C "C2'" . DG  A 1 6   ? 113.267 68.156  131.971 1.00 119.87 ? -58 DG  I "C2'" 1 
ATOM   109   C "C1'" . DG  A 1 6   ? 112.868 69.614  132.100 1.00 120.41 ? -58 DG  I "C1'" 1 
ATOM   110   N N9    . DG  A 1 6   ? 114.000 70.535  132.136 1.00 120.50 ? -58 DG  I N9    1 
ATOM   111   C C8    . DG  A 1 6   ? 115.224 70.318  132.724 1.00 120.74 ? -58 DG  I C8    1 
ATOM   112   N N7    . DG  A 1 6   ? 116.042 71.326  132.593 1.00 120.92 ? -58 DG  I N7    1 
ATOM   113   C C5    . DG  A 1 6   ? 115.316 72.265  131.875 1.00 120.38 ? -58 DG  I C5    1 
ATOM   114   C C6    . DG  A 1 6   ? 115.680 73.563  131.430 1.00 119.83 ? -58 DG  I C6    1 
ATOM   115   O O6    . DG  A 1 6   ? 116.751 74.159  131.592 1.00 120.20 ? -58 DG  I O6    1 
ATOM   116   N N1    . DG  A 1 6   ? 114.643 74.173  130.734 1.00 119.29 ? -58 DG  I N1    1 
ATOM   117   C C2    . DG  A 1 6   ? 113.413 73.611  130.497 1.00 119.81 ? -58 DG  I C2    1 
ATOM   118   N N2    . DG  A 1 6   ? 112.544 74.361  129.804 1.00 119.45 ? -58 DG  I N2    1 
ATOM   119   N N3    . DG  A 1 6   ? 113.060 72.405  130.908 1.00 120.01 ? -58 DG  I N3    1 
ATOM   120   C C4    . DG  A 1 6   ? 114.054 71.793  131.585 1.00 120.49 ? -58 DG  I C4    1 
ATOM   121   P P     . DC  A 1 7   ? 111.263 66.582  130.360 1.00 115.77 ? -57 DC  I P     1 
ATOM   122   O OP1   . DC  A 1 7   ? 109.995 65.915  129.964 1.00 115.42 ? -57 DC  I OP1   1 
ATOM   123   O OP2   . DC  A 1 7   ? 112.535 65.811  130.357 1.00 115.16 ? -57 DC  I OP2   1 
ATOM   124   O "O5'" . DC  A 1 7   ? 111.461 67.855  129.426 1.00 114.23 ? -57 DC  I "O5'" 1 
ATOM   125   C "C5'" . DC  A 1 7   ? 110.436 68.838  129.317 1.00 111.34 ? -57 DC  I "C5'" 1 
ATOM   126   C "C4'" . DC  A 1 7   ? 110.661 69.683  128.086 1.00 108.76 ? -57 DC  I "C4'" 1 
ATOM   127   O "O4'" . DC  A 1 7   ? 111.809 70.543  128.284 1.00 108.07 ? -57 DC  I "O4'" 1 
ATOM   128   C "C3'" . DC  A 1 7   ? 110.957 68.870  126.828 1.00 107.59 ? -57 DC  I "C3'" 1 
ATOM   129   O "O3'" . DC  A 1 7   ? 110.376 69.513  125.703 1.00 105.42 ? -57 DC  I "O3'" 1 
ATOM   130   C "C2'" . DC  A 1 7   ? 112.468 68.929  126.723 1.00 107.66 ? -57 DC  I "C2'" 1 
ATOM   131   C "C1'" . DC  A 1 7   ? 112.758 70.319  127.255 1.00 107.25 ? -57 DC  I "C1'" 1 
ATOM   132   N N1    . DC  A 1 7   ? 114.098 70.494  127.831 1.00 106.56 ? -57 DC  I N1    1 
ATOM   133   C C2    . DC  A 1 7   ? 114.838 71.617  127.467 1.00 106.16 ? -57 DC  I C2    1 
ATOM   134   O O2    . DC  A 1 7   ? 114.339 72.428  126.675 1.00 106.19 ? -57 DC  I O2    1 
ATOM   135   N N3    . DC  A 1 7   ? 116.074 71.792  127.986 1.00 105.93 ? -57 DC  I N3    1 
ATOM   136   C C4    . DC  A 1 7   ? 116.571 70.895  128.838 1.00 105.40 ? -57 DC  I C4    1 
ATOM   137   N N4    . DC  A 1 7   ? 117.795 71.107  129.325 1.00 104.49 ? -57 DC  I N4    1 
ATOM   138   C C5    . DC  A 1 7   ? 115.838 69.738  129.228 1.00 105.52 ? -57 DC  I C5    1 
ATOM   139   C C6    . DC  A 1 7   ? 114.615 69.578  128.704 1.00 106.08 ? -57 DC  I C6    1 
ATOM   140   P P     . DA  A 1 8   ? 109.960 68.648  124.423 1.00 104.76 ? -56 DA  I P     1 
ATOM   141   O OP1   . DA  A 1 8   ? 108.821 67.791  124.828 1.00 106.16 ? -56 DA  I OP1   1 
ATOM   142   O OP2   . DA  A 1 8   ? 111.179 68.029  123.841 1.00 104.77 ? -56 DA  I OP2   1 
ATOM   143   O "O5'" . DA  A 1 8   ? 109.416 69.750  123.420 1.00 103.42 ? -56 DA  I "O5'" 1 
ATOM   144   C "C5'" . DA  A 1 8   ? 108.794 70.925  123.926 1.00 99.19  ? -56 DA  I "C5'" 1 
ATOM   145   C "C4'" . DA  A 1 8   ? 109.475 72.151  123.368 1.00 95.87  ? -56 DA  I "C4'" 1 
ATOM   146   O "O4'" . DA  A 1 8   ? 110.837 72.229  123.859 1.00 94.74  ? -56 DA  I "O4'" 1 
ATOM   147   C "C3'" . DA  A 1 8   ? 109.571 72.156  121.846 1.00 93.23  ? -56 DA  I "C3'" 1 
ATOM   148   O "O3'" . DA  A 1 8   ? 109.323 73.470  121.361 1.00 89.69  ? -56 DA  I "O3'" 1 
ATOM   149   C "C2'" . DA  A 1 8   ? 111.002 71.724  121.575 1.00 92.89  ? -56 DA  I "C2'" 1 
ATOM   150   C "C1'" . DA  A 1 8   ? 111.755 72.262  122.778 1.00 93.47  ? -56 DA  I "C1'" 1 
ATOM   151   N N9    . DA  A 1 8   ? 112.916 71.457  123.157 1.00 94.04  ? -56 DA  I N9    1 
ATOM   152   C C8    . DA  A 1 8   ? 113.025 70.088  123.134 1.00 94.32  ? -56 DA  I C8    1 
ATOM   153   N N7    . DA  A 1 8   ? 114.191 69.644  123.535 1.00 94.70  ? -56 DA  I N7    1 
ATOM   154   C C5    . DA  A 1 8   ? 114.899 70.793  123.841 1.00 95.06  ? -56 DA  I C5    1 
ATOM   155   C C6    . DA  A 1 8   ? 116.207 71.001  124.322 1.00 95.76  ? -56 DA  I C6    1 
ATOM   156   N N6    . DA  A 1 8   ? 117.064 70.012  124.591 1.00 95.60  ? -56 DA  I N6    1 
ATOM   157   N N1    . DA  A 1 8   ? 116.608 72.276  124.519 1.00 95.19  ? -56 DA  I N1    1 
ATOM   158   C C2    . DA  A 1 8   ? 115.746 73.266  124.249 1.00 95.96  ? -56 DA  I C2    1 
ATOM   159   N N3    . DA  A 1 8   ? 114.494 73.198  123.795 1.00 95.38  ? -56 DA  I N3    1 
ATOM   160   C C4    . DA  A 1 8   ? 114.127 71.920  123.611 1.00 94.52  ? -56 DA  I C4    1 
ATOM   161   P P     . DG  A 1 9   ? 109.232 73.727  119.782 1.00 88.80  ? -55 DG  I P     1 
ATOM   162   O OP1   . DG  A 1 9   ? 107.976 74.482  119.536 1.00 88.06  ? -55 DG  I OP1   1 
ATOM   163   O OP2   . DG  A 1 9   ? 109.474 72.448  119.067 1.00 88.61  ? -55 DG  I OP2   1 
ATOM   164   O "O5'" . DG  A 1 9   ? 110.470 74.688  119.524 1.00 81.63  ? -55 DG  I "O5'" 1 
ATOM   165   C "C5'" . DG  A 1 9   ? 110.796 75.681  120.481 1.00 73.40  ? -55 DG  I "C5'" 1 
ATOM   166   C "C4'" . DG  A 1 9   ? 112.258 76.041  120.386 1.00 68.47  ? -55 DG  I "C4'" 1 
ATOM   167   O "O4'" . DG  A 1 9   ? 113.090 74.963  120.877 1.00 68.68  ? -55 DG  I "O4'" 1 
ATOM   168   C "C3'" . DG  A 1 9   ? 112.763 76.363  118.982 1.00 65.29  ? -55 DG  I "C3'" 1 
ATOM   169   O "O3'" . DG  A 1 9   ? 113.612 77.501  119.084 1.00 59.81  ? -55 DG  I "O3'" 1 
ATOM   170   C "C2'" . DG  A 1 9   ? 113.576 75.134  118.609 1.00 65.89  ? -55 DG  I "C2'" 1 
ATOM   171   C "C1'" . DG  A 1 9   ? 114.139 74.732  119.956 1.00 68.62  ? -55 DG  I "C1'" 1 
ATOM   172   N N9    . DG  A 1 9   ? 114.548 73.336  120.075 1.00 71.95  ? -55 DG  I N9    1 
ATOM   173   C C8    . DG  A 1 9   ? 113.847 72.228  119.670 1.00 73.39  ? -55 DG  I C8    1 
ATOM   174   N N7    . DG  A 1 9   ? 114.473 71.110  119.915 1.00 73.18  ? -55 DG  I N7    1 
ATOM   175   C C5    . DG  A 1 9   ? 115.657 71.503  120.520 1.00 74.12  ? -55 DG  I C5    1 
ATOM   176   C C6    . DG  A 1 9   ? 116.733 70.729  121.014 1.00 75.79  ? -55 DG  I C6    1 
ATOM   177   O O6    . DG  A 1 9   ? 116.856 69.501  121.020 1.00 79.41  ? -55 DG  I O6    1 
ATOM   178   N N1    . DG  A 1 9   ? 117.738 71.529  121.545 1.00 75.98  ? -55 DG  I N1    1 
ATOM   179   C C2    . DG  A 1 9   ? 117.709 72.900  121.596 1.00 75.01  ? -55 DG  I C2    1 
ATOM   180   N N2    . DG  A 1 9   ? 118.783 73.496  122.138 1.00 75.16  ? -55 DG  I N2    1 
ATOM   181   N N3    . DG  A 1 9   ? 116.705 73.632  121.149 1.00 74.22  ? -55 DG  I N3    1 
ATOM   182   C C4    . DG  A 1 9   ? 115.721 72.874  120.623 1.00 73.05  ? -55 DG  I C4    1 
ATOM   183   P P     . DA  A 1 10  ? 114.229 78.165  117.766 1.00 58.07  ? -54 DA  I P     1 
ATOM   184   O OP1   . DA  A 1 10  ? 113.888 79.602  117.876 1.00 54.84  ? -54 DA  I OP1   1 
ATOM   185   O OP2   . DA  A 1 10  ? 113.836 77.409  116.555 1.00 54.47  ? -54 DA  I OP2   1 
ATOM   186   O "O5'" . DA  A 1 10  ? 115.796 77.971  117.981 1.00 58.22  ? -54 DA  I "O5'" 1 
ATOM   187   C "C5'" . DA  A 1 10  ? 116.406 78.359  119.213 1.00 65.23  ? -54 DA  I "C5'" 1 
ATOM   188   C "C4'" . DA  A 1 10  ? 117.860 77.941  119.247 1.00 69.79  ? -54 DA  I "C4'" 1 
ATOM   189   O "O4'" . DA  A 1 10  ? 117.984 76.521  119.491 1.00 69.84  ? -54 DA  I "O4'" 1 
ATOM   190   C "C3'" . DA  A 1 10  ? 118.660 78.227  117.977 1.00 72.85  ? -54 DA  I "C3'" 1 
ATOM   191   O "O3'" . DA  A 1 10  ? 119.964 78.696  118.329 1.00 77.90  ? -54 DA  I "O3'" 1 
ATOM   192   C "C2'" . DA  A 1 10  ? 118.757 76.861  117.316 1.00 70.95  ? -54 DA  I "C2'" 1 
ATOM   193   C "C1'" . DA  A 1 10  ? 118.842 75.945  118.519 1.00 72.86  ? -54 DA  I "C1'" 1 
ATOM   194   N N9    . DA  A 1 10  ? 118.413 74.560  118.310 1.00 76.04  ? -54 DA  I N9    1 
ATOM   195   C C8    . DA  A 1 10  ? 117.248 74.102  117.746 1.00 76.88  ? -54 DA  I C8    1 
ATOM   196   N N7    . DA  A 1 10  ? 117.142 72.797  117.738 1.00 77.58  ? -54 DA  I N7    1 
ATOM   197   C C5    . DA  A 1 10  ? 118.321 72.363  118.327 1.00 79.15  ? -54 DA  I C5    1 
ATOM   198   C C6    . DA  A 1 10  ? 118.820 71.077  118.625 1.00 81.05  ? -54 DA  I C6    1 
ATOM   199   N N6    . DA  A 1 10  ? 118.160 69.945  118.363 1.00 80.85  ? -54 DA  I N6    1 
ATOM   200   N N1    . DA  A 1 10  ? 120.033 70.994  119.213 1.00 80.04  ? -54 DA  I N1    1 
ATOM   201   C C2    . DA  A 1 10  ? 120.690 72.129  119.487 1.00 80.94  ? -54 DA  I C2    1 
ATOM   202   N N3    . DA  A 1 10  ? 120.325 73.391  119.261 1.00 80.22  ? -54 DA  I N3    1 
ATOM   203   C C4    . DA  A 1 10  ? 119.117 73.438  118.674 1.00 77.94  ? -54 DA  I C4    1 
ATOM   204   P P     . DT  A 1 11  ? 120.774 79.640  117.313 1.00 82.08  ? -53 DT  I P     1 
ATOM   205   O OP1   . DT  A 1 11  ? 120.781 81.036  117.823 1.00 80.00  ? -53 DT  I OP1   1 
ATOM   206   O OP2   . DT  A 1 11  ? 120.269 79.363  115.946 1.00 81.76  ? -53 DT  I OP2   1 
ATOM   207   O "O5'" . DT  A 1 11  ? 122.259 79.074  117.405 1.00 86.03  ? -53 DT  I "O5'" 1 
ATOM   208   C "C5'" . DT  A 1 11  ? 122.870 78.861  118.669 1.00 91.46  ? -53 DT  I "C5'" 1 
ATOM   209   C "C4'" . DT  A 1 11  ? 123.776 77.654  118.614 1.00 96.79  ? -53 DT  I "C4'" 1 
ATOM   210   O "O4'" . DT  A 1 11  ? 122.994 76.459  118.359 1.00 97.63  ? -53 DT  I "O4'" 1 
ATOM   211   C "C3'" . DT  A 1 11  ? 124.853 77.693  117.527 1.00 100.33 ? -53 DT  I "C3'" 1 
ATOM   212   O "O3'" . DT  A 1 11  ? 126.078 77.176  118.069 1.00 105.47 ? -53 DT  I "O3'" 1 
ATOM   213   C "C2'" . DT  A 1 11  ? 124.294 76.778  116.451 1.00 99.52  ? -53 DT  I "C2'" 1 
ATOM   214   C "C1'" . DT  A 1 11  ? 123.584 75.736  117.290 1.00 98.52  ? -53 DT  I "C1'" 1 
ATOM   215   N N1    . DT  A 1 11  ? 122.526 74.974  116.600 1.00 98.82  ? -53 DT  I N1    1 
ATOM   216   C C2    . DT  A 1 11  ? 122.467 73.618  116.834 1.00 97.90  ? -53 DT  I C2    1 
ATOM   217   O O2    . DT  A 1 11  ? 123.259 73.032  117.552 1.00 98.29  ? -53 DT  I O2    1 
ATOM   218   N N3    . DT  A 1 11  ? 121.447 72.967  116.185 1.00 97.52  ? -53 DT  I N3    1 
ATOM   219   C C4    . DT  A 1 11  ? 120.506 73.523  115.337 1.00 98.12  ? -53 DT  I C4    1 
ATOM   220   O O4    . DT  A 1 11  ? 119.639 72.813  114.833 1.00 98.22  ? -53 DT  I O4    1 
ATOM   221   C C5    . DT  A 1 11  ? 120.640 74.948  115.121 1.00 97.74  ? -53 DT  I C5    1 
ATOM   222   C C7    . DT  A 1 11  ? 119.680 75.633  114.201 1.00 97.54  ? -53 DT  I C7    1 
ATOM   223   C C6    . DT  A 1 11  ? 121.627 75.594  115.757 1.00 98.53  ? -53 DT  I C6    1 
ATOM   224   P P     . DT  A 1 12  ? 127.145 76.453  117.108 1.00 108.78 ? -52 DT  I P     1 
ATOM   225   O OP1   . DT  A 1 12  ? 128.473 76.526  117.768 1.00 109.22 ? -52 DT  I OP1   1 
ATOM   226   O OP2   . DT  A 1 12  ? 126.977 77.004  115.738 1.00 109.39 ? -52 DT  I OP2   1 
ATOM   227   O "O5'" . DT  A 1 12  ? 126.682 74.929  117.119 1.00 110.66 ? -52 DT  I "O5'" 1 
ATOM   228   C "C5'" . DT  A 1 12  ? 126.659 74.195  118.344 1.00 114.96 ? -52 DT  I "C5'" 1 
ATOM   229   C "C4'" . DT  A 1 12  ? 127.267 72.826  118.148 1.00 117.40 ? -52 DT  I "C4'" 1 
ATOM   230   O "O4'" . DT  A 1 12  ? 126.313 71.942  117.514 1.00 117.52 ? -52 DT  I "O4'" 1 
ATOM   231   C "C3'" . DT  A 1 12  ? 128.511 72.817  117.262 1.00 119.07 ? -52 DT  I "C3'" 1 
ATOM   232   O "O3'" . DT  A 1 12  ? 129.471 71.881  117.756 1.00 121.33 ? -52 DT  I "O3'" 1 
ATOM   233   C "C2'" . DT  A 1 12  ? 127.972 72.382  115.910 1.00 118.72 ? -52 DT  I "C2'" 1 
ATOM   234   C "C1'" . DT  A 1 12  ? 126.835 71.446  116.291 1.00 117.84 ? -52 DT  I "C1'" 1 
ATOM   235   N N1    . DT  A 1 12  ? 125.726 71.409  115.319 1.00 117.61 ? -52 DT  I N1    1 
ATOM   236   C C2    . DT  A 1 12  ? 125.091 70.206  115.106 1.00 117.04 ? -52 DT  I C2    1 
ATOM   237   O O2    . DT  A 1 12  ? 125.417 69.173  115.668 1.00 116.61 ? -52 DT  I O2    1 
ATOM   238   N N3    . DT  A 1 12  ? 124.054 70.256  114.208 1.00 116.67 ? -52 DT  I N3    1 
ATOM   239   C C4    . DT  A 1 12  ? 123.603 71.365  113.513 1.00 116.55 ? -52 DT  I C4    1 
ATOM   240   O O4    . DT  A 1 12  ? 122.652 71.260  112.743 1.00 116.23 ? -52 DT  I O4    1 
ATOM   241   C C5    . DT  A 1 12  ? 124.324 72.591  113.774 1.00 116.48 ? -52 DT  I C5    1 
ATOM   242   C C7    . DT  A 1 12  ? 123.915 73.840  113.059 1.00 116.47 ? -52 DT  I C7    1 
ATOM   243   C C6    . DT  A 1 12  ? 125.335 72.551  114.652 1.00 116.72 ? -52 DT  I C6    1 
ATOM   244   P P     . DC  A 1 13  ? 130.780 71.555  116.885 1.00 123.58 ? -51 DC  I P     1 
ATOM   245   O OP1   . DC  A 1 13  ? 131.733 70.791  117.731 1.00 123.69 ? -51 DC  I OP1   1 
ATOM   246   O OP2   . DC  A 1 13  ? 131.219 72.819  116.242 1.00 123.26 ? -51 DC  I OP2   1 
ATOM   247   O "O5'" . DC  A 1 13  ? 130.228 70.588  115.748 1.00 124.53 ? -51 DC  I "O5'" 1 
ATOM   248   C "C5'" . DC  A 1 13  ? 130.933 70.415  114.526 1.00 126.00 ? -51 DC  I "C5'" 1 
ATOM   249   C "C4'" . DC  A 1 13  ? 130.757 69.001  114.024 1.00 126.44 ? -51 DC  I "C4'" 1 
ATOM   250   O "O4'" . DC  A 1 13  ? 129.346 68.719  113.850 1.00 126.56 ? -51 DC  I "O4'" 1 
ATOM   251   C "C3'" . DC  A 1 13  ? 131.412 68.725  112.672 1.00 127.22 ? -51 DC  I "C3'" 1 
ATOM   252   O "O3'" . DC  A 1 13  ? 131.983 67.416  112.677 1.00 129.01 ? -51 DC  I "O3'" 1 
ATOM   253   C "C2'" . DC  A 1 13  ? 130.255 68.807  111.695 1.00 126.63 ? -51 DC  I "C2'" 1 
ATOM   254   C "C1'" . DC  A 1 13  ? 129.100 68.280  112.523 1.00 126.22 ? -51 DC  I "C1'" 1 
ATOM   255   N N1    . DC  A 1 13  ? 127.782 68.781  112.108 1.00 125.38 ? -51 DC  I N1    1 
ATOM   256   C C2    . DC  A 1 13  ? 126.708 67.886  112.055 1.00 125.04 ? -51 DC  I C2    1 
ATOM   257   O O2    . DC  A 1 13  ? 126.897 66.702  112.376 1.00 124.77 ? -51 DC  I O2    1 
ATOM   258   N N3    . DC  A 1 13  ? 125.495 68.330  111.654 1.00 124.57 ? -51 DC  I N3    1 
ATOM   259   C C4    . DC  A 1 13  ? 125.331 69.610  111.318 1.00 124.28 ? -51 DC  I C4    1 
ATOM   260   N N4    . DC  A 1 13  ? 124.119 70.002  110.920 1.00 123.86 ? -51 DC  I N4    1 
ATOM   261   C C5    . DC  A 1 13  ? 126.405 70.547  111.373 1.00 124.09 ? -51 DC  I C5    1 
ATOM   262   C C6    . DC  A 1 13  ? 127.600 70.096  111.772 1.00 124.58 ? -51 DC  I C6    1 
ATOM   263   P P     . DT  A 1 14  ? 132.406 66.730  111.292 1.00 129.51 ? -50 DT  I P     1 
ATOM   264   O OP1   . DT  A 1 14  ? 133.443 65.705  111.575 1.00 129.81 ? -50 DT  I OP1   1 
ATOM   265   O OP2   . DT  A 1 14  ? 132.689 67.813  110.320 1.00 129.52 ? -50 DT  I OP2   1 
ATOM   266   O "O5'" . DT  A 1 14  ? 131.079 65.983  110.833 1.00 131.56 ? -50 DT  I "O5'" 1 
ATOM   267   C "C5'" . DT  A 1 14  ? 130.831 64.635  111.222 1.00 134.53 ? -50 DT  I "C5'" 1 
ATOM   268   C "C4'" . DT  A 1 14  ? 130.498 63.808  110.005 1.00 136.57 ? -50 DT  I "C4'" 1 
ATOM   269   O "O4'" . DT  A 1 14  ? 129.173 64.162  109.535 1.00 136.98 ? -50 DT  I "O4'" 1 
ATOM   270   C "C3'" . DT  A 1 14  ? 131.448 64.071  108.838 1.00 137.88 ? -50 DT  I "C3'" 1 
ATOM   271   O "O3'" . DT  A 1 14  ? 131.727 62.868  108.122 1.00 139.24 ? -50 DT  I "O3'" 1 
ATOM   272   C "C2'" . DT  A 1 14  ? 130.685 65.055  107.972 1.00 137.83 ? -50 DT  I "C2'" 1 
ATOM   273   C "C1'" . DT  A 1 14  ? 129.236 64.661  108.206 1.00 137.33 ? -50 DT  I "C1'" 1 
ATOM   274   N N1    . DT  A 1 14  ? 128.285 65.785  108.100 1.00 137.24 ? -50 DT  I N1    1 
ATOM   275   C C2    . DT  A 1 14  ? 126.944 65.497  107.982 1.00 137.31 ? -50 DT  I C2    1 
ATOM   276   O O2    . DT  A 1 14  ? 126.503 64.361  107.986 1.00 137.32 ? -50 DT  I O2    1 
ATOM   277   N N3    . DT  A 1 14  ? 126.133 66.598  107.864 1.00 137.58 ? -50 DT  I N3    1 
ATOM   278   C C4    . DT  A 1 14  ? 126.519 67.925  107.856 1.00 137.74 ? -50 DT  I C4    1 
ATOM   279   O O4    . DT  A 1 14  ? 125.675 68.810  107.733 1.00 137.78 ? -50 DT  I O4    1 
ATOM   280   C C5    . DT  A 1 14  ? 127.939 68.155  108.000 1.00 137.48 ? -50 DT  I C5    1 
ATOM   281   C C7    . DT  A 1 14  ? 128.451 69.560  108.019 1.00 137.16 ? -50 DT  I C7    1 
ATOM   282   C C6    . DT  A 1 14  ? 128.738 67.088  108.109 1.00 137.21 ? -50 DT  I C6    1 
ATOM   283   P P     . DA  A 1 15  ? 132.360 62.953  106.651 1.00 140.68 ? -49 DA  I P     1 
ATOM   284   O OP1   . DA  A 1 15  ? 133.095 61.691  106.379 1.00 141.38 ? -49 DA  I OP1   1 
ATOM   285   O OP2   . DA  A 1 15  ? 133.067 64.256  106.529 1.00 140.31 ? -49 DA  I OP2   1 
ATOM   286   O "O5'" . DA  A 1 15  ? 131.077 62.996  105.711 1.00 140.45 ? -49 DA  I "O5'" 1 
ATOM   287   C "C5'" . DA  A 1 15  ? 130.080 61.985  105.806 1.00 140.85 ? -49 DA  I "C5'" 1 
ATOM   288   C "C4'" . DA  A 1 15  ? 129.139 62.078  104.628 1.00 141.09 ? -49 DA  I "C4'" 1 
ATOM   289   O "O4'" . DA  A 1 15  ? 128.336 63.275  104.753 1.00 141.47 ? -49 DA  I "O4'" 1 
ATOM   290   C "C3'" . DA  A 1 15  ? 129.856 62.185  103.283 1.00 141.25 ? -49 DA  I "C3'" 1 
ATOM   291   O "O3'" . DA  A 1 15  ? 129.136 61.466  102.283 1.00 140.70 ? -49 DA  I "O3'" 1 
ATOM   292   C "C2'" . DA  A 1 15  ? 129.844 63.675  102.998 1.00 141.65 ? -49 DA  I "C2'" 1 
ATOM   293   C "C1'" . DA  A 1 15  ? 128.538 64.122  103.630 1.00 142.02 ? -49 DA  I "C1'" 1 
ATOM   294   N N9    . DA  A 1 15  ? 128.558 65.503  104.111 1.00 142.80 ? -49 DA  I N9    1 
ATOM   295   C C8    . DA  A 1 15  ? 129.604 66.180  104.689 1.00 143.04 ? -49 DA  I C8    1 
ATOM   296   N N7    . DA  A 1 15  ? 129.320 67.421  105.007 1.00 143.02 ? -49 DA  I N7    1 
ATOM   297   C C5    . DA  A 1 15  ? 127.997 67.568  104.615 1.00 143.20 ? -49 DA  I C5    1 
ATOM   298   C C6    . DA  A 1 15  ? 127.110 68.656  104.677 1.00 143.47 ? -49 DA  I C6    1 
ATOM   299   N N6    . DA  A 1 15  ? 127.436 69.850  105.179 1.00 143.52 ? -49 DA  I N6    1 
ATOM   300   N N1    . DA  A 1 15  ? 125.859 68.474  104.201 1.00 143.48 ? -49 DA  I N1    1 
ATOM   301   C C2    . DA  A 1 15  ? 125.533 67.277  103.698 1.00 143.60 ? -49 DA  I C2    1 
ATOM   302   N N3    . DA  A 1 15  ? 126.279 66.181  103.581 1.00 143.56 ? -49 DA  I N3    1 
ATOM   303   C C4    . DA  A 1 15  ? 127.515 66.395  104.065 1.00 143.14 ? -49 DA  I C4    1 
ATOM   304   P P     . DC  A 1 16  ? 129.614 61.539  100.753 1.00 140.22 ? -48 DC  I P     1 
ATOM   305   O OP1   . DC  A 1 16  ? 129.533 60.161  100.202 1.00 140.25 ? -48 DC  I OP1   1 
ATOM   306   O OP2   . DC  A 1 16  ? 130.897 62.282  100.684 1.00 140.01 ? -48 DC  I OP2   1 
ATOM   307   O "O5'" . DC  A 1 16  ? 128.480 62.418  100.064 1.00 139.35 ? -48 DC  I "O5'" 1 
ATOM   308   C "C5'" . DC  A 1 16  ? 127.113 62.029  100.159 1.00 138.25 ? -48 DC  I "C5'" 1 
ATOM   309   C "C4'" . DC  A 1 16  ? 126.248 62.923  99.301  1.00 137.12 ? -48 DC  I "C4'" 1 
ATOM   310   O "O4'" . DC  A 1 16  ? 126.057 64.210  99.937  1.00 137.00 ? -48 DC  I "O4'" 1 
ATOM   311   C "C3'" . DC  A 1 16  ? 126.810 63.211  97.909  1.00 136.10 ? -48 DC  I "C3'" 1 
ATOM   312   O "O3'" . DC  A 1 16  ? 125.753 63.171  96.947  1.00 134.34 ? -48 DC  I "O3'" 1 
ATOM   313   C "C2'" . DC  A 1 16  ? 127.364 64.620  98.044  1.00 136.19 ? -48 DC  I "C2'" 1 
ATOM   314   C "C1'" . DC  A 1 16  ? 126.385 65.244  99.023  1.00 136.62 ? -48 DC  I "C1'" 1 
ATOM   315   N N1    . DC  A 1 16  ? 126.899 66.390  99.794  1.00 136.65 ? -48 DC  I N1    1 
ATOM   316   C C2    . DC  A 1 16  ? 126.100 67.536  99.910  1.00 136.23 ? -48 DC  I C2    1 
ATOM   317   O O2    . DC  A 1 16  ? 124.989 67.553  99.359  1.00 136.06 ? -48 DC  I O2    1 
ATOM   318   N N3    . DC  A 1 16  ? 126.559 68.592  100.619 1.00 135.95 ? -48 DC  I N3    1 
ATOM   319   C C4    . DC  A 1 16  ? 127.760 68.538  101.196 1.00 136.56 ? -48 DC  I C4    1 
ATOM   320   N N4    . DC  A 1 16  ? 128.171 69.605  101.887 1.00 136.34 ? -48 DC  I N4    1 
ATOM   321   C C5    . DC  A 1 16  ? 128.596 67.386  101.092 1.00 136.47 ? -48 DC  I C5    1 
ATOM   322   C C6    . DC  A 1 16  ? 128.130 66.345  100.389 1.00 136.70 ? -48 DC  I C6    1 
ATOM   323   P P     . DC  A 1 17  ? 126.091 63.286  95.382  1.00 133.10 ? -47 DC  I P     1 
ATOM   324   O OP1   . DC  A 1 17  ? 125.458 62.146  94.673  1.00 133.47 ? -47 DC  I OP1   1 
ATOM   325   O OP2   . DC  A 1 17  ? 127.554 63.509  95.257  1.00 132.87 ? -47 DC  I OP2   1 
ATOM   326   O "O5'" . DC  A 1 17  ? 125.352 64.627  94.951  1.00 131.34 ? -47 DC  I "O5'" 1 
ATOM   327   C "C5'" . DC  A 1 17  ? 125.417 65.777  95.785  1.00 128.33 ? -47 DC  I "C5'" 1 
ATOM   328   C "C4'" . DC  A 1 17  ? 124.933 66.998  95.042  1.00 125.62 ? -47 DC  I "C4'" 1 
ATOM   329   O "O4'" . DC  A 1 17  ? 125.172 68.150  95.881  1.00 125.22 ? -47 DC  I "O4'" 1 
ATOM   330   C "C3'" . DC  A 1 17  ? 125.695 67.263  93.748  1.00 124.13 ? -47 DC  I "C3'" 1 
ATOM   331   O "O3'" . DC  A 1 17  ? 124.837 67.909  92.809  1.00 121.90 ? -47 DC  I "O3'" 1 
ATOM   332   C "C2'" . DC  A 1 17  ? 126.815 68.186  94.188  1.00 124.51 ? -47 DC  I "C2'" 1 
ATOM   333   C "C1'" . DC  A 1 17  ? 126.175 68.983  95.314  1.00 124.67 ? -47 DC  I "C1'" 1 
ATOM   334   N N1    . DC  A 1 17  ? 127.102 69.358  96.395  1.00 124.19 ? -47 DC  I N1    1 
ATOM   335   C C2    . DC  A 1 17  ? 126.668 70.264  97.360  1.00 123.15 ? -47 DC  I C2    1 
ATOM   336   O O2    . DC  A 1 17  ? 125.522 70.722  97.275  1.00 122.93 ? -47 DC  I O2    1 
ATOM   337   N N3    . DC  A 1 17  ? 127.506 70.619  98.361  1.00 122.44 ? -47 DC  I N3    1 
ATOM   338   C C4    . DC  A 1 17  ? 128.734 70.099  98.418  1.00 122.35 ? -47 DC  I C4    1 
ATOM   339   N N4    . DC  A 1 17  ? 129.527 70.474  99.423  1.00 121.36 ? -47 DC  I N4    1 
ATOM   340   C C5    . DC  A 1 17  ? 129.203 69.171  97.445  1.00 123.38 ? -47 DC  I C5    1 
ATOM   341   C C6    . DC  A 1 17  ? 128.363 68.832  96.459  1.00 123.90 ? -47 DC  I C6    1 
ATOM   342   P P     . DA  A 1 18  ? 124.451 67.162  91.441  1.00 120.63 ? -46 DA  I P     1 
ATOM   343   O OP1   . DA  A 1 18  ? 123.982 65.804  91.810  1.00 120.95 ? -46 DA  I OP1   1 
ATOM   344   O OP2   . DA  A 1 18  ? 125.574 67.317  90.480  1.00 120.51 ? -46 DA  I OP2   1 
ATOM   345   O "O5'" . DA  A 1 18  ? 123.201 67.985  90.902  1.00 119.17 ? -46 DA  I "O5'" 1 
ATOM   346   C "C5'" . DA  A 1 18  ? 122.006 68.084  91.673  1.00 115.31 ? -46 DA  I "C5'" 1 
ATOM   347   C "C4'" . DA  A 1 18  ? 121.672 69.535  91.933  1.00 112.07 ? -46 DA  I "C4'" 1 
ATOM   348   O "O4'" . DA  A 1 18  ? 122.713 70.126  92.744  1.00 111.83 ? -46 DA  I "O4'" 1 
ATOM   349   C "C3'" . DA  A 1 18  ? 121.577 70.402  90.681  1.00 110.30 ? -46 DA  I "C3'" 1 
ATOM   350   O "O3'" . DA  A 1 18  ? 120.568 71.391  90.874  1.00 107.92 ? -46 DA  I "O3'" 1 
ATOM   351   C "C2'" . DA  A 1 18  ? 122.945 71.055  90.603  1.00 110.83 ? -46 DA  I "C2'" 1 
ATOM   352   C "C1'" . DA  A 1 18  ? 123.303 71.226  92.066  1.00 111.78 ? -46 DA  I "C1'" 1 
ATOM   353   N N9    . DA  A 1 18  ? 124.740 71.202  92.345  1.00 112.98 ? -46 DA  I N9    1 
ATOM   354   C C8    . DA  A 1 18  ? 125.735 70.616  91.605  1.00 113.10 ? -46 DA  I C8    1 
ATOM   355   N N7    . DA  A 1 18  ? 126.931 70.744  92.128  1.00 113.59 ? -46 DA  I N7    1 
ATOM   356   C C5    . DA  A 1 18  ? 126.709 71.468  93.291  1.00 113.54 ? -46 DA  I C5    1 
ATOM   357   C C6    . DA  A 1 18  ? 127.574 71.927  94.300  1.00 113.98 ? -46 DA  I C6    1 
ATOM   358   N N6    . DA  A 1 18  ? 128.890 71.704  94.308  1.00 114.30 ? -46 DA  I N6    1 
ATOM   359   N N1    . DA  A 1 18  ? 127.033 72.629  95.317  1.00 114.19 ? -46 DA  I N1    1 
ATOM   360   C C2    . DA  A 1 18  ? 125.713 72.845  95.316  1.00 114.29 ? -46 DA  I C2    1 
ATOM   361   N N3    . DA  A 1 18  ? 124.797 72.459  94.433  1.00 114.26 ? -46 DA  I N3    1 
ATOM   362   C C4    . DA  A 1 18  ? 125.366 71.766  93.432  1.00 113.89 ? -46 DA  I C4    1 
ATOM   363   P P     . DA  A 1 19  ? 120.157 72.363  89.666  1.00 106.61 ? -45 DA  I P     1 
ATOM   364   O OP1   . DA  A 1 19  ? 118.729 72.104  89.347  1.00 106.28 ? -45 DA  I OP1   1 
ATOM   365   O OP2   . DA  A 1 19  ? 121.182 72.269  88.592  1.00 106.12 ? -45 DA  I OP2   1 
ATOM   366   O "O5'" . DA  A 1 19  ? 120.249 73.802  90.328  1.00 104.98 ? -45 DA  I "O5'" 1 
ATOM   367   C "C5'" . DA  A 1 19  ? 119.925 73.983  91.703  1.00 101.47 ? -45 DA  I "C5'" 1 
ATOM   368   C "C4'" . DA  A 1 19  ? 120.741 75.115  92.278  1.00 98.25  ? -45 DA  I "C4'" 1 
ATOM   369   O "O4'" . DA  A 1 19  ? 122.131 74.718  92.404  1.00 96.80  ? -45 DA  I "O4'" 1 
ATOM   370   C "C3'" . DA  A 1 19  ? 120.732 76.361  91.396  1.00 96.17  ? -45 DA  I "C3'" 1 
ATOM   371   O "O3'" . DA  A 1 19  ? 120.672 77.533  92.208  1.00 93.27  ? -45 DA  I "O3'" 1 
ATOM   372   C "C2'" . DA  A 1 19  ? 122.059 76.274  90.662  1.00 96.71  ? -45 DA  I "C2'" 1 
ATOM   373   C "C1'" . DA  A 1 19  ? 122.950 75.657  91.724  1.00 97.55  ? -45 DA  I "C1'" 1 
ATOM   374   N N9    . DA  A 1 19  ? 124.133 74.957  91.218  1.00 98.84  ? -45 DA  I N9    1 
ATOM   375   C C8    . DA  A 1 19  ? 124.265 74.226  90.064  1.00 99.19  ? -45 DA  I C8    1 
ATOM   376   N N7    . DA  A 1 19  ? 125.468 73.729  89.889  1.00 99.01  ? -45 DA  I N7    1 
ATOM   377   C C5    . DA  A 1 19  ? 126.173 74.160  91.003  1.00 99.20  ? -45 DA  I C5    1 
ATOM   378   C C6    . DA  A 1 19  ? 127.506 73.970  91.414  1.00 99.54  ? -45 DA  I C6    1 
ATOM   379   N N6    . DA  A 1 19  ? 128.404 73.267  90.723  1.00 99.46  ? -45 DA  I N6    1 
ATOM   380   N N1    . DA  A 1 19  ? 127.891 74.538  92.576  1.00 99.75  ? -45 DA  I N1    1 
ATOM   381   C C2    . DA  A 1 19  ? 126.994 75.245  93.270  1.00 99.69  ? -45 DA  I C2    1 
ATOM   382   N N3    . DA  A 1 19  ? 125.717 75.494  92.989  1.00 99.44  ? -45 DA  I N3    1 
ATOM   383   C C4    . DA  A 1 19  ? 125.365 74.917  91.830  1.00 98.91  ? -45 DA  I C4    1 
ATOM   384   P P     . DA  A 1 20  ? 120.245 78.930  91.550  1.00 90.58  ? -44 DA  I P     1 
ATOM   385   O OP1   . DA  A 1 20  ? 119.279 79.610  92.455  1.00 91.62  ? -44 DA  I OP1   1 
ATOM   386   O OP2   . DA  A 1 20  ? 119.869 78.652  90.143  1.00 93.41  ? -44 DA  I OP2   1 
ATOM   387   O "O5'" . DA  A 1 20  ? 121.596 79.761  91.542  1.00 88.11  ? -44 DA  I "O5'" 1 
ATOM   388   C "C5'" . DA  A 1 20  ? 122.834 79.088  91.651  1.00 85.99  ? -44 DA  I "C5'" 1 
ATOM   389   C "C4'" . DA  A 1 20  ? 123.626 79.627  92.817  1.00 83.83  ? -44 DA  I "C4'" 1 
ATOM   390   O "O4'" . DA  A 1 20  ? 124.814 78.822  92.933  1.00 82.88  ? -44 DA  I "O4'" 1 
ATOM   391   C "C3'" . DA  A 1 20  ? 124.119 81.049  92.598  1.00 82.84  ? -44 DA  I "C3'" 1 
ATOM   392   O "O3'" . DA  A 1 20  ? 124.296 81.724  93.842  1.00 81.09  ? -44 DA  I "O3'" 1 
ATOM   393   C "C2'" . DA  A 1 20  ? 125.436 80.851  91.875  1.00 83.38  ? -44 DA  I "C2'" 1 
ATOM   394   C "C1'" . DA  A 1 20  ? 125.919 79.478  92.333  1.00 83.94  ? -44 DA  I "C1'" 1 
ATOM   395   N N9    . DA  A 1 20  ? 126.357 78.637  91.221  1.00 85.30  ? -44 DA  I N9    1 
ATOM   396   C C8    . DA  A 1 20  ? 125.650 78.344  90.081  1.00 85.23  ? -44 DA  I C8    1 
ATOM   397   N N7    . DA  A 1 20  ? 126.282 77.548  89.258  1.00 84.96  ? -44 DA  I N7    1 
ATOM   398   C C5    . DA  A 1 20  ? 127.487 77.301  89.896  1.00 85.92  ? -44 DA  I C5    1 
ATOM   399   C C6    . DA  A 1 20  ? 128.601 76.530  89.537  1.00 86.18  ? -44 DA  I C6    1 
ATOM   400   N N6    . DA  A 1 20  ? 128.679 75.832  88.404  1.00 87.95  ? -44 DA  I N6    1 
ATOM   401   N N1    . DA  A 1 20  ? 129.644 76.499  90.394  1.00 87.05  ? -44 DA  I N1    1 
ATOM   402   C C2    . DA  A 1 20  ? 129.561 77.197  91.532  1.00 86.10  ? -44 DA  I C2    1 
ATOM   403   N N3    . DA  A 1 20  ? 128.567 77.958  91.980  1.00 86.16  ? -44 DA  I N3    1 
ATOM   404   C C4    . DA  A 1 20  ? 127.548 77.968  91.104  1.00 85.24  ? -44 DA  I C4    1 
ATOM   405   P P     . DA  A 1 21  ? 124.587 83.301  93.849  1.00 79.15  ? -43 DA  I P     1 
ATOM   406   O OP1   . DA  A 1 21  ? 124.380 83.791  95.237  1.00 80.08  ? -43 DA  I OP1   1 
ATOM   407   O OP2   . DA  A 1 21  ? 123.824 83.903  92.722  1.00 79.88  ? -43 DA  I OP2   1 
ATOM   408   O "O5'" . DA  A 1 21  ? 126.131 83.401  93.517  1.00 72.17  ? -43 DA  I "O5'" 1 
ATOM   409   C "C5'" . DA  A 1 21  ? 127.065 82.848  94.416  1.00 70.81  ? -43 DA  I "C5'" 1 
ATOM   410   C "C4'" . DA  A 1 21  ? 128.453 82.917  93.840  1.00 67.78  ? -43 DA  I "C4'" 1 
ATOM   411   O "O4'" . DA  A 1 21  ? 128.683 81.842  92.898  1.00 68.74  ? -43 DA  I "O4'" 1 
ATOM   412   C "C3'" . DA  A 1 21  ? 128.811 84.217  93.121  1.00 66.18  ? -43 DA  I "C3'" 1 
ATOM   413   O "O3'" . DA  A 1 21  ? 130.041 84.676  93.668  1.00 62.96  ? -43 DA  I "O3'" 1 
ATOM   414   C "C2'" . DA  A 1 21  ? 128.960 83.796  91.664  1.00 68.59  ? -43 DA  I "C2'" 1 
ATOM   415   C "C1'" . DA  A 1 21  ? 129.385 82.339  91.780  1.00 68.20  ? -43 DA  I "C1'" 1 
ATOM   416   N N9    . DA  A 1 21  ? 129.052 81.492  90.633  1.00 69.99  ? -43 DA  I N9    1 
ATOM   417   C C8    . DA  A 1 21  ? 127.855 81.391  89.976  1.00 70.34  ? -43 DA  I C8    1 
ATOM   418   N N7    . DA  A 1 21  ? 127.868 80.544  88.974  1.00 69.98  ? -43 DA  I N7    1 
ATOM   419   C C5    . DA  A 1 21  ? 129.165 80.055  88.971  1.00 69.82  ? -43 DA  I C5    1 
ATOM   420   C C6    . DA  A 1 21  ? 129.822 79.117  88.151  1.00 68.32  ? -43 DA  I C6    1 
ATOM   421   N N6    . DA  A 1 21  ? 129.244 78.500  87.125  1.00 65.90  ? -43 DA  I N6    1 
ATOM   422   N N1    . DA  A 1 21  ? 131.111 78.838  88.426  1.00 69.14  ? -43 DA  I N1    1 
ATOM   423   C C2    . DA  A 1 21  ? 131.698 79.469  89.453  1.00 70.94  ? -43 DA  I C2    1 
ATOM   424   N N3    . DA  A 1 21  ? 131.193 80.374  90.287  1.00 70.30  ? -43 DA  I N3    1 
ATOM   425   C C4    . DA  A 1 21  ? 129.906 80.625  89.991  1.00 70.50  ? -43 DA  I C4    1 
ATOM   426   P P     . DG  A 1 22  ? 130.780 85.947  93.052  1.00 58.67  ? -42 DG  I P     1 
ATOM   427   O OP1   . DG  A 1 22  ? 131.309 86.721  94.199  1.00 61.55  ? -42 DG  I OP1   1 
ATOM   428   O OP2   . DG  A 1 22  ? 129.908 86.606  92.056  1.00 61.42  ? -42 DG  I OP2   1 
ATOM   429   O "O5'" . DG  A 1 22  ? 132.009 85.278  92.307  1.00 63.19  ? -42 DG  I "O5'" 1 
ATOM   430   C "C5'" . DG  A 1 22  ? 132.736 84.221  92.933  1.00 67.61  ? -42 DG  I "C5'" 1 
ATOM   431   C "C4'" . DG  A 1 22  ? 133.795 83.690  91.997  1.00 70.84  ? -42 DG  I "C4'" 1 
ATOM   432   O "O4'" . DG  A 1 22  ? 133.200 82.854  90.979  1.00 70.67  ? -42 DG  I "O4'" 1 
ATOM   433   C "C3'" . DG  A 1 22  ? 134.555 84.786  91.255  1.00 73.13  ? -42 DG  I "C3'" 1 
ATOM   434   O "O3'" . DG  A 1 22  ? 135.930 84.440  91.163  1.00 77.12  ? -42 DG  I "O3'" 1 
ATOM   435   C "C2'" . DG  A 1 22  ? 133.921 84.782  89.877  1.00 72.66  ? -42 DG  I "C2'" 1 
ATOM   436   C "C1'" . DG  A 1 22  ? 133.586 83.318  89.698  1.00 73.33  ? -42 DG  I "C1'" 1 
ATOM   437   N N9    . DG  A 1 22  ? 132.489 83.048  88.779  1.00 76.57  ? -42 DG  I N9    1 
ATOM   438   C C8    . DG  A 1 22  ? 131.226 83.584  88.805  1.00 77.95  ? -42 DG  I C8    1 
ATOM   439   N N7    . DG  A 1 22  ? 130.458 83.128  87.853  1.00 78.78  ? -42 DG  I N7    1 
ATOM   440   C C5    . DG  A 1 22  ? 131.267 82.244  87.154  1.00 78.82  ? -42 DG  I C5    1 
ATOM   441   C C6    . DG  A 1 22  ? 130.988 81.446  86.019  1.00 77.82  ? -42 DG  I C6    1 
ATOM   442   O O6    . DG  A 1 22  ? 129.937 81.362  85.376  1.00 77.59  ? -42 DG  I O6    1 
ATOM   443   N N1    . DG  A 1 22  ? 132.092 80.691  85.644  1.00 78.96  ? -42 DG  I N1    1 
ATOM   444   C C2    . DG  A 1 22  ? 133.309 80.701  86.279  1.00 79.48  ? -42 DG  I C2    1 
ATOM   445   N N2    . DG  A 1 22  ? 134.251 79.890  85.776  1.00 79.55  ? -42 DG  I N2    1 
ATOM   446   N N3    . DG  A 1 22  ? 133.584 81.446  87.331  1.00 78.50  ? -42 DG  I N3    1 
ATOM   447   C C4    . DG  A 1 22  ? 132.524 82.186  87.715  1.00 78.09  ? -42 DG  I C4    1 
ATOM   448   P P     . DT  A 1 23  ? 136.976 85.510  90.601  1.00 80.97  ? -41 DT  I P     1 
ATOM   449   O OP1   . DT  A 1 23  ? 138.046 85.645  91.621  1.00 80.78  ? -41 DT  I OP1   1 
ATOM   450   O OP2   . DT  A 1 23  ? 136.245 86.713  90.139  1.00 81.06  ? -41 DT  I OP2   1 
ATOM   451   O "O5'" . DT  A 1 23  ? 137.566 84.800  89.308  1.00 86.96  ? -41 DT  I "O5'" 1 
ATOM   452   C "C5'" . DT  A 1 23  ? 138.246 83.553  89.398  1.00 92.38  ? -41 DT  I "C5'" 1 
ATOM   453   C "C4'" . DT  A 1 23  ? 138.765 83.156  88.037  1.00 97.26  ? -41 DT  I "C4'" 1 
ATOM   454   O "O4'" . DT  A 1 23  ? 137.676 82.667  87.217  1.00 98.25  ? -41 DT  I "O4'" 1 
ATOM   455   C "C3'" . DT  A 1 23  ? 139.388 84.321  87.268  1.00 99.82  ? -41 DT  I "C3'" 1 
ATOM   456   O "O3'" . DT  A 1 23  ? 140.573 83.906  86.593  1.00 104.07 ? -41 DT  I "O3'" 1 
ATOM   457   C "C2'" . DT  A 1 23  ? 138.312 84.711  86.271  1.00 98.62  ? -41 DT  I "C2'" 1 
ATOM   458   C "C1'" . DT  A 1 23  ? 137.622 83.389  85.996  1.00 98.16  ? -41 DT  I "C1'" 1 
ATOM   459   N N1    . DT  A 1 23  ? 136.205 83.514  85.599  1.00 98.42  ? -41 DT  I N1    1 
ATOM   460   C C2    . DT  A 1 23  ? 135.698 82.607  84.695  1.00 98.31  ? -41 DT  I C2    1 
ATOM   461   O O2    . DT  A 1 23  ? 136.357 81.692  84.224  1.00 98.35  ? -41 DT  I O2    1 
ATOM   462   N N3    . DT  A 1 23  ? 134.381 82.808  84.363  1.00 98.02  ? -41 DT  I N3    1 
ATOM   463   C C4    . DT  A 1 23  ? 133.538 83.795  84.839  1.00 97.83  ? -41 DT  I C4    1 
ATOM   464   O O4    . DT  A 1 23  ? 132.378 83.851  84.446  1.00 97.70  ? -41 DT  I O4    1 
ATOM   465   C C5    . DT  A 1 23  ? 134.130 84.702  85.792  1.00 98.29  ? -41 DT  I C5    1 
ATOM   466   C C7    . DT  A 1 23  ? 133.290 85.797  86.369  1.00 98.05  ? -41 DT  I C7    1 
ATOM   467   C C6    . DT  A 1 23  ? 135.416 84.519  86.119  1.00 98.83  ? -41 DT  I C6    1 
ATOM   468   P P     . DG  A 1 24  ? 141.246 84.876  85.507  1.00 107.47 ? -40 DG  I P     1 
ATOM   469   O OP1   . DG  A 1 24  ? 142.697 84.579  85.463  1.00 108.47 ? -40 DG  I OP1   1 
ATOM   470   O OP2   . DG  A 1 24  ? 140.790 86.266  85.770  1.00 106.46 ? -40 DG  I OP2   1 
ATOM   471   O "O5'" . DG  A 1 24  ? 140.578 84.390  84.145  1.00 109.88 ? -40 DG  I "O5'" 1 
ATOM   472   C "C5'" . DG  A 1 24  ? 140.548 83.003  83.814  1.00 113.46 ? -40 DG  I "C5'" 1 
ATOM   473   C "C4'" . DG  A 1 24  ? 140.127 82.821  82.376  1.00 116.09 ? -40 DG  I "C4'" 1 
ATOM   474   O "O4'" . DG  A 1 24  ? 138.700 83.030  82.238  1.00 116.53 ? -40 DG  I "O4'" 1 
ATOM   475   C "C3'" . DG  A 1 24  ? 140.797 83.801  81.413  1.00 117.68 ? -40 DG  I "C3'" 1 
ATOM   476   O "O3'" . DG  A 1 24  ? 141.139 83.144  80.192  1.00 119.91 ? -40 DG  I "O3'" 1 
ATOM   477   C "C2'" . DG  A 1 24  ? 139.722 84.845  81.170  1.00 117.17 ? -40 DG  I "C2'" 1 
ATOM   478   C "C1'" . DG  A 1 24  ? 138.456 84.015  81.247  1.00 116.76 ? -40 DG  I "C1'" 1 
ATOM   479   N N9    . DG  A 1 24  ? 137.262 84.758  81.634  1.00 116.45 ? -40 DG  I N9    1 
ATOM   480   C C8    . DG  A 1 24  ? 137.168 85.754  82.576  1.00 116.44 ? -40 DG  I C8    1 
ATOM   481   N N7    . DG  A 1 24  ? 135.960 86.233  82.696  1.00 116.69 ? -40 DG  I N7    1 
ATOM   482   C C5    . DG  A 1 24  ? 135.210 85.508  81.779  1.00 116.67 ? -40 DG  I C5    1 
ATOM   483   C C6    . DG  A 1 24  ? 133.832 85.581  81.458  1.00 116.93 ? -40 DG  I C6    1 
ATOM   484   O O6    . DG  A 1 24  ? 132.967 86.323  81.934  1.00 117.06 ? -40 DG  I O6    1 
ATOM   485   N N1    . DG  A 1 24  ? 133.490 84.665  80.469  1.00 117.67 ? -40 DG  I N1    1 
ATOM   486   C C2    . DG  A 1 24  ? 134.360 83.789  79.866  1.00 117.44 ? -40 DG  I C2    1 
ATOM   487   N N2    . DG  A 1 24  ? 133.837 82.979  78.934  1.00 117.42 ? -40 DG  I N2    1 
ATOM   488   N N3    . DG  A 1 24  ? 135.646 83.712  80.158  1.00 117.07 ? -40 DG  I N3    1 
ATOM   489   C C4    . DG  A 1 24  ? 136.001 84.593  81.116  1.00 116.81 ? -40 DG  I C4    1 
ATOM   490   P P     . DT  A 1 25  ? 141.938 83.951  79.060  1.00 121.54 ? -39 DT  I P     1 
ATOM   491   O OP1   . DT  A 1 25  ? 142.906 83.025  78.418  1.00 122.11 ? -39 DT  I OP1   1 
ATOM   492   O OP2   . DT  A 1 25  ? 142.423 85.215  79.669  1.00 121.48 ? -39 DT  I OP2   1 
ATOM   493   O "O5'" . DT  A 1 25  ? 140.809 84.322  78.002  1.00 122.21 ? -39 DT  I "O5'" 1 
ATOM   494   C "C5'" . DT  A 1 25  ? 140.998 85.387  77.076  1.00 122.92 ? -39 DT  I "C5'" 1 
ATOM   495   C "C4'" . DT  A 1 25  ? 140.149 85.158  75.849  1.00 123.59 ? -39 DT  I "C4'" 1 
ATOM   496   O "O4'" . DT  A 1 25  ? 138.770 84.973  76.251  1.00 123.12 ? -39 DT  I "O4'" 1 
ATOM   497   C "C3'" . DT  A 1 25  ? 140.148 86.324  74.860  1.00 124.24 ? -39 DT  I "C3'" 1 
ATOM   498   O "O3'" . DT  A 1 25  ? 140.112 85.831  73.518  1.00 124.52 ? -39 DT  I "O3'" 1 
ATOM   499   C "C2'" . DT  A 1 25  ? 138.868 87.066  75.197  1.00 124.14 ? -39 DT  I "C2'" 1 
ATOM   500   C "C1'" . DT  A 1 25  ? 137.944 85.941  75.620  1.00 123.76 ? -39 DT  I "C1'" 1 
ATOM   501   N N1    . DT  A 1 25  ? 136.907 86.352  76.585  1.00 123.48 ? -39 DT  I N1    1 
ATOM   502   C C2    . DT  A 1 25  ? 135.590 86.106  76.269  1.00 123.54 ? -39 DT  I C2    1 
ATOM   503   O O2    . DT  A 1 25  ? 135.243 85.569  75.230  1.00 123.84 ? -39 DT  I O2    1 
ATOM   504   N N3    . DT  A 1 25  ? 134.690 86.519  77.218  1.00 123.29 ? -39 DT  I N3    1 
ATOM   505   C C4    . DT  A 1 25  ? 134.970 87.141  78.419  1.00 123.16 ? -39 DT  I C4    1 
ATOM   506   O O4    . DT  A 1 25  ? 134.053 87.458  79.171  1.00 123.21 ? -39 DT  I O4    1 
ATOM   507   C C5    . DT  A 1 25  ? 136.370 87.369  78.685  1.00 123.42 ? -39 DT  I C5    1 
ATOM   508   C C7    . DT  A 1 25  ? 136.769 88.040  79.961  1.00 123.72 ? -39 DT  I C7    1 
ATOM   509   C C6    . DT  A 1 25  ? 137.257 86.966  77.766  1.00 123.41 ? -39 DT  I C6    1 
ATOM   510   P P     . DA  A 1 26  ? 139.724 86.827  72.320  1.00 125.09 ? -38 DA  I P     1 
ATOM   511   O OP1   . DA  A 1 26  ? 140.159 86.202  71.045  1.00 125.50 ? -38 DA  I OP1   1 
ATOM   512   O OP2   . DA  A 1 26  ? 140.207 88.189  72.673  1.00 125.28 ? -38 DA  I OP2   1 
ATOM   513   O "O5'" . DA  A 1 26  ? 138.133 86.836  72.350  1.00 124.59 ? -38 DA  I "O5'" 1 
ATOM   514   C "C5'" . DA  A 1 26  ? 137.392 85.678  71.974  1.00 123.52 ? -38 DA  I "C5'" 1 
ATOM   515   C "C4'" . DA  A 1 26  ? 136.038 86.084  71.443  1.00 123.23 ? -38 DA  I "C4'" 1 
ATOM   516   O "O4'" . DA  A 1 26  ? 135.211 86.546  72.538  1.00 123.64 ? -38 DA  I "O4'" 1 
ATOM   517   C "C3'" . DA  A 1 26  ? 136.093 87.236  70.441  1.00 122.39 ? -38 DA  I "C3'" 1 
ATOM   518   O "O3'" . DA  A 1 26  ? 135.122 87.046  69.406  1.00 120.59 ? -38 DA  I "O3'" 1 
ATOM   519   C "C2'" . DA  A 1 26  ? 135.764 88.454  71.287  1.00 122.96 ? -38 DA  I "C2'" 1 
ATOM   520   C "C1'" . DA  A 1 26  ? 134.800 87.888  72.313  1.00 123.66 ? -38 DA  I "C1'" 1 
ATOM   521   N N9    . DA  A 1 26  ? 134.824 88.583  73.600  1.00 123.96 ? -38 DA  I N9    1 
ATOM   522   C C8    . DA  A 1 26  ? 135.915 88.843  74.389  1.00 124.21 ? -38 DA  I C8    1 
ATOM   523   N N7    . DA  A 1 26  ? 135.627 89.479  75.498  1.00 124.01 ? -38 DA  I N7    1 
ATOM   524   C C5    . DA  A 1 26  ? 134.251 89.651  75.434  1.00 124.04 ? -38 DA  I C5    1 
ATOM   525   C C6    . DA  A 1 26  ? 133.334 90.258  76.309  1.00 124.24 ? -38 DA  I C6    1 
ATOM   526   N N6    . DA  A 1 26  ? 133.679 90.819  77.470  1.00 124.64 ? -38 DA  I N6    1 
ATOM   527   N N1    . DA  A 1 26  ? 132.032 90.267  75.946  1.00 124.06 ? -38 DA  I N1    1 
ATOM   528   C C2    . DA  A 1 26  ? 131.689 89.698  74.785  1.00 124.22 ? -38 DA  I C2    1 
ATOM   529   N N3    . DA  A 1 26  ? 132.457 89.094  73.880  1.00 124.47 ? -38 DA  I N3    1 
ATOM   530   C C4    . DA  A 1 26  ? 133.744 89.106  74.269  1.00 124.09 ? -38 DA  I C4    1 
ATOM   531   P P     . DT  A 1 27  ? 134.758 88.263  68.423  1.00 119.45 ? -37 DT  I P     1 
ATOM   532   O OP1   . DT  A 1 27  ? 134.220 87.698  67.158  1.00 119.03 ? -37 DT  I OP1   1 
ATOM   533   O OP2   . DT  A 1 27  ? 135.920 89.187  68.380  1.00 119.30 ? -37 DT  I OP2   1 
ATOM   534   O "O5'" . DT  A 1 27  ? 133.567 88.996  69.181  1.00 117.23 ? -37 DT  I "O5'" 1 
ATOM   535   C "C5'" . DT  A 1 27  ? 132.353 88.302  69.447  1.00 114.08 ? -37 DT  I "C5'" 1 
ATOM   536   C "C4'" . DT  A 1 27  ? 131.216 89.281  69.611  1.00 112.04 ? -37 DT  I "C4'" 1 
ATOM   537   O "O4'" . DT  A 1 27  ? 131.238 89.859  70.938  1.00 111.46 ? -37 DT  I "O4'" 1 
ATOM   538   C "C3'" . DT  A 1 27  ? 131.239 90.452  68.630  1.00 109.91 ? -37 DT  I "C3'" 1 
ATOM   539   O "O3'" . DT  A 1 27  ? 129.917 90.686  68.135  1.00 106.90 ? -37 DT  I "O3'" 1 
ATOM   540   C "C2'" . DT  A 1 27  ? 131.748 91.609  69.472  1.00 110.38 ? -37 DT  I "C2'" 1 
ATOM   541   C "C1'" . DT  A 1 27  ? 131.206 91.274  70.849  1.00 110.46 ? -37 DT  I "C1'" 1 
ATOM   542   N N1    . DT  A 1 27  ? 131.993 91.815  71.975  1.00 109.56 ? -37 DT  I N1    1 
ATOM   543   C C2    . DT  A 1 27  ? 131.318 92.445  73.001  1.00 109.00 ? -37 DT  I C2    1 
ATOM   544   O O2    . DT  A 1 27  ? 130.104 92.584  73.017  1.00 108.24 ? -37 DT  I O2    1 
ATOM   545   N N3    . DT  A 1 27  ? 132.117 92.907  74.015  1.00 108.44 ? -37 DT  I N3    1 
ATOM   546   C C4    . DT  A 1 27  ? 133.494 92.807  74.107  1.00 108.86 ? -37 DT  I C4    1 
ATOM   547   O O4    . DT  A 1 27  ? 134.079 93.263  75.088  1.00 107.02 ? -37 DT  I O4    1 
ATOM   548   C C5    . DT  A 1 27  ? 134.139 92.144  72.994  1.00 109.20 ? -37 DT  I C5    1 
ATOM   549   C C7    . DT  A 1 27  ? 135.628 91.995  73.002  1.00 108.80 ? -37 DT  I C7    1 
ATOM   550   C C6    . DT  A 1 27  ? 133.365 91.688  71.997  1.00 109.16 ? -37 DT  I C6    1 
ATOM   551   P P     . DT  A 1 28  ? 129.487 92.155  67.652  1.00 105.81 ? -36 DT  I P     1 
ATOM   552   O OP1   . DT  A 1 28  ? 128.414 91.992  66.640  1.00 104.75 ? -36 DT  I OP1   1 
ATOM   553   O OP2   . DT  A 1 28  ? 130.697 92.953  67.319  1.00 104.73 ? -36 DT  I OP2   1 
ATOM   554   O "O5'" . DT  A 1 28  ? 128.819 92.760  68.961  1.00 103.56 ? -36 DT  I "O5'" 1 
ATOM   555   C "C5'" . DT  A 1 28  ? 127.908 91.975  69.721  1.00 99.44  ? -36 DT  I "C5'" 1 
ATOM   556   C "C4'" . DT  A 1 28  ? 127.123 92.852  70.664  1.00 96.22  ? -36 DT  I "C4'" 1 
ATOM   557   O "O4'" . DT  A 1 28  ? 127.999 93.336  71.708  1.00 95.89  ? -36 DT  I "O4'" 1 
ATOM   558   C "C3'" . DT  A 1 28  ? 126.509 94.090  70.013  1.00 93.28  ? -36 DT  I "C3'" 1 
ATOM   559   O "O3'" . DT  A 1 28  ? 125.210 94.326  70.558  1.00 88.41  ? -36 DT  I "O3'" 1 
ATOM   560   C "C2'" . DT  A 1 28  ? 127.474 95.203  70.386  1.00 93.15  ? -36 DT  I "C2'" 1 
ATOM   561   C "C1'" . DT  A 1 28  ? 127.982 94.754  71.742  1.00 94.75  ? -36 DT  I "C1'" 1 
ATOM   562   N N1    . DT  A 1 28  ? 129.338 95.203  72.094  1.00 94.48  ? -36 DT  I N1    1 
ATOM   563   C C2    . DT  A 1 28  ? 129.524 95.734  73.344  1.00 94.95  ? -36 DT  I C2    1 
ATOM   564   O O2    . DT  A 1 28  ? 128.616 95.879  74.146  1.00 96.24  ? -36 DT  I O2    1 
ATOM   565   N N3    . DT  A 1 28  ? 130.818 96.091  73.628  1.00 94.31  ? -36 DT  I N3    1 
ATOM   566   C C4    . DT  A 1 28  ? 131.915 95.978  72.800  1.00 93.52  ? -36 DT  I C4    1 
ATOM   567   O O4    . DT  A 1 28  ? 133.020 96.330  73.198  1.00 91.86  ? -36 DT  I O4    1 
ATOM   568   C C5    . DT  A 1 28  ? 131.644 95.430  71.492  1.00 94.30  ? -36 DT  I C5    1 
ATOM   569   C C7    . DT  A 1 28  ? 132.772 95.276  70.522  1.00 95.07  ? -36 DT  I C7    1 
ATOM   570   C C6    . DT  A 1 28  ? 130.384 95.076  71.207  1.00 94.56  ? -36 DT  I C6    1 
ATOM   571   P P     . DT  A 1 29  ? 124.341 95.559  70.023  1.00 85.10  ? -35 DT  I P     1 
ATOM   572   O OP1   . DT  A 1 29  ? 122.913 95.176  70.142  1.00 84.25  ? -35 DT  I OP1   1 
ATOM   573   O OP2   . DT  A 1 29  ? 124.884 95.972  68.707  1.00 87.03  ? -35 DT  I OP2   1 
ATOM   574   O "O5'" . DT  A 1 29  ? 124.656 96.710  71.078  1.00 84.60  ? -35 DT  I "O5'" 1 
ATOM   575   C "C5'" . DT  A 1 29  ? 124.384 96.516  72.467  1.00 79.50  ? -35 DT  I "C5'" 1 
ATOM   576   C "C4'" . DT  A 1 29  ? 124.661 97.777  73.247  1.00 74.79  ? -35 DT  I "C4'" 1 
ATOM   577   O "O4'" . DT  A 1 29  ? 126.085 97.970  73.431  1.00 73.59  ? -35 DT  I "O4'" 1 
ATOM   578   C "C3'" . DT  A 1 29  ? 124.133 99.065  72.609  1.00 72.78  ? -35 DT  I "C3'" 1 
ATOM   579   O "O3'" . DT  A 1 29  ? 123.595 99.912  73.623  1.00 67.65  ? -35 DT  I "O3'" 1 
ATOM   580   C "C2'" . DT  A 1 29  ? 125.389 99.714  72.061  1.00 73.94  ? -35 DT  I "C2'" 1 
ATOM   581   C "C1'" . DT  A 1 29  ? 126.400 99.310  73.113  1.00 75.26  ? -35 DT  I "C1'" 1 
ATOM   582   N N1    . DT  A 1 29  ? 127.812 99.372  72.696  1.00 77.94  ? -35 DT  I N1    1 
ATOM   583   C C2    . DT  A 1 29  ? 128.693 99.990  73.552  1.00 79.25  ? -35 DT  I C2    1 
ATOM   584   O O2    . DT  A 1 29  ? 128.355 100.456 74.630  1.00 79.14  ? -35 DT  I O2    1 
ATOM   585   N N3    . DT  A 1 29  ? 129.987 100.043 73.100  1.00 79.80  ? -35 DT  I N3    1 
ATOM   586   C C4    . DT  A 1 29  ? 130.476 99.550  71.906  1.00 79.40  ? -35 DT  I C4    1 
ATOM   587   O O4    . DT  A 1 29  ? 131.665 99.676  71.634  1.00 79.09  ? -35 DT  I O4    1 
ATOM   588   C C5    . DT  A 1 29  ? 129.498 98.903  71.060  1.00 79.59  ? -35 DT  I C5    1 
ATOM   589   C C7    . DT  A 1 29  ? 129.936 98.337  69.747  1.00 81.17  ? -35 DT  I C7    1 
ATOM   590   C C6    . DT  A 1 29  ? 128.231 98.843  71.494  1.00 78.49  ? -35 DT  I C6    1 
ATOM   591   P P     . DG  A 1 30  ? 122.015 99.938  73.883  1.00 63.34  ? -34 DG  I P     1 
ATOM   592   O OP1   . DG  A 1 30  ? 121.541 98.538  73.936  1.00 64.84  ? -34 DG  I OP1   1 
ATOM   593   O OP2   . DG  A 1 30  ? 121.386 100.889 72.939  1.00 63.55  ? -34 DG  I OP2   1 
ATOM   594   O "O5'" . DG  A 1 30  ? 121.908 100.550 75.349  1.00 63.81  ? -34 DG  I "O5'" 1 
ATOM   595   C "C5'" . DG  A 1 30  ? 122.338 99.798  76.478  1.00 58.14  ? -34 DG  I "C5'" 1 
ATOM   596   C "C4'" . DG  A 1 30  ? 123.003 100.708 77.484  1.00 56.51  ? -34 DG  I "C4'" 1 
ATOM   597   O "O4'" . DG  A 1 30  ? 124.296 101.139 77.011  1.00 56.45  ? -34 DG  I "O4'" 1 
ATOM   598   C "C3'" . DG  A 1 30  ? 122.235 101.984 77.802  1.00 54.44  ? -34 DG  I "C3'" 1 
ATOM   599   O "O3'" . DG  A 1 30  ? 122.487 102.319 79.166  1.00 48.81  ? -34 DG  I "O3'" 1 
ATOM   600   C "C2'" . DG  A 1 30  ? 122.858 103.001 76.863  1.00 54.91  ? -34 DG  I "C2'" 1 
ATOM   601   C "C1'" . DG  A 1 30  ? 124.307 102.542 76.799  1.00 58.69  ? -34 DG  I "C1'" 1 
ATOM   602   N N9    . DG  A 1 30  ? 124.977 102.772 75.522  1.00 63.58  ? -34 DG  I N9    1 
ATOM   603   C C8    . DG  A 1 30  ? 124.422 102.715 74.264  1.00 62.24  ? -34 DG  I C8    1 
ATOM   604   N N7    . DG  A 1 30  ? 125.296 102.898 73.314  1.00 64.52  ? -34 DG  I N7    1 
ATOM   605   C C5    . DG  A 1 30  ? 126.494 103.104 73.979  1.00 64.36  ? -34 DG  I C5    1 
ATOM   606   C C6    . DG  A 1 30  ? 127.791 103.341 73.476  1.00 65.71  ? -34 DG  I C6    1 
ATOM   607   O O6    . DG  A 1 30  ? 128.157 103.425 72.301  1.00 67.72  ? -34 DG  I O6    1 
ATOM   608   N N1    . DG  A 1 30  ? 128.717 103.487 74.500  1.00 64.27  ? -34 DG  I N1    1 
ATOM   609   C C2    . DG  A 1 30  ? 128.433 103.410 75.838  1.00 63.87  ? -34 DG  I C2    1 
ATOM   610   N N2    . DG  A 1 30  ? 129.470 103.561 76.671  1.00 62.89  ? -34 DG  I N2    1 
ATOM   611   N N3    . DG  A 1 30  ? 127.226 103.195 76.322  1.00 62.05  ? -34 DG  I N3    1 
ATOM   612   C C4    . DG  A 1 30  ? 126.312 103.048 75.344  1.00 63.78  ? -34 DG  I C4    1 
ATOM   613   P P     . DG  A 1 31  ? 121.657 103.495 79.864  1.00 46.59  ? -33 DG  I P     1 
ATOM   614   O OP1   . DG  A 1 31  ? 121.441 103.084 81.281  1.00 49.06  ? -33 DG  I OP1   1 
ATOM   615   O OP2   . DG  A 1 31  ? 120.481 103.853 79.019  1.00 45.45  ? -33 DG  I OP2   1 
ATOM   616   O "O5'" . DG  A 1 31  ? 122.657 104.734 79.808  1.00 47.48  ? -33 DG  I "O5'" 1 
ATOM   617   C "C5'" . DG  A 1 31  ? 123.951 104.654 80.386  1.00 48.98  ? -33 DG  I "C5'" 1 
ATOM   618   C "C4'" . DG  A 1 31  ? 124.793 105.829 79.948  1.00 53.56  ? -33 DG  I "C4'" 1 
ATOM   619   O "O4'" . DG  A 1 31  ? 125.178 105.682 78.562  1.00 54.49  ? -33 DG  I "O4'" 1 
ATOM   620   C "C3'" . DG  A 1 31  ? 124.119 107.201 80.051  1.00 56.15  ? -33 DG  I "C3'" 1 
ATOM   621   O "O3'" . DG  A 1 31  ? 125.098 108.153 80.440  1.00 57.99  ? -33 DG  I "O3'" 1 
ATOM   622   C "C2'" . DG  A 1 31  ? 123.725 107.497 78.616  1.00 56.61  ? -33 DG  I "C2'" 1 
ATOM   623   C "C1'" . DG  A 1 31  ? 124.915 106.901 77.892  1.00 56.09  ? -33 DG  I "C1'" 1 
ATOM   624   N N9    . DG  A 1 31  ? 124.782 106.626 76.463  1.00 56.66  ? -33 DG  I N9    1 
ATOM   625   C C8    . DG  A 1 31  ? 123.635 106.434 75.727  1.00 56.35  ? -33 DG  I C8    1 
ATOM   626   N N7    . DG  A 1 31  ? 123.870 106.218 74.460  1.00 56.20  ? -33 DG  I N7    1 
ATOM   627   C C5    . DG  A 1 31  ? 125.255 106.275 74.354  1.00 58.38  ? -33 DG  I C5    1 
ATOM   628   C C6    . DG  A 1 31  ? 126.105 106.126 73.222  1.00 58.78  ? -33 DG  I C6    1 
ATOM   629   O O6    . DG  A 1 31  ? 125.794 105.906 72.043  1.00 57.89  ? -33 DG  I O6    1 
ATOM   630   N N1    . DG  A 1 31  ? 127.446 106.253 73.571  1.00 57.52  ? -33 DG  I N1    1 
ATOM   631   C C2    . DG  A 1 31  ? 127.914 106.489 74.843  1.00 61.41  ? -33 DG  I C2    1 
ATOM   632   N N2    . DG  A 1 31  ? 129.246 106.558 74.989  1.00 61.85  ? -33 DG  I N2    1 
ATOM   633   N N3    . DG  A 1 31  ? 127.133 106.640 75.899  1.00 58.62  ? -33 DG  I N3    1 
ATOM   634   C C4    . DG  A 1 31  ? 125.827 106.520 75.584  1.00 57.00  ? -33 DG  I C4    1 
ATOM   635   P P     . DA  A 1 32  ? 124.952 108.922 81.837  1.00 61.90  ? -32 DA  I P     1 
ATOM   636   O OP1   . DA  A 1 32  ? 124.738 107.898 82.887  1.00 62.25  ? -32 DA  I OP1   1 
ATOM   637   O OP2   . DA  A 1 32  ? 123.977 110.028 81.673  1.00 62.14  ? -32 DA  I OP2   1 
ATOM   638   O "O5'" . DA  A 1 32  ? 126.401 109.544 82.053  1.00 61.73  ? -32 DA  I "O5'" 1 
ATOM   639   C "C5'" . DA  A 1 32  ? 127.512 108.699 82.339  1.00 65.81  ? -32 DA  I "C5'" 1 
ATOM   640   C "C4'" . DA  A 1 32  ? 128.766 109.255 81.710  1.00 69.52  ? -32 DA  I "C4'" 1 
ATOM   641   O "O4'" . DA  A 1 32  ? 128.711 109.095 80.274  1.00 68.85  ? -32 DA  I "O4'" 1 
ATOM   642   C "C3'" . DA  A 1 32  ? 128.983 110.743 81.955  1.00 70.27  ? -32 DA  I "C3'" 1 
ATOM   643   O "O3'" . DA  A 1 32  ? 130.375 111.003 82.112  1.00 74.30  ? -32 DA  I "O3'" 1 
ATOM   644   C "C2'" . DA  A 1 32  ? 128.444 111.391 80.693  1.00 69.29  ? -32 DA  I "C2'" 1 
ATOM   645   C "C1'" . DA  A 1 32  ? 128.774 110.359 79.629  1.00 68.91  ? -32 DA  I "C1'" 1 
ATOM   646   N N9    . DA  A 1 32  ? 127.841 110.313 78.505  1.00 69.42  ? -32 DA  I N9    1 
ATOM   647   C C8    . DA  A 1 32  ? 126.466 110.310 78.554  1.00 69.28  ? -32 DA  I C8    1 
ATOM   648   N N7    . DA  A 1 32  ? 125.898 110.188 77.379  1.00 68.35  ? -32 DA  I N7    1 
ATOM   649   C C5    . DA  A 1 32  ? 126.967 110.119 76.496  1.00 70.21  ? -32 DA  I C5    1 
ATOM   650   C C6    . DA  A 1 32  ? 127.033 109.961 75.102  1.00 70.32  ? -32 DA  I C6    1 
ATOM   651   N N6    . DA  A 1 32  ? 125.961 109.815 74.323  1.00 72.27  ? -32 DA  I N6    1 
ATOM   652   N N1    . DA  A 1 32  ? 128.255 109.946 74.527  1.00 67.83  ? -32 DA  I N1    1 
ATOM   653   C C2    . DA  A 1 32  ? 129.332 110.064 75.312  1.00 68.01  ? -32 DA  I C2    1 
ATOM   654   N N3    . DA  A 1 32  ? 129.400 110.198 76.637  1.00 69.51  ? -32 DA  I N3    1 
ATOM   655   C C4    . DA  A 1 32  ? 128.169 110.219 77.175  1.00 69.60  ? -32 DA  I C4    1 
ATOM   656   P P     . DA  A 1 33  ? 130.892 112.515 82.172  1.00 80.29  ? -31 DA  I P     1 
ATOM   657   O OP1   . DA  A 1 33  ? 132.272 112.501 82.720  1.00 81.36  ? -31 DA  I OP1   1 
ATOM   658   O OP2   . DA  A 1 33  ? 129.847 113.350 82.828  1.00 79.55  ? -31 DA  I OP2   1 
ATOM   659   O "O5'" . DA  A 1 33  ? 130.967 112.932 80.641  1.00 79.02  ? -31 DA  I "O5'" 1 
ATOM   660   C "C5'" . DA  A 1 33  ? 132.001 112.430 79.811  1.00 79.92  ? -31 DA  I "C5'" 1 
ATOM   661   C "C4'" . DA  A 1 33  ? 132.218 113.360 78.644  1.00 81.28  ? -31 DA  I "C4'" 1 
ATOM   662   O "O4'" . DA  A 1 33  ? 131.189 113.166 77.646  1.00 78.99  ? -31 DA  I "O4'" 1 
ATOM   663   C "C3'" . DA  A 1 33  ? 132.177 114.839 79.022  1.00 82.80  ? -31 DA  I "C3'" 1 
ATOM   664   O "O3'" . DA  A 1 33  ? 133.207 115.537 78.329  1.00 84.73  ? -31 DA  I "O3'" 1 
ATOM   665   C "C2'" . DA  A 1 33  ? 130.805 115.289 78.547  1.00 81.66  ? -31 DA  I "C2'" 1 
ATOM   666   C "C1'" . DA  A 1 33  ? 130.575 114.405 77.334  1.00 80.82  ? -31 DA  I "C1'" 1 
ATOM   667   N N9    . DA  A 1 33  ? 129.173 114.134 77.009  1.00 79.86  ? -31 DA  I N9    1 
ATOM   668   C C8    . DA  A 1 33  ? 128.090 114.084 77.854  1.00 78.68  ? -31 DA  I C8    1 
ATOM   669   N N7    . DA  A 1 33  ? 126.965 113.777 77.252  1.00 77.73  ? -31 DA  I N7    1 
ATOM   670   C C5    . DA  A 1 33  ? 127.332 113.620 75.923  1.00 77.07  ? -31 DA  I C5    1 
ATOM   671   C C6    . DA  A 1 33  ? 126.596 113.279 74.769  1.00 75.71  ? -31 DA  I C6    1 
ATOM   672   N N6    . DA  A 1 33  ? 125.290 113.015 74.770  1.00 72.51  ? -31 DA  I N6    1 
ATOM   673   N N1    . DA  A 1 33  ? 127.263 113.214 73.597  1.00 76.66  ? -31 DA  I N1    1 
ATOM   674   C C2    . DA  A 1 33  ? 128.578 113.472 73.593  1.00 77.82  ? -31 DA  I C2    1 
ATOM   675   N N3    . DA  A 1 33  ? 129.377 113.796 74.607  1.00 77.78  ? -31 DA  I N3    1 
ATOM   676   C C4    . DA  A 1 33  ? 128.685 113.852 75.756  1.00 78.13  ? -31 DA  I C4    1 
ATOM   677   P P     . DA  A 1 34  ? 133.515 117.066 78.696  1.00 87.28  ? -30 DA  I P     1 
ATOM   678   O OP1   . DA  A 1 34  ? 134.955 117.181 79.038  1.00 87.93  ? -30 DA  I OP1   1 
ATOM   679   O OP2   . DA  A 1 34  ? 132.488 117.536 79.662  1.00 88.22  ? -30 DA  I OP2   1 
ATOM   680   O "O5'" . DA  A 1 34  ? 133.255 117.812 77.320  1.00 86.61  ? -30 DA  I "O5'" 1 
ATOM   681   C "C5'" . DA  A 1 34  ? 133.801 117.300 76.115  1.00 85.99  ? -30 DA  I "C5'" 1 
ATOM   682   C "C4'" . DA  A 1 34  ? 133.083 117.894 74.928  1.00 85.94  ? -30 DA  I "C4'" 1 
ATOM   683   O "O4'" . DA  A 1 34  ? 131.816 117.227 74.708  1.00 85.15  ? -30 DA  I "O4'" 1 
ATOM   684   C "C3'" . DA  A 1 34  ? 132.769 119.381 75.081  1.00 85.77  ? -30 DA  I "C3'" 1 
ATOM   685   O "O3'" . DA  A 1 34  ? 133.102 120.076 73.885  1.00 86.27  ? -30 DA  I "O3'" 1 
ATOM   686   C "C2'" . DA  A 1 34  ? 131.266 119.410 75.299  1.00 84.53  ? -30 DA  I "C2'" 1 
ATOM   687   C "C1'" . DA  A 1 34  ? 130.812 118.204 74.503  1.00 84.96  ? -30 DA  I "C1'" 1 
ATOM   688   N N9    . DA  A 1 34  ? 129.530 117.638 74.922  1.00 85.49  ? -30 DA  I N9    1 
ATOM   689   C C8    . DA  A 1 34  ? 129.119 117.322 76.192  1.00 85.55  ? -30 DA  I C8    1 
ATOM   690   N N7    . DA  A 1 34  ? 127.898 116.851 76.251  1.00 84.68  ? -30 DA  I N7    1 
ATOM   691   C C5    . DA  A 1 34  ? 127.475 116.852 74.929  1.00 84.64  ? -30 DA  I C5    1 
ATOM   692   C C6    . DA  A 1 34  ? 126.268 116.468 74.325  1.00 83.94  ? -30 DA  I C6    1 
ATOM   693   N N6    . DA  A 1 34  ? 125.223 115.993 75.003  1.00 83.76  ? -30 DA  I N6    1 
ATOM   694   N N1    . DA  A 1 34  ? 126.169 116.591 72.983  1.00 84.13  ? -30 DA  I N1    1 
ATOM   695   C C2    . DA  A 1 34  ? 127.220 117.066 72.306  1.00 84.92  ? -30 DA  I C2    1 
ATOM   696   N N3    . DA  A 1 34  ? 128.409 117.461 72.761  1.00 85.72  ? -30 DA  I N3    1 
ATOM   697   C C4    . DA  A 1 34  ? 128.472 117.327 74.099  1.00 85.31  ? -30 DA  I C4    1 
ATOM   698   P P     . DC  A 1 35  ? 133.062 121.677 73.864  1.00 87.13  ? -29 DC  I P     1 
ATOM   699   O OP1   . DC  A 1 35  ? 134.368 122.158 73.345  1.00 89.54  ? -29 DC  I OP1   1 
ATOM   700   O OP2   . DC  A 1 35  ? 132.572 122.163 75.178  1.00 87.75  ? -29 DC  I OP2   1 
ATOM   701   O "O5'" . DC  A 1 35  ? 131.945 121.971 72.775  1.00 86.98  ? -29 DC  I "O5'" 1 
ATOM   702   C "C5'" . DC  A 1 35  ? 131.885 121.193 71.589  1.00 87.86  ? -29 DC  I "C5'" 1 
ATOM   703   C "C4'" . DC  A 1 35  ? 130.622 121.512 70.828  1.00 89.58  ? -29 DC  I "C4'" 1 
ATOM   704   O "O4'" . DC  A 1 35  ? 129.499 120.772 71.371  1.00 90.13  ? -29 DC  I "O4'" 1 
ATOM   705   C "C3'" . DC  A 1 35  ? 130.232 122.990 70.882  1.00 89.05  ? -29 DC  I "C3'" 1 
ATOM   706   O "O3'" . DC  A 1 35  ? 129.803 123.428 69.596  1.00 90.56  ? -29 DC  I "O3'" 1 
ATOM   707   C "C2'" . DC  A 1 35  ? 129.079 123.014 71.870  1.00 89.54  ? -29 DC  I "C2'" 1 
ATOM   708   C "C1'" . DC  A 1 35  ? 128.429 121.663 71.628  1.00 89.54  ? -29 DC  I "C1'" 1 
ATOM   709   N N1    . DC  A 1 35  ? 127.642 121.130 72.755  1.00 90.06  ? -29 DC  I N1    1 
ATOM   710   C C2    . DC  A 1 35  ? 126.537 120.321 72.476  1.00 89.66  ? -29 DC  I C2    1 
ATOM   711   O O2    . DC  A 1 35  ? 126.281 120.044 71.297  1.00 90.40  ? -29 DC  I O2    1 
ATOM   712   N N3    . DC  A 1 35  ? 125.779 119.857 73.493  1.00 90.09  ? -29 DC  I N3    1 
ATOM   713   C C4    . DC  A 1 35  ? 126.096 120.164 74.753  1.00 90.45  ? -29 DC  I C4    1 
ATOM   714   N N4    . DC  A 1 35  ? 125.309 119.695 75.727  1.00 89.86  ? -29 DC  I N4    1 
ATOM   715   C C5    . DC  A 1 35  ? 127.230 120.970 75.070  1.00 90.23  ? -29 DC  I C5    1 
ATOM   716   C C6    . DC  A 1 35  ? 127.969 121.427 74.049  1.00 89.78  ? -29 DC  I C6    1 
ATOM   717   P P     . DT  A 1 36  ? 129.038 124.828 69.451  1.00 91.16  ? -28 DT  I P     1 
ATOM   718   O OP1   . DT  A 1 36  ? 129.178 125.302 68.050  1.00 91.46  ? -28 DT  I OP1   1 
ATOM   719   O OP2   . DT  A 1 36  ? 129.481 125.691 70.573  1.00 91.05  ? -28 DT  I OP2   1 
ATOM   720   O "O5'" . DT  A 1 36  ? 127.518 124.433 69.687  1.00 90.63  ? -28 DT  I "O5'" 1 
ATOM   721   C "C5'" . DT  A 1 36  ? 126.866 123.544 68.791  1.00 92.56  ? -28 DT  I "C5'" 1 
ATOM   722   C "C4'" . DT  A 1 36  ? 125.376 123.763 68.849  1.00 93.57  ? -28 DT  I "C4'" 1 
ATOM   723   O "O4'" . DT  A 1 36  ? 124.823 123.150 70.039  1.00 93.83  ? -28 DT  I "O4'" 1 
ATOM   724   C "C3'" . DT  A 1 36  ? 124.990 125.239 68.918  1.00 94.44  ? -28 DT  I "C3'" 1 
ATOM   725   O "O3'" . DT  A 1 36  ? 123.796 125.445 68.173  1.00 94.85  ? -28 DT  I "O3'" 1 
ATOM   726   C "C2'" . DT  A 1 36  ? 124.719 125.456 70.397  1.00 93.93  ? -28 DT  I "C2'" 1 
ATOM   727   C "C1'" . DT  A 1 36  ? 124.104 124.124 70.777  1.00 94.00  ? -28 DT  I "C1'" 1 
ATOM   728   N N1    . DT  A 1 36  ? 124.184 123.763 72.200  1.00 93.71  ? -28 DT  I N1    1 
ATOM   729   C C2    . DT  A 1 36  ? 123.195 122.950 72.698  1.00 93.47  ? -28 DT  I C2    1 
ATOM   730   O O2    . DT  A 1 36  ? 122.271 122.536 72.016  1.00 93.05  ? -28 DT  I O2    1 
ATOM   731   N N3    . DT  A 1 36  ? 123.328 122.636 74.026  1.00 93.29  ? -28 DT  I N3    1 
ATOM   732   C C4    . DT  A 1 36  ? 124.326 123.046 74.885  1.00 94.00  ? -28 DT  I C4    1 
ATOM   733   O O4    . DT  A 1 36  ? 124.316 122.678 76.059  1.00 94.04  ? -28 DT  I O4    1 
ATOM   734   C C5    . DT  A 1 36  ? 125.329 123.906 74.299  1.00 93.72  ? -28 DT  I C5    1 
ATOM   735   C C7    . DT  A 1 36  ? 126.448 124.407 75.158  1.00 92.05  ? -28 DT  I C7    1 
ATOM   736   C C6    . DT  A 1 36  ? 125.210 124.216 73.002  1.00 93.61  ? -28 DT  I C6    1 
ATOM   737   P P     . DG  A 1 37  ? 123.487 126.885 67.546  1.00 93.59  ? -27 DG  I P     1 
ATOM   738   O OP1   . DG  A 1 37  ? 124.355 127.034 66.352  1.00 94.46  ? -27 DG  I OP1   1 
ATOM   739   O OP2   . DG  A 1 37  ? 123.541 127.900 68.627  1.00 93.84  ? -27 DG  I OP2   1 
ATOM   740   O "O5'" . DG  A 1 37  ? 121.976 126.738 67.076  1.00 93.60  ? -27 DG  I "O5'" 1 
ATOM   741   C "C5'" . DG  A 1 37  ? 121.493 125.492 66.586  1.00 92.96  ? -27 DG  I "C5'" 1 
ATOM   742   C "C4'" . DG  A 1 37  ? 120.144 125.184 67.191  1.00 93.51  ? -27 DG  I "C4'" 1 
ATOM   743   O "O4'" . DG  A 1 37  ? 120.279 124.735 68.562  1.00 94.15  ? -27 DG  I "O4'" 1 
ATOM   744   C "C3'" . DG  A 1 37  ? 119.193 126.377 67.229  1.00 93.48  ? -27 DG  I "C3'" 1 
ATOM   745   O "O3'" . DG  A 1 37  ? 117.877 125.939 66.916  1.00 93.45  ? -27 DG  I "O3'" 1 
ATOM   746   C "C2'" . DG  A 1 37  ? 119.271 126.847 68.670  1.00 93.49  ? -27 DG  I "C2'" 1 
ATOM   747   C "C1'" . DG  A 1 37  ? 119.479 125.540 69.416  1.00 93.74  ? -27 DG  I "C1'" 1 
ATOM   748   N N9    . DG  A 1 37  ? 120.175 125.666 70.694  1.00 93.17  ? -27 DG  I N9    1 
ATOM   749   C C8    . DG  A 1 37  ? 121.420 126.203 70.908  1.00 93.64  ? -27 DG  I C8    1 
ATOM   750   N N7    . DG  A 1 37  ? 121.791 126.158 72.158  1.00 93.64  ? -27 DG  I N7    1 
ATOM   751   C C5    . DG  A 1 37  ? 120.723 125.557 72.811  1.00 93.10  ? -27 DG  I C5    1 
ATOM   752   C C6    . DG  A 1 37  ? 120.549 125.232 74.183  1.00 91.92  ? -27 DG  I C6    1 
ATOM   753   O O6    . DG  A 1 37  ? 121.333 125.405 75.122  1.00 90.47  ? -27 DG  I O6    1 
ATOM   754   N N1    . DG  A 1 37  ? 119.310 124.643 74.416  1.00 92.30  ? -27 DG  I N1    1 
ATOM   755   C C2    . DG  A 1 37  ? 118.363 124.389 73.454  1.00 93.29  ? -27 DG  I C2    1 
ATOM   756   N N2    . DG  A 1 37  ? 117.223 123.820 73.877  1.00 91.80  ? -27 DG  I N2    1 
ATOM   757   N N3    . DG  A 1 37  ? 118.518 124.677 72.169  1.00 93.63  ? -27 DG  I N3    1 
ATOM   758   C C4    . DG  A 1 37  ? 119.713 125.256 71.922  1.00 93.30  ? -27 DG  I C4    1 
ATOM   759   P P     . DC  A 1 38  ? 116.711 127.017 66.728  1.00 94.99  ? -26 DC  I P     1 
ATOM   760   O OP1   . DC  A 1 38  ? 116.000 126.735 65.454  1.00 94.84  ? -26 DC  I OP1   1 
ATOM   761   O OP2   . DC  A 1 38  ? 117.287 128.367 66.973  1.00 94.66  ? -26 DC  I OP2   1 
ATOM   762   O "O5'" . DC  A 1 38  ? 115.723 126.677 67.922  1.00 93.71  ? -26 DC  I "O5'" 1 
ATOM   763   C "C5'" . DC  A 1 38  ? 115.359 125.329 68.185  1.00 91.60  ? -26 DC  I "C5'" 1 
ATOM   764   C "C4'" . DC  A 1 38  ? 114.581 125.255 69.473  1.00 88.97  ? -26 DC  I "C4'" 1 
ATOM   765   O "O4'" . DC  A 1 38  ? 115.460 125.548 70.584  1.00 88.63  ? -26 DC  I "O4'" 1 
ATOM   766   C "C3'" . DC  A 1 38  ? 113.456 126.283 69.538  1.00 86.91  ? -26 DC  I "C3'" 1 
ATOM   767   O "O3'" . DC  A 1 38  ? 112.337 125.705 70.199  1.00 86.53  ? -26 DC  I "O3'" 1 
ATOM   768   C "C2'" . DC  A 1 38  ? 114.062 127.421 70.342  1.00 86.16  ? -26 DC  I "C2'" 1 
ATOM   769   C "C1'" . DC  A 1 38  ? 115.016 126.700 71.282  1.00 86.29  ? -26 DC  I "C1'" 1 
ATOM   770   N N1    . DC  A 1 38  ? 116.209 127.468 71.685  1.00 84.20  ? -26 DC  I N1    1 
ATOM   771   C C2    . DC  A 1 38  ? 116.613 127.431 73.028  1.00 84.23  ? -26 DC  I C2    1 
ATOM   772   O O2    . DC  A 1 38  ? 115.961 126.756 73.832  1.00 85.45  ? -26 DC  I O2    1 
ATOM   773   N N3    . DC  A 1 38  ? 117.703 128.129 73.408  1.00 84.31  ? -26 DC  I N3    1 
ATOM   774   C C4    . DC  A 1 38  ? 118.388 128.842 72.510  1.00 85.01  ? -26 DC  I C4    1 
ATOM   775   N N4    . DC  A 1 38  ? 119.457 129.517 72.934  1.00 83.02  ? -26 DC  I N4    1 
ATOM   776   C C5    . DC  A 1 38  ? 118.004 128.893 71.139  1.00 84.03  ? -26 DC  I C5    1 
ATOM   777   C C6    . DC  A 1 38  ? 116.916 128.200 70.774  1.00 83.76  ? -26 DC  I C6    1 
ATOM   778   P P     . DT  A 1 39  ? 110.859 126.237 69.871  1.00 85.55  ? -25 DT  I P     1 
ATOM   779   O OP1   . DT  A 1 39  ? 110.133 125.191 69.101  1.00 85.56  ? -25 DT  I OP1   1 
ATOM   780   O OP2   . DT  A 1 39  ? 110.987 127.611 69.325  1.00 84.31  ? -25 DT  I OP2   1 
ATOM   781   O "O5'" . DT  A 1 39  ? 110.218 126.367 71.319  1.00 84.65  ? -25 DT  I "O5'" 1 
ATOM   782   C "C5'" . DT  A 1 39  ? 110.984 126.951 72.355  1.00 79.77  ? -25 DT  I "C5'" 1 
ATOM   783   C "C4'" . DT  A 1 39  ? 111.035 126.038 73.554  1.00 76.56  ? -25 DT  I "C4'" 1 
ATOM   784   O "O4'" . DT  A 1 39  ? 112.319 126.206 74.181  1.00 76.43  ? -25 DT  I "O4'" 1 
ATOM   785   C "C3'" . DT  A 1 39  ? 110.008 126.383 74.621  1.00 74.26  ? -25 DT  I "C3'" 1 
ATOM   786   O "O3'" . DT  A 1 39  ? 109.656 125.211 75.364  1.00 71.76  ? -25 DT  I "O3'" 1 
ATOM   787   C "C2'" . DT  A 1 39  ? 110.737 127.415 75.465  1.00 75.12  ? -25 DT  I "C2'" 1 
ATOM   788   C "C1'" . DT  A 1 39  ? 112.202 127.003 75.348  1.00 76.35  ? -25 DT  I "C1'" 1 
ATOM   789   N N1    . DT  A 1 39  ? 113.168 128.108 75.196  1.00 77.54  ? -25 DT  I N1    1 
ATOM   790   C C2    . DT  A 1 39  ? 114.151 128.263 76.148  1.00 78.19  ? -25 DT  I C2    1 
ATOM   791   O O2    . DT  A 1 39  ? 114.217 127.582 77.160  1.00 77.88  ? -25 DT  I O2    1 
ATOM   792   N N3    . DT  A 1 39  ? 115.064 129.250 75.871  1.00 77.73  ? -25 DT  I N3    1 
ATOM   793   C C4    . DT  A 1 39  ? 115.086 130.080 74.766  1.00 78.63  ? -25 DT  I C4    1 
ATOM   794   O O4    . DT  A 1 39  ? 115.999 130.890 74.625  1.00 80.42  ? -25 DT  I O4    1 
ATOM   795   C C5    . DT  A 1 39  ? 113.999 129.895 73.835  1.00 78.16  ? -25 DT  I C5    1 
ATOM   796   C C7    . DT  A 1 39  ? 113.925 130.772 72.625  1.00 76.82  ? -25 DT  I C7    1 
ATOM   797   C C6    . DT  A 1 39  ? 113.102 128.937 74.097  1.00 78.06  ? -25 DT  I C6    1 
ATOM   798   P P     . DC  A 1 40  ? 108.296 125.192 76.220  1.00 67.31  ? -24 DC  I P     1 
ATOM   799   O OP1   . DC  A 1 40  ? 107.967 123.792 76.575  1.00 67.13  ? -24 DC  I OP1   1 
ATOM   800   O OP2   . DC  A 1 40  ? 107.303 126.016 75.481  1.00 68.57  ? -24 DC  I OP2   1 
ATOM   801   O "O5'" . DC  A 1 40  ? 108.698 125.984 77.539  1.00 63.76  ? -24 DC  I "O5'" 1 
ATOM   802   C "C5'" . DC  A 1 40  ? 109.741 125.510 78.382  1.00 60.94  ? -24 DC  I "C5'" 1 
ATOM   803   C "C4'" . DC  A 1 40  ? 110.137 126.592 79.356  1.00 58.01  ? -24 DC  I "C4'" 1 
ATOM   804   O "O4'" . DC  A 1 40  ? 110.898 127.617 78.671  1.00 59.73  ? -24 DC  I "O4'" 1 
ATOM   805   C "C3'" . DC  A 1 40  ? 108.947 127.304 79.997  1.00 55.05  ? -24 DC  I "C3'" 1 
ATOM   806   O "O3'" . DC  A 1 40  ? 109.291 127.690 81.324  1.00 51.63  ? -24 DC  I "O3'" 1 
ATOM   807   C "C2'" . DC  A 1 40  ? 108.835 128.569 79.163  1.00 59.11  ? -24 DC  I "C2'" 1 
ATOM   808   C "C1'" . DC  A 1 40  ? 110.304 128.873 78.932  1.00 61.88  ? -24 DC  I "C1'" 1 
ATOM   809   N N1    . DC  A 1 40  ? 110.631 129.783 77.818  1.00 65.77  ? -24 DC  I N1    1 
ATOM   810   C C2    . DC  A 1 40  ? 111.915 130.340 77.768  1.00 65.86  ? -24 DC  I C2    1 
ATOM   811   O O2    . DC  A 1 40  ? 112.737 130.034 78.643  1.00 62.01  ? -24 DC  I O2    1 
ATOM   812   N N3    . DC  A 1 40  ? 112.228 131.198 76.772  1.00 69.72  ? -24 DC  I N3    1 
ATOM   813   C C4    . DC  A 1 40  ? 111.317 131.510 75.850  1.00 70.17  ? -24 DC  I C4    1 
ATOM   814   N N4    . DC  A 1 40  ? 111.669 132.372 74.898  1.00 72.60  ? -24 DC  I N4    1 
ATOM   815   C C5    . DC  A 1 40  ? 110.002 130.951 75.868  1.00 69.40  ? -24 DC  I C5    1 
ATOM   816   C C6    . DC  A 1 40  ? 109.706 130.096 76.858  1.00 67.08  ? -24 DC  I C6    1 
ATOM   817   P P     . DC  A 1 41  ? 109.033 126.683 82.554  1.00 47.95  ? -23 DC  I P     1 
ATOM   818   O OP1   . DC  A 1 41  ? 109.638 125.377 82.190  1.00 41.80  ? -23 DC  I OP1   1 
ATOM   819   O OP2   . DC  A 1 41  ? 107.598 126.740 82.935  1.00 47.62  ? -23 DC  I OP2   1 
ATOM   820   O "O5'" . DC  A 1 41  ? 109.903 127.355 83.704  1.00 44.71  ? -23 DC  I "O5'" 1 
ATOM   821   C "C5'" . DC  A 1 41  ? 111.306 127.120 83.773  1.00 45.56  ? -23 DC  I "C5'" 1 
ATOM   822   C "C4'" . DC  A 1 41  ? 112.046 128.368 84.199  1.00 46.53  ? -23 DC  I "C4'" 1 
ATOM   823   O "O4'" . DC  A 1 41  ? 112.262 129.280 83.087  1.00 51.50  ? -23 DC  I "O4'" 1 
ATOM   824   C "C3'" . DC  A 1 41  ? 111.417 129.195 85.323  1.00 47.58  ? -23 DC  I "C3'" 1 
ATOM   825   O "O3'" . DC  A 1 41  ? 112.425 129.484 86.281  1.00 43.04  ? -23 DC  I "O3'" 1 
ATOM   826   C "C2'" . DC  A 1 41  ? 110.972 130.474 84.627  1.00 51.31  ? -23 DC  I "C2'" 1 
ATOM   827   C "C1'" . DC  A 1 41  ? 111.990 130.610 83.501  1.00 53.17  ? -23 DC  I "C1'" 1 
ATOM   828   N N1    . DC  A 1 41  ? 111.527 131.366 82.316  1.00 56.97  ? -23 DC  I N1    1 
ATOM   829   C C2    . DC  A 1 41  ? 112.394 132.306 81.717  1.00 56.99  ? -23 DC  I C2    1 
ATOM   830   O O2    . DC  A 1 41  ? 113.517 132.487 82.202  1.00 55.59  ? -23 DC  I O2    1 
ATOM   831   N N3    . DC  A 1 41  ? 111.981 132.981 80.626  1.00 57.18  ? -23 DC  I N3    1 
ATOM   832   C C4    . DC  A 1 41  ? 110.765 132.755 80.123  1.00 59.25  ? -23 DC  I C4    1 
ATOM   833   N N4    . DC  A 1 41  ? 110.409 133.432 79.033  1.00 60.24  ? -23 DC  I N4    1 
ATOM   834   C C5    . DC  A 1 41  ? 109.863 131.823 80.711  1.00 58.24  ? -23 DC  I C5    1 
ATOM   835   C C6    . DC  A 1 41  ? 110.281 131.158 81.797  1.00 56.95  ? -23 DC  I C6    1 
ATOM   836   P P     . DA  A 1 42  ? 112.031 130.141 87.680  1.00 42.14  ? -22 DA  I P     1 
ATOM   837   O OP1   . DA  A 1 42  ? 112.534 129.297 88.770  1.00 41.70  ? -22 DA  I OP1   1 
ATOM   838   O OP2   . DA  A 1 42  ? 110.599 130.492 87.611  1.00 39.38  ? -22 DA  I OP2   1 
ATOM   839   O "O5'" . DA  A 1 42  ? 112.871 131.495 87.706  1.00 46.84  ? -22 DA  I "O5'" 1 
ATOM   840   C "C5'" . DA  A 1 42  ? 114.256 131.497 87.372  1.00 52.50  ? -22 DA  I "C5'" 1 
ATOM   841   C "C4'" . DA  A 1 42  ? 114.765 132.915 87.304  1.00 59.71  ? -22 DA  I "C4'" 1 
ATOM   842   O "O4'" . DA  A 1 42  ? 114.261 133.583 86.121  1.00 59.26  ? -22 DA  I "O4'" 1 
ATOM   843   C "C3'" . DA  A 1 42  ? 114.324 133.765 88.487  1.00 62.11  ? -22 DA  I "C3'" 1 
ATOM   844   O "O3'" . DA  A 1 42  ? 115.383 134.636 88.852  1.00 67.33  ? -22 DA  I "O3'" 1 
ATOM   845   C "C2'" . DA  A 1 42  ? 113.124 134.524 87.956  1.00 61.97  ? -22 DA  I "C2'" 1 
ATOM   846   C "C1'" . DA  A 1 42  ? 113.455 134.696 86.483  1.00 63.62  ? -22 DA  I "C1'" 1 
ATOM   847   N N9    . DA  A 1 42  ? 112.289 134.686 85.604  1.00 67.64  ? -22 DA  I N9    1 
ATOM   848   C C8    . DA  A 1 42  ? 111.142 133.950 85.746  1.00 71.37  ? -22 DA  I C8    1 
ATOM   849   N N7    . DA  A 1 42  ? 110.298 134.090 84.753  1.00 71.94  ? -22 DA  I N7    1 
ATOM   850   C C5    . DA  A 1 42  ? 110.924 134.990 83.910  1.00 71.14  ? -22 DA  I C5    1 
ATOM   851   C C6    . DA  A 1 42  ? 110.549 135.538 82.680  1.00 73.09  ? -22 DA  I C6    1 
ATOM   852   N N6    . DA  A 1 42  ? 109.407 135.240 82.059  1.00 73.09  ? -22 DA  I N6    1 
ATOM   853   N N1    . DA  A 1 42  ? 111.398 136.412 82.098  1.00 73.76  ? -22 DA  I N1    1 
ATOM   854   C C2    . DA  A 1 42  ? 112.542 136.709 82.727  1.00 73.37  ? -22 DA  I C2    1 
ATOM   855   N N3    . DA  A 1 42  ? 113.007 136.256 83.888  1.00 71.70  ? -22 DA  I N3    1 
ATOM   856   C C4    . DA  A 1 42  ? 112.142 135.384 84.432  1.00 71.08  ? -22 DA  I C4    1 
ATOM   857   P P     . DT  A 1 43  ? 115.128 135.772 89.945  1.00 74.54  ? -21 DT  I P     1 
ATOM   858   O OP1   . DT  A 1 43  ? 116.437 136.100 90.562  1.00 74.54  ? -21 DT  I OP1   1 
ATOM   859   O OP2   . DT  A 1 43  ? 113.997 135.347 90.802  1.00 72.59  ? -21 DT  I OP2   1 
ATOM   860   O "O5'" . DT  A 1 43  ? 114.668 137.010 89.058  1.00 76.24  ? -21 DT  I "O5'" 1 
ATOM   861   C "C5'" . DT  A 1 43  ? 115.555 137.572 88.095  1.00 81.25  ? -21 DT  I "C5'" 1 
ATOM   862   C "C4'" . DT  A 1 43  ? 114.992 138.864 87.555  1.00 84.15  ? -21 DT  I "C4'" 1 
ATOM   863   O "O4'" . DT  A 1 43  ? 113.933 138.598 86.604  1.00 85.17  ? -21 DT  I "O4'" 1 
ATOM   864   C "C3'" . DT  A 1 43  ? 114.397 139.791 88.612  1.00 86.50  ? -21 DT  I "C3'" 1 
ATOM   865   O "O3'" . DT  A 1 43  ? 114.777 141.136 88.333  1.00 92.42  ? -21 DT  I "O3'" 1 
ATOM   866   C "C2'" . DT  A 1 43  ? 112.901 139.624 88.423  1.00 85.70  ? -21 DT  I "C2'" 1 
ATOM   867   C "C1'" . DT  A 1 43  ? 112.799 139.380 86.930  1.00 85.43  ? -21 DT  I "C1'" 1 
ATOM   868   N N1    . DT  A 1 43  ? 111.595 138.646 86.490  1.00 86.25  ? -21 DT  I N1    1 
ATOM   869   C C2    . DT  A 1 43  ? 111.204 138.768 85.174  1.00 87.69  ? -21 DT  I C2    1 
ATOM   870   O O2    . DT  A 1 43  ? 111.816 139.438 84.355  1.00 87.94  ? -21 DT  I O2    1 
ATOM   871   N N3    . DT  A 1 43  ? 110.065 138.072 84.848  1.00 87.95  ? -21 DT  I N3    1 
ATOM   872   C C4    . DT  A 1 43  ? 109.296 137.282 85.688  1.00 88.09  ? -21 DT  I C4    1 
ATOM   873   O O4    . DT  A 1 43  ? 108.295 136.713 85.253  1.00 87.03  ? -21 DT  I O4    1 
ATOM   874   C C5    . DT  A 1 43  ? 109.766 137.197 87.050  1.00 87.77  ? -21 DT  I C5    1 
ATOM   875   C C7    . DT  A 1 43  ? 108.998 136.370 88.031  1.00 87.22  ? -21 DT  I C7    1 
ATOM   876   C C6    . DT  A 1 43  ? 110.877 137.871 87.378  1.00 87.92  ? -21 DT  I C6    1 
ATOM   877   P P     . DC  A 1 44  ? 114.555 142.274 89.441  1.00 95.84  ? -20 DC  I P     1 
ATOM   878   O OP1   . DC  A 1 44  ? 115.897 142.672 89.936  1.00 95.20  ? -20 DC  I OP1   1 
ATOM   879   O OP2   . DC  A 1 44  ? 113.522 141.821 90.407  1.00 97.50  ? -20 DC  I OP2   1 
ATOM   880   O "O5'" . DC  A 1 44  ? 113.946 143.467 88.586  1.00 98.92  ? -20 DC  I "O5'" 1 
ATOM   881   C "C5'" . DC  A 1 44  ? 114.458 143.753 87.287  1.00 105.71 ? -20 DC  I "C5'" 1 
ATOM   882   C "C4'" . DC  A 1 44  ? 113.417 144.472 86.461  1.00 110.72 ? -20 DC  I "C4'" 1 
ATOM   883   O "O4'" . DC  A 1 44  ? 112.426 143.545 85.955  1.00 111.75 ? -20 DC  I "O4'" 1 
ATOM   884   C "C3'" . DC  A 1 44  ? 112.649 145.543 87.233  1.00 113.49 ? -20 DC  I "C3'" 1 
ATOM   885   O "O3'" . DC  A 1 44  ? 112.486 146.709 86.428  1.00 116.49 ? -20 DC  I "O3'" 1 
ATOM   886   C "C2'" . DC  A 1 44  ? 111.302 144.892 87.496  1.00 113.56 ? -20 DC  I "C2'" 1 
ATOM   887   C "C1'" . DC  A 1 44  ? 111.128 144.029 86.262  1.00 113.25 ? -20 DC  I "C1'" 1 
ATOM   888   N N1    . DC  A 1 44  ? 110.233 142.871 86.432  1.00 114.08 ? -20 DC  I N1    1 
ATOM   889   C C2    . DC  A 1 44  ? 109.397 142.511 85.371  1.00 114.71 ? -20 DC  I C2    1 
ATOM   890   O O2    . DC  A 1 44  ? 109.447 143.164 84.320  1.00 115.39 ? -20 DC  I O2    1 
ATOM   891   N N3    . DC  A 1 44  ? 108.557 141.461 85.516  1.00 115.15 ? -20 DC  I N3    1 
ATOM   892   C C4    . DC  A 1 44  ? 108.535 140.779 86.662  1.00 115.51 ? -20 DC  I C4    1 
ATOM   893   N N4    . DC  A 1 44  ? 107.688 139.751 86.762  1.00 115.79 ? -20 DC  I N4    1 
ATOM   894   C C5    . DC  A 1 44  ? 109.382 141.120 87.757  1.00 115.48 ? -20 DC  I C5    1 
ATOM   895   C C6    . DC  A 1 44  ? 110.208 142.162 87.600  1.00 114.71 ? -20 DC  I C6    1 
ATOM   896   P P     . DA  A 1 45  ? 111.897 148.045 87.087  1.00 118.70 ? -19 DA  I P     1 
ATOM   897   O OP1   . DA  A 1 45  ? 112.752 149.183 86.668  1.00 119.07 ? -19 DA  I OP1   1 
ATOM   898   O OP2   . DA  A 1 45  ? 111.692 147.774 88.533  1.00 117.92 ? -19 DA  I OP2   1 
ATOM   899   O "O5'" . DA  A 1 45  ? 110.472 148.201 86.393  1.00 119.85 ? -19 DA  I "O5'" 1 
ATOM   900   C "C5'" . DA  A 1 45  ? 110.371 148.411 84.988  1.00 122.41 ? -19 DA  I "C5'" 1 
ATOM   901   C "C4'" . DA  A 1 45  ? 108.931 148.653 84.600  1.00 124.67 ? -19 DA  I "C4'" 1 
ATOM   902   O "O4'" . DA  A 1 45  ? 108.179 147.422 84.727  1.00 125.50 ? -19 DA  I "O4'" 1 
ATOM   903   C "C3'" . DA  A 1 45  ? 108.213 149.676 85.481  1.00 125.86 ? -19 DA  I "C3'" 1 
ATOM   904   O "O3'" . DA  A 1 45  ? 107.308 150.448 84.690  1.00 127.18 ? -19 DA  I "O3'" 1 
ATOM   905   C "C2'" . DA  A 1 45  ? 107.446 148.813 86.462  1.00 126.03 ? -19 DA  I "C2'" 1 
ATOM   906   C "C1'" . DA  A 1 45  ? 107.079 147.620 85.601  1.00 126.63 ? -19 DA  I "C1'" 1 
ATOM   907   N N9    . DA  A 1 45  ? 106.869 146.378 86.344  1.00 127.67 ? -19 DA  I N9    1 
ATOM   908   C C8    . DA  A 1 45  ? 107.532 145.930 87.461  1.00 128.29 ? -19 DA  I C8    1 
ATOM   909   N N7    . DA  A 1 45  ? 107.116 144.764 87.890  1.00 128.61 ? -19 DA  I N7    1 
ATOM   910   C C5    . DA  A 1 45  ? 106.110 144.421 86.995  1.00 128.67 ? -19 DA  I C5    1 
ATOM   911   C C6    . DA  A 1 45  ? 105.274 143.297 86.900  1.00 128.85 ? -19 DA  I C6    1 
ATOM   912   N N6    . DA  A 1 45  ? 105.327 142.265 87.742  1.00 129.41 ? -19 DA  I N6    1 
ATOM   913   N N1    . DA  A 1 45  ? 104.371 143.269 85.895  1.00 128.69 ? -19 DA  I N1    1 
ATOM   914   C C2    . DA  A 1 45  ? 104.326 144.303 85.047  1.00 128.43 ? -19 DA  I C2    1 
ATOM   915   N N3    . DA  A 1 45  ? 105.061 145.411 85.029  1.00 128.35 ? -19 DA  I N3    1 
ATOM   916   C C4    . DA  A 1 45  ? 105.945 145.409 86.042  1.00 128.19 ? -19 DA  I C4    1 
ATOM   917   P P     . DA  A 1 46  ? 106.508 151.665 85.358  1.00 127.61 ? -18 DA  I P     1 
ATOM   918   O OP1   . DA  A 1 46  ? 106.670 152.855 84.486  1.00 128.73 ? -18 DA  I OP1   1 
ATOM   919   O OP2   . DA  A 1 46  ? 106.906 151.742 86.787  1.00 128.02 ? -18 DA  I OP2   1 
ATOM   920   O "O5'" . DA  A 1 46  ? 104.992 151.192 85.290  1.00 128.46 ? -18 DA  I "O5'" 1 
ATOM   921   C "C5'" . DA  A 1 46  ? 104.454 150.656 84.085  1.00 129.66 ? -18 DA  I "C5'" 1 
ATOM   922   C "C4'" . DA  A 1 46  ? 103.182 149.899 84.377  1.00 131.20 ? -18 DA  I "C4'" 1 
ATOM   923   O "O4'" . DA  A 1 46  ? 103.486 148.720 85.161  1.00 132.34 ? -18 DA  I "O4'" 1 
ATOM   924   C "C3'" . DA  A 1 46  ? 102.158 150.689 85.188  1.00 131.59 ? -18 DA  I "C3'" 1 
ATOM   925   O "O3'" . DA  A 1 46  ? 100.842 150.328 84.770  1.00 131.16 ? -18 DA  I "O3'" 1 
ATOM   926   C "C2'" . DA  A 1 46  ? 102.393 150.199 86.605  1.00 132.27 ? -18 DA  I "C2'" 1 
ATOM   927   C "C1'" . DA  A 1 46  ? 102.728 148.740 86.359  1.00 132.79 ? -18 DA  I "C1'" 1 
ATOM   928   N N9    . DA  A 1 46  ? 103.522 148.104 87.407  1.00 133.23 ? -18 DA  I N9    1 
ATOM   929   C C8    . DA  A 1 46  ? 104.599 148.613 88.090  1.00 133.37 ? -18 DA  I C8    1 
ATOM   930   N N7    . DA  A 1 46  ? 105.097 147.788 88.981  1.00 133.62 ? -18 DA  I N7    1 
ATOM   931   C C5    . DA  A 1 46  ? 104.292 146.662 88.878  1.00 133.68 ? -18 DA  I C5    1 
ATOM   932   C C6    . DA  A 1 46  ? 104.296 145.432 89.554  1.00 133.47 ? -18 DA  I C6    1 
ATOM   933   N N6    . DA  A 1 46  ? 105.177 145.110 90.505  1.00 133.70 ? -18 DA  I N6    1 
ATOM   934   N N1    . DA  A 1 46  ? 103.355 144.524 89.213  1.00 133.18 ? -18 DA  I N1    1 
ATOM   935   C C2    . DA  A 1 46  ? 102.477 144.842 88.254  1.00 133.01 ? -18 DA  I C2    1 
ATOM   936   N N3    . DA  A 1 46  ? 102.372 145.963 87.546  1.00 133.55 ? -18 DA  I N3    1 
ATOM   937   C C4    . DA  A 1 46  ? 103.320 146.843 87.912  1.00 133.55 ? -18 DA  I C4    1 
ATOM   938   P P     . DA  A 1 47  ? 99.816  151.468 84.300  1.00 131.27 ? -17 DA  I P     1 
ATOM   939   O OP1   . DA  A 1 47  ? 100.267 151.984 82.982  1.00 131.45 ? -17 DA  I OP1   1 
ATOM   940   O OP2   . DA  A 1 47  ? 99.640  152.410 85.436  1.00 131.19 ? -17 DA  I OP2   1 
ATOM   941   O "O5'" . DA  A 1 47  ? 98.452  150.678 84.087  1.00 130.54 ? -17 DA  I "O5'" 1 
ATOM   942   C "C5'" . DA  A 1 47  ? 98.370  149.612 83.145  1.00 129.01 ? -17 DA  I "C5'" 1 
ATOM   943   C "C4'" . DA  A 1 47  ? 97.607  148.451 83.739  1.00 128.02 ? -17 DA  I "C4'" 1 
ATOM   944   O "O4'" . DA  A 1 47  ? 98.406  147.804 84.762  1.00 128.27 ? -17 DA  I "O4'" 1 
ATOM   945   C "C3'" . DA  A 1 47  ? 96.296  148.847 84.417  1.00 127.06 ? -17 DA  I "C3'" 1 
ATOM   946   O "O3'" . DA  A 1 47  ? 95.296  147.861 84.165  1.00 125.01 ? -17 DA  I "O3'" 1 
ATOM   947   C "C2'" . DA  A 1 47  ? 96.656  148.877 85.891  1.00 127.17 ? -17 DA  I "C2'" 1 
ATOM   948   C "C1'" . DA  A 1 47  ? 97.692  147.772 85.990  1.00 127.66 ? -17 DA  I "C1'" 1 
ATOM   949   N N9    . DA  A 1 47  ? 98.654  147.952 87.076  1.00 128.27 ? -17 DA  I N9    1 
ATOM   950   C C8    . DA  A 1 47  ? 99.406  149.066 87.357  1.00 128.62 ? -17 DA  I C8    1 
ATOM   951   N N7    . DA  A 1 47  ? 100.183 148.929 88.406  1.00 128.56 ? -17 DA  I N7    1 
ATOM   952   C C5    . DA  A 1 47  ? 99.925  147.638 88.844  1.00 128.55 ? -17 DA  I C5    1 
ATOM   953   C C6    . DA  A 1 47  ? 100.430 146.885 89.919  1.00 128.57 ? -17 DA  I C6    1 
ATOM   954   N N6    . DA  A 1 47  ? 101.343 147.341 90.780  1.00 129.09 ? -17 DA  I N6    1 
ATOM   955   N N1    . DA  A 1 47  ? 99.961  145.629 90.081  1.00 128.46 ? -17 DA  I N1    1 
ATOM   956   C C2    . DA  A 1 47  ? 99.049  145.171 89.217  1.00 128.74 ? -17 DA  I C2    1 
ATOM   957   N N3    . DA  A 1 47  ? 98.499  145.780 88.168  1.00 128.93 ? -17 DA  I N3    1 
ATOM   958   C C4    . DA  A 1 47  ? 98.986  147.026 88.035  1.00 128.62 ? -17 DA  I C4    1 
ATOM   959   P P     . DA  A 1 48  ? 93.945  147.865 85.030  1.00 123.27 ? -16 DA  I P     1 
ATOM   960   O OP1   . DA  A 1 48  ? 92.874  147.224 84.224  1.00 123.85 ? -16 DA  I OP1   1 
ATOM   961   O OP2   . DA  A 1 48  ? 93.750  149.244 85.543  1.00 123.18 ? -16 DA  I OP2   1 
ATOM   962   O "O5'" . DA  A 1 48  ? 94.293  146.915 86.259  1.00 122.00 ? -16 DA  I "O5'" 1 
ATOM   963   C "C5'" . DA  A 1 48  ? 94.631  145.545 86.044  1.00 118.47 ? -16 DA  I "C5'" 1 
ATOM   964   C "C4'" . DA  A 1 48  ? 94.387  144.738 87.297  1.00 115.90 ? -16 DA  I "C4'" 1 
ATOM   965   O "O4'" . DA  A 1 48  ? 95.439  144.958 88.267  1.00 115.10 ? -16 DA  I "O4'" 1 
ATOM   966   C "C3'" . DA  A 1 48  ? 93.075  145.056 88.014  1.00 114.44 ? -16 DA  I "C3'" 1 
ATOM   967   O "O3'" . DA  A 1 48  ? 92.497  143.854 88.513  1.00 112.31 ? -16 DA  I "O3'" 1 
ATOM   968   C "C2'" . DA  A 1 48  ? 93.517  145.926 89.177  1.00 114.05 ? -16 DA  I "C2'" 1 
ATOM   969   C "C1'" . DA  A 1 48  ? 94.868  145.326 89.513  1.00 113.97 ? -16 DA  I "C1'" 1 
ATOM   970   N N9    . DA  A 1 48  ? 95.796  146.235 90.182  1.00 113.44 ? -16 DA  I N9    1 
ATOM   971   C C8    . DA  A 1 48  ? 96.180  147.493 89.791  1.00 113.48 ? -16 DA  I C8    1 
ATOM   972   N N7    . DA  A 1 48  ? 97.045  148.057 90.597  1.00 113.56 ? -16 DA  I N7    1 
ATOM   973   C C5    . DA  A 1 48  ? 97.242  147.109 91.591  1.00 113.54 ? -16 DA  I C5    1 
ATOM   974   C C6    . DA  A 1 48  ? 98.051  147.097 92.742  1.00 113.74 ? -16 DA  I C6    1 
ATOM   975   N N6    . DA  A 1 48  ? 98.844  148.109 93.099  1.00 113.16 ? -16 DA  I N6    1 
ATOM   976   N N1    . DA  A 1 48  ? 98.014  145.997 93.523  1.00 113.77 ? -16 DA  I N1    1 
ATOM   977   C C2    . DA  A 1 48  ? 97.220  144.982 93.163  1.00 113.42 ? -16 DA  I C2    1 
ATOM   978   N N3    . DA  A 1 48  ? 96.418  144.874 92.107  1.00 114.05 ? -16 DA  I N3    1 
ATOM   979   C C4    . DA  A 1 48  ? 96.477  145.983 91.350  1.00 113.73 ? -16 DA  I C4    1 
ATOM   980   P P     . DG  A 1 49  ? 90.905  143.743 88.673  1.00 110.97 ? -15 DG  I P     1 
ATOM   981   O OP1   . DG  A 1 49  ? 90.344  143.115 87.451  1.00 111.86 ? -15 DG  I OP1   1 
ATOM   982   O OP2   . DG  A 1 49  ? 90.400  145.064 89.125  1.00 111.34 ? -15 DG  I OP2   1 
ATOM   983   O "O5'" . DG  A 1 49  ? 90.740  142.711 89.866  1.00 108.72 ? -15 DG  I "O5'" 1 
ATOM   984   C "C5'" . DG  A 1 49  ? 91.620  141.600 89.976  1.00 105.50 ? -15 DG  I "C5'" 1 
ATOM   985   C "C4'" . DG  A 1 49  ? 91.964  141.357 91.425  1.00 102.63 ? -15 DG  I "C4'" 1 
ATOM   986   O "O4'" . DG  A 1 49  ? 92.846  142.394 91.922  1.00 102.26 ? -15 DG  I "O4'" 1 
ATOM   987   C "C3'" . DG  A 1 49  ? 90.753  141.344 92.353  1.00 99.70  ? -15 DG  I "C3'" 1 
ATOM   988   O "O3'" . DG  A 1 49  ? 90.895  140.286 93.294  1.00 95.15  ? -15 DG  I "O3'" 1 
ATOM   989   C "C2'" . DG  A 1 49  ? 90.805  142.701 93.033  1.00 99.87  ? -15 DG  I "C2'" 1 
ATOM   990   C "C1'" . DG  A 1 49  ? 92.294  142.989 93.087  1.00 101.13 ? -15 DG  I "C1'" 1 
ATOM   991   N N9    . DG  A 1 49  ? 92.635  144.408 93.060  1.00 102.24 ? -15 DG  I N9    1 
ATOM   992   C C8    . DG  A 1 49  ? 92.205  145.346 92.152  1.00 102.78 ? -15 DG  I C8    1 
ATOM   993   N N7    . DG  A 1 49  ? 92.701  146.535 92.368  1.00 101.81 ? -15 DG  I N7    1 
ATOM   994   C C5    . DG  A 1 49  ? 93.505  146.374 93.489  1.00 101.77 ? -15 DG  I C5    1 
ATOM   995   C C6    . DG  A 1 49  ? 94.309  147.311 94.183  1.00 101.47 ? -15 DG  I C6    1 
ATOM   996   O O6    . DG  A 1 49  ? 94.487  148.506 93.936  1.00 101.22 ? -15 DG  I O6    1 
ATOM   997   N N1    . DG  A 1 49  ? 94.952  146.725 95.270  1.00 102.33 ? -15 DG  I N1    1 
ATOM   998   C C2    . DG  A 1 49  ? 94.842  145.407 95.639  1.00 102.00 ? -15 DG  I C2    1 
ATOM   999   N N2    . DG  A 1 49  ? 95.535  145.036 96.728  1.00 101.58 ? -15 DG  I N2    1 
ATOM   1000  N N3    . DG  A 1 49  ? 94.103  144.519 94.992  1.00 102.13 ? -15 DG  I N3    1 
ATOM   1001  C C4    . DG  A 1 49  ? 93.467  145.068 93.934  1.00 102.17 ? -15 DG  I C4    1 
ATOM   1002  P P     . DG  A 1 50  ? 89.742  140.022 94.368  1.00 90.41  ? -14 DG  I P     1 
ATOM   1003  O OP1   . DG  A 1 50  ? 89.589  138.551 94.510  1.00 92.31  ? -14 DG  I OP1   1 
ATOM   1004  O OP2   . DG  A 1 50  ? 88.557  140.855 94.054  1.00 92.10  ? -14 DG  I OP2   1 
ATOM   1005  O "O5'" . DG  A 1 50  ? 90.386  140.572 95.704  1.00 86.89  ? -14 DG  I "O5'" 1 
ATOM   1006  C "C5'" . DG  A 1 50  ? 90.444  139.756 96.852  1.00 80.82  ? -14 DG  I "C5'" 1 
ATOM   1007  C "C4'" . DG  A 1 50  ? 91.859  139.688 97.369  1.00 76.09  ? -14 DG  I "C4'" 1 
ATOM   1008  O "O4'" . DG  A 1 50  ? 92.441  141.010 97.381  1.00 77.89  ? -14 DG  I "O4'" 1 
ATOM   1009  C "C3'" . DG  A 1 50  ? 91.878  139.223 98.814  1.00 72.51  ? -14 DG  I "C3'" 1 
ATOM   1010  O "O3'" . DG  A 1 50  ? 93.075  138.530 99.124  1.00 63.67  ? -14 DG  I "O3'" 1 
ATOM   1011  C "C2'" . DG  A 1 50  ? 91.821  140.518 99.590  1.00 74.25  ? -14 DG  I "C2'" 1 
ATOM   1012  C "C1'" . DG  A 1 50  ? 92.647  141.440 98.720  1.00 79.10  ? -14 DG  I "C1'" 1 
ATOM   1013  N N9    . DG  A 1 50  ? 92.227  142.831 98.811  1.00 83.24  ? -14 DG  I N9    1 
ATOM   1014  C C8    . DG  A 1 50  ? 90.995  143.346 98.494  1.00 84.72  ? -14 DG  I C8    1 
ATOM   1015  N N7    . DG  A 1 50  ? 90.923  144.635 98.660  1.00 87.81  ? -14 DG  I N7    1 
ATOM   1016  C C5    . DG  A 1 50  ? 92.184  144.991 99.116  1.00 89.05  ? -14 DG  I C5    1 
ATOM   1017  C C6    . DG  A 1 50  ? 92.713  146.261 99.461  1.00 91.83  ? -14 DG  I C6    1 
ATOM   1018  O O6    . DG  A 1 50  ? 92.152  147.366 99.430  1.00 94.09  ? -14 DG  I O6    1 
ATOM   1019  N N1    . DG  A 1 50  ? 94.038  146.166 99.880  1.00 93.01  ? -14 DG  I N1    1 
ATOM   1020  C C2    . DG  A 1 50  ? 94.759  144.998 99.957  1.00 91.02  ? -14 DG  I C2    1 
ATOM   1021  N N2    . DG  A 1 50  ? 96.025  145.109 100.390 1.00 90.00  ? -14 DG  I N2    1 
ATOM   1022  N N3    . DG  A 1 50  ? 94.276  143.812 99.635  1.00 88.83  ? -14 DG  I N3    1 
ATOM   1023  C C4    . DG  A 1 50  ? 92.995  143.884 99.223  1.00 86.07  ? -14 DG  I C4    1 
ATOM   1024  P P     . DC  A 1 51  ? 93.132  137.671 100.463 1.00 53.34  ? -13 DC  I P     1 
ATOM   1025  O OP1   . DC  A 1 51  ? 93.964  136.480 100.148 1.00 57.57  ? -13 DC  I OP1   1 
ATOM   1026  O OP2   . DC  A 1 51  ? 91.740  137.504 100.923 1.00 53.38  ? -13 DC  I OP2   1 
ATOM   1027  O "O5'" . DC  A 1 51  ? 93.897  138.600 101.494 1.00 53.63  ? -13 DC  I "O5'" 1 
ATOM   1028  C "C5'" . DC  A 1 51  ? 95.211  139.047 101.211 1.00 57.08  ? -13 DC  I "C5'" 1 
ATOM   1029  C "C4'" . DC  A 1 51  ? 95.640  140.081 102.223 1.00 56.21  ? -13 DC  I "C4'" 1 
ATOM   1030  O "O4'" . DC  A 1 51  ? 94.952  141.337 102.004 1.00 56.02  ? -13 DC  I "O4'" 1 
ATOM   1031  C "C3'" . DC  A 1 51  ? 95.368  139.688 103.672 1.00 56.24  ? -13 DC  I "C3'" 1 
ATOM   1032  O "O3'" . DC  A 1 51  ? 96.500  140.046 104.444 1.00 56.01  ? -13 DC  I "O3'" 1 
ATOM   1033  C "C2'" . DC  A 1 51  ? 94.157  140.520 104.055 1.00 54.97  ? -13 DC  I "C2'" 1 
ATOM   1034  C "C1'" . DC  A 1 51  ? 94.343  141.773 103.209 1.00 55.79  ? -13 DC  I "C1'" 1 
ATOM   1035  N N1    . DC  A 1 51  ? 93.106  142.487 102.850 1.00 54.40  ? -13 DC  I N1    1 
ATOM   1036  C C2    . DC  A 1 51  ? 93.080  143.890 102.952 1.00 57.64  ? -13 DC  I C2    1 
ATOM   1037  O O2    . DC  A 1 51  ? 94.090  144.483 103.363 1.00 54.62  ? -13 DC  I O2    1 
ATOM   1038  N N3    . DC  A 1 51  ? 91.958  144.556 102.597 1.00 55.95  ? -13 DC  I N3    1 
ATOM   1039  C C4    . DC  A 1 51  ? 90.896  143.882 102.156 1.00 59.43  ? -13 DC  I C4    1 
ATOM   1040  N N4    . DC  A 1 51  ? 89.815  144.579 101.799 1.00 61.19  ? -13 DC  I N4    1 
ATOM   1041  C C5    . DC  A 1 51  ? 90.892  142.457 102.056 1.00 54.86  ? -13 DC  I C5    1 
ATOM   1042  C C6    . DC  A 1 51  ? 92.006  141.809 102.412 1.00 50.58  ? -13 DC  I C6    1 
ATOM   1043  P P     . DA  A 1 52  ? 96.598  139.593 105.966 1.00 58.54  ? -12 DA  I P     1 
ATOM   1044  O OP1   . DA  A 1 52  ? 97.874  138.857 106.147 1.00 58.59  ? -12 DA  I OP1   1 
ATOM   1045  O OP2   . DA  A 1 52  ? 95.319  138.966 106.354 1.00 61.82  ? -12 DA  I OP2   1 
ATOM   1046  O "O5'" . DA  A 1 52  ? 96.732  140.971 106.737 1.00 56.98  ? -12 DA  I "O5'" 1 
ATOM   1047  C "C5'" . DA  A 1 52  ? 97.718  141.916 106.341 1.00 56.13  ? -12 DA  I "C5'" 1 
ATOM   1048  C "C4'" . DA  A 1 52  ? 97.491  143.217 107.061 1.00 58.06  ? -12 DA  I "C4'" 1 
ATOM   1049  O "O4'" . DA  A 1 52  ? 96.232  143.779 106.628 1.00 58.11  ? -12 DA  I "O4'" 1 
ATOM   1050  C "C3'" . DA  A 1 52  ? 97.379  143.036 108.568 1.00 60.25  ? -12 DA  I "C3'" 1 
ATOM   1051  O "O3'" . DA  A 1 52  ? 98.034  144.108 109.225 1.00 66.92  ? -12 DA  I "O3'" 1 
ATOM   1052  C "C2'" . DA  A 1 52  ? 95.884  143.038 108.826 1.00 58.82  ? -12 DA  I "C2'" 1 
ATOM   1053  C "C1'" . DA  A 1 52  ? 95.334  143.909 107.715 1.00 57.42  ? -12 DA  I "C1'" 1 
ATOM   1054  N N9    . DA  A 1 52  ? 94.015  143.511 107.227 1.00 61.52  ? -12 DA  I N9    1 
ATOM   1055  C C8    . DA  A 1 52  ? 93.426  142.272 107.280 1.00 60.12  ? -12 DA  I C8    1 
ATOM   1056  N N7    . DA  A 1 52  ? 92.245  142.222 106.716 1.00 61.44  ? -12 DA  I N7    1 
ATOM   1057  C C5    . DA  A 1 52  ? 92.035  143.518 106.267 1.00 62.90  ? -12 DA  I C5    1 
ATOM   1058  C C6    . DA  A 1 52  ? 90.967  144.123 105.578 1.00 65.65  ? -12 DA  I C6    1 
ATOM   1059  N N6    . DA  A 1 52  ? 89.863  143.474 105.198 1.00 63.47  ? -12 DA  I N6    1 
ATOM   1060  N N1    . DA  A 1 52  ? 91.076  145.441 105.284 1.00 67.09  ? -12 DA  I N1    1 
ATOM   1061  C C2    . DA  A 1 52  ? 92.182  146.093 105.660 1.00 65.03  ? -12 DA  I C2    1 
ATOM   1062  N N3    . DA  A 1 52  ? 93.248  145.639 106.308 1.00 66.49  ? -12 DA  I N3    1 
ATOM   1063  C C4    . DA  A 1 52  ? 93.113  144.326 106.584 1.00 64.88  ? -12 DA  I C4    1 
ATOM   1064  P P     . DT  A 1 53  ? 98.229  144.057 110.807 1.00 72.78  ? -11 DT  I P     1 
ATOM   1065  O OP1   . DT  A 1 53  ? 99.494  144.766 111.114 1.00 73.02  ? -11 DT  I OP1   1 
ATOM   1066  O OP2   . DT  A 1 53  ? 98.042  142.663 111.265 1.00 72.63  ? -11 DT  I OP2   1 
ATOM   1067  O "O5'" . DT  A 1 53  ? 96.991  144.910 111.325 1.00 74.74  ? -11 DT  I "O5'" 1 
ATOM   1068  C "C5'" . DT  A 1 53  ? 96.792  146.243 110.865 1.00 75.94  ? -11 DT  I "C5'" 1 
ATOM   1069  C "C4'" . DT  A 1 53  ? 95.546  146.829 111.481 1.00 77.37  ? -11 DT  I "C4'" 1 
ATOM   1070  O "O4'" . DT  A 1 53  ? 94.367  146.490 110.709 1.00 76.80  ? -11 DT  I "O4'" 1 
ATOM   1071  C "C3'" . DT  A 1 53  ? 95.275  146.363 112.912 1.00 79.64  ? -11 DT  I "C3'" 1 
ATOM   1072  O "O3'" . DT  A 1 53  ? 94.922  147.468 113.731 1.00 83.89  ? -11 DT  I "O3'" 1 
ATOM   1073  C "C2'" . DT  A 1 53  ? 94.074  145.447 112.768 1.00 78.93  ? -11 DT  I "C2'" 1 
ATOM   1074  C "C1'" . DT  A 1 53  ? 93.348  146.076 111.597 1.00 76.90  ? -11 DT  I "C1'" 1 
ATOM   1075  N N1    . DT  A 1 53  ? 92.428  145.186 110.861 1.00 77.79  ? -11 DT  I N1    1 
ATOM   1076  C C2    . DT  A 1 53  ? 91.373  145.778 110.210 1.00 78.53  ? -11 DT  I C2    1 
ATOM   1077  O O2    . DT  A 1 53  ? 91.179  146.980 110.214 1.00 80.44  ? -11 DT  I O2    1 
ATOM   1078  N N3    . DT  A 1 53  ? 90.546  144.906 109.551 1.00 77.67  ? -11 DT  I N3    1 
ATOM   1079  C C4    . DT  A 1 53  ? 90.662  143.536 109.486 1.00 75.60  ? -11 DT  I C4    1 
ATOM   1080  O O4    . DT  A 1 53  ? 89.839  142.886 108.853 1.00 75.10  ? -11 DT  I O4    1 
ATOM   1081  C C5    . DT  A 1 53  ? 91.786  142.977 110.198 1.00 76.16  ? -11 DT  I C5    1 
ATOM   1082  C C7    . DT  A 1 53  ? 91.978  141.493 110.195 1.00 75.26  ? -11 DT  I C7    1 
ATOM   1083  C C6    . DT  A 1 53  ? 92.609  143.820 110.837 1.00 75.91  ? -11 DT  I C6    1 
ATOM   1084  P P     . DG  A 1 54  ? 95.096  147.359 115.319 1.00 88.25  ? -10 DG  I P     1 
ATOM   1085  O OP1   . DG  A 1 54  ? 96.278  148.164 115.714 1.00 88.10  ? -10 DG  I OP1   1 
ATOM   1086  O OP2   . DG  A 1 54  ? 95.025  145.923 115.692 1.00 88.95  ? -10 DG  I OP2   1 
ATOM   1087  O "O5'" . DG  A 1 54  ? 93.785  148.072 115.860 1.00 86.91  ? -10 DG  I "O5'" 1 
ATOM   1088  C "C5'" . DG  A 1 54  ? 93.302  149.240 115.219 1.00 88.49  ? -10 DG  I "C5'" 1 
ATOM   1089  C "C4'" . DG  A 1 54  ? 91.816  149.374 115.442 1.00 88.16  ? -10 DG  I "C4'" 1 
ATOM   1090  O "O4'" . DG  A 1 54  ? 91.097  148.408 114.642 1.00 88.87  ? -10 DG  I "O4'" 1 
ATOM   1091  C "C3'" . DG  A 1 54  ? 91.378  149.145 116.886 1.00 88.80  ? -10 DG  I "C3'" 1 
ATOM   1092  O "O3'" . DG  A 1 54  ? 90.384  150.115 117.218 1.00 88.70  ? -10 DG  I "O3'" 1 
ATOM   1093  C "C2'" . DG  A 1 54  ? 90.815  147.733 116.866 1.00 88.38  ? -10 DG  I "C2'" 1 
ATOM   1094  C "C1'" . DG  A 1 54  ? 90.237  147.634 115.467 1.00 88.80  ? -10 DG  I "C1'" 1 
ATOM   1095  N N9    . DG  A 1 54  ? 90.178  146.288 114.901 1.00 88.01  ? -10 DG  I N9    1 
ATOM   1096  C C8    . DG  A 1 54  ? 91.109  145.284 115.029 1.00 87.31  ? -10 DG  I C8    1 
ATOM   1097  N N7    . DG  A 1 54  ? 90.795  144.206 114.360 1.00 85.90  ? -10 DG  I N7    1 
ATOM   1098  C C5    . DG  A 1 54  ? 89.580  144.513 113.765 1.00 86.96  ? -10 DG  I C5    1 
ATOM   1099  C C6    . DG  A 1 54  ? 88.754  143.739 112.911 1.00 87.23  ? -10 DG  I C6    1 
ATOM   1100  O O6    . DG  A 1 54  ? 88.943  142.599 112.483 1.00 88.80  ? -10 DG  I O6    1 
ATOM   1101  N N1    . DG  A 1 54  ? 87.603  144.431 112.548 1.00 87.57  ? -10 DG  I N1    1 
ATOM   1102  C C2    . DG  A 1 54  ? 87.292  145.708 112.946 1.00 87.87  ? -10 DG  I C2    1 
ATOM   1103  N N2    . DG  A 1 54  ? 86.131  146.201 112.490 1.00 88.37  ? -10 DG  I N2    1 
ATOM   1104  N N3    . DG  A 1 54  ? 88.058  146.445 113.731 1.00 86.37  ? -10 DG  I N3    1 
ATOM   1105  C C4    . DG  A 1 54  ? 89.179  145.788 114.101 1.00 87.35  ? -10 DG  I C4    1 
ATOM   1106  P P     . DT  A 1 55  ? 89.615  150.022 118.620 1.00 87.87  ? -9  DT  I P     1 
ATOM   1107  O OP1   . DT  A 1 55  ? 89.487  151.398 119.159 1.00 89.76  ? -9  DT  I OP1   1 
ATOM   1108  O OP2   . DT  A 1 55  ? 90.251  148.966 119.447 1.00 88.24  ? -9  DT  I OP2   1 
ATOM   1109  O "O5'" . DT  A 1 55  ? 88.172  149.534 118.169 1.00 86.50  ? -9  DT  I "O5'" 1 
ATOM   1110  C "C5'" . DT  A 1 55  ? 87.512  150.182 117.088 1.00 84.35  ? -9  DT  I "C5'" 1 
ATOM   1111  C "C4'" . DT  A 1 55  ? 86.063  149.769 117.049 1.00 84.38  ? -9  DT  I "C4'" 1 
ATOM   1112  O "O4'" . DT  A 1 55  ? 85.911  148.509 116.351 1.00 82.96  ? -9  DT  I "O4'" 1 
ATOM   1113  C "C3'" . DT  A 1 55  ? 85.469  149.566 118.438 1.00 83.74  ? -9  DT  I "C3'" 1 
ATOM   1114  O "O3'" . DT  A 1 55  ? 84.147  150.095 118.488 1.00 82.16  ? -9  DT  I "O3'" 1 
ATOM   1115  C "C2'" . DT  A 1 55  ? 85.472  148.054 118.605 1.00 84.02  ? -9  DT  I "C2'" 1 
ATOM   1116  C "C1'" . DT  A 1 55  ? 85.247  147.572 117.183 1.00 83.46  ? -9  DT  I "C1'" 1 
ATOM   1117  N N1    . DT  A 1 55  ? 85.793  146.233 116.872 1.00 83.77  ? -9  DT  I N1    1 
ATOM   1118  C C2    . DT  A 1 55  ? 85.040  145.398 116.074 1.00 83.46  ? -9  DT  I C2    1 
ATOM   1119  O O2    . DT  A 1 55  ? 83.928  145.693 115.660 1.00 82.22  ? -9  DT  I O2    1 
ATOM   1120  N N3    . DT  A 1 55  ? 85.637  144.197 115.780 1.00 83.57  ? -9  DT  I N3    1 
ATOM   1121  C C4    . DT  A 1 55  ? 86.876  143.752 116.204 1.00 83.64  ? -9  DT  I C4    1 
ATOM   1122  O O4    . DT  A 1 55  ? 87.292  142.656 115.838 1.00 83.67  ? -9  DT  I O4    1 
ATOM   1123  C C5    . DT  A 1 55  ? 87.593  144.664 117.068 1.00 83.38  ? -9  DT  I C5    1 
ATOM   1124  C C7    . DT  A 1 55  ? 88.929  144.254 117.605 1.00 80.67  ? -9  DT  I C7    1 
ATOM   1125  C C6    . DT  A 1 55  ? 87.025  145.843 117.352 1.00 83.31  ? -9  DT  I C6    1 
ATOM   1126  P P     . DT  A 1 56  ? 83.300  149.961 119.837 1.00 82.86  ? -8  DT  I P     1 
ATOM   1127  O OP1   . DT  A 1 56  ? 82.447  151.172 119.980 1.00 84.28  ? -8  DT  I OP1   1 
ATOM   1128  O OP2   . DT  A 1 56  ? 84.248  149.595 120.921 1.00 81.26  ? -8  DT  I OP2   1 
ATOM   1129  O "O5'" . DT  A 1 56  ? 82.360  148.712 119.547 1.00 79.25  ? -8  DT  I "O5'" 1 
ATOM   1130  C "C5'" . DT  A 1 56  ? 81.501  148.713 118.417 1.00 74.52  ? -8  DT  I "C5'" 1 
ATOM   1131  C "C4'" . DT  A 1 56  ? 80.641  147.474 118.416 1.00 70.68  ? -8  DT  I "C4'" 1 
ATOM   1132  O "O4'" . DT  A 1 56  ? 81.401  146.319 117.983 1.00 67.44  ? -8  DT  I "O4'" 1 
ATOM   1133  C "C3'" . DT  A 1 56  ? 80.074  147.121 119.789 1.00 69.39  ? -8  DT  I "C3'" 1 
ATOM   1134  O "O3'" . DT  A 1 56  ? 78.721  146.704 119.647 1.00 69.14  ? -8  DT  I "O3'" 1 
ATOM   1135  C "C2'" . DT  A 1 56  ? 80.943  145.961 120.241 1.00 67.87  ? -8  DT  I "C2'" 1 
ATOM   1136  C "C1'" . DT  A 1 56  ? 81.240  145.271 118.922 1.00 64.66  ? -8  DT  I "C1'" 1 
ATOM   1137  N N1    . DT  A 1 56  ? 82.459  144.434 118.882 1.00 61.19  ? -8  DT  I N1    1 
ATOM   1138  C C2    . DT  A 1 56  ? 82.490  143.390 117.979 1.00 58.62  ? -8  DT  I C2    1 
ATOM   1139  O O2    . DT  A 1 56  ? 81.560  143.123 117.238 1.00 55.80  ? -8  DT  I O2    1 
ATOM   1140  N N3    . DT  A 1 56  ? 83.657  142.671 117.973 1.00 55.98  ? -8  DT  I N3    1 
ATOM   1141  C C4    . DT  A 1 56  ? 84.770  142.883 118.759 1.00 56.36  ? -8  DT  I C4    1 
ATOM   1142  O O4    . DT  A 1 56  ? 85.751  142.159 118.632 1.00 53.72  ? -8  DT  I O4    1 
ATOM   1143  C C5    . DT  A 1 56  ? 84.668  143.988 119.690 1.00 56.74  ? -8  DT  I C5    1 
ATOM   1144  C C7    . DT  A 1 56  ? 85.830  144.299 120.579 1.00 54.88  ? -8  DT  I C7    1 
ATOM   1145  C C6    . DT  A 1 56  ? 83.529  144.692 119.710 1.00 57.38  ? -8  DT  I C6    1 
ATOM   1146  P P     . DC  A 1 57  ? 77.817  146.512 120.950 1.00 70.43  ? -7  DC  I P     1 
ATOM   1147  O OP1   . DC  A 1 57  ? 76.580  147.312 120.774 1.00 69.16  ? -7  DC  I OP1   1 
ATOM   1148  O OP2   . DC  A 1 57  ? 78.682  146.728 122.136 1.00 70.94  ? -7  DC  I OP2   1 
ATOM   1149  O "O5'" . DC  A 1 57  ? 77.436  144.970 120.911 1.00 68.85  ? -7  DC  I "O5'" 1 
ATOM   1150  C "C5'" . DC  A 1 57  ? 76.852  144.395 119.745 1.00 65.86  ? -7  DC  I "C5'" 1 
ATOM   1151  C "C4'" . DC  A 1 57  ? 76.958  142.890 119.805 1.00 64.24  ? -7  DC  I "C4'" 1 
ATOM   1152  O "O4'" . DC  A 1 57  ? 78.345  142.492 119.683 1.00 62.48  ? -7  DC  I "O4'" 1 
ATOM   1153  C "C3'" . DC  A 1 57  ? 76.462  142.281 121.119 1.00 62.88  ? -7  DC  I "C3'" 1 
ATOM   1154  O "O3'" . DC  A 1 57  ? 75.835  141.038 120.838 1.00 65.48  ? -7  DC  I "O3'" 1 
ATOM   1155  C "C2'" . DC  A 1 57  ? 77.747  142.008 121.878 1.00 60.96  ? -7  DC  I "C2'" 1 
ATOM   1156  C "C1'" . DC  A 1 57  ? 78.648  141.598 120.736 1.00 61.54  ? -7  DC  I "C1'" 1 
ATOM   1157  N N1    . DC  A 1 57  ? 80.095  141.636 120.984 1.00 61.23  ? -7  DC  I N1    1 
ATOM   1158  C C2    . DC  A 1 57  ? 80.911  140.726 120.290 1.00 60.01  ? -7  DC  I C2    1 
ATOM   1159  O O2    . DC  A 1 57  ? 80.385  139.944 119.489 1.00 60.56  ? -7  DC  I O2    1 
ATOM   1160  N N3    . DC  A 1 57  ? 82.239  140.726 120.512 1.00 58.86  ? -7  DC  I N3    1 
ATOM   1161  C C4    . DC  A 1 57  ? 82.765  141.584 121.386 1.00 60.13  ? -7  DC  I C4    1 
ATOM   1162  N N4    . DC  A 1 57  ? 84.082  141.544 121.575 1.00 60.29  ? -7  DC  I N4    1 
ATOM   1163  C C5    . DC  A 1 57  ? 81.962  142.521 122.103 1.00 59.70  ? -7  DC  I C5    1 
ATOM   1164  C C6    . DC  A 1 57  ? 80.644  142.514 121.870 1.00 57.87  ? -7  DC  I C6    1 
ATOM   1165  P P     . DA  A 1 58  ? 74.257  140.981 120.607 1.00 62.70  ? -6  DA  I P     1 
ATOM   1166  O OP1   . DA  A 1 58  ? 73.887  142.138 119.764 1.00 64.31  ? -6  DA  I OP1   1 
ATOM   1167  O OP2   . DA  A 1 58  ? 73.623  140.796 121.930 1.00 68.63  ? -6  DA  I OP2   1 
ATOM   1168  O "O5'" . DA  A 1 58  ? 74.052  139.661 119.746 1.00 63.45  ? -6  DA  I "O5'" 1 
ATOM   1169  C "C5'" . DA  A 1 58  ? 74.427  139.626 118.375 1.00 59.42  ? -6  DA  I "C5'" 1 
ATOM   1170  C "C4'" . DA  A 1 58  ? 74.994  138.270 118.026 1.00 56.69  ? -6  DA  I "C4'" 1 
ATOM   1171  O "O4'" . DA  A 1 58  ? 76.298  138.117 118.627 1.00 57.04  ? -6  DA  I "O4'" 1 
ATOM   1172  C "C3'" . DA  A 1 58  ? 74.163  137.094 118.522 1.00 53.67  ? -6  DA  I "C3'" 1 
ATOM   1173  O "O3'" . DA  A 1 58  ? 74.178  136.072 117.533 1.00 52.10  ? -6  DA  I "O3'" 1 
ATOM   1174  C "C2'" . DA  A 1 58  ? 74.871  136.669 119.797 1.00 52.21  ? -6  DA  I "C2'" 1 
ATOM   1175  C "C1'" . DA  A 1 58  ? 76.320  137.011 119.518 1.00 53.18  ? -6  DA  I "C1'" 1 
ATOM   1176  N N9    . DA  A 1 58  ? 77.108  137.415 120.683 1.00 54.21  ? -6  DA  I N9    1 
ATOM   1177  C C8    . DA  A 1 58  ? 76.694  138.183 121.741 1.00 54.63  ? -6  DA  I C8    1 
ATOM   1178  N N7    . DA  A 1 58  ? 77.644  138.452 122.602 1.00 54.15  ? -6  DA  I N7    1 
ATOM   1179  C C5    . DA  A 1 58  ? 78.755  137.808 122.088 1.00 52.79  ? -6  DA  I C5    1 
ATOM   1180  C C6    . DA  A 1 58  ? 80.080  137.725 122.532 1.00 54.51  ? -6  DA  I C6    1 
ATOM   1181  N N6    . DA  A 1 58  ? 80.526  138.334 123.631 1.00 54.11  ? -6  DA  I N6    1 
ATOM   1182  N N1    . DA  A 1 58  ? 80.950  136.989 121.795 1.00 54.08  ? -6  DA  I N1    1 
ATOM   1183  C C2    . DA  A 1 58  ? 80.495  136.387 120.689 1.00 50.73  ? -6  DA  I C2    1 
ATOM   1184  N N3    . DA  A 1 58  ? 79.267  136.399 120.168 1.00 53.16  ? -6  DA  I N3    1 
ATOM   1185  C C4    . DA  A 1 58  ? 78.436  137.140 120.920 1.00 53.50  ? -6  DA  I C4    1 
ATOM   1186  P P     . DG  A 1 59  ? 73.223  134.804 117.690 1.00 52.37  ? -5  DG  I P     1 
ATOM   1187  O OP1   . DG  A 1 59  ? 72.785  134.355 116.354 1.00 49.25  ? -5  DG  I OP1   1 
ATOM   1188  O OP2   . DG  A 1 59  ? 72.212  135.081 118.732 1.00 54.01  ? -5  DG  I OP2   1 
ATOM   1189  O "O5'" . DG  A 1 59  ? 74.198  133.710 118.306 1.00 54.57  ? -5  DG  I "O5'" 1 
ATOM   1190  C "C5'" . DG  A 1 59  ? 75.422  133.390 117.665 1.00 51.67  ? -5  DG  I "C5'" 1 
ATOM   1191  C "C4'" . DG  A 1 59  ? 76.271  132.551 118.584 1.00 51.98  ? -5  DG  I "C4'" 1 
ATOM   1192  O "O4'" . DG  A 1 59  ? 76.845  133.362 119.634 1.00 48.92  ? -5  DG  I "O4'" 1 
ATOM   1193  C "C3'" . DG  A 1 59  ? 75.506  131.431 119.295 1.00 52.93  ? -5  DG  I "C3'" 1 
ATOM   1194  O "O3'" . DG  A 1 59  ? 76.389  130.332 119.456 1.00 54.25  ? -5  DG  I "O3'" 1 
ATOM   1195  C "C2'" . DG  A 1 59  ? 75.289  132.005 120.682 1.00 51.34  ? -5  DG  I "C2'" 1 
ATOM   1196  C "C1'" . DG  A 1 59  ? 76.619  132.693 120.858 1.00 51.63  ? -5  DG  I "C1'" 1 
ATOM   1197  N N9    . DG  A 1 59  ? 76.735  133.655 121.944 1.00 55.36  ? -5  DG  I N9    1 
ATOM   1198  C C8    . DG  A 1 59  ? 75.751  134.417 122.522 1.00 54.43  ? -5  DG  I C8    1 
ATOM   1199  N N7    . DG  A 1 59  ? 76.197  135.179 123.486 1.00 57.63  ? -5  DG  I N7    1 
ATOM   1200  C C5    . DG  A 1 59  ? 77.558  134.900 123.539 1.00 58.69  ? -5  DG  I C5    1 
ATOM   1201  C C6    . DG  A 1 59  ? 78.576  135.414 124.385 1.00 60.58  ? -5  DG  I C6    1 
ATOM   1202  O O6    . DG  A 1 59  ? 78.480  136.251 125.288 1.00 65.24  ? -5  DG  I O6    1 
ATOM   1203  N N1    . DG  A 1 59  ? 79.812  134.850 124.097 1.00 60.46  ? -5  DG  I N1    1 
ATOM   1204  C C2    . DG  A 1 59  ? 80.042  133.918 123.118 1.00 58.89  ? -5  DG  I C2    1 
ATOM   1205  N N2    . DG  A 1 59  ? 81.306  133.499 122.981 1.00 60.41  ? -5  DG  I N2    1 
ATOM   1206  N N3    . DG  A 1 59  ? 79.105  133.433 122.330 1.00 56.40  ? -5  DG  I N3    1 
ATOM   1207  C C4    . DG  A 1 59  ? 77.899  133.965 122.592 1.00 55.67  ? -5  DG  I C4    1 
ATOM   1208  P P     . DC  A 1 60  ? 76.200  129.012 118.578 1.00 52.18  ? -4  DC  I P     1 
ATOM   1209  O OP1   . DC  A 1 60  ? 76.081  129.413 117.157 1.00 50.41  ? -4  DC  I OP1   1 
ATOM   1210  O OP2   . DC  A 1 60  ? 75.125  128.215 119.215 1.00 53.68  ? -4  DC  I OP2   1 
ATOM   1211  O "O5'" . DC  A 1 60  ? 77.613  128.310 118.778 1.00 53.15  ? -4  DC  I "O5'" 1 
ATOM   1212  C "C5'" . DC  A 1 60  ? 78.790  128.978 118.344 1.00 48.14  ? -4  DC  I "C5'" 1 
ATOM   1213  C "C4'" . DC  A 1 60  ? 79.884  128.840 119.375 1.00 47.50  ? -4  DC  I "C4'" 1 
ATOM   1214  O "O4'" . DC  A 1 60  ? 79.729  129.789 120.458 1.00 44.00  ? -4  DC  I "O4'" 1 
ATOM   1215  C "C3'" . DC  A 1 60  ? 79.983  127.452 120.005 1.00 45.58  ? -4  DC  I "C3'" 1 
ATOM   1216  O "O3'" . DC  A 1 60  ? 81.311  126.957 119.868 1.00 41.34  ? -4  DC  I "O3'" 1 
ATOM   1217  C "C2'" . DC  A 1 60  ? 79.613  127.674 121.466 1.00 45.35  ? -4  DC  I "C2'" 1 
ATOM   1218  C "C1'" . DC  A 1 60  ? 79.922  129.148 121.713 1.00 46.60  ? -4  DC  I "C1'" 1 
ATOM   1219  N N1    . DC  A 1 60  ? 79.015  129.791 122.705 1.00 46.96  ? -4  DC  I N1    1 
ATOM   1220  C C2    . DC  A 1 60  ? 79.564  130.499 123.783 1.00 46.21  ? -4  DC  I C2    1 
ATOM   1221  O O2    . DC  A 1 60  ? 80.790  130.593 123.882 1.00 47.26  ? -4  DC  I O2    1 
ATOM   1222  N N3    . DC  A 1 60  ? 78.738  131.073 124.689 1.00 48.60  ? -4  DC  I N3    1 
ATOM   1223  C C4    . DC  A 1 60  ? 77.415  130.967 124.544 1.00 48.96  ? -4  DC  I C4    1 
ATOM   1224  N N4    . DC  A 1 60  ? 76.631  131.569 125.452 1.00 52.10  ? -4  DC  I N4    1 
ATOM   1225  C C5    . DC  A 1 60  ? 76.830  130.248 123.458 1.00 45.53  ? -4  DC  I C5    1 
ATOM   1226  C C6    . DC  A 1 60  ? 77.656  129.688 122.573 1.00 43.09  ? -4  DC  I C6    1 
ATOM   1227  P P     . DT  A 1 61  ? 81.644  125.437 120.280 1.00 36.81  ? -3  DT  I P     1 
ATOM   1228  O OP1   . DT  A 1 61  ? 82.551  124.886 119.219 1.00 40.27  ? -3  DT  I OP1   1 
ATOM   1229  O OP2   . DT  A 1 61  ? 80.390  124.741 120.596 1.00 31.93  ? -3  DT  I OP2   1 
ATOM   1230  O "O5'" . DT  A 1 61  ? 82.504  125.652 121.585 1.00 32.85  ? -3  DT  I "O5'" 1 
ATOM   1231  C "C5'" . DT  A 1 61  ? 83.674  126.443 121.520 1.00 36.37  ? -3  DT  I "C5'" 1 
ATOM   1232  C "C4'" . DT  A 1 61  ? 84.240  126.638 122.903 1.00 42.87  ? -3  DT  I "C4'" 1 
ATOM   1233  O "O4'" . DT  A 1 61  ? 83.284  127.366 123.713 1.00 46.96  ? -3  DT  I "O4'" 1 
ATOM   1234  C "C3'" . DT  A 1 61  ? 84.543  125.345 123.656 1.00 42.42  ? -3  DT  I "C3'" 1 
ATOM   1235  O "O3'" . DT  A 1 61  ? 85.750  125.555 124.365 1.00 44.97  ? -3  DT  I "O3'" 1 
ATOM   1236  C "C2'" . DT  A 1 61  ? 83.355  125.187 124.594 1.00 44.66  ? -3  DT  I "C2'" 1 
ATOM   1237  C "C1'" . DT  A 1 61  ? 82.984  126.633 124.892 1.00 45.97  ? -3  DT  I "C1'" 1 
ATOM   1238  N N1    . DT  A 1 61  ? 81.568  126.892 125.231 1.00 45.86  ? -3  DT  I N1    1 
ATOM   1239  C C2    . DT  A 1 61  ? 81.313  127.813 126.232 1.00 46.36  ? -3  DT  I C2    1 
ATOM   1240  O O2    . DT  A 1 61  ? 82.194  128.401 126.831 1.00 46.20  ? -3  DT  I O2    1 
ATOM   1241  N N3    . DT  A 1 61  ? 79.980  128.023 126.500 1.00 44.25  ? -3  DT  I N3    1 
ATOM   1242  C C4    . DT  A 1 61  ? 78.904  127.423 125.880 1.00 45.43  ? -3  DT  I C4    1 
ATOM   1243  O O4    . DT  A 1 61  ? 77.762  127.714 126.222 1.00 46.13  ? -3  DT  I O4    1 
ATOM   1244  C C5    . DT  A 1 61  ? 79.242  126.471 124.834 1.00 46.22  ? -3  DT  I C5    1 
ATOM   1245  C C7    . DT  A 1 61  ? 78.133  125.789 124.090 1.00 39.15  ? -3  DT  I C7    1 
ATOM   1246  C C6    . DT  A 1 61  ? 80.543  126.250 124.575 1.00 41.85  ? -3  DT  I C6    1 
ATOM   1247  P P     . DG  A 1 62  ? 86.547  124.316 124.984 1.00 47.94  ? -2  DG  I P     1 
ATOM   1248  O OP1   . DG  A 1 62  ? 87.979  124.675 124.809 1.00 49.64  ? -2  DG  I OP1   1 
ATOM   1249  O OP2   . DG  A 1 62  ? 86.028  123.022 124.480 1.00 49.94  ? -2  DG  I OP2   1 
ATOM   1250  O "O5'" . DG  A 1 62  ? 86.195  124.380 126.528 1.00 46.79  ? -2  DG  I "O5'" 1 
ATOM   1251  C "C5'" . DG  A 1 62  ? 86.512  125.533 127.281 1.00 51.33  ? -2  DG  I "C5'" 1 
ATOM   1252  C "C4'" . DG  A 1 62  ? 85.804  125.478 128.613 1.00 54.28  ? -2  DG  I "C4'" 1 
ATOM   1253  O "O4'" . DG  A 1 62  ? 84.389  125.716 128.434 1.00 49.85  ? -2  DG  I "O4'" 1 
ATOM   1254  C "C3'" . DG  A 1 62  ? 85.911  124.118 129.309 1.00 55.98  ? -2  DG  I "C3'" 1 
ATOM   1255  O "O3'" . DG  A 1 62  ? 85.945  124.351 130.703 1.00 60.85  ? -2  DG  I "O3'" 1 
ATOM   1256  C "C2'" . DG  A 1 62  ? 84.581  123.469 128.988 1.00 54.34  ? -2  DG  I "C2'" 1 
ATOM   1257  C "C1'" . DG  A 1 62  ? 83.685  124.681 129.078 1.00 51.83  ? -2  DG  I "C1'" 1 
ATOM   1258  N N9    . DG  A 1 62  ? 82.373  124.562 128.465 1.00 51.03  ? -2  DG  I N9    1 
ATOM   1259  C C8    . DG  A 1 62  ? 81.981  123.723 127.457 1.00 50.85  ? -2  DG  I C8    1 
ATOM   1260  N N7    . DG  A 1 62  ? 80.712  123.814 127.182 1.00 51.48  ? -2  DG  I N7    1 
ATOM   1261  C C5    . DG  A 1 62  ? 80.244  124.779 128.061 1.00 53.11  ? -2  DG  I C5    1 
ATOM   1262  C C6    . DG  A 1 62  ? 78.945  125.292 128.250 1.00 51.94  ? -2  DG  I C6    1 
ATOM   1263  O O6    . DG  A 1 62  ? 77.905  124.977 127.665 1.00 54.61  ? -2  DG  I O6    1 
ATOM   1264  N N1    . DG  A 1 62  ? 78.918  126.271 129.238 1.00 53.97  ? -2  DG  I N1    1 
ATOM   1265  C C2    . DG  A 1 62  ? 80.004  126.700 129.950 1.00 54.83  ? -2  DG  I C2    1 
ATOM   1266  N N2    . DG  A 1 62  ? 79.785  127.672 130.846 1.00 59.13  ? -2  DG  I N2    1 
ATOM   1267  N N3    . DG  A 1 62  ? 81.221  126.217 129.794 1.00 54.40  ? -2  DG  I N3    1 
ATOM   1268  C C4    . DG  A 1 62  ? 81.264  125.265 128.839 1.00 53.33  ? -2  DG  I C4    1 
ATOM   1269  P P     . DA  A 1 63  ? 86.923  123.502 131.639 1.00 62.05  ? -1  DA  I P     1 
ATOM   1270  O OP1   . DA  A 1 63  ? 88.329  123.795 131.267 1.00 59.15  ? -1  DA  I OP1   1 
ATOM   1271  O OP2   . DA  A 1 63  ? 86.439  122.099 131.686 1.00 59.20  ? -1  DA  I OP2   1 
ATOM   1272  O "O5'" . DA  A 1 63  ? 86.650  124.178 133.045 1.00 61.70  ? -1  DA  I "O5'" 1 
ATOM   1273  C "C5'" . DA  A 1 63  ? 86.392  125.576 133.120 1.00 61.14  ? -1  DA  I "C5'" 1 
ATOM   1274  C "C4'" . DA  A 1 63  ? 85.223  125.833 134.041 1.00 64.27  ? -1  DA  I "C4'" 1 
ATOM   1275  O "O4'" . DA  A 1 63  ? 83.954  125.762 133.346 1.00 61.67  ? -1  DA  I "O4'" 1 
ATOM   1276  C "C3'" . DA  A 1 63  ? 85.129  124.847 135.202 1.00 65.24  ? -1  DA  I "C3'" 1 
ATOM   1277  O "O3'" . DA  A 1 63  ? 84.808  125.567 136.387 1.00 72.11  ? -1  DA  I "O3'" 1 
ATOM   1278  C "C2'" . DA  A 1 63  ? 83.993  123.924 134.794 1.00 61.28  ? -1  DA  I "C2'" 1 
ATOM   1279  C "C1'" . DA  A 1 63  ? 83.085  124.862 134.015 1.00 60.08  ? -1  DA  I "C1'" 1 
ATOM   1280  N N9    . DA  A 1 63  ? 82.238  124.224 133.003 1.00 57.07  ? -1  DA  I N9    1 
ATOM   1281  C C8    . DA  A 1 63  ? 82.632  123.437 131.952 1.00 53.49  ? -1  DA  I C8    1 
ATOM   1282  N N7    . DA  A 1 63  ? 81.642  123.037 131.191 1.00 52.84  ? -1  DA  I N7    1 
ATOM   1283  C C5    . DA  A 1 63  ? 80.518  123.589 131.784 1.00 52.19  ? -1  DA  I C5    1 
ATOM   1284  C C6    . DA  A 1 63  ? 79.150  123.544 131.453 1.00 51.73  ? -1  DA  I C6    1 
ATOM   1285  N N6    . DA  A 1 63  ? 78.654  122.890 130.399 1.00 46.24  ? -1  DA  I N6    1 
ATOM   1286  N N1    . DA  A 1 63  ? 78.290  124.208 132.255 1.00 51.82  ? -1  DA  I N1    1 
ATOM   1287  C C2    . DA  A 1 63  ? 78.779  124.863 133.310 1.00 53.11  ? -1  DA  I C2    1 
ATOM   1288  N N3    . DA  A 1 63  ? 80.039  124.983 133.722 1.00 55.30  ? -1  DA  I N3    1 
ATOM   1289  C C4    . DA  A 1 63  ? 80.869  124.317 132.906 1.00 54.81  ? -1  DA  I C4    1 
ATOM   1290  P P     . DA  A 1 64  ? 85.014  124.877 137.816 1.00 75.59  ? 0   DA  I P     1 
ATOM   1291  O OP1   . DA  A 1 64  ? 85.584  125.917 138.709 1.00 77.46  ? 0   DA  I OP1   1 
ATOM   1292  O OP2   . DA  A 1 64  ? 85.728  123.581 137.643 1.00 76.76  ? 0   DA  I OP2   1 
ATOM   1293  O "O5'" . DA  A 1 64  ? 83.522  124.571 138.261 1.00 71.34  ? 0   DA  I "O5'" 1 
ATOM   1294  C "C5'" . DA  A 1 64  ? 82.597  125.633 138.379 1.00 71.14  ? 0   DA  I "C5'" 1 
ATOM   1295  C "C4'" . DA  A 1 64  ? 81.248  125.101 138.785 1.00 71.01  ? 0   DA  I "C4'" 1 
ATOM   1296  O "O4'" . DA  A 1 64  ? 80.534  124.603 137.631 1.00 69.80  ? 0   DA  I "O4'" 1 
ATOM   1297  C "C3'" . DA  A 1 64  ? 81.304  123.955 139.792 1.00 71.46  ? 0   DA  I "C3'" 1 
ATOM   1298  O "O3'" . DA  A 1 64  ? 80.357  124.191 140.831 1.00 72.93  ? 0   DA  I "O3'" 1 
ATOM   1299  C "C2'" . DA  A 1 64  ? 80.938  122.732 138.966 1.00 70.80  ? 0   DA  I "C2'" 1 
ATOM   1300  C "C1'" . DA  A 1 64  ? 80.025  123.312 137.902 1.00 71.32  ? 0   DA  I "C1'" 1 
ATOM   1301  N N9    . DA  A 1 64  ? 80.009  122.572 136.641 1.00 72.46  ? 0   DA  I N9    1 
ATOM   1302  C C8    . DA  A 1 64  ? 81.067  121.963 136.013 1.00 71.99  ? 0   DA  I C8    1 
ATOM   1303  N N7    . DA  A 1 64  ? 80.747  121.379 134.886 1.00 72.30  ? 0   DA  I N7    1 
ATOM   1304  C C5    . DA  A 1 64  ? 79.388  121.617 134.762 1.00 71.07  ? 0   DA  I C5    1 
ATOM   1305  C C6    . DA  A 1 64  ? 78.459  121.259 133.781 1.00 72.17  ? 0   DA  I C6    1 
ATOM   1306  N N6    . DA  A 1 64  ? 78.777  120.566 132.683 1.00 71.06  ? 0   DA  I N6    1 
ATOM   1307  N N1    . DA  A 1 64  ? 77.176  121.643 133.958 1.00 74.07  ? 0   DA  I N1    1 
ATOM   1308  C C2    . DA  A 1 64  ? 76.867  122.351 135.054 1.00 73.87  ? 0   DA  I C2    1 
ATOM   1309  N N3    . DA  A 1 64  ? 77.656  122.756 136.044 1.00 72.69  ? 0   DA  I N3    1 
ATOM   1310  C C4    . DA  A 1 64  ? 78.918  122.350 135.836 1.00 71.58  ? 0   DA  I C4    1 
ATOM   1311  P P     . DT  A 1 65  ? 80.105  123.070 141.950 1.00 73.35  ? 1   DT  I P     1 
ATOM   1312  O OP1   . DT  A 1 65  ? 79.796  123.770 143.226 1.00 76.01  ? 1   DT  I OP1   1 
ATOM   1313  O OP2   . DT  A 1 65  ? 81.222  122.086 141.897 1.00 72.17  ? 1   DT  I OP2   1 
ATOM   1314  O "O5'" . DT  A 1 65  ? 78.784  122.361 141.431 1.00 68.31  ? 1   DT  I "O5'" 1 
ATOM   1315  C "C5'" . DT  A 1 65  ? 77.691  123.146 140.980 1.00 63.87  ? 1   DT  I "C5'" 1 
ATOM   1316  C "C4'" . DT  A 1 65  ? 76.520  122.253 140.663 1.00 63.25  ? 1   DT  I "C4'" 1 
ATOM   1317  O "O4'" . DT  A 1 65  ? 76.631  121.724 139.317 1.00 64.15  ? 1   DT  I "O4'" 1 
ATOM   1318  C "C3'" . DT  A 1 65  ? 76.430  121.049 141.598 1.00 64.36  ? 1   DT  I "C3'" 1 
ATOM   1319  O "O3'" . DT  A 1 65  ? 75.107  120.899 142.089 1.00 65.53  ? 1   DT  I "O3'" 1 
ATOM   1320  C "C2'" . DT  A 1 65  ? 76.818  119.871 140.718 1.00 64.81  ? 1   DT  I "C2'" 1 
ATOM   1321  C "C1'" . DT  A 1 65  ? 76.384  120.331 139.333 1.00 63.38  ? 1   DT  I "C1'" 1 
ATOM   1322  N N1    . DT  A 1 65  ? 77.122  119.711 138.200 1.00 58.50  ? 1   DT  I N1    1 
ATOM   1323  C C2    . DT  A 1 65  ? 76.400  119.276 137.109 1.00 57.88  ? 1   DT  I C2    1 
ATOM   1324  O O2    . DT  A 1 65  ? 75.185  119.379 137.020 1.00 55.99  ? 1   DT  I O2    1 
ATOM   1325  N N3    . DT  A 1 65  ? 77.158  118.703 136.115 1.00 57.80  ? 1   DT  I N3    1 
ATOM   1326  C C4    . DT  A 1 65  ? 78.526  118.527 136.102 1.00 57.38  ? 1   DT  I C4    1 
ATOM   1327  O O4    . DT  A 1 65  ? 79.066  117.998 135.134 1.00 61.35  ? 1   DT  I O4    1 
ATOM   1328  C C5    . DT  A 1 65  ? 79.218  119.003 137.276 1.00 56.93  ? 1   DT  I C5    1 
ATOM   1329  C C7    . DT  A 1 65  ? 80.704  118.840 137.357 1.00 52.95  ? 1   DT  I C7    1 
ATOM   1330  C C6    . DT  A 1 65  ? 78.491  119.571 138.248 1.00 57.62  ? 1   DT  I C6    1 
ATOM   1331  P P     . DT  A 1 66  ? 74.791  119.753 143.163 1.00 72.04  ? 2   DT  I P     1 
ATOM   1332  O OP1   . DT  A 1 66  ? 73.844  120.323 144.156 1.00 73.44  ? 2   DT  I OP1   1 
ATOM   1333  O OP2   . DT  A 1 66  ? 76.085  119.177 143.627 1.00 70.44  ? 2   DT  I OP2   1 
ATOM   1334  O "O5'" . DT  A 1 66  ? 74.014  118.678 142.291 1.00 66.51  ? 2   DT  I "O5'" 1 
ATOM   1335  C "C5'" . DT  A 1 66  ? 72.938  119.103 141.470 1.00 66.38  ? 2   DT  I "C5'" 1 
ATOM   1336  C "C4'" . DT  A 1 66  ? 72.393  117.948 140.668 1.00 66.41  ? 2   DT  I "C4'" 1 
ATOM   1337  O "O4'" . DT  A 1 66  ? 73.257  117.653 139.542 1.00 64.81  ? 2   DT  I "O4'" 1 
ATOM   1338  C "C3'" . DT  A 1 66  ? 72.229  116.646 141.450 1.00 65.55  ? 2   DT  I "C3'" 1 
ATOM   1339  O "O3'" . DT  A 1 66  ? 70.930  116.109 141.198 1.00 67.50  ? 2   DT  I "O3'" 1 
ATOM   1340  C "C2'" . DT  A 1 66  ? 73.320  115.747 140.885 1.00 63.12  ? 2   DT  I "C2'" 1 
ATOM   1341  C "C1'" . DT  A 1 66  ? 73.454  116.255 139.455 1.00 62.24  ? 2   DT  I "C1'" 1 
ATOM   1342  N N1    . DT  A 1 66  ? 74.758  116.025 138.795 1.00 57.37  ? 2   DT  I N1    1 
ATOM   1343  C C2    . DT  A 1 66  ? 74.756  115.625 137.477 1.00 56.25  ? 2   DT  I C2    1 
ATOM   1344  O O2    . DT  A 1 66  ? 73.733  115.442 136.837 1.00 55.99  ? 2   DT  I O2    1 
ATOM   1345  N N3    . DT  A 1 66  ? 76.003  115.444 136.932 1.00 52.16  ? 2   DT  I N3    1 
ATOM   1346  C C4    . DT  A 1 66  ? 77.217  115.618 137.557 1.00 52.02  ? 2   DT  I C4    1 
ATOM   1347  O O4    . DT  A 1 66  ? 78.258  115.413 136.941 1.00 51.05  ? 2   DT  I O4    1 
ATOM   1348  C C5    . DT  A 1 66  ? 77.145  116.040 138.935 1.00 52.30  ? 2   DT  I C5    1 
ATOM   1349  C C7    . DT  A 1 66  ? 78.416  116.265 139.690 1.00 48.43  ? 2   DT  I C7    1 
ATOM   1350  C C6    . DT  A 1 66  ? 75.936  116.214 139.479 1.00 54.41  ? 2   DT  I C6    1 
ATOM   1351  P P     . DC  A 1 67  ? 70.330  114.993 142.181 1.00 69.36  ? 3   DC  I P     1 
ATOM   1352  O OP1   . DC  A 1 67  ? 68.919  115.334 142.478 1.00 69.94  ? 3   DC  I OP1   1 
ATOM   1353  O OP2   . DC  A 1 67  ? 71.298  114.820 143.291 1.00 66.59  ? 3   DC  I OP2   1 
ATOM   1354  O "O5'" . DC  A 1 67  ? 70.337  113.679 141.284 1.00 66.48  ? 3   DC  I "O5'" 1 
ATOM   1355  C "C5'" . DC  A 1 67  ? 69.639  113.648 140.040 1.00 62.98  ? 3   DC  I "C5'" 1 
ATOM   1356  C "C4'" . DC  A 1 67  ? 70.013  112.409 139.261 1.00 61.95  ? 3   DC  I "C4'" 1 
ATOM   1357  O "O4'" . DC  A 1 67  ? 71.324  112.546 138.657 1.00 56.96  ? 3   DC  I "O4'" 1 
ATOM   1358  C "C3'" . DC  A 1 67  ? 70.066  111.131 140.100 1.00 60.20  ? 3   DC  I "C3'" 1 
ATOM   1359  O "O3'" . DC  A 1 67  ? 69.547  110.057 139.331 1.00 63.94  ? 3   DC  I "O3'" 1 
ATOM   1360  C "C2'" . DC  A 1 67  ? 71.554  110.912 140.296 1.00 59.50  ? 3   DC  I "C2'" 1 
ATOM   1361  C "C1'" . DC  A 1 67  ? 72.078  111.389 138.957 1.00 55.08  ? 3   DC  I "C1'" 1 
ATOM   1362  N N1    . DC  A 1 67  ? 73.510  111.727 138.893 1.00 53.71  ? 3   DC  I N1    1 
ATOM   1363  C C2    . DC  A 1 67  ? 74.172  111.584 137.661 1.00 52.13  ? 3   DC  I C2    1 
ATOM   1364  O O2    . DC  A 1 67  ? 73.524  111.218 136.672 1.00 48.67  ? 3   DC  I O2    1 
ATOM   1365  N N3    . DC  A 1 67  ? 75.498  111.847 137.586 1.00 51.14  ? 3   DC  I N3    1 
ATOM   1366  C C4    . DC  A 1 67  ? 76.158  112.239 138.677 1.00 48.28  ? 3   DC  I C4    1 
ATOM   1367  N N4    . DC  A 1 67  ? 77.472  112.452 138.564 1.00 42.24  ? 3   DC  I N4    1 
ATOM   1368  C C5    . DC  A 1 67  ? 75.503  112.421 139.936 1.00 48.81  ? 3   DC  I C5    1 
ATOM   1369  C C6    . DC  A 1 67  ? 74.191  112.156 139.996 1.00 49.32  ? 3   DC  I C6    1 
ATOM   1370  P P     . DA  A 1 68  ? 68.230  109.296 139.824 1.00 66.53  ? 4   DA  I P     1 
ATOM   1371  O OP1   . DA  A 1 68  ? 67.236  110.343 140.156 1.00 70.57  ? 4   DA  I OP1   1 
ATOM   1372  O OP2   . DA  A 1 68  ? 68.623  108.288 140.849 1.00 68.19  ? 4   DA  I OP2   1 
ATOM   1373  O "O5'" . DA  A 1 68  ? 67.732  108.523 138.524 1.00 65.15  ? 4   DA  I "O5'" 1 
ATOM   1374  C "C5'" . DA  A 1 68  ? 67.519  109.221 137.300 1.00 63.39  ? 4   DA  I "C5'" 1 
ATOM   1375  C "C4'" . DA  A 1 68  ? 68.180  108.481 136.160 1.00 63.44  ? 4   DA  I "C4'" 1 
ATOM   1376  O "O4'" . DA  A 1 68  ? 69.621  108.611 136.232 1.00 63.82  ? 4   DA  I "O4'" 1 
ATOM   1377  C "C3'" . DA  A 1 68  ? 67.900  106.981 136.148 1.00 62.32  ? 4   DA  I "C3'" 1 
ATOM   1378  O "O3'" . DA  A 1 68  ? 67.778  106.541 134.798 1.00 60.50  ? 4   DA  I "O3'" 1 
ATOM   1379  C "C2'" . DA  A 1 68  ? 69.125  106.387 136.824 1.00 62.37  ? 4   DA  I "C2'" 1 
ATOM   1380  C "C1'" . DA  A 1 68  ? 70.231  107.336 136.389 1.00 62.62  ? 4   DA  I "C1'" 1 
ATOM   1381  N N9    . DA  A 1 68  ? 71.326  107.504 137.339 1.00 61.63  ? 4   DA  I N9    1 
ATOM   1382  C C8    . DA  A 1 68  ? 71.260  107.594 138.706 1.00 64.03  ? 4   DA  I C8    1 
ATOM   1383  N N7    . DA  A 1 68  ? 72.412  107.863 139.275 1.00 61.62  ? 4   DA  I N7    1 
ATOM   1384  C C5    . DA  A 1 68  ? 73.298  107.927 138.213 1.00 58.54  ? 4   DA  I C5    1 
ATOM   1385  C C6    . DA  A 1 68  ? 74.666  108.205 138.149 1.00 57.05  ? 4   DA  I C6    1 
ATOM   1386  N N6    . DA  A 1 68  ? 75.412  108.505 139.216 1.00 53.15  ? 4   DA  I N6    1 
ATOM   1387  N N1    . DA  A 1 68  ? 75.252  108.177 136.934 1.00 57.77  ? 4   DA  I N1    1 
ATOM   1388  C C2    . DA  A 1 68  ? 74.498  107.902 135.863 1.00 58.98  ? 4   DA  I C2    1 
ATOM   1389  N N3    . DA  A 1 68  ? 73.198  107.642 135.794 1.00 58.37  ? 4   DA  I N3    1 
ATOM   1390  C C4    . DA  A 1 68  ? 72.649  107.673 137.018 1.00 61.18  ? 4   DA  I C4    1 
ATOM   1391  P P     . DG  A 1 69  ? 67.310  105.045 134.498 1.00 63.19  ? 5   DG  I P     1 
ATOM   1392  O OP1   . DG  A 1 69  ? 66.563  105.064 133.217 1.00 62.24  ? 5   DG  I OP1   1 
ATOM   1393  O OP2   . DG  A 1 69  ? 66.668  104.497 135.718 1.00 64.59  ? 5   DG  I OP2   1 
ATOM   1394  O "O5'" . DG  A 1 69  ? 68.679  104.255 134.288 1.00 63.12  ? 5   DG  I "O5'" 1 
ATOM   1395  C "C5'" . DG  A 1 69  ? 69.576  104.607 133.242 1.00 58.25  ? 5   DG  I "C5'" 1 
ATOM   1396  C "C4'" . DG  A 1 69  ? 70.862  103.822 133.373 1.00 56.75  ? 5   DG  I "C4'" 1 
ATOM   1397  O "O4'" . DG  A 1 69  ? 71.624  104.294 134.512 1.00 53.61  ? 5   DG  I "O4'" 1 
ATOM   1398  C "C3'" . DG  A 1 69  ? 70.692  102.313 133.581 1.00 56.44  ? 5   DG  I "C3'" 1 
ATOM   1399  O "O3'" . DG  A 1 69  ? 71.742  101.633 132.895 1.00 53.78  ? 5   DG  I "O3'" 1 
ATOM   1400  C "C2'" . DG  A 1 69  ? 70.941  102.154 135.071 1.00 55.89  ? 5   DG  I "C2'" 1 
ATOM   1401  C "C1'" . DG  A 1 69  ? 72.043  103.173 135.258 1.00 54.66  ? 5   DG  I "C1'" 1 
ATOM   1402  N N9    . DG  A 1 69  ? 72.329  103.607 136.620 1.00 56.81  ? 5   DG  I N9    1 
ATOM   1403  C C8    . DG  A 1 69  ? 71.450  103.681 137.672 1.00 56.16  ? 5   DG  I C8    1 
ATOM   1404  N N7    . DG  A 1 69  ? 72.008  104.108 138.772 1.00 57.72  ? 5   DG  I N7    1 
ATOM   1405  C C5    . DG  A 1 69  ? 73.335  104.325 138.429 1.00 57.82  ? 5   DG  I C5    1 
ATOM   1406  C C6    . DG  A 1 69  ? 74.429  104.783 139.219 1.00 58.86  ? 5   DG  I C6    1 
ATOM   1407  O O6    . DG  A 1 69  ? 74.440  105.099 140.408 1.00 58.47  ? 5   DG  I O6    1 
ATOM   1408  N N1    . DG  A 1 69  ? 75.603  104.852 138.478 1.00 58.69  ? 5   DG  I N1    1 
ATOM   1409  C C2    . DG  A 1 69  ? 75.716  104.531 137.146 1.00 59.43  ? 5   DG  I C2    1 
ATOM   1410  N N2    . DG  A 1 69  ? 76.942  104.674 136.610 1.00 55.55  ? 5   DG  I N2    1 
ATOM   1411  N N3    . DG  A 1 69  ? 74.703  104.102 136.399 1.00 56.28  ? 5   DG  I N3    1 
ATOM   1412  C C4    . DG  A 1 69  ? 73.551  104.023 137.103 1.00 57.77  ? 5   DG  I C4    1 
ATOM   1413  P P     . DC  A 1 70  ? 71.431  100.812 131.553 1.00 54.11  ? 6   DC  I P     1 
ATOM   1414  O OP1   . DC  A 1 70  ? 70.480  101.614 130.745 1.00 54.25  ? 6   DC  I OP1   1 
ATOM   1415  O OP2   . DC  A 1 70  ? 71.139  99.390  131.843 1.00 51.63  ? 6   DC  I OP2   1 
ATOM   1416  O "O5'" . DC  A 1 70  ? 72.832  100.851 130.800 1.00 50.98  ? 6   DC  I "O5'" 1 
ATOM   1417  C "C5'" . DC  A 1 70  ? 73.354  102.085 130.331 1.00 45.57  ? 6   DC  I "C5'" 1 
ATOM   1418  C "C4'" . DC  A 1 70  ? 74.827  102.174 130.640 1.00 45.82  ? 6   DC  I "C4'" 1 
ATOM   1419  O "O4'" . DC  A 1 70  ? 75.082  102.354 132.054 1.00 42.34  ? 6   DC  I "O4'" 1 
ATOM   1420  C "C3'" . DC  A 1 70  ? 75.642  100.958 130.222 1.00 42.27  ? 6   DC  I "C3'" 1 
ATOM   1421  O "O3'" . DC  A 1 70  ? 76.883  101.502 129.850 1.00 47.68  ? 6   DC  I "O3'" 1 
ATOM   1422  C "C2'" . DC  A 1 70  ? 75.783  100.183 131.519 1.00 46.00  ? 6   DC  I "C2'" 1 
ATOM   1423  C "C1'" . DC  A 1 70  ? 75.894  101.299 132.545 1.00 42.61  ? 6   DC  I "C1'" 1 
ATOM   1424  N N1    . DC  A 1 70  ? 75.421  100.981 133.906 1.00 47.33  ? 6   DC  I N1    1 
ATOM   1425  C C2    . DC  A 1 70  ? 76.224  101.344 135.005 1.00 45.99  ? 6   DC  I C2    1 
ATOM   1426  O O2    . DC  A 1 70  ? 77.331  101.861 134.798 1.00 47.17  ? 6   DC  I O2    1 
ATOM   1427  N N3    . DC  A 1 70  ? 75.764  101.126 136.261 1.00 47.52  ? 6   DC  I N3    1 
ATOM   1428  C C4    . DC  A 1 70  ? 74.560  100.582 136.444 1.00 48.06  ? 6   DC  I C4    1 
ATOM   1429  N N4    . DC  A 1 70  ? 74.122  100.455 137.697 1.00 48.80  ? 6   DC  I N4    1 
ATOM   1430  C C5    . DC  A 1 70  ? 73.741  100.165 135.349 1.00 48.51  ? 6   DC  I C5    1 
ATOM   1431  C C6    . DC  A 1 70  ? 74.210  100.377 134.108 1.00 47.06  ? 6   DC  I C6    1 
ATOM   1432  P P     . DT  A 1 71  ? 77.810  100.769 128.786 1.00 45.40  ? 7   DT  I P     1 
ATOM   1433  O OP1   . DT  A 1 71  ? 78.329  101.925 128.019 1.00 44.88  ? 7   DT  I OP1   1 
ATOM   1434  O OP2   . DT  A 1 71  ? 77.168  99.649  128.094 1.00 40.68  ? 7   DT  I OP2   1 
ATOM   1435  O "O5'" . DT  A 1 71  ? 78.973  100.184 129.694 1.00 41.01  ? 7   DT  I "O5'" 1 
ATOM   1436  C "C5'" . DT  A 1 71  ? 79.770  101.066 130.450 1.00 38.23  ? 7   DT  I "C5'" 1 
ATOM   1437  C "C4'" . DT  A 1 71  ? 80.452  100.314 131.562 1.00 37.55  ? 7   DT  I "C4'" 1 
ATOM   1438  O "O4'" . DT  A 1 71  ? 79.490  99.976  132.593 1.00 34.75  ? 7   DT  I "O4'" 1 
ATOM   1439  C "C3'" . DT  A 1 71  ? 81.142  99.007  131.158 1.00 34.59  ? 7   DT  I "C3'" 1 
ATOM   1440  O "O3'" . DT  A 1 71  ? 82.420  99.016  131.771 1.00 32.66  ? 7   DT  I "O3'" 1 
ATOM   1441  C "C2'" . DT  A 1 71  ? 80.279  97.935  131.800 1.00 37.70  ? 7   DT  I "C2'" 1 
ATOM   1442  C "C1'" . DT  A 1 71  ? 79.731  98.659  133.028 1.00 39.53  ? 7   DT  I "C1'" 1 
ATOM   1443  N N1    . DT  A 1 71  ? 78.465  98.132  133.594 1.00 42.38  ? 7   DT  I N1    1 
ATOM   1444  C C2    . DT  A 1 71  ? 78.279  98.200  134.973 1.00 44.66  ? 7   DT  I C2    1 
ATOM   1445  O O2    . DT  A 1 71  ? 79.077  98.706  135.753 1.00 35.02  ? 7   DT  I O2    1 
ATOM   1446  N N3    . DT  A 1 71  ? 77.103  97.657  135.412 1.00 46.98  ? 7   DT  I N3    1 
ATOM   1447  C C4    . DT  A 1 71  ? 76.112  97.087  134.649 1.00 49.19  ? 7   DT  I C4    1 
ATOM   1448  O O4    . DT  A 1 71  ? 75.111  96.625  135.196 1.00 55.50  ? 7   DT  I O4    1 
ATOM   1449  C C5    . DT  A 1 71  ? 76.349  97.076  133.225 1.00 47.98  ? 7   DT  I C5    1 
ATOM   1450  C C7    . DT  A 1 71  ? 75.290  96.515  132.326 1.00 44.78  ? 7   DT  I C7    1 
ATOM   1451  C C6    . DT  A 1 71  ? 77.503  97.582  132.774 1.00 41.56  ? 7   DT  I C6    1 
ATOM   1452  P P     . DG  A 1 72  ? 83.529  97.929  131.390 1.00 27.91  ? 8   DG  I P     1 
ATOM   1453  O OP1   . DG  A 1 72  ? 84.509  98.639  130.514 1.00 30.92  ? 8   DG  I OP1   1 
ATOM   1454  O OP2   . DG  A 1 72  ? 82.982  96.641  130.963 1.00 29.71  ? 8   DG  I OP2   1 
ATOM   1455  O "O5'" . DG  A 1 72  ? 84.211  97.740  132.811 1.00 29.58  ? 8   DG  I "O5'" 1 
ATOM   1456  C "C5'" . DG  A 1 72  ? 84.581  98.893  133.566 1.00 27.74  ? 8   DG  I "C5'" 1 
ATOM   1457  C "C4'" . DG  A 1 72  ? 84.874  98.515  135.000 1.00 30.02  ? 8   DG  I "C4'" 1 
ATOM   1458  O "O4'" . DG  A 1 72  ? 83.666  98.166  135.717 1.00 27.68  ? 8   DG  I "O4'" 1 
ATOM   1459  C "C3'" . DG  A 1 72  ? 85.804  97.323  135.159 1.00 32.69  ? 8   DG  I "C3'" 1 
ATOM   1460  O "O3'" . DG  A 1 72  ? 86.608  97.575  136.313 1.00 29.52  ? 8   DG  I "O3'" 1 
ATOM   1461  C "C2'" . DG  A 1 72  ? 84.844  96.157  135.327 1.00 26.96  ? 8   DG  I "C2'" 1 
ATOM   1462  C "C1'" . DG  A 1 72  ? 83.658  96.795  136.034 1.00 32.10  ? 8   DG  I "C1'" 1 
ATOM   1463  N N9    . DG  A 1 72  ? 82.332  96.282  135.683 1.00 36.84  ? 8   DG  I N9    1 
ATOM   1464  C C8    . DG  A 1 72  ? 81.845  95.954  134.442 1.00 37.16  ? 8   DG  I C8    1 
ATOM   1465  N N7    . DG  A 1 72  ? 80.600  95.548  134.471 1.00 36.60  ? 8   DG  I N7    1 
ATOM   1466  C C5    . DG  A 1 72  ? 80.250  95.608  135.812 1.00 40.38  ? 8   DG  I C5    1 
ATOM   1467  C C6    . DG  A 1 72  ? 79.011  95.306  136.467 1.00 40.95  ? 8   DG  I C6    1 
ATOM   1468  O O6    . DG  A 1 72  ? 77.958  94.904  135.967 1.00 36.49  ? 8   DG  I O6    1 
ATOM   1469  N N1    . DG  A 1 72  ? 79.093  95.520  137.839 1.00 37.63  ? 8   DG  I N1    1 
ATOM   1470  C C2    . DG  A 1 72  ? 80.217  95.947  138.497 1.00 39.31  ? 8   DG  I C2    1 
ATOM   1471  N N2    . DG  A 1 72  ? 80.117  96.074  139.818 1.00 35.60  ? 8   DG  I N2    1 
ATOM   1472  N N3    . DG  A 1 72  ? 81.369  96.230  137.900 1.00 35.52  ? 8   DG  I N3    1 
ATOM   1473  C C4    . DG  A 1 72  ? 81.310  96.048  136.574 1.00 37.54  ? 8   DG  I C4    1 
ATOM   1474  P P     . DA  A 1 73  ? 87.775  96.575  136.703 1.00 29.72  ? 9   DA  I P     1 
ATOM   1475  O OP1   . DA  A 1 73  ? 88.857  97.461  137.225 1.00 30.61  ? 9   DA  I OP1   1 
ATOM   1476  O OP2   . DA  A 1 73  ? 88.037  95.646  135.586 1.00 29.20  ? 9   DA  I OP2   1 
ATOM   1477  O "O5'" . DA  A 1 73  ? 87.166  95.717  137.900 1.00 30.30  ? 9   DA  I "O5'" 1 
ATOM   1478  C "C5'" . DA  A 1 73  ? 86.714  96.363  139.082 1.00 24.97  ? 9   DA  I "C5'" 1 
ATOM   1479  C "C4'" . DA  A 1 73  ? 86.169  95.346  140.051 1.00 29.94  ? 9   DA  I "C4'" 1 
ATOM   1480  O "O4'" . DA  A 1 73  ? 84.862  94.917  139.626 1.00 32.37  ? 9   DA  I "O4'" 1 
ATOM   1481  C "C3'" . DA  A 1 73  ? 87.009  94.083  140.200 1.00 30.21  ? 9   DA  I "C3'" 1 
ATOM   1482  O "O3'" . DA  A 1 73  ? 87.178  93.844  141.592 1.00 34.17  ? 9   DA  I "O3'" 1 
ATOM   1483  C "C2'" . DA  A 1 73  ? 86.188  93.003  139.505 1.00 28.61  ? 9   DA  I "C2'" 1 
ATOM   1484  C "C1'" . DA  A 1 73  ? 84.763  93.511  139.639 1.00 32.93  ? 9   DA  I "C1'" 1 
ATOM   1485  N N9    . DA  A 1 73  ? 83.814  93.145  138.582 1.00 36.72  ? 9   DA  I N9    1 
ATOM   1486  C C8    . DA  A 1 73  ? 84.037  93.066  137.226 1.00 34.78  ? 9   DA  I C8    1 
ATOM   1487  N N7    . DA  A 1 73  ? 82.976  92.733  136.536 1.00 35.30  ? 9   DA  I N7    1 
ATOM   1488  C C5    . DA  A 1 73  ? 81.984  92.580  137.498 1.00 37.29  ? 9   DA  I C5    1 
ATOM   1489  C C6    . DA  A 1 73  ? 80.620  92.236  137.409 1.00 37.84  ? 9   DA  I C6    1 
ATOM   1490  N N6    . DA  A 1 73  ? 79.996  91.981  136.254 1.00 31.38  ? 9   DA  I N6    1 
ATOM   1491  N N1    . DA  A 1 73  ? 79.911  92.160  138.567 1.00 36.33  ? 9   DA  I N1    1 
ATOM   1492  C C2    . DA  A 1 73  ? 80.539  92.410  139.712 1.00 38.34  ? 9   DA  I C2    1 
ATOM   1493  N N3    . DA  A 1 73  ? 81.813  92.748  139.918 1.00 40.28  ? 9   DA  I N3    1 
ATOM   1494  C C4    . DA  A 1 73  ? 82.487  92.821  138.760 1.00 36.72  ? 9   DA  I C4    1 
ATOM   1495  P P     . DA  A 1 74  ? 88.071  92.624  142.098 1.00 34.62  ? 10  DA  I P     1 
ATOM   1496  O OP1   . DA  A 1 74  ? 88.631  93.040  143.411 1.00 38.09  ? 10  DA  I OP1   1 
ATOM   1497  O OP2   . DA  A 1 74  ? 88.996  92.167  141.028 1.00 36.10  ? 10  DA  I OP2   1 
ATOM   1498  O "O5'" . DA  A 1 74  ? 86.991  91.506  142.369 1.00 35.80  ? 10  DA  I "O5'" 1 
ATOM   1499  C "C5'" . DA  A 1 74  ? 85.972  91.765  143.325 1.00 39.28  ? 10  DA  I "C5'" 1 
ATOM   1500  C "C4'" . DA  A 1 74  ? 85.028  90.596  143.414 1.00 42.05  ? 10  DA  I "C4'" 1 
ATOM   1501  O "O4'" . DA  A 1 74  ? 84.185  90.574  142.237 1.00 42.18  ? 10  DA  I "O4'" 1 
ATOM   1502  C "C3'" . DA  A 1 74  ? 85.699  89.221  143.510 1.00 42.36  ? 10  DA  I "C3'" 1 
ATOM   1503  O "O3'" . DA  A 1 74  ? 85.116  88.513  144.603 1.00 51.03  ? 10  DA  I "O3'" 1 
ATOM   1504  C "C2'" . DA  A 1 74  ? 85.395  88.566  142.172 1.00 40.40  ? 10  DA  I "C2'" 1 
ATOM   1505  C "C1'" . DA  A 1 74  ? 84.098  89.244  141.758 1.00 45.37  ? 10  DA  I "C1'" 1 
ATOM   1506  N N9    . DA  A 1 74  ? 83.848  89.312  140.319 1.00 42.18  ? 10  DA  I N9    1 
ATOM   1507  C C8    . DA  A 1 74  ? 84.740  89.559  139.308 1.00 43.88  ? 10  DA  I C8    1 
ATOM   1508  N N7    . DA  A 1 74  ? 84.197  89.572  138.117 1.00 41.78  ? 10  DA  I N7    1 
ATOM   1509  C C5    . DA  A 1 74  ? 82.861  89.307  138.361 1.00 42.82  ? 10  DA  I C5    1 
ATOM   1510  C C6    . DA  A 1 74  ? 81.758  89.186  137.508 1.00 45.49  ? 10  DA  I C6    1 
ATOM   1511  N N6    . DA  A 1 74  ? 81.829  89.323  136.178 1.00 42.74  ? 10  DA  I N6    1 
ATOM   1512  N N1    . DA  A 1 74  ? 80.560  88.915  138.071 1.00 46.86  ? 10  DA  I N1    1 
ATOM   1513  C C2    . DA  A 1 74  ? 80.490  88.780  139.399 1.00 44.05  ? 10  DA  I C2    1 
ATOM   1514  N N3    . DA  A 1 74  ? 81.460  88.873  140.304 1.00 44.20  ? 10  DA  I N3    1 
ATOM   1515  C C4    . DA  A 1 74  ? 82.633  89.140  139.711 1.00 43.24  ? 10  DA  I C4    1 
ATOM   1516  P P     . DC  A 1 75  ? 85.671  87.064  145.034 1.00 51.74  ? 11  DC  I P     1 
ATOM   1517  O OP1   . DC  A 1 75  ? 85.530  86.999  146.513 1.00 58.16  ? 11  DC  I OP1   1 
ATOM   1518  O OP2   . DC  A 1 75  ? 86.956  86.716  144.415 1.00 50.08  ? 11  DC  I OP2   1 
ATOM   1519  O "O5'" . DC  A 1 75  ? 84.565  86.104  144.427 1.00 51.26  ? 11  DC  I "O5'" 1 
ATOM   1520  C "C5'" . DC  A 1 75  ? 83.197  86.400  144.657 1.00 55.65  ? 11  DC  I "C5'" 1 
ATOM   1521  C "C4'" . DC  A 1 75  ? 82.322  85.427  143.911 1.00 57.34  ? 11  DC  I "C4'" 1 
ATOM   1522  O "O4'" . DC  A 1 75  ? 82.090  85.841  142.542 1.00 58.21  ? 11  DC  I "O4'" 1 
ATOM   1523  C "C3'" . DC  A 1 75  ? 82.896  84.017  143.852 1.00 57.98  ? 11  DC  I "C3'" 1 
ATOM   1524  O "O3'" . DC  A 1 75  ? 81.887  83.102  144.237 1.00 61.46  ? 11  DC  I "O3'" 1 
ATOM   1525  C "C2'" . DC  A 1 75  ? 83.242  83.825  142.387 1.00 57.54  ? 11  DC  I "C2'" 1 
ATOM   1526  C "C1'" . DC  A 1 75  ? 82.230  84.719  141.692 1.00 55.35  ? 11  DC  I "C1'" 1 
ATOM   1527  N N1    . DC  A 1 75  ? 82.638  85.194  140.353 1.00 50.90  ? 11  DC  I N1    1 
ATOM   1528  C C2    . DC  A 1 75  ? 81.671  85.260  139.347 1.00 53.84  ? 11  DC  I C2    1 
ATOM   1529  O O2    . DC  A 1 75  ? 80.499  84.971  139.627 1.00 52.34  ? 11  DC  I O2    1 
ATOM   1530  N N3    . DC  A 1 75  ? 82.036  85.635  138.093 1.00 52.74  ? 11  DC  I N3    1 
ATOM   1531  C C4    . DC  A 1 75  ? 83.312  85.934  137.832 1.00 50.64  ? 11  DC  I C4    1 
ATOM   1532  N N4    . DC  A 1 75  ? 83.631  86.263  136.576 1.00 47.59  ? 11  DC  I N4    1 
ATOM   1533  C C5    . DC  A 1 75  ? 84.316  85.903  138.850 1.00 49.51  ? 11  DC  I C5    1 
ATOM   1534  C C6    . DC  A 1 75  ? 83.935  85.536  140.086 1.00 48.85  ? 11  DC  I C6    1 
ATOM   1535  P P     . DA  A 1 76  ? 82.294  81.633  144.708 1.00 56.72  ? 12  DA  I P     1 
ATOM   1536  O OP1   . DA  A 1 76  ? 81.935  81.520  146.151 1.00 62.30  ? 12  DA  I OP1   1 
ATOM   1537  O OP2   . DA  A 1 76  ? 83.665  81.308  144.263 1.00 56.28  ? 12  DA  I OP2   1 
ATOM   1538  O "O5'" . DA  A 1 76  ? 81.280  80.752  143.871 1.00 55.68  ? 12  DA  I "O5'" 1 
ATOM   1539  C "C5'" . DA  A 1 76  ? 79.905  81.080  143.851 1.00 51.58  ? 12  DA  I "C5'" 1 
ATOM   1540  C "C4'" . DA  A 1 76  ? 79.226  80.303  142.756 1.00 55.78  ? 12  DA  I "C4'" 1 
ATOM   1541  O "O4'" . DA  A 1 76  ? 79.562  80.889  141.473 1.00 55.26  ? 12  DA  I "O4'" 1 
ATOM   1542  C "C3'" . DA  A 1 76  ? 79.686  78.848  142.705 1.00 55.93  ? 12  DA  I "C3'" 1 
ATOM   1543  O "O3'" . DA  A 1 76  ? 78.564  77.988  142.526 1.00 58.32  ? 12  DA  I "O3'" 1 
ATOM   1544  C "C2'" . DA  A 1 76  ? 80.642  78.802  141.522 1.00 53.72  ? 12  DA  I "C2'" 1 
ATOM   1545  C "C1'" . DA  A 1 76  ? 80.146  79.921  140.616 1.00 55.72  ? 12  DA  I "C1'" 1 
ATOM   1546  N N9    . DA  A 1 76  ? 81.202  80.594  139.850 1.00 56.08  ? 12  DA  I N9    1 
ATOM   1547  C C8    . DA  A 1 76  ? 82.444  80.962  140.304 1.00 55.29  ? 12  DA  I C8    1 
ATOM   1548  N N7    . DA  A 1 76  ? 83.182  81.562  139.404 1.00 55.02  ? 12  DA  I N7    1 
ATOM   1549  C C5    . DA  A 1 76  ? 82.378  81.584  138.274 1.00 55.62  ? 12  DA  I C5    1 
ATOM   1550  C C6    . DA  A 1 76  ? 82.593  82.077  136.973 1.00 55.40  ? 12  DA  I C6    1 
ATOM   1551  N N6    . DA  A 1 76  ? 83.735  82.647  136.584 1.00 47.65  ? 12  DA  I N6    1 
ATOM   1552  N N1    . DA  A 1 76  ? 81.582  81.954  136.074 1.00 54.50  ? 12  DA  I N1    1 
ATOM   1553  C C2    . DA  A 1 76  ? 80.441  81.368  136.475 1.00 55.92  ? 12  DA  I C2    1 
ATOM   1554  N N3    . DA  A 1 76  ? 80.126  80.857  137.668 1.00 54.63  ? 12  DA  I N3    1 
ATOM   1555  C C4    . DA  A 1 76  ? 81.149  80.996  138.534 1.00 55.64  ? 12  DA  I C4    1 
ATOM   1556  P P     . DT  A 1 77  ? 78.792  76.415  142.356 1.00 57.96  ? 13  DT  I P     1 
ATOM   1557  O OP1   . DT  A 1 77  ? 77.602  75.721  142.903 1.00 63.98  ? 13  DT  I OP1   1 
ATOM   1558  O OP2   . DT  A 1 77  ? 80.141  76.049  142.829 1.00 55.70  ? 13  DT  I OP2   1 
ATOM   1559  O "O5'" . DT  A 1 77  ? 78.765  76.254  140.780 1.00 58.80  ? 13  DT  I "O5'" 1 
ATOM   1560  C "C5'" . DT  A 1 77  ? 77.754  76.898  140.028 1.00 52.00  ? 13  DT  I "C5'" 1 
ATOM   1561  C "C4'" . DT  A 1 77  ? 77.948  76.609  138.565 1.00 53.39  ? 13  DT  I "C4'" 1 
ATOM   1562  O "O4'" . DT  A 1 77  ? 78.990  77.456  138.013 1.00 52.20  ? 13  DT  I "O4'" 1 
ATOM   1563  C "C3'" . DT  A 1 77  ? 78.352  75.163  138.270 1.00 51.02  ? 13  DT  I "C3'" 1 
ATOM   1564  O "O3'" . DT  A 1 77  ? 77.491  74.644  137.248 1.00 52.95  ? 13  DT  I "O3'" 1 
ATOM   1565  C "C2'" . DT  A 1 77  ? 79.802  75.281  137.812 1.00 51.01  ? 13  DT  I "C2'" 1 
ATOM   1566  C "C1'" . DT  A 1 77  ? 79.843  76.673  137.200 1.00 51.89  ? 13  DT  I "C1'" 1 
ATOM   1567  N N1    . DT  A 1 77  ? 81.166  77.358  137.115 1.00 52.18  ? 13  DT  I N1    1 
ATOM   1568  C C2    . DT  A 1 77  ? 81.448  78.070  135.951 1.00 51.26  ? 13  DT  I C2    1 
ATOM   1569  O O2    . DT  A 1 77  ? 80.676  78.168  135.022 1.00 46.60  ? 13  DT  I O2    1 
ATOM   1570  N N3    . DT  A 1 77  ? 82.677  78.673  135.926 1.00 51.79  ? 13  DT  I N3    1 
ATOM   1571  C C4    . DT  A 1 77  ? 83.635  78.658  136.919 1.00 53.05  ? 13  DT  I C4    1 
ATOM   1572  O O4    . DT  A 1 77  ? 84.695  79.263  136.750 1.00 51.56  ? 13  DT  I O4    1 
ATOM   1573  C C5    . DT  A 1 77  ? 83.282  77.904  138.111 1.00 51.25  ? 13  DT  I C5    1 
ATOM   1574  C C7    . DT  A 1 77  ? 84.268  77.832  139.235 1.00 45.55  ? 13  DT  I C7    1 
ATOM   1575  C C6    . DT  A 1 77  ? 82.081  77.300  138.147 1.00 50.83  ? 13  DT  I C6    1 
ATOM   1576  P P     . DG  A 1 78  ? 77.497  73.073  136.906 1.00 51.30  ? 14  DG  I P     1 
ATOM   1577  O OP1   . DG  A 1 78  ? 76.110  72.678  136.592 1.00 50.03  ? 14  DG  I OP1   1 
ATOM   1578  O OP2   . DG  A 1 78  ? 78.266  72.353  137.938 1.00 52.29  ? 14  DG  I OP2   1 
ATOM   1579  O "O5'" . DG  A 1 78  ? 78.354  72.980  135.567 1.00 49.12  ? 14  DG  I "O5'" 1 
ATOM   1580  C "C5'" . DG  A 1 78  ? 77.895  73.589  134.364 1.00 48.20  ? 14  DG  I "C5'" 1 
ATOM   1581  C "C4'" . DG  A 1 78  ? 78.967  73.511  133.303 1.00 46.51  ? 14  DG  I "C4'" 1 
ATOM   1582  O "O4'" . DG  A 1 78  ? 80.053  74.393  133.665 1.00 46.11  ? 14  DG  I "O4'" 1 
ATOM   1583  C "C3'" . DG  A 1 78  ? 79.590  72.122  133.133 1.00 47.84  ? 14  DG  I "C3'" 1 
ATOM   1584  O "O3'" . DG  A 1 78  ? 79.862  71.872  131.753 1.00 49.59  ? 14  DG  I "O3'" 1 
ATOM   1585  C "C2'" . DG  A 1 78  ? 80.915  72.249  133.858 1.00 49.57  ? 14  DG  I "C2'" 1 
ATOM   1586  C "C1'" . DG  A 1 78  ? 81.262  73.682  133.525 1.00 49.21  ? 14  DG  I "C1'" 1 
ATOM   1587  N N9    . DG  A 1 78  ? 82.268  74.310  134.367 1.00 53.87  ? 14  DG  I N9    1 
ATOM   1588  C C8    . DG  A 1 78  ? 82.447  74.167  135.722 1.00 54.93  ? 14  DG  I C8    1 
ATOM   1589  N N7    . DG  A 1 78  ? 83.476  74.832  136.175 1.00 55.98  ? 14  DG  I N7    1 
ATOM   1590  C C5    . DG  A 1 78  ? 84.000  75.460  135.052 1.00 55.79  ? 14  DG  I C5    1 
ATOM   1591  C C6    . DG  A 1 78  ? 85.130  76.301  134.915 1.00 56.19  ? 14  DG  I C6    1 
ATOM   1592  O O6    . DG  A 1 78  ? 85.937  76.649  135.783 1.00 54.94  ? 14  DG  I O6    1 
ATOM   1593  N N1    . DG  A 1 78  ? 85.291  76.737  133.597 1.00 55.90  ? 14  DG  I N1    1 
ATOM   1594  C C2    . DG  A 1 78  ? 84.478  76.389  132.543 1.00 56.86  ? 14  DG  I C2    1 
ATOM   1595  N N2    . DG  A 1 78  ? 84.784  76.927  131.345 1.00 50.09  ? 14  DG  I N2    1 
ATOM   1596  N N3    . DG  A 1 78  ? 83.435  75.575  132.658 1.00 53.53  ? 14  DG  I N3    1 
ATOM   1597  C C4    . DG  A 1 78  ? 83.256  75.159  133.931 1.00 55.84  ? 14  DG  I C4    1 
ATOM   1598  P P     . DC  A 1 79  ? 78.653  71.515  130.764 1.00 46.80  ? 15  DC  I P     1 
ATOM   1599  O OP1   . DC  A 1 79  ? 77.433  72.198  131.267 1.00 39.84  ? 15  DC  I OP1   1 
ATOM   1600  O OP2   . DC  A 1 79  ? 78.637  70.062  130.505 1.00 49.68  ? 15  DC  I OP2   1 
ATOM   1601  O "O5'" . DC  A 1 79  ? 79.058  72.244  129.415 1.00 50.66  ? 15  DC  I "O5'" 1 
ATOM   1602  C "C5'" . DC  A 1 79  ? 78.602  73.561  129.165 1.00 47.12  ? 15  DC  I "C5'" 1 
ATOM   1603  C "C4'" . DC  A 1 79  ? 79.637  74.318  128.377 1.00 51.52  ? 15  DC  I "C4'" 1 
ATOM   1604  O "O4'" . DC  A 1 79  ? 80.855  74.426  129.143 1.00 50.15  ? 15  DC  I "O4'" 1 
ATOM   1605  C "C3'" . DC  A 1 79  ? 80.034  73.662  127.064 1.00 50.15  ? 15  DC  I "C3'" 1 
ATOM   1606  O "O3'" . DC  A 1 79  ? 80.288  74.732  126.166 1.00 52.40  ? 15  DC  I "O3'" 1 
ATOM   1607  C "C2'" . DC  A 1 79  ? 81.313  72.922  127.422 1.00 52.32  ? 15  DC  I "C2'" 1 
ATOM   1608  C "C1'" . DC  A 1 79  ? 81.932  73.884  128.415 1.00 52.11  ? 15  DC  I "C1'" 1 
ATOM   1609  N N1    . DC  A 1 79  ? 82.906  73.378  129.391 1.00 54.25  ? 15  DC  I N1    1 
ATOM   1610  C C2    . DC  A 1 79  ? 84.069  74.125  129.602 1.00 58.86  ? 15  DC  I C2    1 
ATOM   1611  O O2    . DC  A 1 79  ? 84.270  75.130  128.900 1.00 62.17  ? 15  DC  I O2    1 
ATOM   1612  N N3    . DC  A 1 79  ? 84.942  73.743  130.559 1.00 58.03  ? 15  DC  I N3    1 
ATOM   1613  C C4    . DC  A 1 79  ? 84.695  72.655  131.287 1.00 61.14  ? 15  DC  I C4    1 
ATOM   1614  N N4    . DC  A 1 79  ? 85.563  72.344  132.254 1.00 61.86  ? 15  DC  I N4    1 
ATOM   1615  C C5    . DC  A 1 79  ? 83.540  71.844  131.065 1.00 57.78  ? 15  DC  I C5    1 
ATOM   1616  C C6    . DC  A 1 79  ? 82.681  72.237  130.108 1.00 57.71  ? 15  DC  I C6    1 
ATOM   1617  P P     . DC  A 1 80  ? 80.178  74.503  124.597 1.00 52.25  ? 16  DC  I P     1 
ATOM   1618  O OP1   . DC  A 1 80  ? 79.395  75.659  124.070 1.00 50.24  ? 16  DC  I OP1   1 
ATOM   1619  O OP2   . DC  A 1 80  ? 79.761  73.114  124.289 1.00 48.75  ? 16  DC  I OP2   1 
ATOM   1620  O "O5'" . DC  A 1 80  ? 81.669  74.656  124.093 1.00 49.84  ? 16  DC  I "O5'" 1 
ATOM   1621  C "C5'" . DC  A 1 80  ? 82.388  75.848  124.337 1.00 45.24  ? 16  DC  I "C5'" 1 
ATOM   1622  C "C4'" . DC  A 1 80  ? 83.860  75.576  124.181 1.00 42.30  ? 16  DC  I "C4'" 1 
ATOM   1623  O "O4'" . DC  A 1 80  ? 84.316  74.721  125.250 1.00 40.10  ? 16  DC  I "O4'" 1 
ATOM   1624  C "C3'" . DC  A 1 80  ? 84.226  74.851  122.882 1.00 42.70  ? 16  DC  I "C3'" 1 
ATOM   1625  O "O3'" . DC  A 1 80  ? 85.481  75.347  122.466 1.00 45.62  ? 16  DC  I "O3'" 1 
ATOM   1626  C "C2'" . DC  A 1 80  ? 84.468  73.425  123.344 1.00 45.36  ? 16  DC  I "C2'" 1 
ATOM   1627  C "C1'" . DC  A 1 80  ? 85.117  73.700  124.681 1.00 42.72  ? 16  DC  I "C1'" 1 
ATOM   1628  N N1    . DC  A 1 80  ? 85.199  72.576  125.629 1.00 46.01  ? 16  DC  I N1    1 
ATOM   1629  C C2    . DC  A 1 80  ? 86.276  72.537  126.540 1.00 48.30  ? 16  DC  I C2    1 
ATOM   1630  O O2    . DC  A 1 80  ? 87.140  73.432  126.506 1.00 40.79  ? 16  DC  I O2    1 
ATOM   1631  N N3    . DC  A 1 80  ? 86.344  71.518  127.429 1.00 49.23  ? 16  DC  I N3    1 
ATOM   1632  C C4    . DC  A 1 80  ? 85.405  70.564  127.435 1.00 50.66  ? 16  DC  I C4    1 
ATOM   1633  N N4    . DC  A 1 80  ? 85.508  69.591  128.349 1.00 50.60  ? 16  DC  I N4    1 
ATOM   1634  C C5    . DC  A 1 80  ? 84.317  70.570  126.510 1.00 46.48  ? 16  DC  I C5    1 
ATOM   1635  C C6    . DC  A 1 80  ? 84.253  71.585  125.636 1.00 49.49  ? 16  DC  I C6    1 
ATOM   1636  P P     . DT  A 1 81  ? 85.667  75.958  121.002 1.00 43.27  ? 17  DT  I P     1 
ATOM   1637  O OP1   . DT  A 1 81  ? 84.732  77.074  120.852 1.00 39.77  ? 17  DT  I OP1   1 
ATOM   1638  O OP2   . DT  A 1 81  ? 85.629  74.800  120.081 1.00 41.55  ? 17  DT  I OP2   1 
ATOM   1639  O "O5'" . DT  A 1 81  ? 87.132  76.545  121.127 1.00 36.92  ? 17  DT  I "O5'" 1 
ATOM   1640  C "C5'" . DT  A 1 81  ? 87.415  77.413  122.201 1.00 33.85  ? 17  DT  I "C5'" 1 
ATOM   1641  C "C4'" . DT  A 1 81  ? 88.670  76.979  122.908 1.00 33.93  ? 17  DT  I "C4'" 1 
ATOM   1642  O "O4'" . DT  A 1 81  ? 88.467  75.740  123.627 1.00 33.95  ? 17  DT  I "O4'" 1 
ATOM   1643  C "C3'" . DT  A 1 81  ? 89.856  76.760  121.972 1.00 35.86  ? 17  DT  I "C3'" 1 
ATOM   1644  O "O3'" . DT  A 1 81  ? 90.934  77.568  122.406 1.00 27.44  ? 17  DT  I "O3'" 1 
ATOM   1645  C "C2'" . DT  A 1 81  ? 90.173  75.274  122.088 1.00 34.00  ? 17  DT  I "C2'" 1 
ATOM   1646  C "C1'" . DT  A 1 81  ? 89.585  74.886  123.440 1.00 36.71  ? 17  DT  I "C1'" 1 
ATOM   1647  N N1    . DT  A 1 81  ? 89.095  73.487  123.555 1.00 43.28  ? 17  DT  I N1    1 
ATOM   1648  C C2    . DT  A 1 81  ? 89.553  72.713  124.611 1.00 48.65  ? 17  DT  I C2    1 
ATOM   1649  O O2    . DT  A 1 81  ? 90.390  73.101  125.413 1.00 46.98  ? 17  DT  I O2    1 
ATOM   1650  N N3    . DT  A 1 81  ? 88.987  71.460  124.691 1.00 49.73  ? 17  DT  I N3    1 
ATOM   1651  C C4    . DT  A 1 81  ? 88.039  70.914  123.840 1.00 50.51  ? 17  DT  I C4    1 
ATOM   1652  O O4    . DT  A 1 81  ? 87.588  69.806  124.060 1.00 47.38  ? 17  DT  I O4    1 
ATOM   1653  C C5    . DT  A 1 81  ? 87.642  71.756  122.735 1.00 49.00  ? 17  DT  I C5    1 
ATOM   1654  C C7    . DT  A 1 81  ? 86.651  71.224  121.743 1.00 44.84  ? 17  DT  I C7    1 
ATOM   1655  C C6    . DT  A 1 81  ? 88.184  72.986  122.649 1.00 46.33  ? 17  DT  I C6    1 
ATOM   1656  P P     . DT  A 1 82  ? 92.265  77.605  121.552 1.00 32.17  ? 18  DT  I P     1 
ATOM   1657  O OP1   . DT  A 1 82  ? 92.846  78.950  121.740 1.00 32.41  ? 18  DT  I OP1   1 
ATOM   1658  O OP2   . DT  A 1 82  ? 91.986  77.109  120.199 1.00 31.30  ? 18  DT  I OP2   1 
ATOM   1659  O "O5'" . DT  A 1 82  ? 93.218  76.560  122.269 1.00 35.18  ? 18  DT  I "O5'" 1 
ATOM   1660  C "C5'" . DT  A 1 82  ? 93.454  76.665  123.674 1.00 37.01  ? 18  DT  I "C5'" 1 
ATOM   1661  C "C4'" . DT  A 1 82  ? 94.153  75.429  124.194 1.00 38.71  ? 18  DT  I "C4'" 1 
ATOM   1662  O "O4'" . DT  A 1 82  ? 93.258  74.289  124.197 1.00 38.38  ? 18  DT  I "O4'" 1 
ATOM   1663  C "C3'" . DT  A 1 82  ? 95.386  75.002  123.401 1.00 43.67  ? 18  DT  I "C3'" 1 
ATOM   1664  O "O3'" . DT  A 1 82  ? 96.496  74.887  124.287 1.00 47.11  ? 18  DT  I "O3'" 1 
ATOM   1665  C "C2'" . DT  A 1 82  ? 95.008  73.648  122.805 1.00 43.62  ? 18  DT  I "C2'" 1 
ATOM   1666  C "C1'" . DT  A 1 82  ? 93.960  73.133  123.770 1.00 40.85  ? 18  DT  I "C1'" 1 
ATOM   1667  N N1    . DT  A 1 82  ? 92.961  72.164  123.238 1.00 43.36  ? 18  DT  I N1    1 
ATOM   1668  C C2    . DT  A 1 82  ? 92.723  71.015  123.987 1.00 46.84  ? 18  DT  I C2    1 
ATOM   1669  O O2    . DT  A 1 82  ? 93.334  70.741  125.007 1.00 44.50  ? 18  DT  I O2    1 
ATOM   1670  N N3    . DT  A 1 82  ? 91.735  70.196  123.491 1.00 42.69  ? 18  DT  I N3    1 
ATOM   1671  C C4    . DT  A 1 82  ? 90.982  70.395  122.353 1.00 44.76  ? 18  DT  I C4    1 
ATOM   1672  O O4    . DT  A 1 82  ? 90.105  69.596  122.059 1.00 42.62  ? 18  DT  I O4    1 
ATOM   1673  C C5    . DT  A 1 82  ? 91.304  71.592  121.592 1.00 42.87  ? 18  DT  I C5    1 
ATOM   1674  C C7    . DT  A 1 82  ? 90.543  71.861  120.331 1.00 34.23  ? 18  DT  I C7    1 
ATOM   1675  C C6    . DT  A 1 82  ? 92.269  72.403  122.064 1.00 41.80  ? 18  DT  I C6    1 
ATOM   1676  P P     . DT  A 1 83  ? 97.964  74.666  123.694 1.00 49.49  ? 19  DT  I P     1 
ATOM   1677  O OP1   . DT  A 1 83  ? 98.882  75.406  124.591 1.00 52.36  ? 19  DT  I OP1   1 
ATOM   1678  O OP2   . DT  A 1 83  ? 98.011  74.904  122.237 1.00 49.61  ? 19  DT  I OP2   1 
ATOM   1679  O "O5'" . DT  A 1 83  ? 98.180  73.112  123.924 1.00 52.94  ? 19  DT  I "O5'" 1 
ATOM   1680  C "C5'" . DT  A 1 83  ? 97.922  72.556  125.204 1.00 55.03  ? 19  DT  I "C5'" 1 
ATOM   1681  C "C4'" . DT  A 1 83  ? 98.065  71.057  125.161 1.00 56.30  ? 19  DT  I "C4'" 1 
ATOM   1682  O "O4'" . DT  A 1 83  ? 96.868  70.426  124.653 1.00 55.49  ? 19  DT  I "O4'" 1 
ATOM   1683  C "C3'" . DT  A 1 83  ? 99.216  70.569  124.289 1.00 58.41  ? 19  DT  I "C3'" 1 
ATOM   1684  O "O3'" . DT  A 1 83  ? 99.985  69.644  125.038 1.00 62.43  ? 19  DT  I "O3'" 1 
ATOM   1685  C "C2'" . DT  A 1 83  ? 98.525  69.896  123.111 1.00 55.66  ? 19  DT  I "C2'" 1 
ATOM   1686  C "C1'" . DT  A 1 83  ? 97.226  69.424  123.726 1.00 53.90  ? 19  DT  I "C1'" 1 
ATOM   1687  N N1    . DT  A 1 83  ? 96.091  69.244  122.804 1.00 53.02  ? 19  DT  I N1    1 
ATOM   1688  C C2    . DT  A 1 83  ? 95.276  68.162  123.024 1.00 53.39  ? 19  DT  I C2    1 
ATOM   1689  O O2    . DT  A 1 83  ? 95.487  67.342  123.898 1.00 56.85  ? 19  DT  I O2    1 
ATOM   1690  N N3    . DT  A 1 83  ? 94.200  68.072  122.175 1.00 51.76  ? 19  DT  I N3    1 
ATOM   1691  C C4    . DT  A 1 83  ? 93.873  68.931  121.146 1.00 50.15  ? 19  DT  I C4    1 
ATOM   1692  O O4    . DT  A 1 83  ? 92.854  68.741  120.488 1.00 48.41  ? 19  DT  I O4    1 
ATOM   1693  C C5    . DT  A 1 83  ? 94.794  70.024  120.944 1.00 48.44  ? 19  DT  I C5    1 
ATOM   1694  C C7    . DT  A 1 83  ? 94.539  70.983  119.826 1.00 47.19  ? 19  DT  I C7    1 
ATOM   1695  C C6    . DT  A 1 83  ? 95.842  70.127  121.774 1.00 51.15  ? 19  DT  I C6    1 
ATOM   1696  P P     . DT  A 1 84  ? 101.414 69.181  124.495 1.00 65.21  ? 20  DT  I P     1 
ATOM   1697  O OP1   . DT  A 1 84  ? 102.337 69.199  125.656 1.00 65.04  ? 20  DT  I OP1   1 
ATOM   1698  O OP2   . DT  A 1 84  ? 101.766 69.940  123.267 1.00 65.25  ? 20  DT  I OP2   1 
ATOM   1699  O "O5'" . DT  A 1 84  ? 101.120 67.679  124.079 1.00 68.59  ? 20  DT  I "O5'" 1 
ATOM   1700  C "C5'" . DT  A 1 84  ? 100.443 66.815  124.984 1.00 73.48  ? 20  DT  I "C5'" 1 
ATOM   1701  C "C4'" . DT  A 1 84  ? 100.150 65.496  124.316 1.00 76.56  ? 20  DT  I "C4'" 1 
ATOM   1702  O "O4'" . DT  A 1 84  ? 98.907  65.555  123.576 1.00 75.57  ? 20  DT  I "O4'" 1 
ATOM   1703  C "C3'" . DT  A 1 84  ? 101.228 65.073  123.323 1.00 79.43  ? 20  DT  I "C3'" 1 
ATOM   1704  O "O3'" . DT  A 1 84  ? 101.523 63.691  123.502 1.00 85.64  ? 20  DT  I "O3'" 1 
ATOM   1705  C "C2'" . DT  A 1 84  ? 100.585 65.334  121.969 1.00 78.05  ? 20  DT  I "C2'" 1 
ATOM   1706  C "C1'" . DT  A 1 84  ? 99.119  65.078  122.259 1.00 75.14  ? 20  DT  I "C1'" 1 
ATOM   1707  N N1    . DT  A 1 84  ? 98.158  65.757  121.364 1.00 73.89  ? 20  DT  I N1    1 
ATOM   1708  C C2    . DT  A 1 84  ? 96.957  65.128  121.122 1.00 74.26  ? 20  DT  I C2    1 
ATOM   1709  O O2    . DT  A 1 84  ? 96.644  64.069  121.640 1.00 76.40  ? 20  DT  I O2    1 
ATOM   1710  N N3    . DT  A 1 84  ? 96.128  65.790  120.255 1.00 73.00  ? 20  DT  I N3    1 
ATOM   1711  C C4    . DT  A 1 84  ? 96.362  67.000  119.634 1.00 72.28  ? 20  DT  I C4    1 
ATOM   1712  O O4    . DT  A 1 84  ? 95.521  67.467  118.869 1.00 70.79  ? 20  DT  I O4    1 
ATOM   1713  C C5    . DT  A 1 84  ? 97.627  67.621  119.955 1.00 73.08  ? 20  DT  I C5    1 
ATOM   1714  C C7    . DT  A 1 84  ? 97.957  68.949  119.350 1.00 72.25  ? 20  DT  I C7    1 
ATOM   1715  C C6    . DT  A 1 84  ? 98.454  66.975  120.790 1.00 73.57  ? 20  DT  I C6    1 
ATOM   1716  P P     . DG  A 1 85  ? 102.740 63.025  122.696 1.00 90.93  ? 21  DG  I P     1 
ATOM   1717  O OP1   . DG  A 1 85  ? 103.594 62.289  123.665 1.00 90.09  ? 21  DG  I OP1   1 
ATOM   1718  O OP2   . DG  A 1 85  ? 103.346 64.070  121.828 1.00 89.95  ? 21  DG  I OP2   1 
ATOM   1719  O "O5'" . DG  A 1 85  ? 101.995 61.977  121.761 1.00 90.35  ? 21  DG  I "O5'" 1 
ATOM   1720  C "C5'" . DG  A 1 85  ? 100.690 62.262  121.270 1.00 92.23  ? 21  DG  I "C5'" 1 
ATOM   1721  C "C4'" . DG  A 1 85  ? 100.177 61.103  120.455 1.00 93.07  ? 21  DG  I "C4'" 1 
ATOM   1722  O "O4'" . DG  A 1 85  ? 98.874  61.445  119.925 1.00 92.32  ? 21  DG  I "O4'" 1 
ATOM   1723  C "C3'" . DG  A 1 85  ? 101.063 60.792  119.253 1.00 94.18  ? 21  DG  I "C3'" 1 
ATOM   1724  O "O3'" . DG  A 1 85  ? 101.172 59.381  119.070 1.00 97.30  ? 21  DG  I "O3'" 1 
ATOM   1725  C "C2'" . DG  A 1 85  ? 100.351 61.464  118.094 1.00 92.47  ? 21  DG  I "C2'" 1 
ATOM   1726  C "C1'" . DG  A 1 85  ? 98.888  61.431  118.505 1.00 90.77  ? 21  DG  I "C1'" 1 
ATOM   1727  N N9    . DG  A 1 85  ? 98.153  62.601  118.032 1.00 87.73  ? 21  DG  I N9    1 
ATOM   1728  C C8    . DG  A 1 85  ? 98.607  63.899  118.004 1.00 86.58  ? 21  DG  I C8    1 
ATOM   1729  N N7    . DG  A 1 85  ? 97.750  64.730  117.479 1.00 84.34  ? 21  DG  I N7    1 
ATOM   1730  C C5    . DG  A 1 85  ? 96.658  63.940  117.154 1.00 84.26  ? 21  DG  I C5    1 
ATOM   1731  C C6    . DG  A 1 85  ? 95.429  64.286  116.545 1.00 83.42  ? 21  DG  I C6    1 
ATOM   1732  O O6    . DG  A 1 85  ? 95.051  65.393  116.151 1.00 82.84  ? 21  DG  I O6    1 
ATOM   1733  N N1    . DG  A 1 85  ? 94.601  63.179  116.402 1.00 83.11  ? 21  DG  I N1    1 
ATOM   1734  C C2    . DG  A 1 85  ? 94.917  61.901  116.790 1.00 84.11  ? 21  DG  I C2    1 
ATOM   1735  N N2    . DG  A 1 85  ? 93.978  60.967  116.570 1.00 84.03  ? 21  DG  I N2    1 
ATOM   1736  N N3    . DG  A 1 85  ? 96.067  61.564  117.352 1.00 84.08  ? 21  DG  I N3    1 
ATOM   1737  C C4    . DG  A 1 85  ? 96.885  62.625  117.503 1.00 85.13  ? 21  DG  I C4    1 
ATOM   1738  P P     . DA  A 1 86  ? 101.864 58.805  117.742 1.00 99.52  ? 22  DA  I P     1 
ATOM   1739  O OP1   . DA  A 1 86  ? 102.631 57.583  118.105 1.00 98.93  ? 22  DA  I OP1   1 
ATOM   1740  O OP2   . DA  A 1 86  ? 102.556 59.922  117.047 1.00 99.86  ? 22  DA  I OP2   1 
ATOM   1741  O "O5'" . DA  A 1 86  ? 100.608 58.389  116.865 1.00 97.04  ? 22  DA  I "O5'" 1 
ATOM   1742  C "C5'" . DA  A 1 86  ? 99.504  57.719  117.465 1.00 96.60  ? 22  DA  I "C5'" 1 
ATOM   1743  C "C4'" . DA  A 1 86  ? 98.487  57.376  116.409 1.00 96.67  ? 22  DA  I "C4'" 1 
ATOM   1744  O "O4'" . DA  A 1 86  ? 97.670  58.534  116.108 1.00 96.86  ? 22  DA  I "O4'" 1 
ATOM   1745  C "C3'" . DA  A 1 86  ? 99.154  56.970  115.099 1.00 96.67  ? 22  DA  I "C3'" 1 
ATOM   1746  O "O3'" . DA  A 1 86  ? 98.476  55.876  114.496 1.00 96.98  ? 22  DA  I "O3'" 1 
ATOM   1747  C "C2'" . DA  A 1 86  ? 99.049  58.217  114.241 1.00 95.82  ? 22  DA  I "C2'" 1 
ATOM   1748  C "C1'" . DA  A 1 86  ? 97.757  58.847  114.728 1.00 94.81  ? 22  DA  I "C1'" 1 
ATOM   1749  N N9    . DA  A 1 86  ? 97.731  60.304  114.593 1.00 93.60  ? 22  DA  I N9    1 
ATOM   1750  C C8    . DA  A 1 86  ? 98.686  61.203  114.999 1.00 92.44  ? 22  DA  I C8    1 
ATOM   1751  N N7    . DA  A 1 86  ? 98.392  62.449  114.720 1.00 90.35  ? 22  DA  I N7    1 
ATOM   1752  C C5    . DA  A 1 86  ? 97.159  62.365  114.091 1.00 91.11  ? 22  DA  I C5    1 
ATOM   1753  C C6    . DA  A 1 86  ? 96.309  63.340  113.547 1.00 90.82  ? 22  DA  I C6    1 
ATOM   1754  N N6    . DA  A 1 86  ? 96.591  64.646  113.546 1.00 89.50  ? 22  DA  I N6    1 
ATOM   1755  N N1    . DA  A 1 86  ? 95.148  62.926  112.995 1.00 91.30  ? 22  DA  I N1    1 
ATOM   1756  C C2    . DA  A 1 86  ? 94.872  61.615  112.994 1.00 92.12  ? 22  DA  I C2    1 
ATOM   1757  N N3    . DA  A 1 86  ? 95.590  60.602  113.471 1.00 92.25  ? 22  DA  I N3    1 
ATOM   1758  C C4    . DA  A 1 86  ? 96.737  61.051  114.011 1.00 92.01  ? 22  DA  I C4    1 
ATOM   1759  P P     . DT  A 1 87  ? 99.041  55.270  113.127 1.00 98.08  ? 23  DT  I P     1 
ATOM   1760  O OP1   . DT  A 1 87  ? 98.928  53.789  113.172 1.00 98.83  ? 23  DT  I OP1   1 
ATOM   1761  O OP2   . DT  A 1 87  ? 100.362 55.899  112.872 1.00 97.56  ? 23  DT  I OP2   1 
ATOM   1762  O "O5'" . DT  A 1 87  ? 98.027  55.836  112.043 1.00 95.79  ? 23  DT  I "O5'" 1 
ATOM   1763  C "C5'" . DT  A 1 87  ? 96.624  55.667  112.202 1.00 92.79  ? 23  DT  I "C5'" 1 
ATOM   1764  C "C4'" . DT  A 1 87  ? 95.914  56.205  110.986 1.00 92.08  ? 23  DT  I "C4'" 1 
ATOM   1765  O "O4'" . DT  A 1 87  ? 95.808  57.652  111.053 1.00 89.60  ? 23  DT  I "O4'" 1 
ATOM   1766  C "C3'" . DT  A 1 87  ? 96.670  55.890  109.696 1.00 91.90  ? 23  DT  I "C3'" 1 
ATOM   1767  O "O3'" . DT  A 1 87  ? 95.764  55.540  108.661 1.00 93.01  ? 23  DT  I "O3'" 1 
ATOM   1768  C "C2'" . DT  A 1 87  ? 97.351  57.202  109.356 1.00 90.25  ? 23  DT  I "C2'" 1 
ATOM   1769  C "C1'" . DT  A 1 87  ? 96.338  58.212  109.861 1.00 88.06  ? 23  DT  I "C1'" 1 
ATOM   1770  N N1    . DT  A 1 87  ? 96.909  59.538  110.177 1.00 85.42  ? 23  DT  I N1    1 
ATOM   1771  C C2    . DT  A 1 87  ? 96.216  60.650  109.760 1.00 83.27  ? 23  DT  I C2    1 
ATOM   1772  O O2    . DT  A 1 87  ? 95.140  60.584  109.191 1.00 84.69  ? 23  DT  I O2    1 
ATOM   1773  N N3    . DT  A 1 87  ? 96.829  61.844  110.035 1.00 80.97  ? 23  DT  I N3    1 
ATOM   1774  C C4    . DT  A 1 87  ? 98.036  62.033  110.677 1.00 80.97  ? 23  DT  I C4    1 
ATOM   1775  O O4    . DT  A 1 87  ? 98.477  63.170  110.832 1.00 77.51  ? 23  DT  I O4    1 
ATOM   1776  C C5    . DT  A 1 87  ? 98.696  60.823  111.116 1.00 81.09  ? 23  DT  I C5    1 
ATOM   1777  C C7    . DT  A 1 87  ? 99.998  60.929  111.843 1.00 80.22  ? 23  DT  I C7    1 
ATOM   1778  C C6    . DT  A 1 87  ? 98.105  59.654  110.849 1.00 82.76  ? 23  DT  I C6    1 
ATOM   1779  P P     . DG  A 1 88  ? 96.308  54.787  107.359 1.00 92.78  ? 24  DG  I P     1 
ATOM   1780  O OP1   . DG  A 1 88  ? 96.202  53.329  107.602 1.00 95.53  ? 24  DG  I OP1   1 
ATOM   1781  O OP2   . DG  A 1 88  ? 97.618  55.379  106.990 1.00 91.74  ? 24  DG  I OP2   1 
ATOM   1782  O "O5'" . DG  A 1 88  ? 95.240  55.189  106.255 1.00 91.17  ? 24  DG  I "O5'" 1 
ATOM   1783  C "C5'" . DG  A 1 88  ? 93.878  55.370  106.614 1.00 88.41  ? 24  DG  I "C5'" 1 
ATOM   1784  C "C4'" . DG  A 1 88  ? 93.295  56.527  105.842 1.00 86.14  ? 24  DG  I "C4'" 1 
ATOM   1785  O "O4'" . DG  A 1 88  ? 93.899  57.772  106.278 1.00 85.91  ? 24  DG  I "O4'" 1 
ATOM   1786  C "C3'" . DG  A 1 88  ? 93.545  56.436  104.341 1.00 84.12  ? 24  DG  I "C3'" 1 
ATOM   1787  O "O3'" . DG  A 1 88  ? 92.383  56.873  103.639 1.00 83.39  ? 24  DG  I "O3'" 1 
ATOM   1788  C "C2'" . DG  A 1 88  ? 94.720  57.372  104.118 1.00 84.47  ? 24  DG  I "C2'" 1 
ATOM   1789  C "C1'" . DG  A 1 88  ? 94.493  58.440  105.174 1.00 83.15  ? 24  DG  I "C1'" 1 
ATOM   1790  N N9    . DG  A 1 88  ? 95.707  59.097  105.658 1.00 80.78  ? 24  DG  I N9    1 
ATOM   1791  C C8    . DG  A 1 88  ? 96.881  58.494  106.036 1.00 79.97  ? 24  DG  I C8    1 
ATOM   1792  N N7    . DG  A 1 88  ? 97.779  59.341  106.461 1.00 77.97  ? 24  DG  I N7    1 
ATOM   1793  C C5    . DG  A 1 88  ? 97.163  60.580  106.351 1.00 77.48  ? 24  DG  I C5    1 
ATOM   1794  C C6    . DG  A 1 88  ? 97.643  61.880  106.673 1.00 75.59  ? 24  DG  I C6    1 
ATOM   1795  O O6    . DG  A 1 88  ? 98.735  62.204  107.151 1.00 72.18  ? 24  DG  I O6    1 
ATOM   1796  N N1    . DG  A 1 88  ? 96.696  62.858  106.390 1.00 73.14  ? 24  DG  I N1    1 
ATOM   1797  C C2    . DG  A 1 88  ? 95.447  62.623  105.876 1.00 76.02  ? 24  DG  I C2    1 
ATOM   1798  N N2    . DG  A 1 88  ? 94.679  63.705  105.670 1.00 71.59  ? 24  DG  I N2    1 
ATOM   1799  N N3    . DG  A 1 88  ? 94.983  61.415  105.582 1.00 76.91  ? 24  DG  I N3    1 
ATOM   1800  C C4    . DG  A 1 88  ? 95.889  60.449  105.843 1.00 78.47  ? 24  DG  I C4    1 
ATOM   1801  P P     . DG  A 1 89  ? 92.299  56.672  102.055 1.00 82.30  ? 25  DG  I P     1 
ATOM   1802  O OP1   . DG  A 1 89  ? 90.876  56.500  101.675 1.00 81.05  ? 25  DG  I OP1   1 
ATOM   1803  O OP2   . DG  A 1 89  ? 93.300  55.646  101.677 1.00 82.15  ? 25  DG  I OP2   1 
ATOM   1804  O "O5'" . DG  A 1 89  ? 92.824  58.055  101.480 1.00 81.67  ? 25  DG  I "O5'" 1 
ATOM   1805  C "C5'" . DG  A 1 89  ? 92.135  59.260  101.759 1.00 77.70  ? 25  DG  I "C5'" 1 
ATOM   1806  C "C4'" . DG  A 1 89  ? 92.905  60.429  101.199 1.00 75.32  ? 25  DG  I "C4'" 1 
ATOM   1807  O "O4'" . DG  A 1 89  ? 94.053  60.727  102.030 1.00 74.67  ? 25  DG  I "O4'" 1 
ATOM   1808  C "C3'" . DG  A 1 89  ? 93.454  60.186  99.791  1.00 74.21  ? 25  DG  I "C3'" 1 
ATOM   1809  O "O3'" . DG  A 1 89  ? 93.321  61.380  99.037  1.00 75.99  ? 25  DG  I "O3'" 1 
ATOM   1810  C "C2'" . DG  A 1 89  ? 94.930  59.938  100.036 1.00 74.28  ? 25  DG  I "C2'" 1 
ATOM   1811  C "C1'" . DG  A 1 89  ? 95.173  60.885  101.188 1.00 74.13  ? 25  DG  I "C1'" 1 
ATOM   1812  N N9    . DG  A 1 89  ? 96.383  60.665  101.970 1.00 73.31  ? 25  DG  I N9    1 
ATOM   1813  C C8    . DG  A 1 89  ? 97.028  59.477  102.210 1.00 73.46  ? 25  DG  I C8    1 
ATOM   1814  N N7    . DG  A 1 89  ? 98.120  59.620  102.914 1.00 74.05  ? 25  DG  I N7    1 
ATOM   1815  C C5    . DG  A 1 89  ? 98.194  60.984  103.160 1.00 73.36  ? 25  DG  I C5    1 
ATOM   1816  C C6    . DG  A 1 89  ? 99.167  61.743  103.868 1.00 73.58  ? 25  DG  I C6    1 
ATOM   1817  O O6    . DG  A 1 89  ? 100.200 61.349  104.422 1.00 72.89  ? 25  DG  I O6    1 
ATOM   1818  N N1    . DG  A 1 89  ? 98.846  63.098  103.886 1.00 72.50  ? 25  DG  I N1    1 
ATOM   1819  C C2    . DG  A 1 89  ? 97.741  63.654  103.290 1.00 72.96  ? 25  DG  I C2    1 
ATOM   1820  N N2    . DG  A 1 89  ? 97.606  64.984  103.419 1.00 71.89  ? 25  DG  I N2    1 
ATOM   1821  N N3    . DG  A 1 89  ? 96.834  62.962  102.620 1.00 72.24  ? 25  DG  I N3    1 
ATOM   1822  C C4    . DG  A 1 89  ? 97.122  61.642  102.597 1.00 74.40  ? 25  DG  I C4    1 
ATOM   1823  P P     . DA  A 1 90  ? 92.067  61.566  98.058  1.00 77.97  ? 26  DA  I P     1 
ATOM   1824  O OP1   . DA  A 1 90  ? 90.856  61.021  98.727  1.00 79.02  ? 26  DA  I OP1   1 
ATOM   1825  O OP2   . DA  A 1 90  ? 92.463  61.059  96.719  1.00 79.42  ? 26  DA  I OP2   1 
ATOM   1826  O "O5'" . DA  A 1 90  ? 91.917  63.147  97.971  1.00 75.62  ? 26  DA  I "O5'" 1 
ATOM   1827  C "C5'" . DA  A 1 90  ? 91.290  63.875  99.020  1.00 70.83  ? 26  DA  I "C5'" 1 
ATOM   1828  C "C4'" . DA  A 1 90  ? 92.001  65.187  99.234  1.00 69.51  ? 26  DA  I "C4'" 1 
ATOM   1829  O "O4'" . DA  A 1 90  ? 93.321  64.932  99.769  1.00 67.93  ? 26  DA  I "O4'" 1 
ATOM   1830  C "C3'" . DA  A 1 90  ? 92.212  66.001  97.958  1.00 67.42  ? 26  DA  I "C3'" 1 
ATOM   1831  O "O3'" . DA  A 1 90  ? 92.099  67.394  98.260  1.00 65.14  ? 26  DA  I "O3'" 1 
ATOM   1832  C "C2'" . DA  A 1 90  ? 93.627  65.633  97.543  1.00 67.99  ? 26  DA  I "C2'" 1 
ATOM   1833  C "C1'" . DA  A 1 90  ? 94.321  65.409  98.880  1.00 68.02  ? 26  DA  I "C1'" 1 
ATOM   1834  N N9    . DA  A 1 90  ? 95.387  64.407  98.846  1.00 67.48  ? 26  DA  I N9    1 
ATOM   1835  C C8    . DA  A 1 90  ? 95.329  63.157  98.286  1.00 68.44  ? 26  DA  I C8    1 
ATOM   1836  N N7    . DA  A 1 90  ? 96.420  62.452  98.452  1.00 67.40  ? 26  DA  I N7    1 
ATOM   1837  C C5    . DA  A 1 90  ? 97.260  63.301  99.154  1.00 67.62  ? 26  DA  I C5    1 
ATOM   1838  C C6    . DA  A 1 90  ? 98.566  63.143  99.641  1.00 68.48  ? 26  DA  I C6    1 
ATOM   1839  N N6    . DA  A 1 90  ? 99.270  62.020  99.507  1.00 69.67  ? 26  DA  I N6    1 
ATOM   1840  N N1    . DA  A 1 90  ? 99.131  64.190  100.285 1.00 67.09  ? 26  DA  I N1    1 
ATOM   1841  C C2    . DA  A 1 90  ? 98.411  65.306  100.435 1.00 66.33  ? 26  DA  I C2    1 
ATOM   1842  N N3    . DA  A 1 90  ? 97.169  65.570  100.033 1.00 66.64  ? 26  DA  I N3    1 
ATOM   1843  C C4    . DA  A 1 90  ? 96.643  64.515  99.391  1.00 67.37  ? 26  DA  I C4    1 
ATOM   1844  P P     . DG  A 1 91  ? 92.024  68.467  97.073  1.00 62.69  ? 27  DG  I P     1 
ATOM   1845  O OP1   . DG  A 1 91  ? 90.944  69.426  97.405  1.00 66.52  ? 27  DG  I OP1   1 
ATOM   1846  O OP2   . DG  A 1 91  ? 91.971  67.709  95.801  1.00 65.89  ? 27  DG  I OP2   1 
ATOM   1847  O "O5'" . DG  A 1 91  ? 93.429  69.196  97.174  1.00 59.96  ? 27  DG  I "O5'" 1 
ATOM   1848  C "C5'" . DG  A 1 91  ? 94.507  68.506  97.771  1.00 56.33  ? 27  DG  I "C5'" 1 
ATOM   1849  C "C4'" . DG  A 1 91  ? 95.825  69.191  97.518  1.00 52.66  ? 27  DG  I "C4'" 1 
ATOM   1850  O "O4'" . DG  A 1 91  ? 96.798  68.131  97.621  1.00 51.81  ? 27  DG  I "O4'" 1 
ATOM   1851  C "C3'" . DG  A 1 91  ? 96.058  69.791  96.133  1.00 50.73  ? 27  DG  I "C3'" 1 
ATOM   1852  O "O3'" . DG  A 1 91  ? 97.215  70.625  96.267  1.00 48.26  ? 27  DG  I "O3'" 1 
ATOM   1853  C "C2'" . DG  A 1 91  ? 96.494  68.583  95.334  1.00 48.03  ? 27  DG  I "C2'" 1 
ATOM   1854  C "C1'" . DG  A 1 91  ? 97.399  67.921  96.356  1.00 50.93  ? 27  DG  I "C1'" 1 
ATOM   1855  N N9    . DG  A 1 91  ? 97.607  66.489  96.198  1.00 53.41  ? 27  DG  I N9    1 
ATOM   1856  C C8    . DG  A 1 91  ? 96.789  65.579  95.576  1.00 53.60  ? 27  DG  I C8    1 
ATOM   1857  N N7    . DG  A 1 91  ? 97.281  64.374  95.574  1.00 55.71  ? 27  DG  I N7    1 
ATOM   1858  C C5    . DG  A 1 91  ? 98.493  64.498  96.234  1.00 57.02  ? 27  DG  I C5    1 
ATOM   1859  C C6    . DG  A 1 91  ? 99.480  63.532  96.527  1.00 56.37  ? 27  DG  I C6    1 
ATOM   1860  O O6    . DG  A 1 91  ? 99.490  62.332  96.238  1.00 60.10  ? 27  DG  I O6    1 
ATOM   1861  N N1    . DG  A 1 91  ? 100.545 64.088  97.232  1.00 57.92  ? 27  DG  I N1    1 
ATOM   1862  C C2    . DG  A 1 91  ? 100.643 65.406  97.607  1.00 58.54  ? 27  DG  I C2    1 
ATOM   1863  N N2    . DG  A 1 91  ? 101.736 65.753  98.298  1.00 57.57  ? 27  DG  I N2    1 
ATOM   1864  N N3    . DG  A 1 91  ? 99.731  66.317  97.327  1.00 56.07  ? 27  DG  I N3    1 
ATOM   1865  C C4    . DG  A 1 91  ? 98.694  65.797  96.643  1.00 54.80  ? 27  DG  I C4    1 
ATOM   1866  P P     . DC  A 1 92  ? 97.194  72.144  95.782  1.00 41.84  ? 28  DC  I P     1 
ATOM   1867  O OP1   . DC  A 1 92  ? 96.217  72.864  96.611  1.00 46.95  ? 28  DC  I OP1   1 
ATOM   1868  O OP2   . DC  A 1 92  ? 97.100  72.228  94.324  1.00 43.50  ? 28  DC  I OP2   1 
ATOM   1869  O "O5'" . DC  A 1 92  ? 98.643  72.620  96.213  1.00 47.33  ? 28  DC  I "O5'" 1 
ATOM   1870  C "C5'" . DC  A 1 92  ? 99.047  72.514  97.568  1.00 52.79  ? 28  DC  I "C5'" 1 
ATOM   1871  C "C4'" . DC  A 1 92  ? 100.467 72.009  97.655  1.00 57.86  ? 28  DC  I "C4'" 1 
ATOM   1872  O "O4'" . DC  A 1 92  ? 100.537 70.612  97.278  1.00 58.72  ? 28  DC  I "O4'" 1 
ATOM   1873  C "C3'" . DC  A 1 92  ? 101.473 72.741  96.765  1.00 61.06  ? 28  DC  I "C3'" 1 
ATOM   1874  O "O3'" . DC  A 1 92  ? 102.682 72.936  97.504  1.00 65.69  ? 28  DC  I "O3'" 1 
ATOM   1875  C "C2'" . DC  A 1 92  ? 101.688 71.774  95.614  1.00 60.83  ? 28  DC  I "C2'" 1 
ATOM   1876  C "C1'" . DC  A 1 92  ? 101.553 70.432  96.305  1.00 59.09  ? 28  DC  I "C1'" 1 
ATOM   1877  N N1    . DC  A 1 92  ? 101.154 69.305  95.447  1.00 61.45  ? 28  DC  I N1    1 
ATOM   1878  C C2    . DC  A 1 92  ? 101.902 68.111  95.504  1.00 60.71  ? 28  DC  I C2    1 
ATOM   1879  O O2    . DC  A 1 92  ? 102.891 68.051  96.244  1.00 59.12  ? 28  DC  I O2    1 
ATOM   1880  N N3    . DC  A 1 92  ? 101.520 67.056  94.755  1.00 60.72  ? 28  DC  I N3    1 
ATOM   1881  C C4    . DC  A 1 92  ? 100.442 67.148  93.975  1.00 60.04  ? 28  DC  I C4    1 
ATOM   1882  N N4    . DC  A 1 92  ? 100.085 66.063  93.287  1.00 63.26  ? 28  DC  I N4    1 
ATOM   1883  C C5    . DC  A 1 92  ? 99.679  68.351  93.871  1.00 59.93  ? 28  DC  I C5    1 
ATOM   1884  C C6    . DC  A 1 92  ? 100.069 69.398  94.617  1.00 61.61  ? 28  DC  I C6    1 
ATOM   1885  P P     . DA  A 1 93  ? 103.812 73.920  96.936  1.00 69.60  ? 29  DA  I P     1 
ATOM   1886  O OP1   . DA  A 1 93  ? 104.541 74.509  98.083  1.00 68.06  ? 29  DA  I OP1   1 
ATOM   1887  O OP2   . DA  A 1 93  ? 103.192 74.805  95.919  1.00 70.97  ? 29  DA  I OP2   1 
ATOM   1888  O "O5'" . DA  A 1 93  ? 104.813 72.933  96.192  1.00 70.08  ? 29  DA  I "O5'" 1 
ATOM   1889  C "C5'" . DA  A 1 93  ? 105.565 71.989  96.943  1.00 70.49  ? 29  DA  I "C5'" 1 
ATOM   1890  C "C4'" . DA  A 1 93  ? 106.299 71.052  96.017  1.00 70.73  ? 29  DA  I "C4'" 1 
ATOM   1891  O "O4'" . DA  A 1 93  ? 105.367 70.184  95.326  1.00 68.53  ? 29  DA  I "O4'" 1 
ATOM   1892  C "C3'" . DA  A 1 93  ? 107.125 71.736  94.926  1.00 70.60  ? 29  DA  I "C3'" 1 
ATOM   1893  O "O3'" . DA  A 1 93  ? 108.344 71.012  94.793  1.00 74.05  ? 29  DA  I "O3'" 1 
ATOM   1894  C "C2'" . DA  A 1 93  ? 106.276 71.547  93.680  1.00 67.86  ? 29  DA  I "C2'" 1 
ATOM   1895  C "C1'" . DA  A 1 93  ? 105.700 70.174  93.952  1.00 67.33  ? 29  DA  I "C1'" 1 
ATOM   1896  N N9    . DA  A 1 93  ? 104.514 69.775  93.197  1.00 66.28  ? 29  DA  I N9    1 
ATOM   1897  C C8    . DA  A 1 93  ? 103.416 70.514  92.822  1.00 67.39  ? 29  DA  I C8    1 
ATOM   1898  N N7    . DA  A 1 93  ? 102.510 69.819  92.171  1.00 64.70  ? 29  DA  I N7    1 
ATOM   1899  C C5    . DA  A 1 93  ? 103.054 68.542  92.110  1.00 63.81  ? 29  DA  I C5    1 
ATOM   1900  C C6    . DA  A 1 93  ? 102.584 67.337  91.558  1.00 62.28  ? 29  DA  I C6    1 
ATOM   1901  N N6    . DA  A 1 93  ? 101.408 67.209  90.946  1.00 59.88  ? 29  DA  I N6    1 
ATOM   1902  N N1    . DA  A 1 93  ? 103.378 66.250  91.665  1.00 61.52  ? 29  DA  I N1    1 
ATOM   1903  C C2    . DA  A 1 93  ? 104.553 66.368  92.289  1.00 61.47  ? 29  DA  I C2    1 
ATOM   1904  N N3    . DA  A 1 93  ? 105.098 67.438  92.856  1.00 64.84  ? 29  DA  I N3    1 
ATOM   1905  C C4    . DA  A 1 93  ? 104.289 68.506  92.729  1.00 65.04  ? 29  DA  I C4    1 
ATOM   1906  P P     . DG  A 1 94  ? 109.539 71.613  93.911  1.00 74.30  ? 30  DG  I P     1 
ATOM   1907  O OP1   . DG  A 1 94  ? 110.517 72.210  94.846  1.00 76.26  ? 30  DG  I OP1   1 
ATOM   1908  O OP2   . DG  A 1 94  ? 108.976 72.429  92.813  1.00 73.42  ? 30  DG  I OP2   1 
ATOM   1909  O "O5'" . DG  A 1 94  ? 110.205 70.315  93.283  1.00 75.53  ? 30  DG  I "O5'" 1 
ATOM   1910  C "C5'" . DG  A 1 94  ? 110.674 69.259  94.114  1.00 74.64  ? 30  DG  I "C5'" 1 
ATOM   1911  C "C4'" . DG  A 1 94  ? 110.954 68.037  93.273  1.00 75.68  ? 30  DG  I "C4'" 1 
ATOM   1912  O "O4'" . DG  A 1 94  ? 109.705 67.556  92.717  1.00 75.38  ? 30  DG  I "O4'" 1 
ATOM   1913  C "C3'" . DG  A 1 94  ? 111.867 68.299  92.078  1.00 76.75  ? 30  DG  I "C3'" 1 
ATOM   1914  O "O3'" . DG  A 1 94  ? 112.710 67.165  91.869  1.00 80.45  ? 30  DG  I "O3'" 1 
ATOM   1915  C "C2'" . DG  A 1 94  ? 110.898 68.484  90.923  1.00 75.32  ? 30  DG  I "C2'" 1 
ATOM   1916  C "C1'" . DG  A 1 94  ? 109.756 67.559  91.299  1.00 74.60  ? 30  DG  I "C1'" 1 
ATOM   1917  N N9    . DG  A 1 94  ? 108.445 67.979  90.809  1.00 74.25  ? 30  DG  I N9    1 
ATOM   1918  C C8    . DG  A 1 94  ? 107.806 69.165  91.075  1.00 73.87  ? 30  DG  I C8    1 
ATOM   1919  N N7    . DG  A 1 94  ? 106.632 69.253  90.513  1.00 72.69  ? 30  DG  I N7    1 
ATOM   1920  C C5    . DG  A 1 94  ? 106.484 68.054  89.831  1.00 72.59  ? 30  DG  I C5    1 
ATOM   1921  C C6    . DG  A 1 94  ? 105.408 67.572  89.044  1.00 72.73  ? 30  DG  I C6    1 
ATOM   1922  O O6    . DG  A 1 94  ? 104.331 68.121  88.788  1.00 73.89  ? 30  DG  I O6    1 
ATOM   1923  N N1    . DG  A 1 94  ? 105.674 66.309  88.533  1.00 74.16  ? 30  DG  I N1    1 
ATOM   1924  C C2    . DG  A 1 94  ? 106.824 65.591  88.755  1.00 75.34  ? 30  DG  I C2    1 
ATOM   1925  N N2    . DG  A 1 94  ? 106.888 64.385  88.171  1.00 74.47  ? 30  DG  I N2    1 
ATOM   1926  N N3    . DG  A 1 94  ? 107.836 66.027  89.494  1.00 74.29  ? 30  DG  I N3    1 
ATOM   1927  C C4    . DG  A 1 94  ? 107.597 67.257  89.997  1.00 73.67  ? 30  DG  I C4    1 
ATOM   1928  P P     . DT  A 1 95  ? 113.816 67.195  90.706  1.00 82.65  ? 31  DT  I P     1 
ATOM   1929  O OP1   . DT  A 1 95  ? 114.938 66.320  91.129  1.00 84.64  ? 31  DT  I OP1   1 
ATOM   1930  O OP2   . DT  A 1 95  ? 114.085 68.603  90.340  1.00 83.77  ? 31  DT  I OP2   1 
ATOM   1931  O "O5'" . DT  A 1 95  ? 113.076 66.496  89.486  1.00 85.40  ? 31  DT  I "O5'" 1 
ATOM   1932  C "C5'" . DT  A 1 95  ? 112.753 65.112  89.545  1.00 87.58  ? 31  DT  I "C5'" 1 
ATOM   1933  C "C4'" . DT  A 1 95  ? 112.409 64.599  88.169  1.00 89.58  ? 31  DT  I "C4'" 1 
ATOM   1934  O "O4'" . DT  A 1 95  ? 111.040 64.923  87.822  1.00 88.22  ? 31  DT  I "O4'" 1 
ATOM   1935  C "C3'" . DT  A 1 95  ? 113.284 65.166  87.050  1.00 90.98  ? 31  DT  I "C3'" 1 
ATOM   1936  O "O3'" . DT  A 1 95  ? 113.648 64.115  86.156  1.00 94.21  ? 31  DT  I "O3'" 1 
ATOM   1937  C "C2'" . DT  A 1 95  ? 112.373 66.172  86.367  1.00 89.58  ? 31  DT  I "C2'" 1 
ATOM   1938  C "C1'" . DT  A 1 95  ? 111.006 65.531  86.545  1.00 88.64  ? 31  DT  I "C1'" 1 
ATOM   1939  N N1    . DT  A 1 95  ? 109.860 66.456  86.517  1.00 88.02  ? 31  DT  I N1    1 
ATOM   1940  C C2    . DT  A 1 95  ? 108.723 66.046  85.860  1.00 88.19  ? 31  DT  I C2    1 
ATOM   1941  O O2    . DT  A 1 95  ? 108.632 64.973  85.290  1.00 88.36  ? 31  DT  I O2    1 
ATOM   1942  N N3    . DT  A 1 95  ? 107.686 66.946  85.894  1.00 88.24  ? 31  DT  I N3    1 
ATOM   1943  C C4    . DT  A 1 95  ? 107.674 68.185  86.500  1.00 87.38  ? 31  DT  I C4    1 
ATOM   1944  O O4    . DT  A 1 95  ? 106.659 68.873  86.461  1.00 87.58  ? 31  DT  I O4    1 
ATOM   1945  C C5    . DT  A 1 95  ? 108.904 68.561  87.156  1.00 87.75  ? 31  DT  I C5    1 
ATOM   1946  C C7    . DT  A 1 95  ? 108.989 69.896  87.828  1.00 86.51  ? 31  DT  I C7    1 
ATOM   1947  C C6    . DT  A 1 95  ? 109.922 67.689  87.134  1.00 88.60  ? 31  DT  I C6    1 
ATOM   1948  P P     . DT  A 1 96  ? 114.666 64.408  84.951  1.00 96.40  ? 32  DT  I P     1 
ATOM   1949  O OP1   . DT  A 1 96  ? 115.712 63.358  85.006  1.00 97.48  ? 32  DT  I OP1   1 
ATOM   1950  O OP2   . DT  A 1 96  ? 115.060 65.839  84.976  1.00 97.29  ? 32  DT  I OP2   1 
ATOM   1951  O "O5'" . DT  A 1 96  ? 113.765 64.140  83.669  1.00 95.44  ? 32  DT  I "O5'" 1 
ATOM   1952  C "C5'" . DT  A 1 96  ? 112.965 62.968  83.601  1.00 96.64  ? 32  DT  I "C5'" 1 
ATOM   1953  C "C4'" . DT  A 1 96  ? 112.076 63.008  82.384  1.00 97.74  ? 32  DT  I "C4'" 1 
ATOM   1954  O "O4'" . DT  A 1 96  ? 110.920 63.850  82.608  1.00 97.28  ? 32  DT  I "O4'" 1 
ATOM   1955  C "C3'" . DT  A 1 96  ? 112.749 63.526  81.115  1.00 98.21  ? 32  DT  I "C3'" 1 
ATOM   1956  O "O3'" . DT  A 1 96  ? 112.359 62.698  80.020  1.00 99.69  ? 32  DT  I "O3'" 1 
ATOM   1957  C "C2'" . DT  A 1 96  ? 112.186 64.929  80.966  1.00 97.36  ? 32  DT  I "C2'" 1 
ATOM   1958  C "C1'" . DT  A 1 96  ? 110.786 64.766  81.535  1.00 96.61  ? 32  DT  I "C1'" 1 
ATOM   1959  N N1    . DT  A 1 96  ? 110.164 65.998  82.064  1.00 94.99  ? 32  DT  I N1    1 
ATOM   1960  C C2    . DT  A 1 96  ? 108.846 66.242  81.740  1.00 94.57  ? 32  DT  I C2    1 
ATOM   1961  O O2    . DT  A 1 96  ? 108.192 65.513  81.011  1.00 94.19  ? 32  DT  I O2    1 
ATOM   1962  N N3    . DT  A 1 96  ? 108.321 67.379  82.300  1.00 93.35  ? 32  DT  I N3    1 
ATOM   1963  C C4    . DT  A 1 96  ? 108.966 68.281  83.122  1.00 92.49  ? 32  DT  I C4    1 
ATOM   1964  O O4    . DT  A 1 96  ? 108.357 69.251  83.561  1.00 91.90  ? 32  DT  I O4    1 
ATOM   1965  C C5    . DT  A 1 96  ? 110.352 67.978  83.401  1.00 92.16  ? 32  DT  I C5    1 
ATOM   1966  C C7    . DT  A 1 96  ? 111.139 68.911  84.265  1.00 90.44  ? 32  DT  I C7    1 
ATOM   1967  C C6    . DT  A 1 96  ? 110.874 66.867  82.866  1.00 93.46  ? 32  DT  I C6    1 
ATOM   1968  P P     . DT  A 1 97  ? 112.920 62.998  78.548  1.00 101.15 ? 33  DT  I P     1 
ATOM   1969  O OP1   . DT  A 1 97  ? 113.505 61.735  78.038  1.00 101.57 ? 33  DT  I OP1   1 
ATOM   1970  O OP2   . DT  A 1 97  ? 113.743 64.234  78.574  1.00 100.35 ? 33  DT  I OP2   1 
ATOM   1971  O "O5'" . DT  A 1 97  ? 111.585 63.289  77.734  1.00 101.76 ? 33  DT  I "O5'" 1 
ATOM   1972  C "C5'" . DT  A 1 97  ? 110.414 62.514  77.984  1.00 102.36 ? 33  DT  I "C5'" 1 
ATOM   1973  C "C4'" . DT  A 1 97  ? 109.219 63.140  77.311  1.00 102.90 ? 33  DT  I "C4'" 1 
ATOM   1974  O "O4'" . DT  A 1 97  ? 108.787 64.321  78.033  1.00 103.40 ? 33  DT  I "O4'" 1 
ATOM   1975  C "C3'" . DT  A 1 97  ? 109.493 63.591  75.878  1.00 102.99 ? 33  DT  I "C3'" 1 
ATOM   1976  O "O3'" . DT  A 1 97  ? 108.388 63.266  75.039  1.00 102.76 ? 33  DT  I "O3'" 1 
ATOM   1977  C "C2'" . DT  A 1 97  ? 109.637 65.098  75.999  1.00 103.41 ? 33  DT  I "C2'" 1 
ATOM   1978  C "C1'" . DT  A 1 97  ? 108.687 65.417  77.138  1.00 102.85 ? 33  DT  I "C1'" 1 
ATOM   1979  N N1    . DT  A 1 97  ? 109.020 66.646  77.884  1.00 102.19 ? 33  DT  I N1    1 
ATOM   1980  C C2    . DT  A 1 97  ? 107.999 67.525  78.172  1.00 101.57 ? 33  DT  I C2    1 
ATOM   1981  O O2    . DT  A 1 97  ? 106.841 67.337  77.833  1.00 100.69 ? 33  DT  I O2    1 
ATOM   1982  N N3    . DT  A 1 97  ? 108.385 68.640  78.874  1.00 101.08 ? 33  DT  I N3    1 
ATOM   1983  C C4    . DT  A 1 97  ? 109.660 68.956  79.301  1.00 101.11 ? 33  DT  I C4    1 
ATOM   1984  O O4    . DT  A 1 97  ? 109.855 69.991  79.935  1.00 100.94 ? 33  DT  I O4    1 
ATOM   1985  C C5    . DT  A 1 97  ? 110.684 67.996  78.955  1.00 101.21 ? 33  DT  I C5    1 
ATOM   1986  C C7    . DT  A 1 97  ? 112.096 68.265  79.363  1.00 100.85 ? 33  DT  I C7    1 
ATOM   1987  C C6    . DT  A 1 97  ? 110.316 66.902  78.276  1.00 101.54 ? 33  DT  I C6    1 
ATOM   1988  P P     . DC  A 1 98  ? 108.483 63.561  73.468  1.00 102.32 ? 34  DC  I P     1 
ATOM   1989  O OP1   . DC  A 1 98  ? 107.502 62.671  72.796  1.00 102.34 ? 34  DC  I OP1   1 
ATOM   1990  O OP2   . DC  A 1 98  ? 109.915 63.512  73.077  1.00 101.02 ? 34  DC  I OP2   1 
ATOM   1991  O "O5'" . DC  A 1 98  ? 107.981 65.064  73.338  1.00 100.47 ? 34  DC  I "O5'" 1 
ATOM   1992  C "C5'" . DC  A 1 98  ? 106.605 65.388  73.509  1.00 98.94  ? 34  DC  I "C5'" 1 
ATOM   1993  C "C4'" . DC  A 1 98  ? 106.344 66.802  73.046  1.00 98.30  ? 34  DC  I "C4'" 1 
ATOM   1994  O "O4'" . DC  A 1 98  ? 106.840 67.756  74.019  1.00 97.14  ? 34  DC  I "O4'" 1 
ATOM   1995  C "C3'" . DC  A 1 98  ? 107.020 67.156  71.720  1.00 97.10  ? 34  DC  I "C3'" 1 
ATOM   1996  O "O3'" . DC  A 1 98  ? 106.156 67.974  70.938  1.00 96.17  ? 34  DC  I "O3'" 1 
ATOM   1997  C "C2'" . DC  A 1 98  ? 108.223 67.971  72.153  1.00 97.02  ? 34  DC  I "C2'" 1 
ATOM   1998  C "C1'" . DC  A 1 98  ? 107.658 68.704  73.355  1.00 95.65  ? 34  DC  I "C1'" 1 
ATOM   1999  N N1    . DC  A 1 98  ? 108.648 69.221  74.313  1.00 93.00  ? 34  DC  I N1    1 
ATOM   2000  C C2    . DC  A 1 98  ? 108.205 70.047  75.349  1.00 91.17  ? 34  DC  I C2    1 
ATOM   2001  O O2    . DC  A 1 98  ? 106.994 70.279  75.448  1.00 88.45  ? 34  DC  I O2    1 
ATOM   2002  N N3    . DC  A 1 98  ? 109.105 70.567  76.213  1.00 88.94  ? 34  DC  I N3    1 
ATOM   2003  C C4    . DC  A 1 98  ? 110.402 70.282  76.075  1.00 90.37  ? 34  DC  I C4    1 
ATOM   2004  N N4    . DC  A 1 98  ? 111.260 70.829  76.938  1.00 89.24  ? 34  DC  I N4    1 
ATOM   2005  C C5    . DC  A 1 98  ? 110.878 69.426  75.041  1.00 91.77  ? 34  DC  I C5    1 
ATOM   2006  C C6    . DC  A 1 98  ? 109.975 68.920  74.192  1.00 92.63  ? 34  DC  I C6    1 
ATOM   2007  P P     . DC  A 1 99  ? 106.232 67.905  69.337  1.00 95.55  ? 35  DC  I P     1 
ATOM   2008  O OP1   . DC  A 1 99  ? 105.951 66.504  68.937  1.00 98.42  ? 35  DC  I OP1   1 
ATOM   2009  O OP2   . DC  A 1 99  ? 107.495 68.552  68.906  1.00 96.08  ? 35  DC  I OP2   1 
ATOM   2010  O "O5'" . DC  A 1 99  ? 105.014 68.816  68.878  1.00 94.31  ? 35  DC  I "O5'" 1 
ATOM   2011  C "C5'" . DC  A 1 99  ? 103.753 68.699  69.524  1.00 91.20  ? 35  DC  I "C5'" 1 
ATOM   2012  C "C4'" . DC  A 1 99  ? 103.354 70.017  70.145  1.00 89.18  ? 35  DC  I "C4'" 1 
ATOM   2013  O "O4'" . DC  A 1 99  ? 104.304 70.417  71.163  1.00 87.65  ? 35  DC  I "O4'" 1 
ATOM   2014  C "C3'" . DC  A 1 99  ? 103.275 71.182  69.163  1.00 87.35  ? 35  DC  I "C3'" 1 
ATOM   2015  O "O3'" . DC  A 1 99  ? 102.156 71.984  69.507  1.00 86.30  ? 35  DC  I "O3'" 1 
ATOM   2016  C "C2'" . DC  A 1 99  ? 104.555 71.953  69.428  1.00 86.58  ? 35  DC  I "C2'" 1 
ATOM   2017  C "C1'" . DC  A 1 99  ? 104.709 71.755  70.920  1.00 86.95  ? 35  DC  I "C1'" 1 
ATOM   2018  N N1    . DC  A 1 99  ? 106.075 71.926  71.442  1.00 86.87  ? 35  DC  I N1    1 
ATOM   2019  C C2    . DC  A 1 99  ? 106.312 72.943  72.375  1.00 85.56  ? 35  DC  I C2    1 
ATOM   2020  O O2    . DC  A 1 99  ? 105.370 73.670  72.719  1.00 85.12  ? 35  DC  I O2    1 
ATOM   2021  N N3    . DC  A 1 99  ? 107.558 73.107  72.872  1.00 84.85  ? 35  DC  I N3    1 
ATOM   2022  C C4    . DC  A 1 99  ? 108.544 72.305  72.470  1.00 84.53  ? 35  DC  I C4    1 
ATOM   2023  N N4    . DC  A 1 99  ? 109.759 72.498  72.991  1.00 84.15  ? 35  DC  I N4    1 
ATOM   2024  C C5    . DC  A 1 99  ? 108.334 71.267  71.519  1.00 84.75  ? 35  DC  I C5    1 
ATOM   2025  C C6    . DC  A 1 99  ? 107.094 71.113  71.036  1.00 85.84  ? 35  DC  I C6    1 
ATOM   2026  P P     . DA  A 1 100 ? 101.086 72.375  68.386  1.00 86.95  ? 36  DA  I P     1 
ATOM   2027  O OP1   . DA  A 1 100 ? 100.071 71.295  68.331  1.00 86.92  ? 36  DA  I OP1   1 
ATOM   2028  O OP2   . DA  A 1 100 ? 101.829 72.752  67.159  1.00 88.20  ? 36  DA  I OP2   1 
ATOM   2029  O "O5'" . DA  A 1 100 ? 100.392 73.672  68.995  1.00 85.69  ? 36  DA  I "O5'" 1 
ATOM   2030  C "C5'" . DA  A 1 100 ? 99.891  73.661  70.333  1.00 81.34  ? 36  DA  I "C5'" 1 
ATOM   2031  C "C4'" . DA  A 1 100 ? 100.188 74.974  71.020  1.00 78.40  ? 36  DA  I "C4'" 1 
ATOM   2032  O "O4'" . DA  A 1 100 ? 101.614 75.118  71.216  1.00 75.54  ? 36  DA  I "O4'" 1 
ATOM   2033  C "C3'" . DA  A 1 100 ? 99.736  76.220  70.258  1.00 77.71  ? 36  DA  I "C3'" 1 
ATOM   2034  O "O3'" . DA  A 1 100 ? 99.213  77.180  71.181  1.00 77.83  ? 36  DA  I "O3'" 1 
ATOM   2035  C "C2'" . DA  A 1 100 ? 101.012 76.714  69.596  1.00 75.51  ? 36  DA  I "C2'" 1 
ATOM   2036  C "C1'" . DA  A 1 100 ? 102.093 76.293  70.578  1.00 76.10  ? 36  DA  I "C1'" 1 
ATOM   2037  N N9    . DA  A 1 100 ? 103.377 75.960  69.960  1.00 76.25  ? 36  DA  I N9    1 
ATOM   2038  C C8    . DA  A 1 100 ? 103.595 75.484  68.690  1.00 76.84  ? 36  DA  I C8    1 
ATOM   2039  N N7    . DA  A 1 100 ? 104.856 75.236  68.428  1.00 77.18  ? 36  DA  I N7    1 
ATOM   2040  C C5    . DA  A 1 100 ? 105.516 75.579  69.599  1.00 76.50  ? 36  DA  I C5    1 
ATOM   2041  C C6    . DA  A 1 100 ? 106.873 75.544  69.968  1.00 76.29  ? 36  DA  I C6    1 
ATOM   2042  N N6    . DA  A 1 100 ? 107.851 75.120  69.163  1.00 76.30  ? 36  DA  I N6    1 
ATOM   2043  N N1    . DA  A 1 100 ? 107.198 75.964  71.208  1.00 76.07  ? 36  DA  I N1    1 
ATOM   2044  C C2    . DA  A 1 100 ? 106.220 76.388  72.015  1.00 75.80  ? 36  DA  I C2    1 
ATOM   2045  N N3    . DA  A 1 100 ? 104.912 76.464  71.787  1.00 76.91  ? 36  DA  I N3    1 
ATOM   2046  C C4    . DA  A 1 100 ? 104.620 76.041  70.546  1.00 76.73  ? 36  DA  I C4    1 
ATOM   2047  P P     . DA  A 1 101 ? 98.725  78.617  70.654  1.00 76.45  ? 37  DA  I P     1 
ATOM   2048  O OP1   . DA  A 1 101 ? 97.521  78.971  71.445  1.00 78.23  ? 37  DA  I OP1   1 
ATOM   2049  O OP2   . DA  A 1 101 ? 98.644  78.589  69.174  1.00 78.10  ? 37  DA  I OP2   1 
ATOM   2050  O "O5'" . DA  A 1 101 ? 99.923  79.578  71.074  1.00 75.56  ? 37  DA  I "O5'" 1 
ATOM   2051  C "C5'" . DA  A 1 101 ? 100.414 79.568  72.412  1.00 72.33  ? 37  DA  I "C5'" 1 
ATOM   2052  C "C4'" . DA  A 1 101 ? 101.665 80.404  72.527  1.00 71.05  ? 37  DA  I "C4'" 1 
ATOM   2053  O "O4'" . DA  A 1 101 ? 102.800 79.720  71.943  1.00 71.37  ? 37  DA  I "O4'" 1 
ATOM   2054  C "C3'" . DA  A 1 101 ? 101.605 81.772  71.849  1.00 71.38  ? 37  DA  I "C3'" 1 
ATOM   2055  O "O3'" . DA  A 1 101 ? 102.293 82.718  72.669  1.00 70.37  ? 37  DA  I "O3'" 1 
ATOM   2056  C "C2'" . DA  A 1 101 ? 102.399 81.551  70.574  1.00 71.14  ? 37  DA  I "C2'" 1 
ATOM   2057  C "C1'" . DA  A 1 101 ? 103.474 80.614  71.079  1.00 71.17  ? 37  DA  I "C1'" 1 
ATOM   2058  N N9    . DA  A 1 101 ? 104.171 79.834  70.057  1.00 71.47  ? 37  DA  I N9    1 
ATOM   2059  C C8    . DA  A 1 101 ? 103.654 79.254  68.929  1.00 72.33  ? 37  DA  I C8    1 
ATOM   2060  N N7    . DA  A 1 101 ? 104.547 78.626  68.200  1.00 73.27  ? 37  DA  I N7    1 
ATOM   2061  C C5    . DA  A 1 101 ? 105.733 78.805  68.899  1.00 73.23  ? 37  DA  I C5    1 
ATOM   2062  C C6    . DA  A 1 101 ? 107.056 78.378  68.654  1.00 72.94  ? 37  DA  I C6    1 
ATOM   2063  N N6    . DA  A 1 101 ? 107.417 77.644  67.597  1.00 73.28  ? 37  DA  I N6    1 
ATOM   2064  N N1    . DA  A 1 101 ? 108.004 78.731  69.548  1.00 72.85  ? 37  DA  I N1    1 
ATOM   2065  C C2    . DA  A 1 101 ? 107.638 79.449  70.618  1.00 72.98  ? 37  DA  I C2    1 
ATOM   2066  N N3    . DA  A 1 101 ? 106.433 79.902  70.959  1.00 72.57  ? 37  DA  I N3    1 
ATOM   2067  C C4    . DA  A 1 101 ? 105.515 79.544  70.047  1.00 71.72  ? 37  DA  I C4    1 
ATOM   2068  P P     . DA  A 1 102 ? 102.257 84.279  72.294  1.00 68.27  ? 38  DA  I P     1 
ATOM   2069  O OP1   . DA  A 1 102 ? 101.161 84.915  73.064  1.00 63.43  ? 38  DA  I OP1   1 
ATOM   2070  O OP2   . DA  A 1 102 ? 102.296 84.415  70.816  1.00 66.91  ? 38  DA  I OP2   1 
ATOM   2071  O "O5'" . DA  A 1 102 ? 103.652 84.812  72.839  1.00 65.40  ? 38  DA  I "O5'" 1 
ATOM   2072  C "C5'" . DA  A 1 102 ? 104.273 84.216  73.972  1.00 62.48  ? 38  DA  I "C5'" 1 
ATOM   2073  C "C4'" . DA  A 1 102 ? 105.769 84.406  73.886  1.00 61.06  ? 38  DA  I "C4'" 1 
ATOM   2074  O "O4'" . DA  A 1 102 ? 106.344 83.416  72.995  1.00 62.53  ? 38  DA  I "O4'" 1 
ATOM   2075  C "C3'" . DA  A 1 102 ? 106.150 85.770  73.313  1.00 59.64  ? 38  DA  I "C3'" 1 
ATOM   2076  O "O3'" . DA  A 1 102 ? 107.296 86.311  73.962  1.00 53.56  ? 38  DA  I "O3'" 1 
ATOM   2077  C "C2'" . DA  A 1 102 ? 106.478 85.463  71.867  1.00 62.48  ? 38  DA  I "C2'" 1 
ATOM   2078  C "C1'" . DA  A 1 102 ? 107.057 84.064  71.950  1.00 65.71  ? 38  DA  I "C1'" 1 
ATOM   2079  N N9    . DA  A 1 102 ? 106.866 83.288  70.726  1.00 67.16  ? 38  DA  I N9    1 
ATOM   2080  C C8    . DA  A 1 102 ? 105.682 82.968  70.113  1.00 68.28  ? 38  DA  I C8    1 
ATOM   2081  N N7    . DA  A 1 102 ? 105.827 82.276  69.012  1.00 69.79  ? 38  DA  I N7    1 
ATOM   2082  C C5    . DA  A 1 102 ? 107.201 82.126  68.892  1.00 69.06  ? 38  DA  I C5    1 
ATOM   2083  C C6    . DA  A 1 102 ? 108.001 81.480  67.929  1.00 70.00  ? 38  DA  I C6    1 
ATOM   2084  N N6    . DA  A 1 102 ? 107.508 80.852  66.866  1.00 68.96  ? 38  DA  I N6    1 
ATOM   2085  N N1    . DA  A 1 102 ? 109.339 81.507  68.102  1.00 68.70  ? 38  DA  I N1    1 
ATOM   2086  C C2    . DA  A 1 102 ? 109.829 82.142  69.174  1.00 70.72  ? 38  DA  I C2    1 
ATOM   2087  N N3    . DA  A 1 102 ? 109.178 82.789  70.149  1.00 69.56  ? 38  DA  I N3    1 
ATOM   2088  C C4    . DA  A 1 102 ? 107.852 82.739  69.944  1.00 67.81  ? 38  DA  I C4    1 
ATOM   2089  P P     . DT  A 1 103 ? 107.784 87.790  73.584  1.00 52.69  ? 39  DT  I P     1 
ATOM   2090  O OP1   . DT  A 1 103 ? 107.832 88.620  74.812  1.00 55.72  ? 39  DT  I OP1   1 
ATOM   2091  O OP2   . DT  A 1 103 ? 106.970 88.241  72.436  1.00 54.99  ? 39  DT  I OP2   1 
ATOM   2092  O "O5'" . DT  A 1 103 ? 109.273 87.558  73.083  1.00 54.68  ? 39  DT  I "O5'" 1 
ATOM   2093  C "C5'" . DT  A 1 103 ? 110.169 86.766  73.852  1.00 63.08  ? 39  DT  I "C5'" 1 
ATOM   2094  C "C4'" . DT  A 1 103 ? 111.434 86.492  73.074  1.00 66.54  ? 39  DT  I "C4'" 1 
ATOM   2095  O "O4'" . DT  A 1 103 ? 111.145 85.632  71.946  1.00 67.42  ? 39  DT  I "O4'" 1 
ATOM   2096  C "C3'" . DT  A 1 103 ? 112.118 87.731  72.503  1.00 70.57  ? 39  DT  I "C3'" 1 
ATOM   2097  O "O3'" . DT  A 1 103 ? 113.530 87.594  72.655  1.00 78.32  ? 39  DT  I "O3'" 1 
ATOM   2098  C "C2'" . DT  A 1 103 ? 111.713 87.713  71.036  1.00 70.48  ? 39  DT  I "C2'" 1 
ATOM   2099  C "C1'" . DT  A 1 103 ? 111.626 86.227  70.749  1.00 68.50  ? 39  DT  I "C1'" 1 
ATOM   2100  N N1    . DT  A 1 103 ? 110.710 85.842  69.654  1.00 68.42  ? 39  DT  I N1    1 
ATOM   2101  C C2    . DT  A 1 103 ? 111.216 85.089  68.612  1.00 67.80  ? 39  DT  I C2    1 
ATOM   2102  O O2    . DT  A 1 103 ? 112.392 84.775  68.525  1.00 66.68  ? 39  DT  I O2    1 
ATOM   2103  N N3    . DT  A 1 103 ? 110.291 84.720  67.669  1.00 66.58  ? 39  DT  I N3    1 
ATOM   2104  C C4    . DT  A 1 103 ? 108.945 85.034  67.655  1.00 67.46  ? 39  DT  I C4    1 
ATOM   2105  O O4    . DT  A 1 103 ? 108.227 84.609  66.758  1.00 66.62  ? 39  DT  I O4    1 
ATOM   2106  C C5    . DT  A 1 103 ? 108.493 85.859  68.750  1.00 66.14  ? 39  DT  I C5    1 
ATOM   2107  C C7    . DT  A 1 103 ? 107.060 86.284  68.789  1.00 66.89  ? 39  DT  I C7    1 
ATOM   2108  C C6    . DT  A 1 103 ? 109.384 86.211  69.685  1.00 67.79  ? 39  DT  I C6    1 
ATOM   2109  P P     . DA  A 1 104 ? 114.518 88.599  71.888  1.00 82.74  ? 40  DA  I P     1 
ATOM   2110  O OP1   . DA  A 1 104 ? 115.877 88.415  72.459  1.00 82.56  ? 40  DA  I OP1   1 
ATOM   2111  O OP2   . DA  A 1 104 ? 113.901 89.947  71.882  1.00 80.91  ? 40  DA  I OP2   1 
ATOM   2112  O "O5'" . DA  A 1 104 ? 114.530 88.029  70.402  1.00 86.18  ? 40  DA  I "O5'" 1 
ATOM   2113  C "C5'" . DA  A 1 104 ? 115.331 86.898  70.065  1.00 89.86  ? 40  DA  I "C5'" 1 
ATOM   2114  C "C4'" . DA  A 1 104 ? 115.812 87.014  68.639  1.00 92.37  ? 40  DA  I "C4'" 1 
ATOM   2115  O "O4'" . DA  A 1 104 ? 114.741 86.674  67.725  1.00 93.01  ? 40  DA  I "O4'" 1 
ATOM   2116  C "C3'" . DA  A 1 104 ? 116.253 88.428  68.266  1.00 94.32  ? 40  DA  I "C3'" 1 
ATOM   2117  O "O3'" . DA  A 1 104 ? 117.393 88.388  67.405  1.00 98.39  ? 40  DA  I "O3'" 1 
ATOM   2118  C "C2'" . DA  A 1 104 ? 115.047 88.990  67.535  1.00 93.07  ? 40  DA  I "C2'" 1 
ATOM   2119  C "C1'" . DA  A 1 104 ? 114.501 87.757  66.838  1.00 92.61  ? 40  DA  I "C1'" 1 
ATOM   2120  N N9    . DA  A 1 104 ? 113.068 87.794  66.560  1.00 91.87  ? 40  DA  I N9    1 
ATOM   2121  C C8    . DA  A 1 104 ? 112.061 88.289  67.351  1.00 92.12  ? 40  DA  I C8    1 
ATOM   2122  N N7    . DA  A 1 104 ? 110.865 88.143  66.835  1.00 92.21  ? 40  DA  I N7    1 
ATOM   2123  C C5    . DA  A 1 104 ? 111.102 87.517  65.620  1.00 91.96  ? 40  DA  I C5    1 
ATOM   2124  C C6    . DA  A 1 104 ? 110.241 87.077  64.598  1.00 92.41  ? 40  DA  I C6    1 
ATOM   2125  N N6    . DA  A 1 104 ? 108.914 87.196  64.643  1.00 92.19  ? 40  DA  I N6    1 
ATOM   2126  N N1    . DA  A 1 104 ? 110.801 86.503  63.512  1.00 92.43  ? 40  DA  I N1    1 
ATOM   2127  C C2    . DA  A 1 104 ? 112.132 86.378  63.469  1.00 92.18  ? 40  DA  I C2    1 
ATOM   2128  N N3    . DA  A 1 104 ? 113.041 86.739  64.367  1.00 92.50  ? 40  DA  I N3    1 
ATOM   2129  C C4    . DA  A 1 104 ? 112.454 87.308  65.432  1.00 91.84  ? 40  DA  I C4    1 
ATOM   2130  P P     . DC  A 1 105 ? 118.214 89.737  67.119  1.00 101.38 ? 41  DC  I P     1 
ATOM   2131  O OP1   . DC  A 1 105 ? 119.131 89.481  65.981  1.00 101.34 ? 41  DC  I OP1   1 
ATOM   2132  O OP2   . DC  A 1 105 ? 118.764 90.221  68.411  1.00 101.86 ? 41  DC  I OP2   1 
ATOM   2133  O "O5'" . DC  A 1 105 ? 117.081 90.755  66.652  1.00 103.52 ? 41  DC  I "O5'" 1 
ATOM   2134  C "C5'" . DC  A 1 105 ? 117.269 91.586  65.517  1.00 107.00 ? 41  DC  I "C5'" 1 
ATOM   2135  C "C4'" . DC  A 1 105 ? 117.272 90.752  64.257  1.00 109.21 ? 41  DC  I "C4'" 1 
ATOM   2136  O "O4'" . DC  A 1 105 ? 116.044 89.987  64.146  1.00 109.83 ? 41  DC  I "O4'" 1 
ATOM   2137  C "C3'" . DC  A 1 105 ? 117.381 91.563  62.968  1.00 110.72 ? 41  DC  I "C3'" 1 
ATOM   2138  O "O3'" . DC  A 1 105 ? 118.264 90.910  62.060  1.00 113.95 ? 41  DC  I "O3'" 1 
ATOM   2139  C "C2'" . DC  A 1 105 ? 115.964 91.570  62.426  1.00 109.62 ? 41  DC  I "C2'" 1 
ATOM   2140  C "C1'" . DC  A 1 105 ? 115.436 90.225  62.885  1.00 108.56 ? 41  DC  I "C1'" 1 
ATOM   2141  N N1    . DC  A 1 105 ? 113.976 90.184  63.068  1.00 107.36 ? 41  DC  I N1    1 
ATOM   2142  C C2    . DC  A 1 105 ? 113.190 89.533  62.108  1.00 106.97 ? 41  DC  I C2    1 
ATOM   2143  O O2    . DC  A 1 105 ? 113.746 89.010  61.132  1.00 107.42 ? 41  DC  I O2    1 
ATOM   2144  N N3    . DC  A 1 105 ? 111.848 89.494  62.269  1.00 106.03 ? 41  DC  I N3    1 
ATOM   2145  C C4    . DC  A 1 105 ? 111.287 90.078  63.331  1.00 105.52 ? 41  DC  I C4    1 
ATOM   2146  N N4    . DC  A 1 105 ? 109.959 90.021  63.445  1.00 104.96 ? 41  DC  I N4    1 
ATOM   2147  C C5    . DC  A 1 105 ? 112.063 90.745  64.323  1.00 105.42 ? 41  DC  I C5    1 
ATOM   2148  C C6    . DC  A 1 105 ? 113.390 90.774  64.154  1.00 106.44 ? 41  DC  I C6    1 
ATOM   2149  P P     . DA  A 1 106 ? 118.891 91.739  60.843  1.00 116.00 ? 42  DA  I P     1 
ATOM   2150  O OP1   . DA  A 1 106 ? 120.012 90.954  60.264  1.00 115.95 ? 42  DA  I OP1   1 
ATOM   2151  O OP2   . DA  A 1 106 ? 119.137 93.121  61.332  1.00 115.36 ? 42  DA  I OP2   1 
ATOM   2152  O "O5'" . DA  A 1 106 ? 117.698 91.784  59.791  1.00 116.99 ? 42  DA  I "O5'" 1 
ATOM   2153  C "C5'" . DA  A 1 106 ? 117.405 90.652  58.980  1.00 118.71 ? 42  DA  I "C5'" 1 
ATOM   2154  C "C4'" . DA  A 1 106 ? 116.388 91.018  57.926  1.00 120.04 ? 42  DA  I "C4'" 1 
ATOM   2155  O "O4'" . DA  A 1 106 ? 115.053 90.994  58.488  1.00 120.09 ? 42  DA  I "O4'" 1 
ATOM   2156  C "C3'" . DA  A 1 106 ? 116.585 92.416  57.339  1.00 121.03 ? 42  DA  I "C3'" 1 
ATOM   2157  O "O3'" . DA  A 1 106 ? 116.385 92.395  55.924  1.00 122.47 ? 42  DA  I "O3'" 1 
ATOM   2158  C "C2'" . DA  A 1 106 ? 115.505 93.239  58.019  1.00 121.14 ? 42  DA  I "C2'" 1 
ATOM   2159  C "C1'" . DA  A 1 106 ? 114.394 92.220  58.200  1.00 120.49 ? 42  DA  I "C1'" 1 
ATOM   2160  N N9    . DA  A 1 106 ? 113.470 92.511  59.297  1.00 119.64 ? 42  DA  I N9    1 
ATOM   2161  C C8    . DA  A 1 106 ? 113.749 93.096  60.507  1.00 119.29 ? 42  DA  I C8    1 
ATOM   2162  N N7    . DA  A 1 106 ? 112.700 93.232  61.283  1.00 119.16 ? 42  DA  I N7    1 
ATOM   2163  C C5    . DA  A 1 106 ? 111.662 92.697  60.535  1.00 118.93 ? 42  DA  I C5    1 
ATOM   2164  C C6    . DA  A 1 106 ? 110.288 92.546  60.795  1.00 118.73 ? 42  DA  I C6    1 
ATOM   2165  N N6    . DA  A 1 106 ? 109.705 92.931  61.932  1.00 118.66 ? 42  DA  I N6    1 
ATOM   2166  N N1    . DA  A 1 106 ? 109.526 91.976  59.837  1.00 118.16 ? 42  DA  I N1    1 
ATOM   2167  C C2    . DA  A 1 106 ? 110.112 91.590  58.700  1.00 118.25 ? 42  DA  I C2    1 
ATOM   2168  N N3    . DA  A 1 106 ? 111.390 91.679  58.336  1.00 118.57 ? 42  DA  I N3    1 
ATOM   2169  C C4    . DA  A 1 106 ? 112.120 92.249  59.309  1.00 118.89 ? 42  DA  I C4    1 
ATOM   2170  P P     . DC  A 1 107 ? 116.379 93.774  55.101  1.00 122.61 ? 43  DC  I P     1 
ATOM   2171  O OP1   . DC  A 1 107 ? 117.082 93.547  53.814  1.00 122.97 ? 43  DC  I OP1   1 
ATOM   2172  O OP2   . DC  A 1 107 ? 116.835 94.860  56.007  1.00 122.63 ? 43  DC  I OP2   1 
ATOM   2173  O "O5'" . DC  A 1 107 ? 114.834 93.999  54.795  1.00 121.61 ? 43  DC  I "O5'" 1 
ATOM   2174  C "C5'" . DC  A 1 107 ? 114.066 92.961  54.193  1.00 120.43 ? 43  DC  I "C5'" 1 
ATOM   2175  C "C4'" . DC  A 1 107 ? 112.641 93.415  53.991  1.00 119.32 ? 43  DC  I "C4'" 1 
ATOM   2176  O "O4'" . DC  A 1 107 ? 111.947 93.470  55.263  1.00 119.19 ? 43  DC  I "O4'" 1 
ATOM   2177  C "C3'" . DC  A 1 107 ? 112.512 94.807  53.371  1.00 117.57 ? 43  DC  I "C3'" 1 
ATOM   2178  O "O3'" . DC  A 1 107 ? 111.453 94.818  52.415  1.00 114.39 ? 43  DC  I "O3'" 1 
ATOM   2179  C "C2'" . DC  A 1 107 ? 112.165 95.686  54.556  1.00 117.96 ? 43  DC  I "C2'" 1 
ATOM   2180  C "C1'" . DC  A 1 107 ? 111.349 94.747  55.423  1.00 118.62 ? 43  DC  I "C1'" 1 
ATOM   2181  N N1    . DC  A 1 107 ? 111.358 95.081  56.856  1.00 118.54 ? 43  DC  I N1    1 
ATOM   2182  C C2    . DC  A 1 107 ? 110.145 95.085  57.557  1.00 118.54 ? 43  DC  I C2    1 
ATOM   2183  O O2    . DC  A 1 107 ? 109.101 94.792  56.953  1.00 118.33 ? 43  DC  I O2    1 
ATOM   2184  N N3    . DC  A 1 107 ? 110.141 95.407  58.872  1.00 118.35 ? 43  DC  I N3    1 
ATOM   2185  C C4    . DC  A 1 107 ? 111.286 95.714  59.485  1.00 118.24 ? 43  DC  I C4    1 
ATOM   2186  N N4    . DC  A 1 107 ? 111.234 96.027  60.782  1.00 117.67 ? 43  DC  I N4    1 
ATOM   2187  C C5    . DC  A 1 107 ? 112.535 95.713  58.799  1.00 118.28 ? 43  DC  I C5    1 
ATOM   2188  C C6    . DC  A 1 107 ? 112.526 95.393  57.498  1.00 118.49 ? 43  DC  I C6    1 
ATOM   2189  P P     . DT  A 1 108 ? 111.085 96.180  51.649  1.00 111.97 ? 44  DT  I P     1 
ATOM   2190  O OP1   . DT  A 1 108 ? 111.099 95.911  50.190  1.00 112.91 ? 44  DT  I OP1   1 
ATOM   2191  O OP2   . DT  A 1 108 ? 111.914 97.282  52.201  1.00 111.31 ? 44  DT  I OP2   1 
ATOM   2192  O "O5'" . DT  A 1 108 ? 109.577 96.426  52.080  1.00 110.43 ? 44  DT  I "O5'" 1 
ATOM   2193  C "C5'" . DT  A 1 108 ? 108.600 95.413  51.879  1.00 108.82 ? 44  DT  I "C5'" 1 
ATOM   2194  C "C4'" . DT  A 1 108 ? 107.222 95.972  52.135  1.00 107.68 ? 44  DT  I "C4'" 1 
ATOM   2195  O "O4'" . DT  A 1 108 ? 107.043 96.170  53.557  1.00 107.61 ? 44  DT  I "O4'" 1 
ATOM   2196  C "C3'" . DT  A 1 108 ? 106.999 97.332  51.481  1.00 106.74 ? 44  DT  I "C3'" 1 
ATOM   2197  O "O3'" . DT  A 1 108 ? 105.674 97.406  50.948  1.00 105.55 ? 44  DT  I "O3'" 1 
ATOM   2198  C "C2'" . DT  A 1 108 ? 107.241 98.318  52.611  1.00 106.83 ? 44  DT  I "C2'" 1 
ATOM   2199  C "C1'" . DT  A 1 108 ? 106.839 97.543  53.858  1.00 106.50 ? 44  DT  I "C1'" 1 
ATOM   2200  N N1    . DT  A 1 108 ? 107.647 97.863  55.056  1.00 105.48 ? 44  DT  I N1    1 
ATOM   2201  C C2    . DT  A 1 108 ? 107.008 97.979  56.275  1.00 105.11 ? 44  DT  I C2    1 
ATOM   2202  O O2    . DT  A 1 108 ? 105.804 97.845  56.418  1.00 104.06 ? 44  DT  I O2    1 
ATOM   2203  N N3    . DT  A 1 108 ? 107.839 98.263  57.330  1.00 104.55 ? 44  DT  I N3    1 
ATOM   2204  C C4    . DT  A 1 108 ? 109.207 98.445  57.291  1.00 105.00 ? 44  DT  I C4    1 
ATOM   2205  O O4    . DT  A 1 108 ? 109.823 98.692  58.323  1.00 104.80 ? 44  DT  I O4    1 
ATOM   2206  C C5    . DT  A 1 108 ? 109.809 98.321  55.983  1.00 104.33 ? 44  DT  I C5    1 
ATOM   2207  C C7    . DT  A 1 108 ? 111.285 98.515  55.844  1.00 103.78 ? 44  DT  I C7    1 
ATOM   2208  C C6    . DT  A 1 108 ? 109.011 98.036  54.947  1.00 104.39 ? 44  DT  I C6    1 
ATOM   2209  P P     . DT  A 1 109 ? 105.003 98.838  50.677  1.00 104.81 ? 45  DT  I P     1 
ATOM   2210  O OP1   . DT  A 1 109 ? 104.001 98.664  49.595  1.00 104.84 ? 45  DT  I OP1   1 
ATOM   2211  O OP2   . DT  A 1 109 ? 106.067 99.864  50.536  1.00 104.13 ? 45  DT  I OP2   1 
ATOM   2212  O "O5'" . DT  A 1 109 ? 104.219 99.094  52.032  1.00 102.40 ? 45  DT  I "O5'" 1 
ATOM   2213  C "C5'" . DT  A 1 109 ? 103.535 98.019  52.666  1.00 98.39  ? 45  DT  I "C5'" 1 
ATOM   2214  C "C4'" . DT  A 1 109 ? 102.716 98.534  53.822  1.00 94.69  ? 45  DT  I "C4'" 1 
ATOM   2215  O "O4'" . DT  A 1 109 ? 103.585 98.861  54.930  1.00 94.23  ? 45  DT  I "O4'" 1 
ATOM   2216  C "C3'" . DT  A 1 109 ? 101.938 99.804  53.499  1.00 92.43  ? 45  DT  I "C3'" 1 
ATOM   2217  O "O3'" . DT  A 1 109 ? 100.656 99.739  54.118  1.00 90.38  ? 45  DT  I "O3'" 1 
ATOM   2218  C "C2'" . DT  A 1 109 ? 102.803 100.906 54.090  1.00 92.19  ? 45  DT  I "C2'" 1 
ATOM   2219  C "C1'" . DT  A 1 109 ? 103.416 100.221 55.299  1.00 92.54  ? 45  DT  I "C1'" 1 
ATOM   2220  N N1    . DT  A 1 109 ? 104.732 100.736 55.717  1.00 90.89  ? 45  DT  I N1    1 
ATOM   2221  C C2    . DT  A 1 109 ? 104.881 101.156 57.018  1.00 90.87  ? 45  DT  I C2    1 
ATOM   2222  O O2    . DT  A 1 109 ? 103.968 101.157 57.826  1.00 90.94  ? 45  DT  I O2    1 
ATOM   2223  N N3    . DT  A 1 109 ? 106.143 101.581 57.342  1.00 89.92  ? 45  DT  I N3    1 
ATOM   2224  C C4    . DT  A 1 109 ? 107.245 101.635 56.514  1.00 89.86  ? 45  DT  I C4    1 
ATOM   2225  O O4    . DT  A 1 109 ? 108.322 102.029 56.954  1.00 88.53  ? 45  DT  I O4    1 
ATOM   2226  C C5    . DT  A 1 109 ? 107.012 101.200 55.153  1.00 90.48  ? 45  DT  I C5    1 
ATOM   2227  C C7    . DT  A 1 109 ? 108.143 101.238 54.174  1.00 89.71  ? 45  DT  I C7    1 
ATOM   2228  C C6    . DT  A 1 109 ? 105.783 100.777 54.829  1.00 90.80  ? 45  DT  I C6    1 
ATOM   2229  P P     . DT  A 1 110 ? 99.689  101.017 54.081  1.00 90.96  ? 46  DT  I P     1 
ATOM   2230  O OP1   . DT  A 1 110 ? 98.297  100.539 53.899  1.00 90.11  ? 46  DT  I OP1   1 
ATOM   2231  O OP2   . DT  A 1 110 ? 100.259 102.006 53.129  1.00 90.88  ? 46  DT  I OP2   1 
ATOM   2232  O "O5'" . DT  A 1 110 ? 99.836  101.611 55.549  1.00 91.17  ? 46  DT  I "O5'" 1 
ATOM   2233  C "C5'" . DT  A 1 110 ? 99.343  100.890 56.674  1.00 91.32  ? 46  DT  I "C5'" 1 
ATOM   2234  C "C4'" . DT  A 1 110 ? 98.974  101.850 57.779  1.00 90.83  ? 46  DT  I "C4'" 1 
ATOM   2235  O "O4'" . DT  A 1 110 ? 100.193 102.278 58.429  1.00 91.88  ? 46  DT  I "O4'" 1 
ATOM   2236  C "C3'" . DT  A 1 110 ? 98.286  103.115 57.272  1.00 91.10  ? 46  DT  I "C3'" 1 
ATOM   2237  O "O3'" . DT  A 1 110 ? 97.006  103.374 57.868  1.00 90.49  ? 46  DT  I "O3'" 1 
ATOM   2238  C "C2'" . DT  A 1 110 ? 99.315  104.224 57.410  1.00 91.65  ? 46  DT  I "C2'" 1 
ATOM   2239  C "C1'" . DT  A 1 110 ? 100.338 103.691 58.399  1.00 91.93  ? 46  DT  I "C1'" 1 
ATOM   2240  N N1    . DT  A 1 110 ? 101.733 103.988 58.008  1.00 92.46  ? 46  DT  I N1    1 
ATOM   2241  C C2    . DT  A 1 110 ? 102.650 104.290 58.990  1.00 93.49  ? 46  DT  I C2    1 
ATOM   2242  O O2    . DT  A 1 110 ? 102.368 104.330 60.176  1.00 95.77  ? 46  DT  I O2    1 
ATOM   2243  N N3    . DT  A 1 110 ? 103.918 104.548 58.530  1.00 93.44  ? 46  DT  I N3    1 
ATOM   2244  C C4    . DT  A 1 110 ? 104.350 104.536 57.216  1.00 93.85  ? 46  DT  I C4    1 
ATOM   2245  O O4    . DT  A 1 110 ? 105.524 104.785 56.952  1.00 93.43  ? 46  DT  I O4    1 
ATOM   2246  C C5    . DT  A 1 110 ? 103.337 104.217 56.240  1.00 93.81  ? 46  DT  I C5    1 
ATOM   2247  C C7    . DT  A 1 110 ? 103.712 104.183 54.792  1.00 94.46  ? 46  DT  I C7    1 
ATOM   2248  C C6    . DT  A 1 110 ? 102.098 103.961 56.679  1.00 93.46  ? 46  DT  I C6    1 
ATOM   2249  P P     . DT  A 1 111 ? 96.805  103.318 59.458  1.00 86.69  ? 47  DT  I P     1 
ATOM   2250  O OP1   . DT  A 1 111 ? 96.768  101.888 59.852  1.00 87.66  ? 47  DT  I OP1   1 
ATOM   2251  O OP2   . DT  A 1 111 ? 95.632  104.184 59.733  1.00 87.77  ? 47  DT  I OP2   1 
ATOM   2252  O "O5'" . DT  A 1 111 ? 98.098  103.989 60.099  1.00 84.30  ? 47  DT  I "O5'" 1 
ATOM   2253  C "C5'" . DT  A 1 111 ? 98.671  103.428 61.279  1.00 80.56  ? 47  DT  I "C5'" 1 
ATOM   2254  C "C4'" . DT  A 1 111 ? 99.149  104.509 62.222  1.00 76.13  ? 47  DT  I "C4'" 1 
ATOM   2255  O "O4'" . DT  A 1 111 ? 100.378 105.092 61.738  1.00 75.64  ? 47  DT  I "O4'" 1 
ATOM   2256  C "C3'" . DT  A 1 111 ? 98.190  105.669 62.490  1.00 75.22  ? 47  DT  I "C3'" 1 
ATOM   2257  O "O3'" . DT  A 1 111 ? 98.234  105.996 63.878  1.00 72.44  ? 47  DT  I "O3'" 1 
ATOM   2258  C "C2'" . DT  A 1 111 ? 98.785  106.807 61.680  1.00 76.88  ? 47  DT  I "C2'" 1 
ATOM   2259  C "C1'" . DT  A 1 111 ? 100.274 106.505 61.724  1.00 77.42  ? 47  DT  I "C1'" 1 
ATOM   2260  N N1    . DT  A 1 111 ? 101.040 106.987 60.560  1.00 78.56  ? 47  DT  I N1    1 
ATOM   2261  C C2    . DT  A 1 111 ? 102.320 107.450 60.767  1.00 79.10  ? 47  DT  I C2    1 
ATOM   2262  O O2    . DT  A 1 111 ? 102.838 107.512 61.869  1.00 76.99  ? 47  DT  I O2    1 
ATOM   2263  N N3    . DT  A 1 111 ? 102.977 107.835 59.624  1.00 81.68  ? 47  DT  I N3    1 
ATOM   2264  C C4    . DT  A 1 111 ? 102.492 107.806 58.326  1.00 81.95  ? 47  DT  I C4    1 
ATOM   2265  O O4    . DT  A 1 111 ? 103.212 108.160 57.394  1.00 81.46  ? 47  DT  I O4    1 
ATOM   2266  C C5    . DT  A 1 111 ? 101.133 107.333 58.189  1.00 81.39  ? 47  DT  I C5    1 
ATOM   2267  C C7    . DT  A 1 111 ? 100.513 107.289 56.829  1.00 81.28  ? 47  DT  I C7    1 
ATOM   2268  C C6    . DT  A 1 111 ? 100.484 106.954 59.297  1.00 79.97  ? 47  DT  I C6    1 
ATOM   2269  P P     . DG  A 1 112 ? 97.076  106.892 64.534  1.00 72.04  ? 48  DG  I P     1 
ATOM   2270  O OP1   . DG  A 1 112 ? 95.946  106.033 64.968  1.00 72.06  ? 48  DG  I OP1   1 
ATOM   2271  O OP2   . DG  A 1 112 ? 96.816  108.046 63.643  1.00 72.01  ? 48  DG  I OP2   1 
ATOM   2272  O "O5'" . DG  A 1 112 ? 97.782  107.448 65.841  1.00 66.07  ? 48  DG  I "O5'" 1 
ATOM   2273  C "C5'" . DG  A 1 112 ? 98.814  106.703 66.470  1.00 58.87  ? 48  DG  I "C5'" 1 
ATOM   2274  C "C4'" . DG  A 1 112 ? 99.903  107.632 66.940  1.00 54.74  ? 48  DG  I "C4'" 1 
ATOM   2275  O "O4'" . DG  A 1 112 ? 100.643 108.139 65.807  1.00 54.83  ? 48  DG  I "O4'" 1 
ATOM   2276  C "C3'" . DG  A 1 112 ? 99.387  108.858 67.683  1.00 51.33  ? 48  DG  I "C3'" 1 
ATOM   2277  O "O3'" . DG  A 1 112 ? 100.339 109.201 68.675  1.00 46.72  ? 48  DG  I "O3'" 1 
ATOM   2278  C "C2'" . DG  A 1 112 ? 99.334  109.922 66.604  1.00 53.93  ? 48  DG  I "C2'" 1 
ATOM   2279  C "C1'" . DG  A 1 112 ? 100.514 109.552 65.717  1.00 54.84  ? 48  DG  I "C1'" 1 
ATOM   2280  N N9    . DG  A 1 112 ? 100.319 109.875 64.306  1.00 61.48  ? 48  DG  I N9    1 
ATOM   2281  C C8    . DG  A 1 112 ? 99.151  109.761 63.592  1.00 59.28  ? 48  DG  I C8    1 
ATOM   2282  N N7    . DG  A 1 112 ? 99.287  110.074 62.336  1.00 61.76  ? 48  DG  I N7    1 
ATOM   2283  C C5    . DG  A 1 112 ? 100.622 110.426 62.209  1.00 62.63  ? 48  DG  I C5    1 
ATOM   2284  C C6    . DG  A 1 112 ? 101.352 110.841 61.073  1.00 64.13  ? 48  DG  I C6    1 
ATOM   2285  O O6    . DG  A 1 112 ? 100.948 110.979 59.916  1.00 66.11  ? 48  DG  I O6    1 
ATOM   2286  N N1    . DG  A 1 112 ? 102.682 111.103 61.386  1.00 63.02  ? 48  DG  I N1    1 
ATOM   2287  C C2    . DG  A 1 112 ? 103.239 110.976 62.632  1.00 63.16  ? 48  DG  I C2    1 
ATOM   2288  N N2    . DG  A 1 112 ? 104.537 111.286 62.731  1.00 63.24  ? 48  DG  I N2    1 
ATOM   2289  N N3    . DG  A 1 112 ? 102.571 110.578 63.702  1.00 62.07  ? 48  DG  I N3    1 
ATOM   2290  C C4    . DG  A 1 112 ? 101.273 110.321 63.419  1.00 62.64  ? 48  DG  I C4    1 
ATOM   2291  P P     . DG  A 1 113 ? 100.028 110.374 69.717  1.00 47.26  ? 49  DG  I P     1 
ATOM   2292  O OP1   . DG  A 1 113 ? 100.358 109.816 71.054  1.00 45.84  ? 49  DG  I OP1   1 
ATOM   2293  O OP2   . DG  A 1 113 ? 98.701  110.956 69.474  1.00 43.07  ? 49  DG  I OP2   1 
ATOM   2294  O "O5'" . DG  A 1 113 ? 101.139 111.449 69.367  1.00 46.98  ? 49  DG  I "O5'" 1 
ATOM   2295  C "C5'" . DG  A 1 113 ? 102.503 111.050 69.318  1.00 55.28  ? 49  DG  I "C5'" 1 
ATOM   2296  C "C4'" . DG  A 1 113 ? 103.350 112.156 68.740  1.00 59.01  ? 49  DG  I "C4'" 1 
ATOM   2297  O "O4'" . DG  A 1 113 ? 103.144 112.253 67.313  1.00 60.78  ? 49  DG  I "O4'" 1 
ATOM   2298  C "C3'" . DG  A 1 113 ? 103.034 113.535 69.312  1.00 62.29  ? 49  DG  I "C3'" 1 
ATOM   2299  O "O3'" . DG  A 1 113 ? 104.249 114.198 69.629  1.00 64.72  ? 49  DG  I "O3'" 1 
ATOM   2300  C "C2'" . DG  A 1 113 ? 102.297 114.242 68.186  1.00 62.01  ? 49  DG  I "C2'" 1 
ATOM   2301  C "C1'" . DG  A 1 113 ? 102.930 113.610 66.965  1.00 63.21  ? 49  DG  I "C1'" 1 
ATOM   2302  N N9    . DG  A 1 113 ? 102.134 113.641 65.742  1.00 63.44  ? 49  DG  I N9    1 
ATOM   2303  C C8    . DG  A 1 113 ? 100.798 113.371 65.606  1.00 64.17  ? 49  DG  I C8    1 
ATOM   2304  N N7    . DG  A 1 113 ? 100.381 113.464 64.371  1.00 66.46  ? 49  DG  I N7    1 
ATOM   2305  C C5    . DG  A 1 113 ? 101.510 113.825 63.652  1.00 64.97  ? 49  DG  I C5    1 
ATOM   2306  C C6    . DG  A 1 113 ? 101.678 114.072 62.264  1.00 67.58  ? 49  DG  I C6    1 
ATOM   2307  O O6    . DG  A 1 113 ? 100.828 114.027 61.359  1.00 66.11  ? 49  DG  I O6    1 
ATOM   2308  N N1    . DG  A 1 113 ? 102.997 114.404 61.960  1.00 66.57  ? 49  DG  I N1    1 
ATOM   2309  C C2    . DG  A 1 113 ? 104.017 114.499 62.871  1.00 66.72  ? 49  DG  I C2    1 
ATOM   2310  N N2    . DG  A 1 113 ? 105.216 114.836 62.382  1.00 64.57  ? 49  DG  I N2    1 
ATOM   2311  N N3    . DG  A 1 113 ? 103.871 114.277 64.168  1.00 67.01  ? 49  DG  I N3    1 
ATOM   2312  C C4    . DG  A 1 113 ? 102.600 113.944 64.484  1.00 65.32  ? 49  DG  I C4    1 
ATOM   2313  P P     . DT  A 1 114 ? 104.202 115.663 70.260  1.00 69.64  ? 50  DT  I P     1 
ATOM   2314  O OP1   . DT  A 1 114 ? 105.217 115.758 71.334  1.00 70.66  ? 50  DT  I OP1   1 
ATOM   2315  O OP2   . DT  A 1 114 ? 102.785 115.996 70.552  1.00 69.26  ? 50  DT  I OP2   1 
ATOM   2316  O "O5'" . DT  A 1 114 ? 104.702 116.547 69.040  1.00 75.27  ? 50  DT  I "O5'" 1 
ATOM   2317  C "C5'" . DT  A 1 114 ? 105.870 116.162 68.322  1.00 80.35  ? 50  DT  I "C5'" 1 
ATOM   2318  C "C4'" . DT  A 1 114 ? 106.190 117.192 67.272  1.00 84.59  ? 50  DT  I "C4'" 1 
ATOM   2319  O "O4'" . DT  A 1 114 ? 105.359 116.995 66.104  1.00 85.30  ? 50  DT  I "O4'" 1 
ATOM   2320  C "C3'" . DT  A 1 114 ? 105.939 118.621 67.745  1.00 87.25  ? 50  DT  I "C3'" 1 
ATOM   2321  O "O3'" . DT  A 1 114 ? 107.029 119.455 67.367  1.00 91.85  ? 50  DT  I "O3'" 1 
ATOM   2322  C "C2'" . DT  A 1 114 ? 104.648 119.015 67.046  1.00 85.46  ? 50  DT  I "C2'" 1 
ATOM   2323  C "C1'" . DT  A 1 114 ? 104.702 118.203 65.765  1.00 85.20  ? 50  DT  I "C1'" 1 
ATOM   2324  N N1    . DT  A 1 114 ? 103.393 117.852 65.185  1.00 86.09  ? 50  DT  I N1    1 
ATOM   2325  C C2    . DT  A 1 114 ? 103.284 117.817 63.812  1.00 86.61  ? 50  DT  I C2    1 
ATOM   2326  O O2    . DT  A 1 114 ? 104.212 118.080 63.064  1.00 86.63  ? 50  DT  I O2    1 
ATOM   2327  N N3    . DT  A 1 114 ? 102.041 117.461 63.344  1.00 84.74  ? 50  DT  I N3    1 
ATOM   2328  C C4    . DT  A 1 114 ? 100.924 117.151 64.095  1.00 84.90  ? 50  DT  I C4    1 
ATOM   2329  O O4    . DT  A 1 114 ? 99.876  116.841 63.537  1.00 84.09  ? 50  DT  I O4    1 
ATOM   2330  C C5    . DT  A 1 114 ? 101.106 117.221 65.524  1.00 84.52  ? 50  DT  I C5    1 
ATOM   2331  C C7    . DT  A 1 114 ? 99.946  116.913 66.415  1.00 85.08  ? 50  DT  I C7    1 
ATOM   2332  C C6    . DT  A 1 114 ? 102.314 117.563 65.993  1.00 85.48  ? 50  DT  I C6    1 
ATOM   2333  P P     . DA  A 1 115 ? 106.956 121.025 67.660  1.00 95.39  ? 51  DA  I P     1 
ATOM   2334  O OP1   . DA  A 1 115 ? 108.331 121.513 67.941  1.00 95.49  ? 51  DA  I OP1   1 
ATOM   2335  O OP2   . DA  A 1 115 ? 105.872 121.268 68.645  1.00 95.40  ? 51  DA  I OP2   1 
ATOM   2336  O "O5'" . DA  A 1 115 ? 106.480 121.599 66.258  1.00 98.45  ? 51  DA  I "O5'" 1 
ATOM   2337  C "C5'" . DA  A 1 115 ? 107.261 121.386 65.089  1.00 102.60 ? 51  DA  I "C5'" 1 
ATOM   2338  C "C4'" . DA  A 1 115 ? 106.920 122.435 64.063  1.00 105.96 ? 51  DA  I "C4'" 1 
ATOM   2339  O "O4'" . DA  A 1 115 ? 105.718 122.043 63.355  1.00 105.71 ? 51  DA  I "O4'" 1 
ATOM   2340  C "C3'" . DA  A 1 115 ? 106.614 123.775 64.727  1.00 108.56 ? 51  DA  I "C3'" 1 
ATOM   2341  O "O3'" . DA  A 1 115 ? 107.186 124.863 64.007  1.00 112.68 ? 51  DA  I "O3'" 1 
ATOM   2342  C "C2'" . DA  A 1 115 ? 105.098 123.837 64.737  1.00 107.55 ? 51  DA  I "C2'" 1 
ATOM   2343  C "C1'" . DA  A 1 115 ? 104.705 123.020 63.519  1.00 106.19 ? 51  DA  I "C1'" 1 
ATOM   2344  N N9    . DA  A 1 115 ? 103.429 122.322 63.680  1.00 104.67 ? 51  DA  I N9    1 
ATOM   2345  C C8    . DA  A 1 115 ? 102.819 121.970 64.858  1.00 104.54 ? 51  DA  I C8    1 
ATOM   2346  N N7    . DA  A 1 115 ? 101.670 121.362 64.698  1.00 104.04 ? 51  DA  I N7    1 
ATOM   2347  C C5    . DA  A 1 115 ? 101.513 121.305 63.321  1.00 104.42 ? 51  DA  I C5    1 
ATOM   2348  C C6    . DA  A 1 115 ? 100.496 120.780 62.506  1.00 104.25 ? 51  DA  I C6    1 
ATOM   2349  N N6    . DA  A 1 115 ? 99.399  120.188 62.984  1.00 104.30 ? 51  DA  I N6    1 
ATOM   2350  N N1    . DA  A 1 115 ? 100.646 120.887 61.168  1.00 103.64 ? 51  DA  I N1    1 
ATOM   2351  C C2    . DA  A 1 115 ? 101.745 121.479 60.693  1.00 103.11 ? 51  DA  I C2    1 
ATOM   2352  N N3    . DA  A 1 115 ? 102.770 122.010 61.355  1.00 103.80 ? 51  DA  I N3    1 
ATOM   2353  C C4    . DA  A 1 115 ? 102.591 121.890 62.681  1.00 104.25 ? 51  DA  I C4    1 
ATOM   2354  P P     . DG  A 1 116 ? 106.718 126.358 64.338  1.00 116.17 ? 52  DG  I P     1 
ATOM   2355  O OP1   . DG  A 1 116 ? 107.866 127.256 64.050  1.00 116.57 ? 52  DG  I OP1   1 
ATOM   2356  O OP2   . DG  A 1 116 ? 106.085 126.386 65.681  1.00 115.65 ? 52  DG  I OP2   1 
ATOM   2357  O "O5'" . DG  A 1 116 ? 105.594 126.605 63.242  1.00 118.38 ? 52  DG  I "O5'" 1 
ATOM   2358  C "C5'" . DG  A 1 116 ? 105.838 126.245 61.886  1.00 122.11 ? 52  DG  I "C5'" 1 
ATOM   2359  C "C4'" . DG  A 1 116 ? 104.733 126.762 60.999  1.00 124.80 ? 52  DG  I "C4'" 1 
ATOM   2360  O "O4'" . DG  A 1 116 ? 103.572 125.901 61.093  1.00 125.33 ? 52  DG  I "O4'" 1 
ATOM   2361  C "C3'" . DG  A 1 116 ? 104.260 128.170 61.357  1.00 126.24 ? 52  DG  I "C3'" 1 
ATOM   2362  O "O3'" . DG  A 1 116 ? 104.068 128.942 60.172  1.00 128.21 ? 52  DG  I "O3'" 1 
ATOM   2363  C "C2'" . DG  A 1 116 ? 102.941 127.929 62.070  1.00 126.57 ? 52  DG  I "C2'" 1 
ATOM   2364  C "C1'" . DG  A 1 116 ? 102.423 126.677 61.384  1.00 126.17 ? 52  DG  I "C1'" 1 
ATOM   2365  N N9    . DG  A 1 116 ? 101.529 125.868 62.208  1.00 126.43 ? 52  DG  I N9    1 
ATOM   2366  C C8    . DG  A 1 116 ? 101.537 125.758 63.578  1.00 126.67 ? 52  DG  I C8    1 
ATOM   2367  N N7    . DG  A 1 116 ? 100.597 124.977 64.034  1.00 127.03 ? 52  DG  I N7    1 
ATOM   2368  C C5    . DG  A 1 116 ? 99.930  124.541 62.898  1.00 126.82 ? 52  DG  I C5    1 
ATOM   2369  C C6    . DG  A 1 116 ? 98.814  123.672 62.764  1.00 127.15 ? 52  DG  I C6    1 
ATOM   2370  O O6    . DG  A 1 116 ? 98.172  123.098 63.651  1.00 127.71 ? 52  DG  I O6    1 
ATOM   2371  N N1    . DG  A 1 116 ? 98.465  123.496 61.430  1.00 126.78 ? 52  DG  I N1    1 
ATOM   2372  C C2    . DG  A 1 116 ? 99.101  124.077 60.362  1.00 126.35 ? 52  DG  I C2    1 
ATOM   2373  N N2    . DG  A 1 116 ? 98.612  123.780 59.151  1.00 126.09 ? 52  DG  I N2    1 
ATOM   2374  N N3    . DG  A 1 116 ? 100.140 124.890 60.474  1.00 126.25 ? 52  DG  I N3    1 
ATOM   2375  C C4    . DG  A 1 116 ? 100.497 125.077 61.761  1.00 126.48 ? 52  DG  I C4    1 
ATOM   2376  P P     . DA  A 1 117 ? 103.169 130.269 60.224  1.00 129.27 ? 53  DA  I P     1 
ATOM   2377  O OP1   . DA  A 1 117 ? 103.640 131.167 59.141  1.00 129.84 ? 53  DA  I OP1   1 
ATOM   2378  O OP2   . DA  A 1 117 ? 103.131 130.762 61.627  1.00 129.23 ? 53  DA  I OP2   1 
ATOM   2379  O "O5'" . DA  A 1 117 ? 101.725 129.736 59.825  1.00 129.57 ? 53  DA  I "O5'" 1 
ATOM   2380  C "C5'" . DA  A 1 117 ? 101.485 129.235 58.513  1.00 131.07 ? 53  DA  I "C5'" 1 
ATOM   2381  C "C4'" . DA  A 1 117 ? 100.057 129.503 58.107  1.00 132.06 ? 53  DA  I "C4'" 1 
ATOM   2382  O "O4'" . DA  A 1 117 ? 99.180  128.499 58.669  1.00 132.34 ? 53  DA  I "O4'" 1 
ATOM   2383  C "C3'" . DA  A 1 117 ? 99.526  130.854 58.580  1.00 132.71 ? 53  DA  I "C3'" 1 
ATOM   2384  O "O3'" . DA  A 1 117 ? 98.734  131.454 57.555  1.00 133.26 ? 53  DA  I "O3'" 1 
ATOM   2385  C "C2'" . DA  A 1 117 ? 98.695  130.497 59.801  1.00 132.64 ? 53  DA  I "C2'" 1 
ATOM   2386  C "C1'" . DA  A 1 117 ? 98.166  129.116 59.448  1.00 132.73 ? 53  DA  I "C1'" 1 
ATOM   2387  N N9    . DA  A 1 117 ? 97.904  128.252 60.598  1.00 133.24 ? 53  DA  I N9    1 
ATOM   2388  C C8    . DA  A 1 117 ? 98.602  128.178 61.781  1.00 133.36 ? 53  DA  I C8    1 
ATOM   2389  N N7    . DA  A 1 117 ? 98.124  127.293 62.622  1.00 133.21 ? 53  DA  I N7    1 
ATOM   2390  C C5    . DA  A 1 117 ? 97.037  126.750 61.952  1.00 133.28 ? 53  DA  I C5    1 
ATOM   2391  C C6    . DA  A 1 117 ? 96.105  125.759 62.308  1.00 133.09 ? 53  DA  I C6    1 
ATOM   2392  N N6    . DA  A 1 117 ? 96.124  125.111 63.473  1.00 133.27 ? 53  DA  I N6    1 
ATOM   2393  N N1    . DA  A 1 117 ? 95.143  125.452 61.412  1.00 133.21 ? 53  DA  I N1    1 
ATOM   2394  C C2    . DA  A 1 117 ? 95.125  126.102 60.241  1.00 133.16 ? 53  DA  I C2    1 
ATOM   2395  N N3    . DA  A 1 117 ? 95.942  127.050 59.792  1.00 133.27 ? 53  DA  I N3    1 
ATOM   2396  C C4    . DA  A 1 117 ? 96.889  127.333 60.706  1.00 133.36 ? 53  DA  I C4    1 
ATOM   2397  P P     . DA  A 1 118 ? 97.761  132.680 57.912  1.00 132.98 ? 54  DA  I P     1 
ATOM   2398  O OP1   . DA  A 1 118 ? 97.476  133.426 56.661  1.00 133.33 ? 54  DA  I OP1   1 
ATOM   2399  O OP2   . DA  A 1 118 ? 98.325  133.395 59.085  1.00 132.80 ? 54  DA  I OP2   1 
ATOM   2400  O "O5'" . DA  A 1 118 ? 96.427  131.941 58.365  1.00 132.92 ? 54  DA  I "O5'" 1 
ATOM   2401  C "C5'" . DA  A 1 118 ? 95.834  130.956 57.525  1.00 132.75 ? 54  DA  I "C5'" 1 
ATOM   2402  C "C4'" . DA  A 1 118 ? 94.425  130.669 57.982  1.00 132.55 ? 54  DA  I "C4'" 1 
ATOM   2403  O "O4'" . DA  A 1 118 ? 94.436  129.788 59.131  1.00 132.83 ? 54  DA  I "O4'" 1 
ATOM   2404  C "C3'" . DA  A 1 118 ? 93.659  131.922 58.407  1.00 132.46 ? 54  DA  I "C3'" 1 
ATOM   2405  O "O3'" . DA  A 1 118 ? 92.320  131.845 57.932  1.00 131.79 ? 54  DA  I "O3'" 1 
ATOM   2406  C "C2'" . DA  A 1 118 ? 93.700  131.863 59.921  1.00 132.58 ? 54  DA  I "C2'" 1 
ATOM   2407  C "C1'" . DA  A 1 118 ? 93.697  130.370 60.193  1.00 132.72 ? 54  DA  I "C1'" 1 
ATOM   2408  N N9    . DA  A 1 118 ? 94.342  129.996 61.452  1.00 132.47 ? 54  DA  I N9    1 
ATOM   2409  C C8    . DA  A 1 118 ? 95.500  130.508 61.983  1.00 132.13 ? 54  DA  I C8    1 
ATOM   2410  N N7    . DA  A 1 118 ? 95.828  129.987 63.140  1.00 131.94 ? 54  DA  I N7    1 
ATOM   2411  C C5    . DA  A 1 118 ? 94.822  129.062 63.387  1.00 131.86 ? 54  DA  I C5    1 
ATOM   2412  C C6    . DA  A 1 118 ? 94.594  128.176 64.455  1.00 131.43 ? 54  DA  I C6    1 
ATOM   2413  N N6    . DA  A 1 118 ? 95.396  128.075 65.516  1.00 131.03 ? 54  DA  I N6    1 
ATOM   2414  N N1    . DA  A 1 118 ? 93.499  127.390 64.394  1.00 131.20 ? 54  DA  I N1    1 
ATOM   2415  C C2    . DA  A 1 118 ? 92.696  127.491 63.329  1.00 131.53 ? 54  DA  I C2    1 
ATOM   2416  N N3    . DA  A 1 118 ? 92.804  128.285 62.263  1.00 131.84 ? 54  DA  I N3    1 
ATOM   2417  C C4    . DA  A 1 118 ? 93.901  129.054 62.354  1.00 132.12 ? 54  DA  I C4    1 
ATOM   2418  P P     . DT  A 1 119 ? 91.284  133.025 58.259  1.00 131.07 ? 55  DT  I P     1 
ATOM   2419  O OP1   . DT  A 1 119 ? 90.992  133.732 56.984  1.00 130.80 ? 55  DT  I OP1   1 
ATOM   2420  O OP2   . DT  A 1 119 ? 91.768  133.798 59.431  1.00 131.41 ? 55  DT  I OP2   1 
ATOM   2421  O "O5'" . DT  A 1 119 ? 89.987  132.207 58.678  1.00 129.80 ? 55  DT  I "O5'" 1 
ATOM   2422  C "C5'" . DT  A 1 119 ? 89.709  130.962 58.041  1.00 127.08 ? 55  DT  I "C5'" 1 
ATOM   2423  C "C4'" . DT  A 1 119 ? 88.901  130.064 58.946  1.00 124.56 ? 55  DT  I "C4'" 1 
ATOM   2424  O "O4'" . DT  A 1 119 ? 89.675  129.653 60.099  1.00 124.28 ? 55  DT  I "O4'" 1 
ATOM   2425  C "C3'" . DT  A 1 119 ? 87.613  130.675 59.492  1.00 122.78 ? 55  DT  I "C3'" 1 
ATOM   2426  O "O3'" . DT  A 1 119 ? 86.570  129.706 59.393  1.00 119.59 ? 55  DT  I "O3'" 1 
ATOM   2427  C "C2'" . DT  A 1 119 ? 87.945  130.965 60.946  1.00 122.99 ? 55  DT  I "C2'" 1 
ATOM   2428  C "C1'" . DT  A 1 119 ? 88.899  129.834 61.272  1.00 123.96 ? 55  DT  I "C1'" 1 
ATOM   2429  N N1    . DT  A 1 119 ? 89.818  130.079 62.402  1.00 124.45 ? 55  DT  I N1    1 
ATOM   2430  C C2    . DT  A 1 119 ? 89.711  129.265 63.510  1.00 124.63 ? 55  DT  I C2    1 
ATOM   2431  O O2    . DT  A 1 119 ? 88.884  128.372 63.606  1.00 124.32 ? 55  DT  I O2    1 
ATOM   2432  N N3    . DT  A 1 119 ? 90.613  129.537 64.509  1.00 124.35 ? 55  DT  I N3    1 
ATOM   2433  C C4    . DT  A 1 119 ? 91.583  130.519 64.516  1.00 124.22 ? 55  DT  I C4    1 
ATOM   2434  O O4    . DT  A 1 119 ? 92.330  130.635 65.483  1.00 123.72 ? 55  DT  I O4    1 
ATOM   2435  C C5    . DT  A 1 119 ? 91.629  131.345 63.330  1.00 124.30 ? 55  DT  I C5    1 
ATOM   2436  C C7    . DT  A 1 119 ? 92.638  132.447 63.255  1.00 124.57 ? 55  DT  I C7    1 
ATOM   2437  C C6    . DT  A 1 119 ? 90.757  131.087 62.344  1.00 124.48 ? 55  DT  I C6    1 
ATOM   2438  P P     . DC  A 1 120 ? 85.097  130.067 59.908  1.00 117.27 ? 56  DC  I P     1 
ATOM   2439  O OP1   . DC  A 1 120 ? 84.132  129.454 58.957  1.00 117.16 ? 56  DC  I OP1   1 
ATOM   2440  O OP2   . DC  A 1 120 ? 85.034  131.525 60.185  1.00 118.25 ? 56  DC  I OP2   1 
ATOM   2441  O "O5'" . DC  A 1 120 ? 85.004  129.284 61.290  1.00 114.33 ? 56  DC  I "O5'" 1 
ATOM   2442  C "C5'" . DC  A 1 120 ? 85.347  127.903 61.356  1.00 108.04 ? 56  DC  I "C5'" 1 
ATOM   2443  C "C4'" . DC  A 1 120 ? 85.172  127.385 62.764  1.00 103.55 ? 56  DC  I "C4'" 1 
ATOM   2444  O "O4'" . DC  A 1 120 ? 86.220  127.894 63.624  1.00 103.26 ? 56  DC  I "O4'" 1 
ATOM   2445  C "C3'" . DC  A 1 120 ? 83.851  127.766 63.434  1.00 99.14  ? 56  DC  I "C3'" 1 
ATOM   2446  O "O3'" . DC  A 1 120 ? 83.369  126.646 64.175  1.00 93.35  ? 56  DC  I "O3'" 1 
ATOM   2447  C "C2'" . DC  A 1 120 ? 84.248  128.890 64.376  1.00 99.73  ? 56  DC  I "C2'" 1 
ATOM   2448  C "C1'" . DC  A 1 120 ? 85.639  128.452 64.790  1.00 102.28 ? 56  DC  I "C1'" 1 
ATOM   2449  N N1    . DC  A 1 120 ? 86.532  129.517 65.277  1.00 102.62 ? 56  DC  I N1    1 
ATOM   2450  C C2    . DC  A 1 120 ? 87.098  129.386 66.549  1.00 102.58 ? 56  DC  I C2    1 
ATOM   2451  O O2    . DC  A 1 120 ? 86.816  128.393 67.232  1.00 101.97 ? 56  DC  I O2    1 
ATOM   2452  N N3    . DC  A 1 120 ? 87.934  130.343 67.003  1.00 103.15 ? 56  DC  I N3    1 
ATOM   2453  C C4    . DC  A 1 120 ? 88.205  131.405 66.244  1.00 103.68 ? 56  DC  I C4    1 
ATOM   2454  N N4    . DC  A 1 120 ? 89.036  132.327 66.733  1.00 104.10 ? 56  DC  I N4    1 
ATOM   2455  C C5    . DC  A 1 120 ? 87.635  131.569 64.947  1.00 103.45 ? 56  DC  I C5    1 
ATOM   2456  C C6    . DC  A 1 120 ? 86.811  130.609 64.507  1.00 102.87 ? 56  DC  I C6    1 
ATOM   2457  P P     . DT  A 1 121 ? 81.852  126.623 64.688  1.00 88.49  ? 57  DT  I P     1 
ATOM   2458  O OP1   . DT  A 1 121 ? 81.283  125.277 64.419  1.00 87.00  ? 57  DT  I OP1   1 
ATOM   2459  O OP2   . DT  A 1 121 ? 81.172  127.829 64.157  1.00 88.25  ? 57  DT  I OP2   1 
ATOM   2460  O "O5'" . DT  A 1 121 ? 81.997  126.798 66.262  1.00 85.65  ? 57  DT  I "O5'" 1 
ATOM   2461  C "C5'" . DT  A 1 121 ? 82.557  125.762 67.056  1.00 78.01  ? 57  DT  I "C5'" 1 
ATOM   2462  C "C4'" . DT  A 1 121 ? 82.584  126.180 68.506  1.00 73.14  ? 57  DT  I "C4'" 1 
ATOM   2463  O "O4'" . DT  A 1 121 ? 83.592  127.199 68.709  1.00 71.26  ? 57  DT  I "O4'" 1 
ATOM   2464  C "C3'" . DT  A 1 121 ? 81.269  126.778 69.014  1.00 70.29  ? 57  DT  I "C3'" 1 
ATOM   2465  O "O3'" . DT  A 1 121 ? 81.044  126.346 70.353  1.00 66.37  ? 57  DT  I "O3'" 1 
ATOM   2466  C "C2'" . DT  A 1 121 ? 81.556  128.267 69.024  1.00 70.85  ? 57  DT  I "C2'" 1 
ATOM   2467  C "C1'" . DT  A 1 121 ? 83.013  128.267 69.428  1.00 73.21  ? 57  DT  I "C1'" 1 
ATOM   2468  N N1    . DT  A 1 121 ? 83.771  129.492 69.135  1.00 76.89  ? 57  DT  I N1    1 
ATOM   2469  C C2    . DT  A 1 121 ? 84.534  130.012 70.157  1.00 79.12  ? 57  DT  I C2    1 
ATOM   2470  O O2    . DT  A 1 121 ? 84.604  129.498 71.261  1.00 78.24  ? 57  DT  I O2    1 
ATOM   2471  N N3    . DT  A 1 121 ? 85.210  131.163 69.840  1.00 81.56  ? 57  DT  I N3    1 
ATOM   2472  C C4    . DT  A 1 121 ? 85.196  131.835 68.634  1.00 81.60  ? 57  DT  I C4    1 
ATOM   2473  O O4    . DT  A 1 121 ? 85.844  132.872 68.507  1.00 82.45  ? 57  DT  I O4    1 
ATOM   2474  C C5    . DT  A 1 121 ? 84.380  131.230 67.603  1.00 80.71  ? 57  DT  I C5    1 
ATOM   2475  C C7    . DT  A 1 121 ? 84.309  131.885 66.259  1.00 81.51  ? 57  DT  I C7    1 
ATOM   2476  C C6    . DT  A 1 121 ? 83.720  130.101 67.900  1.00 79.12  ? 57  DT  I C6    1 
ATOM   2477  P P     . DG  A 1 122 ? 79.739  125.486 70.707  1.00 62.15  ? 58  DG  I P     1 
ATOM   2478  O OP1   . DG  A 1 122 ? 79.741  124.259 69.881  1.00 62.58  ? 58  DG  I OP1   1 
ATOM   2479  O OP2   . DG  A 1 122 ? 78.565  126.390 70.676  1.00 62.70  ? 58  DG  I OP2   1 
ATOM   2480  O "O5'" . DG  A 1 122 ? 79.984  125.069 72.223  1.00 62.82  ? 58  DG  I "O5'" 1 
ATOM   2481  C "C5'" . DG  A 1 122 ? 81.146  124.335 72.600  1.00 56.51  ? 58  DG  I "C5'" 1 
ATOM   2482  C "C4'" . DG  A 1 122 ? 81.711  124.872 73.894  1.00 54.92  ? 58  DG  I "C4'" 1 
ATOM   2483  O "O4'" . DG  A 1 122 ? 82.316  126.170 73.683  1.00 53.53  ? 58  DG  I "O4'" 1 
ATOM   2484  C "C3'" . DG  A 1 122 ? 80.694  125.058 75.015  1.00 51.79  ? 58  DG  I "C3'" 1 
ATOM   2485  O "O3'" . DG  A 1 122 ? 81.309  124.719 76.260  1.00 46.85  ? 58  DG  I "O3'" 1 
ATOM   2486  C "C2'" . DG  A 1 122 ? 80.356  126.542 74.942  1.00 50.08  ? 58  DG  I "C2'" 1 
ATOM   2487  C "C1'" . DG  A 1 122 ? 81.652  127.176 74.450  1.00 54.34  ? 58  DG  I "C1'" 1 
ATOM   2488  N N9    . DG  A 1 122 ? 81.463  128.320 73.560  1.00 58.58  ? 58  DG  I N9    1 
ATOM   2489  C C8    . DG  A 1 122 ? 80.498  128.450 72.588  1.00 57.92  ? 58  DG  I C8    1 
ATOM   2490  N N7    . DG  A 1 122 ? 80.638  129.529 71.869  1.00 57.97  ? 58  DG  I N7    1 
ATOM   2491  C C5    . DG  A 1 122 ? 81.746  130.165 72.408  1.00 60.04  ? 58  DG  I C5    1 
ATOM   2492  C C6    . DG  A 1 122 ? 82.395  131.365 72.018  1.00 60.21  ? 58  DG  I C6    1 
ATOM   2493  O O6    . DG  A 1 122 ? 82.125  132.112 71.077  1.00 62.22  ? 58  DG  I O6    1 
ATOM   2494  N N1    . DG  A 1 122 ? 83.479  131.650 72.838  1.00 60.79  ? 58  DG  I N1    1 
ATOM   2495  C C2    . DG  A 1 122 ? 83.904  130.869 73.885  1.00 60.24  ? 58  DG  I C2    1 
ATOM   2496  N N2    . DG  A 1 122 ? 84.983  131.309 74.547  1.00 58.97  ? 58  DG  I N2    1 
ATOM   2497  N N3    . DG  A 1 122 ? 83.318  129.739 74.249  1.00 56.84  ? 58  DG  I N3    1 
ATOM   2498  C C4    . DG  A 1 122 ? 82.252  129.449 73.474  1.00 58.90  ? 58  DG  I C4    1 
ATOM   2499  P P     . DC  A 1 123 ? 80.456  124.782 77.621  1.00 51.37  ? 59  DC  I P     1 
ATOM   2500  O OP1   . DC  A 1 123 ? 81.007  123.760 78.558  1.00 50.87  ? 59  DC  I OP1   1 
ATOM   2501  O OP2   . DC  A 1 123 ? 79.015  124.744 77.268  1.00 54.15  ? 59  DC  I OP2   1 
ATOM   2502  O "O5'" . DC  A 1 123 ? 80.799  126.221 78.199  1.00 48.75  ? 59  DC  I "O5'" 1 
ATOM   2503  C "C5'" . DC  A 1 123 ? 82.155  126.603 78.406  1.00 51.32  ? 59  DC  I "C5'" 1 
ATOM   2504  C "C4'" . DC  A 1 123 ? 82.232  128.039 78.869  1.00 54.90  ? 59  DC  I "C4'" 1 
ATOM   2505  O "O4'" . DC  A 1 123 ? 82.031  128.950 77.765  1.00 52.95  ? 59  DC  I "O4'" 1 
ATOM   2506  C "C3'" . DC  A 1 123 ? 81.191  128.421 79.919  1.00 53.16  ? 59  DC  I "C3'" 1 
ATOM   2507  O "O3'" . DC  A 1 123 ? 81.774  129.377 80.796  1.00 56.82  ? 59  DC  I "O3'" 1 
ATOM   2508  C "C2'" . DC  A 1 123 ? 80.124  129.115 79.094  1.00 53.57  ? 59  DC  I "C2'" 1 
ATOM   2509  C "C1'" . DC  A 1 123 ? 81.004  129.865 78.119  1.00 54.55  ? 59  DC  I "C1'" 1 
ATOM   2510  N N1    . DC  A 1 123 ? 80.373  130.345 76.884  1.00 56.35  ? 59  DC  I N1    1 
ATOM   2511  C C2    . DC  A 1 123 ? 80.999  131.376 76.197  1.00 59.00  ? 59  DC  I C2    1 
ATOM   2512  O O2    . DC  A 1 123 ? 82.043  131.860 76.676  1.00 58.10  ? 59  DC  I O2    1 
ATOM   2513  N N3    . DC  A 1 123 ? 80.461  131.828 75.039  1.00 58.59  ? 59  DC  I N3    1 
ATOM   2514  C C4    . DC  A 1 123 ? 79.328  131.292 74.579  1.00 59.26  ? 59  DC  I C4    1 
ATOM   2515  N N4    . DC  A 1 123 ? 78.835  131.764 73.430  1.00 60.03  ? 59  DC  I N4    1 
ATOM   2516  C C5    . DC  A 1 123 ? 78.654  130.248 75.276  1.00 56.68  ? 59  DC  I C5    1 
ATOM   2517  C C6    . DC  A 1 123 ? 79.210  129.804 76.413  1.00 54.08  ? 59  DC  I C6    1 
ATOM   2518  P P     . DG  B 2 1   ? 81.632  141.183 70.718  1.00 91.87  ? -59 DG  J P     1 
ATOM   2519  O OP1   . DG  B 2 1   ? 80.878  142.465 70.759  1.00 91.29  ? -59 DG  J OP1   1 
ATOM   2520  O OP2   . DG  B 2 1   ? 81.796  140.463 69.426  1.00 90.94  ? -59 DG  J OP2   1 
ATOM   2521  O "O5'" . DG  B 2 1   ? 83.073  141.424 71.348  1.00 90.90  ? -59 DG  J "O5'" 1 
ATOM   2522  C "C5'" . DG  B 2 1   ? 83.210  141.959 72.662  1.00 91.26  ? -59 DG  J "C5'" 1 
ATOM   2523  C "C4'" . DG  B 2 1   ? 84.197  141.134 73.454  1.00 91.87  ? -59 DG  J "C4'" 1 
ATOM   2524  O "O4'" . DG  B 2 1   ? 83.616  139.853 73.793  1.00 91.28  ? -59 DG  J "O4'" 1 
ATOM   2525  C "C3'" . DG  B 2 1   ? 85.482  140.823 72.694  1.00 91.82  ? -59 DG  J "C3'" 1 
ATOM   2526  O "O3'" . DG  B 2 1   ? 86.589  140.837 73.590  1.00 91.16  ? -59 DG  J "O3'" 1 
ATOM   2527  C "C2'" . DG  B 2 1   ? 85.238  139.429 72.144  1.00 91.72  ? -59 DG  J "C2'" 1 
ATOM   2528  C "C1'" . DG  B 2 1   ? 84.369  138.795 73.215  1.00 90.50  ? -59 DG  J "C1'" 1 
ATOM   2529  N N9    . DG  B 2 1   ? 83.417  137.804 72.720  1.00 90.76  ? -59 DG  J N9    1 
ATOM   2530  C C8    . DG  B 2 1   ? 82.741  137.823 71.524  1.00 90.11  ? -59 DG  J C8    1 
ATOM   2531  N N7    . DG  B 2 1   ? 81.925  136.814 71.379  1.00 89.69  ? -59 DG  J N7    1 
ATOM   2532  C C5    . DG  B 2 1   ? 82.081  136.079 72.548  1.00 89.49  ? -59 DG  J C5    1 
ATOM   2533  C C6    . DG  B 2 1   ? 81.449  134.879 72.973  1.00 89.17  ? -59 DG  J C6    1 
ATOM   2534  O O6    . DG  B 2 1   ? 80.584  134.209 72.392  1.00 85.74  ? -59 DG  J O6    1 
ATOM   2535  N N1    . DG  B 2 1   ? 81.912  134.476 74.223  1.00 90.49  ? -59 DG  J N1    1 
ATOM   2536  C C2    . DG  B 2 1   ? 82.855  135.141 74.970  1.00 90.36  ? -59 DG  J C2    1 
ATOM   2537  N N2    . DG  B 2 1   ? 83.178  134.588 76.150  1.00 90.00  ? -59 DG  J N2    1 
ATOM   2538  N N3    . DG  B 2 1   ? 83.438  136.263 74.591  1.00 90.65  ? -59 DG  J N3    1 
ATOM   2539  C C4    . DG  B 2 1   ? 83.009  136.671 73.378  1.00 90.31  ? -59 DG  J C4    1 
ATOM   2540  P P     . DC  B 2 2   ? 88.076  140.742 73.005  1.00 92.11  ? -58 DC  J P     1 
ATOM   2541  O OP1   . DC  B 2 2   ? 88.912  141.712 73.756  1.00 91.57  ? -58 DC  J OP1   1 
ATOM   2542  O OP2   . DC  B 2 2   ? 88.016  140.808 71.521  1.00 91.32  ? -58 DC  J OP2   1 
ATOM   2543  O "O5'" . DC  B 2 2   ? 88.531  139.277 73.414  1.00 91.62  ? -58 DC  J "O5'" 1 
ATOM   2544  C "C5'" . DC  B 2 2   ? 88.524  138.876 74.775  1.00 92.67  ? -58 DC  J "C5'" 1 
ATOM   2545  C "C4'" . DC  B 2 2   ? 88.822  137.402 74.876  1.00 93.23  ? -58 DC  J "C4'" 1 
ATOM   2546  O "O4'" . DC  B 2 2   ? 87.676  136.624 74.454  1.00 92.98  ? -58 DC  J "O4'" 1 
ATOM   2547  C "C3'" . DC  B 2 2   ? 89.989  136.951 73.997  1.00 94.37  ? -58 DC  J "C3'" 1 
ATOM   2548  O "O3'" . DC  B 2 2   ? 90.755  135.985 74.705  1.00 95.94  ? -58 DC  J "O3'" 1 
ATOM   2549  C "C2'" . DC  B 2 2   ? 89.304  136.283 72.819  1.00 94.32  ? -58 DC  J "C2'" 1 
ATOM   2550  C "C1'" . DC  B 2 2   ? 88.102  135.664 73.504  1.00 94.17  ? -58 DC  J "C1'" 1 
ATOM   2551  N N1    . DC  B 2 2   ? 86.963  135.343 72.629  1.00 95.02  ? -58 DC  J N1    1 
ATOM   2552  C C2    . DC  B 2 2   ? 86.175  134.233 72.946  1.00 94.70  ? -58 DC  J C2    1 
ATOM   2553  O O2    . DC  B 2 2   ? 86.447  133.578 73.964  1.00 94.52  ? -58 DC  J O2    1 
ATOM   2554  N N3    . DC  B 2 2   ? 85.141  133.903 72.141  1.00 94.64  ? -58 DC  J N3    1 
ATOM   2555  C C4    . DC  B 2 2   ? 84.875  134.642 71.063  1.00 95.55  ? -58 DC  J C4    1 
ATOM   2556  N N4    . DC  B 2 2   ? 83.845  134.279 70.295  1.00 94.86  ? -58 DC  J N4    1 
ATOM   2557  C C5    . DC  B 2 2   ? 85.655  135.787 70.721  1.00 95.21  ? -58 DC  J C5    1 
ATOM   2558  C C6    . DC  B 2 2   ? 86.679  136.100 71.526  1.00 94.97  ? -58 DC  J C6    1 
ATOM   2559  P P     . DA  B 2 3   ? 92.320  136.226 74.922  1.00 96.74  ? -57 DA  J P     1 
ATOM   2560  O OP1   . DA  B 2 3   ? 92.489  137.548 75.574  1.00 96.39  ? -57 DA  J OP1   1 
ATOM   2561  O OP2   . DA  B 2 3   ? 92.998  135.949 73.629  1.00 97.58  ? -57 DA  J OP2   1 
ATOM   2562  O "O5'" . DA  B 2 3   ? 92.715  135.097 75.970  1.00 96.53  ? -57 DA  J "O5'" 1 
ATOM   2563  C "C5'" . DA  B 2 3   ? 91.998  134.959 77.193  1.00 94.86  ? -57 DA  J "C5'" 1 
ATOM   2564  C "C4'" . DA  B 2 3   ? 91.564  133.524 77.378  1.00 94.02  ? -57 DA  J "C4'" 1 
ATOM   2565  O "O4'" . DA  B 2 3   ? 90.582  133.190 76.368  1.00 94.29  ? -57 DA  J "O4'" 1 
ATOM   2566  C "C3'" . DA  B 2 3   ? 92.691  132.506 77.218  1.00 92.61  ? -57 DA  J "C3'" 1 
ATOM   2567  O "O3'" . DA  B 2 3   ? 92.487  131.414 78.117  1.00 92.24  ? -57 DA  J "O3'" 1 
ATOM   2568  C "C2'" . DA  B 2 3   ? 92.560  132.059 75.775  1.00 92.30  ? -57 DA  J "C2'" 1 
ATOM   2569  C "C1'" . DA  B 2 3   ? 91.063  132.148 75.530  1.00 92.95  ? -57 DA  J "C1'" 1 
ATOM   2570  N N9    . DA  B 2 3   ? 90.708  132.489 74.152  1.00 92.63  ? -57 DA  J N9    1 
ATOM   2571  C C8    . DA  B 2 3   ? 91.387  133.314 73.288  1.00 92.26  ? -57 DA  J C8    1 
ATOM   2572  N N7    . DA  B 2 3   ? 90.823  133.424 72.110  1.00 91.59  ? -57 DA  J N7    1 
ATOM   2573  C C5    . DA  B 2 3   ? 89.698  132.618 72.202  1.00 92.04  ? -57 DA  J C5    1 
ATOM   2574  C C6    . DA  B 2 3   ? 88.678  132.310 71.286  1.00 92.61  ? -57 DA  J C6    1 
ATOM   2575  N N6    . DA  B 2 3   ? 88.624  132.799 70.042  1.00 92.98  ? -57 DA  J N6    1 
ATOM   2576  N N1    . DA  B 2 3   ? 87.702  131.469 71.694  1.00 92.09  ? -57 DA  J N1    1 
ATOM   2577  C C2    . DA  B 2 3   ? 87.753  130.986 72.939  1.00 92.10  ? -57 DA  J C2    1 
ATOM   2578  N N3    . DA  B 2 3   ? 88.656  131.204 73.893  1.00 92.28  ? -57 DA  J N3    1 
ATOM   2579  C C4    . DA  B 2 3   ? 89.614  132.038 73.455  1.00 92.27  ? -57 DA  J C4    1 
ATOM   2580  P P     . DG  B 2 4   ? 93.515  130.182 78.119  1.00 90.61  ? -56 DG  J P     1 
ATOM   2581  O OP1   . DG  B 2 4   ? 93.592  129.663 79.508  1.00 90.98  ? -56 DG  J OP1   1 
ATOM   2582  O OP2   . DG  B 2 4   ? 94.754  130.620 77.424  1.00 91.25  ? -56 DG  J OP2   1 
ATOM   2583  O "O5'" . DG  B 2 4   ? 92.781  129.095 77.225  1.00 84.93  ? -56 DG  J "O5'" 1 
ATOM   2584  C "C5'" . DG  B 2 4   ? 91.450  128.718 77.534  1.00 81.44  ? -56 DG  J "C5'" 1 
ATOM   2585  C "C4'" . DG  B 2 4   ? 90.885  127.839 76.446  1.00 79.94  ? -56 DG  J "C4'" 1 
ATOM   2586  O "O4'" . DG  B 2 4   ? 90.684  128.579 75.220  1.00 79.13  ? -56 DG  J "O4'" 1 
ATOM   2587  C "C3'" . DG  B 2 4   ? 91.721  126.619 76.064  1.00 78.75  ? -56 DG  J "C3'" 1 
ATOM   2588  O "O3'" . DG  B 2 4   ? 90.809  125.561 75.799  1.00 77.23  ? -56 DG  J "O3'" 1 
ATOM   2589  C "C2'" . DG  B 2 4   ? 92.353  127.040 74.749  1.00 78.13  ? -56 DG  J "C2'" 1 
ATOM   2590  C "C1'" . DG  B 2 4   ? 91.197  127.807 74.151  1.00 79.18  ? -56 DG  J "C1'" 1 
ATOM   2591  N N9    . DG  B 2 4   ? 91.503  128.703 73.040  1.00 79.89  ? -56 DG  J N9    1 
ATOM   2592  C C8    . DG  B 2 4   ? 92.600  129.511 72.883  1.00 78.60  ? -56 DG  J C8    1 
ATOM   2593  N N7    . DG  B 2 4   ? 92.574  130.196 71.773  1.00 79.00  ? -56 DG  J N7    1 
ATOM   2594  C C5    . DG  B 2 4   ? 91.387  129.817 71.163  1.00 78.88  ? -56 DG  J C5    1 
ATOM   2595  C C6    . DG  B 2 4   ? 90.806  130.232 69.938  1.00 78.66  ? -56 DG  J C6    1 
ATOM   2596  O O6    . DG  B 2 4   ? 91.236  131.053 69.123  1.00 79.24  ? -56 DG  J O6    1 
ATOM   2597  N N1    . DG  B 2 4   ? 89.593  129.591 69.702  1.00 78.27  ? -56 DG  J N1    1 
ATOM   2598  C C2    . DG  B 2 4   ? 89.009  128.677 70.543  1.00 77.28  ? -56 DG  J C2    1 
ATOM   2599  N N2    . DG  B 2 4   ? 87.834  128.169 70.151  1.00 73.76  ? -56 DG  J N2    1 
ATOM   2600  N N3    . DG  B 2 4   ? 89.536  128.288 71.689  1.00 77.85  ? -56 DG  J N3    1 
ATOM   2601  C C4    . DG  B 2 4   ? 90.716  128.895 71.932  1.00 78.55  ? -56 DG  J C4    1 
ATOM   2602  P P     . DA  B 2 5   ? 91.312  124.047 75.803  1.00 75.32  ? -55 DA  J P     1 
ATOM   2603  O OP1   . DA  B 2 5   ? 90.891  123.475 77.101  1.00 74.32  ? -55 DA  J OP1   1 
ATOM   2604  O OP2   . DA  B 2 5   ? 92.737  124.001 75.402  1.00 75.61  ? -55 DA  J OP2   1 
ATOM   2605  O "O5'" . DA  B 2 5   ? 90.413  123.384 74.672  1.00 77.77  ? -55 DA  J "O5'" 1 
ATOM   2606  C "C5'" . DA  B 2 5   ? 88.994  123.475 74.747  1.00 83.79  ? -55 DA  J "C5'" 1 
ATOM   2607  C "C4'" . DA  B 2 5   ? 88.374  123.338 73.377  1.00 87.45  ? -55 DA  J "C4'" 1 
ATOM   2608  O "O4'" . DA  B 2 5   ? 88.728  124.470 72.546  1.00 87.96  ? -55 DA  J "O4'" 1 
ATOM   2609  C "C3'" . DA  B 2 5   ? 88.795  122.095 72.598  1.00 90.37  ? -55 DA  J "C3'" 1 
ATOM   2610  O "O3'" . DA  B 2 5   ? 87.663  121.575 71.906  1.00 94.95  ? -55 DA  J "O3'" 1 
ATOM   2611  C "C2'" . DA  B 2 5   ? 89.825  122.626 71.617  1.00 90.03  ? -55 DA  J "C2'" 1 
ATOM   2612  C "C1'" . DA  B 2 5   ? 89.292  124.014 71.326  1.00 89.15  ? -55 DA  J "C1'" 1 
ATOM   2613  N N9    . DA  B 2 5   ? 90.299  124.986 70.908  1.00 89.43  ? -55 DA  J N9    1 
ATOM   2614  C C8    . DA  B 2 5   ? 91.360  125.467 71.634  1.00 90.61  ? -55 DA  J C8    1 
ATOM   2615  N N7    . DA  B 2 5   ? 92.081  126.354 70.992  1.00 90.42  ? -55 DA  J N7    1 
ATOM   2616  C C5    . DA  B 2 5   ? 91.457  126.461 69.759  1.00 89.92  ? -55 DA  J C5    1 
ATOM   2617  C C6    . DA  B 2 5   ? 91.732  127.247 68.628  1.00 90.85  ? -55 DA  J C6    1 
ATOM   2618  N N6    . DA  B 2 5   ? 92.750  128.110 68.555  1.00 90.97  ? -55 DA  J N6    1 
ATOM   2619  N N1    . DA  B 2 5   ? 90.915  127.118 67.560  1.00 90.29  ? -55 DA  J N1    1 
ATOM   2620  C C2    . DA  B 2 5   ? 89.892  126.259 67.638  1.00 90.36  ? -55 DA  J C2    1 
ATOM   2621  N N3    . DA  B 2 5   ? 89.530  125.468 68.646  1.00 89.79  ? -55 DA  J N3    1 
ATOM   2622  C C4    . DA  B 2 5   ? 90.363  125.621 69.689  1.00 90.00  ? -55 DA  J C4    1 
ATOM   2623  P P     . DT  B 2 6   ? 87.833  120.294 70.960  1.00 99.11  ? -54 DT  J P     1 
ATOM   2624  O OP1   . DT  B 2 6   ? 86.600  119.476 71.093  1.00 100.22 ? -54 DT  J OP1   1 
ATOM   2625  O OP2   . DT  B 2 6   ? 89.154  119.678 71.235  1.00 99.60  ? -54 DT  J OP2   1 
ATOM   2626  O "O5'" . DT  B 2 6   ? 87.850  120.936 69.505  1.00 101.81 ? -54 DT  J "O5'" 1 
ATOM   2627  C "C5'" . DT  B 2 6   ? 86.818  121.832 69.107  1.00 106.15 ? -54 DT  J "C5'" 1 
ATOM   2628  C "C4'" . DT  B 2 6   ? 86.876  122.062 67.618  1.00 110.20 ? -54 DT  J "C4'" 1 
ATOM   2629  O "O4'" . DT  B 2 6   ? 87.902  123.034 67.295  1.00 110.76 ? -54 DT  J "O4'" 1 
ATOM   2630  C "C3'" . DT  B 2 6   ? 87.207  120.805 66.818  1.00 112.71 ? -54 DT  J "C3'" 1 
ATOM   2631  O "O3'" . DT  B 2 6   ? 86.399  120.738 65.641  1.00 115.32 ? -54 DT  J "O3'" 1 
ATOM   2632  C "C2'" . DT  B 2 6   ? 88.674  120.985 66.469  1.00 112.35 ? -54 DT  J "C2'" 1 
ATOM   2633  C "C1'" . DT  B 2 6   ? 88.793  122.491 66.335  1.00 111.36 ? -54 DT  J "C1'" 1 
ATOM   2634  N N1    . DT  B 2 6   ? 90.138  123.028 66.609  1.00 111.07 ? -54 DT  J N1    1 
ATOM   2635  C C2    . DT  B 2 6   ? 90.689  123.884 65.684  1.00 111.86 ? -54 DT  J C2    1 
ATOM   2636  O O2    . DT  B 2 6   ? 90.116  124.216 64.656  1.00 112.63 ? -54 DT  J O2    1 
ATOM   2637  N N3    . DT  B 2 6   ? 91.942  124.346 66.009  1.00 111.83 ? -54 DT  J N3    1 
ATOM   2638  C C4    . DT  B 2 6   ? 92.678  124.045 67.139  1.00 111.16 ? -54 DT  J C4    1 
ATOM   2639  O O4    . DT  B 2 6   ? 93.789  124.540 67.297  1.00 111.45 ? -54 DT  J O4    1 
ATOM   2640  C C5    . DT  B 2 6   ? 92.039  123.140 68.063  1.00 110.79 ? -54 DT  J C5    1 
ATOM   2641  C C7    . DT  B 2 6   ? 92.763  122.754 69.316  1.00 110.18 ? -54 DT  J C7    1 
ATOM   2642  C C6    . DT  B 2 6   ? 90.818  122.682 67.756  1.00 110.79 ? -54 DT  J C6    1 
ATOM   2643  P P     . DT  B 2 7   ? 86.738  119.657 64.507  1.00 116.86 ? -53 DT  J P     1 
ATOM   2644  O OP1   . DT  B 2 7   ? 85.464  119.203 63.894  1.00 117.28 ? -53 DT  J OP1   1 
ATOM   2645  O OP2   . DT  B 2 7   ? 87.671  118.657 65.088  1.00 117.16 ? -53 DT  J OP2   1 
ATOM   2646  O "O5'" . DT  B 2 7   ? 87.537  120.522 63.441  1.00 118.89 ? -53 DT  J "O5'" 1 
ATOM   2647  C "C5'" . DT  B 2 7   ? 86.927  121.659 62.833  1.00 121.56 ? -53 DT  J "C5'" 1 
ATOM   2648  C "C4'" . DT  B 2 7   ? 87.585  121.943 61.507  1.00 122.63 ? -53 DT  J "C4'" 1 
ATOM   2649  O "O4'" . DT  B 2 7   ? 88.835  122.640 61.725  1.00 121.60 ? -53 DT  J "O4'" 1 
ATOM   2650  C "C3'" . DT  B 2 7   ? 87.929  120.667 60.747  1.00 124.24 ? -53 DT  J "C3'" 1 
ATOM   2651  O "O3'" . DT  B 2 7   ? 87.682  120.819 59.351  1.00 127.53 ? -53 DT  J "O3'" 1 
ATOM   2652  C "C2'" . DT  B 2 7   ? 89.405  120.469 61.039  1.00 123.19 ? -53 DT  J "C2'" 1 
ATOM   2653  C "C1'" . DT  B 2 7   ? 89.917  121.889 61.202  1.00 121.68 ? -53 DT  J "C1'" 1 
ATOM   2654  N N1    . DT  B 2 7   ? 91.050  122.019 62.142  1.00 121.01 ? -53 DT  J N1    1 
ATOM   2655  C C2    . DT  B 2 7   ? 91.954  123.036 61.933  1.00 120.01 ? -53 DT  J C2    1 
ATOM   2656  O O2    . DT  B 2 7   ? 91.859  123.832 61.014  1.00 119.08 ? -53 DT  J O2    1 
ATOM   2657  N N3    . DT  B 2 7   ? 92.979  123.089 62.846  1.00 119.60 ? -53 DT  J N3    1 
ATOM   2658  C C4    . DT  B 2 7   ? 93.184  122.243 63.923  1.00 119.32 ? -53 DT  J C4    1 
ATOM   2659  O O4    . DT  B 2 7   ? 94.150  122.411 64.660  1.00 118.46 ? -53 DT  J O4    1 
ATOM   2660  C C5    . DT  B 2 7   ? 92.199  121.200 64.082  1.00 119.57 ? -53 DT  J C5    1 
ATOM   2661  C C7    . DT  B 2 7   ? 92.339  120.238 65.218  1.00 119.77 ? -53 DT  J C7    1 
ATOM   2662  C C6    . DT  B 2 7   ? 91.194  121.141 63.197  1.00 120.20 ? -53 DT  J C6    1 
ATOM   2663  P P     . DC  B 2 8   ? 88.321  119.773 58.320  1.00 130.10 ? -52 DC  J P     1 
ATOM   2664  O OP1   . DC  B 2 8   ? 87.547  119.856 57.055  1.00 130.31 ? -52 DC  J OP1   1 
ATOM   2665  O OP2   . DC  B 2 8   ? 88.476  118.460 59.002  1.00 129.23 ? -52 DC  J OP2   1 
ATOM   2666  O "O5'" . DC  B 2 8   ? 89.766  120.382 58.060  1.00 131.87 ? -52 DC  J "O5'" 1 
ATOM   2667  C "C5'" . DC  B 2 8   ? 89.901  121.712 57.572  1.00 134.76 ? -52 DC  J "C5'" 1 
ATOM   2668  C "C4'" . DC  B 2 8   ? 91.256  121.894 56.937  1.00 136.75 ? -52 DC  J "C4'" 1 
ATOM   2669  O "O4'" . DC  B 2 8   ? 92.249  122.246 57.933  1.00 137.15 ? -52 DC  J "O4'" 1 
ATOM   2670  C "C3'" . DC  B 2 8   ? 91.777  120.643 56.228  1.00 137.74 ? -52 DC  J "C3'" 1 
ATOM   2671  O "O3'" . DC  B 2 8   ? 92.362  121.003 54.979  1.00 139.28 ? -52 DC  J "O3'" 1 
ATOM   2672  C "C2'" . DC  B 2 8   ? 92.834  120.115 57.185  1.00 137.57 ? -52 DC  J "C2'" 1 
ATOM   2673  C "C1'" . DC  B 2 8   ? 93.375  121.397 57.789  1.00 137.08 ? -52 DC  J "C1'" 1 
ATOM   2674  N N1    . DC  B 2 8   ? 94.013  121.250 59.107  1.00 136.72 ? -52 DC  J N1    1 
ATOM   2675  C C2    . DC  B 2 8   ? 94.994  122.174 59.485  1.00 136.54 ? -52 DC  J C2    1 
ATOM   2676  O O2    . DC  B 2 8   ? 95.274  123.102 58.710  1.00 136.18 ? -52 DC  J O2    1 
ATOM   2677  N N3    . DC  B 2 8   ? 95.609  122.034 60.683  1.00 136.30 ? -52 DC  J N3    1 
ATOM   2678  C C4    . DC  B 2 8   ? 95.275  121.025 61.491  1.00 136.16 ? -52 DC  J C4    1 
ATOM   2679  N N4    . DC  B 2 8   ? 95.913  120.919 62.657  1.00 135.65 ? -52 DC  J N4    1 
ATOM   2680  C C5    . DC  B 2 8   ? 94.270  120.077 61.137  1.00 136.12 ? -52 DC  J C5    1 
ATOM   2681  C C6    . DC  B 2 8   ? 93.670  120.226 59.947  1.00 136.50 ? -52 DC  J C6    1 
ATOM   2682  P P     . DT  B 2 9   ? 93.140  119.898 54.114  1.00 140.51 ? -51 DT  J P     1 
ATOM   2683  O OP1   . DT  B 2 9   ? 92.654  119.986 52.715  1.00 140.91 ? -51 DT  J OP1   1 
ATOM   2684  O OP2   . DT  B 2 9   ? 93.087  118.598 54.829  1.00 139.76 ? -51 DT  J OP2   1 
ATOM   2685  O "O5'" . DT  B 2 9   ? 94.639  120.423 54.154  1.00 140.91 ? -51 DT  J "O5'" 1 
ATOM   2686  C "C5'" . DT  B 2 9   ? 94.955  121.740 53.713  1.00 141.90 ? -51 DT  J "C5'" 1 
ATOM   2687  C "C4'" . DT  B 2 9   ? 96.450  121.896 53.593  1.00 142.59 ? -51 DT  J "C4'" 1 
ATOM   2688  O "O4'" . DT  B 2 9   ? 97.032  121.948 54.918  1.00 142.57 ? -51 DT  J "O4'" 1 
ATOM   2689  C "C3'" . DT  B 2 9   ? 97.116  120.722 52.879  1.00 142.92 ? -51 DT  J "C3'" 1 
ATOM   2690  O "O3'" . DT  B 2 9   ? 98.174  121.175 52.034  1.00 143.30 ? -51 DT  J "O3'" 1 
ATOM   2691  C "C2'" . DT  B 2 9   ? 97.650  119.870 54.016  1.00 142.69 ? -51 DT  J "C2'" 1 
ATOM   2692  C "C1'" . DT  B 2 9   ? 97.971  120.897 55.087  1.00 142.22 ? -51 DT  J "C1'" 1 
ATOM   2693  N N1    . DT  B 2 9   ? 97.836  120.389 56.464  1.00 141.58 ? -51 DT  J N1    1 
ATOM   2694  C C2    . DT  B 2 9   ? 98.619  120.950 57.445  1.00 141.63 ? -51 DT  J C2    1 
ATOM   2695  O O2    . DT  B 2 9   ? 99.407  121.858 57.232  1.00 142.03 ? -51 DT  J O2    1 
ATOM   2696  N N3    . DT  B 2 9   ? 98.447  120.409 58.695  1.00 141.63 ? -51 DT  J N3    1 
ATOM   2697  C C4    . DT  B 2 9   ? 97.588  119.389 59.052  1.00 141.45 ? -51 DT  J C4    1 
ATOM   2698  O O4    . DT  B 2 9   ? 97.548  119.001 60.215  1.00 141.71 ? -51 DT  J O4    1 
ATOM   2699  C C5    . DT  B 2 9   ? 96.789  118.854 57.975  1.00 141.33 ? -51 DT  J C5    1 
ATOM   2700  C C7    . DT  B 2 9   ? 95.822  117.750 58.269  1.00 141.21 ? -51 DT  J C7    1 
ATOM   2701  C C6    . DT  B 2 9   ? 96.949  119.373 56.753  1.00 141.42 ? -51 DT  J C6    1 
ATOM   2702  P P     . DA  B 2 10  ? 99.173  120.105 51.378  1.00 143.54 ? -50 DA  J P     1 
ATOM   2703  O OP1   . DA  B 2 10  ? 99.714  120.680 50.121  1.00 143.71 ? -50 DA  J OP1   1 
ATOM   2704  O OP2   . DA  B 2 10  ? 98.475  118.792 51.346  1.00 143.72 ? -50 DA  J OP2   1 
ATOM   2705  O "O5'" . DA  B 2 10  ? 100.350 120.014 52.444  1.00 142.52 ? -50 DA  J "O5'" 1 
ATOM   2706  C "C5'" . DA  B 2 10  ? 101.080 121.181 52.810  1.00 141.29 ? -50 DA  J "C5'" 1 
ATOM   2707  C "C4'" . DA  B 2 10  ? 102.302 120.803 53.612  1.00 140.21 ? -50 DA  J "C4'" 1 
ATOM   2708  O "O4'" . DA  B 2 10  ? 101.912 120.407 54.948  1.00 140.38 ? -50 DA  J "O4'" 1 
ATOM   2709  C "C3'" . DA  B 2 10  ? 103.085 119.629 53.028  1.00 139.45 ? -50 DA  J "C3'" 1 
ATOM   2710  O "O3'" . DA  B 2 10  ? 104.488 119.870 53.137  1.00 137.87 ? -50 DA  J "O3'" 1 
ATOM   2711  C "C2'" . DA  B 2 10  ? 102.661 118.455 53.891  1.00 139.89 ? -50 DA  J "C2'" 1 
ATOM   2712  C "C1'" . DA  B 2 10  ? 102.400 119.107 55.237  1.00 140.45 ? -50 DA  J "C1'" 1 
ATOM   2713  N N9    . DA  B 2 10  ? 101.395 118.422 56.050  1.00 140.83 ? -50 DA  J N9    1 
ATOM   2714  C C8    . DA  B 2 10  ? 100.228 117.833 55.628  1.00 141.25 ? -50 DA  J C8    1 
ATOM   2715  N N7    . DA  B 2 10  ? 99.525  117.297 56.596  1.00 141.32 ? -50 DA  J N7    1 
ATOM   2716  C C5    . DA  B 2 10  ? 100.279 117.547 57.733  1.00 140.98 ? -50 DA  J C5    1 
ATOM   2717  C C6    . DA  B 2 10  ? 100.078 117.233 59.090  1.00 140.96 ? -50 DA  J C6    1 
ATOM   2718  N N6    . DA  B 2 10  ? 99.011  116.572 59.548  1.00 140.67 ? -50 DA  J N6    1 
ATOM   2719  N N1    . DA  B 2 10  ? 101.021 117.627 59.972  1.00 140.85 ? -50 DA  J N1    1 
ATOM   2720  C C2    . DA  B 2 10  ? 102.091 118.291 59.512  1.00 140.95 ? -50 DA  J C2    1 
ATOM   2721  N N3    . DA  B 2 10  ? 102.392 118.644 58.264  1.00 140.84 ? -50 DA  J N3    1 
ATOM   2722  C C4    . DA  B 2 10  ? 101.434 118.237 57.413  1.00 140.87 ? -50 DA  J C4    1 
ATOM   2723  P P     . DC  B 2 11  ? 105.527 118.763 52.619  1.00 136.35 ? -49 DC  J P     1 
ATOM   2724  O OP1   . DC  B 2 11  ? 106.631 119.445 51.901  1.00 136.33 ? -49 DC  J OP1   1 
ATOM   2725  O OP2   . DC  B 2 11  ? 104.756 117.692 51.935  1.00 136.51 ? -49 DC  J OP2   1 
ATOM   2726  O "O5'" . DC  B 2 11  ? 106.106 118.162 53.970  1.00 134.95 ? -49 DC  J "O5'" 1 
ATOM   2727  C "C5'" . DC  B 2 11  ? 106.757 119.007 54.910  1.00 132.52 ? -49 DC  J "C5'" 1 
ATOM   2728  C "C4'" . DC  B 2 11  ? 107.402 118.173 55.988  1.00 130.94 ? -49 DC  J "C4'" 1 
ATOM   2729  O "O4'" . DC  B 2 11  ? 106.401 117.710 56.926  1.00 130.59 ? -49 DC  J "O4'" 1 
ATOM   2730  C "C3'" . DC  B 2 11  ? 108.101 116.924 55.449  1.00 129.70 ? -49 DC  J "C3'" 1 
ATOM   2731  O "O3'" . DC  B 2 11  ? 109.364 116.750 56.084  1.00 127.68 ? -49 DC  J "O3'" 1 
ATOM   2732  C "C2'" . DC  B 2 11  ? 107.144 115.795 55.799  1.00 129.69 ? -49 DC  J "C2'" 1 
ATOM   2733  C "C1'" . DC  B 2 11  ? 106.489 116.302 57.074  1.00 129.88 ? -49 DC  J "C1'" 1 
ATOM   2734  N N1    . DC  B 2 11  ? 105.130 115.786 57.322  1.00 129.27 ? -49 DC  J N1    1 
ATOM   2735  C C2    . DC  B 2 11  ? 104.769 115.437 58.629  1.00 128.28 ? -49 DC  J C2    1 
ATOM   2736  O O2    . DC  B 2 11  ? 105.599 115.586 59.539  1.00 127.38 ? -49 DC  J O2    1 
ATOM   2737  N N3    . DC  B 2 11  ? 103.529 114.952 58.868  1.00 127.70 ? -49 DC  J N3    1 
ATOM   2738  C C4    . DC  B 2 11  ? 102.662 114.812 57.863  1.00 128.31 ? -49 DC  J C4    1 
ATOM   2739  N N4    . DC  B 2 11  ? 101.450 114.325 58.142  1.00 127.52 ? -49 DC  J N4    1 
ATOM   2740  C C5    . DC  B 2 11  ? 103.000 115.164 56.522  1.00 128.83 ? -49 DC  J C5    1 
ATOM   2741  C C6    . DC  B 2 11  ? 104.232 115.644 56.299  1.00 129.44 ? -49 DC  J C6    1 
ATOM   2742  P P     . DC  B 2 12  ? 110.287 115.505 55.680  1.00 125.74 ? -48 DC  J P     1 
ATOM   2743  O OP1   . DC  B 2 12  ? 111.697 115.916 55.876  1.00 126.42 ? -48 DC  J OP1   1 
ATOM   2744  O OP2   . DC  B 2 12  ? 109.849 114.987 54.360  1.00 126.27 ? -48 DC  J OP2   1 
ATOM   2745  O "O5'" . DC  B 2 12  ? 109.921 114.423 56.785  1.00 125.62 ? -48 DC  J "O5'" 1 
ATOM   2746  C "C5'" . DC  B 2 12  ? 110.260 114.649 58.149  1.00 123.97 ? -48 DC  J "C5'" 1 
ATOM   2747  C "C4'" . DC  B 2 12  ? 110.162 113.359 58.926  1.00 123.04 ? -48 DC  J "C4'" 1 
ATOM   2748  O "O4'" . DC  B 2 12  ? 108.773 113.043 59.184  1.00 124.23 ? -48 DC  J "O4'" 1 
ATOM   2749  C "C3'" . DC  B 2 12  ? 110.752 112.151 58.203  1.00 121.53 ? -48 DC  J "C3'" 1 
ATOM   2750  O "O3'" . DC  B 2 12  ? 111.445 111.326 59.141  1.00 119.05 ? -48 DC  J "O3'" 1 
ATOM   2751  C "C2'" . DC  B 2 12  ? 109.526 111.434 57.663  1.00 122.25 ? -48 DC  J "C2'" 1 
ATOM   2752  C "C1'" . DC  B 2 12  ? 108.497 111.727 58.742  1.00 123.34 ? -48 DC  J "C1'" 1 
ATOM   2753  N N1    . DC  B 2 12  ? 107.084 111.675 58.326  1.00 123.65 ? -48 DC  J N1    1 
ATOM   2754  C C2    . DC  B 2 12  ? 106.094 111.896 59.291  1.00 123.95 ? -48 DC  J C2    1 
ATOM   2755  O O2    . DC  B 2 12  ? 106.440 112.145 60.458  1.00 124.17 ? -48 DC  J O2    1 
ATOM   2756  N N3    . DC  B 2 12  ? 104.793 111.831 58.934  1.00 123.39 ? -48 DC  J N3    1 
ATOM   2757  C C4    . DC  B 2 12  ? 104.462 111.563 57.672  1.00 123.65 ? -48 DC  J C4    1 
ATOM   2758  N N4    . DC  B 2 12  ? 103.165 111.499 57.367  1.00 123.47 ? -48 DC  J N4    1 
ATOM   2759  C C5    . DC  B 2 12  ? 105.447 111.342 56.665  1.00 123.90 ? -48 DC  J C5    1 
ATOM   2760  C C6    . DC  B 2 12  ? 106.733 111.410 57.031  1.00 123.68 ? -48 DC  J C6    1 
ATOM   2761  P P     . DA  B 2 13  ? 113.032 111.129 59.005  1.00 117.40 ? -47 DA  J P     1 
ATOM   2762  O OP1   . DA  B 2 13  ? 113.649 112.468 58.817  1.00 117.41 ? -47 DA  J OP1   1 
ATOM   2763  O OP2   . DA  B 2 13  ? 113.270 110.062 58.000  1.00 117.07 ? -47 DA  J OP2   1 
ATOM   2764  O "O5'" . DA  B 2 13  ? 113.465 110.580 60.433  1.00 115.20 ? -47 DA  J "O5'" 1 
ATOM   2765  C "C5'" . DA  B 2 13  ? 113.488 111.445 61.566  1.00 111.85 ? -47 DA  J "C5'" 1 
ATOM   2766  C "C4'" . DA  B 2 13  ? 112.738 110.818 62.719  1.00 109.56 ? -47 DA  J "C4'" 1 
ATOM   2767  O "O4'" . DA  B 2 13  ? 111.344 110.672 62.352  1.00 108.12 ? -47 DA  J "O4'" 1 
ATOM   2768  C "C3'" . DA  B 2 13  ? 113.223 109.423 63.110  1.00 108.46 ? -47 DA  J "C3'" 1 
ATOM   2769  O "O3'" . DA  B 2 13  ? 113.183 109.266 64.532  1.00 106.35 ? -47 DA  J "O3'" 1 
ATOM   2770  C "C2'" . DA  B 2 13  ? 112.242 108.498 62.412  1.00 108.06 ? -47 DA  J "C2'" 1 
ATOM   2771  C "C1'" . DA  B 2 13  ? 110.956 109.306 62.379  1.00 108.21 ? -47 DA  J "C1'" 1 
ATOM   2772  N N9    . DA  B 2 13  ? 110.151 109.050 61.185  1.00 108.68 ? -47 DA  J N9    1 
ATOM   2773  C C8    . DA  B 2 13  ? 110.609 108.747 59.927  1.00 108.97 ? -47 DA  J C8    1 
ATOM   2774  N N7    . DA  B 2 13  ? 109.658 108.571 59.045  1.00 109.13 ? -47 DA  J N7    1 
ATOM   2775  C C5    . DA  B 2 13  ? 108.492 108.770 59.769  1.00 109.14 ? -47 DA  J C5    1 
ATOM   2776  C C6    . DA  B 2 13  ? 107.136 108.727 59.404  1.00 109.20 ? -47 DA  J C6    1 
ATOM   2777  N N6    . DA  B 2 13  ? 106.710 108.466 58.166  1.00 108.60 ? -47 DA  J N6    1 
ATOM   2778  N N1    . DA  B 2 13  ? 106.220 108.968 60.366  1.00 108.95 ? -47 DA  J N1    1 
ATOM   2779  C C2    . DA  B 2 13  ? 106.649 109.239 61.604  1.00 109.77 ? -47 DA  J C2    1 
ATOM   2780  N N3    . DA  B 2 13  ? 107.896 109.313 62.069  1.00 109.90 ? -47 DA  J N3    1 
ATOM   2781  C C4    . DA  B 2 13  ? 108.781 109.065 61.090  1.00 109.21 ? -47 DA  J C4    1 
ATOM   2782  P P     . DA  B 2 14  ? 113.358 107.809 65.184  1.00 104.45 ? -46 DA  J P     1 
ATOM   2783  O OP1   . DA  B 2 14  ? 114.184 107.929 66.410  1.00 104.96 ? -46 DA  J OP1   1 
ATOM   2784  O OP2   . DA  B 2 14  ? 113.762 106.858 64.117  1.00 104.36 ? -46 DA  J OP2   1 
ATOM   2785  O "O5'" . DA  B 2 14  ? 111.878 107.448 65.632  1.00 102.69 ? -46 DA  J "O5'" 1 
ATOM   2786  C "C5'" . DA  B 2 14  ? 111.054 108.434 66.245  1.00 99.96  ? -46 DA  J "C5'" 1 
ATOM   2787  C "C4'" . DA  B 2 14  ? 109.659 107.890 66.433  1.00 98.31  ? -46 DA  J "C4'" 1 
ATOM   2788  O "O4'" . DA  B 2 14  ? 109.018 107.732 65.144  1.00 97.03  ? -46 DA  J "O4'" 1 
ATOM   2789  C "C3'" . DA  B 2 14  ? 109.649 106.510 67.082  1.00 97.54  ? -46 DA  J "C3'" 1 
ATOM   2790  O "O3'" . DA  B 2 14  ? 108.542 106.393 67.981  1.00 96.95  ? -46 DA  J "O3'" 1 
ATOM   2791  C "C2'" . DA  B 2 14  ? 109.542 105.571 65.893  1.00 96.28  ? -46 DA  J "C2'" 1 
ATOM   2792  C "C1'" . DA  B 2 14  ? 108.702 106.369 64.913  1.00 96.30  ? -46 DA  J "C1'" 1 
ATOM   2793  N N9    . DA  B 2 14  ? 108.982 106.077 63.506  1.00 96.28  ? -46 DA  J N9    1 
ATOM   2794  C C8    . DA  B 2 14  ? 110.208 105.880 62.918  1.00 96.94  ? -46 DA  J C8    1 
ATOM   2795  N N7    . DA  B 2 14  ? 110.145 105.635 61.633  1.00 96.01  ? -46 DA  J N7    1 
ATOM   2796  C C5    . DA  B 2 14  ? 108.787 105.672 61.354  1.00 95.70  ? -46 DA  J C5    1 
ATOM   2797  C C6    . DA  B 2 14  ? 108.062 105.487 60.164  1.00 96.21  ? -46 DA  J C6    1 
ATOM   2798  N N6    . DA  B 2 14  ? 108.627 105.211 58.987  1.00 95.36  ? -46 DA  J N6    1 
ATOM   2799  N N1    . DA  B 2 14  ? 106.718 105.592 60.228  1.00 96.34  ? -46 DA  J N1    1 
ATOM   2800  C C2    . DA  B 2 14  ? 106.153 105.864 61.409  1.00 95.69  ? -46 DA  J C2    1 
ATOM   2801  N N3    . DA  B 2 14  ? 106.725 106.057 62.592  1.00 95.11  ? -46 DA  J N3    1 
ATOM   2802  C C4    . DA  B 2 14  ? 108.059 105.945 62.497  1.00 95.33  ? -46 DA  J C4    1 
ATOM   2803  P P     . DA  B 2 15  ? 108.699 105.522 69.318  1.00 97.61  ? -45 DA  J P     1 
ATOM   2804  O OP1   . DA  B 2 15  ? 107.903 106.140 70.410  1.00 99.03  ? -45 DA  J OP1   1 
ATOM   2805  O OP2   . DA  B 2 15  ? 110.152 105.290 69.509  1.00 99.22  ? -45 DA  J OP2   1 
ATOM   2806  O "O5'" . DA  B 2 15  ? 108.025 104.139 68.929  1.00 93.45  ? -45 DA  J "O5'" 1 
ATOM   2807  C "C5'" . DA  B 2 15  ? 107.828 103.826 67.569  1.00 90.43  ? -45 DA  J "C5'" 1 
ATOM   2808  C "C4'" . DA  B 2 15  ? 106.357 103.708 67.266  1.00 87.70  ? -45 DA  J "C4'" 1 
ATOM   2809  O "O4'" . DA  B 2 15  ? 106.157 103.902 65.851  1.00 85.96  ? -45 DA  J "O4'" 1 
ATOM   2810  C "C3'" . DA  B 2 15  ? 105.808 102.326 67.575  1.00 86.67  ? -45 DA  J "C3'" 1 
ATOM   2811  O "O3'" . DA  B 2 15  ? 104.435 102.417 67.930  1.00 86.07  ? -45 DA  J "O3'" 1 
ATOM   2812  C "C2'" . DA  B 2 15  ? 106.017 101.579 66.273  1.00 86.16  ? -45 DA  J "C2'" 1 
ATOM   2813  C "C1'" . DA  B 2 15  ? 105.917 102.663 65.207  1.00 85.75  ? -45 DA  J "C1'" 1 
ATOM   2814  N N9    . DA  B 2 15  ? 106.917 102.541 64.150  1.00 86.08  ? -45 DA  J N9    1 
ATOM   2815  C C8    . DA  B 2 15  ? 108.283 102.532 64.294  1.00 85.57  ? -45 DA  J C8    1 
ATOM   2816  N N7    . DA  B 2 15  ? 108.934 102.441 63.162  1.00 84.53  ? -45 DA  J N7    1 
ATOM   2817  C C5    . DA  B 2 15  ? 107.931 102.380 62.206  1.00 85.16  ? -45 DA  J C5    1 
ATOM   2818  C C6    . DA  B 2 15  ? 107.966 102.280 60.810  1.00 84.51  ? -45 DA  J C6    1 
ATOM   2819  N N6    . DA  B 2 15  ? 109.096 102.231 60.104  1.00 85.30  ? -45 DA  J N6    1 
ATOM   2820  N N1    . DA  B 2 15  ? 106.787 102.236 60.154  1.00 83.26  ? -45 DA  J N1    1 
ATOM   2821  C C2    . DA  B 2 15  ? 105.657 102.292 60.865  1.00 84.17  ? -45 DA  J C2    1 
ATOM   2822  N N3    . DA  B 2 15  ? 105.493 102.391 62.181  1.00 83.36  ? -45 DA  J N3    1 
ATOM   2823  C C4    . DA  B 2 15  ? 106.684 102.431 62.800  1.00 84.64  ? -45 DA  J C4    1 
ATOM   2824  P P     . DA  B 2 16  ? 103.741 101.203 68.713  1.00 85.40  ? -44 DA  J P     1 
ATOM   2825  O OP1   . DA  B 2 16  ? 102.720 101.784 69.617  1.00 86.22  ? -44 DA  J OP1   1 
ATOM   2826  O OP2   . DA  B 2 16  ? 104.823 100.345 69.266  1.00 84.71  ? -44 DA  J OP2   1 
ATOM   2827  O "O5'" . DA  B 2 16  ? 103.008 100.402 67.552  1.00 83.22  ? -44 DA  J "O5'" 1 
ATOM   2828  C "C5'" . DA  B 2 16  ? 102.139 101.078 66.651  1.00 79.16  ? -44 DA  J "C5'" 1 
ATOM   2829  C "C4'" . DA  B 2 16  ? 101.911 100.241 65.415  1.00 76.24  ? -44 DA  J "C4'" 1 
ATOM   2830  O "O4'" . DA  B 2 16  ? 103.043 100.326 64.515  1.00 75.02  ? -44 DA  J "O4'" 1 
ATOM   2831  C "C3'" . DA  B 2 16  ? 101.691 98.752  65.689  1.00 74.77  ? -44 DA  J "C3'" 1 
ATOM   2832  O "O3'" . DA  B 2 16  ? 100.608 98.273  64.902  1.00 71.95  ? -44 DA  J "O3'" 1 
ATOM   2833  C "C2'" . DA  B 2 16  ? 102.984 98.108  65.221  1.00 75.04  ? -44 DA  J "C2'" 1 
ATOM   2834  C "C1'" . DA  B 2 16  ? 103.382 99.020  64.077  1.00 76.03  ? -44 DA  J "C1'" 1 
ATOM   2835  N N9    . DA  B 2 16  ? 104.804 99.006  63.740  1.00 75.33  ? -44 DA  J N9    1 
ATOM   2836  C C8    . DA  B 2 16  ? 105.875 98.969  64.593  1.00 76.76  ? -44 DA  J C8    1 
ATOM   2837  N N7    . DA  B 2 16  ? 107.036 98.971  63.987  1.00 77.47  ? -44 DA  J N7    1 
ATOM   2838  C C5    . DA  B 2 16  ? 106.709 99.007  62.640  1.00 77.44  ? -44 DA  J C5    1 
ATOM   2839  C C6    . DA  B 2 16  ? 107.496 99.022  61.468  1.00 75.55  ? -44 DA  J C6    1 
ATOM   2840  N N6    . DA  B 2 16  ? 108.831 99.013  61.468  1.00 72.27  ? -44 DA  J N6    1 
ATOM   2841  N N1    . DA  B 2 16  ? 106.854 99.051  60.283  1.00 76.16  ? -44 DA  J N1    1 
ATOM   2842  C C2    . DA  B 2 16  ? 105.515 99.068  60.278  1.00 76.37  ? -44 DA  J C2    1 
ATOM   2843  N N3    . DA  B 2 16  ? 104.668 99.061  61.305  1.00 78.31  ? -44 DA  J N3    1 
ATOM   2844  C C4    . DA  B 2 16  ? 105.336 99.029  62.472  1.00 77.20  ? -44 DA  J C4    1 
ATOM   2845  P P     . DG  B 2 17  ? 99.988  96.830  65.205  1.00 72.58  ? -43 DG  J P     1 
ATOM   2846  O OP1   . DG  B 2 17  ? 98.565  97.001  65.585  1.00 70.67  ? -43 DG  J OP1   1 
ATOM   2847  O OP2   . DG  B 2 17  ? 100.908 96.107  66.115  1.00 72.21  ? -43 DG  J OP2   1 
ATOM   2848  O "O5'" . DG  B 2 17  ? 100.035 96.120  63.784  1.00 77.52  ? -43 DG  J "O5'" 1 
ATOM   2849  C "C5'" . DG  B 2 17  ? 99.466  96.751  62.641  1.00 82.58  ? -43 DG  J "C5'" 1 
ATOM   2850  C "C4'" . DG  B 2 17  ? 99.950  96.080  61.378  1.00 86.83  ? -43 DG  J "C4'" 1 
ATOM   2851  O "O4'" . DG  B 2 17  ? 101.342 96.408  61.143  1.00 87.96  ? -43 DG  J "O4'" 1 
ATOM   2852  C "C3'" . DG  B 2 17  ? 99.873  94.553  61.421  1.00 89.37  ? -43 DG  J "C3'" 1 
ATOM   2853  O "O3'" . DG  B 2 17  ? 99.427  94.051  60.161  1.00 92.06  ? -43 DG  J "O3'" 1 
ATOM   2854  C "C2'" . DG  B 2 17  ? 101.307 94.132  61.680  1.00 89.18  ? -43 DG  J "C2'" 1 
ATOM   2855  C "C1'" . DG  B 2 17  ? 102.088 95.216  60.963  1.00 90.38  ? -43 DG  J "C1'" 1 
ATOM   2856  N N9    . DG  B 2 17  ? 103.431 95.433  61.493  1.00 92.55  ? -43 DG  J N9    1 
ATOM   2857  C C8    . DG  B 2 17  ? 103.796 95.559  62.811  1.00 94.11  ? -43 DG  J C8    1 
ATOM   2858  N N7    . DG  B 2 17  ? 105.081 95.709  62.975  1.00 93.65  ? -43 DG  J N7    1 
ATOM   2859  C C5    . DG  B 2 17  ? 105.595 95.690  61.686  1.00 94.62  ? -43 DG  J C5    1 
ATOM   2860  C C6    . DG  B 2 17  ? 106.930 95.799  61.230  1.00 95.58  ? -43 DG  J C6    1 
ATOM   2861  O O6    . DG  B 2 17  ? 107.963 95.935  61.894  1.00 96.28  ? -43 DG  J O6    1 
ATOM   2862  N N1    . DG  B 2 17  ? 107.004 95.732  59.844  1.00 96.43  ? -43 DG  J N1    1 
ATOM   2863  C C2    . DG  B 2 17  ? 105.933 95.573  59.003  1.00 97.22  ? -43 DG  J C2    1 
ATOM   2864  N N2    . DG  B 2 17  ? 106.212 95.529  57.690  1.00 98.92  ? -43 DG  J N2    1 
ATOM   2865  N N3    . DG  B 2 17  ? 104.683 95.468  59.415  1.00 96.92  ? -43 DG  J N3    1 
ATOM   2866  C C4    . DG  B 2 17  ? 104.588 95.531  60.760  1.00 94.89  ? -43 DG  J C4    1 
ATOM   2867  P P     . DT  B 2 18  ? 99.045  92.499  60.015  1.00 93.41  ? -42 DT  J P     1 
ATOM   2868  O OP1   . DT  B 2 18  ? 97.721  92.447  59.347  1.00 93.35  ? -42 DT  J OP1   1 
ATOM   2869  O OP2   . DT  B 2 18  ? 99.239  91.808  61.317  1.00 94.40  ? -42 DT  J OP2   1 
ATOM   2870  O "O5'" . DT  B 2 18  ? 100.152 91.955  59.012  1.00 97.83  ? -42 DT  J "O5'" 1 
ATOM   2871  C "C5'" . DT  B 2 18  ? 100.357 92.584  57.752  1.00 101.01 ? -42 DT  J "C5'" 1 
ATOM   2872  C "C4'" . DT  B 2 18  ? 101.523 91.955  57.031  1.00 102.96 ? -42 DT  J "C4'" 1 
ATOM   2873  O "O4'" . DT  B 2 18  ? 102.772 92.375  57.631  1.00 103.94 ? -42 DT  J "O4'" 1 
ATOM   2874  C "C3'" . DT  B 2 18  ? 101.528 90.427  57.061  1.00 104.60 ? -42 DT  J "C3'" 1 
ATOM   2875  O "O3'" . DT  B 2 18  ? 101.886 89.920  55.775  1.00 106.07 ? -42 DT  J "O3'" 1 
ATOM   2876  C "C2'" . DT  B 2 18  ? 102.597 90.096  58.089  1.00 104.21 ? -42 DT  J "C2'" 1 
ATOM   2877  C "C1'" . DT  B 2 18  ? 103.573 91.238  57.895  1.00 104.63 ? -42 DT  J "C1'" 1 
ATOM   2878  N N1    . DT  B 2 18  ? 104.435 91.543  59.052  1.00 106.18 ? -42 DT  J N1    1 
ATOM   2879  C C2    . DT  B 2 18  ? 105.769 91.765  58.803  1.00 107.58 ? -42 DT  J C2    1 
ATOM   2880  O O2    . DT  B 2 18  ? 106.253 91.713  57.685  1.00 109.13 ? -42 DT  J O2    1 
ATOM   2881  N N3    . DT  B 2 18  ? 106.523 92.049  59.915  1.00 107.42 ? -42 DT  J N3    1 
ATOM   2882  C C4    . DT  B 2 18  ? 106.084 92.127  61.221  1.00 107.88 ? -42 DT  J C4    1 
ATOM   2883  O O4    . DT  B 2 18  ? 106.881 92.392  62.117  1.00 108.48 ? -42 DT  J O4    1 
ATOM   2884  C C5    . DT  B 2 18  ? 104.670 91.879  61.412  1.00 107.66 ? -42 DT  J C5    1 
ATOM   2885  C C7    . DT  B 2 18  ? 104.102 91.942  62.796  1.00 107.78 ? -42 DT  J C7    1 
ATOM   2886  C C6    . DT  B 2 18  ? 103.925 91.603  60.331  1.00 107.07 ? -42 DT  J C6    1 
ATOM   2887  P P     . DG  B 2 19  ? 101.916 88.337  55.527  1.00 106.77 ? -41 DG  J P     1 
ATOM   2888  O OP1   . DG  B 2 19  ? 101.394 88.058  54.169  1.00 108.56 ? -41 DG  J OP1   1 
ATOM   2889  O OP2   . DG  B 2 19  ? 101.282 87.688  56.702  1.00 108.39 ? -41 DG  J OP2   1 
ATOM   2890  O "O5'" . DG  B 2 19  ? 103.470 88.007  55.545  1.00 108.08 ? -41 DG  J "O5'" 1 
ATOM   2891  C "C5'" . DG  B 2 19  ? 104.349 88.627  54.611  1.00 110.31 ? -41 DG  J "C5'" 1 
ATOM   2892  C "C4'" . DG  B 2 19  ? 105.715 87.992  54.693  1.00 112.58 ? -41 DG  J "C4'" 1 
ATOM   2893  O "O4'" . DG  B 2 19  ? 106.428 88.489  55.853  1.00 113.23 ? -41 DG  J "O4'" 1 
ATOM   2894  C "C3'" . DG  B 2 19  ? 105.665 86.473  54.838  1.00 113.30 ? -41 DG  J "C3'" 1 
ATOM   2895  O "O3'" . DG  B 2 19  ? 106.693 85.869  54.054  1.00 114.09 ? -41 DG  J "O3'" 1 
ATOM   2896  C "C2'" . DG  B 2 19  ? 105.901 86.253  56.321  1.00 113.45 ? -41 DG  J "C2'" 1 
ATOM   2897  C "C1'" . DG  B 2 19  ? 106.822 87.405  56.682  1.00 113.49 ? -41 DG  J "C1'" 1 
ATOM   2898  N N9    . DG  B 2 19  ? 106.717 87.844  58.071  1.00 113.47 ? -41 DG  J N9    1 
ATOM   2899  C C8    . DG  B 2 19  ? 105.567 88.119  58.767  1.00 113.46 ? -41 DG  J C8    1 
ATOM   2900  N N7    . DG  B 2 19  ? 105.789 88.489  59.999  1.00 113.60 ? -41 DG  J N7    1 
ATOM   2901  C C5    . DG  B 2 19  ? 107.170 88.459  60.123  1.00 113.37 ? -41 DG  J C5    1 
ATOM   2902  C C6    . DG  B 2 19  ? 108.001 88.764  61.235  1.00 113.91 ? -41 DG  J C6    1 
ATOM   2903  O O6    . DG  B 2 19  ? 107.669 89.133  62.370  1.00 113.61 ? -41 DG  J O6    1 
ATOM   2904  N N1    . DG  B 2 19  ? 109.347 88.602  60.925  1.00 113.57 ? -41 DG  J N1    1 
ATOM   2905  C C2    . DG  B 2 19  ? 109.834 88.199  59.705  1.00 113.82 ? -41 DG  J C2    1 
ATOM   2906  N N2    . DG  B 2 19  ? 111.166 88.102  59.601  1.00 114.13 ? -41 DG  J N2    1 
ATOM   2907  N N3    . DG  B 2 19  ? 109.072 87.911  58.663  1.00 113.66 ? -41 DG  J N3    1 
ATOM   2908  C C4    . DG  B 2 19  ? 107.759 88.063  58.942  1.00 113.54 ? -41 DG  J C4    1 
ATOM   2909  P P     . DT  B 2 20  ? 107.043 84.319  54.270  1.00 114.64 ? -40 DT  J P     1 
ATOM   2910  O OP1   . DT  B 2 20  ? 107.526 83.779  52.975  1.00 115.32 ? -40 DT  J OP1   1 
ATOM   2911  O OP2   . DT  B 2 20  ? 105.897 83.668  54.956  1.00 115.33 ? -40 DT  J OP2   1 
ATOM   2912  O "O5'" . DT  B 2 20  ? 108.273 84.369  55.277  1.00 114.07 ? -40 DT  J "O5'" 1 
ATOM   2913  C "C5'" . DT  B 2 20  ? 109.502 84.972  54.883  1.00 113.49 ? -40 DT  J "C5'" 1 
ATOM   2914  C "C4'" . DT  B 2 20  ? 110.635 84.415  55.709  1.00 113.32 ? -40 DT  J "C4'" 1 
ATOM   2915  O "O4'" . DT  B 2 20  ? 110.611 84.993  57.036  1.00 113.13 ? -40 DT  J "O4'" 1 
ATOM   2916  C "C3'" . DT  B 2 20  ? 110.560 82.901  55.900  1.00 113.25 ? -40 DT  J "C3'" 1 
ATOM   2917  O "O3'" . DT  B 2 20  ? 111.865 82.327  55.823  1.00 113.53 ? -40 DT  J "O3'" 1 
ATOM   2918  C "C2'" . DT  B 2 20  ? 109.985 82.754  57.296  1.00 113.12 ? -40 DT  J "C2'" 1 
ATOM   2919  C "C1'" . DT  B 2 20  ? 110.567 83.960  58.007  1.00 112.99 ? -40 DT  J "C1'" 1 
ATOM   2920  N N1    . DT  B 2 20  ? 109.772 84.438  59.154  1.00 113.14 ? -40 DT  J N1    1 
ATOM   2921  C C2    . DT  B 2 20  ? 110.448 84.834  60.284  1.00 113.11 ? -40 DT  J C2    1 
ATOM   2922  O O2    . DT  B 2 20  ? 111.665 84.822  60.371  1.00 113.29 ? -40 DT  J O2    1 
ATOM   2923  N N3    . DT  B 2 20  ? 109.645 85.249  61.318  1.00 112.58 ? -40 DT  J N3    1 
ATOM   2924  C C4    . DT  B 2 20  ? 108.266 85.305  61.332  1.00 112.66 ? -40 DT  J C4    1 
ATOM   2925  O O4    . DT  B 2 20  ? 107.680 85.699  62.337  1.00 112.50 ? -40 DT  J O4    1 
ATOM   2926  C C5    . DT  B 2 20  ? 107.619 84.879  60.113  1.00 112.77 ? -40 DT  J C5    1 
ATOM   2927  C C7    . DT  B 2 20  ? 106.126 84.901  60.038  1.00 112.60 ? -40 DT  J C7    1 
ATOM   2928  C C6    . DT  B 2 20  ? 108.394 84.475  59.097  1.00 113.00 ? -40 DT  J C6    1 
ATOM   2929  P P     . DA  B 2 21  ? 112.102 80.830  56.347  1.00 113.32 ? -39 DA  J P     1 
ATOM   2930  O OP1   . DA  B 2 21  ? 113.192 80.210  55.551  1.00 113.77 ? -39 DA  J OP1   1 
ATOM   2931  O OP2   . DA  B 2 21  ? 110.774 80.164  56.423  1.00 113.99 ? -39 DA  J OP2   1 
ATOM   2932  O "O5'" . DA  B 2 21  ? 112.646 81.048  57.824  1.00 112.41 ? -39 DA  J "O5'" 1 
ATOM   2933  C "C5'" . DA  B 2 21  ? 113.890 81.706  58.035  1.00 111.58 ? -39 DA  J "C5'" 1 
ATOM   2934  C "C4'" . DA  B 2 21  ? 114.523 81.213  59.312  1.00 110.50 ? -39 DA  J "C4'" 1 
ATOM   2935  O "O4'" . DA  B 2 21  ? 113.823 81.776  60.447  1.00 109.93 ? -39 DA  J "O4'" 1 
ATOM   2936  C "C3'" . DA  B 2 21  ? 114.472 79.696  59.480  1.00 109.87 ? -39 DA  J "C3'" 1 
ATOM   2937  O "O3'" . DA  B 2 21  ? 115.727 79.217  59.978  1.00 109.71 ? -39 DA  J "O3'" 1 
ATOM   2938  C "C2'" . DA  B 2 21  ? 113.314 79.479  60.440  1.00 108.85 ? -39 DA  J "C2'" 1 
ATOM   2939  C "C1'" . DA  B 2 21  ? 113.295 80.751  61.271  1.00 108.25 ? -39 DA  J "C1'" 1 
ATOM   2940  N N9    . DA  B 2 21  ? 111.949 81.158  61.682  1.00 106.33 ? -39 DA  J N9    1 
ATOM   2941  C C8    . DA  B 2 21  ? 110.752 80.769  61.133  1.00 105.49 ? -39 DA  J C8    1 
ATOM   2942  N N7    . DA  B 2 21  ? 109.705 81.295  61.719  1.00 103.77 ? -39 DA  J N7    1 
ATOM   2943  C C5    . DA  B 2 21  ? 110.247 82.085  62.721  1.00 103.60 ? -39 DA  J C5    1 
ATOM   2944  C C6    . DA  B 2 21  ? 109.658 82.904  63.699  1.00 102.45 ? -39 DA  J C6    1 
ATOM   2945  N N6    . DA  B 2 21  ? 108.341 83.066  63.829  1.00 101.05 ? -39 DA  J N6    1 
ATOM   2946  N N1    . DA  B 2 21  ? 110.480 83.557  64.548  1.00 101.97 ? -39 DA  J N1    1 
ATOM   2947  C C2    . DA  B 2 21  ? 111.800 83.390  64.415  1.00 102.38 ? -39 DA  J C2    1 
ATOM   2948  N N3    . DA  B 2 21  ? 112.473 82.649  63.538  1.00 103.36 ? -39 DA  J N3    1 
ATOM   2949  C C4    . DA  B 2 21  ? 111.628 82.014  62.709  1.00 104.32 ? -39 DA  J C4    1 
ATOM   2950  P P     . DT  B 2 22  ? 115.774 77.966  60.980  1.00 109.58 ? -38 DT  J P     1 
ATOM   2951  O OP1   . DT  B 2 22  ? 117.114 77.337  60.864  1.00 109.32 ? -38 DT  J OP1   1 
ATOM   2952  O OP2   . DT  B 2 22  ? 114.557 77.139  60.779  1.00 109.42 ? -38 DT  J OP2   1 
ATOM   2953  O "O5'" . DT  B 2 22  ? 115.692 78.683  62.397  1.00 107.96 ? -38 DT  J "O5'" 1 
ATOM   2954  C "C5'" . DT  B 2 22  ? 116.439 79.878  62.628  1.00 105.05 ? -38 DT  J "C5'" 1 
ATOM   2955  C "C4'" . DT  B 2 22  ? 116.536 80.152  64.109  1.00 102.92 ? -38 DT  J "C4'" 1 
ATOM   2956  O "O4'" . DT  B 2 22  ? 115.281 80.683  64.594  1.00 101.09 ? -38 DT  J "O4'" 1 
ATOM   2957  C "C3'" . DT  B 2 22  ? 116.830 78.906  64.940  1.00 101.29 ? -38 DT  J "C3'" 1 
ATOM   2958  O "O3'" . DT  B 2 22  ? 117.766 79.213  65.974  1.00 99.44  ? -38 DT  J "O3'" 1 
ATOM   2959  C "C2'" . DT  B 2 22  ? 115.471 78.527  65.499  1.00 100.37 ? -38 DT  J "C2'" 1 
ATOM   2960  C "C1'" . DT  B 2 22  ? 114.775 79.870  65.638  1.00 99.61  ? -38 DT  J "C1'" 1 
ATOM   2961  N N1    . DT  B 2 22  ? 113.308 79.811  65.493  1.00 98.07  ? -38 DT  J N1    1 
ATOM   2962  C C2    . DT  B 2 22  ? 112.539 80.618  66.304  1.00 97.14  ? -38 DT  J C2    1 
ATOM   2963  O O2    . DT  B 2 22  ? 113.010 81.390  67.124  1.00 97.19  ? -38 DT  J O2    1 
ATOM   2964  N N3    . DT  B 2 22  ? 111.186 80.487  66.117  1.00 96.39  ? -38 DT  J N3    1 
ATOM   2965  C C4    . DT  B 2 22  ? 110.539 79.656  65.224  1.00 96.77  ? -38 DT  J C4    1 
ATOM   2966  O O4    . DT  B 2 22  ? 109.314 79.643  65.174  1.00 95.32  ? -38 DT  J O4    1 
ATOM   2967  C C5    . DT  B 2 22  ? 111.407 78.845  64.403  1.00 97.70  ? -38 DT  J C5    1 
ATOM   2968  C C7    . DT  B 2 22  ? 110.794 77.915  63.405  1.00 98.14  ? -38 DT  J C7    1 
ATOM   2969  C C6    . DT  B 2 22  ? 112.728 78.963  64.574  1.00 97.97  ? -38 DT  J C6    1 
ATOM   2970  P P     . DT  B 2 23  ? 117.989 78.177  67.178  1.00 99.07  ? -37 DT  J P     1 
ATOM   2971  O OP1   . DT  B 2 23  ? 119.395 78.299  67.648  1.00 97.47  ? -37 DT  J OP1   1 
ATOM   2972  O OP2   . DT  B 2 23  ? 117.472 76.854  66.736  1.00 96.93  ? -37 DT  J OP2   1 
ATOM   2973  O "O5'" . DT  B 2 23  ? 117.036 78.757  68.315  1.00 95.82  ? -37 DT  J "O5'" 1 
ATOM   2974  C "C5'" . DT  B 2 23  ? 117.068 80.147  68.634  1.00 91.49  ? -37 DT  J "C5'" 1 
ATOM   2975  C "C4'" . DT  B 2 23  ? 116.190 80.436  69.831  1.00 89.01  ? -37 DT  J "C4'" 1 
ATOM   2976  O "O4'" . DT  B 2 23  ? 114.794 80.318  69.469  1.00 87.93  ? -37 DT  J "O4'" 1 
ATOM   2977  C "C3'" . DT  B 2 23  ? 116.403 79.508  71.027  1.00 87.54  ? -37 DT  J "C3'" 1 
ATOM   2978  O "O3'" . DT  B 2 23  ? 116.395 80.266  72.236  1.00 84.48  ? -37 DT  J "O3'" 1 
ATOM   2979  C "C2'" . DT  B 2 23  ? 115.214 78.563  70.961  1.00 86.73  ? -37 DT  J "C2'" 1 
ATOM   2980  C "C1'" . DT  B 2 23  ? 114.132 79.437  70.361  1.00 86.68  ? -37 DT  J "C1'" 1 
ATOM   2981  N N1    . DT  B 2 23  ? 113.099 78.718  69.594  1.00 86.92  ? -37 DT  J N1    1 
ATOM   2982  C C2    . DT  B 2 23  ? 111.782 78.906  69.949  1.00 87.67  ? -37 DT  J C2    1 
ATOM   2983  O O2    . DT  B 2 23  ? 111.434 79.621  70.870  1.00 88.75  ? -37 DT  J O2    1 
ATOM   2984  N N3    . DT  B 2 23  ? 110.878 78.222  69.178  1.00 87.75  ? -37 DT  J N3    1 
ATOM   2985  C C4    . DT  B 2 23  ? 111.151 77.390  68.112  1.00 87.56  ? -37 DT  J C4    1 
ATOM   2986  O O4    . DT  B 2 23  ? 110.230 76.857  67.505  1.00 87.74  ? -37 DT  J O4    1 
ATOM   2987  C C5    . DT  B 2 23  ? 112.554 77.230  67.801  1.00 87.23  ? -37 DT  J C5    1 
ATOM   2988  C C7    . DT  B 2 23  ? 112.946 76.342  66.663  1.00 86.79  ? -37 DT  J C7    1 
ATOM   2989  C C6    . DT  B 2 23  ? 113.446 77.891  68.550  1.00 86.83  ? -37 DT  J C6    1 
ATOM   2990  P P     . DT  B 2 24  ? 116.649 79.528  73.638  1.00 83.76  ? -36 DT  J P     1 
ATOM   2991  O OP1   . DT  B 2 24  ? 117.367 80.473  74.533  1.00 82.62  ? -36 DT  J OP1   1 
ATOM   2992  O OP2   . DT  B 2 24  ? 117.233 78.193  73.356  1.00 84.11  ? -36 DT  J OP2   1 
ATOM   2993  O "O5'" . DT  B 2 24  ? 115.176 79.321  74.211  1.00 82.22  ? -36 DT  J "O5'" 1 
ATOM   2994  C "C5'" . DT  B 2 24  ? 114.316 80.442  74.406  1.00 76.96  ? -36 DT  J "C5'" 1 
ATOM   2995  C "C4'" . DT  B 2 24  ? 113.002 80.003  75.011  1.00 74.33  ? -36 DT  J "C4'" 1 
ATOM   2996  O "O4'" . DT  B 2 24  ? 112.153 79.383  74.013  1.00 73.48  ? -36 DT  J "O4'" 1 
ATOM   2997  C "C3'" . DT  B 2 24  ? 113.119 79.001  76.161  1.00 72.48  ? -36 DT  J "C3'" 1 
ATOM   2998  O "O3'" . DT  B 2 24  ? 112.180 79.343  77.178  1.00 68.60  ? -36 DT  J "O3'" 1 
ATOM   2999  C "C2'" . DT  B 2 24  ? 112.695 77.691  75.519  1.00 72.88  ? -36 DT  J "C2'" 1 
ATOM   3000  C "C1'" . DT  B 2 24  ? 111.643 78.171  74.536  1.00 73.46  ? -36 DT  J "C1'" 1 
ATOM   3001  N N1    . DT  B 2 24  ? 111.362 77.267  73.409  1.00 75.82  ? -36 DT  J N1    1 
ATOM   3002  C C2    . DT  B 2 24  ? 110.048 77.096  73.046  1.00 77.94  ? -36 DT  J C2    1 
ATOM   3003  O O2    . DT  B 2 24  ? 109.127 77.664  73.604  1.00 79.42  ? -36 DT  J O2    1 
ATOM   3004  N N3    . DT  B 2 24  ? 109.848 76.235  71.995  1.00 79.26  ? -36 DT  J N3    1 
ATOM   3005  C C4    . DT  B 2 24  ? 110.811 75.549  71.285  1.00 80.32  ? -36 DT  J C4    1 
ATOM   3006  O O4    . DT  B 2 24  ? 110.481 74.810  70.361  1.00 79.95  ? -36 DT  J O4    1 
ATOM   3007  C C5    . DT  B 2 24  ? 112.174 75.779  71.716  1.00 79.55  ? -36 DT  J C5    1 
ATOM   3008  C C7    . DT  B 2 24  ? 113.286 75.084  71.001  1.00 81.42  ? -36 DT  J C7    1 
ATOM   3009  C C6    . DT  B 2 24  ? 112.377 76.615  72.744  1.00 77.79  ? -36 DT  J C6    1 
ATOM   3010  P P     . DG  B 2 25  ? 112.682 79.629  78.678  1.00 66.33  ? -35 DG  J P     1 
ATOM   3011  O OP1   . DG  B 2 25  ? 113.682 80.724  78.669  1.00 65.12  ? -35 DG  J OP1   1 
ATOM   3012  O OP2   . DG  B 2 25  ? 113.022 78.332  79.308  1.00 66.74  ? -35 DG  J OP2   1 
ATOM   3013  O "O5'" . DG  B 2 25  ? 111.359 80.160  79.384  1.00 63.81  ? -35 DG  J "O5'" 1 
ATOM   3014  C "C5'" . DG  B 2 25  ? 110.629 81.238  78.819  1.00 59.34  ? -35 DG  J "C5'" 1 
ATOM   3015  C "C4'" . DG  B 2 25  ? 109.160 80.893  78.754  1.00 57.80  ? -35 DG  J "C4'" 1 
ATOM   3016  O "O4'" . DG  B 2 25  ? 108.941 79.829  77.806  1.00 57.25  ? -35 DG  J "O4'" 1 
ATOM   3017  C "C3'" . DG  B 2 25  ? 108.547 80.415  80.066  1.00 55.30  ? -35 DG  J "C3'" 1 
ATOM   3018  O "O3'" . DG  B 2 25  ? 107.208 80.907  80.148  1.00 50.17  ? -35 DG  J "O3'" 1 
ATOM   3019  C "C2'" . DG  B 2 25  ? 108.572 78.903  79.933  1.00 57.34  ? -35 DG  J "C2'" 1 
ATOM   3020  C "C1'" . DG  B 2 25  ? 108.374 78.692  78.438  1.00 58.23  ? -35 DG  J "C1'" 1 
ATOM   3021  N N9    . DG  B 2 25  ? 109.049 77.520  77.885  1.00 61.52  ? -35 DG  J N9    1 
ATOM   3022  C C8    . DG  B 2 25  ? 110.345 77.123  78.129  1.00 61.52  ? -35 DG  J C8    1 
ATOM   3023  N N7    . DG  B 2 25  ? 110.704 76.086  77.420  1.00 63.52  ? -35 DG  J N7    1 
ATOM   3024  C C5    . DG  B 2 25  ? 109.577 75.770  76.673  1.00 62.61  ? -35 DG  J C5    1 
ATOM   3025  C C6    . DG  B 2 25  ? 109.373 74.757  75.701  1.00 61.40  ? -35 DG  J C6    1 
ATOM   3026  O O6    . DG  B 2 25  ? 110.185 73.942  75.267  1.00 63.30  ? -35 DG  J O6    1 
ATOM   3027  N N1    . DG  B 2 25  ? 108.073 74.769  75.214  1.00 60.07  ? -35 DG  J N1    1 
ATOM   3028  C C2    . DG  B 2 25  ? 107.095 75.656  75.594  1.00 60.47  ? -35 DG  J C2    1 
ATOM   3029  N N2    . DG  B 2 25  ? 105.892 75.488  75.025  1.00 58.45  ? -35 DG  J N2    1 
ATOM   3030  N N3    . DG  B 2 25  ? 107.282 76.627  76.475  1.00 59.39  ? -35 DG  J N3    1 
ATOM   3031  C C4    . DG  B 2 25  ? 108.534 76.625  76.972  1.00 60.70  ? -35 DG  J C4    1 
ATOM   3032  P P     . DG  B 2 26  ? 106.466 80.957  81.563  1.00 47.91  ? -34 DG  J P     1 
ATOM   3033  O OP1   . DG  B 2 26  ? 105.550 82.125  81.512  1.00 47.12  ? -34 DG  J OP1   1 
ATOM   3034  O OP2   . DG  B 2 26  ? 107.513 80.881  82.609  1.00 44.17  ? -34 DG  J OP2   1 
ATOM   3035  O "O5'" . DG  B 2 26  ? 105.605 79.619  81.583  1.00 47.17  ? -34 DG  J "O5'" 1 
ATOM   3036  C "C5'" . DG  B 2 26  ? 104.569 79.425  80.624  1.00 53.95  ? -34 DG  J "C5'" 1 
ATOM   3037  C "C4'" . DG  B 2 26  ? 104.169 77.969  80.553  1.00 57.64  ? -34 DG  J "C4'" 1 
ATOM   3038  O "O4'" . DG  B 2 26  ? 105.225 77.171  79.964  1.00 57.82  ? -34 DG  J "O4'" 1 
ATOM   3039  C "C3'" . DG  B 2 26  ? 103.840 77.304  81.891  1.00 60.29  ? -34 DG  J "C3'" 1 
ATOM   3040  O "O3'" . DG  B 2 26  ? 102.763 76.389  81.689  1.00 65.93  ? -34 DG  J "O3'" 1 
ATOM   3041  C "C2'" . DG  B 2 26  ? 105.089 76.496  82.179  1.00 59.80  ? -34 DG  J "C2'" 1 
ATOM   3042  C "C1'" . DG  B 2 26  ? 105.421 76.034  80.776  1.00 58.28  ? -34 DG  J "C1'" 1 
ATOM   3043  N N9    . DG  B 2 26  ? 106.767 75.520  80.544  1.00 59.14  ? -34 DG  J N9    1 
ATOM   3044  C C8    . DG  B 2 26  ? 107.921 75.818  81.226  1.00 58.18  ? -34 DG  J C8    1 
ATOM   3045  N N7    . DG  B 2 26  ? 108.960 75.155  80.791  1.00 57.86  ? -34 DG  J N7    1 
ATOM   3046  C C5    . DG  B 2 26  ? 108.461 74.382  79.750  1.00 58.78  ? -34 DG  J C5    1 
ATOM   3047  C C6    . DG  B 2 26  ? 109.111 73.442  78.894  1.00 59.61  ? -34 DG  J C6    1 
ATOM   3048  O O6    . DG  B 2 26  ? 110.299 73.095  78.883  1.00 56.66  ? -34 DG  J O6    1 
ATOM   3049  N N1    . DG  B 2 26  ? 108.221 72.887  77.981  1.00 57.26  ? -34 DG  J N1    1 
ATOM   3050  C C2    . DG  B 2 26  ? 106.884 73.189  77.898  1.00 59.72  ? -34 DG  J C2    1 
ATOM   3051  N N2    . DG  B 2 26  ? 106.188 72.559  76.946  1.00 57.00  ? -34 DG  J N2    1 
ATOM   3052  N N3    . DG  B 2 26  ? 106.270 74.050  78.687  1.00 58.40  ? -34 DG  J N3    1 
ATOM   3053  C C4    . DG  B 2 26  ? 107.111 74.604  79.582  1.00 58.35  ? -34 DG  J C4    1 
ATOM   3054  P P     . DA  B 2 27  ? 101.292 76.762  82.199  1.00 69.72  ? -33 DA  J P     1 
ATOM   3055  O OP1   . DA  B 2 27  ? 100.933 78.075  81.610  1.00 71.83  ? -33 DA  J OP1   1 
ATOM   3056  O OP2   . DA  B 2 27  ? 101.251 76.583  83.667  1.00 71.26  ? -33 DA  J OP2   1 
ATOM   3057  O "O5'" . DA  B 2 27  ? 100.372 75.647  81.534  1.00 70.89  ? -33 DA  J "O5'" 1 
ATOM   3058  C "C5'" . DA  B 2 27  ? 99.934  75.776  80.184  1.00 75.05  ? -33 DA  J "C5'" 1 
ATOM   3059  C "C4'" . DA  B 2 27  ? 99.871  74.419  79.524  1.00 78.63  ? -33 DA  J "C4'" 1 
ATOM   3060  O "O4'" . DA  B 2 27  ? 101.209 73.889  79.378  1.00 79.02  ? -33 DA  J "O4'" 1 
ATOM   3061  C "C3'" . DA  B 2 27  ? 99.086  73.365  80.302  1.00 80.42  ? -33 DA  J "C3'" 1 
ATOM   3062  O "O3'" . DA  B 2 27  ? 98.391  72.515  79.387  1.00 86.53  ? -33 DA  J "O3'" 1 
ATOM   3063  C "C2'" . DA  B 2 27  ? 100.168 72.587  81.026  1.00 78.86  ? -33 DA  J "C2'" 1 
ATOM   3064  C "C1'" . DA  B 2 27  ? 101.311 72.632  80.032  1.00 77.66  ? -33 DA  J "C1'" 1 
ATOM   3065  N N9    . DA  B 2 27  ? 102.644 72.554  80.626  1.00 75.77  ? -33 DA  J N9    1 
ATOM   3066  C C8    . DA  B 2 27  ? 103.108 73.171  81.759  1.00 74.65  ? -33 DA  J C8    1 
ATOM   3067  N N7    . DA  B 2 27  ? 104.370 72.924  82.017  1.00 73.75  ? -33 DA  J N7    1 
ATOM   3068  C C5    . DA  B 2 27  ? 104.761 72.080  80.985  1.00 74.88  ? -33 DA  J C5    1 
ATOM   3069  C C6    . DA  B 2 27  ? 105.989 71.467  80.676  1.00 74.33  ? -33 DA  J C6    1 
ATOM   3070  N N6    . DA  B 2 27  ? 107.097 71.615  81.402  1.00 75.12  ? -33 DA  J N6    1 
ATOM   3071  N N1    . DA  B 2 27  ? 106.039 70.686  79.576  1.00 73.41  ? -33 DA  J N1    1 
ATOM   3072  C C2    . DA  B 2 27  ? 104.932 70.544  78.844  1.00 74.94  ? -33 DA  J C2    1 
ATOM   3073  N N3    . DA  B 2 27  ? 103.725 71.070  79.029  1.00 75.06  ? -33 DA  J N3    1 
ATOM   3074  C C4    . DA  B 2 27  ? 103.706 71.837  80.129  1.00 75.11  ? -33 DA  J C4    1 
ATOM   3075  P P     . DA  B 2 28  ? 97.330  71.445  79.943  1.00 89.81  ? -32 DA  J P     1 
ATOM   3076  O OP1   . DA  B 2 28  ? 96.184  71.409  78.998  1.00 89.81  ? -32 DA  J OP1   1 
ATOM   3077  O OP2   . DA  B 2 28  ? 97.089  71.730  81.379  1.00 89.89  ? -32 DA  J OP2   1 
ATOM   3078  O "O5'" . DA  B 2 28  ? 98.106  70.061  79.837  1.00 88.91  ? -32 DA  J "O5'" 1 
ATOM   3079  C "C5'" . DA  B 2 28  ? 98.008  69.277  78.658  1.00 91.67  ? -32 DA  J "C5'" 1 
ATOM   3080  C "C4'" . DA  B 2 28  ? 98.254  67.824  78.986  1.00 93.28  ? -32 DA  J "C4'" 1 
ATOM   3081  O "O4'" . DA  B 2 28  ? 99.667  67.649  79.245  1.00 92.66  ? -32 DA  J "O4'" 1 
ATOM   3082  C "C3'" . DA  B 2 28  ? 97.522  67.345  80.238  1.00 94.58  ? -32 DA  J "C3'" 1 
ATOM   3083  O "O3'" . DA  B 2 28  ? 96.785  66.130  80.024  1.00 96.27  ? -32 DA  J "O3'" 1 
ATOM   3084  C "C2'" . DA  B 2 28  ? 98.591  67.284  81.316  1.00 92.78  ? -32 DA  J "C2'" 1 
ATOM   3085  C "C1'" . DA  B 2 28  ? 99.900  67.154  80.552  1.00 92.08  ? -32 DA  J "C1'" 1 
ATOM   3086  N N9    . DA  B 2 28  ? 100.995 67.932  81.131  1.00 91.56  ? -32 DA  J N9    1 
ATOM   3087  C C8    . DA  B 2 28  ? 100.904 69.070  81.895  1.00 91.43  ? -32 DA  J C8    1 
ATOM   3088  N N7    . DA  B 2 28  ? 102.061 69.537  82.291  1.00 90.79  ? -32 DA  J N7    1 
ATOM   3089  C C5    . DA  B 2 28  ? 102.979 68.651  81.750  1.00 90.58  ? -32 DA  J C5    1 
ATOM   3090  C C6    . DA  B 2 28  ? 104.382 68.587  81.814  1.00 90.55  ? -32 DA  J C6    1 
ATOM   3091  N N6    . DA  B 2 28  ? 105.131 69.459  82.494  1.00 90.45  ? -32 DA  J N6    1 
ATOM   3092  N N1    . DA  B 2 28  ? 104.995 67.579  81.158  1.00 89.00  ? -32 DA  J N1    1 
ATOM   3093  C C2    . DA  B 2 28  ? 104.240 66.694  80.496  1.00 89.78  ? -32 DA  J C2    1 
ATOM   3094  N N3    . DA  B 2 28  ? 102.916 66.640  80.371  1.00 90.50  ? -32 DA  J N3    1 
ATOM   3095  C C4    . DA  B 2 28  ? 102.338 67.659  81.028  1.00 91.16  ? -32 DA  J C4    1 
ATOM   3096  P P     . DA  B 2 29  ? 97.468  64.875  79.290  1.00 97.78  ? -31 DA  J P     1 
ATOM   3097  O OP1   . DA  B 2 29  ? 97.590  65.198  77.844  1.00 97.65  ? -31 DA  J OP1   1 
ATOM   3098  O OP2   . DA  B 2 29  ? 96.696  63.678  79.708  1.00 98.62  ? -31 DA  J OP2   1 
ATOM   3099  O "O5'" . DA  B 2 29  ? 98.927  64.761  79.912  1.00 97.20  ? -31 DA  J "O5'" 1 
ATOM   3100  C "C5'" . DA  B 2 29  ? 99.983  64.164  79.160  1.00 94.78  ? -31 DA  J "C5'" 1 
ATOM   3101  C "C4'" . DA  B 2 29  ? 100.771 63.210  80.025  1.00 92.68  ? -31 DA  J "C4'" 1 
ATOM   3102  O "O4'" . DA  B 2 29  ? 101.707 63.933  80.861  1.00 91.54  ? -31 DA  J "O4'" 1 
ATOM   3103  C "C3'" . DA  B 2 29  ? 99.927  62.352  80.969  1.00 92.06  ? -31 DA  J "C3'" 1 
ATOM   3104  O "O3'" . DA  B 2 29  ? 100.430 61.013  80.978  1.00 93.18  ? -31 DA  J "O3'" 1 
ATOM   3105  C "C2'" . DA  B 2 29  ? 100.137 63.013  82.321  1.00 90.90  ? -31 DA  J "C2'" 1 
ATOM   3106  C "C1'" . DA  B 2 29  ? 101.569 63.494  82.202  1.00 89.51  ? -31 DA  J "C1'" 1 
ATOM   3107  N N9    . DA  B 2 29  ? 101.931 64.606  83.082  1.00 88.06  ? -31 DA  J N9    1 
ATOM   3108  C C8    . DA  B 2 29  ? 101.106 65.399  83.839  1.00 86.27  ? -31 DA  J C8    1 
ATOM   3109  N N7    . DA  B 2 29  ? 101.742 66.303  84.541  1.00 85.45  ? -31 DA  J N7    1 
ATOM   3110  C C5    . DA  B 2 29  ? 103.077 66.095  84.224  1.00 85.33  ? -31 DA  J C5    1 
ATOM   3111  C C6    . DA  B 2 29  ? 104.259 66.728  84.642  1.00 85.30  ? -31 DA  J C6    1 
ATOM   3112  N N6    . DA  B 2 29  ? 104.294 67.736  85.515  1.00 86.09  ? -31 DA  J N6    1 
ATOM   3113  N N1    . DA  B 2 29  ? 105.425 66.283  84.130  1.00 85.72  ? -31 DA  J N1    1 
ATOM   3114  C C2    . DA  B 2 29  ? 105.394 65.269  83.263  1.00 86.57  ? -31 DA  J C2    1 
ATOM   3115  N N3    . DA  B 2 29  ? 104.350 64.590  82.796  1.00 87.31  ? -31 DA  J N3    1 
ATOM   3116  C C4    . DA  B 2 29  ? 103.207 65.059  83.323  1.00 86.80  ? -31 DA  J C4    1 
ATOM   3117  P P     . DC  B 2 30  ? 99.866  59.949  82.043  1.00 92.43  ? -30 DC  J P     1 
ATOM   3118  O OP1   . DC  B 2 30  ? 99.783  58.644  81.347  1.00 93.37  ? -30 DC  J OP1   1 
ATOM   3119  O OP2   . DC  B 2 30  ? 98.660  60.500  82.713  1.00 91.99  ? -30 DC  J OP2   1 
ATOM   3120  O "O5'" . DC  B 2 30  ? 101.039 59.860  83.113  1.00 93.67  ? -30 DC  J "O5'" 1 
ATOM   3121  C "C5'" . DC  B 2 30  ? 102.361 59.513  82.706  1.00 93.24  ? -30 DC  J "C5'" 1 
ATOM   3122  C "C4'" . DC  B 2 30  ? 103.258 59.351  83.909  1.00 93.24  ? -30 DC  J "C4'" 1 
ATOM   3123  O "O4'" . DC  B 2 30  ? 103.589 60.645  84.471  1.00 93.32  ? -30 DC  J "O4'" 1 
ATOM   3124  C "C3'" . DC  B 2 30  ? 102.662 58.530  85.053  1.00 93.28  ? -30 DC  J "C3'" 1 
ATOM   3125  O "O3'" . DC  B 2 30  ? 103.665 57.672  85.602  1.00 94.10  ? -30 DC  J "O3'" 1 
ATOM   3126  C "C2'" . DC  B 2 30  ? 102.249 59.586  86.065  1.00 92.98  ? -30 DC  J "C2'" 1 
ATOM   3127  C "C1'" . DC  B 2 30  ? 103.321 60.640  85.865  1.00 91.99  ? -30 DC  J "C1'" 1 
ATOM   3128  N N1    . DC  B 2 30  ? 102.940 62.007  86.263  1.00 90.50  ? -30 DC  J N1    1 
ATOM   3129  C C2    . DC  B 2 30  ? 103.948 62.898  86.653  1.00 89.31  ? -30 DC  J C2    1 
ATOM   3130  O O2    . DC  B 2 30  ? 105.125 62.507  86.651  1.00 88.47  ? -30 DC  J O2    1 
ATOM   3131  N N3    . DC  B 2 30  ? 103.615 64.154  87.027  1.00 88.92  ? -30 DC  J N3    1 
ATOM   3132  C C4    . DC  B 2 30  ? 102.335 64.532  87.026  1.00 88.79  ? -30 DC  J C4    1 
ATOM   3133  N N4    . DC  B 2 30  ? 102.050 65.776  87.409  1.00 87.67  ? -30 DC  J N4    1 
ATOM   3134  C C5    . DC  B 2 30  ? 101.288 63.648  86.632  1.00 88.76  ? -30 DC  J C5    1 
ATOM   3135  C C6    . DC  B 2 30  ? 101.633 62.408  86.260  1.00 89.47  ? -30 DC  J C6    1 
ATOM   3136  P P     . DT  B 2 31  ? 103.406 56.940  87.005  1.00 94.81  ? -29 DT  J P     1 
ATOM   3137  O OP1   . DT  B 2 31  ? 104.281 55.742  87.085  1.00 94.07  ? -29 DT  J OP1   1 
ATOM   3138  O OP2   . DT  B 2 31  ? 101.936 56.792  87.172  1.00 95.66  ? -29 DT  J OP2   1 
ATOM   3139  O "O5'" . DT  B 2 31  ? 103.928 58.007  88.066  1.00 94.94  ? -29 DT  J "O5'" 1 
ATOM   3140  C "C5'" . DT  B 2 31  ? 105.283 58.449  88.030  1.00 92.44  ? -29 DT  J "C5'" 1 
ATOM   3141  C "C4'" . DT  B 2 31  ? 105.649 59.138  89.323  1.00 90.09  ? -29 DT  J "C4'" 1 
ATOM   3142  O "O4'" . DT  B 2 31  ? 105.056 60.456  89.391  1.00 88.49  ? -29 DT  J "O4'" 1 
ATOM   3143  C "C3'" . DT  B 2 31  ? 105.215 58.414  90.599  1.00 89.25  ? -29 DT  J "C3'" 1 
ATOM   3144  O "O3'" . DT  B 2 31  ? 106.230 58.577  91.586  1.00 90.80  ? -29 DT  J "O3'" 1 
ATOM   3145  C "C2'" . DT  B 2 31  ? 103.986 59.194  91.029  1.00 87.47  ? -29 DT  J "C2'" 1 
ATOM   3146  C "C1'" . DT  B 2 31  ? 104.397 60.598  90.636  1.00 86.77  ? -29 DT  J "C1'" 1 
ATOM   3147  N N1    . DT  B 2 31  ? 103.306 61.569  90.467  1.00 84.27  ? -29 DT  J N1    1 
ATOM   3148  C C2    . DT  B 2 31  ? 103.558 62.865  90.842  1.00 81.90  ? -29 DT  J C2    1 
ATOM   3149  O O2    . DT  B 2 31  ? 104.629 63.225  91.299  1.00 80.21  ? -29 DT  J O2    1 
ATOM   3150  N N3    . DT  B 2 31  ? 102.508 63.728  90.661  1.00 81.58  ? -29 DT  J N3    1 
ATOM   3151  C C4    . DT  B 2 31  ? 101.260 63.429  90.148  1.00 82.52  ? -29 DT  J C4    1 
ATOM   3152  O O4    . DT  B 2 31  ? 100.413 64.314  90.041  1.00 81.10  ? -29 DT  J O4    1 
ATOM   3153  C C5    . DT  B 2 31  ? 101.067 62.047  89.773  1.00 82.84  ? -29 DT  J C5    1 
ATOM   3154  C C7    . DT  B 2 31  ? 99.748  61.629  89.204  1.00 83.95  ? -29 DT  J C7    1 
ATOM   3155  C C6    . DT  B 2 31  ? 102.084 61.198  89.950  1.00 83.30  ? -29 DT  J C6    1 
ATOM   3156  P P     . DG  B 2 32  ? 106.593 57.368  92.569  1.00 90.39  ? -28 DG  J P     1 
ATOM   3157  O OP1   . DG  B 2 32  ? 107.375 56.375  91.789  1.00 90.98  ? -28 DG  J OP1   1 
ATOM   3158  O OP2   . DG  B 2 32  ? 105.350 56.946  93.265  1.00 90.65  ? -28 DG  J OP2   1 
ATOM   3159  O "O5'" . DG  B 2 32  ? 107.553 58.051  93.639  1.00 89.48  ? -28 DG  J "O5'" 1 
ATOM   3160  C "C5'" . DG  B 2 32  ? 108.672 58.821  93.215  1.00 86.99  ? -28 DG  J "C5'" 1 
ATOM   3161  C "C4'" . DG  B 2 32  ? 108.800 60.071  94.055  1.00 87.08  ? -28 DG  J "C4'" 1 
ATOM   3162  O "O4'" . DG  B 2 32  ? 107.672 60.949  93.820  1.00 87.01  ? -28 DG  J "O4'" 1 
ATOM   3163  C "C3'" . DG  B 2 32  ? 108.852 59.845  95.564  1.00 86.14  ? -28 DG  J "C3'" 1 
ATOM   3164  O "O3'" . DG  B 2 32  ? 109.823 60.731  96.132  1.00 85.84  ? -28 DG  J "O3'" 1 
ATOM   3165  C "C2'" . DG  B 2 32  ? 107.445 60.187  96.022  1.00 85.61  ? -28 DG  J "C2'" 1 
ATOM   3166  C "C1'" . DG  B 2 32  ? 107.046 61.283  95.049  1.00 86.40  ? -28 DG  J "C1'" 1 
ATOM   3167  N N9    . DG  B 2 32  ? 105.614 61.426  94.790  1.00 85.11  ? -28 DG  J N9    1 
ATOM   3168  C C8    . DG  B 2 32  ? 104.754 60.464  94.318  1.00 85.56  ? -28 DG  J C8    1 
ATOM   3169  N N7    . DG  B 2 32  ? 103.543 60.911  94.118  1.00 84.91  ? -28 DG  J N7    1 
ATOM   3170  C C5    . DG  B 2 32  ? 103.602 62.246  94.492  1.00 84.80  ? -28 DG  J C5    1 
ATOM   3171  C C6    . DG  B 2 32  ? 102.599 63.258  94.473  1.00 84.80  ? -28 DG  J C6    1 
ATOM   3172  O O6    . DG  B 2 32  ? 101.426 63.181  94.088  1.00 83.50  ? -28 DG  J O6    1 
ATOM   3173  N N1    . DG  B 2 32  ? 103.087 64.467  94.953  1.00 84.19  ? -28 DG  J N1    1 
ATOM   3174  C C2    . DG  B 2 32  ? 104.369 64.687  95.384  1.00 83.80  ? -28 DG  J C2    1 
ATOM   3175  N N2    . DG  B 2 32  ? 104.637 65.925  95.821  1.00 83.15  ? -28 DG  J N2    1 
ATOM   3176  N N3    . DG  B 2 32  ? 105.317 63.762  95.392  1.00 84.38  ? -28 DG  J N3    1 
ATOM   3177  C C4    . DG  B 2 32  ? 104.867 62.574  94.934  1.00 84.56  ? -28 DG  J C4    1 
ATOM   3178  P P     . DC  B 2 33  ? 110.329 60.504  97.642  1.00 87.04  ? -27 DC  J P     1 
ATOM   3179  O OP1   . DC  B 2 33  ? 111.692 61.082  97.775  1.00 84.35  ? -27 DC  J OP1   1 
ATOM   3180  O OP2   . DC  B 2 33  ? 110.093 59.087  98.011  1.00 86.11  ? -27 DC  J OP2   1 
ATOM   3181  O "O5'" . DC  B 2 33  ? 109.331 61.404  98.492  1.00 86.61  ? -27 DC  J "O5'" 1 
ATOM   3182  C "C5'" . DC  B 2 33  ? 109.335 62.819  98.337  1.00 83.78  ? -27 DC  J "C5'" 1 
ATOM   3183  C "C4'" . DC  B 2 33  ? 108.222 63.437  99.149  1.00 80.70  ? -27 DC  J "C4'" 1 
ATOM   3184  O "O4'" . DC  B 2 33  ? 106.945 63.322  98.481  1.00 80.43  ? -27 DC  J "O4'" 1 
ATOM   3185  C "C3'" . DC  B 2 33  ? 108.023 62.833  100.540 1.00 78.40  ? -27 DC  J "C3'" 1 
ATOM   3186  O "O3'" . DC  B 2 33  ? 107.667 63.887  101.423 1.00 77.12  ? -27 DC  J "O3'" 1 
ATOM   3187  C "C2'" . DC  B 2 33  ? 106.794 61.966  100.356 1.00 78.00  ? -27 DC  J "C2'" 1 
ATOM   3188  C "C1'" . DC  B 2 33  ? 106.007 62.877  99.443  1.00 79.12  ? -27 DC  J "C1'" 1 
ATOM   3189  N N1    . DC  B 2 33  ? 104.837 62.319  98.754  1.00 78.55  ? -27 DC  J N1    1 
ATOM   3190  C C2    . DC  B 2 33  ? 103.714 63.138  98.608  1.00 78.17  ? -27 DC  J C2    1 
ATOM   3191  O O2    . DC  B 2 33  ? 103.774 64.311  99.016  1.00 78.19  ? -27 DC  J O2    1 
ATOM   3192  N N3    . DC  B 2 33  ? 102.602 62.642  98.025  1.00 77.29  ? -27 DC  J N3    1 
ATOM   3193  C C4    . DC  B 2 33  ? 102.587 61.381  97.588  1.00 77.79  ? -27 DC  J C4    1 
ATOM   3194  N N4    . DC  B 2 33  ? 101.459 60.926  97.036  1.00 74.94  ? -27 DC  J N4    1 
ATOM   3195  C C5    . DC  B 2 33  ? 103.727 60.530  97.702  1.00 76.66  ? -27 DC  J C5    1 
ATOM   3196  C C6    . DC  B 2 33  ? 104.822 61.036  98.285  1.00 77.35  ? -27 DC  J C6    1 
ATOM   3197  P P     . DT  B 2 34  ? 108.483 64.104  102.779 1.00 76.56  ? -26 DT  J P     1 
ATOM   3198  O OP1   . DT  B 2 34  ? 109.910 64.244  102.392 1.00 75.81  ? -26 DT  J OP1   1 
ATOM   3199  O OP2   . DT  B 2 34  ? 108.077 63.064  103.760 1.00 76.51  ? -26 DT  J OP2   1 
ATOM   3200  O "O5'" . DT  B 2 34  ? 107.969 65.525  103.273 1.00 75.42  ? -26 DT  J "O5'" 1 
ATOM   3201  C "C5'" . DT  B 2 34  ? 108.215 66.680  102.479 1.00 70.80  ? -26 DT  J "C5'" 1 
ATOM   3202  C "C4'" . DT  B 2 34  ? 106.961 67.509  102.343 1.00 68.14  ? -26 DT  J "C4'" 1 
ATOM   3203  O "O4'" . DT  B 2 34  ? 105.917 66.722  101.724 1.00 67.65  ? -26 DT  J "O4'" 1 
ATOM   3204  C "C3'" . DT  B 2 34  ? 106.377 68.032  103.654 1.00 65.44  ? -26 DT  J "C3'" 1 
ATOM   3205  O "O3'" . DT  B 2 34  ? 105.972 69.389  103.468 1.00 63.95  ? -26 DT  J "O3'" 1 
ATOM   3206  C "C2'" . DT  B 2 34  ? 105.185 67.124  103.904 1.00 65.28  ? -26 DT  J "C2'" 1 
ATOM   3207  C "C1'" . DT  B 2 34  ? 104.732 66.803  102.492 1.00 67.92  ? -26 DT  J "C1'" 1 
ATOM   3208  N N1    . DT  B 2 34  ? 103.996 65.534  102.322 1.00 69.05  ? -26 DT  J N1    1 
ATOM   3209  C C2    . DT  B 2 34  ? 102.720 65.583  101.793 1.00 71.80  ? -26 DT  J C2    1 
ATOM   3210  O O2    . DT  B 2 34  ? 102.163 66.621  101.465 1.00 70.93  ? -26 DT  J O2    1 
ATOM   3211  N N3    . DT  B 2 34  ? 102.112 64.357  101.653 1.00 72.56  ? -26 DT  J N3    1 
ATOM   3212  C C4    . DT  B 2 34  ? 102.636 63.124  101.982 1.00 70.85  ? -26 DT  J C4    1 
ATOM   3213  O O4    . DT  B 2 34  ? 101.970 62.112  101.796 1.00 70.46  ? -26 DT  J O4    1 
ATOM   3214  C C5    . DT  B 2 34  ? 103.967 63.148  102.535 1.00 71.52  ? -26 DT  J C5    1 
ATOM   3215  C C7    . DT  B 2 34  ? 104.611 61.853  102.927 1.00 72.16  ? -26 DT  J C7    1 
ATOM   3216  C C6    . DT  B 2 34  ? 104.573 64.336  102.676 1.00 70.03  ? -26 DT  J C6    1 
ATOM   3217  P P     . DC  B 2 35  ? 105.704 70.318  104.745 1.00 59.61  ? -25 DC  J P     1 
ATOM   3218  O OP1   . DC  B 2 35  ? 106.004 71.716  104.378 1.00 61.55  ? -25 DC  J OP1   1 
ATOM   3219  O OP2   . DC  B 2 35  ? 106.375 69.700  105.914 1.00 62.73  ? -25 DC  J OP2   1 
ATOM   3220  O "O5'" . DC  B 2 35  ? 104.143 70.157  104.988 1.00 55.04  ? -25 DC  J "O5'" 1 
ATOM   3221  C "C5'" . DC  B 2 35  ? 103.200 70.657  104.053 1.00 49.66  ? -25 DC  J "C5'" 1 
ATOM   3222  C "C4'" . DC  B 2 35  ? 101.814 70.242  104.473 1.00 47.88  ? -25 DC  J "C4'" 1 
ATOM   3223  O "O4'" . DC  B 2 35  ? 101.655 68.821  104.240 1.00 47.08  ? -25 DC  J "O4'" 1 
ATOM   3224  C "C3'" . DC  B 2 35  ? 101.543 70.465  105.968 1.00 47.55  ? -25 DC  J "C3'" 1 
ATOM   3225  O "O3'" . DC  B 2 35  ? 100.187 70.862  106.159 1.00 42.64  ? -25 DC  J "O3'" 1 
ATOM   3226  C "C2'" . DC  B 2 35  ? 101.717 69.079  106.556 1.00 49.08  ? -25 DC  J "C2'" 1 
ATOM   3227  C "C1'" . DC  B 2 35  ? 101.147 68.235  105.424 1.00 50.50  ? -25 DC  J "C1'" 1 
ATOM   3228  N N1    . DC  B 2 35  ? 101.492 66.805  105.425 1.00 49.99  ? -25 DC  J N1    1 
ATOM   3229  C C2    . DC  B 2 35  ? 100.654 65.916  104.735 1.00 50.68  ? -25 DC  J C2    1 
ATOM   3230  O O2    . DC  B 2 35  ? 99.659  66.360  104.149 1.00 43.15  ? -25 DC  J O2    1 
ATOM   3231  N N3    . DC  B 2 35  ? 100.952 64.599  104.728 1.00 51.25  ? -25 DC  J N3    1 
ATOM   3232  C C4    . DC  B 2 35  ? 102.026 64.156  105.376 1.00 53.39  ? -25 DC  J C4    1 
ATOM   3233  N N4    . DC  B 2 35  ? 102.271 62.846  105.347 1.00 60.06  ? -25 DC  J N4    1 
ATOM   3234  C C5    . DC  B 2 35  ? 102.897 65.033  106.085 1.00 53.28  ? -25 DC  J C5    1 
ATOM   3235  C C6    . DC  B 2 35  ? 102.597 66.342  106.081 1.00 53.09  ? -25 DC  J C6    1 
ATOM   3236  P P     . DC  B 2 36  ? 99.766  72.389  105.906 1.00 41.21  ? -24 DC  J P     1 
ATOM   3237  O OP1   . DC  B 2 36  ? 100.449 72.879  104.690 1.00 34.34  ? -24 DC  J OP1   1 
ATOM   3238  O OP2   . DC  B 2 36  ? 99.913  73.141  107.182 1.00 40.23  ? -24 DC  J OP2   1 
ATOM   3239  O "O5'" . DC  B 2 36  ? 98.223  72.280  105.566 1.00 41.49  ? -24 DC  J "O5'" 1 
ATOM   3240  C "C5'" . DC  B 2 36  ? 97.805  71.866  104.274 1.00 38.27  ? -24 DC  J "C5'" 1 
ATOM   3241  C "C4'" . DC  B 2 36  ? 96.592  70.979  104.400 1.00 41.63  ? -24 DC  J "C4'" 1 
ATOM   3242  O "O4'" . DC  B 2 36  ? 96.994  69.604  104.627 1.00 42.05  ? -24 DC  J "O4'" 1 
ATOM   3243  C "C3'" . DC  B 2 36  ? 95.668  71.362  105.554 1.00 37.23  ? -24 DC  J "C3'" 1 
ATOM   3244  O "O3'" . DC  B 2 36  ? 94.341  71.493  105.068 1.00 31.61  ? -24 DC  J "O3'" 1 
ATOM   3245  C "C2'" . DC  B 2 36  ? 95.816  70.213  106.547 1.00 42.27  ? -24 DC  J "C2'" 1 
ATOM   3246  C "C1'" . DC  B 2 36  ? 96.217  69.041  105.665 1.00 42.86  ? -24 DC  J "C1'" 1 
ATOM   3247  N N1    . DC  B 2 36  ? 97.046  68.004  106.315 1.00 44.57  ? -24 DC  J N1    1 
ATOM   3248  C C2    . DC  B 2 36  ? 96.697  66.650  106.150 1.00 42.09  ? -24 DC  J C2    1 
ATOM   3249  O O2    . DC  B 2 36  ? 95.688  66.369  105.501 1.00 41.37  ? -24 DC  J O2    1 
ATOM   3250  N N3    . DC  B 2 36  ? 97.473  65.695  106.705 1.00 41.26  ? -24 DC  J N3    1 
ATOM   3251  C C4    . DC  B 2 36  ? 98.559  66.035  107.406 1.00 45.50  ? -24 DC  J C4    1 
ATOM   3252  N N4    . DC  B 2 36  ? 99.324  65.056  107.900 1.00 45.30  ? -24 DC  J N4    1 
ATOM   3253  C C5    . DC  B 2 36  ? 98.922  67.405  107.620 1.00 46.98  ? -24 DC  J C5    1 
ATOM   3254  C C6    . DC  B 2 36  ? 98.145  68.347  107.058 1.00 45.11  ? -24 DC  J C6    1 
ATOM   3255  P P     . DA  B 2 37  ? 93.191  72.016  106.041 1.00 34.45  ? -23 DA  J P     1 
ATOM   3256  O OP1   . DA  B 2 37  ? 92.340  72.993  105.315 1.00 34.71  ? -23 DA  J OP1   1 
ATOM   3257  O OP2   . DA  B 2 37  ? 93.777  72.377  107.351 1.00 37.21  ? -23 DA  J OP2   1 
ATOM   3258  O "O5'" . DA  B 2 37  ? 92.306  70.705  106.257 1.00 42.20  ? -23 DA  J "O5'" 1 
ATOM   3259  C "C5'" . DA  B 2 37  ? 91.802  69.987  105.127 1.00 43.64  ? -23 DA  J "C5'" 1 
ATOM   3260  C "C4'" . DA  B 2 37  ? 91.111  68.719  105.570 1.00 48.36  ? -23 DA  J "C4'" 1 
ATOM   3261  O "O4'" . DA  B 2 37  ? 92.081  67.814  106.141 1.00 50.29  ? -23 DA  J "O4'" 1 
ATOM   3262  C "C3'" . DA  B 2 37  ? 90.044  68.914  106.641 1.00 52.04  ? -23 DA  J "C3'" 1 
ATOM   3263  O "O3'" . DA  B 2 37  ? 88.920  68.092  106.353 1.00 58.19  ? -23 DA  J "O3'" 1 
ATOM   3264  C "C2'" . DA  B 2 37  ? 90.729  68.489  107.930 1.00 48.97  ? -23 DA  J "C2'" 1 
ATOM   3265  C "C1'" . DA  B 2 37  ? 91.709  67.445  107.459 1.00 48.03  ? -23 DA  J "C1'" 1 
ATOM   3266  N N9    . DA  B 2 37  ? 92.940  67.348  108.236 1.00 53.84  ? -23 DA  J N9    1 
ATOM   3267  C C8    . DA  B 2 37  ? 93.682  68.366  108.774 1.00 55.11  ? -23 DA  J C8    1 
ATOM   3268  N N7    . DA  B 2 37  ? 94.781  67.964  109.363 1.00 55.54  ? -23 DA  J N7    1 
ATOM   3269  C C5    . DA  B 2 37  ? 94.753  66.586  109.216 1.00 53.46  ? -23 DA  J C5    1 
ATOM   3270  C C6    . DA  B 2 37  ? 95.637  65.583  109.621 1.00 54.19  ? -23 DA  J C6    1 
ATOM   3271  N N6    . DA  B 2 37  ? 96.778  65.822  110.271 1.00 52.95  ? -23 DA  J N6    1 
ATOM   3272  N N1    . DA  B 2 37  ? 95.314  64.307  109.328 1.00 56.18  ? -23 DA  J N1    1 
ATOM   3273  C C2    . DA  B 2 37  ? 94.174  64.073  108.669 1.00 57.27  ? -23 DA  J C2    1 
ATOM   3274  N N3    . DA  B 2 37  ? 93.262  64.934  108.232 1.00 56.39  ? -23 DA  J N3    1 
ATOM   3275  C C4    . DA  B 2 37  ? 93.618  66.191  108.540 1.00 54.67  ? -23 DA  J C4    1 
ATOM   3276  P P     . DT  B 2 38  ? 87.614  68.191  107.271 1.00 59.19  ? -22 DT  J P     1 
ATOM   3277  O OP1   . DT  B 2 38  ? 86.453  67.902  106.405 1.00 64.29  ? -22 DT  J OP1   1 
ATOM   3278  O OP2   . DT  B 2 38  ? 87.665  69.448  108.046 1.00 63.92  ? -22 DT  J OP2   1 
ATOM   3279  O "O5'" . DT  B 2 38  ? 87.833  66.976  108.262 1.00 61.53  ? -22 DT  J "O5'" 1 
ATOM   3280  C "C5'" . DT  B 2 38  ? 88.385  65.773  107.760 1.00 63.98  ? -22 DT  J "C5'" 1 
ATOM   3281  C "C4'" . DT  B 2 38  ? 88.578  64.786  108.880 1.00 65.12  ? -22 DT  J "C4'" 1 
ATOM   3282  O "O4'" . DT  B 2 38  ? 89.944  64.778  109.357 1.00 63.88  ? -22 DT  J "O4'" 1 
ATOM   3283  C "C3'" . DT  B 2 38  ? 87.691  65.050  110.095 1.00 66.99  ? -22 DT  J "C3'" 1 
ATOM   3284  O "O3'" . DT  B 2 38  ? 87.120  63.818  110.502 1.00 75.29  ? -22 DT  J "O3'" 1 
ATOM   3285  C "C2'" . DT  B 2 38  ? 88.675  65.528  111.147 1.00 65.29  ? -22 DT  J "C2'" 1 
ATOM   3286  C "C1'" . DT  B 2 38  ? 89.912  64.744  110.767 1.00 61.77  ? -22 DT  J "C1'" 1 
ATOM   3287  N N1    . DT  B 2 38  ? 91.200  65.248  111.274 1.00 60.41  ? -22 DT  J N1    1 
ATOM   3288  C C2    . DT  B 2 38  ? 92.171  64.310  111.546 1.00 59.40  ? -22 DT  J C2    1 
ATOM   3289  O O2    . DT  B 2 38  ? 92.027  63.123  111.316 1.00 57.72  ? -22 DT  J O2    1 
ATOM   3290  N N3    . DT  B 2 38  ? 93.325  64.814  112.089 1.00 56.76  ? -22 DT  J N3    1 
ATOM   3291  C C4    . DT  B 2 38  ? 93.605  66.137  112.365 1.00 56.40  ? -22 DT  J C4    1 
ATOM   3292  O O4    . DT  B 2 38  ? 94.670  66.436  112.891 1.00 54.41  ? -22 DT  J O4    1 
ATOM   3293  C C5    . DT  B 2 38  ? 92.570  67.077  112.005 1.00 55.71  ? -22 DT  J C5    1 
ATOM   3294  C C7    . DT  B 2 38  ? 92.819  68.535  112.215 1.00 55.10  ? -22 DT  J C7    1 
ATOM   3295  C C6    . DT  B 2 38  ? 91.426  66.594  111.490 1.00 59.20  ? -22 DT  J C6    1 
ATOM   3296  P P     . DC  B 2 39  ? 85.811  63.809  111.425 1.00 78.06  ? -21 DC  J P     1 
ATOM   3297  O OP1   . DC  B 2 39  ? 84.683  63.318  110.595 1.00 78.12  ? -21 DC  J OP1   1 
ATOM   3298  O OP2   . DC  B 2 39  ? 85.691  65.105  112.139 1.00 79.68  ? -21 DC  J OP2   1 
ATOM   3299  O "O5'" . DC  B 2 39  ? 86.192  62.682  112.469 1.00 76.63  ? -21 DC  J "O5'" 1 
ATOM   3300  C "C5'" . DC  B 2 39  ? 86.745  61.458  112.010 1.00 77.19  ? -21 DC  J "C5'" 1 
ATOM   3301  C "C4'" . DC  B 2 39  ? 87.344  60.704  113.167 1.00 78.03  ? -21 DC  J "C4'" 1 
ATOM   3302  O "O4'" . DC  B 2 39  ? 88.698  61.158  113.401 1.00 77.33  ? -21 DC  J "O4'" 1 
ATOM   3303  C "C3'" . DC  B 2 39  ? 86.575  60.922  114.468 1.00 79.41  ? -21 DC  J "C3'" 1 
ATOM   3304  O "O3'" . DC  B 2 39  ? 86.371  59.686  115.147 1.00 82.46  ? -21 DC  J "O3'" 1 
ATOM   3305  C "C2'" . DC  B 2 39  ? 87.460  61.873  115.258 1.00 77.74  ? -21 DC  J "C2'" 1 
ATOM   3306  C "C1'" . DC  B 2 39  ? 88.856  61.539  114.756 1.00 76.41  ? -21 DC  J "C1'" 1 
ATOM   3307  N N1    . DC  B 2 39  ? 89.821  62.655  114.801 1.00 74.09  ? -21 DC  J N1    1 
ATOM   3308  C C2    . DC  B 2 39  ? 91.179  62.359  114.895 1.00 73.99  ? -21 DC  J C2    1 
ATOM   3309  O O2    . DC  B 2 39  ? 91.532  61.172  114.911 1.00 76.66  ? -21 DC  J O2    1 
ATOM   3310  N N3    . DC  B 2 39  ? 92.076  63.370  114.964 1.00 72.30  ? -21 DC  J N3    1 
ATOM   3311  C C4    . DC  B 2 39  ? 91.655  64.633  114.935 1.00 70.87  ? -21 DC  J C4    1 
ATOM   3312  N N4    . DC  B 2 39  ? 92.573  65.599  115.016 1.00 69.43  ? -21 DC  J N4    1 
ATOM   3313  C C5    . DC  B 2 39  ? 90.277  64.965  114.826 1.00 70.58  ? -21 DC  J C5    1 
ATOM   3314  C C6    . DC  B 2 39  ? 89.401  63.956  114.760 1.00 72.41  ? -21 DC  J C6    1 
ATOM   3315  P P     . DA  B 2 40  ? 85.771  59.693  116.632 1.00 83.54  ? -20 DA  J P     1 
ATOM   3316  O OP1   . DA  B 2 40  ? 85.077  58.396  116.854 1.00 86.32  ? -20 DA  J OP1   1 
ATOM   3317  O OP2   . DA  B 2 40  ? 85.029  60.964  116.818 1.00 82.30  ? -20 DA  J OP2   1 
ATOM   3318  O "O5'" . DA  B 2 40  ? 87.085  59.726  117.526 1.00 80.23  ? -20 DA  J "O5'" 1 
ATOM   3319  C "C5'" . DA  B 2 40  ? 88.158  58.834  117.252 1.00 78.15  ? -20 DA  J "C5'" 1 
ATOM   3320  C "C4'" . DA  B 2 40  ? 89.054  58.725  118.459 1.00 78.08  ? -20 DA  J "C4'" 1 
ATOM   3321  O "O4'" . DA  B 2 40  ? 90.137  59.686  118.393 1.00 76.73  ? -20 DA  J "O4'" 1 
ATOM   3322  C "C3'" . DA  B 2 40  ? 88.305  59.000  119.760 1.00 78.61  ? -20 DA  J "C3'" 1 
ATOM   3323  O "O3'" . DA  B 2 40  ? 88.652  58.033  120.749 1.00 81.03  ? -20 DA  J "O3'" 1 
ATOM   3324  C "C2'" . DA  B 2 40  ? 88.766  60.393  120.157 1.00 75.60  ? -20 DA  J "C2'" 1 
ATOM   3325  C "C1'" . DA  B 2 40  ? 90.171  60.460  119.581 1.00 74.57  ? -20 DA  J "C1'" 1 
ATOM   3326  N N9    . DA  B 2 40  ? 90.625  61.809  119.228 1.00 72.36  ? -20 DA  J N9    1 
ATOM   3327  C C8    . DA  B 2 40  ? 89.899  62.812  118.636 1.00 70.94  ? -20 DA  J C8    1 
ATOM   3328  N N7    . DA  B 2 40  ? 90.577  63.914  118.445 1.00 69.41  ? -20 DA  J N7    1 
ATOM   3329  C C5    . DA  B 2 40  ? 91.838  63.620  118.943 1.00 69.59  ? -20 DA  J C5    1 
ATOM   3330  C C6    . DA  B 2 40  ? 93.021  64.380  119.036 1.00 69.31  ? -20 DA  J C6    1 
ATOM   3331  N N6    . DA  B 2 40  ? 93.125  65.643  118.623 1.00 67.68  ? -20 DA  J N6    1 
ATOM   3332  N N1    . DA  B 2 40  ? 94.107  63.787  119.582 1.00 70.70  ? -20 DA  J N1    1 
ATOM   3333  C C2    . DA  B 2 40  ? 93.999  62.522  120.006 1.00 72.12  ? -20 DA  J C2    1 
ATOM   3334  N N3    . DA  B 2 40  ? 92.941  61.710  119.978 1.00 72.37  ? -20 DA  J N3    1 
ATOM   3335  C C4    . DA  B 2 40  ? 91.883  62.327  119.426 1.00 70.82  ? -20 DA  J C4    1 
ATOM   3336  P P     . DA  B 2 41  ? 87.729  57.871  122.049 1.00 81.53  ? -19 DA  J P     1 
ATOM   3337  O OP1   . DA  B 2 41  ? 87.597  56.419  122.335 1.00 83.09  ? -19 DA  J OP1   1 
ATOM   3338  O OP2   . DA  B 2 41  ? 86.512  58.696  121.845 1.00 81.38  ? -19 DA  J OP2   1 
ATOM   3339  O "O5'" . DA  B 2 41  ? 88.615  58.542  123.186 1.00 80.40  ? -19 DA  J "O5'" 1 
ATOM   3340  C "C5'" . DA  B 2 41  ? 89.974  58.153  123.355 1.00 79.17  ? -19 DA  J "C5'" 1 
ATOM   3341  C "C4'" . DA  B 2 41  ? 90.657  59.069  124.340 1.00 79.53  ? -19 DA  J "C4'" 1 
ATOM   3342  O "O4'" . DA  B 2 41  ? 91.068  60.305  123.702 1.00 78.16  ? -19 DA  J "O4'" 1 
ATOM   3343  C "C3'" . DA  B 2 41  ? 89.767  59.465  125.513 1.00 80.77  ? -19 DA  J "C3'" 1 
ATOM   3344  O "O3'" . DA  B 2 41  ? 90.509  59.410  126.726 1.00 84.99  ? -19 DA  J "O3'" 1 
ATOM   3345  C "C2'" . DA  B 2 41  ? 89.376  60.896  125.193 1.00 78.97  ? -19 DA  J "C2'" 1 
ATOM   3346  C "C1'" . DA  B 2 41  ? 90.608  61.405  124.465 1.00 76.27  ? -19 DA  J "C1'" 1 
ATOM   3347  N N9    . DA  B 2 41  ? 90.363  62.528  123.553 1.00 73.69  ? -19 DA  J N9    1 
ATOM   3348  C C8    . DA  B 2 41  ? 89.245  62.769  122.796 1.00 70.05  ? -19 DA  J C8    1 
ATOM   3349  N N7    . DA  B 2 41  ? 89.312  63.867  122.088 1.00 68.80  ? -19 DA  J N7    1 
ATOM   3350  C C5    . DA  B 2 41  ? 90.563  64.387  122.393 1.00 67.95  ? -19 DA  J C5    1 
ATOM   3351  C C6    . DA  B 2 41  ? 91.240  65.543  121.960 1.00 65.38  ? -19 DA  J C6    1 
ATOM   3352  N N6    . DA  B 2 41  ? 90.728  66.421  121.102 1.00 62.67  ? -19 DA  J N6    1 
ATOM   3353  N N1    . DA  B 2 41  ? 92.475  65.770  122.450 1.00 66.13  ? -19 DA  J N1    1 
ATOM   3354  C C2    . DA  B 2 41  ? 92.985  64.892  123.322 1.00 67.55  ? -19 DA  J C2    1 
ATOM   3355  N N3    . DA  B 2 41  ? 92.448  63.774  123.805 1.00 69.64  ? -19 DA  J N3    1 
ATOM   3356  C C4    . DA  B 2 41  ? 91.222  63.573  123.292 1.00 70.12  ? -19 DA  J C4    1 
ATOM   3357  P P     . DA  B 2 42  ? 89.739  59.480  128.130 1.00 87.80  ? -18 DA  J P     1 
ATOM   3358  O OP1   . DA  B 2 42  ? 89.780  58.132  128.749 1.00 89.90  ? -18 DA  J OP1   1 
ATOM   3359  O OP2   . DA  B 2 42  ? 88.429  60.154  127.919 1.00 87.26  ? -18 DA  J OP2   1 
ATOM   3360  O "O5'" . DA  B 2 42  ? 90.650  60.461  128.983 1.00 84.92  ? -18 DA  J "O5'" 1 
ATOM   3361  C "C5'" . DA  B 2 42  ? 92.028  60.625  128.670 1.00 79.53  ? -18 DA  J "C5'" 1 
ATOM   3362  C "C4'" . DA  B 2 42  ? 92.457  62.035  128.989 1.00 77.78  ? -18 DA  J "C4'" 1 
ATOM   3363  O "O4'" . DA  B 2 42  ? 92.169  62.942  127.896 1.00 75.52  ? -18 DA  J "O4'" 1 
ATOM   3364  C "C3'" . DA  B 2 42  ? 91.754  62.612  130.216 1.00 76.64  ? -18 DA  J "C3'" 1 
ATOM   3365  O "O3'" . DA  B 2 42  ? 92.707  63.288  131.031 1.00 79.81  ? -18 DA  J "O3'" 1 
ATOM   3366  C "C2'" . DA  B 2 42  ? 90.758  63.597  129.625 1.00 74.12  ? -18 DA  J "C2'" 1 
ATOM   3367  C "C1'" . DA  B 2 42  ? 91.514  64.092  128.408 1.00 71.94  ? -18 DA  J "C1'" 1 
ATOM   3368  N N9    . DA  B 2 42  ? 90.714  64.681  127.332 1.00 66.58  ? -18 DA  J N9    1 
ATOM   3369  C C8    . DA  B 2 42  ? 89.528  64.243  126.802 1.00 66.27  ? -18 DA  J C8    1 
ATOM   3370  N N7    . DA  B 2 42  ? 89.086  64.980  125.809 1.00 62.28  ? -18 DA  J N7    1 
ATOM   3371  C C5    . DA  B 2 42  ? 90.043  65.978  125.684 1.00 61.08  ? -18 DA  J C5    1 
ATOM   3372  C C6    . DA  B 2 42  ? 90.167  67.068  124.800 1.00 58.54  ? -18 DA  J C6    1 
ATOM   3373  N N6    . DA  B 2 42  ? 89.295  67.340  123.835 1.00 50.47  ? -18 DA  J N6    1 
ATOM   3374  N N1    . DA  B 2 42  ? 91.239  67.875  124.947 1.00 57.71  ? -18 DA  J N1    1 
ATOM   3375  C C2    . DA  B 2 42  ? 92.126  67.594  125.909 1.00 60.68  ? -18 DA  J C2    1 
ATOM   3376  N N3    . DA  B 2 42  ? 92.123  66.597  126.792 1.00 60.02  ? -18 DA  J N3    1 
ATOM   3377  C C4    . DA  B 2 42  ? 91.043  65.814  126.623 1.00 62.86  ? -18 DA  J C4    1 
ATOM   3378  P P     . DA  B 2 43  ? 92.391  63.525  132.584 1.00 78.49  ? -17 DA  J P     1 
ATOM   3379  O OP1   . DA  B 2 43  ? 93.547  63.025  133.366 1.00 78.20  ? -17 DA  J OP1   1 
ATOM   3380  O OP2   . DA  B 2 43  ? 91.028  63.002  132.857 1.00 79.04  ? -17 DA  J OP2   1 
ATOM   3381  O "O5'" . DA  B 2 43  ? 92.327  65.108  132.700 1.00 77.79  ? -17 DA  J "O5'" 1 
ATOM   3382  C "C5'" . DA  B 2 43  ? 93.438  65.907  132.310 1.00 74.77  ? -17 DA  J "C5'" 1 
ATOM   3383  C "C4'" . DA  B 2 43  ? 93.032  67.360  132.257 1.00 72.05  ? -17 DA  J "C4'" 1 
ATOM   3384  O "O4'" . DA  B 2 43  ? 92.311  67.647  131.036 1.00 69.99  ? -17 DA  J "O4'" 1 
ATOM   3385  C "C3'" . DA  B 2 43  ? 92.117  67.795  133.404 1.00 70.09  ? -17 DA  J "C3'" 1 
ATOM   3386  O "O3'" . DA  B 2 43  ? 92.496  69.093  133.828 1.00 69.18  ? -17 DA  J "O3'" 1 
ATOM   3387  C "C2'" . DA  B 2 43  ? 90.756  67.887  132.743 1.00 68.42  ? -17 DA  J "C2'" 1 
ATOM   3388  C "C1'" . DA  B 2 43  ? 91.158  68.391  131.375 1.00 68.95  ? -17 DA  J "C1'" 1 
ATOM   3389  N N9    . DA  B 2 43  ? 90.174  68.216  130.316 1.00 66.49  ? -17 DA  J N9    1 
ATOM   3390  C C8    . DA  B 2 43  ? 89.084  67.387  130.279 1.00 67.30  ? -17 DA  J C8    1 
ATOM   3391  N N7    . DA  B 2 43  ? 88.378  67.493  129.182 1.00 69.07  ? -17 DA  J N7    1 
ATOM   3392  C C5    . DA  B 2 43  ? 89.053  68.456  128.445 1.00 65.90  ? -17 DA  J C5    1 
ATOM   3393  C C6    . DA  B 2 43  ? 88.810  69.024  127.188 1.00 64.18  ? -17 DA  J C6    1 
ATOM   3394  N N6    . DA  B 2 43  ? 87.770  68.703  126.424 1.00 62.70  ? -17 DA  J N6    1 
ATOM   3395  N N1    . DA  B 2 43  ? 89.682  69.952  126.738 1.00 63.37  ? -17 DA  J N1    1 
ATOM   3396  C C2    . DA  B 2 43  ? 90.722  70.282  127.516 1.00 66.01  ? -17 DA  J C2    1 
ATOM   3397  N N3    . DA  B 2 43  ? 91.053  69.822  128.719 1.00 64.43  ? -17 DA  J N3    1 
ATOM   3398  C C4    . DA  B 2 43  ? 90.166  68.901  129.129 1.00 65.75  ? -17 DA  J C4    1 
ATOM   3399  P P     . DG  B 2 44  ? 93.443  69.263  135.104 1.00 70.58  ? -16 DG  J P     1 
ATOM   3400  O OP1   . DG  B 2 44  ? 94.582  68.319  134.988 1.00 67.92  ? -16 DG  J OP1   1 
ATOM   3401  O OP2   . DG  B 2 44  ? 92.560  69.228  136.301 1.00 69.17  ? -16 DG  J OP2   1 
ATOM   3402  O "O5'" . DG  B 2 44  ? 94.019  70.730  134.933 1.00 67.04  ? -16 DG  J "O5'" 1 
ATOM   3403  C "C5'" . DG  B 2 44  ? 94.776  71.079  133.784 1.00 62.65  ? -16 DG  J "C5'" 1 
ATOM   3404  C "C4'" . DG  B 2 44  ? 94.166  72.290  133.128 1.00 60.91  ? -16 DG  J "C4'" 1 
ATOM   3405  O "O4'" . DG  B 2 44  ? 92.997  71.931  132.349 1.00 57.20  ? -16 DG  J "O4'" 1 
ATOM   3406  C "C3'" . DG  B 2 44  ? 93.691  73.336  134.134 1.00 59.75  ? -16 DG  J "C3'" 1 
ATOM   3407  O "O3'" . DG  B 2 44  ? 93.883  74.612  133.556 1.00 60.78  ? -16 DG  J "O3'" 1 
ATOM   3408  C "C2'" . DG  B 2 44  ? 92.199  73.079  134.214 1.00 60.11  ? -16 DG  J "C2'" 1 
ATOM   3409  C "C1'" . DG  B 2 44  ? 91.907  72.734  132.767 1.00 58.12  ? -16 DG  J "C1'" 1 
ATOM   3410  N N9    . DG  B 2 44  ? 90.676  71.997  132.521 1.00 58.76  ? -16 DG  J N9    1 
ATOM   3411  C C8    . DG  B 2 44  ? 90.037  71.124  133.363 1.00 60.15  ? -16 DG  J C8    1 
ATOM   3412  N N7    . DG  B 2 44  ? 88.939  70.636  132.855 1.00 62.41  ? -16 DG  J N7    1 
ATOM   3413  C C5    . DG  B 2 44  ? 88.851  71.224  131.601 1.00 61.99  ? -16 DG  J C5    1 
ATOM   3414  C C6    . DG  B 2 44  ? 87.866  71.090  130.587 1.00 61.68  ? -16 DG  J C6    1 
ATOM   3415  O O6    . DG  B 2 44  ? 86.830  70.406  130.599 1.00 58.52  ? -16 DG  J O6    1 
ATOM   3416  N N1    . DG  B 2 44  ? 88.178  71.867  129.470 1.00 61.58  ? -16 DG  J N1    1 
ATOM   3417  C C2    . DG  B 2 44  ? 89.287  72.672  129.351 1.00 61.28  ? -16 DG  J C2    1 
ATOM   3418  N N2    . DG  B 2 44  ? 89.420  73.349  128.204 1.00 58.74  ? -16 DG  J N2    1 
ATOM   3419  N N3    . DG  B 2 44  ? 90.204  72.806  130.293 1.00 60.74  ? -16 DG  J N3    1 
ATOM   3420  C C4    . DG  B 2 44  ? 89.924  72.060  131.380 1.00 61.07  ? -16 DG  J C4    1 
ATOM   3421  P P     . DG  B 2 45  ? 94.792  75.692  134.291 1.00 59.13  ? -15 DG  J P     1 
ATOM   3422  O OP1   . DG  B 2 45  ? 96.131  75.117  134.521 1.00 60.90  ? -15 DG  J OP1   1 
ATOM   3423  O OP2   . DG  B 2 45  ? 94.017  76.249  135.427 1.00 57.40  ? -15 DG  J OP2   1 
ATOM   3424  O "O5'" . DG  B 2 45  ? 94.940  76.786  133.152 1.00 55.76  ? -15 DG  J "O5'" 1 
ATOM   3425  C "C5'" . DG  B 2 45  ? 95.426  76.395  131.874 1.00 55.47  ? -15 DG  J "C5'" 1 
ATOM   3426  C "C4'" . DG  B 2 45  ? 94.601  77.024  130.782 1.00 50.71  ? -15 DG  J "C4'" 1 
ATOM   3427  O "O4'" . DG  B 2 45  ? 93.280  76.432  130.709 1.00 50.43  ? -15 DG  J "O4'" 1 
ATOM   3428  C "C3'" . DG  B 2 45  ? 94.399  78.513  130.991 1.00 50.24  ? -15 DG  J "C3'" 1 
ATOM   3429  O "O3'" . DG  B 2 45  ? 94.681  79.171  129.771 1.00 49.21  ? -15 DG  J "O3'" 1 
ATOM   3430  C "C2'" . DG  B 2 45  ? 92.958  78.642  131.475 1.00 49.22  ? -15 DG  J "C2'" 1 
ATOM   3431  C "C1'" . DG  B 2 45  ? 92.264  77.400  130.920 1.00 50.99  ? -15 DG  J "C1'" 1 
ATOM   3432  N N9    . DG  B 2 45  ? 91.275  76.800  131.816 1.00 53.82  ? -15 DG  J N9    1 
ATOM   3433  C C8    . DG  B 2 45  ? 91.423  76.581  133.166 1.00 56.35  ? -15 DG  J C8    1 
ATOM   3434  N N7    . DG  B 2 45  ? 90.388  76.000  133.709 1.00 56.96  ? -15 DG  J N7    1 
ATOM   3435  C C5    . DG  B 2 45  ? 89.495  75.826  132.661 1.00 56.49  ? -15 DG  J C5    1 
ATOM   3436  C C6    . DG  B 2 45  ? 88.199  75.230  132.641 1.00 57.37  ? -15 DG  J C6    1 
ATOM   3437  O O6    . DG  B 2 45  ? 87.579  74.701  133.564 1.00 55.82  ? -15 DG  J O6    1 
ATOM   3438  N N1    . DG  B 2 45  ? 87.634  75.277  131.375 1.00 55.33  ? -15 DG  J N1    1 
ATOM   3439  C C2    . DG  B 2 45  ? 88.233  75.803  130.265 1.00 53.36  ? -15 DG  J C2    1 
ATOM   3440  N N2    . DG  B 2 45  ? 87.500  75.759  129.142 1.00 47.96  ? -15 DG  J N2    1 
ATOM   3441  N N3    . DG  B 2 45  ? 89.451  76.337  130.257 1.00 52.67  ? -15 DG  J N3    1 
ATOM   3442  C C4    . DG  B 2 45  ? 90.018  76.320  131.484 1.00 54.70  ? -15 DG  J C4    1 
ATOM   3443  P P     . DC  B 2 46  ? 94.180  80.662  129.552 1.00 46.92  ? -14 DC  J P     1 
ATOM   3444  O OP1   . DC  B 2 46  ? 94.822  81.218  128.331 1.00 45.36  ? -14 DC  J OP1   1 
ATOM   3445  O OP2   . DC  B 2 46  ? 94.170  81.444  130.814 1.00 43.77  ? -14 DC  J OP2   1 
ATOM   3446  O "O5'" . DC  B 2 46  ? 92.681  80.374  129.211 1.00 47.19  ? -14 DC  J "O5'" 1 
ATOM   3447  C "C5'" . DC  B 2 46  ? 91.748  81.330  129.421 1.00 40.03  ? -14 DC  J "C5'" 1 
ATOM   3448  C "C4'" . DC  B 2 46  ? 90.468  80.890  128.785 1.00 41.29  ? -14 DC  J "C4'" 1 
ATOM   3449  O "O4'" . DC  B 2 46  ? 89.830  79.842  129.568 1.00 40.08  ? -14 DC  J "O4'" 1 
ATOM   3450  C "C3'" . DC  B 2 46  ? 89.559  82.087  128.863 1.00 37.63  ? -14 DC  J "C3'" 1 
ATOM   3451  O "O3'" . DC  B 2 46  ? 88.746  82.064  127.723 1.00 35.15  ? -14 DC  J "O3'" 1 
ATOM   3452  C "C2'" . DC  B 2 46  ? 88.825  81.886  130.170 1.00 39.39  ? -14 DC  J "C2'" 1 
ATOM   3453  C "C1'" . DC  B 2 46  ? 88.698  80.376  130.232 1.00 39.13  ? -14 DC  J "C1'" 1 
ATOM   3454  N N1    . DC  B 2 46  ? 88.645  79.837  131.602 1.00 41.58  ? -14 DC  J N1    1 
ATOM   3455  C C2    . DC  B 2 46  ? 87.570  79.018  131.922 1.00 43.75  ? -14 DC  J C2    1 
ATOM   3456  O O2    . DC  B 2 46  ? 86.762  78.749  131.025 1.00 34.95  ? -14 DC  J O2    1 
ATOM   3457  N N3    . DC  B 2 46  ? 87.442  78.543  133.189 1.00 44.12  ? -14 DC  J N3    1 
ATOM   3458  C C4    . DC  B 2 46  ? 88.369  78.846  134.115 1.00 45.22  ? -14 DC  J C4    1 
ATOM   3459  N N4    . DC  B 2 46  ? 88.215  78.342  135.354 1.00 41.68  ? -14 DC  J N4    1 
ATOM   3460  C C5    . DC  B 2 46  ? 89.496  79.670  133.809 1.00 40.90  ? -14 DC  J C5    1 
ATOM   3461  C C6    . DC  B 2 46  ? 89.593  80.142  132.547 1.00 42.94  ? -14 DC  J C6    1 
ATOM   3462  P P     . DA  B 2 47  ? 88.220  83.427  127.142 1.00 30.33  ? -13 DA  J P     1 
ATOM   3463  O OP1   . DA  B 2 47  ? 88.859  83.489  125.808 1.00 29.12  ? -13 DA  J OP1   1 
ATOM   3464  O OP2   . DA  B 2 47  ? 88.447  84.497  128.149 1.00 28.45  ? -13 DA  J OP2   1 
ATOM   3465  O "O5'" . DA  B 2 47  ? 86.668  83.126  126.969 1.00 30.78  ? -13 DA  J "O5'" 1 
ATOM   3466  C "C5'" . DA  B 2 47  ? 86.282  81.987  126.194 1.00 32.36  ? -13 DA  J "C5'" 1 
ATOM   3467  C "C4'" . DA  B 2 47  ? 84.850  81.607  126.482 1.00 30.31  ? -13 DA  J "C4'" 1 
ATOM   3468  O "O4'" . DA  B 2 47  ? 84.741  80.989  127.782 1.00 31.85  ? -13 DA  J "O4'" 1 
ATOM   3469  C "C3'" . DA  B 2 47  ? 83.891  82.779  126.485 1.00 32.32  ? -13 DA  J "C3'" 1 
ATOM   3470  O "O3'" . DA  B 2 47  ? 82.732  82.386  125.767 1.00 32.58  ? -13 DA  J "O3'" 1 
ATOM   3471  C "C2'" . DA  B 2 47  ? 83.638  83.060  127.957 1.00 31.69  ? -13 DA  J "C2'" 1 
ATOM   3472  C "C1'" . DA  B 2 47  ? 83.860  81.715  128.618 1.00 32.19  ? -13 DA  J "C1'" 1 
ATOM   3473  N N9    . DA  B 2 47  ? 84.482  81.769  129.940 1.00 37.92  ? -13 DA  J N9    1 
ATOM   3474  C C8    . DA  B 2 47  ? 85.642  82.412  130.297 1.00 41.74  ? -13 DA  J C8    1 
ATOM   3475  N N7    . DA  B 2 47  ? 85.990  82.226  131.548 1.00 40.30  ? -13 DA  J N7    1 
ATOM   3476  C C5    . DA  B 2 47  ? 84.983  81.422  132.056 1.00 45.30  ? -13 DA  J C5    1 
ATOM   3477  C C6    . DA  B 2 47  ? 84.775  80.855  133.325 1.00 46.03  ? -13 DA  J C6    1 
ATOM   3478  N N6    . DA  B 2 47  ? 85.602  81.032  134.364 1.00 43.41  ? -13 DA  J N6    1 
ATOM   3479  N N1    . DA  B 2 47  ? 83.676  80.087  133.494 1.00 47.47  ? -13 DA  J N1    1 
ATOM   3480  C C2    . DA  B 2 47  ? 82.842  79.917  132.455 1.00 45.04  ? -13 DA  J C2    1 
ATOM   3481  N N3    . DA  B 2 47  ? 82.926  80.396  131.221 1.00 43.56  ? -13 DA  J N3    1 
ATOM   3482  C C4    . DA  B 2 47  ? 84.035  81.146  131.079 1.00 44.11  ? -13 DA  J C4    1 
ATOM   3483  P P     . DT  B 2 48  ? 81.531  83.400  125.568 1.00 32.76  ? -12 DT  J P     1 
ATOM   3484  O OP1   . DT  B 2 48  ? 80.882  82.858  124.329 1.00 34.83  ? -12 DT  J OP1   1 
ATOM   3485  O OP2   . DT  B 2 48  ? 81.902  84.841  125.640 1.00 36.08  ? -12 DT  J OP2   1 
ATOM   3486  O "O5'" . DT  B 2 48  ? 80.623  83.061  126.817 1.00 33.53  ? -12 DT  J "O5'" 1 
ATOM   3487  C "C5'" . DT  B 2 48  ? 80.246  81.717  127.015 1.00 33.42  ? -12 DT  J "C5'" 1 
ATOM   3488  C "C4'" . DT  B 2 48  ? 79.356  81.595  128.221 1.00 34.88  ? -12 DT  J "C4'" 1 
ATOM   3489  O "O4'" . DT  B 2 48  ? 80.117  81.650  129.446 1.00 35.72  ? -12 DT  J "O4'" 1 
ATOM   3490  C "C3'" . DT  B 2 48  ? 78.266  82.650  128.329 1.00 35.93  ? -12 DT  J "C3'" 1 
ATOM   3491  O "O3'" . DT  B 2 48  ? 77.042  81.937  128.460 1.00 40.36  ? -12 DT  J "O3'" 1 
ATOM   3492  C "C2'" . DT  B 2 48  ? 78.622  83.438  129.586 1.00 30.92  ? -12 DT  J "C2'" 1 
ATOM   3493  C "C1'" . DT  B 2 48  ? 79.436  82.445  130.397 1.00 33.47  ? -12 DT  J "C1'" 1 
ATOM   3494  N N1    . DT  B 2 48  ? 80.470  82.977  131.317 1.00 39.91  ? -12 DT  J N1    1 
ATOM   3495  C C2    . DT  B 2 48  ? 80.490  82.475  132.595 1.00 43.37  ? -12 DT  J C2    1 
ATOM   3496  O O2    . DT  B 2 48  ? 79.630  81.725  133.029 1.00 43.41  ? -12 DT  J O2    1 
ATOM   3497  N N3    . DT  B 2 48  ? 81.561  82.882  133.357 1.00 43.70  ? -12 DT  J N3    1 
ATOM   3498  C C4    . DT  B 2 48  ? 82.579  83.735  132.978 1.00 43.23  ? -12 DT  J C4    1 
ATOM   3499  O O4    . DT  B 2 48  ? 83.538  83.933  133.743 1.00 40.24  ? -12 DT  J O4    1 
ATOM   3500  C C5    . DT  B 2 48  ? 82.434  84.308  131.651 1.00 39.77  ? -12 DT  J C5    1 
ATOM   3501  C C7    . DT  B 2 48  ? 83.419  85.342  131.191 1.00 41.24  ? -12 DT  J C7    1 
ATOM   3502  C C6    . DT  B 2 48  ? 81.409  83.894  130.896 1.00 39.70  ? -12 DT  J C6    1 
ATOM   3503  P P     . DG  B 2 49  ? 75.663  82.663  128.146 1.00 40.86  ? -11 DG  J P     1 
ATOM   3504  O OP1   . DG  B 2 49  ? 74.807  81.539  127.681 1.00 47.65  ? -11 DG  J OP1   1 
ATOM   3505  O OP2   . DG  B 2 49  ? 75.845  83.855  127.308 1.00 39.72  ? -11 DG  J OP2   1 
ATOM   3506  O "O5'" . DG  B 2 49  ? 75.163  83.107  129.591 1.00 42.26  ? -11 DG  J "O5'" 1 
ATOM   3507  C "C5'" . DG  B 2 49  ? 75.006  82.119  130.603 1.00 43.03  ? -11 DG  J "C5'" 1 
ATOM   3508  C "C4'" . DG  B 2 49  ? 74.853  82.757  131.962 1.00 44.67  ? -11 DG  J "C4'" 1 
ATOM   3509  O "O4'" . DG  B 2 49  ? 76.131  83.138  132.521 1.00 41.83  ? -11 DG  J "O4'" 1 
ATOM   3510  C "C3'" . DG  B 2 49  ? 73.960  83.996  132.039 1.00 46.38  ? -11 DG  J "C3'" 1 
ATOM   3511  O "O3'" . DG  B 2 49  ? 73.029  83.817  133.103 1.00 48.77  ? -11 DG  J "O3'" 1 
ATOM   3512  C "C2'" . DG  B 2 49  ? 74.928  85.111  132.398 1.00 46.94  ? -11 DG  J "C2'" 1 
ATOM   3513  C "C1'" . DG  B 2 49  ? 75.977  84.367  133.197 1.00 45.22  ? -11 DG  J "C1'" 1 
ATOM   3514  N N9    . DG  B 2 49  ? 77.283  85.007  133.247 1.00 44.61  ? -11 DG  J N9    1 
ATOM   3515  C C8    . DG  B 2 49  ? 77.915  85.654  132.216 1.00 42.62  ? -11 DG  J C8    1 
ATOM   3516  N N7    . DG  B 2 49  ? 79.105  86.074  132.530 1.00 41.77  ? -11 DG  J N7    1 
ATOM   3517  C C5    . DG  B 2 49  ? 79.268  85.699  133.855 1.00 42.80  ? -11 DG  J C5    1 
ATOM   3518  C C6    . DG  B 2 49  ? 80.370  85.878  134.730 1.00 45.82  ? -11 DG  J C6    1 
ATOM   3519  O O6    . DG  B 2 49  ? 81.465  86.380  134.488 1.00 39.42  ? -11 DG  J O6    1 
ATOM   3520  N N1    . DG  B 2 49  ? 80.108  85.370  136.001 1.00 48.52  ? -11 DG  J N1    1 
ATOM   3521  C C2    . DG  B 2 49  ? 78.948  84.743  136.373 1.00 46.64  ? -11 DG  J C2    1 
ATOM   3522  N N2    . DG  B 2 49  ? 78.905  84.317  137.640 1.00 47.82  ? -11 DG  J N2    1 
ATOM   3523  N N3    . DG  B 2 49  ? 77.914  84.550  135.558 1.00 41.65  ? -11 DG  J N3    1 
ATOM   3524  C C4    . DG  B 2 49  ? 78.144  85.055  134.323 1.00 45.19  ? -11 DG  J C4    1 
ATOM   3525  P P     . DT  B 2 50  ? 71.926  84.937  133.403 1.00 52.58  ? -10 DT  J P     1 
ATOM   3526  O OP1   . DT  B 2 50  ? 70.634  84.213  133.521 1.00 52.97  ? -10 DT  J OP1   1 
ATOM   3527  O OP2   . DT  B 2 50  ? 72.050  86.073  132.464 1.00 47.34  ? -10 DT  J OP2   1 
ATOM   3528  O "O5'" . DT  B 2 50  ? 72.347  85.442  134.852 1.00 53.25  ? -10 DT  J "O5'" 1 
ATOM   3529  C "C5'" . DT  B 2 50  ? 72.791  84.496  135.822 1.00 56.63  ? -10 DT  J "C5'" 1 
ATOM   3530  C "C4'" . DT  B 2 50  ? 73.240  85.190  137.085 1.00 58.42  ? -10 DT  J "C4'" 1 
ATOM   3531  O "O4'" . DT  B 2 50  ? 74.641  85.562  137.033 1.00 60.34  ? -10 DT  J "O4'" 1 
ATOM   3532  C "C3'" . DT  B 2 50  ? 72.463  86.451  137.448 1.00 58.19  ? -10 DT  J "C3'" 1 
ATOM   3533  O "O3'" . DT  B 2 50  ? 72.068  86.383  138.811 1.00 62.39  ? -10 DT  J "O3'" 1 
ATOM   3534  C "C2'" . DT  B 2 50  ? 73.473  87.568  137.251 1.00 57.94  ? -10 DT  J "C2'" 1 
ATOM   3535  C "C1'" . DT  B 2 50  ? 74.804  86.883  137.520 1.00 57.44  ? -10 DT  J "C1'" 1 
ATOM   3536  N N1    . DT  B 2 50  ? 75.950  87.483  136.803 1.00 57.65  ? -10 DT  J N1    1 
ATOM   3537  C C2    . DT  B 2 50  ? 77.147  87.661  137.476 1.00 58.83  ? -10 DT  J C2    1 
ATOM   3538  O O2    . DT  B 2 50  ? 77.318  87.354  138.641 1.00 59.95  ? -10 DT  J O2    1 
ATOM   3539  N N3    . DT  B 2 50  ? 78.149  88.220  136.720 1.00 56.01  ? -10 DT  J N3    1 
ATOM   3540  C C4    . DT  B 2 50  ? 78.079  88.618  135.403 1.00 54.77  ? -10 DT  J C4    1 
ATOM   3541  O O4    . DT  B 2 50  ? 79.068  89.107  134.864 1.00 50.13  ? -10 DT  J O4    1 
ATOM   3542  C C5    . DT  B 2 50  ? 76.789  88.406  134.763 1.00 53.51  ? -10 DT  J C5    1 
ATOM   3543  C C7    . DT  B 2 50  ? 76.606  88.810  133.334 1.00 52.34  ? -10 DT  J C7    1 
ATOM   3544  C C6    . DT  B 2 50  ? 75.812  87.854  135.485 1.00 53.19  ? -10 DT  J C6    1 
ATOM   3545  P P     . DT  B 2 51  ? 71.113  87.513  139.409 1.00 65.40  ? -9  DT  J P     1 
ATOM   3546  O OP1   . DT  B 2 51  ? 69.962  86.833  140.044 1.00 63.47  ? -9  DT  J OP1   1 
ATOM   3547  O OP2   . DT  B 2 51  ? 70.881  88.540  138.364 1.00 65.37  ? -9  DT  J OP2   1 
ATOM   3548  O "O5'" . DT  B 2 51  ? 72.024  88.197  140.520 1.00 62.33  ? -9  DT  J "O5'" 1 
ATOM   3549  C "C5'" . DT  B 2 51  ? 72.831  87.404  141.379 1.00 58.23  ? -9  DT  J "C5'" 1 
ATOM   3550  C "C4'" . DT  B 2 51  ? 73.752  88.289  142.177 1.00 56.52  ? -9  DT  J "C4'" 1 
ATOM   3551  O "O4'" . DT  B 2 51  ? 74.889  88.710  141.381 1.00 52.66  ? -9  DT  J "O4'" 1 
ATOM   3552  C "C3'" . DT  B 2 51  ? 73.080  89.566  142.673 1.00 54.64  ? -9  DT  J "C3'" 1 
ATOM   3553  O "O3'" . DT  B 2 51  ? 73.479  89.806  144.018 1.00 55.27  ? -9  DT  J "O3'" 1 
ATOM   3554  C "C2'" . DT  B 2 51  ? 73.610  90.641  141.736 1.00 50.22  ? -9  DT  J "C2'" 1 
ATOM   3555  C "C1'" . DT  B 2 51  ? 74.995  90.128  141.386 1.00 49.01  ? -9  DT  J "C1'" 1 
ATOM   3556  N N1    . DT  B 2 51  ? 75.522  90.544  140.062 1.00 46.16  ? -9  DT  J N1    1 
ATOM   3557  C C2    . DT  B 2 51  ? 76.837  90.965  139.988 1.00 45.96  ? -9  DT  J C2    1 
ATOM   3558  O O2    . DT  B 2 51  ? 77.563  91.061  140.964 1.00 39.52  ? -9  DT  J O2    1 
ATOM   3559  N N3    . DT  B 2 51  ? 77.277  91.264  138.715 1.00 41.66  ? -9  DT  J N3    1 
ATOM   3560  C C4    . DT  B 2 51  ? 76.553  91.192  137.544 1.00 44.71  ? -9  DT  J C4    1 
ATOM   3561  O O4    . DT  B 2 51  ? 77.098  91.434  136.470 1.00 41.94  ? -9  DT  J O4    1 
ATOM   3562  C C5    . DT  B 2 51  ? 75.165  90.800  137.699 1.00 45.69  ? -9  DT  J C5    1 
ATOM   3563  C C7    . DT  B 2 51  ? 74.286  90.767  136.489 1.00 41.12  ? -9  DT  J C7    1 
ATOM   3564  C C6    . DT  B 2 51  ? 74.728  90.493  138.932 1.00 44.16  ? -9  DT  J C6    1 
ATOM   3565  P P     . DC  B 2 52  ? 72.680  90.873  144.905 1.00 56.30  ? -8  DC  J P     1 
ATOM   3566  O OP1   . DC  B 2 52  ? 72.608  90.304  146.270 1.00 60.43  ? -8  DC  J OP1   1 
ATOM   3567  O OP2   . DC  B 2 52  ? 71.442  91.307  144.215 1.00 51.93  ? -8  DC  J OP2   1 
ATOM   3568  O "O5'" . DC  B 2 52  ? 73.673  92.108  144.938 1.00 55.89  ? -8  DC  J "O5'" 1 
ATOM   3569  C "C5'" . DC  B 2 52  ? 75.041  91.899  145.236 1.00 53.87  ? -8  DC  J "C5'" 1 
ATOM   3570  C "C4'" . DC  B 2 52  ? 75.840  93.130  144.900 1.00 55.04  ? -8  DC  J "C4'" 1 
ATOM   3571  O "O4'" . DC  B 2 52  ? 76.172  93.185  143.490 1.00 53.44  ? -8  DC  J "O4'" 1 
ATOM   3572  C "C3'" . DC  B 2 52  ? 75.130  94.441  145.229 1.00 52.89  ? -8  DC  J "C3'" 1 
ATOM   3573  O "O3'" . DC  B 2 52  ? 75.974  95.232  146.046 1.00 52.95  ? -8  DC  J "O3'" 1 
ATOM   3574  C "C2'" . DC  B 2 52  ? 74.916  95.102  143.872 1.00 54.31  ? -8  DC  J "C2'" 1 
ATOM   3575  C "C1'" . DC  B 2 52  ? 76.043  94.520  143.042 1.00 51.26  ? -8  DC  J "C1'" 1 
ATOM   3576  N N1    . DC  B 2 52  ? 75.835  94.488  141.581 1.00 50.04  ? -8  DC  J N1    1 
ATOM   3577  C C2    . DC  B 2 52  ? 76.937  94.750  140.737 1.00 48.59  ? -8  DC  J C2    1 
ATOM   3578  O O2    . DC  B 2 52  ? 78.031  95.025  141.250 1.00 41.69  ? -8  DC  J O2    1 
ATOM   3579  N N3    . DC  B 2 52  ? 76.772  94.690  139.390 1.00 43.41  ? -8  DC  J N3    1 
ATOM   3580  C C4    . DC  B 2 52  ? 75.577  94.392  138.877 1.00 48.44  ? -8  DC  J C4    1 
ATOM   3581  N N4    . DC  B 2 52  ? 75.466  94.334  137.550 1.00 44.53  ? -8  DC  J N4    1 
ATOM   3582  C C5    . DC  B 2 52  ? 74.437  94.137  139.711 1.00 47.66  ? -8  DC  J C5    1 
ATOM   3583  C C6    . DC  B 2 52  ? 74.611  94.198  141.044 1.00 47.89  ? -8  DC  J C6    1 
ATOM   3584  P P     . DA  B 2 53  ? 75.363  96.476  146.834 1.00 50.03  ? -7  DA  J P     1 
ATOM   3585  O OP1   . DA  B 2 53  ? 75.708  96.296  148.254 1.00 51.15  ? -7  DA  J OP1   1 
ATOM   3586  O OP2   . DA  B 2 53  ? 73.943  96.641  146.423 1.00 48.39  ? -7  DA  J OP2   1 
ATOM   3587  O "O5'" . DA  B 2 53  ? 76.194  97.710  146.259 1.00 48.98  ? -7  DA  J "O5'" 1 
ATOM   3588  C "C5'" . DA  B 2 53  ? 77.605  97.608  146.105 1.00 46.87  ? -7  DA  J "C5'" 1 
ATOM   3589  C "C4'" . DA  B 2 53  ? 78.097  98.617  145.094 1.00 48.57  ? -7  DA  J "C4'" 1 
ATOM   3590  O "O4'" . DA  B 2 53  ? 77.700  98.239  143.758 1.00 46.02  ? -7  DA  J "O4'" 1 
ATOM   3591  C "C3'" . DA  B 2 53  ? 77.566  100.033 145.299 1.00 47.41  ? -7  DA  J "C3'" 1 
ATOM   3592  O "O3'" . DA  B 2 53  ? 78.583  100.950 144.929 1.00 51.20  ? -7  DA  J "O3'" 1 
ATOM   3593  C "C2'" . DA  B 2 53  ? 76.461  100.135 144.272 1.00 48.59  ? -7  DA  J "C2'" 1 
ATOM   3594  C "C1'" . DA  B 2 53  ? 77.086  99.350  143.145 1.00 46.55  ? -7  DA  J "C1'" 1 
ATOM   3595  N N9    . DA  B 2 53  ? 76.171  98.855  142.128 1.00 49.42  ? -7  DA  J N9    1 
ATOM   3596  C C8    . DA  B 2 53  ? 74.835  98.565  142.213 1.00 49.71  ? -7  DA  J C8    1 
ATOM   3597  N N7    . DA  B 2 53  ? 74.309  98.163  141.076 1.00 52.78  ? -7  DA  J N7    1 
ATOM   3598  C C5    . DA  B 2 53  ? 75.377  98.188  140.189 1.00 50.45  ? -7  DA  J C5    1 
ATOM   3599  C C6    . DA  B 2 53  ? 75.479  97.874  138.830 1.00 51.77  ? -7  DA  J C6    1 
ATOM   3600  N N6    . DA  B 2 53  ? 74.449  97.456  138.090 1.00 48.74  ? -7  DA  J N6    1 
ATOM   3601  N N1    . DA  B 2 53  ? 76.693  98.001  138.245 1.00 52.02  ? -7  DA  J N1    1 
ATOM   3602  C C2    . DA  B 2 53  ? 77.729  98.413  138.996 1.00 52.83  ? -7  DA  J C2    1 
ATOM   3603  N N3    . DA  B 2 53  ? 77.757  98.736  140.287 1.00 46.94  ? -7  DA  J N3    1 
ATOM   3604  C C4    . DA  B 2 53  ? 76.533  98.604  140.826 1.00 51.27  ? -7  DA  J C4    1 
ATOM   3605  P P     . DG  B 2 54  ? 79.433  101.687 146.065 1.00 47.88  ? -6  DG  J P     1 
ATOM   3606  O OP1   . DG  B 2 54  ? 79.837  100.686 147.077 1.00 45.43  ? -6  DG  J OP1   1 
ATOM   3607  O OP2   . DG  B 2 54  ? 78.662  102.883 146.460 1.00 49.02  ? -6  DG  J OP2   1 
ATOM   3608  O "O5'" . DG  B 2 54  ? 80.748  102.150 145.293 1.00 46.48  ? -6  DG  J "O5'" 1 
ATOM   3609  C "C5'" . DG  B 2 54  ? 81.701  101.190 144.851 1.00 42.97  ? -6  DG  J "C5'" 1 
ATOM   3610  C "C4'" . DG  B 2 54  ? 82.313  101.634 143.541 1.00 43.03  ? -6  DG  J "C4'" 1 
ATOM   3611  O "O4'" . DG  B 2 54  ? 81.351  101.494 142.467 1.00 40.68  ? -6  DG  J "O4'" 1 
ATOM   3612  C "C3'" . DG  B 2 54  ? 82.761  103.092 143.525 1.00 38.35  ? -6  DG  J "C3'" 1 
ATOM   3613  O "O3'" . DG  B 2 54  ? 83.988  103.192 142.814 1.00 40.55  ? -6  DG  J "O3'" 1 
ATOM   3614  C "C2'" . DG  B 2 54  ? 81.620  103.815 142.826 1.00 40.38  ? -6  DG  J "C2'" 1 
ATOM   3615  C "C1'" . DG  B 2 54  ? 81.074  102.760 141.874 1.00 40.59  ? -6  DG  J "C1'" 1 
ATOM   3616  N N9    . DG  B 2 54  ? 79.637  102.805 141.632 1.00 42.83  ? -6  DG  J N9    1 
ATOM   3617  C C8    . DG  B 2 54  ? 78.640  103.036 142.556 1.00 44.19  ? -6  DG  J C8    1 
ATOM   3618  N N7    . DG  B 2 54  ? 77.437  102.896 142.057 1.00 43.99  ? -6  DG  J N7    1 
ATOM   3619  C C5    . DG  B 2 54  ? 77.649  102.570 140.724 1.00 42.70  ? -6  DG  J C5    1 
ATOM   3620  C C6    . DG  B 2 54  ? 76.726  102.271 139.696 1.00 47.51  ? -6  DG  J C6    1 
ATOM   3621  O O6    . DG  B 2 54  ? 75.493  102.181 139.764 1.00 44.88  ? -6  DG  J O6    1 
ATOM   3622  N N1    . DG  B 2 54  ? 77.369  102.037 138.482 1.00 46.50  ? -6  DG  J N1    1 
ATOM   3623  C C2    . DG  B 2 54  ? 78.728  102.068 138.291 1.00 45.72  ? -6  DG  J C2    1 
ATOM   3624  N N2    . DG  B 2 54  ? 79.148  101.830 137.051 1.00 42.41  ? -6  DG  J N2    1 
ATOM   3625  N N3    . DG  B 2 54  ? 79.603  102.317 139.247 1.00 45.18  ? -6  DG  J N3    1 
ATOM   3626  C C4    . DG  B 2 54  ? 78.999  102.557 140.432 1.00 46.21  ? -6  DG  J C4    1 
ATOM   3627  P P     . DC  B 2 55  ? 84.739  104.611 142.699 1.00 41.29  ? -5  DC  J P     1 
ATOM   3628  O OP1   . DC  B 2 55  ? 86.168  104.315 142.491 1.00 37.99  ? -5  DC  J OP1   1 
ATOM   3629  O OP2   . DC  B 2 55  ? 84.330  105.515 143.800 1.00 42.62  ? -5  DC  J OP2   1 
ATOM   3630  O "O5'" . DC  B 2 55  ? 84.145  105.217 141.359 1.00 40.63  ? -5  DC  J "O5'" 1 
ATOM   3631  C "C5'" . DC  B 2 55  ? 84.201  104.469 140.156 1.00 42.18  ? -5  DC  J "C5'" 1 
ATOM   3632  C "C4'" . DC  B 2 55  ? 83.463  105.198 139.063 1.00 42.80  ? -5  DC  J "C4'" 1 
ATOM   3633  O "O4'" . DC  B 2 55  ? 82.039  105.085 139.267 1.00 42.92  ? -5  DC  J "O4'" 1 
ATOM   3634  C "C3'" . DC  B 2 55  ? 83.759  106.693 138.981 1.00 42.89  ? -5  DC  J "C3'" 1 
ATOM   3635  O "O3'" . DC  B 2 55  ? 83.752  107.054 137.605 1.00 42.43  ? -5  DC  J "O3'" 1 
ATOM   3636  C "C2'" . DC  B 2 55  ? 82.544  107.307 139.655 1.00 43.18  ? -5  DC  J "C2'" 1 
ATOM   3637  C "C1'" . DC  B 2 55  ? 81.468  106.364 139.149 1.00 45.40  ? -5  DC  J "C1'" 1 
ATOM   3638  N N1    . DC  B 2 55  ? 80.174  106.345 139.841 1.00 48.10  ? -5  DC  J N1    1 
ATOM   3639  C C2    . DC  B 2 55  ? 79.037  105.980 139.108 1.00 49.92  ? -5  DC  J C2    1 
ATOM   3640  O O2    . DC  B 2 55  ? 79.145  105.734 137.888 1.00 42.77  ? -5  DC  J O2    1 
ATOM   3641  N N3    . DC  B 2 55  ? 77.849  105.914 139.738 1.00 48.74  ? -5  DC  J N3    1 
ATOM   3642  C C4    . DC  B 2 55  ? 77.759  106.214 141.029 1.00 50.01  ? -5  DC  J C4    1 
ATOM   3643  N N4    . DC  B 2 55  ? 76.552  106.128 141.602 1.00 53.15  ? -5  DC  J N4    1 
ATOM   3644  C C5    . DC  B 2 55  ? 78.892  106.613 141.791 1.00 49.22  ? -5  DC  J C5    1 
ATOM   3645  C C6    . DC  B 2 55  ? 80.069  106.660 141.167 1.00 50.39  ? -5  DC  J C6    1 
ATOM   3646  P P     . DT  B 2 56  ? 85.125  107.393 136.850 1.00 44.32  ? -4  DT  J P     1 
ATOM   3647  O OP1   . DT  B 2 56  ? 86.072  106.263 137.036 1.00 43.64  ? -4  DT  J OP1   1 
ATOM   3648  O OP2   . DT  B 2 56  ? 85.553  108.766 137.181 1.00 41.91  ? -4  DT  J OP2   1 
ATOM   3649  O "O5'" . DT  B 2 56  ? 84.665  107.381 135.329 1.00 40.27  ? -4  DT  J "O5'" 1 
ATOM   3650  C "C5'" . DT  B 2 56  ? 84.198  106.176 134.751 1.00 36.34  ? -4  DT  J "C5'" 1 
ATOM   3651  C "C4'" . DT  B 2 56  ? 82.948  106.441 133.954 1.00 39.58  ? -4  DT  J "C4'" 1 
ATOM   3652  O "O4'" . DT  B 2 56  ? 81.743  106.555 134.770 1.00 39.69  ? -4  DT  J "O4'" 1 
ATOM   3653  C "C3'" . DT  B 2 56  ? 83.044  107.721 133.131 1.00 35.35  ? -4  DT  J "C3'" 1 
ATOM   3654  O "O3'" . DT  B 2 56  ? 82.750  107.367 131.810 1.00 34.07  ? -4  DT  J "O3'" 1 
ATOM   3655  C "C2'" . DT  B 2 56  ? 81.966  108.622 133.713 1.00 41.22  ? -4  DT  J "C2'" 1 
ATOM   3656  C "C1'" . DT  B 2 56  ? 80.953  107.644 134.307 1.00 42.20  ? -4  DT  J "C1'" 1 
ATOM   3657  N N1    . DT  B 2 56  ? 80.177  108.189 135.470 1.00 40.29  ? -4  DT  J N1    1 
ATOM   3658  C C2    . DT  B 2 56  ? 78.815  107.923 135.587 1.00 41.03  ? -4  DT  J C2    1 
ATOM   3659  O O2    . DT  B 2 56  ? 78.178  107.286 134.777 1.00 39.44  ? -4  DT  J O2    1 
ATOM   3660  N N3    . DT  B 2 56  ? 78.220  108.439 136.721 1.00 43.18  ? -4  DT  J N3    1 
ATOM   3661  C C4    . DT  B 2 56  ? 78.831  109.174 137.722 1.00 44.05  ? -4  DT  J C4    1 
ATOM   3662  O O4    . DT  B 2 56  ? 78.180  109.532 138.698 1.00 47.67  ? -4  DT  J O4    1 
ATOM   3663  C C5    . DT  B 2 56  ? 80.237  109.447 137.520 1.00 42.51  ? -4  DT  J C5    1 
ATOM   3664  C C7    . DT  B 2 56  ? 80.965  110.276 138.528 1.00 41.87  ? -4  DT  J C7    1 
ATOM   3665  C C6    . DT  B 2 56  ? 80.831  108.944 136.421 1.00 41.95  ? -4  DT  J C6    1 
ATOM   3666  P P     . DG  B 2 57  ? 82.977  108.408 130.626 1.00 31.94  ? -3  DG  J P     1 
ATOM   3667  O OP1   . DG  B 2 57  ? 83.735  107.612 129.604 1.00 34.64  ? -3  DG  J OP1   1 
ATOM   3668  O OP2   . DG  B 2 57  ? 83.517  109.681 131.090 1.00 32.17  ? -3  DG  J OP2   1 
ATOM   3669  O "O5'" . DG  B 2 57  ? 81.488  108.609 130.126 1.00 29.82  ? -3  DG  J "O5'" 1 
ATOM   3670  C "C5'" . DG  B 2 57  ? 80.710  107.465 129.837 1.00 29.41  ? -3  DG  J "C5'" 1 
ATOM   3671  C "C4'" . DG  B 2 57  ? 79.282  107.858 129.564 1.00 37.44  ? -3  DG  J "C4'" 1 
ATOM   3672  O "O4'" . DG  B 2 57  ? 78.691  108.396 130.761 1.00 39.47  ? -3  DG  J "O4'" 1 
ATOM   3673  C "C3'" . DG  B 2 57  ? 79.086  108.920 128.493 1.00 38.03  ? -3  DG  J "C3'" 1 
ATOM   3674  O "O3'" . DG  B 2 57  ? 77.876  108.583 127.827 1.00 42.44  ? -3  DG  J "O3'" 1 
ATOM   3675  C "C2'" . DG  B 2 57  ? 78.978  110.208 129.290 1.00 38.74  ? -3  DG  J "C2'" 1 
ATOM   3676  C "C1'" . DG  B 2 57  ? 78.308  109.747 130.574 1.00 40.26  ? -3  DG  J "C1'" 1 
ATOM   3677  N N9    . DG  B 2 57  ? 78.686  110.461 131.788 1.00 41.15  ? -3  DG  J N9    1 
ATOM   3678  C C8    . DG  B 2 57  ? 79.910  110.980 132.119 1.00 39.34  ? -3  DG  J C8    1 
ATOM   3679  N N7    . DG  B 2 57  ? 79.943  111.491 133.315 1.00 41.05  ? -3  DG  J N7    1 
ATOM   3680  C C5    . DG  B 2 57  ? 78.652  111.308 133.797 1.00 45.10  ? -3  DG  J C5    1 
ATOM   3681  C C6    . DG  B 2 57  ? 78.085  111.635 135.049 1.00 44.16  ? -3  DG  J C6    1 
ATOM   3682  O O6    . DG  B 2 57  ? 78.640  112.127 136.023 1.00 44.45  ? -3  DG  J O6    1 
ATOM   3683  N N1    . DG  B 2 57  ? 76.735  111.304 135.107 1.00 43.53  ? -3  DG  J N1    1 
ATOM   3684  C C2    . DG  B 2 57  ? 76.029  110.708 134.088 1.00 46.68  ? -3  DG  J C2    1 
ATOM   3685  N N2    . DG  B 2 57  ? 74.721  110.466 134.310 1.00 44.64  ? -3  DG  J N2    1 
ATOM   3686  N N3    . DG  B 2 57  ? 76.558  110.368 132.930 1.00 43.20  ? -3  DG  J N3    1 
ATOM   3687  C C4    . DG  B 2 57  ? 77.862  110.698 132.855 1.00 44.60  ? -3  DG  J C4    1 
ATOM   3688  P P     . DA  B 2 58  ? 77.357  109.462 126.599 1.00 45.50  ? -2  DA  J P     1 
ATOM   3689  O OP1   . DA  B 2 58  ? 76.758  108.533 125.618 1.00 40.85  ? -2  DA  J OP1   1 
ATOM   3690  O OP2   . DA  B 2 58  ? 78.414  110.421 126.194 1.00 47.21  ? -2  DA  J OP2   1 
ATOM   3691  O "O5'" . DA  B 2 58  ? 76.189  110.311 127.261 1.00 48.20  ? -2  DA  J "O5'" 1 
ATOM   3692  C "C5'" . DA  B 2 58  ? 75.134  109.658 127.950 1.00 50.17  ? -2  DA  J "C5'" 1 
ATOM   3693  C "C4'" . DA  B 2 58  ? 74.189  110.689 128.511 1.00 56.90  ? -2  DA  J "C4'" 1 
ATOM   3694  O "O4'" . DA  B 2 58  ? 74.716  111.253 129.738 1.00 57.67  ? -2  DA  J "O4'" 1 
ATOM   3695  C "C3'" . DA  B 2 58  ? 73.982  111.866 127.560 1.00 58.80  ? -2  DA  J "C3'" 1 
ATOM   3696  O "O3'" . DA  B 2 58  ? 72.607  112.243 127.568 1.00 64.08  ? -2  DA  J "O3'" 1 
ATOM   3697  C "C2'" . DA  B 2 58  ? 74.854  112.957 128.157 1.00 55.54  ? -2  DA  J "C2'" 1 
ATOM   3698  C "C1'" . DA  B 2 58  ? 74.726  112.659 129.632 1.00 55.25  ? -2  DA  J "C1'" 1 
ATOM   3699  N N9    . DA  B 2 58  ? 75.790  113.176 130.487 1.00 52.48  ? -2  DA  J N9    1 
ATOM   3700  C C8    . DA  B 2 58  ? 77.102  113.426 130.182 1.00 53.67  ? -2  DA  J C8    1 
ATOM   3701  N N7    . DA  B 2 58  ? 77.789  113.935 131.179 1.00 51.39  ? -2  DA  J N7    1 
ATOM   3702  C C5    . DA  B 2 58  ? 76.868  114.008 132.214 1.00 51.35  ? -2  DA  J C5    1 
ATOM   3703  C C6    . DA  B 2 58  ? 76.971  114.459 133.541 1.00 49.92  ? -2  DA  J C6    1 
ATOM   3704  N N6    . DA  B 2 58  ? 78.100  114.923 134.079 1.00 49.14  ? -2  DA  J N6    1 
ATOM   3705  N N1    . DA  B 2 58  ? 75.858  114.416 134.307 1.00 52.54  ? -2  DA  J N1    1 
ATOM   3706  C C2    . DA  B 2 58  ? 74.723  113.934 133.769 1.00 54.25  ? -2  DA  J C2    1 
ATOM   3707  N N3    . DA  B 2 58  ? 74.507  113.471 132.540 1.00 51.50  ? -2  DA  J N3    1 
ATOM   3708  C C4    . DA  B 2 58  ? 75.635  113.541 131.804 1.00 52.68  ? -2  DA  J C4    1 
ATOM   3709  P P     . DA  B 2 59  ? 72.078  113.378 126.558 1.00 65.21  ? -1  DA  J P     1 
ATOM   3710  O OP1   . DA  B 2 59  ? 71.142  112.690 125.636 1.00 65.43  ? -1  DA  J OP1   1 
ATOM   3711  O OP2   . DA  B 2 59  ? 73.200  114.183 126.009 1.00 61.99  ? -1  DA  J OP2   1 
ATOM   3712  O "O5'" . DA  B 2 59  ? 71.279  114.338 127.539 1.00 61.79  ? -1  DA  J "O5'" 1 
ATOM   3713  C "C5'" . DA  B 2 59  ? 70.660  113.801 128.697 1.00 60.36  ? -1  DA  J "C5'" 1 
ATOM   3714  C "C4'" . DA  B 2 59  ? 70.457  114.880 129.729 1.00 60.12  ? -1  DA  J "C4'" 1 
ATOM   3715  O "O4'" . DA  B 2 59  ? 71.637  115.059 130.550 1.00 59.10  ? -1  DA  J "O4'" 1 
ATOM   3716  C "C3'" . DA  B 2 59  ? 70.117  116.247 129.139 1.00 61.25  ? -1  DA  J "C3'" 1 
ATOM   3717  O "O3'" . DA  B 2 59  ? 68.932  116.741 129.747 1.00 67.24  ? -1  DA  J "O3'" 1 
ATOM   3718  C "C2'" . DA  B 2 59  ? 71.324  117.110 129.479 1.00 59.07  ? -1  DA  J "C2'" 1 
ATOM   3719  C "C1'" . DA  B 2 59  ? 71.895  116.441 130.717 1.00 58.41  ? -1  DA  J "C1'" 1 
ATOM   3720  N N9    . DA  B 2 59  ? 73.338  116.614 130.882 1.00 58.82  ? -1  DA  J N9    1 
ATOM   3721  C C8    . DA  B 2 59  ? 74.313  116.391 129.945 1.00 58.69  ? -1  DA  J C8    1 
ATOM   3722  N N7    . DA  B 2 59  ? 75.525  116.656 130.366 1.00 57.44  ? -1  DA  J N7    1 
ATOM   3723  C C5    . DA  B 2 59  ? 75.342  117.068 131.672 1.00 57.19  ? -1  DA  J C5    1 
ATOM   3724  C C6    . DA  B 2 59  ? 76.242  117.490 132.662 1.00 56.74  ? -1  DA  J C6    1 
ATOM   3725  N N6    . DA  B 2 59  ? 77.562  117.564 132.483 1.00 52.72  ? -1  DA  J N6    1 
ATOM   3726  N N1    . DA  B 2 59  ? 75.729  117.844 133.864 1.00 59.85  ? -1  DA  J N1    1 
ATOM   3727  C C2    . DA  B 2 59  ? 74.405  117.774 134.041 1.00 58.57  ? -1  DA  J C2    1 
ATOM   3728  N N3    . DA  B 2 59  ? 73.461  117.395 133.187 1.00 59.15  ? -1  DA  J N3    1 
ATOM   3729  C C4    . DA  B 2 59  ? 73.998  117.049 132.007 1.00 58.92  ? -1  DA  J C4    1 
ATOM   3730  P P     . DT  B 2 60  ? 68.245  118.067 129.182 1.00 69.05  ? 0   DT  J P     1 
ATOM   3731  O OP1   . DT  B 2 60  ? 66.780  117.855 129.270 1.00 72.63  ? 0   DT  J OP1   1 
ATOM   3732  O OP2   . DT  B 2 60  ? 68.860  118.462 127.889 1.00 69.51  ? 0   DT  J OP2   1 
ATOM   3733  O "O5'" . DT  B 2 60  ? 68.683  119.143 130.257 1.00 68.49  ? 0   DT  J "O5'" 1 
ATOM   3734  C "C5'" . DT  B 2 60  ? 68.657  118.818 131.635 1.00 65.23  ? 0   DT  J "C5'" 1 
ATOM   3735  C "C4'" . DT  B 2 60  ? 69.177  119.982 132.435 1.00 66.17  ? 0   DT  J "C4'" 1 
ATOM   3736  O "O4'" . DT  B 2 60  ? 70.612  119.893 132.599 1.00 64.36  ? 0   DT  J "O4'" 1 
ATOM   3737  C "C3'" . DT  B 2 60  ? 68.891  121.337 131.792 1.00 65.34  ? 0   DT  J "C3'" 1 
ATOM   3738  O "O3'" . DT  B 2 60  ? 68.370  122.221 132.781 1.00 69.18  ? 0   DT  J "O3'" 1 
ATOM   3739  C "C2'" . DT  B 2 60  ? 70.252  121.790 131.288 1.00 64.03  ? 0   DT  J "C2'" 1 
ATOM   3740  C "C1'" . DT  B 2 60  ? 71.205  121.133 132.274 1.00 64.39  ? 0   DT  J "C1'" 1 
ATOM   3741  N N1    . DT  B 2 60  ? 72.586  120.868 131.794 1.00 60.11  ? 0   DT  J N1    1 
ATOM   3742  C C2    . DT  B 2 60  ? 73.619  121.187 132.637 1.00 59.69  ? 0   DT  J C2    1 
ATOM   3743  O O2    . DT  B 2 60  ? 73.451  121.705 133.723 1.00 60.87  ? 0   DT  J O2    1 
ATOM   3744  N N3    . DT  B 2 60  ? 74.866  120.881 132.162 1.00 60.15  ? 0   DT  J N3    1 
ATOM   3745  C C4    . DT  B 2 60  ? 75.180  120.305 130.953 1.00 60.14  ? 0   DT  J C4    1 
ATOM   3746  O O4    . DT  B 2 60  ? 76.351  120.054 130.681 1.00 60.51  ? 0   DT  J O4    1 
ATOM   3747  C C5    . DT  B 2 60  ? 74.056  120.027 130.094 1.00 60.21  ? 0   DT  J C5    1 
ATOM   3748  C C7    . DT  B 2 60  ? 74.310  119.439 128.740 1.00 57.49  ? 0   DT  J C7    1 
ATOM   3749  C C6    . DT  B 2 60  ? 72.825  120.312 130.554 1.00 61.03  ? 0   DT  J C6    1 
ATOM   3750  P P     . DT  B 2 61  ? 67.835  123.673 132.355 1.00 73.07  ? 1   DT  J P     1 
ATOM   3751  O OP1   . DT  B 2 61  ? 66.555  123.892 133.069 1.00 73.18  ? 1   DT  J OP1   1 
ATOM   3752  O OP2   . DT  B 2 61  ? 67.884  123.800 130.871 1.00 70.95  ? 1   DT  J OP2   1 
ATOM   3753  O "O5'" . DT  B 2 61  ? 68.948  124.615 132.979 1.00 69.44  ? 1   DT  J "O5'" 1 
ATOM   3754  C "C5'" . DT  B 2 61  ? 69.468  124.329 134.268 1.00 69.06  ? 1   DT  J "C5'" 1 
ATOM   3755  C "C4'" . DT  B 2 61  ? 70.600  125.269 134.588 1.00 70.58  ? 1   DT  J "C4'" 1 
ATOM   3756  O "O4'" . DT  B 2 61  ? 71.867  124.759 134.115 1.00 68.57  ? 1   DT  J "O4'" 1 
ATOM   3757  C "C3'" . DT  B 2 61  ? 70.432  126.650 133.963 1.00 72.14  ? 1   DT  J "C3'" 1 
ATOM   3758  O "O3'" . DT  B 2 61  ? 70.738  127.639 134.937 1.00 76.51  ? 1   DT  J "O3'" 1 
ATOM   3759  C "C2'" . DT  B 2 61  ? 71.455  126.662 132.840 1.00 68.87  ? 1   DT  J "C2'" 1 
ATOM   3760  C "C1'" . DT  B 2 61  ? 72.546  125.769 133.398 1.00 65.70  ? 1   DT  J "C1'" 1 
ATOM   3761  N N1    . DT  B 2 61  ? 73.401  125.108 132.393 1.00 62.23  ? 1   DT  J N1    1 
ATOM   3762  C C2    . DT  B 2 61  ? 74.753  125.046 132.643 1.00 61.63  ? 1   DT  J C2    1 
ATOM   3763  O O2    . DT  B 2 61  ? 75.271  125.530 133.638 1.00 60.99  ? 1   DT  J O2    1 
ATOM   3764  N N3    . DT  B 2 61  ? 75.482  124.391 131.683 1.00 59.94  ? 1   DT  J N3    1 
ATOM   3765  C C4    . DT  B 2 61  ? 75.005  123.805 130.527 1.00 59.02  ? 1   DT  J C4    1 
ATOM   3766  O O4    . DT  B 2 61  ? 75.778  123.229 129.771 1.00 58.58  ? 1   DT  J O4    1 
ATOM   3767  C C5    . DT  B 2 61  ? 73.583  123.924 130.318 1.00 58.16  ? 1   DT  J C5    1 
ATOM   3768  C C7    . DT  B 2 61  ? 72.979  123.338 129.084 1.00 56.85  ? 1   DT  J C7    1 
ATOM   3769  C C6    . DT  B 2 61  ? 72.861  124.562 131.250 1.00 59.55  ? 1   DT  J C6    1 
ATOM   3770  P P     . DC  B 2 62  ? 70.369  129.169 134.652 1.00 79.17  ? 2   DC  J P     1 
ATOM   3771  O OP1   . DC  B 2 62  ? 69.715  129.693 135.882 1.00 81.61  ? 2   DC  J OP1   1 
ATOM   3772  O OP2   . DC  B 2 62  ? 69.662  129.249 133.344 1.00 76.44  ? 2   DC  J OP2   1 
ATOM   3773  O "O5'" . DC  B 2 62  ? 71.804  129.838 134.517 1.00 77.81  ? 2   DC  J "O5'" 1 
ATOM   3774  C "C5'" . DC  B 2 62  ? 72.829  129.526 135.461 1.00 78.15  ? 2   DC  J "C5'" 1 
ATOM   3775  C "C4'" . DC  B 2 62  ? 74.164  130.021 134.961 1.00 78.47  ? 2   DC  J "C4'" 1 
ATOM   3776  O "O4'" . DC  B 2 62  ? 74.799  129.078 134.058 1.00 76.54  ? 2   DC  J "O4'" 1 
ATOM   3777  C "C3'" . DC  B 2 62  ? 74.047  131.335 134.195 1.00 78.91  ? 2   DC  J "C3'" 1 
ATOM   3778  O "O3'" . DC  B 2 62  ? 75.086  132.204 134.583 1.00 80.70  ? 2   DC  J "O3'" 1 
ATOM   3779  C "C2'" . DC  B 2 62  ? 74.259  130.928 132.749 1.00 78.65  ? 2   DC  J "C2'" 1 
ATOM   3780  C "C1'" . DC  B 2 62  ? 75.234  129.776 132.899 1.00 75.59  ? 2   DC  J "C1'" 1 
ATOM   3781  N N1    . DC  B 2 62  ? 75.243  128.844 131.760 1.00 73.02  ? 2   DC  J N1    1 
ATOM   3782  C C2    . DC  B 2 62  ? 76.457  128.239 131.384 1.00 71.29  ? 2   DC  J C2    1 
ATOM   3783  O O2    . DC  B 2 62  ? 77.480  128.479 132.043 1.00 69.66  ? 2   DC  J O2    1 
ATOM   3784  N N3    . DC  B 2 62  ? 76.479  127.412 130.317 1.00 68.93  ? 2   DC  J N3    1 
ATOM   3785  C C4    . DC  B 2 62  ? 75.355  127.174 129.634 1.00 69.52  ? 2   DC  J C4    1 
ATOM   3786  N N4    . DC  B 2 62  ? 75.426  126.361 128.578 1.00 67.01  ? 2   DC  J N4    1 
ATOM   3787  C C5    . DC  B 2 62  ? 74.108  127.762 130.002 1.00 69.37  ? 2   DC  J C5    1 
ATOM   3788  C C6    . DC  B 2 62  ? 74.098  128.581 131.061 1.00 70.97  ? 2   DC  J C6    1 
ATOM   3789  P P     . DA  B 2 63  ? 74.794  133.765 134.691 1.00 81.16  ? 3   DA  J P     1 
ATOM   3790  O OP1   . DA  B 2 63  ? 74.122  133.990 135.994 1.00 83.86  ? 3   DA  J OP1   1 
ATOM   3791  O OP2   . DA  B 2 63  ? 74.134  134.199 133.433 1.00 81.11  ? 3   DA  J OP2   1 
ATOM   3792  O "O5'" . DA  B 2 63  ? 76.253  134.379 134.753 1.00 80.91  ? 3   DA  J "O5'" 1 
ATOM   3793  C "C5'" . DA  B 2 63  ? 77.282  133.699 135.456 1.00 81.07  ? 3   DA  J "C5'" 1 
ATOM   3794  C "C4'" . DA  B 2 63  ? 78.546  133.704 134.634 1.00 81.37  ? 3   DA  J "C4'" 1 
ATOM   3795  O "O4'" . DA  B 2 63  ? 78.450  132.747 133.548 1.00 81.24  ? 3   DA  J "O4'" 1 
ATOM   3796  C "C3'" . DA  B 2 63  ? 78.819  135.057 133.985 1.00 82.01  ? 3   DA  J "C3'" 1 
ATOM   3797  O "O3'" . DA  B 2 63  ? 80.211  135.319 134.026 1.00 84.62  ? 3   DA  J "O3'" 1 
ATOM   3798  C "C2'" . DA  B 2 63  ? 78.371  134.853 132.548 1.00 80.92  ? 3   DA  J "C2'" 1 
ATOM   3799  C "C1'" . DA  B 2 63  ? 78.729  133.395 132.319 1.00 79.11  ? 3   DA  J "C1'" 1 
ATOM   3800  N N9    . DA  B 2 63  ? 77.958  132.726 131.270 1.00 77.03  ? 3   DA  J N9    1 
ATOM   3801  C C8    . DA  B 2 63  ? 76.651  132.945 130.914 1.00 77.31  ? 3   DA  J C8    1 
ATOM   3802  N N7    . DA  B 2 63  ? 76.236  132.190 129.928 1.00 75.61  ? 3   DA  J N7    1 
ATOM   3803  C C5    . DA  B 2 63  ? 77.341  131.414 129.616 1.00 75.32  ? 3   DA  J C5    1 
ATOM   3804  C C6    . DA  B 2 63  ? 77.548  130.402 128.659 1.00 73.68  ? 3   DA  J C6    1 
ATOM   3805  N N6    . DA  B 2 63  ? 76.597  129.969 127.827 1.00 72.06  ? 3   DA  J N6    1 
ATOM   3806  N N1    . DA  B 2 63  ? 78.773  129.841 128.592 1.00 74.39  ? 3   DA  J N1    1 
ATOM   3807  C C2    . DA  B 2 63  ? 79.720  130.262 129.446 1.00 74.44  ? 3   DA  J C2    1 
ATOM   3808  N N3    . DA  B 2 63  ? 79.641  131.190 130.399 1.00 75.08  ? 3   DA  J N3    1 
ATOM   3809  C C4    . DA  B 2 63  ? 78.412  131.737 130.430 1.00 76.13  ? 3   DA  J C4    1 
ATOM   3810  P P     . DG  B 2 64  ? 80.737  136.827 133.974 1.00 85.50  ? 4   DG  J P     1 
ATOM   3811  O OP1   . DG  B 2 64  ? 80.850  137.319 135.368 1.00 85.50  ? 4   DG  J OP1   1 
ATOM   3812  O OP2   . DG  B 2 64  ? 79.905  137.574 132.994 1.00 85.25  ? 4   DG  J OP2   1 
ATOM   3813  O "O5'" . DG  B 2 64  ? 82.206  136.646 133.397 1.00 84.16  ? 4   DG  J "O5'" 1 
ATOM   3814  C "C5'" . DG  B 2 64  ? 83.029  135.592 133.887 1.00 80.01  ? 4   DG  J "C5'" 1 
ATOM   3815  C "C4'" . DG  B 2 64  ? 83.826  134.979 132.762 1.00 77.40  ? 4   DG  J "C4'" 1 
ATOM   3816  O "O4'" . DG  B 2 64  ? 82.952  134.320 131.817 1.00 75.34  ? 4   DG  J "O4'" 1 
ATOM   3817  C "C3'" . DG  B 2 64  ? 84.649  135.974 131.955 1.00 75.95  ? 4   DG  J "C3'" 1 
ATOM   3818  O "O3'" . DG  B 2 64  ? 85.922  135.395 131.690 1.00 75.89  ? 4   DG  J "O3'" 1 
ATOM   3819  C "C2'" . DG  B 2 64  ? 83.837  136.172 130.684 1.00 73.15  ? 4   DG  J "C2'" 1 
ATOM   3820  C "C1'" . DG  B 2 64  ? 83.163  134.825 130.508 1.00 73.10  ? 4   DG  J "C1'" 1 
ATOM   3821  N N9    . DG  B 2 64  ? 81.864  134.861 129.842 1.00 72.52  ? 4   DG  J N9    1 
ATOM   3822  C C8    . DG  B 2 64  ? 80.809  135.693 130.126 1.00 71.58  ? 4   DG  J C8    1 
ATOM   3823  N N7    . DG  B 2 64  ? 79.755  135.454 129.393 1.00 69.92  ? 4   DG  J N7    1 
ATOM   3824  C C5    . DG  B 2 64  ? 80.139  134.407 128.570 1.00 69.31  ? 4   DG  J C5    1 
ATOM   3825  C C6    . DG  B 2 64  ? 79.413  133.711 127.568 1.00 69.39  ? 4   DG  J C6    1 
ATOM   3826  O O6    . DG  B 2 64  ? 78.237  133.865 127.219 1.00 66.08  ? 4   DG  J O6    1 
ATOM   3827  N N1    . DG  B 2 64  ? 80.195  132.736 126.957 1.00 68.67  ? 4   DG  J N1    1 
ATOM   3828  C C2    . DG  B 2 64  ? 81.496  132.453 127.278 1.00 70.59  ? 4   DG  J C2    1 
ATOM   3829  N N2    . DG  B 2 64  ? 82.081  131.477 126.566 1.00 72.17  ? 4   DG  J N2    1 
ATOM   3830  N N3    . DG  B 2 64  ? 82.176  133.078 128.225 1.00 70.08  ? 4   DG  J N3    1 
ATOM   3831  C C4    . DG  B 2 64  ? 81.442  134.039 128.821 1.00 71.48  ? 4   DG  J C4    1 
ATOM   3832  P P     . DC  B 2 65  ? 87.086  136.300 131.080 1.00 79.86  ? 5   DC  J P     1 
ATOM   3833  O OP1   . DC  B 2 65  ? 88.390  135.820 131.597 1.00 78.42  ? 5   DC  J OP1   1 
ATOM   3834  O OP2   . DC  B 2 65  ? 86.699  137.717 131.272 1.00 79.73  ? 5   DC  J OP2   1 
ATOM   3835  O "O5'" . DC  B 2 65  ? 86.983  135.985 129.522 1.00 81.17  ? 5   DC  J "O5'" 1 
ATOM   3836  C "C5'" . DC  B 2 65  ? 87.112  134.653 129.035 1.00 80.39  ? 5   DC  J "C5'" 1 
ATOM   3837  C "C4'" . DC  B 2 65  ? 86.877  134.627 127.543 1.00 80.98  ? 5   DC  J "C4'" 1 
ATOM   3838  O "O4'" . DC  B 2 65  ? 85.462  134.688 127.240 1.00 81.10  ? 5   DC  J "O4'" 1 
ATOM   3839  C "C3'" . DC  B 2 65  ? 87.514  135.804 126.802 1.00 81.45  ? 5   DC  J "C3'" 1 
ATOM   3840  O "O3'" . DC  B 2 65  ? 87.965  135.365 125.525 1.00 78.89  ? 5   DC  J "O3'" 1 
ATOM   3841  C "C2'" . DC  B 2 65  ? 86.342  136.747 126.605 1.00 82.21  ? 5   DC  J "C2'" 1 
ATOM   3842  C "C1'" . DC  B 2 65  ? 85.241  135.746 126.322 1.00 83.07  ? 5   DC  J "C1'" 1 
ATOM   3843  N N1    . DC  B 2 65  ? 83.865  136.235 126.496 1.00 83.99  ? 5   DC  J N1    1 
ATOM   3844  C C2    . DC  B 2 65  ? 82.831  135.580 125.813 1.00 85.17  ? 5   DC  J C2    1 
ATOM   3845  O O2    . DC  B 2 65  ? 83.110  134.604 125.091 1.00 84.25  ? 5   DC  J O2    1 
ATOM   3846  N N3    . DC  B 2 65  ? 81.561  136.025 125.954 1.00 85.89  ? 5   DC  J N3    1 
ATOM   3847  C C4    . DC  B 2 65  ? 81.307  137.075 126.737 1.00 85.86  ? 5   DC  J C4    1 
ATOM   3848  N N4    . DC  B 2 65  ? 80.040  137.483 126.849 1.00 86.78  ? 5   DC  J N4    1 
ATOM   3849  C C5    . DC  B 2 65  ? 82.341  137.757 127.443 1.00 85.62  ? 5   DC  J C5    1 
ATOM   3850  C C6    . DC  B 2 65  ? 83.591  137.307 127.297 1.00 84.09  ? 5   DC  J C6    1 
ATOM   3851  P P     . DT  B 2 66  ? 89.513  135.493 125.136 1.00 77.25  ? 6   DT  J P     1 
ATOM   3852  O OP1   . DT  B 2 66  ? 90.345  135.202 126.329 1.00 78.34  ? 6   DT  J OP1   1 
ATOM   3853  O OP2   . DT  B 2 66  ? 89.692  136.771 124.404 1.00 76.92  ? 6   DT  J OP2   1 
ATOM   3854  O "O5'" . DT  B 2 66  ? 89.702  134.296 124.105 1.00 76.76  ? 6   DT  J "O5'" 1 
ATOM   3855  C "C5'" . DT  B 2 66  ? 89.027  133.054 124.304 1.00 69.02  ? 6   DT  J "C5'" 1 
ATOM   3856  C "C4'" . DT  B 2 66  ? 88.105  132.772 123.141 1.00 66.18  ? 6   DT  J "C4'" 1 
ATOM   3857  O "O4'" . DT  B 2 66  ? 86.869  133.524 123.222 1.00 63.96  ? 6   DT  J "O4'" 1 
ATOM   3858  C "C3'" . DT  B 2 66  ? 88.693  133.109 121.775 1.00 64.13  ? 6   DT  J "C3'" 1 
ATOM   3859  O "O3'" . DT  B 2 66  ? 88.059  132.245 120.849 1.00 60.75  ? 6   DT  J "O3'" 1 
ATOM   3860  C "C2'" . DT  B 2 66  ? 88.146  134.507 121.534 1.00 64.86  ? 6   DT  J "C2'" 1 
ATOM   3861  C "C1'" . DT  B 2 66  ? 86.732  134.324 122.055 1.00 65.44  ? 6   DT  J "C1'" 1 
ATOM   3862  N N1    . DT  B 2 66  ? 85.988  135.546 122.421 1.00 65.94  ? 6   DT  J N1    1 
ATOM   3863  C C2    . DT  B 2 66  ? 84.667  135.617 122.058 1.00 65.27  ? 6   DT  J C2    1 
ATOM   3864  O O2    . DT  B 2 66  ? 84.117  134.765 121.389 1.00 65.29  ? 6   DT  J O2    1 
ATOM   3865  N N3    . DT  B 2 66  ? 84.009  136.734 122.500 1.00 67.64  ? 6   DT  J N3    1 
ATOM   3866  C C4    . DT  B 2 66  ? 84.534  137.772 123.235 1.00 68.02  ? 6   DT  J C4    1 
ATOM   3867  O O4    . DT  B 2 66  ? 83.807  138.690 123.594 1.00 71.13  ? 6   DT  J O4    1 
ATOM   3868  C C5    . DT  B 2 66  ? 85.941  137.664 123.530 1.00 68.29  ? 6   DT  J C5    1 
ATOM   3869  C C7    . DT  B 2 66  ? 86.618  138.778 124.264 1.00 68.29  ? 6   DT  J C7    1 
ATOM   3870  C C6    . DT  B 2 66  ? 86.589  136.565 123.122 1.00 67.93  ? 6   DT  J C6    1 
ATOM   3871  P P     . DG  B 2 67  ? 88.917  131.279 119.900 1.00 57.75  ? 7   DG  J P     1 
ATOM   3872  O OP1   . DG  B 2 67  ? 89.155  129.983 120.588 1.00 56.49  ? 7   DG  J OP1   1 
ATOM   3873  O OP2   . DG  B 2 67  ? 90.053  132.029 119.312 1.00 51.33  ? 7   DG  J OP2   1 
ATOM   3874  O "O5'" . DG  B 2 67  ? 87.882  131.060 118.732 1.00 52.80  ? 7   DG  J "O5'" 1 
ATOM   3875  C "C5'" . DG  B 2 67  ? 87.921  131.924 117.642 1.00 49.82  ? 7   DG  J "C5'" 1 
ATOM   3876  C "C4'" . DG  B 2 67  ? 86.529  132.292 117.211 1.00 49.62  ? 7   DG  J "C4'" 1 
ATOM   3877  O "O4'" . DG  B 2 67  ? 85.960  133.331 118.054 1.00 50.72  ? 7   DG  J "O4'" 1 
ATOM   3878  C "C3'" . DG  B 2 67  ? 86.631  132.904 115.829 1.00 44.46  ? 7   DG  J "C3'" 1 
ATOM   3879  O "O3'" . DG  B 2 67  ? 85.504  132.538 115.092 1.00 40.11  ? 7   DG  J "O3'" 1 
ATOM   3880  C "C2'" . DG  B 2 67  ? 86.679  134.392 116.086 1.00 45.75  ? 7   DG  J "C2'" 1 
ATOM   3881  C "C1'" . DG  B 2 67  ? 85.770  134.512 117.287 1.00 48.17  ? 7   DG  J "C1'" 1 
ATOM   3882  N N9    . DG  B 2 67  ? 86.069  135.659 118.131 1.00 49.22  ? 7   DG  J N9    1 
ATOM   3883  C C8    . DG  B 2 67  ? 87.279  136.013 118.680 1.00 50.09  ? 7   DG  J C8    1 
ATOM   3884  N N7    . DG  B 2 67  ? 87.213  137.098 119.403 1.00 52.35  ? 7   DG  J N7    1 
ATOM   3885  C C5    . DG  B 2 67  ? 85.879  137.477 119.324 1.00 52.34  ? 7   DG  J C5    1 
ATOM   3886  C C6    . DG  B 2 67  ? 85.199  138.569 119.914 1.00 53.63  ? 7   DG  J C6    1 
ATOM   3887  O O6    . DG  B 2 67  ? 85.651  139.430 120.664 1.00 60.33  ? 7   DG  J O6    1 
ATOM   3888  N N1    . DG  B 2 67  ? 83.855  138.589 119.560 1.00 50.58  ? 7   DG  J N1    1 
ATOM   3889  C C2    . DG  B 2 67  ? 83.238  137.663 118.750 1.00 53.60  ? 7   DG  J C2    1 
ATOM   3890  N N2    . DG  B 2 67  ? 81.923  137.842 118.514 1.00 51.38  ? 7   DG  J N2    1 
ATOM   3891  N N3    . DG  B 2 67  ? 83.863  136.630 118.207 1.00 47.24  ? 7   DG  J N3    1 
ATOM   3892  C C4    . DG  B 2 67  ? 85.168  136.604 118.533 1.00 48.10  ? 7   DG  J C4    1 
ATOM   3893  P P     . DA  B 2 68  ? 85.570  132.635 113.523 1.00 40.82  ? 8   DA  J P     1 
ATOM   3894  O OP1   . DA  B 2 68  ? 85.438  131.260 112.952 1.00 39.29  ? 8   DA  J OP1   1 
ATOM   3895  O OP2   . DA  B 2 68  ? 86.777  133.440 113.227 1.00 32.85  ? 8   DA  J OP2   1 
ATOM   3896  O "O5'" . DA  B 2 68  ? 84.255  133.455 113.188 1.00 36.80  ? 8   DA  J "O5'" 1 
ATOM   3897  C "C5'" . DA  B 2 68  ? 82.994  132.999 113.658 1.00 36.24  ? 8   DA  J "C5'" 1 
ATOM   3898  C "C4'" . DA  B 2 68  ? 81.930  134.012 113.317 1.00 39.73  ? 8   DA  J "C4'" 1 
ATOM   3899  O "O4'" . DA  B 2 68  ? 82.065  135.168 114.166 1.00 44.02  ? 8   DA  J "O4'" 1 
ATOM   3900  C "C3'" . DA  B 2 68  ? 82.020  134.537 111.892 1.00 38.85  ? 8   DA  J "C3'" 1 
ATOM   3901  O "O3'" . DA  B 2 68  ? 80.707  134.800 111.460 1.00 39.46  ? 8   DA  J "O3'" 1 
ATOM   3902  C "C2'" . DA  B 2 68  ? 82.829  135.812 112.035 1.00 40.84  ? 8   DA  J "C2'" 1 
ATOM   3903  C "C1'" . DA  B 2 68  ? 82.439  136.310 113.418 1.00 42.71  ? 8   DA  J "C1'" 1 
ATOM   3904  N N9    . DA  B 2 68  ? 83.521  136.959 114.158 1.00 46.66  ? 8   DA  J N9    1 
ATOM   3905  C C8    . DA  B 2 68  ? 84.821  136.545 114.271 1.00 47.58  ? 8   DA  J C8    1 
ATOM   3906  N N7    . DA  B 2 68  ? 85.559  137.321 115.030 1.00 48.47  ? 8   DA  J N7    1 
ATOM   3907  C C5    . DA  B 2 68  ? 84.686  138.314 115.441 1.00 47.73  ? 8   DA  J C5    1 
ATOM   3908  C C6    . DA  B 2 68  ? 84.855  139.434 116.268 1.00 49.34  ? 8   DA  J C6    1 
ATOM   3909  N N6    . DA  B 2 68  ? 86.001  139.734 116.874 1.00 48.65  ? 8   DA  J N6    1 
ATOM   3910  N N1    . DA  B 2 68  ? 83.792  140.239 116.462 1.00 50.59  ? 8   DA  J N1    1 
ATOM   3911  C C2    . DA  B 2 68  ? 82.625  139.917 115.875 1.00 51.62  ? 8   DA  J C2    1 
ATOM   3912  N N3    . DA  B 2 68  ? 82.338  138.880 115.089 1.00 51.07  ? 8   DA  J N3    1 
ATOM   3913  C C4    . DA  B 2 68  ? 83.427  138.109 114.906 1.00 49.04  ? 8   DA  J C4    1 
ATOM   3914  P P     . DA  B 2 69  ? 80.428  135.156 109.937 1.00 38.65  ? 9   DA  J P     1 
ATOM   3915  O OP1   . DA  B 2 69  ? 79.181  134.459 109.562 1.00 36.52  ? 9   DA  J OP1   1 
ATOM   3916  O OP2   . DA  B 2 69  ? 81.665  134.965 109.158 1.00 39.68  ? 9   DA  J OP2   1 
ATOM   3917  O "O5'" . DA  B 2 69  ? 80.126  136.711 109.990 1.00 42.46  ? 9   DA  J "O5'" 1 
ATOM   3918  C "C5'" . DA  B 2 69  ? 79.053  137.184 110.793 1.00 41.15  ? 9   DA  J "C5'" 1 
ATOM   3919  C "C4'" . DA  B 2 69  ? 79.055  138.687 110.814 1.00 44.03  ? 9   DA  J "C4'" 1 
ATOM   3920  O "O4'" . DA  B 2 69  ? 80.141  139.175 111.633 1.00 40.90  ? 9   DA  J "O4'" 1 
ATOM   3921  C "C3'" . DA  B 2 69  ? 79.234  139.309 109.431 1.00 43.84  ? 9   DA  J "C3'" 1 
ATOM   3922  O "O3'" . DA  B 2 69  ? 78.227  140.291 109.270 1.00 54.10  ? 9   DA  J "O3'" 1 
ATOM   3923  C "C2'" . DA  B 2 69  ? 80.628  139.914 109.474 1.00 42.56  ? 9   DA  J "C2'" 1 
ATOM   3924  C "C1'" . DA  B 2 69  ? 80.836  140.196 110.948 1.00 43.92  ? 9   DA  J "C1'" 1 
ATOM   3925  N N9    . DA  B 2 69  ? 82.224  140.159 111.404 1.00 47.69  ? 9   DA  J N9    1 
ATOM   3926  C C8    . DA  B 2 69  ? 83.210  139.271 111.035 1.00 51.08  ? 9   DA  J C8    1 
ATOM   3927  N N7    . DA  B 2 69  ? 84.357  139.476 111.630 1.00 48.80  ? 9   DA  J N7    1 
ATOM   3928  C C5    . DA  B 2 69  ? 84.118  140.578 112.441 1.00 48.86  ? 9   DA  J C5    1 
ATOM   3929  C C6    . DA  B 2 69  ? 84.939  141.293 113.318 1.00 48.76  ? 9   DA  J C6    1 
ATOM   3930  N N6    . DA  B 2 69  ? 86.226  140.999 113.532 1.00 45.86  ? 9   DA  J N6    1 
ATOM   3931  N N1    . DA  B 2 69  ? 84.395  142.344 113.975 1.00 50.13  ? 9   DA  J N1    1 
ATOM   3932  C C2    . DA  B 2 69  ? 83.117  142.651 113.742 1.00 50.45  ? 9   DA  J C2    1 
ATOM   3933  N N3    . DA  B 2 69  ? 82.243  142.062 112.930 1.00 51.11  ? 9   DA  J N3    1 
ATOM   3934  C C4    . DA  B 2 69  ? 82.811  141.014 112.306 1.00 50.00  ? 9   DA  J C4    1 
ATOM   3935  P P     . DC  B 2 70  ? 78.060  141.048 107.876 1.00 55.96  ? 10  DC  J P     1 
ATOM   3936  O OP1   . DC  B 2 70  ? 76.635  141.451 107.827 1.00 57.70  ? 10  DC  J OP1   1 
ATOM   3937  O OP2   . DC  B 2 70  ? 78.619  140.213 106.786 1.00 56.24  ? 10  DC  J OP2   1 
ATOM   3938  O "O5'" . DC  B 2 70  ? 78.963  142.337 108.105 1.00 55.90  ? 10  DC  J "O5'" 1 
ATOM   3939  C "C5'" . DC  B 2 70  ? 78.755  143.144 109.260 1.00 58.82  ? 10  DC  J "C5'" 1 
ATOM   3940  C "C4'" . DC  B 2 70  ? 79.725  144.300 109.285 1.00 62.91  ? 10  DC  J "C4'" 1 
ATOM   3941  O "O4'" . DC  B 2 70  ? 80.958  143.966 109.968 1.00 63.76  ? 10  DC  J "O4'" 1 
ATOM   3942  C "C3'" . DC  B 2 70  ? 80.124  144.831 107.910 1.00 67.91  ? 10  DC  J "C3'" 1 
ATOM   3943  O "O3'" . DC  B 2 70  ? 80.082  146.253 107.907 1.00 77.29  ? 10  DC  J "O3'" 1 
ATOM   3944  C "C2'" . DC  B 2 70  ? 81.570  144.396 107.774 1.00 66.02  ? 10  DC  J "C2'" 1 
ATOM   3945  C "C1'" . DC  B 2 70  ? 82.037  144.486 109.209 1.00 63.16  ? 10  DC  J "C1'" 1 
ATOM   3946  N N1    . DC  B 2 70  ? 83.251  143.711 109.516 1.00 63.14  ? 10  DC  J N1    1 
ATOM   3947  C C2    . DC  B 2 70  ? 84.166  144.231 110.440 1.00 61.85  ? 10  DC  J C2    1 
ATOM   3948  O O2    . DC  B 2 70  ? 83.902  145.292 111.009 1.00 66.22  ? 10  DC  J O2    1 
ATOM   3949  N N3    . DC  B 2 70  ? 85.310  143.562 110.693 1.00 61.11  ? 10  DC  J N3    1 
ATOM   3950  C C4    . DC  B 2 70  ? 85.554  142.408 110.072 1.00 58.21  ? 10  DC  J C4    1 
ATOM   3951  N N4    . DC  B 2 70  ? 86.702  141.789 110.344 1.00 55.72  ? 10  DC  J N4    1 
ATOM   3952  C C5    . DC  B 2 70  ? 84.631  141.839 109.144 1.00 59.15  ? 10  DC  J C5    1 
ATOM   3953  C C6    . DC  B 2 70  ? 83.499  142.514 108.901 1.00 58.74  ? 10  DC  J C6    1 
ATOM   3954  P P     . DA  B 2 71  ? 79.781  147.029 106.541 1.00 81.35  ? 11  DA  J P     1 
ATOM   3955  O OP1   . DA  B 2 71  ? 78.316  146.966 106.313 1.00 81.48  ? 11  DA  J OP1   1 
ATOM   3956  O OP2   . DA  B 2 71  ? 80.709  146.518 105.498 1.00 81.69  ? 11  DA  J OP2   1 
ATOM   3957  O "O5'" . DA  B 2 71  ? 80.191  148.524 106.884 1.00 87.06  ? 11  DA  J "O5'" 1 
ATOM   3958  C "C5'" . DA  B 2 71  ? 80.065  149.021 108.211 1.00 96.93  ? 11  DA  J "C5'" 1 
ATOM   3959  C "C4'" . DA  B 2 71  ? 81.359  149.668 108.642 1.00 103.66 ? 11  DA  J "C4'" 1 
ATOM   3960  O "O4'" . DA  B 2 71  ? 82.369  148.647 108.838 1.00 106.26 ? 11  DA  J "O4'" 1 
ATOM   3961  C "C3'" . DA  B 2 71  ? 81.928  150.631 107.599 1.00 107.56 ? 11  DA  J "C3'" 1 
ATOM   3962  O "O3'" . DA  B 2 71  ? 82.487  151.784 108.232 1.00 111.98 ? 11  DA  J "O3'" 1 
ATOM   3963  C "C2'" . DA  B 2 71  ? 83.011  149.817 106.916 1.00 107.67 ? 11  DA  J "C2'" 1 
ATOM   3964  C "C1'" . DA  B 2 71  ? 83.509  148.935 108.044 1.00 107.91 ? 11  DA  J "C1'" 1 
ATOM   3965  N N9    . DA  B 2 71  ? 84.082  147.667 107.594 1.00 109.47 ? 11  DA  J N9    1 
ATOM   3966  C C8    . DA  B 2 71  ? 83.537  146.753 106.727 1.00 109.80 ? 11  DA  J C8    1 
ATOM   3967  N N7    . DA  B 2 71  ? 84.306  145.717 106.496 1.00 109.71 ? 11  DA  J N7    1 
ATOM   3968  C C5    . DA  B 2 71  ? 85.432  145.961 107.269 1.00 110.17 ? 11  DA  J C5    1 
ATOM   3969  C C6    . DA  B 2 71  ? 86.622  145.235 107.461 1.00 110.72 ? 11  DA  J C6    1 
ATOM   3970  N N6    . DA  B 2 71  ? 86.883  144.068 106.871 1.00 110.60 ? 11  DA  J N6    1 
ATOM   3971  N N1    . DA  B 2 71  ? 87.547  145.759 108.295 1.00 111.77 ? 11  DA  J N1    1 
ATOM   3972  C C2    . DA  B 2 71  ? 87.283  146.929 108.891 1.00 112.34 ? 11  DA  J C2    1 
ATOM   3973  N N3    . DA  B 2 71  ? 86.201  147.702 108.793 1.00 110.94 ? 11  DA  J N3    1 
ATOM   3974  C C4    . DA  B 2 71  ? 85.305  147.155 107.955 1.00 110.22 ? 11  DA  J C4    1 
ATOM   3975  P P     . DT  B 2 72  ? 83.068  152.974 107.328 1.00 114.08 ? 12  DT  J P     1 
ATOM   3976  O OP1   . DT  B 2 72  ? 82.780  154.247 108.033 1.00 114.50 ? 12  DT  J OP1   1 
ATOM   3977  O OP2   . DT  B 2 72  ? 82.579  152.776 105.942 1.00 113.97 ? 12  DT  J OP2   1 
ATOM   3978  O "O5'" . DT  B 2 72  ? 84.642  152.724 107.355 1.00 117.01 ? 12  DT  J "O5'" 1 
ATOM   3979  C "C5'" . DT  B 2 72  ? 85.403  153.022 108.523 1.00 122.45 ? 12  DT  J "C5'" 1 
ATOM   3980  C "C4'" . DT  B 2 72  ? 86.876  153.080 108.191 1.00 126.41 ? 12  DT  J "C4'" 1 
ATOM   3981  O "O4'" . DT  B 2 72  ? 87.421  151.744 108.062 1.00 127.31 ? 12  DT  J "O4'" 1 
ATOM   3982  C "C3'" . DT  B 2 72  ? 87.198  153.801 106.881 1.00 128.85 ? 12  DT  J "C3'" 1 
ATOM   3983  O "O3'" . DT  B 2 72  ? 88.368  154.606 107.032 1.00 131.55 ? 12  DT  J "O3'" 1 
ATOM   3984  C "C2'" . DT  B 2 72  ? 87.478  152.663 105.919 1.00 128.80 ? 12  DT  J "C2'" 1 
ATOM   3985  C "C1'" . DT  B 2 72  ? 88.121  151.640 106.834 1.00 128.59 ? 12  DT  J "C1'" 1 
ATOM   3986  N N1    . DT  B 2 72  ? 88.031  150.245 106.366 1.00 129.54 ? 12  DT  J N1    1 
ATOM   3987  C C2    . DT  B 2 72  ? 89.104  149.415 106.598 1.00 129.94 ? 12  DT  J C2    1 
ATOM   3988  O O2    . DT  B 2 72  ? 90.114  149.778 107.179 1.00 129.93 ? 12  DT  J O2    1 
ATOM   3989  N N3    . DT  B 2 72  ? 88.955  148.138 106.118 1.00 130.27 ? 12  DT  J N3    1 
ATOM   3990  C C4    . DT  B 2 72  ? 87.865  147.621 105.449 1.00 130.73 ? 12  DT  J C4    1 
ATOM   3991  O O4    . DT  B 2 72  ? 87.878  146.453 105.071 1.00 130.97 ? 12  DT  J O4    1 
ATOM   3992  C C5    . DT  B 2 72  ? 86.772  148.544 105.246 1.00 130.91 ? 12  DT  J C5    1 
ATOM   3993  C C7    . DT  B 2 72  ? 85.547  148.072 104.528 1.00 131.35 ? 12  DT  J C7    1 
ATOM   3994  C C6    . DT  B 2 72  ? 86.907  149.792 105.712 1.00 130.61 ? 12  DT  J C6    1 
ATOM   3995  P P     . DG  B 2 73  ? 88.870  155.515 105.807 1.00 133.28 ? 13  DG  J P     1 
ATOM   3996  O OP1   . DG  B 2 73  ? 89.125  156.876 106.342 1.00 134.11 ? 13  DG  J OP1   1 
ATOM   3997  O OP2   . DG  B 2 73  ? 87.934  155.336 104.667 1.00 132.78 ? 13  DG  J OP2   1 
ATOM   3998  O "O5'" . DG  B 2 73  ? 90.268  154.863 105.414 1.00 134.26 ? 13  DG  J "O5'" 1 
ATOM   3999  C "C5'" . DG  B 2 73  ? 91.311  154.745 106.377 1.00 136.43 ? 13  DG  J "C5'" 1 
ATOM   4000  C "C4'" . DG  B 2 73  ? 92.465  153.959 105.800 1.00 137.84 ? 13  DG  J "C4'" 1 
ATOM   4001  O "O4'" . DG  B 2 73  ? 92.074  152.573 105.631 1.00 138.84 ? 13  DG  J "O4'" 1 
ATOM   4002  C "C3'" . DG  B 2 73  ? 92.927  154.441 104.424 1.00 137.98 ? 13  DG  J "C3'" 1 
ATOM   4003  O "O3'" . DG  B 2 73  ? 94.351  154.351 104.331 1.00 136.06 ? 13  DG  J "O3'" 1 
ATOM   4004  C "C2'" . DG  B 2 73  ? 92.273  153.459 103.472 1.00 139.07 ? 13  DG  J "C2'" 1 
ATOM   4005  C "C1'" . DG  B 2 73  ? 92.279  152.177 104.283 1.00 140.07 ? 13  DG  J "C1'" 1 
ATOM   4006  N N9    . DG  B 2 73  ? 91.223  151.237 103.918 1.00 141.61 ? 13  DG  J N9    1 
ATOM   4007  C C8    . DG  B 2 73  ? 89.869  151.471 103.912 1.00 142.08 ? 13  DG  J C8    1 
ATOM   4008  N N7    . DG  B 2 73  ? 89.171  150.440 103.517 1.00 142.16 ? 13  DG  J N7    1 
ATOM   4009  C C5    . DG  B 2 73  ? 90.122  149.465 103.250 1.00 142.60 ? 13  DG  J C5    1 
ATOM   4010  C C6    . DG  B 2 73  ? 89.966  148.134 102.784 1.00 142.85 ? 13  DG  J C6    1 
ATOM   4011  O O6    . DG  B 2 73  ? 88.923  147.531 102.503 1.00 142.38 ? 13  DG  J O6    1 
ATOM   4012  N N1    . DG  B 2 73  ? 91.196  147.492 102.650 1.00 143.32 ? 13  DG  J N1    1 
ATOM   4013  C C2    . DG  B 2 73  ? 92.416  148.059 102.926 1.00 143.23 ? 13  DG  J C2    1 
ATOM   4014  N N2    . DG  B 2 73  ? 93.489  147.276 102.734 1.00 143.08 ? 13  DG  J N2    1 
ATOM   4015  N N3    . DG  B 2 73  ? 92.575  149.298 103.359 1.00 142.95 ? 13  DG  J N3    1 
ATOM   4016  C C4    . DG  B 2 73  ? 91.394  149.939 103.496 1.00 142.51 ? 13  DG  J C4    1 
ATOM   4017  P P     . DC  B 2 74  ? 95.105  154.930 103.035 1.00 134.26 ? 14  DC  J P     1 
ATOM   4018  O OP1   . DC  B 2 74  ? 95.723  156.225 103.415 1.00 135.02 ? 14  DC  J OP1   1 
ATOM   4019  O OP2   . DC  B 2 74  ? 94.192  154.868 101.866 1.00 134.46 ? 14  DC  J OP2   1 
ATOM   4020  O "O5'" . DC  B 2 74  ? 96.277  153.876 102.815 1.00 133.39 ? 14  DC  J "O5'" 1 
ATOM   4021  C "C5'" . DC  B 2 74  ? 96.649  152.998 103.872 1.00 129.93 ? 14  DC  J "C5'" 1 
ATOM   4022  C "C4'" . DC  B 2 74  ? 97.334  151.768 103.328 1.00 127.27 ? 14  DC  J "C4'" 1 
ATOM   4023  O "O4'" . DC  B 2 74  ? 96.428  151.014 102.484 1.00 127.93 ? 14  DC  J "O4'" 1 
ATOM   4024  C "C3'" . DC  B 2 74  ? 98.579  152.031 102.482 1.00 124.65 ? 14  DC  J "C3'" 1 
ATOM   4025  O "O3'" . DC  B 2 74  ? 99.545  151.029 102.784 1.00 120.13 ? 14  DC  J "O3'" 1 
ATOM   4026  C "C2'" . DC  B 2 74  ? 98.086  151.824 101.062 1.00 126.10 ? 14  DC  J "C2'" 1 
ATOM   4027  C "C1'" . DC  B 2 74  ? 97.089  150.702 101.269 1.00 128.12 ? 14  DC  J "C1'" 1 
ATOM   4028  N N1    . DC  B 2 74  ? 96.077  150.548 100.211 1.00 129.57 ? 14  DC  J N1    1 
ATOM   4029  C C2    . DC  B 2 74  ? 95.786  149.257 99.750  1.00 130.19 ? 14  DC  J C2    1 
ATOM   4030  O O2    . DC  B 2 74  ? 96.368  148.290 100.267 1.00 130.13 ? 14  DC  J O2    1 
ATOM   4031  N N3    . DC  B 2 74  ? 94.879  149.096 98.761  1.00 130.28 ? 14  DC  J N3    1 
ATOM   4032  C C4    . DC  B 2 74  ? 94.264  150.159 98.242  1.00 131.10 ? 14  DC  J C4    1 
ATOM   4033  N N4    . DC  B 2 74  ? 93.379  149.954 97.265  1.00 131.99 ? 14  DC  J N4    1 
ATOM   4034  C C5    . DC  B 2 74  ? 94.530  151.484 98.703  1.00 130.94 ? 14  DC  J C5    1 
ATOM   4035  C C6    . DC  B 2 74  ? 95.436  151.630 99.680  1.00 130.06 ? 14  DC  J C6    1 
ATOM   4036  P P     . DC  B 2 75  ? 101.106 151.348 102.618 1.00 117.11 ? 15  DC  J P     1 
ATOM   4037  O OP1   . DC  B 2 75  ? 101.554 152.079 103.829 1.00 117.52 ? 15  DC  J OP1   1 
ATOM   4038  O OP2   . DC  B 2 75  ? 101.327 151.942 101.275 1.00 117.23 ? 15  DC  J OP2   1 
ATOM   4039  O "O5'" . DC  B 2 75  ? 101.765 149.902 102.638 1.00 114.24 ? 15  DC  J "O5'" 1 
ATOM   4040  C "C5'" . DC  B 2 75  ? 101.172 148.847 103.392 1.00 108.31 ? 15  DC  J "C5'" 1 
ATOM   4041  C "C4'" . DC  B 2 75  ? 101.071 147.597 102.551 1.00 103.95 ? 15  DC  J "C4'" 1 
ATOM   4042  O "O4'" . DC  B 2 75  ? 100.009 147.719 101.570 1.00 102.78 ? 15  DC  J "O4'" 1 
ATOM   4043  C "C3'" . DC  B 2 75  ? 102.338 147.266 101.762 1.00 101.59 ? 15  DC  J "C3'" 1 
ATOM   4044  O "O3'" . DC  B 2 75  ? 102.574 145.863 101.780 1.00 96.03  ? 15  DC  J "O3'" 1 
ATOM   4045  C "C2'" . DC  B 2 75  ? 101.989 147.682 100.346 1.00 102.14 ? 15  DC  J "C2'" 1 
ATOM   4046  C "C1'" . DC  B 2 75  ? 100.515 147.338 100.302 1.00 103.14 ? 15  DC  J "C1'" 1 
ATOM   4047  N N1    . DC  B 2 75  ? 99.745  148.034 99.262  1.00 104.15 ? 15  DC  J N1    1 
ATOM   4048  C C2    . DC  B 2 75  ? 98.604  147.413 98.751  1.00 105.08 ? 15  DC  J C2    1 
ATOM   4049  O O2    . DC  B 2 75  ? 98.273  146.309 99.201  1.00 105.25 ? 15  DC  J O2    1 
ATOM   4050  N N3    . DC  B 2 75  ? 97.892  148.032 97.782  1.00 106.25 ? 15  DC  J N3    1 
ATOM   4051  C C4    . DC  B 2 75  ? 98.283  149.224 97.326  1.00 106.75 ? 15  DC  J C4    1 
ATOM   4052  N N4    . DC  B 2 75  ? 97.552  149.797 96.366  1.00 106.44 ? 15  DC  J N4    1 
ATOM   4053  C C5    . DC  B 2 75  ? 99.439  149.882 97.833  1.00 106.54 ? 15  DC  J C5    1 
ATOM   4054  C C6    . DC  B 2 75  ? 100.133 149.258 98.794  1.00 105.55 ? 15  DC  J C6    1 
ATOM   4055  P P     . DT  B 2 76  ? 104.002 145.295 101.332 1.00 92.50  ? 16  DT  J P     1 
ATOM   4056  O OP1   . DT  B 2 76  ? 104.902 145.297 102.513 1.00 93.38  ? 16  DT  J OP1   1 
ATOM   4057  O OP2   . DT  B 2 76  ? 104.407 146.007 100.094 1.00 92.72  ? 16  DT  J OP2   1 
ATOM   4058  O "O5'" . DT  B 2 76  ? 103.682 143.789 100.949 1.00 90.37  ? 16  DT  J "O5'" 1 
ATOM   4059  C "C5'" . DT  B 2 76  ? 102.601 143.110 101.572 1.00 83.07  ? 16  DT  J "C5'" 1 
ATOM   4060  C "C4'" . DT  B 2 76  ? 101.818 142.330 100.546 1.00 76.16  ? 16  DT  J "C4'" 1 
ATOM   4061  O "O4'" . DT  B 2 76  ? 101.141 143.233 99.636  1.00 74.68  ? 16  DT  J "O4'" 1 
ATOM   4062  C "C3'" . DT  B 2 76  ? 102.665 141.408 99.675  1.00 72.74  ? 16  DT  J "C3'" 1 
ATOM   4063  O "O3'" . DT  B 2 76  ? 101.959 140.188 99.475  1.00 68.28  ? 16  DT  J "O3'" 1 
ATOM   4064  C "C2'" . DT  B 2 76  ? 102.780 142.166 98.365  1.00 72.67  ? 16  DT  J "C2'" 1 
ATOM   4065  C "C1'" . DT  B 2 76  ? 101.449 142.883 98.299  1.00 73.69  ? 16  DT  J "C1'" 1 
ATOM   4066  N N1    . DT  B 2 76  ? 101.464 144.118 97.498  1.00 74.92  ? 16  DT  J N1    1 
ATOM   4067  C C2    . DT  B 2 76  ? 100.398 144.365 96.659  1.00 76.33  ? 16  DT  J C2    1 
ATOM   4068  O O2    . DT  B 2 76  ? 99.441  143.614 96.547  1.00 77.95  ? 16  DT  J O2    1 
ATOM   4069  N N3    . DT  B 2 76  ? 100.493 145.536 95.947  1.00 76.39  ? 16  DT  J N3    1 
ATOM   4070  C C4    . DT  B 2 76  ? 101.521 146.458 95.991  1.00 76.48  ? 16  DT  J C4    1 
ATOM   4071  O O4    . DT  B 2 76  ? 101.468 147.467 95.293  1.00 78.11  ? 16  DT  J O4    1 
ATOM   4072  C C5    . DT  B 2 76  ? 102.604 146.132 96.890  1.00 74.41  ? 16  DT  J C5    1 
ATOM   4073  C C7    . DT  B 2 76  ? 103.763 147.069 97.000  1.00 73.45  ? 16  DT  J C7    1 
ATOM   4074  C C6    . DT  B 2 76  ? 102.522 144.994 97.590  1.00 74.43  ? 16  DT  J C6    1 
ATOM   4075  P P     . DT  B 2 77  ? 102.595 139.039 98.561  1.00 62.22  ? 17  DT  J P     1 
ATOM   4076  O OP1   . DT  B 2 77  ? 102.426 137.798 99.347  1.00 66.86  ? 17  DT  J OP1   1 
ATOM   4077  O OP2   . DT  B 2 77  ? 103.949 139.435 98.106  1.00 63.57  ? 17  DT  J OP2   1 
ATOM   4078  O "O5'" . DT  B 2 77  ? 101.614 139.003 97.312  1.00 58.57  ? 17  DT  J "O5'" 1 
ATOM   4079  C "C5'" . DT  B 2 77  ? 100.212 138.956 97.524  1.00 54.65  ? 17  DT  J "C5'" 1 
ATOM   4080  C "C4'" . DT  B 2 77  ? 99.459  139.006 96.216  1.00 53.41  ? 17  DT  J "C4'" 1 
ATOM   4081  O "O4'" . DT  B 2 77  ? 99.533  140.327 95.626  1.00 56.23  ? 17  DT  J "O4'" 1 
ATOM   4082  C "C3'" . DT  B 2 77  ? 99.879  138.016 95.130  1.00 50.29  ? 17  DT  J "C3'" 1 
ATOM   4083  O "O3'" . DT  B 2 77  ? 98.695  137.427 94.593  1.00 41.26  ? 17  DT  J "O3'" 1 
ATOM   4084  C "C2'" . DT  B 2 77  ? 100.593 138.888 94.107  1.00 53.95  ? 17  DT  J "C2'" 1 
ATOM   4085  C "C1'" . DT  B 2 77  ? 99.893  140.235 94.256  1.00 57.83  ? 17  DT  J "C1'" 1 
ATOM   4086  N N1    . DT  B 2 77  ? 100.719 141.424 93.936  1.00 63.61  ? 17  DT  J N1    1 
ATOM   4087  C C2    . DT  B 2 77  ? 100.205 142.380 93.081  1.00 66.47  ? 17  DT  J C2    1 
ATOM   4088  O O2    . DT  B 2 77  ? 99.112  142.285 92.538  1.00 67.37  ? 17  DT  J O2    1 
ATOM   4089  N N3    . DT  B 2 77  ? 101.023 143.461 92.880  1.00 69.38  ? 17  DT  J N3    1 
ATOM   4090  C C4    . DT  B 2 77  ? 102.271 143.682 93.433  1.00 68.26  ? 17  DT  J C4    1 
ATOM   4091  O O4    . DT  B 2 77  ? 102.878 144.711 93.177  1.00 69.25  ? 17  DT  J O4    1 
ATOM   4092  C C5    . DT  B 2 77  ? 102.756 142.639 94.297  1.00 67.26  ? 17  DT  J C5    1 
ATOM   4093  C C7    . DT  B 2 77  ? 104.103 142.791 94.927  1.00 67.10  ? 17  DT  J C7    1 
ATOM   4094  C C6    . DT  B 2 77  ? 101.969 141.574 94.502  1.00 65.87  ? 17  DT  J C6    1 
ATOM   4095  P P     . DT  B 2 78  ? 98.780  136.431 93.340  1.00 46.72  ? 18  DT  J P     1 
ATOM   4096  O OP1   . DT  B 2 78  ? 97.646  135.483 93.470  1.00 46.61  ? 18  DT  J OP1   1 
ATOM   4097  O OP2   . DT  B 2 78  ? 100.163 135.905 93.167  1.00 42.35  ? 18  DT  J OP2   1 
ATOM   4098  O "O5'" . DT  B 2 78  ? 98.408  137.374 92.115  1.00 53.86  ? 18  DT  J "O5'" 1 
ATOM   4099  C "C5'" . DT  B 2 78  ? 97.136  138.012 92.059  1.00 55.19  ? 18  DT  J "C5'" 1 
ATOM   4100  C "C4'" . DT  B 2 78  ? 96.955  138.701 90.728  1.00 63.06  ? 18  DT  J "C4'" 1 
ATOM   4101  O "O4'" . DT  B 2 78  ? 97.823  139.859 90.651  1.00 62.75  ? 18  DT  J "O4'" 1 
ATOM   4102  C "C3'" . DT  B 2 78  ? 97.287  137.838 89.512  1.00 64.89  ? 18  DT  J "C3'" 1 
ATOM   4103  O "O3'" . DT  B 2 78  ? 96.333  138.089 88.481  1.00 70.02  ? 18  DT  J "O3'" 1 
ATOM   4104  C "C2'" . DT  B 2 78  ? 98.673  138.316 89.108  1.00 66.29  ? 18  DT  J "C2'" 1 
ATOM   4105  C "C1'" . DT  B 2 78  ? 98.632  139.784 89.488  1.00 65.01  ? 18  DT  J "C1'" 1 
ATOM   4106  N N1    . DT  B 2 78  ? 99.937  140.413 89.797  1.00 65.75  ? 18  DT  J N1    1 
ATOM   4107  C C2    . DT  B 2 78  ? 100.147 141.705 89.354  1.00 67.72  ? 18  DT  J C2    1 
ATOM   4108  O O2    . DT  B 2 78  ? 99.333  142.324 88.688  1.00 66.97  ? 18  DT  J O2    1 
ATOM   4109  N N3    . DT  B 2 78  ? 101.356 142.245 89.713  1.00 66.10  ? 18  DT  J N3    1 
ATOM   4110  C C4    . DT  B 2 78  ? 102.356 141.638 90.441  1.00 67.03  ? 18  DT  J C4    1 
ATOM   4111  O O4    . DT  B 2 78  ? 103.383 142.257 90.706  1.00 65.02  ? 18  DT  J O4    1 
ATOM   4112  C C5    . DT  B 2 78  ? 102.085 140.279 90.845  1.00 65.31  ? 18  DT  J C5    1 
ATOM   4113  C C7    . DT  B 2 78  ? 103.131 139.533 91.612  1.00 65.07  ? 18  DT  J C7    1 
ATOM   4114  C C6    . DT  B 2 78  ? 100.902 139.741 90.511  1.00 65.29  ? 18  DT  J C6    1 
ATOM   4115  P P     . DT  B 2 79  ? 96.405  137.267 87.103  1.00 75.56  ? 19  DT  J P     1 
ATOM   4116  O OP1   . DT  B 2 79  ? 95.017  136.922 86.716  1.00 75.28  ? 19  DT  J OP1   1 
ATOM   4117  O OP2   . DT  B 2 79  ? 97.423  136.196 87.222  1.00 77.91  ? 19  DT  J OP2   1 
ATOM   4118  O "O5'" . DT  B 2 79  ? 96.953  138.350 86.077  1.00 81.84  ? 19  DT  J "O5'" 1 
ATOM   4119  C "C5'" . DT  B 2 79  ? 96.282  139.597 85.926  1.00 87.84  ? 19  DT  J "C5'" 1 
ATOM   4120  C "C4'" . DT  B 2 79  ? 97.054  140.495 84.993  1.00 92.09  ? 19  DT  J "C4'" 1 
ATOM   4121  O "O4'" . DT  B 2 79  ? 98.215  141.039 85.669  1.00 92.30  ? 19  DT  J "O4'" 1 
ATOM   4122  C "C3'" . DT  B 2 79  ? 97.576  139.782 83.747  1.00 95.83  ? 19  DT  J "C3'" 1 
ATOM   4123  O "O3'" . DT  B 2 79  ? 97.406  140.612 82.600  1.00 103.19 ? 19  DT  J "O3'" 1 
ATOM   4124  C "C2'" . DT  B 2 79  ? 99.051  139.586 84.045  1.00 94.79  ? 19  DT  J "C2'" 1 
ATOM   4125  C "C1'" . DT  B 2 79  ? 99.370  140.806 84.884  1.00 93.10  ? 19  DT  J "C1'" 1 
ATOM   4126  N N1    . DT  B 2 79  ? 100.522 140.659 85.794  1.00 94.26  ? 19  DT  J N1    1 
ATOM   4127  C C2    . DT  B 2 79  ? 101.283 141.777 86.053  1.00 95.54  ? 19  DT  J C2    1 
ATOM   4128  O O2    . DT  B 2 79  ? 101.025 142.879 85.595  1.00 97.86  ? 19  DT  J O2    1 
ATOM   4129  N N3    . DT  B 2 79  ? 102.362 141.560 86.874  1.00 94.29  ? 19  DT  J N3    1 
ATOM   4130  C C4    . DT  B 2 79  ? 102.741 140.369 87.454  1.00 93.96  ? 19  DT  J C4    1 
ATOM   4131  O O4    . DT  B 2 79  ? 103.742 140.328 88.157  1.00 94.21  ? 19  DT  J O4    1 
ATOM   4132  C C5    . DT  B 2 79  ? 101.888 139.243 87.162  1.00 94.04  ? 19  DT  J C5    1 
ATOM   4133  C C7    . DT  B 2 79  ? 102.214 137.915 87.767  1.00 93.66  ? 19  DT  J C7    1 
ATOM   4134  C C6    . DT  B 2 79  ? 100.835 139.440 86.356  1.00 94.19  ? 19  DT  J C6    1 
ATOM   4135  P P     . DG  B 2 80  ? 97.269  139.941 81.148  1.00 108.62 ? 20  DG  J P     1 
ATOM   4136  O OP1   . DG  B 2 80  ? 95.960  140.376 80.591  1.00 107.70 ? 20  DG  J OP1   1 
ATOM   4137  O OP2   . DG  B 2 80  ? 97.575  138.491 81.261  1.00 107.55 ? 20  DG  J OP2   1 
ATOM   4138  O "O5'" . DG  B 2 80  ? 98.436  140.640 80.321  1.00 110.32 ? 20  DG  J "O5'" 1 
ATOM   4139  C "C5'" . DG  B 2 80  ? 98.545  142.062 80.287  1.00 114.37 ? 20  DG  J "C5'" 1 
ATOM   4140  C "C4'" . DG  B 2 80  ? 99.967  142.474 79.988  1.00 117.45 ? 20  DG  J "C4'" 1 
ATOM   4141  O "O4'" . DG  B 2 80  ? 100.818 142.252 81.142  1.00 118.00 ? 20  DG  J "O4'" 1 
ATOM   4142  C "C3'" . DG  B 2 80  ? 100.621 141.721 78.827  1.00 119.51 ? 20  DG  J "C3'" 1 
ATOM   4143  O "O3'" . DG  B 2 80  ? 101.397 142.625 78.037  1.00 121.95 ? 20  DG  J "O3'" 1 
ATOM   4144  C "C2'" . DG  B 2 80  ? 101.535 140.732 79.528  1.00 118.89 ? 20  DG  J "C2'" 1 
ATOM   4145  C "C1'" . DG  B 2 80  ? 101.972 141.537 80.733  1.00 119.07 ? 20  DG  J "C1'" 1 
ATOM   4146  N N9    . DG  B 2 80  ? 102.449 140.741 81.862  1.00 119.67 ? 20  DG  J N9    1 
ATOM   4147  C C8    . DG  B 2 80  ? 101.852 139.636 82.419  1.00 119.63 ? 20  DG  J C8    1 
ATOM   4148  N N7    . DG  B 2 80  ? 102.536 139.127 83.408  1.00 119.35 ? 20  DG  J N7    1 
ATOM   4149  C C5    . DG  B 2 80  ? 103.650 139.951 83.513  1.00 119.73 ? 20  DG  J C5    1 
ATOM   4150  C C6    . DG  B 2 80  ? 104.755 139.897 84.405  1.00 120.13 ? 20  DG  J C6    1 
ATOM   4151  O O6    . DG  B 2 80  ? 104.977 139.083 85.312  1.00 120.32 ? 20  DG  J O6    1 
ATOM   4152  N N1    . DG  B 2 80  ? 105.659 140.927 84.160  1.00 120.21 ? 20  DG  J N1    1 
ATOM   4153  C C2    . DG  B 2 80  ? 105.523 141.881 83.184  1.00 119.98 ? 20  DG  J C2    1 
ATOM   4154  N N2    . DG  B 2 80  ? 106.505 142.788 83.101  1.00 119.77 ? 20  DG  J N2    1 
ATOM   4155  N N3    . DG  B 2 80  ? 104.499 141.944 82.349  1.00 119.71 ? 20  DG  J N3    1 
ATOM   4156  C C4    . DG  B 2 80  ? 103.608 140.954 82.568  1.00 119.64 ? 20  DG  J C4    1 
ATOM   4157  P P     . DA  B 2 81  ? 102.188 142.081 76.748  1.00 123.47 ? 21  DA  J P     1 
ATOM   4158  O OP1   . DA  B 2 81  ? 101.735 142.878 75.582  1.00 124.10 ? 21  DA  J OP1   1 
ATOM   4159  O OP2   . DA  B 2 81  ? 102.089 140.600 76.706  1.00 123.82 ? 21  DA  J OP2   1 
ATOM   4160  O "O5'" . DA  B 2 81  ? 103.700 142.463 77.058  1.00 123.89 ? 21  DA  J "O5'" 1 
ATOM   4161  C "C5'" . DA  B 2 81  ? 104.077 143.816 77.290  1.00 125.35 ? 21  DA  J "C5'" 1 
ATOM   4162  C "C4'" . DA  B 2 81  ? 105.574 143.909 77.458  1.00 126.75 ? 21  DA  J "C4'" 1 
ATOM   4163  O "O4'" . DA  B 2 81  ? 105.949 143.271 78.702  1.00 127.59 ? 21  DA  J "O4'" 1 
ATOM   4164  C "C3'" . DA  B 2 81  ? 106.357 143.191 76.359  1.00 126.85 ? 21  DA  J "C3'" 1 
ATOM   4165  O "O3'" . DA  B 2 81  ? 107.541 143.916 76.023  1.00 126.08 ? 21  DA  J "O3'" 1 
ATOM   4166  C "C2'" . DA  B 2 81  ? 106.708 141.857 76.991  1.00 127.50 ? 21  DA  J "C2'" 1 
ATOM   4167  C "C1'" . DA  B 2 81  ? 106.869 142.217 78.456  1.00 128.05 ? 21  DA  J "C1'" 1 
ATOM   4168  N N9    . DA  B 2 81  ? 106.555 141.118 79.369  1.00 128.62 ? 21  DA  J N9    1 
ATOM   4169  C C8    . DA  B 2 81  ? 105.398 140.380 79.436  1.00 128.86 ? 21  DA  J C8    1 
ATOM   4170  N N7    . DA  B 2 81  ? 105.421 139.440 80.350  1.00 129.01 ? 21  DA  J N7    1 
ATOM   4171  C C5    . DA  B 2 81  ? 106.677 139.571 80.929  1.00 128.90 ? 21  DA  J C5    1 
ATOM   4172  C C6    . DA  B 2 81  ? 107.322 138.866 81.961  1.00 128.82 ? 21  DA  J C6    1 
ATOM   4173  N N6    . DA  B 2 81  ? 106.767 137.845 82.620  1.00 128.53 ? 21  DA  J N6    1 
ATOM   4174  N N1    . DA  B 2 81  ? 108.572 139.251 82.298  1.00 128.82 ? 21  DA  J N1    1 
ATOM   4175  C C2    . DA  B 2 81  ? 109.127 140.274 81.636  1.00 128.95 ? 21  DA  J C2    1 
ATOM   4176  N N3    . DA  B 2 81  ? 108.625 141.013 80.649  1.00 128.64 ? 21  DA  J N3    1 
ATOM   4177  C C4    . DA  B 2 81  ? 107.382 140.606 80.339  1.00 128.77 ? 21  DA  J C4    1 
ATOM   4178  P P     . DT  B 2 82  ? 108.507 143.361 74.866  1.00 125.14 ? 22  DT  J P     1 
ATOM   4179  O OP1   . DT  B 2 82  ? 108.945 144.527 74.060  1.00 125.60 ? 22  DT  J OP1   1 
ATOM   4180  O OP2   . DT  B 2 82  ? 107.830 142.219 74.197  1.00 125.17 ? 22  DT  J OP2   1 
ATOM   4181  O "O5'" . DT  B 2 82  ? 109.769 142.808 75.665  1.00 123.53 ? 22  DT  J "O5'" 1 
ATOM   4182  C "C5'" . DT  B 2 82  ? 110.521 143.671 76.513  1.00 121.62 ? 22  DT  J "C5'" 1 
ATOM   4183  C "C4'" . DT  B 2 82  ? 111.687 142.929 77.126  1.00 120.57 ? 22  DT  J "C4'" 1 
ATOM   4184  O "O4'" . DT  B 2 82  ? 111.220 141.986 78.122  1.00 120.52 ? 22  DT  J "O4'" 1 
ATOM   4185  C "C3'" . DT  B 2 82  ? 112.546 142.125 76.147  1.00 119.89 ? 22  DT  J "C3'" 1 
ATOM   4186  O "O3'" . DT  B 2 82  ? 113.926 142.269 76.488  1.00 117.81 ? 22  DT  J "O3'" 1 
ATOM   4187  C "C2'" . DT  B 2 82  ? 112.117 140.692 76.406  1.00 120.02 ? 22  DT  J "C2'" 1 
ATOM   4188  C "C1'" . DT  B 2 82  ? 111.842 140.733 77.894  1.00 120.32 ? 22  DT  J "C1'" 1 
ATOM   4189  N N1    . DT  B 2 82  ? 110.947 139.675 78.399  1.00 120.16 ? 22  DT  J N1    1 
ATOM   4190  C C2    . DT  B 2 82  ? 111.386 138.917 79.459  1.00 119.52 ? 22  DT  J C2    1 
ATOM   4191  O O2    . DT  B 2 82  ? 112.471 139.084 79.994  1.00 118.58 ? 22  DT  J O2    1 
ATOM   4192  N N3    . DT  B 2 82  ? 110.506 137.951 79.874  1.00 119.61 ? 22  DT  J N3    1 
ATOM   4193  C C4    . DT  B 2 82  ? 109.260 137.672 79.344  1.00 120.03 ? 22  DT  J C4    1 
ATOM   4194  O O4    . DT  B 2 82  ? 108.579 136.771 79.820  1.00 120.38 ? 22  DT  J O4    1 
ATOM   4195  C C5    . DT  B 2 82  ? 108.863 138.502 78.233  1.00 120.28 ? 22  DT  J C5    1 
ATOM   4196  C C7    . DT  B 2 82  ? 107.531 138.268 77.592  1.00 119.91 ? 22  DT  J C7    1 
ATOM   4197  C C6    . DT  B 2 82  ? 109.714 139.452 77.821  1.00 120.59 ? 22  DT  J C6    1 
ATOM   4198  P P     . DG  B 2 83  ? 115.054 141.947 75.393  1.00 115.20 ? 23  DG  J P     1 
ATOM   4199  O OP1   . DG  B 2 83  ? 114.913 142.952 74.311  1.00 116.57 ? 23  DG  J OP1   1 
ATOM   4200  O OP2   . DG  B 2 83  ? 114.993 140.502 75.060  1.00 114.95 ? 23  DG  J OP2   1 
ATOM   4201  O "O5'" . DG  B 2 83  ? 116.414 142.235 76.169  1.00 113.41 ? 23  DG  J "O5'" 1 
ATOM   4202  C "C5'" . DG  B 2 83  ? 117.535 141.364 76.038  1.00 110.71 ? 23  DG  J "C5'" 1 
ATOM   4203  C "C4'" . DG  B 2 83  ? 117.907 140.796 77.388  1.00 108.23 ? 23  DG  J "C4'" 1 
ATOM   4204  O "O4'" . DG  B 2 83  ? 116.764 140.102 77.940  1.00 107.81 ? 23  DG  J "O4'" 1 
ATOM   4205  C "C3'" . DG  B 2 83  ? 119.040 139.774 77.361  1.00 106.20 ? 23  DG  J "C3'" 1 
ATOM   4206  O "O3'" . DG  B 2 83  ? 119.813 139.885 78.556  1.00 103.41 ? 23  DG  J "O3'" 1 
ATOM   4207  C "C2'" . DG  B 2 83  ? 118.312 138.444 77.322  1.00 106.50 ? 23  DG  J "C2'" 1 
ATOM   4208  C "C1'" . DG  B 2 83  ? 117.068 138.728 78.146  1.00 106.14 ? 23  DG  J "C1'" 1 
ATOM   4209  N N9    . DG  B 2 83  ? 115.897 137.956 77.747  1.00 105.31 ? 23  DG  J N9    1 
ATOM   4210  C C8    . DG  B 2 83  ? 115.250 138.000 76.536  1.00 105.26 ? 23  DG  J C8    1 
ATOM   4211  N N7    . DG  B 2 83  ? 114.211 137.211 76.479  1.00 104.57 ? 23  DG  J N7    1 
ATOM   4212  C C5    . DG  B 2 83  ? 114.175 136.604 77.728  1.00 105.03 ? 23  DG  J C5    1 
ATOM   4213  C C6    . DG  B 2 83  ? 113.271 135.650 78.258  1.00 103.97 ? 23  DG  J C6    1 
ATOM   4214  O O6    . DG  B 2 83  ? 112.288 135.138 77.715  1.00 103.32 ? 23  DG  J O6    1 
ATOM   4215  N N1    . DG  B 2 83  ? 113.606 135.301 79.562  1.00 103.81 ? 23  DG  J N1    1 
ATOM   4216  C C2    . DG  B 2 83  ? 114.673 135.801 80.265  1.00 103.98 ? 23  DG  J C2    1 
ATOM   4217  N N2    . DG  B 2 83  ? 114.833 135.330 81.508  1.00 102.85 ? 23  DG  J N2    1 
ATOM   4218  N N3    . DG  B 2 83  ? 115.520 136.695 79.784  1.00 105.33 ? 23  DG  J N3    1 
ATOM   4219  C C4    . DG  B 2 83  ? 115.214 137.049 78.518  1.00 105.62 ? 23  DG  J C4    1 
ATOM   4220  P P     . DG  B 2 84  ? 121.243 139.166 78.641  1.00 102.06 ? 24  DG  J P     1 
ATOM   4221  O OP1   . DG  B 2 84  ? 122.209 140.056 79.338  1.00 101.25 ? 24  DG  J OP1   1 
ATOM   4222  O OP2   . DG  B 2 84  ? 121.559 138.650 77.285  1.00 102.85 ? 24  DG  J OP2   1 
ATOM   4223  O "O5'" . DG  B 2 84  ? 120.984 137.898 79.561  1.00 100.48 ? 24  DG  J "O5'" 1 
ATOM   4224  C "C5'" . DG  B 2 84  ? 121.742 136.717 79.366  1.00 97.08  ? 24  DG  J "C5'" 1 
ATOM   4225  C "C4'" . DG  B 2 84  ? 121.060 135.546 80.031  1.00 93.95  ? 24  DG  J "C4'" 1 
ATOM   4226  O "O4'" . DG  B 2 84  ? 119.672 135.483 79.626  1.00 92.48  ? 24  DG  J "O4'" 1 
ATOM   4227  C "C3'" . DG  B 2 84  ? 121.673 134.203 79.648  1.00 91.99  ? 24  DG  J "C3'" 1 
ATOM   4228  O "O3'" . DG  B 2 84  ? 121.649 133.343 80.781  1.00 89.78  ? 24  DG  J "O3'" 1 
ATOM   4229  C "C2'" . DG  B 2 84  ? 120.729 133.686 78.580  1.00 91.89  ? 24  DG  J "C2'" 1 
ATOM   4230  C "C1'" . DG  B 2 84  ? 119.403 134.199 79.096  1.00 92.14  ? 24  DG  J "C1'" 1 
ATOM   4231  N N9    . DG  B 2 84  ? 118.348 134.323 78.097  1.00 92.57  ? 24  DG  J N9    1 
ATOM   4232  C C8    . DG  B 2 84  ? 118.354 135.081 76.951  1.00 92.22  ? 24  DG  J C8    1 
ATOM   4233  N N7    . DG  B 2 84  ? 117.259 134.957 76.250  1.00 92.26  ? 24  DG  J N7    1 
ATOM   4234  C C5    . DG  B 2 84  ? 116.484 134.064 76.978  1.00 91.62  ? 24  DG  J C5    1 
ATOM   4235  C C6    . DG  B 2 84  ? 115.195 133.534 76.715  1.00 90.88  ? 24  DG  J C6    1 
ATOM   4236  O O6    . DG  B 2 84  ? 114.455 133.749 75.748  1.00 88.32  ? 24  DG  J O6    1 
ATOM   4237  N N1    . DG  B 2 84  ? 114.783 132.671 77.726  1.00 91.10  ? 24  DG  J N1    1 
ATOM   4238  C C2    . DG  B 2 84  ? 115.514 132.354 78.844  1.00 91.76  ? 24  DG  J C2    1 
ATOM   4239  N N2    . DG  B 2 84  ? 114.935 131.512 79.718  1.00 92.35  ? 24  DG  J N2    1 
ATOM   4240  N N3    . DG  B 2 84  ? 116.720 132.830 79.093  1.00 91.36  ? 24  DG  J N3    1 
ATOM   4241  C C4    . DG  B 2 84  ? 117.139 133.673 78.126  1.00 92.27  ? 24  DG  J C4    1 
ATOM   4242  P P     . DA  B 2 85  ? 122.989 133.105 81.622  1.00 88.50  ? 25  DA  J P     1 
ATOM   4243  O OP1   . DA  B 2 85  ? 123.356 134.385 82.273  1.00 89.11  ? 25  DA  J OP1   1 
ATOM   4244  O OP2   . DA  B 2 85  ? 123.969 132.411 80.747  1.00 89.02  ? 25  DA  J OP2   1 
ATOM   4245  O "O5'" . DA  B 2 85  ? 122.531 132.105 82.765  1.00 85.82  ? 25  DA  J "O5'" 1 
ATOM   4246  C "C5'" . DA  B 2 85  ? 121.560 132.507 83.719  1.00 80.87  ? 25  DA  J "C5'" 1 
ATOM   4247  C "C4'" . DA  B 2 85  ? 120.546 131.408 83.911  1.00 78.75  ? 25  DA  J "C4'" 1 
ATOM   4248  O "O4'" . DA  B 2 85  ? 119.693 131.300 82.746  1.00 77.64  ? 25  DA  J "O4'" 1 
ATOM   4249  C "C3'" . DA  B 2 85  ? 121.182 130.036 84.099  1.00 75.80  ? 25  DA  J "C3'" 1 
ATOM   4250  O "O3'" . DA  B 2 85  ? 120.480 129.316 85.102  1.00 73.22  ? 25  DA  J "O3'" 1 
ATOM   4251  C "C2'" . DA  B 2 85  ? 121.043 129.381 82.738  1.00 75.55  ? 25  DA  J "C2'" 1 
ATOM   4252  C "C1'" . DA  B 2 85  ? 119.764 129.992 82.200  1.00 76.77  ? 25  DA  J "C1'" 1 
ATOM   4253  N N9    . DA  B 2 85  ? 119.718 130.128 80.745  1.00 76.53  ? 25  DA  J N9    1 
ATOM   4254  C C8    . DA  B 2 85  ? 120.697 130.615 79.917  1.00 77.03  ? 25  DA  J C8    1 
ATOM   4255  N N7    . DA  B 2 85  ? 120.341 130.671 78.655  1.00 77.31  ? 25  DA  J N7    1 
ATOM   4256  C C5    . DA  B 2 85  ? 119.046 130.174 78.651  1.00 77.58  ? 25  DA  J C5    1 
ATOM   4257  C C6    . DA  B 2 85  ? 118.109 129.982 77.623  1.00 76.37  ? 25  DA  J C6    1 
ATOM   4258  N N6    . DA  B 2 85  ? 118.338 130.296 76.348  1.00 77.15  ? 25  DA  J N6    1 
ATOM   4259  N N1    . DA  B 2 85  ? 116.911 129.456 77.954  1.00 75.49  ? 25  DA  J N1    1 
ATOM   4260  C C2    . DA  B 2 85  ? 116.677 129.154 79.235  1.00 74.17  ? 25  DA  J C2    1 
ATOM   4261  N N3    . DA  B 2 85  ? 117.472 129.298 80.291  1.00 74.58  ? 25  DA  J N3    1 
ATOM   4262  C C4    . DA  B 2 85  ? 118.655 129.819 79.929  1.00 76.26  ? 25  DA  J C4    1 
ATOM   4263  P P     . DG  B 2 86  ? 120.919 127.821 85.438  1.00 72.35  ? 26  DG  J P     1 
ATOM   4264  O OP1   . DG  B 2 86  ? 120.559 127.479 86.839  1.00 74.85  ? 26  DG  J OP1   1 
ATOM   4265  O OP2   . DG  B 2 86  ? 122.318 127.652 84.974  1.00 74.28  ? 26  DG  J OP2   1 
ATOM   4266  O "O5'" . DG  B 2 86  ? 120.002 126.971 84.472  1.00 69.28  ? 26  DG  J "O5'" 1 
ATOM   4267  C "C5'" . DG  B 2 86  ? 120.441 125.725 84.010  1.00 64.75  ? 26  DG  J "C5'" 1 
ATOM   4268  C "C4'" . DG  B 2 86  ? 119.444 125.164 83.032  1.00 61.41  ? 26  DG  J "C4'" 1 
ATOM   4269  O "O4'" . DG  B 2 86  ? 119.336 126.008 81.853  1.00 60.55  ? 26  DG  J "O4'" 1 
ATOM   4270  C "C3'" . DG  B 2 86  ? 119.895 123.798 82.532  1.00 57.24  ? 26  DG  J "C3'" 1 
ATOM   4271  O "O3'" . DG  B 2 86  ? 118.741 123.007 82.317  1.00 56.07  ? 26  DG  J "O3'" 1 
ATOM   4272  C "C2'" . DG  B 2 86  ? 120.540 124.130 81.207  1.00 58.59  ? 26  DG  J "C2'" 1 
ATOM   4273  C "C1'" . DG  B 2 86  ? 119.603 125.209 80.713  1.00 60.04  ? 26  DG  J "C1'" 1 
ATOM   4274  N N9    . DG  B 2 86  ? 120.139 126.052 79.650  1.00 62.12  ? 26  DG  J N9    1 
ATOM   4275  C C8    . DG  B 2 86  ? 121.395 126.609 79.574  1.00 61.18  ? 26  DG  J C8    1 
ATOM   4276  N N7    . DG  B 2 86  ? 121.591 127.283 78.474  1.00 61.15  ? 26  DG  J N7    1 
ATOM   4277  C C5    . DG  B 2 86  ? 120.390 127.171 77.784  1.00 63.43  ? 26  DG  J C5    1 
ATOM   4278  C C6    . DG  B 2 86  ? 120.001 127.689 76.517  1.00 63.13  ? 26  DG  J C6    1 
ATOM   4279  O O6    . DG  B 2 86  ? 120.660 128.371 75.727  1.00 67.88  ? 26  DG  J O6    1 
ATOM   4280  N N1    . DG  B 2 86  ? 118.695 127.335 76.201  1.00 62.03  ? 26  DG  J N1    1 
ATOM   4281  C C2    . DG  B 2 86  ? 117.869 126.580 76.991  1.00 60.83  ? 26  DG  J C2    1 
ATOM   4282  N N2    . DG  B 2 86  ? 116.644 126.342 76.497  1.00 57.65  ? 26  DG  J N2    1 
ATOM   4283  N N3    . DG  B 2 86  ? 118.215 126.091 78.171  1.00 56.52  ? 26  DG  J N3    1 
ATOM   4284  C C4    . DG  B 2 86  ? 119.481 126.422 78.502  1.00 61.28  ? 26  DG  J C4    1 
ATOM   4285  P P     . DC  B 2 87  ? 118.303 121.923 83.408  1.00 48.89  ? 27  DC  J P     1 
ATOM   4286  O OP1   . DC  B 2 87  ? 117.968 122.667 84.644  1.00 50.76  ? 27  DC  J OP1   1 
ATOM   4287  O OP2   . DC  B 2 87  ? 119.289 120.828 83.461  1.00 52.39  ? 27  DC  J OP2   1 
ATOM   4288  O "O5'" . DC  B 2 87  ? 116.956 121.386 82.773  1.00 52.70  ? 27  DC  J "O5'" 1 
ATOM   4289  C "C5'" . DC  B 2 87  ? 115.866 122.271 82.599  1.00 52.92  ? 27  DC  J "C5'" 1 
ATOM   4290  C "C4'" . DC  B 2 87  ? 115.289 122.117 81.214  1.00 57.08  ? 27  DC  J "C4'" 1 
ATOM   4291  O "O4'" . DC  B 2 87  ? 116.126 122.748 80.213  1.00 57.21  ? 27  DC  J "O4'" 1 
ATOM   4292  C "C3'" . DC  B 2 87  ? 115.105 120.669 80.774  1.00 57.75  ? 27  DC  J "C3'" 1 
ATOM   4293  O "O3'" . DC  B 2 87  ? 113.822 120.544 80.179  1.00 55.53  ? 27  DC  J "O3'" 1 
ATOM   4294  C "C2'" . DC  B 2 87  ? 116.225 120.448 79.765  1.00 57.77  ? 27  DC  J "C2'" 1 
ATOM   4295  C "C1'" . DC  B 2 87  ? 116.407 121.833 79.160  1.00 56.48  ? 27  DC  J "C1'" 1 
ATOM   4296  N N1    . DC  B 2 87  ? 117.757 122.150 78.659  1.00 57.10  ? 27  DC  J N1    1 
ATOM   4297  C C2    . DC  B 2 87  ? 117.890 122.814 77.421  1.00 58.60  ? 27  DC  J C2    1 
ATOM   4298  O O2    . DC  B 2 87  ? 116.880 123.010 76.727  1.00 56.47  ? 27  DC  J O2    1 
ATOM   4299  N N3    . DC  B 2 87  ? 119.117 123.216 77.018  1.00 58.47  ? 27  DC  J N3    1 
ATOM   4300  C C4    . DC  B 2 87  ? 120.181 122.969 77.782  1.00 57.63  ? 27  DC  J C4    1 
ATOM   4301  N N4    . DC  B 2 87  ? 121.357 123.450 77.388  1.00 58.30  ? 27  DC  J N4    1 
ATOM   4302  C C5    . DC  B 2 87  ? 120.085 122.232 78.998  1.00 56.54  ? 27  DC  J C5    1 
ATOM   4303  C C6    . DC  B 2 87  ? 118.866 121.848 79.396  1.00 57.02  ? 27  DC  J C6    1 
ATOM   4304  P P     . DA  B 2 88  ? 113.403 119.165 79.510  1.00 59.73  ? 28  DA  J P     1 
ATOM   4305  O OP1   . DA  B 2 88  ? 111.928 119.103 79.412  1.00 60.25  ? 28  DA  J OP1   1 
ATOM   4306  O OP2   . DA  B 2 88  ? 114.143 118.082 80.203  1.00 61.93  ? 28  DA  J OP2   1 
ATOM   4307  O "O5'" . DA  B 2 88  ? 113.988 119.302 78.046  1.00 64.35  ? 28  DA  J "O5'" 1 
ATOM   4308  C "C5'" . DA  B 2 88  ? 114.212 118.161 77.257  1.00 70.25  ? 28  DA  J "C5'" 1 
ATOM   4309  C "C4'" . DA  B 2 88  ? 114.642 118.584 75.877  1.00 73.40  ? 28  DA  J "C4'" 1 
ATOM   4310  O "O4'" . DA  B 2 88  ? 115.781 119.471 75.971  1.00 72.69  ? 28  DA  J "O4'" 1 
ATOM   4311  C "C3'" . DA  B 2 88  ? 115.089 117.415 75.013  1.00 74.88  ? 28  DA  J "C3'" 1 
ATOM   4312  O "O3'" . DA  B 2 88  ? 114.726 117.684 73.673  1.00 79.50  ? 28  DA  J "O3'" 1 
ATOM   4313  C "C2'" . DA  B 2 88  ? 116.594 117.432 75.168  1.00 73.76  ? 28  DA  J "C2'" 1 
ATOM   4314  C "C1'" . DA  B 2 88  ? 116.874 118.915 75.261  1.00 73.96  ? 28  DA  J "C1'" 1 
ATOM   4315  N N9    . DA  B 2 88  ? 118.102 119.240 75.982  1.00 74.41  ? 28  DA  J N9    1 
ATOM   4316  C C8    . DA  B 2 88  ? 118.440 118.942 77.278  1.00 74.01  ? 28  DA  J C8    1 
ATOM   4317  N N7    . DA  B 2 88  ? 119.643 119.339 77.614  1.00 74.18  ? 28  DA  J N7    1 
ATOM   4318  C C5    . DA  B 2 88  ? 120.127 119.947 76.463  1.00 75.57  ? 28  DA  J C5    1 
ATOM   4319  C C6    . DA  B 2 88  ? 121.351 120.569 76.162  1.00 75.16  ? 28  DA  J C6    1 
ATOM   4320  N N6    . DA  B 2 88  ? 122.367 120.668 77.025  1.00 72.64  ? 28  DA  J N6    1 
ATOM   4321  N N1    . DA  B 2 88  ? 121.500 121.091 74.923  1.00 75.38  ? 28  DA  J N1    1 
ATOM   4322  C C2    . DA  B 2 88  ? 120.489 120.984 74.054  1.00 75.26  ? 28  DA  J C2    1 
ATOM   4323  N N3    . DA  B 2 88  ? 119.301 120.412 74.214  1.00 76.45  ? 28  DA  J N3    1 
ATOM   4324  C C4    . DA  B 2 88  ? 119.181 119.908 75.455  1.00 75.81  ? 28  DA  J C4    1 
ATOM   4325  P P     . DG  B 2 89  ? 114.108 116.519 72.782  1.00 83.02  ? 29  DG  J P     1 
ATOM   4326  O OP1   . DG  B 2 89  ? 112.716 116.932 72.465  1.00 84.60  ? 29  DG  J OP1   1 
ATOM   4327  O OP2   . DG  B 2 89  ? 114.358 115.217 73.448  1.00 82.40  ? 29  DG  J OP2   1 
ATOM   4328  O "O5'" . DG  B 2 89  ? 114.984 116.588 71.460  1.00 84.37  ? 29  DG  J "O5'" 1 
ATOM   4329  C "C5'" . DG  B 2 89  ? 114.890 117.707 70.583  1.00 85.50  ? 29  DG  J "C5'" 1 
ATOM   4330  C "C4'" . DG  B 2 89  ? 116.079 117.731 69.657  1.00 85.26  ? 29  DG  J "C4'" 1 
ATOM   4331  O "O4'" . DG  B 2 89  ? 117.247 118.195 70.374  1.00 85.37  ? 29  DG  J "O4'" 1 
ATOM   4332  C "C3'" . DG  B 2 89  ? 116.439 116.356 69.103  1.00 86.22  ? 29  DG  J "C3'" 1 
ATOM   4333  O "O3'" . DG  B 2 89  ? 116.812 116.467 67.727  1.00 88.39  ? 29  DG  J "O3'" 1 
ATOM   4334  C "C2'" . DG  B 2 89  ? 117.602 115.914 69.976  1.00 84.57  ? 29  DG  J "C2'" 1 
ATOM   4335  C "C1'" . DG  B 2 89  ? 118.286 117.228 70.295  1.00 85.66  ? 29  DG  J "C1'" 1 
ATOM   4336  N N9    . DG  B 2 89  ? 119.013 117.253 71.560  1.00 86.06  ? 29  DG  J N9    1 
ATOM   4337  C C8    . DG  B 2 89  ? 118.569 116.801 72.777  1.00 86.58  ? 29  DG  J C8    1 
ATOM   4338  N N7    . DG  B 2 89  ? 119.434 116.982 73.739  1.00 86.19  ? 29  DG  J N7    1 
ATOM   4339  C C5    . DG  B 2 89  ? 120.518 117.586 73.118  1.00 86.36  ? 29  DG  J C5    1 
ATOM   4340  C C6    . DG  B 2 89  ? 121.755 118.023 73.654  1.00 86.57  ? 29  DG  J C6    1 
ATOM   4341  O O6    . DG  B 2 89  ? 122.149 117.974 74.823  1.00 87.05  ? 29  DG  J O6    1 
ATOM   4342  N N1    . DG  B 2 89  ? 122.572 118.569 72.671  1.00 87.08  ? 29  DG  J N1    1 
ATOM   4343  C C2    . DG  B 2 89  ? 122.240 118.685 71.346  1.00 86.70  ? 29  DG  J C2    1 
ATOM   4344  N N2    . DG  B 2 89  ? 123.169 119.234 70.553  1.00 87.24  ? 29  DG  J N2    1 
ATOM   4345  N N3    . DG  B 2 89  ? 121.087 118.292 70.834  1.00 85.52  ? 29  DG  J N3    1 
ATOM   4346  C C4    . DG  B 2 89  ? 120.279 117.753 71.771  1.00 86.32  ? 29  DG  J C4    1 
ATOM   4347  P P     . DT  B 2 90  ? 117.596 115.264 67.014  1.00 89.11  ? 30  DT  J P     1 
ATOM   4348  O OP1   . DT  B 2 90  ? 117.333 115.374 65.561  1.00 90.25  ? 30  DT  J OP1   1 
ATOM   4349  O OP2   . DT  B 2 90  ? 117.302 113.988 67.720  1.00 89.78  ? 30  DT  J OP2   1 
ATOM   4350  O "O5'" . DT  B 2 90  ? 119.117 115.640 67.267  1.00 91.74  ? 30  DT  J "O5'" 1 
ATOM   4351  C "C5'" . DT  B 2 90  ? 119.659 116.831 66.718  1.00 96.05  ? 30  DT  J "C5'" 1 
ATOM   4352  C "C4'" . DT  B 2 90  ? 121.129 116.643 66.443  1.00 99.94  ? 30  DT  J "C4'" 1 
ATOM   4353  O "O4'" . DT  B 2 90  ? 121.871 116.751 67.679  1.00 100.44 ? 30  DT  J "O4'" 1 
ATOM   4354  C "C3'" . DT  B 2 90  ? 121.464 115.274 65.855  1.00 101.97 ? 30  DT  J "C3'" 1 
ATOM   4355  O "O3'" . DT  B 2 90  ? 122.449 115.409 64.832  1.00 106.30 ? 30  DT  J "O3'" 1 
ATOM   4356  C "C2'" . DT  B 2 90  ? 121.992 114.496 67.050  1.00 101.21 ? 30  DT  J "C2'" 1 
ATOM   4357  C "C1'" . DT  B 2 90  ? 122.637 115.580 67.897  1.00 100.92 ? 30  DT  J "C1'" 1 
ATOM   4358  N N1    . DT  B 2 90  ? 122.641 115.312 69.349  1.00 101.33 ? 30  DT  J N1    1 
ATOM   4359  C C2    . DT  B 2 90  ? 123.674 115.830 70.099  1.00 102.45 ? 30  DT  J C2    1 
ATOM   4360  O O2    . DT  B 2 90  ? 124.581 116.489 69.617  1.00 103.42 ? 30  DT  J O2    1 
ATOM   4361  N N3    . DT  B 2 90  ? 123.606 115.546 71.440  1.00 101.98 ? 30  DT  J N3    1 
ATOM   4362  C C4    . DT  B 2 90  ? 122.632 114.813 72.090  1.00 101.51 ? 30  DT  J C4    1 
ATOM   4363  O O4    . DT  B 2 90  ? 122.703 114.646 73.303  1.00 101.16 ? 30  DT  J O4    1 
ATOM   4364  C C5    . DT  B 2 90  ? 121.584 114.295 71.243  1.00 101.37 ? 30  DT  J C5    1 
ATOM   4365  C C7    . DT  B 2 90  ? 120.491 113.480 71.857  1.00 101.61 ? 30  DT  J C7    1 
ATOM   4366  C C6    . DT  B 2 90  ? 121.639 114.569 69.933  1.00 101.54 ? 30  DT  J C6    1 
ATOM   4367  P P     . DT  B 2 91  ? 123.149 114.102 64.221  1.00 109.03 ? 31  DT  J P     1 
ATOM   4368  O OP1   . DT  B 2 91  ? 123.428 114.359 62.787  1.00 110.81 ? 31  DT  J OP1   1 
ATOM   4369  O OP2   . DT  B 2 91  ? 122.350 112.910 64.612  1.00 109.58 ? 31  DT  J OP2   1 
ATOM   4370  O "O5'" . DT  B 2 91  ? 124.540 114.061 64.988  1.00 109.56 ? 31  DT  J "O5'" 1 
ATOM   4371  C "C5'" . DT  B 2 91  ? 125.408 115.188 64.950  1.00 111.45 ? 31  DT  J "C5'" 1 
ATOM   4372  C "C4'" . DT  B 2 91  ? 126.771 114.808 65.471  1.00 112.93 ? 31  DT  J "C4'" 1 
ATOM   4373  O "O4'" . DT  B 2 91  ? 126.732 114.682 66.913  1.00 113.15 ? 31  DT  J "O4'" 1 
ATOM   4374  C "C3'" . DT  B 2 91  ? 127.280 113.471 64.937  1.00 113.60 ? 31  DT  J "C3'" 1 
ATOM   4375  O "O3'" . DT  B 2 91  ? 128.678 113.563 64.664  1.00 113.65 ? 31  DT  J "O3'" 1 
ATOM   4376  C "C2'" . DT  B 2 91  ? 126.991 112.508 66.075  1.00 113.55 ? 31  DT  J "C2'" 1 
ATOM   4377  C "C1'" . DT  B 2 91  ? 127.158 113.386 67.301  1.00 113.81 ? 31  DT  J "C1'" 1 
ATOM   4378  N N1    . DT  B 2 91  ? 126.348 112.976 68.462  1.00 114.45 ? 31  DT  J N1    1 
ATOM   4379  C C2    . DT  B 2 91  ? 126.910 113.086 69.715  1.00 114.65 ? 31  DT  J C2    1 
ATOM   4380  O O2    . DT  B 2 91  ? 128.048 113.484 69.902  1.00 114.90 ? 31  DT  J O2    1 
ATOM   4381  N N3    . DT  B 2 91  ? 126.087 112.705 70.747  1.00 114.23 ? 31  DT  J N3    1 
ATOM   4382  C C4    . DT  B 2 91  ? 124.792 112.231 70.649  1.00 114.25 ? 31  DT  J C4    1 
ATOM   4383  O O4    . DT  B 2 91  ? 124.170 111.939 71.665  1.00 114.38 ? 31  DT  J O4    1 
ATOM   4384  C C5    . DT  B 2 91  ? 124.274 112.125 69.308  1.00 114.36 ? 31  DT  J C5    1 
ATOM   4385  C C7    . DT  B 2 91  ? 122.888 111.598 69.105  1.00 114.35 ? 31  DT  J C7    1 
ATOM   4386  C C6    . DT  B 2 91  ? 125.065 112.502 68.294  1.00 114.48 ? 31  DT  J C6    1 
ATOM   4387  P P     . DT  B 2 92  ? 129.504 112.243 64.279  1.00 113.40 ? 32  DT  J P     1 
ATOM   4388  O OP1   . DT  B 2 92  ? 130.430 112.587 63.172  1.00 114.14 ? 32  DT  J OP1   1 
ATOM   4389  O OP2   . DT  B 2 92  ? 128.561 111.105 64.124  1.00 113.52 ? 32  DT  J OP2   1 
ATOM   4390  O "O5'" . DT  B 2 92  ? 130.368 111.994 65.587  1.00 113.23 ? 32  DT  J "O5'" 1 
ATOM   4391  C "C5'" . DT  B 2 92  ? 131.022 113.082 66.226  1.00 112.34 ? 32  DT  J "C5'" 1 
ATOM   4392  C "C4'" . DT  B 2 92  ? 131.810 112.580 67.410  1.00 111.52 ? 32  DT  J "C4'" 1 
ATOM   4393  O "O4'" . DT  B 2 92  ? 130.919 112.320 68.522  1.00 110.84 ? 32  DT  J "O4'" 1 
ATOM   4394  C "C3'" . DT  B 2 92  ? 132.536 111.268 67.119  1.00 110.60 ? 32  DT  J "C3'" 1 
ATOM   4395  O "O3'" . DT  B 2 92  ? 133.858 111.302 67.652  1.00 109.30 ? 32  DT  J "O3'" 1 
ATOM   4396  C "C2'" . DT  B 2 92  ? 131.680 110.223 67.815  1.00 111.05 ? 32  DT  J "C2'" 1 
ATOM   4397  C "C1'" . DT  B 2 92  ? 131.112 110.997 68.993  1.00 111.29 ? 32  DT  J "C1'" 1 
ATOM   4398  N N1    . DT  B 2 92  ? 129.817 110.502 69.508  1.00 111.54 ? 32  DT  J N1    1 
ATOM   4399  C C2    . DT  B 2 92  ? 129.637 110.480 70.873  1.00 111.41 ? 32  DT  J C2    1 
ATOM   4400  O O2    . DT  B 2 92  ? 130.496 110.834 71.664  1.00 111.70 ? 32  DT  J O2    1 
ATOM   4401  N N3    . DT  B 2 92  ? 128.408 110.024 71.281  1.00 111.35 ? 32  DT  J N3    1 
ATOM   4402  C C4    . DT  B 2 92  ? 127.368 109.592 70.480  1.00 111.62 ? 32  DT  J C4    1 
ATOM   4403  O O4    . DT  B 2 92  ? 126.318 109.214 70.989  1.00 111.70 ? 32  DT  J O4    1 
ATOM   4404  C C5    . DT  B 2 92  ? 127.630 109.630 69.061  1.00 111.51 ? 32  DT  J C5    1 
ATOM   4405  C C7    . DT  B 2 92  ? 126.565 109.168 68.117  1.00 111.62 ? 32  DT  J C7    1 
ATOM   4406  C C6    . DT  B 2 92  ? 128.824 110.079 68.651  1.00 111.83 ? 32  DT  J C6    1 
ATOM   4407  P P     . DC  B 2 93  ? 134.779 109.997 67.557  1.00 107.59 ? 33  DC  J P     1 
ATOM   4408  O OP1   . DC  B 2 93  ? 136.195 110.442 67.523  1.00 108.84 ? 33  DC  J OP1   1 
ATOM   4409  O OP2   . DC  B 2 93  ? 134.256 109.119 66.481  1.00 108.39 ? 33  DC  J OP2   1 
ATOM   4410  O "O5'" . DC  B 2 93  ? 134.515 109.276 68.947  1.00 106.82 ? 33  DC  J "O5'" 1 
ATOM   4411  C "C5'" . DC  B 2 93  ? 134.860 109.914 70.170  1.00 104.36 ? 33  DC  J "C5'" 1 
ATOM   4412  C "C4'" . DC  B 2 93  ? 134.863 108.903 71.289  1.00 103.17 ? 33  DC  J "C4'" 1 
ATOM   4413  O "O4'" . DC  B 2 93  ? 133.502 108.557 71.642  1.00 102.77 ? 33  DC  J "O4'" 1 
ATOM   4414  C "C3'" . DC  B 2 93  ? 135.554 107.591 70.919  1.00 101.96 ? 33  DC  J "C3'" 1 
ATOM   4415  O "O3'" . DC  B 2 93  ? 136.279 107.102 72.039  1.00 100.49 ? 33  DC  J "O3'" 1 
ATOM   4416  C "C2'" . DC  B 2 93  ? 134.399 106.658 70.604  1.00 102.27 ? 33  DC  J "C2'" 1 
ATOM   4417  C "C1'" . DC  B 2 93  ? 133.325 107.151 71.559  1.00 102.40 ? 33  DC  J "C1'" 1 
ATOM   4418  N N1    . DC  B 2 93  ? 131.942 106.897 71.123  1.00 102.18 ? 33  DC  J N1    1 
ATOM   4419  C C2    . DC  B 2 93  ? 130.905 107.087 72.042  1.00 102.07 ? 33  DC  J C2    1 
ATOM   4420  O O2    . DC  B 2 93  ? 131.186 107.465 73.191  1.00 100.94 ? 33  DC  J O2    1 
ATOM   4421  N N3    . DC  B 2 93  ? 129.630 106.853 71.657  1.00 101.54 ? 33  DC  J N3    1 
ATOM   4422  C C4    . DC  B 2 93  ? 129.373 106.446 70.413  1.00 102.08 ? 33  DC  J C4    1 
ATOM   4423  N N4    . DC  B 2 93  ? 128.100 106.223 70.076  1.00 101.09 ? 33  DC  J N4    1 
ATOM   4424  C C5    . DC  B 2 93  ? 130.410 106.246 69.456  1.00 102.50 ? 33  DC  J C5    1 
ATOM   4425  C C6    . DC  B 2 93  ? 131.667 106.482 69.849  1.00 102.21 ? 33  DC  J C6    1 
ATOM   4426  P P     . DC  B 2 94  ? 137.385 105.963 71.839  1.00 99.31  ? 34  DC  J P     1 
ATOM   4427  O OP1   . DC  B 2 94  ? 138.658 106.625 71.476  1.00 100.59 ? 34  DC  J OP1   1 
ATOM   4428  O OP2   . DC  B 2 94  ? 136.830 104.900 70.958  1.00 100.39 ? 34  DC  J OP2   1 
ATOM   4429  O "O5'" . DC  B 2 94  ? 137.535 105.384 73.308  1.00 98.31  ? 34  DC  J "O5'" 1 
ATOM   4430  C "C5'" . DC  B 2 94  ? 137.327 106.232 74.433  1.00 95.08  ? 34  DC  J "C5'" 1 
ATOM   4431  C "C4'" . DC  B 2 94  ? 136.513 105.514 75.481  1.00 93.00  ? 34  DC  J "C4'" 1 
ATOM   4432  O "O4'" . DC  B 2 94  ? 135.140 105.361 75.041  1.00 91.69  ? 34  DC  J "O4'" 1 
ATOM   4433  C "C3'" . DC  B 2 94  ? 137.015 104.106 75.792  1.00 91.70  ? 34  DC  J "C3'" 1 
ATOM   4434  O "O3'" . DC  B 2 94  ? 136.877 103.862 77.185  1.00 90.19  ? 34  DC  J "O3'" 1 
ATOM   4435  C "C2'" . DC  B 2 94  ? 136.050 103.217 75.031  1.00 91.45  ? 34  DC  J "C2'" 1 
ATOM   4436  C "C1'" . DC  B 2 94  ? 134.765 104.001 75.186  1.00 92.39  ? 34  DC  J "C1'" 1 
ATOM   4437  N N1    . DC  B 2 94  ? 133.718 103.700 74.198  1.00 92.49  ? 34  DC  J N1    1 
ATOM   4438  C C2    . DC  B 2 94  ? 132.387 103.670 74.625  1.00 91.69  ? 34  DC  J C2    1 
ATOM   4439  O O2    . DC  B 2 94  ? 132.134 103.912 75.814  1.00 88.50  ? 34  DC  J O2    1 
ATOM   4440  N N3    . DC  B 2 94  ? 131.414 103.380 73.731  1.00 91.33  ? 34  DC  J N3    1 
ATOM   4441  C C4    . DC  B 2 94  ? 131.729 103.129 72.461  1.00 92.22  ? 34  DC  J C4    1 
ATOM   4442  N N4    . DC  B 2 94  ? 130.737 102.848 71.613  1.00 92.35  ? 34  DC  J N4    1 
ATOM   4443  C C5    . DC  B 2 94  ? 133.076 103.157 71.998  1.00 92.54  ? 34  DC  J C5    1 
ATOM   4444  C C6    . DC  B 2 94  ? 134.031 103.446 72.892  1.00 92.28  ? 34  DC  J C6    1 
ATOM   4445  P P     . DA  B 2 95  ? 138.119 103.296 78.019  1.00 90.11  ? 35  DA  J P     1 
ATOM   4446  O OP1   . DA  B 2 95  ? 139.214 104.288 77.891  1.00 90.79  ? 35  DA  J OP1   1 
ATOM   4447  O OP2   . DA  B 2 95  ? 138.354 101.884 77.618  1.00 88.84  ? 35  DA  J OP2   1 
ATOM   4448  O "O5'" . DA  B 2 95  ? 137.583 103.328 79.515  1.00 86.79  ? 35  DA  J "O5'" 1 
ATOM   4449  C "C5'" . DA  B 2 95  ? 136.872 104.465 79.999  1.00 82.23  ? 35  DA  J "C5'" 1 
ATOM   4450  C "C4'" . DA  B 2 95  ? 135.509 104.053 80.508  1.00 78.19  ? 35  DA  J "C4'" 1 
ATOM   4451  O "O4'" . DA  B 2 95  ? 134.681 103.612 79.405  1.00 76.23  ? 35  DA  J "O4'" 1 
ATOM   4452  C "C3'" . DA  B 2 95  ? 135.533 102.897 81.502  1.00 75.98  ? 35  DA  J "C3'" 1 
ATOM   4453  O "O3'" . DA  B 2 95  ? 134.568 103.118 82.524  1.00 75.30  ? 35  DA  J "O3'" 1 
ATOM   4454  C "C2'" . DA  B 2 95  ? 135.173 101.690 80.658  1.00 75.16  ? 35  DA  J "C2'" 1 
ATOM   4455  C "C1'" . DA  B 2 95  ? 134.262 102.271 79.594  1.00 74.60  ? 35  DA  J "C1'" 1 
ATOM   4456  N N9    . DA  B 2 95  ? 134.378 101.592 78.305  1.00 75.58  ? 35  DA  J N9    1 
ATOM   4457  C C8    . DA  B 2 95  ? 135.535 101.165 77.706  1.00 76.71  ? 35  DA  J C8    1 
ATOM   4458  N N7    . DA  B 2 95  ? 135.352 100.607 76.535  1.00 77.70  ? 35  DA  J N7    1 
ATOM   4459  C C5    . DA  B 2 95  ? 133.977 100.663 76.353  1.00 78.11  ? 35  DA  J C5    1 
ATOM   4460  C C6    . DA  B 2 95  ? 133.146 100.234 75.304  1.00 78.70  ? 35  DA  J C6    1 
ATOM   4461  N N6    . DA  B 2 95  ? 133.600 99.646  74.195  1.00 79.25  ? 35  DA  J N6    1 
ATOM   4462  N N1    . DA  B 2 95  ? 131.817 100.429 75.436  1.00 77.80  ? 35  DA  J N1    1 
ATOM   4463  C C2    . DA  B 2 95  ? 131.367 101.017 76.547  1.00 77.37  ? 35  DA  J C2    1 
ATOM   4464  N N3    . DA  B 2 95  ? 132.048 101.467 77.600  1.00 77.31  ? 35  DA  J N3    1 
ATOM   4465  C C4    . DA  B 2 95  ? 133.364 101.258 77.439  1.00 76.99  ? 35  DA  J C4    1 
ATOM   4466  P P     . DA  B 2 96  ? 134.399 102.041 83.699  1.00 74.68  ? 36  DA  J P     1 
ATOM   4467  O OP1   . DA  B 2 96  ? 133.894 102.761 84.895  1.00 74.94  ? 36  DA  J OP1   1 
ATOM   4468  O OP2   . DA  B 2 96  ? 135.653 101.250 83.789  1.00 76.05  ? 36  DA  J OP2   1 
ATOM   4469  O "O5'" . DA  B 2 96  ? 133.250 101.086 83.155  1.00 73.24  ? 36  DA  J "O5'" 1 
ATOM   4470  C "C5'" . DA  B 2 96  ? 131.948 101.601 82.908  1.00 69.46  ? 36  DA  J "C5'" 1 
ATOM   4471  C "C4'" . DA  B 2 96  ? 131.046 100.516 82.374  1.00 67.88  ? 36  DA  J "C4'" 1 
ATOM   4472  O "O4'" . DA  B 2 96  ? 131.389 100.174 81.009  1.00 66.65  ? 36  DA  J "O4'" 1 
ATOM   4473  C "C3'" . DA  B 2 96  ? 131.056 99.198  83.153  1.00 65.95  ? 36  DA  J "C3'" 1 
ATOM   4474  O "O3'" . DA  B 2 96  ? 129.731 98.678  83.123  1.00 63.74  ? 36  DA  J "O3'" 1 
ATOM   4475  C "C2'" . DA  B 2 96  ? 131.926 98.307  82.290  1.00 67.65  ? 36  DA  J "C2'" 1 
ATOM   4476  C "C1'" . DA  B 2 96  ? 131.478 98.762  80.916  1.00 69.05  ? 36  DA  J "C1'" 1 
ATOM   4477  N N9    . DA  B 2 96  ? 132.361 98.419  79.802  1.00 73.25  ? 36  DA  J N9    1 
ATOM   4478  C C8    . DA  B 2 96  ? 133.729 98.315  79.788  1.00 74.74  ? 36  DA  J C8    1 
ATOM   4479  N N7    . DA  B 2 96  ? 134.218 97.946  78.628  1.00 75.41  ? 36  DA  J N7    1 
ATOM   4480  C C5    . DA  B 2 96  ? 133.097 97.808  77.823  1.00 75.05  ? 36  DA  J C5    1 
ATOM   4481  C C6    . DA  B 2 96  ? 132.941 97.442  76.474  1.00 76.10  ? 36  DA  J C6    1 
ATOM   4482  N N6    . DA  B 2 96  ? 133.958 97.150  75.663  1.00 75.08  ? 36  DA  J N6    1 
ATOM   4483  N N1    . DA  B 2 96  ? 131.683 97.397  75.978  1.00 76.29  ? 36  DA  J N1    1 
ATOM   4484  C C2    . DA  B 2 96  ? 130.666 97.713  76.787  1.00 74.64  ? 36  DA  J C2    1 
ATOM   4485  N N3    . DA  B 2 96  ? 130.688 98.078  78.067  1.00 72.23  ? 36  DA  J N3    1 
ATOM   4486  C C4    . DA  B 2 96  ? 131.948 98.104  78.530  1.00 72.55  ? 36  DA  J C4    1 
ATOM   4487  P P     . DA  B 2 97  ? 129.271 97.571  84.185  1.00 63.34  ? 37  DA  J P     1 
ATOM   4488  O OP1   . DA  B 2 97  ? 128.888 98.246  85.444  1.00 61.69  ? 37  DA  J OP1   1 
ATOM   4489  O OP2   . DA  B 2 97  ? 130.257 96.466  84.208  1.00 60.40  ? 37  DA  J OP2   1 
ATOM   4490  O "O5'" . DA  B 2 97  ? 127.937 97.027  83.535  1.00 62.52  ? 37  DA  J "O5'" 1 
ATOM   4491  C "C5'" . DA  B 2 97  ? 127.112 97.892  82.765  1.00 61.87  ? 37  DA  J "C5'" 1 
ATOM   4492  C "C4'" . DA  B 2 97  ? 126.480 97.109  81.645  1.00 59.84  ? 37  DA  J "C4'" 1 
ATOM   4493  O "O4'" . DA  B 2 97  ? 127.415 96.953  80.549  1.00 60.87  ? 37  DA  J "O4'" 1 
ATOM   4494  C "C3'" . DA  B 2 97  ? 126.136 95.704  82.117  1.00 58.86  ? 37  DA  J "C3'" 1 
ATOM   4495  O "O3'" . DA  B 2 97  ? 124.869 95.289  81.661  1.00 55.72  ? 37  DA  J "O3'" 1 
ATOM   4496  C "C2'" . DA  B 2 97  ? 127.223 94.836  81.523  1.00 61.23  ? 37  DA  J "C2'" 1 
ATOM   4497  C "C1'" . DA  B 2 97  ? 127.615 95.579  80.264  1.00 63.03  ? 37  DA  J "C1'" 1 
ATOM   4498  N N9    . DA  B 2 97  ? 129.026 95.393  79.934  1.00 65.13  ? 37  DA  J N9    1 
ATOM   4499  C C8    . DA  B 2 97  ? 130.099 95.522  80.783  1.00 64.93  ? 37  DA  J C8    1 
ATOM   4500  N N7    . DA  B 2 97  ? 131.253 95.278  80.215  1.00 68.07  ? 37  DA  J N7    1 
ATOM   4501  C C5    . DA  B 2 97  ? 130.921 94.974  78.902  1.00 68.36  ? 37  DA  J C5    1 
ATOM   4502  C C6    . DA  B 2 97  ? 131.702 94.626  77.786  1.00 70.20  ? 37  DA  J C6    1 
ATOM   4503  N N6    . DA  B 2 97  ? 133.031 94.524  77.820  1.00 69.87  ? 37  DA  J N6    1 
ATOM   4504  N N1    . DA  B 2 97  ? 131.060 94.384  76.620  1.00 69.66  ? 37  DA  J N1    1 
ATOM   4505  C C2    . DA  B 2 97  ? 129.726 94.488  76.591  1.00 68.77  ? 37  DA  J C2    1 
ATOM   4506  N N3    . DA  B 2 97  ? 128.882 94.808  77.574  1.00 68.61  ? 37  DA  J N3    1 
ATOM   4507  C C4    . DA  B 2 97  ? 129.551 95.042  78.715  1.00 66.67  ? 37  DA  J C4    1 
ATOM   4508  P P     . DT  B 2 98  ? 124.380 93.811  81.997  1.00 56.91  ? 38  DT  J P     1 
ATOM   4509  O OP1   . DT  B 2 98  ? 122.928 93.832  82.280  1.00 58.19  ? 38  DT  J OP1   1 
ATOM   4510  O OP2   . DT  B 2 98  ? 125.311 93.228  82.982  1.00 56.29  ? 38  DT  J OP2   1 
ATOM   4511  O "O5'" . DT  B 2 98  ? 124.643 93.071  80.628  1.00 63.12  ? 38  DT  J "O5'" 1 
ATOM   4512  C "C5'" . DT  B 2 98  ? 124.006 91.857  80.336  1.00 74.65  ? 38  DT  J "C5'" 1 
ATOM   4513  C "C4'" . DT  B 2 98  ? 123.832 91.741  78.845  1.00 81.83  ? 38  DT  J "C4'" 1 
ATOM   4514  O "O4'" . DT  B 2 98  ? 125.049 92.165  78.193  1.00 82.69  ? 38  DT  J "O4'" 1 
ATOM   4515  C "C3'" . DT  B 2 98  ? 123.592 90.308  78.409  1.00 85.63  ? 38  DT  J "C3'" 1 
ATOM   4516  O "O3'" . DT  B 2 98  ? 122.732 90.291  77.278  1.00 91.45  ? 38  DT  J "O3'" 1 
ATOM   4517  C "C2'" . DT  B 2 98  ? 124.991 89.806  78.100  1.00 85.62  ? 38  DT  J "C2'" 1 
ATOM   4518  C "C1'" . DT  B 2 98  ? 125.724 91.053  77.624  1.00 85.22  ? 38  DT  J "C1'" 1 
ATOM   4519  N N1    . DT  B 2 98  ? 127.141 91.134  78.044  1.00 86.06  ? 38  DT  J N1    1 
ATOM   4520  C C2    . DT  B 2 98  ? 128.118 90.779  77.140  1.00 86.35  ? 38  DT  J C2    1 
ATOM   4521  O O2    . DT  B 2 98  ? 127.869 90.350  76.026  1.00 88.01  ? 38  DT  J O2    1 
ATOM   4522  N N3    . DT  B 2 98  ? 129.406 90.938  77.595  1.00 85.37  ? 38  DT  J N3    1 
ATOM   4523  C C4    . DT  B 2 98  ? 129.802 91.390  78.839  1.00 85.89  ? 38  DT  J C4    1 
ATOM   4524  O O4    . DT  B 2 98  ? 130.999 91.501  79.099  1.00 84.93  ? 38  DT  J O4    1 
ATOM   4525  C C5    . DT  B 2 98  ? 128.723 91.710  79.749  1.00 86.02  ? 38  DT  J C5    1 
ATOM   4526  C C7    . DT  B 2 98  ? 129.053 92.174  81.133  1.00 85.66  ? 38  DT  J C7    1 
ATOM   4527  C C6    . DT  B 2 98  ? 127.466 91.572  79.309  1.00 85.85  ? 38  DT  J C6    1 
ATOM   4528  P P     . DA  B 2 99  ? 122.105 88.907  76.796  1.00 97.12  ? 39  DA  J P     1 
ATOM   4529  O OP1   . DA  B 2 99  ? 121.168 89.209  75.681  1.00 97.28  ? 39  DA  J OP1   1 
ATOM   4530  O OP2   . DA  B 2 99  ? 121.614 88.181  77.995  1.00 95.86  ? 39  DA  J OP2   1 
ATOM   4531  O "O5'" . DA  B 2 99  ? 123.373 88.148  76.208  1.00 98.81  ? 39  DA  J "O5'" 1 
ATOM   4532  C "C5'" . DA  B 2 99  ? 123.979 88.596  74.998  1.00 103.57 ? 39  DA  J "C5'" 1 
ATOM   4533  C "C4'" . DA  B 2 99  ? 125.039 87.619  74.555  1.00 106.55 ? 39  DA  J "C4'" 1 
ATOM   4534  O "O4'" . DA  B 2 99  ? 126.315 87.928  75.166  1.00 107.41 ? 39  DA  J "O4'" 1 
ATOM   4535  C "C3'" . DA  B 2 99  ? 124.726 86.168  74.921  1.00 108.30 ? 39  DA  J "C3'" 1 
ATOM   4536  O "O3'" . DA  B 2 99  ? 125.013 85.300  73.827  1.00 109.73 ? 39  DA  J "O3'" 1 
ATOM   4537  C "C2'" . DA  B 2 99  ? 125.652 85.889  76.092  1.00 108.04 ? 39  DA  J "C2'" 1 
ATOM   4538  C "C1'" . DA  B 2 99  ? 126.850 86.760  75.762  1.00 108.05 ? 39  DA  J "C1'" 1 
ATOM   4539  N N9    . DA  B 2 99  ? 127.649 87.170  76.917  1.00 108.63 ? 39  DA  J N9    1 
ATOM   4540  C C8    . DA  B 2 99  ? 127.204 87.642  78.125  1.00 109.46 ? 39  DA  J C8    1 
ATOM   4541  N N7    . DA  B 2 99  ? 128.166 87.937  78.966  1.00 109.52 ? 39  DA  J N7    1 
ATOM   4542  C C5    . DA  B 2 99  ? 129.324 87.630  78.267  1.00 109.24 ? 39  DA  J C5    1 
ATOM   4543  C C6    . DA  B 2 99  ? 130.683 87.715  78.608  1.00 109.43 ? 39  DA  J C6    1 
ATOM   4544  N N6    . DA  B 2 99  ? 131.123 88.147  79.792  1.00 109.30 ? 39  DA  J N6    1 
ATOM   4545  N N1    . DA  B 2 99  ? 131.587 87.332  77.681  1.00 109.18 ? 39  DA  J N1    1 
ATOM   4546  C C2    . DA  B 2 99  ? 131.143 86.893  76.499  1.00 109.37 ? 39  DA  J C2    1 
ATOM   4547  N N3    . DA  B 2 99  ? 129.892 86.765  76.062  1.00 109.33 ? 39  DA  J N3    1 
ATOM   4548  C C4    . DA  B 2 99  ? 129.020 87.155  77.004  1.00 109.07 ? 39  DA  J C4    1 
ATOM   4549  P P     . DC  B 2 100 ? 124.706 83.733  73.961  1.00 110.98 ? 40  DC  J P     1 
ATOM   4550  O OP1   . DC  B 2 100 ? 124.434 83.217  72.596  1.00 110.15 ? 40  DC  J OP1   1 
ATOM   4551  O OP2   . DC  B 2 100 ? 123.702 83.529  75.039  1.00 110.33 ? 40  DC  J OP2   1 
ATOM   4552  O "O5'" . DC  B 2 100 ? 126.097 83.144  74.457  1.00 112.07 ? 40  DC  J "O5'" 1 
ATOM   4553  C "C5'" . DC  B 2 100 ? 127.250 83.232  73.627  1.00 115.48 ? 40  DC  J "C5'" 1 
ATOM   4554  C "C4'" . DC  B 2 100 ? 128.372 82.407  74.209  1.00 117.97 ? 40  DC  J "C4'" 1 
ATOM   4555  O "O4'" . DC  B 2 100 ? 129.023 83.125  75.286  1.00 118.51 ? 40  DC  J "O4'" 1 
ATOM   4556  C "C3'" . DC  B 2 100 ? 127.921 81.070  74.796  1.00 119.30 ? 40  DC  J "C3'" 1 
ATOM   4557  O "O3'" . DC  B 2 100 ? 128.882 80.059  74.495  1.00 121.14 ? 40  DC  J "O3'" 1 
ATOM   4558  C "C2'" . DC  B 2 100 ? 127.917 81.333  76.290  1.00 119.18 ? 40  DC  J "C2'" 1 
ATOM   4559  C "C1'" . DC  B 2 100 ? 129.091 82.283  76.423  1.00 119.40 ? 40  DC  J "C1'" 1 
ATOM   4560  N N1    . DC  B 2 100 ? 129.084 83.132  77.626  1.00 119.94 ? 40  DC  J N1    1 
ATOM   4561  C C2    . DC  B 2 100 ? 130.293 83.667  78.072  1.00 120.44 ? 40  DC  J C2    1 
ATOM   4562  O O2    . DC  B 2 100 ? 131.325 83.431  77.428  1.00 120.32 ? 40  DC  J O2    1 
ATOM   4563  N N3    . DC  B 2 100 ? 130.307 84.427  79.189  1.00 121.12 ? 40  DC  J N3    1 
ATOM   4564  C C4    . DC  B 2 100 ? 129.172 84.662  79.851  1.00 120.76 ? 40  DC  J C4    1 
ATOM   4565  N N4    . DC  B 2 100 ? 129.236 85.410  80.953  1.00 120.94 ? 40  DC  J N4    1 
ATOM   4566  C C5    . DC  B 2 100 ? 127.922 84.138  79.411  1.00 120.58 ? 40  DC  J C5    1 
ATOM   4567  C C6    . DC  B 2 100 ? 127.924 83.387  78.303  1.00 120.18 ? 40  DC  J C6    1 
ATOM   4568  P P     . DA  B 2 101 ? 128.540 78.522  74.797  1.00 122.65 ? 41  DA  J P     1 
ATOM   4569  O OP1   . DA  B 2 101 ? 128.326 77.838  73.498  1.00 123.52 ? 41  DA  J OP1   1 
ATOM   4570  O OP2   . DA  B 2 101 ? 127.483 78.464  75.838  1.00 122.46 ? 41  DA  J OP2   1 
ATOM   4571  O "O5'" . DA  B 2 101 ? 129.891 77.976  75.434  1.00 122.79 ? 41  DA  J "O5'" 1 
ATOM   4572  C "C5'" . DA  B 2 101 ? 131.138 78.181  74.777  1.00 123.55 ? 41  DA  J "C5'" 1 
ATOM   4573  C "C4'" . DA  B 2 101 ? 132.271 77.781  75.689  1.00 124.02 ? 41  DA  J "C4'" 1 
ATOM   4574  O "O4'" . DA  B 2 101 ? 132.425 78.770  76.735  1.00 123.87 ? 41  DA  J "O4'" 1 
ATOM   4575  C "C3'" . DA  B 2 101 ? 132.013 76.453  76.396  1.00 124.30 ? 41  DA  J "C3'" 1 
ATOM   4576  O "O3'" . DA  B 2 101 ? 133.229 75.708  76.515  1.00 124.55 ? 41  DA  J "O3'" 1 
ATOM   4577  C "C2'" . DA  B 2 101 ? 131.472 76.881  77.749  1.00 123.99 ? 41  DA  J "C2'" 1 
ATOM   4578  C "C1'" . DA  B 2 101 ? 132.228 78.174  78.008  1.00 124.21 ? 41  DA  J "C1'" 1 
ATOM   4579  N N9    . DA  B 2 101 ? 131.516 79.138  78.851  1.00 124.14 ? 41  DA  J N9    1 
ATOM   4580  C C8    . DA  B 2 101 ? 130.179 79.450  78.831  1.00 123.87 ? 41  DA  J C8    1 
ATOM   4581  N N7    . DA  B 2 101 ? 129.835 80.362  79.708  1.00 123.55 ? 41  DA  J N7    1 
ATOM   4582  C C5    . DA  B 2 101 ? 131.025 80.672  80.350  1.00 123.65 ? 41  DA  J C5    1 
ATOM   4583  C C6    . DA  B 2 101 ? 131.336 81.573  81.386  1.00 123.96 ? 41  DA  J C6    1 
ATOM   4584  N N6    . DA  B 2 101 ? 130.434 82.357  81.983  1.00 123.28 ? 41  DA  J N6    1 
ATOM   4585  N N1    . DA  B 2 101 ? 132.622 81.642  81.793  1.00 123.68 ? 41  DA  J N1    1 
ATOM   4586  C C2    . DA  B 2 101 ? 133.524 80.855  81.196  1.00 123.92 ? 41  DA  J C2    1 
ATOM   4587  N N3    . DA  B 2 101 ? 133.354 79.970  80.216  1.00 123.98 ? 41  DA  J N3    1 
ATOM   4588  C C4    . DA  B 2 101 ? 132.068 79.926  79.832  1.00 123.77 ? 41  DA  J C4    1 
ATOM   4589  P P     . DC  B 2 102 ? 133.172 74.108  76.654  1.00 125.26 ? 42  DC  J P     1 
ATOM   4590  O OP1   . DC  B 2 102 ? 134.260 73.527  75.827  1.00 126.05 ? 42  DC  J OP1   1 
ATOM   4591  O OP2   . DC  B 2 102 ? 131.767 73.681  76.428  1.00 125.09 ? 42  DC  J OP2   1 
ATOM   4592  O "O5'" . DC  B 2 102 ? 133.523 73.868  78.186  1.00 124.46 ? 42  DC  J "O5'" 1 
ATOM   4593  C "C5'" . DC  B 2 102 ? 133.358 74.924  79.124  1.00 123.43 ? 42  DC  J "C5'" 1 
ATOM   4594  C "C4'" . DC  B 2 102 ? 134.668 75.229  79.805  1.00 122.20 ? 42  DC  J "C4'" 1 
ATOM   4595  O "O4'" . DC  B 2 102 ? 134.557 76.505  80.473  1.00 122.31 ? 42  DC  J "O4'" 1 
ATOM   4596  C "C3'" . DC  B 2 102 ? 135.037 74.220  80.882  1.00 121.92 ? 42  DC  J "C3'" 1 
ATOM   4597  O "O3'" . DC  B 2 102 ? 136.452 74.052  80.950  1.00 120.99 ? 42  DC  J "O3'" 1 
ATOM   4598  C "C2'" . DC  B 2 102 ? 134.483 74.842  82.151  1.00 122.13 ? 42  DC  J "C2'" 1 
ATOM   4599  C "C1'" . DC  B 2 102 ? 134.541 76.339  81.884  1.00 122.10 ? 42  DC  J "C1'" 1 
ATOM   4600  N N1    . DC  B 2 102 ? 133.364 77.058  82.387  1.00 122.22 ? 42  DC  J N1    1 
ATOM   4601  C C2    . DC  B 2 102 ? 133.531 78.042  83.360  1.00 122.09 ? 42  DC  J C2    1 
ATOM   4602  O O2    . DC  B 2 102 ? 134.670 78.277  83.785  1.00 122.20 ? 42  DC  J O2    1 
ATOM   4603  N N3    . DC  B 2 102 ? 132.445 78.714  83.813  1.00 122.19 ? 42  DC  J N3    1 
ATOM   4604  C C4    . DC  B 2 102 ? 131.234 78.426  83.330  1.00 122.53 ? 42  DC  J C4    1 
ATOM   4605  N N4    . DC  B 2 102 ? 130.190 79.112  83.802  1.00 122.35 ? 42  DC  J N4    1 
ATOM   4606  C C5    . DC  B 2 102 ? 131.037 77.424  82.339  1.00 122.75 ? 42  DC  J C5    1 
ATOM   4607  C C6    . DC  B 2 102 ? 132.118 76.771  81.902  1.00 122.61 ? 42  DC  J C6    1 
ATOM   4608  P P     . DT  B 2 103 ? 137.080 73.104  82.080  1.00 120.26 ? 43  DT  J P     1 
ATOM   4609  O OP1   . DT  B 2 103 ? 138.502 72.866  81.727  1.00 120.78 ? 43  DT  J OP1   1 
ATOM   4610  O OP2   . DT  B 2 103 ? 136.167 71.950  82.286  1.00 120.23 ? 43  DT  J OP2   1 
ATOM   4611  O "O5'" . DT  B 2 103 ? 137.033 74.012  83.384  1.00 118.44 ? 43  DT  J "O5'" 1 
ATOM   4612  C "C5'" . DT  B 2 103 ? 137.887 75.143  83.510  1.00 116.23 ? 43  DT  J "C5'" 1 
ATOM   4613  C "C4'" . DT  B 2 103 ? 137.962 75.570  84.956  1.00 114.73 ? 43  DT  J "C4'" 1 
ATOM   4614  O "O4'" . DT  B 2 103 ? 136.770 76.305  85.327  1.00 114.24 ? 43  DT  J "O4'" 1 
ATOM   4615  C "C3'" . DT  B 2 103 ? 138.065 74.400  85.932  1.00 113.58 ? 43  DT  J "C3'" 1 
ATOM   4616  O "O3'" . DT  B 2 103 ? 138.991 74.713  86.969  1.00 112.03 ? 43  DT  J "O3'" 1 
ATOM   4617  C "C2'" . DT  B 2 103 ? 136.655 74.268  86.478  1.00 113.38 ? 43  DT  J "C2'" 1 
ATOM   4618  C "C1'" . DT  B 2 103 ? 136.165 75.703  86.461  1.00 113.79 ? 43  DT  J "C1'" 1 
ATOM   4619  N N1    . DT  B 2 103 ? 134.702 75.843  86.325  1.00 113.60 ? 43  DT  J N1    1 
ATOM   4620  C C2    . DT  B 2 103 ? 134.052 76.748  87.142  1.00 113.41 ? 43  DT  J C2    1 
ATOM   4621  O O2    . DT  B 2 103 ? 134.632 77.453  87.952  1.00 113.53 ? 43  DT  J O2    1 
ATOM   4622  N N3    . DT  B 2 103 ? 132.690 76.795  86.971  1.00 112.82 ? 43  DT  J N3    1 
ATOM   4623  C C4    . DT  B 2 103 ? 131.932 76.050  86.086  1.00 113.08 ? 43  DT  J C4    1 
ATOM   4624  O O4    . DT  B 2 103 ? 130.714 76.193  86.052  1.00 112.66 ? 43  DT  J O4    1 
ATOM   4625  C C5    . DT  B 2 103 ? 132.677 75.136  85.254  1.00 112.94 ? 43  DT  J C5    1 
ATOM   4626  C C7    . DT  B 2 103 ? 131.939 74.295  84.260  1.00 112.53 ? 43  DT  J C7    1 
ATOM   4627  C C6    . DT  B 2 103 ? 134.006 75.079  85.412  1.00 112.95 ? 43  DT  J C6    1 
ATOM   4628  P P     . DT  B 2 104 ? 139.078 73.774  88.266  1.00 110.72 ? 44  DT  J P     1 
ATOM   4629  O OP1   . DT  B 2 104 ? 140.514 73.689  88.635  1.00 112.26 ? 44  DT  J OP1   1 
ATOM   4630  O OP2   . DT  B 2 104 ? 138.301 72.530  88.038  1.00 110.35 ? 44  DT  J OP2   1 
ATOM   4631  O "O5'" . DT  B 2 104 ? 138.332 74.643  89.369  1.00 108.35 ? 44  DT  J "O5'" 1 
ATOM   4632  C "C5'" . DT  B 2 104 ? 138.569 76.042  89.450  1.00 102.95 ? 44  DT  J "C5'" 1 
ATOM   4633  C "C4'" . DT  B 2 104 ? 137.808 76.636  90.610  1.00 98.73  ? 44  DT  J "C4'" 1 
ATOM   4634  O "O4'" . DT  B 2 104 ? 136.400 76.733  90.294  1.00 97.00  ? 44  DT  J "O4'" 1 
ATOM   4635  C "C3'" . DT  B 2 104 ? 137.905 75.838  91.909  1.00 95.95  ? 44  DT  J "C3'" 1 
ATOM   4636  O "O3'" . DT  B 2 104 ? 138.109 76.743  92.991  1.00 93.46  ? 44  DT  J "O3'" 1 
ATOM   4637  C "C2'" . DT  B 2 104 ? 136.559 75.139  92.002  1.00 94.79  ? 44  DT  J "C2'" 1 
ATOM   4638  C "C1'" . DT  B 2 104 ? 135.631 76.125  91.319  1.00 95.27  ? 44  DT  J "C1'" 1 
ATOM   4639  N N1    . DT  B 2 104 ? 134.428 75.536  90.694  1.00 93.64  ? 44  DT  J N1    1 
ATOM   4640  C C2    . DT  B 2 104 ? 133.209 76.096  90.997  1.00 93.53  ? 44  DT  J C2    1 
ATOM   4641  O O2    . DT  B 2 104 ? 133.080 77.028  91.776  1.00 93.59  ? 44  DT  J O2    1 
ATOM   4642  N N3    . DT  B 2 104 ? 132.139 75.523  90.354  1.00 92.69  ? 44  DT  J N3    1 
ATOM   4643  C C4    . DT  B 2 104 ? 132.165 74.465  89.466  1.00 91.73  ? 44  DT  J C4    1 
ATOM   4644  O O4    . DT  B 2 104 ? 131.121 74.065  88.958  1.00 88.94  ? 44  DT  J O4    1 
ATOM   4645  C C5    . DT  B 2 104 ? 133.474 73.911  89.211  1.00 92.10  ? 44  DT  J C5    1 
ATOM   4646  C C7    . DT  B 2 104 ? 133.595 72.748  88.281  1.00 92.75  ? 44  DT  J C7    1 
ATOM   4647  C C6    . DT  B 2 104 ? 134.526 74.468  89.826  1.00 93.19  ? 44  DT  J C6    1 
ATOM   4648  P P     . DT  B 2 105 ? 138.073 76.209  94.502  1.00 91.83  ? 45  DT  J P     1 
ATOM   4649  O OP1   . DT  B 2 105 ? 139.198 76.861  95.218  1.00 92.15  ? 45  DT  J OP1   1 
ATOM   4650  O OP2   . DT  B 2 105 ? 137.936 74.733  94.531  1.00 91.52  ? 45  DT  J OP2   1 
ATOM   4651  O "O5'" . DT  B 2 105 ? 136.728 76.857  95.040  1.00 91.53  ? 45  DT  J "O5'" 1 
ATOM   4652  C "C5'" . DT  B 2 105 ? 136.412 78.195  94.690  1.00 87.50  ? 45  DT  J "C5'" 1 
ATOM   4653  C "C4'" . DT  B 2 105 ? 135.107 78.604  95.318  1.00 84.01  ? 45  DT  J "C4'" 1 
ATOM   4654  O "O4'" . DT  B 2 105 ? 134.021 77.916  94.657  1.00 81.79  ? 45  DT  J "O4'" 1 
ATOM   4655  C "C3'" . DT  B 2 105 ? 134.994 78.275  96.805  1.00 82.49  ? 45  DT  J "C3'" 1 
ATOM   4656  O "O3'" . DT  B 2 105 ? 134.448 79.407  97.486  1.00 80.50  ? 45  DT  J "O3'" 1 
ATOM   4657  C "C2'" . DT  B 2 105 ? 134.077 77.061  96.836  1.00 80.93  ? 45  DT  J "C2'" 1 
ATOM   4658  C "C1'" . DT  B 2 105 ? 133.207 77.258  95.605  1.00 81.39  ? 45  DT  J "C1'" 1 
ATOM   4659  N N1    . DT  B 2 105 ? 132.698 76.027  94.968  1.00 83.14  ? 45  DT  J N1    1 
ATOM   4660  C C2    . DT  B 2 105 ? 131.383 76.012  94.561  1.00 84.66  ? 45  DT  J C2    1 
ATOM   4661  O O2    . DT  B 2 105 ? 130.630 76.955  94.720  1.00 87.08  ? 45  DT  J O2    1 
ATOM   4662  N N3    . DT  B 2 105 ? 130.981 74.850  93.958  1.00 85.50  ? 45  DT  J N3    1 
ATOM   4663  C C4    . DT  B 2 105 ? 131.747 73.722  93.724  1.00 87.33  ? 45  DT  J C4    1 
ATOM   4664  O O4    . DT  B 2 105 ? 131.251 72.746  93.162  1.00 89.03  ? 45  DT  J O4    1 
ATOM   4665  C C5    . DT  B 2 105 ? 133.115 73.804  94.180  1.00 85.73  ? 45  DT  J C5    1 
ATOM   4666  C C7    . DT  B 2 105 ? 134.020 72.634  93.962  1.00 87.47  ? 45  DT  J C7    1 
ATOM   4667  C C6    . DT  B 2 105 ? 133.516 74.935  94.778  1.00 85.21  ? 45  DT  J C6    1 
ATOM   4668  P P     . DT  B 2 106 ? 134.083 79.310  99.040  1.00 77.47  ? 46  DT  J P     1 
ATOM   4669  O OP1   . DT  B 2 106 ? 134.302 80.660  99.616  1.00 77.57  ? 46  DT  J OP1   1 
ATOM   4670  O OP2   . DT  B 2 106 ? 134.744 78.130  99.652  1.00 80.26  ? 46  DT  J OP2   1 
ATOM   4671  O "O5'" . DT  B 2 106 ? 132.522 79.030  98.996  1.00 80.01  ? 46  DT  J "O5'" 1 
ATOM   4672  C "C5'" . DT  B 2 106 ? 131.679 79.822  98.161  1.00 79.42  ? 46  DT  J "C5'" 1 
ATOM   4673  C "C4'" . DT  B 2 106 ? 130.236 79.465  98.408  1.00 78.69  ? 46  DT  J "C4'" 1 
ATOM   4674  O "O4'" . DT  B 2 106 ? 129.874 78.277  97.661  1.00 78.75  ? 46  DT  J "O4'" 1 
ATOM   4675  C "C3'" . DT  B 2 106 ? 129.954 79.158  99.878  1.00 78.63  ? 46  DT  J "C3'" 1 
ATOM   4676  O "O3'" . DT  B 2 106 ? 128.723 79.744  100.262 1.00 77.23  ? 46  DT  J "O3'" 1 
ATOM   4677  C "C2'" . DT  B 2 106 ? 129.848 77.644  99.909  1.00 80.30  ? 46  DT  J "C2'" 1 
ATOM   4678  C "C1'" . DT  B 2 106 ? 129.298 77.322  98.531  1.00 79.89  ? 46  DT  J "C1'" 1 
ATOM   4679  N N1    . DT  B 2 106 ? 129.656 75.978  98.043  1.00 80.25  ? 46  DT  J N1    1 
ATOM   4680  C C2    . DT  B 2 106 ? 128.675 75.212  97.452  1.00 80.68  ? 46  DT  J C2    1 
ATOM   4681  O O2    . DT  B 2 106 ? 127.534 75.601  97.279  1.00 78.52  ? 46  DT  J O2    1 
ATOM   4682  N N3    . DT  B 2 106 ? 129.087 73.964  97.058  1.00 83.12  ? 46  DT  J N3    1 
ATOM   4683  C C4    . DT  B 2 106 ? 130.353 73.421  97.178  1.00 82.34  ? 46  DT  J C4    1 
ATOM   4684  O O4    . DT  B 2 106 ? 130.570 72.282  96.769  1.00 83.65  ? 46  DT  J O4    1 
ATOM   4685  C C5    . DT  B 2 106 ? 131.335 74.283  97.793  1.00 80.88  ? 46  DT  J C5    1 
ATOM   4686  C C7    . DT  B 2 106 ? 132.735 73.785  97.962  1.00 80.33  ? 46  DT  J C7    1 
ATOM   4687  C C6    . DT  B 2 106 ? 130.943 75.501  98.188  1.00 80.28  ? 46  DT  J C6    1 
ATOM   4688  P P     . DG  B 2 107 ? 128.384 79.971  101.815 1.00 78.22  ? 47  DG  J P     1 
ATOM   4689  O OP1   . DG  B 2 107 ? 129.003 81.246  102.249 1.00 78.36  ? 47  DG  J OP1   1 
ATOM   4690  O OP2   . DG  B 2 107 ? 128.645 78.728  102.590 1.00 76.10  ? 47  DG  J OP2   1 
ATOM   4691  O "O5'" . DG  B 2 107 ? 126.817 80.194  101.740 1.00 72.36  ? 47  DG  J "O5'" 1 
ATOM   4692  C "C5'" . DG  B 2 107 ? 126.260 80.778  100.576 1.00 62.47  ? 47  DG  J "C5'" 1 
ATOM   4693  C "C4'" . DG  B 2 107 ? 125.007 80.048  100.177 1.00 57.93  ? 47  DG  J "C4'" 1 
ATOM   4694  O "O4'" . DG  B 2 107 ? 125.320 78.723  99.696  1.00 58.87  ? 47  DG  J "O4'" 1 
ATOM   4695  C "C3'" . DG  B 2 107 ? 124.013 79.870  101.317 1.00 54.34  ? 47  DG  J "C3'" 1 
ATOM   4696  O "O3'" . DG  B 2 107 ? 122.722 80.137  100.796 1.00 52.52  ? 47  DG  J "O3'" 1 
ATOM   4697  C "C2'" . DG  B 2 107 ? 124.214 78.429  101.757 1.00 56.39  ? 47  DG  J "C2'" 1 
ATOM   4698  C "C1'" . DG  B 2 107 ? 124.713 77.724  100.503 1.00 58.31  ? 47  DG  J "C1'" 1 
ATOM   4699  N N9    . DG  B 2 107 ? 125.738 76.723  100.778 1.00 62.37  ? 47  DG  J N9    1 
ATOM   4700  C C8    . DG  B 2 107 ? 126.785 76.851  101.655 1.00 62.66  ? 47  DG  J C8    1 
ATOM   4701  N N7    . DG  B 2 107 ? 127.578 75.818  101.660 1.00 63.58  ? 47  DG  J N7    1 
ATOM   4702  C C5    . DG  B 2 107 ? 127.017 74.946  100.742 1.00 62.48  ? 47  DG  J C5    1 
ATOM   4703  C C6    . DG  B 2 107 ? 127.445 73.660  100.317 1.00 62.64  ? 47  DG  J C6    1 
ATOM   4704  O O6    . DG  B 2 107 ? 128.436 73.020  100.687 1.00 61.09  ? 47  DG  J O6    1 
ATOM   4705  N N1    . DG  B 2 107 ? 126.586 73.125  99.366  1.00 62.26  ? 47  DG  J N1    1 
ATOM   4706  C C2    . DG  B 2 107 ? 125.457 73.746  98.883  1.00 65.21  ? 47  DG  J C2    1 
ATOM   4707  N N2    . DG  B 2 107 ? 124.749 73.070  97.964  1.00 61.70  ? 47  DG  J N2    1 
ATOM   4708  N N3    . DG  B 2 107 ? 125.050 74.945  99.272  1.00 63.51  ? 47  DG  J N3    1 
ATOM   4709  C C4    . DG  B 2 107 ? 125.872 75.482  100.195 1.00 62.57  ? 47  DG  J C4    1 
ATOM   4710  P P     . DG  B 2 108 ? 121.425 79.855  101.675 1.00 48.28  ? 48  DG  J P     1 
ATOM   4711  O OP1   . DG  B 2 108 ? 120.370 80.799  101.227 1.00 46.60  ? 48  DG  J OP1   1 
ATOM   4712  O OP2   . DG  B 2 108 ? 121.763 79.761  103.111 1.00 45.53  ? 48  DG  J OP2   1 
ATOM   4713  O "O5'" . DG  B 2 108 ? 121.036 78.428  101.135 1.00 53.32  ? 48  DG  J "O5'" 1 
ATOM   4714  C "C5'" . DG  B 2 108 ? 120.245 77.579  101.895 1.00 56.94  ? 48  DG  J "C5'" 1 
ATOM   4715  C "C4'" . DG  B 2 108 ? 119.921 76.357  101.084 1.00 60.52  ? 48  DG  J "C4'" 1 
ATOM   4716  O "O4'" . DG  B 2 108 ? 121.138 75.656  100.733 1.00 60.36  ? 48  DG  J "O4'" 1 
ATOM   4717  C "C3'" . DG  B 2 108 ? 119.095 75.396  101.909 1.00 62.15  ? 48  DG  J "C3'" 1 
ATOM   4718  O "O3'" . DG  B 2 108 ? 118.062 74.871  101.119 1.00 65.47  ? 48  DG  J "O3'" 1 
ATOM   4719  C "C2'" . DG  B 2 108 ? 120.081 74.345  102.368 1.00 64.08  ? 48  DG  J "C2'" 1 
ATOM   4720  C "C1'" . DG  B 2 108 ? 121.117 74.342  101.266 1.00 63.88  ? 48  DG  J "C1'" 1 
ATOM   4721  N N9    . DG  B 2 108 ? 122.452 74.035  101.763 1.00 66.52  ? 48  DG  J N9    1 
ATOM   4722  C C8    . DG  B 2 108 ? 123.256 74.830  102.544 1.00 69.06  ? 48  DG  J C8    1 
ATOM   4723  N N7    . DG  B 2 108 ? 124.390 74.259  102.855 1.00 70.89  ? 48  DG  J N7    1 
ATOM   4724  C C5    . DG  B 2 108 ? 124.330 73.020  102.233 1.00 71.31  ? 48  DG  J C5    1 
ATOM   4725  C C6    . DG  B 2 108 ? 125.264 71.954  102.217 1.00 73.17  ? 48  DG  J C6    1 
ATOM   4726  O O6    . DG  B 2 108 ? 126.369 71.887  102.773 1.00 75.07  ? 48  DG  J O6    1 
ATOM   4727  N N1    . DG  B 2 108 ? 124.799 70.881  101.462 1.00 72.83  ? 48  DG  J N1    1 
ATOM   4728  C C2    . DG  B 2 108 ? 123.589 70.835  100.816 1.00 71.74  ? 48  DG  J C2    1 
ATOM   4729  N N2    . DG  B 2 108 ? 123.317 69.705  100.143 1.00 71.71  ? 48  DG  J N2    1 
ATOM   4730  N N3    . DG  B 2 108 ? 122.709 71.818  100.828 1.00 70.29  ? 48  DG  J N3    1 
ATOM   4731  C C4    . DG  B 2 108 ? 123.142 72.872  101.550 1.00 69.68  ? 48  DG  J C4    1 
ATOM   4732  P P     . DT  B 2 109 ? 116.735 74.393  101.834 1.00 71.21  ? 49  DT  J P     1 
ATOM   4733  O OP1   . DT  B 2 109 ? 115.567 74.869  101.058 1.00 70.94  ? 49  DT  J OP1   1 
ATOM   4734  O OP2   . DT  B 2 109 ? 116.899 74.795  103.249 1.00 72.00  ? 49  DT  J OP2   1 
ATOM   4735  O "O5'" . DT  B 2 109 ? 116.856 72.812  101.750 1.00 77.71  ? 49  DT  J "O5'" 1 
ATOM   4736  C "C5'" . DT  B 2 109 ? 117.901 72.201  100.991 1.00 84.41  ? 49  DT  J "C5'" 1 
ATOM   4737  C "C4'" . DT  B 2 109 ? 118.298 70.888  101.624 1.00 90.20  ? 49  DT  J "C4'" 1 
ATOM   4738  O "O4'" . DT  B 2 109 ? 119.659 70.935  102.122 1.00 89.87  ? 49  DT  J "O4'" 1 
ATOM   4739  C "C3'" . DT  B 2 109 ? 117.419 70.496  102.811 1.00 93.67  ? 49  DT  J "C3'" 1 
ATOM   4740  O "O3'" . DT  B 2 109 ? 117.090 69.114  102.741 1.00 100.77 ? 49  DT  J "O3'" 1 
ATOM   4741  C "C2'" . DT  B 2 109 ? 118.310 70.751  104.012 1.00 92.76  ? 49  DT  J "C2'" 1 
ATOM   4742  C "C1'" . DT  B 2 109 ? 119.675 70.425  103.445 1.00 91.68  ? 49  DT  J "C1'" 1 
ATOM   4743  N N1    . DT  B 2 109 ? 120.820 71.020  104.166 1.00 93.43  ? 49  DT  J N1    1 
ATOM   4744  C C2    . DT  B 2 109 ? 122.078 70.503  103.927 1.00 93.43  ? 49  DT  J C2    1 
ATOM   4745  O O2    . DT  B 2 109 ? 122.291 69.606  103.126 1.00 93.56  ? 49  DT  J O2    1 
ATOM   4746  N N3    . DT  B 2 109 ? 123.084 71.083  104.661 1.00 92.21  ? 49  DT  J N3    1 
ATOM   4747  C C4    . DT  B 2 109 ? 122.964 72.107  105.580 1.00 92.90  ? 49  DT  J C4    1 
ATOM   4748  O O4    . DT  B 2 109 ? 123.959 72.522  106.171 1.00 90.89  ? 49  DT  J O4    1 
ATOM   4749  C C5    . DT  B 2 109 ? 121.622 72.612  105.767 1.00 93.43  ? 49  DT  J C5    1 
ATOM   4750  C C7    . DT  B 2 109 ? 121.397 73.733  106.732 1.00 96.25  ? 49  DT  J C7    1 
ATOM   4751  C C6    . DT  B 2 109 ? 120.631 72.049  105.062 1.00 93.76  ? 49  DT  J C6    1 
ATOM   4752  P P     . DA  B 2 110 ? 115.628 68.629  103.177 1.00 106.73 ? 50  DA  J P     1 
ATOM   4753  O OP1   . DA  B 2 110 ? 114.660 68.979  102.106 1.00 106.87 ? 50  DA  J OP1   1 
ATOM   4754  O OP2   . DA  B 2 110 ? 115.399 69.111  104.562 1.00 107.00 ? 50  DA  J OP2   1 
ATOM   4755  O "O5'" . DA  B 2 110 ? 115.764 67.049  103.218 1.00 109.33 ? 50  DA  J "O5'" 1 
ATOM   4756  C "C5'" . DA  B 2 110 ? 116.390 66.342  102.158 1.00 113.99 ? 50  DA  J "C5'" 1 
ATOM   4757  C "C4'" . DA  B 2 110 ? 117.224 65.225  102.732 1.00 117.20 ? 50  DA  J "C4'" 1 
ATOM   4758  O "O4'" . DA  B 2 110 ? 118.520 65.740  103.127 1.00 117.89 ? 50  DA  J "O4'" 1 
ATOM   4759  C "C3'" . DA  B 2 110 ? 116.582 64.657  103.997 1.00 119.44 ? 50  DA  J "C3'" 1 
ATOM   4760  O "O3'" . DA  B 2 110 ? 116.644 63.235  104.036 1.00 122.37 ? 50  DA  J "O3'" 1 
ATOM   4761  C "C2'" . DA  B 2 110 ? 117.394 65.272  105.123 1.00 119.32 ? 50  DA  J "C2'" 1 
ATOM   4762  C "C1'" . DA  B 2 110 ? 118.762 65.453  104.494 1.00 118.89 ? 50  DA  J "C1'" 1 
ATOM   4763  N N9    . DA  B 2 110 ? 119.522 66.567  105.062 1.00 118.79 ? 50  DA  J N9    1 
ATOM   4764  C C8    . DA  B 2 110 ? 119.064 67.830  105.336 1.00 119.21 ? 50  DA  J C8    1 
ATOM   4765  N N7    . DA  B 2 110 ? 119.969 68.619  105.863 1.00 119.45 ? 50  DA  J N7    1 
ATOM   4766  C C5    . DA  B 2 110 ? 121.101 67.821  105.941 1.00 119.44 ? 50  DA  J C5    1 
ATOM   4767  C C6    . DA  B 2 110 ? 122.403 68.070  106.414 1.00 119.48 ? 50  DA  J C6    1 
ATOM   4768  N N6    . DA  B 2 110 ? 122.799 69.240  106.920 1.00 119.09 ? 50  DA  J N6    1 
ATOM   4769  N N1    . DA  B 2 110 ? 123.297 67.059  106.351 1.00 119.50 ? 50  DA  J N1    1 
ATOM   4770  C C2    . DA  B 2 110 ? 122.900 65.887  105.844 1.00 119.17 ? 50  DA  J C2    1 
ATOM   4771  N N3    . DA  B 2 110 ? 121.708 65.533  105.367 1.00 119.43 ? 50  DA  J N3    1 
ATOM   4772  C C4    . DA  B 2 110 ? 120.842 66.557  105.445 1.00 119.08 ? 50  DA  J C4    1 
ATOM   4773  P P     . DG  B 2 111 ? 115.976 62.460  105.270 1.00 123.95 ? 51  DG  J P     1 
ATOM   4774  O OP1   . DG  B 2 111 ? 115.637 61.089  104.813 1.00 124.82 ? 51  DG  J OP1   1 
ATOM   4775  O OP2   . DG  B 2 111 ? 114.916 63.324  105.851 1.00 123.61 ? 51  DG  J OP2   1 
ATOM   4776  O "O5'" . DG  B 2 111 ? 117.169 62.359  106.316 1.00 125.96 ? 51  DG  J "O5'" 1 
ATOM   4777  C "C5'" . DG  B 2 111 ? 118.326 61.590  106.011 1.00 129.37 ? 51  DG  J "C5'" 1 
ATOM   4778  C "C4'" . DG  B 2 111 ? 119.091 61.279  107.275 1.00 131.85 ? 51  DG  J "C4'" 1 
ATOM   4779  O "O4'" . DG  B 2 111 ? 119.900 62.416  107.664 1.00 132.31 ? 51  DG  J "O4'" 1 
ATOM   4780  C "C3'" . DG  B 2 111 ? 118.206 60.942  108.476 1.00 133.11 ? 51  DG  J "C3'" 1 
ATOM   4781  O "O3'" . DG  B 2 111 ? 118.735 59.813  109.173 1.00 135.16 ? 51  DG  J "O3'" 1 
ATOM   4782  C "C2'" . DG  B 2 111 ? 118.280 62.197  109.329 1.00 133.39 ? 51  DG  J "C2'" 1 
ATOM   4783  C "C1'" . DG  B 2 111 ? 119.674 62.710  109.032 1.00 133.31 ? 51  DG  J "C1'" 1 
ATOM   4784  N N9    . DG  B 2 111 ? 119.837 64.147  109.220 1.00 134.03 ? 51  DG  J N9    1 
ATOM   4785  C C8    . DG  B 2 111 ? 118.884 65.121  109.034 1.00 134.78 ? 51  DG  J C8    1 
ATOM   4786  N N7    . DG  B 2 111 ? 119.317 66.322  109.305 1.00 134.71 ? 51  DG  J N7    1 
ATOM   4787  C C5    . DG  B 2 111 ? 120.636 66.132  109.691 1.00 134.29 ? 51  DG  J C5    1 
ATOM   4788  C C6    . DG  B 2 111 ? 121.615 67.071  110.108 1.00 134.01 ? 51  DG  J C6    1 
ATOM   4789  O O6    . DG  B 2 111 ? 121.508 68.298  110.225 1.00 133.87 ? 51  DG  J O6    1 
ATOM   4790  N N1    . DG  B 2 111 ? 122.824 66.451  110.404 1.00 134.43 ? 51  DG  J N1    1 
ATOM   4791  C C2    . DG  B 2 111 ? 123.062 65.103  110.313 1.00 134.23 ? 51  DG  J C2    1 
ATOM   4792  N N2    . DG  B 2 111 ? 124.300 64.700  110.637 1.00 134.67 ? 51  DG  J N2    1 
ATOM   4793  N N3    . DG  B 2 111 ? 122.158 64.214  109.930 1.00 134.11 ? 51  DG  J N3    1 
ATOM   4794  C C4    . DG  B 2 111 ? 120.975 64.796  109.639 1.00 134.25 ? 51  DG  J C4    1 
ATOM   4795  P P     . DA  B 2 112 ? 118.205 59.459  110.647 1.00 137.06 ? 52  DA  J P     1 
ATOM   4796  O OP1   . DA  B 2 112 ? 118.049 57.985  110.736 1.00 137.08 ? 52  DA  J OP1   1 
ATOM   4797  O OP2   . DA  B 2 112 ? 117.054 60.339  110.979 1.00 136.38 ? 52  DA  J OP2   1 
ATOM   4798  O "O5'" . DA  B 2 112 ? 119.435 59.879  111.563 1.00 138.06 ? 52  DA  J "O5'" 1 
ATOM   4799  C "C5'" . DA  B 2 112 ? 120.762 59.525  111.182 1.00 139.72 ? 52  DA  J "C5'" 1 
ATOM   4800  C "C4'" . DA  B 2 112 ? 121.737 59.909  112.266 1.00 140.81 ? 52  DA  J "C4'" 1 
ATOM   4801  O "O4'" . DA  B 2 112 ? 121.901 61.348  112.293 1.00 141.34 ? 52  DA  J "O4'" 1 
ATOM   4802  C "C3'" . DA  B 2 112 ? 121.293 59.502  113.669 1.00 141.44 ? 52  DA  J "C3'" 1 
ATOM   4803  O "O3'" . DA  B 2 112 ? 122.412 59.017  114.412 1.00 141.86 ? 52  DA  J "O3'" 1 
ATOM   4804  C "C2'" . DA  B 2 112 ? 120.748 60.793  114.255 1.00 141.91 ? 52  DA  J "C2'" 1 
ATOM   4805  C "C1'" . DA  B 2 112 ? 121.613 61.846  113.590 1.00 142.32 ? 52  DA  J "C1'" 1 
ATOM   4806  N N9    . DA  B 2 112 ? 120.960 63.147  113.436 1.00 143.32 ? 52  DA  J N9    1 
ATOM   4807  C C8    . DA  B 2 112 ? 119.629 63.402  113.197 1.00 143.47 ? 52  DA  J C8    1 
ATOM   4808  N N7    . DA  B 2 112 ? 119.343 64.678  113.106 1.00 143.67 ? 52  DA  J N7    1 
ATOM   4809  C C5    . DA  B 2 112 ? 120.567 65.308  113.296 1.00 143.99 ? 52  DA  J C5    1 
ATOM   4810  C C6    . DA  B 2 112 ? 120.937 66.663  113.313 1.00 144.22 ? 52  DA  J C6    1 
ATOM   4811  N N6    . DA  B 2 112 ? 120.080 67.668  113.123 1.00 144.22 ? 52  DA  J N6    1 
ATOM   4812  N N1    . DA  B 2 112 ? 122.239 66.955  113.532 1.00 144.30 ? 52  DA  J N1    1 
ATOM   4813  C C2    . DA  B 2 112 ? 123.099 65.944  113.717 1.00 144.57 ? 52  DA  J C2    1 
ATOM   4814  N N3    . DA  B 2 112 ? 122.871 64.632  113.723 1.00 144.15 ? 52  DA  J N3    1 
ATOM   4815  C C4    . DA  B 2 112 ? 121.570 64.377  113.503 1.00 143.91 ? 52  DA  J C4    1 
ATOM   4816  P P     . DA  B 2 113 ? 122.332 58.937  116.012 1.00 142.07 ? 53  DA  J P     1 
ATOM   4817  O OP1   . DA  B 2 113 ? 123.248 57.859  116.462 1.00 142.32 ? 53  DA  J OP1   1 
ATOM   4818  O OP2   . DA  B 2 113 ? 120.900 58.893  116.403 1.00 142.30 ? 53  DA  J OP2   1 
ATOM   4819  O "O5'" . DA  B 2 113 ? 122.942 60.334  116.469 1.00 141.91 ? 53  DA  J "O5'" 1 
ATOM   4820  C "C5'" . DA  B 2 113 ? 124.287 60.674  116.142 1.00 142.41 ? 53  DA  J "C5'" 1 
ATOM   4821  C "C4'" . DA  B 2 113 ? 124.808 61.724  117.094 1.00 142.64 ? 53  DA  J "C4'" 1 
ATOM   4822  O "O4'" . DA  B 2 113 ? 124.318 63.035  116.720 1.00 143.47 ? 53  DA  J "O4'" 1 
ATOM   4823  C "C3'" . DA  B 2 113 ? 124.392 61.507  118.549 1.00 142.41 ? 53  DA  J "C3'" 1 
ATOM   4824  O "O3'" . DA  B 2 113 ? 125.482 61.792  119.424 1.00 140.67 ? 53  DA  J "O3'" 1 
ATOM   4825  C "C2'" . DA  B 2 113 ? 123.278 62.518  118.750 1.00 143.16 ? 53  DA  J "C2'" 1 
ATOM   4826  C "C1'" . DA  B 2 113 ? 123.708 63.654  117.841 1.00 143.96 ? 53  DA  J "C1'" 1 
ATOM   4827  N N9    . DA  B 2 113 ? 122.603 64.480  117.355 1.00 144.87 ? 53  DA  J N9    1 
ATOM   4828  C C8    . DA  B 2 113 ? 121.394 64.058  116.858 1.00 145.18 ? 53  DA  J C8    1 
ATOM   4829  N N7    . DA  B 2 113 ? 120.592 65.036  116.514 1.00 145.32 ? 53  DA  J N7    1 
ATOM   4830  C C5    . DA  B 2 113 ? 121.322 66.181  116.803 1.00 145.08 ? 53  DA  J C5    1 
ATOM   4831  C C6    . DA  B 2 113 ? 121.027 67.548  116.668 1.00 145.19 ? 53  DA  J C6    1 
ATOM   4832  N N6    . DA  B 2 113 ? 119.869 68.011  116.192 1.00 145.14 ? 53  DA  J N6    1 
ATOM   4833  N N1    . DA  B 2 113 ? 121.973 68.435  117.047 1.00 145.30 ? 53  DA  J N1    1 
ATOM   4834  C C2    . DA  B 2 113 ? 123.132 67.969  117.526 1.00 145.18 ? 53  DA  J C2    1 
ATOM   4835  N N3    . DA  B 2 113 ? 123.525 66.710  117.703 1.00 145.11 ? 53  DA  J N3    1 
ATOM   4836  C C4    . DA  B 2 113 ? 122.563 65.854  117.317 1.00 144.98 ? 53  DA  J C4    1 
ATOM   4837  P P     . DT  B 2 114 ? 125.300 61.607  121.007 1.00 139.20 ? 54  DT  J P     1 
ATOM   4838  O OP1   . DT  B 2 114 ? 126.424 60.758  121.480 1.00 139.43 ? 54  DT  J OP1   1 
ATOM   4839  O OP2   . DT  B 2 114 ? 123.900 61.195  121.287 1.00 138.77 ? 54  DT  J OP2   1 
ATOM   4840  O "O5'" . DT  B 2 114 ? 125.523 63.079  121.570 1.00 137.68 ? 54  DT  J "O5'" 1 
ATOM   4841  C "C5'" . DT  B 2 114 ? 126.685 63.818  121.202 1.00 134.45 ? 54  DT  J "C5'" 1 
ATOM   4842  C "C4'" . DT  B 2 114 ? 126.562 65.257  121.644 1.00 131.87 ? 54  DT  J "C4'" 1 
ATOM   4843  O "O4'" . DT  B 2 114 ? 125.527 65.928  120.884 1.00 132.05 ? 54  DT  J "O4'" 1 
ATOM   4844  C "C3'" . DT  B 2 114 ? 126.207 65.461  123.120 1.00 129.56 ? 54  DT  J "C3'" 1 
ATOM   4845  O "O3'" . DT  B 2 114 ? 126.979 66.547  123.640 1.00 125.28 ? 54  DT  J "O3'" 1 
ATOM   4846  C "C2'" . DT  B 2 114 ? 124.737 65.831  123.074 1.00 130.47 ? 54  DT  J "C2'" 1 
ATOM   4847  C "C1'" . DT  B 2 114 ? 124.659 66.607  121.776 1.00 131.81 ? 54  DT  J "C1'" 1 
ATOM   4848  N N1    . DT  B 2 114 ? 123.313 66.653  121.174 1.00 132.75 ? 54  DT  J N1    1 
ATOM   4849  C C2    . DT  B 2 114 ? 122.817 67.884  120.809 1.00 133.44 ? 54  DT  J C2    1 
ATOM   4850  O O2    . DT  B 2 114 ? 123.445 68.921  120.941 1.00 133.86 ? 54  DT  J O2    1 
ATOM   4851  N N3    . DT  B 2 114 ? 121.549 67.855  120.283 1.00 133.49 ? 54  DT  J N3    1 
ATOM   4852  C C4    . DT  B 2 114 ? 120.750 66.746  120.090 1.00 133.37 ? 54  DT  J C4    1 
ATOM   4853  O O4    . DT  B 2 114 ? 119.626 66.876  119.614 1.00 133.70 ? 54  DT  J O4    1 
ATOM   4854  C C5    . DT  B 2 114 ? 121.339 65.488  120.485 1.00 132.97 ? 54  DT  J C5    1 
ATOM   4855  C C7    . DT  B 2 114 ? 120.548 64.230  120.305 1.00 132.94 ? 54  DT  J C7    1 
ATOM   4856  C C6    . DT  B 2 114 ? 122.576 65.502  120.998 1.00 132.78 ? 54  DT  J C6    1 
ATOM   4857  P P     . DC  B 2 115 ? 126.605 67.188  125.065 1.00 122.04 ? 55  DC  J P     1 
ATOM   4858  O OP1   . DC  B 2 115 ? 127.841 67.177  125.891 1.00 122.37 ? 55  DC  J OP1   1 
ATOM   4859  O OP2   . DC  B 2 115 ? 125.369 66.552  125.588 1.00 122.37 ? 55  DC  J OP2   1 
ATOM   4860  O "O5'" . DC  B 2 115 ? 126.271 68.699  124.690 1.00 119.13 ? 55  DC  J "O5'" 1 
ATOM   4861  C "C5'" . DC  B 2 115 ? 126.941 69.336  123.602 1.00 112.58 ? 55  DC  J "C5'" 1 
ATOM   4862  C "C4'" . DC  B 2 115 ? 126.318 70.680  123.305 1.00 107.04 ? 55  DC  J "C4'" 1 
ATOM   4863  O "O4'" . DC  B 2 115 ? 124.989 70.507  122.760 1.00 105.94 ? 55  DC  J "O4'" 1 
ATOM   4864  C "C3'" . DC  B 2 115 ? 126.165 71.605  124.512 1.00 102.68 ? 55  DC  J "C3'" 1 
ATOM   4865  O "O3'" . DC  B 2 115 ? 126.467 72.946  124.116 1.00 95.89  ? 55  DC  J "O3'" 1 
ATOM   4866  C "C2'" . DC  B 2 115 ? 124.697 71.465  124.875 1.00 103.24 ? 55  DC  J "C2'" 1 
ATOM   4867  C "C1'" . DC  B 2 115 ? 124.059 71.270  123.511 1.00 104.89 ? 55  DC  J "C1'" 1 
ATOM   4868  N N1    . DC  B 2 115 ? 122.784 70.543  123.511 1.00 105.51 ? 55  DC  J N1    1 
ATOM   4869  C C2    . DC  B 2 115 ? 121.639 71.185  123.024 1.00 106.27 ? 55  DC  J C2    1 
ATOM   4870  O O2    . DC  B 2 115 ? 121.728 72.361  122.637 1.00 106.52 ? 55  DC  J O2    1 
ATOM   4871  N N3    . DC  B 2 115 ? 120.469 70.511  122.985 1.00 106.45 ? 55  DC  J N3    1 
ATOM   4872  C C4    . DC  B 2 115 ? 120.414 69.248  123.411 1.00 106.64 ? 55  DC  J C4    1 
ATOM   4873  N N4    . DC  B 2 115 ? 119.243 68.613  123.333 1.00 106.82 ? 55  DC  J N4    1 
ATOM   4874  C C5    . DC  B 2 115 ? 121.559 68.577  123.930 1.00 106.91 ? 55  DC  J C5    1 
ATOM   4875  C C6    . DC  B 2 115 ? 122.711 69.256  123.963 1.00 106.16 ? 55  DC  J C6    1 
ATOM   4876  P P     . DT  B 2 116 ? 126.833 74.042  125.230 1.00 91.30  ? 56  DT  J P     1 
ATOM   4877  O OP1   . DT  B 2 116 ? 127.787 75.006  124.623 1.00 89.93  ? 56  DT  J OP1   1 
ATOM   4878  O OP2   . DT  B 2 116 ? 127.189 73.349  126.496 1.00 91.90  ? 56  DT  J OP2   1 
ATOM   4879  O "O5'" . DT  B 2 116 ? 125.460 74.807  125.461 1.00 85.46  ? 56  DT  J "O5'" 1 
ATOM   4880  C "C5'" . DT  B 2 116 ? 124.907 75.618  124.435 1.00 75.75  ? 56  DT  J "C5'" 1 
ATOM   4881  C "C4'" . DT  B 2 116 ? 123.552 76.127  124.858 1.00 69.33  ? 56  DT  J "C4'" 1 
ATOM   4882  O "O4'" . DT  B 2 116 ? 122.563 75.074  124.799 1.00 68.69  ? 56  DT  J "O4'" 1 
ATOM   4883  C "C3'" . DT  B 2 116 ? 123.498 76.671  126.285 1.00 64.75  ? 56  DT  J "C3'" 1 
ATOM   4884  O "O3'" . DT  B 2 116 ? 122.615 77.779  126.297 1.00 60.40  ? 56  DT  J "O3'" 1 
ATOM   4885  C "C2'" . DT  B 2 116 ? 122.824 75.546  127.047 1.00 66.56  ? 56  DT  J "C2'" 1 
ATOM   4886  C "C1'" . DT  B 2 116 ? 121.832 75.092  126.006 1.00 69.56  ? 56  DT  J "C1'" 1 
ATOM   4887  N N1    . DT  B 2 116 ? 121.213 73.773  126.202 1.00 76.31  ? 56  DT  J N1    1 
ATOM   4888  C C2    . DT  B 2 116 ? 119.876 73.662  125.900 1.00 78.99  ? 56  DT  J C2    1 
ATOM   4889  O O2    . DT  B 2 116 ? 119.211 74.591  125.469 1.00 78.49  ? 56  DT  J O2    1 
ATOM   4890  N N3    . DT  B 2 116 ? 119.339 72.419  126.119 1.00 80.81  ? 56  DT  J N3    1 
ATOM   4891  C C4    . DT  B 2 116 ? 119.991 71.299  126.589 1.00 82.32  ? 56  DT  J C4    1 
ATOM   4892  O O4    . DT  B 2 116 ? 119.371 70.247  126.729 1.00 84.70  ? 56  DT  J O4    1 
ATOM   4893  C C5    . DT  B 2 116 ? 121.397 71.480  126.879 1.00 81.87  ? 56  DT  J C5    1 
ATOM   4894  C C7    . DT  B 2 116 ? 122.187 70.317  127.387 1.00 82.05  ? 56  DT  J C7    1 
ATOM   4895  C C6    . DT  B 2 116 ? 121.932 72.694  126.674 1.00 80.06  ? 56  DT  J C6    1 
ATOM   4896  P P     . DG  B 2 117 ? 123.088 79.175  126.899 1.00 56.71  ? 57  DG  J P     1 
ATOM   4897  O OP1   . DG  B 2 117 ? 124.203 79.684  126.066 1.00 56.01  ? 57  DG  J OP1   1 
ATOM   4898  O OP2   . DG  B 2 117 ? 123.262 79.040  128.364 1.00 57.33  ? 57  DG  J OP2   1 
ATOM   4899  O "O5'" . DG  B 2 117 ? 121.825 80.123  126.660 1.00 55.77  ? 57  DG  J "O5'" 1 
ATOM   4900  C "C5'" . DG  B 2 117 ? 121.291 80.313  125.353 1.00 47.88  ? 57  DG  J "C5'" 1 
ATOM   4901  C "C4'" . DG  B 2 117 ? 119.792 80.488  125.424 1.00 44.21  ? 57  DG  J "C4'" 1 
ATOM   4902  O "O4'" . DG  B 2 117 ? 119.146 79.237  125.747 1.00 47.11  ? 57  DG  J "O4'" 1 
ATOM   4903  C "C3'" . DG  B 2 117 ? 119.300 81.491  126.458 1.00 42.19  ? 57  DG  J "C3'" 1 
ATOM   4904  O "O3'" . DG  B 2 117 ? 118.167 82.155  125.907 1.00 37.04  ? 57  DG  J "O3'" 1 
ATOM   4905  C "C2'" . DG  B 2 117 ? 118.915 80.616  127.640 1.00 42.11  ? 57  DG  J "C2'" 1 
ATOM   4906  C "C1'" . DG  B 2 117 ? 118.443 79.333  126.976 1.00 47.09  ? 57  DG  J "C1'" 1 
ATOM   4907  N N9    . DG  B 2 117 ? 118.731 78.111  127.723 1.00 54.24  ? 57  DG  J N9    1 
ATOM   4908  C C8    . DG  B 2 117 ? 119.849 77.842  128.478 1.00 55.01  ? 57  DG  J C8    1 
ATOM   4909  N N7    . DG  B 2 117 ? 119.846 76.639  128.984 1.00 57.32  ? 57  DG  J N7    1 
ATOM   4910  C C5    . DG  B 2 117 ? 118.651 76.083  128.549 1.00 57.75  ? 57  DG  J C5    1 
ATOM   4911  C C6    . DG  B 2 117 ? 118.105 74.792  128.767 1.00 61.07  ? 57  DG  J C6    1 
ATOM   4912  O O6    . DG  B 2 117 ? 118.591 73.847  129.405 1.00 64.65  ? 57  DG  J O6    1 
ATOM   4913  N N1    . DG  B 2 117 ? 116.867 74.647  128.145 1.00 59.18  ? 57  DG  J N1    1 
ATOM   4914  C C2    . DG  B 2 117 ? 116.239 75.614  127.406 1.00 59.73  ? 57  DG  J C2    1 
ATOM   4915  N N2    . DG  B 2 117 ? 115.038 75.288  126.899 1.00 55.46  ? 57  DG  J N2    1 
ATOM   4916  N N3    . DG  B 2 117 ? 116.748 76.818  127.183 1.00 57.19  ? 57  DG  J N3    1 
ATOM   4917  C C4    . DG  B 2 117 ? 117.944 76.981  127.780 1.00 55.52  ? 57  DG  J C4    1 
ATOM   4918  P P     . DC  B 2 118 ? 117.518 83.390  126.668 1.00 39.73  ? 58  DC  J P     1 
ATOM   4919  O OP1   . DC  B 2 118 ? 117.080 84.327  125.592 1.00 40.66  ? 58  DC  J OP1   1 
ATOM   4920  O OP2   . DC  B 2 118 ? 118.447 83.882  127.713 1.00 40.61  ? 58  DC  J OP2   1 
ATOM   4921  O "O5'" . DC  B 2 118 ? 116.227 82.731  127.324 1.00 39.75  ? 58  DC  J "O5'" 1 
ATOM   4922  C "C5'" . DC  B 2 118 ? 115.356 81.938  126.517 1.00 40.80  ? 58  DC  J "C5'" 1 
ATOM   4923  C "C4'" . DC  B 2 118 ? 114.394 81.149  127.376 1.00 45.62  ? 58  DC  J "C4'" 1 
ATOM   4924  O "O4'" . DC  B 2 118 ? 115.044 80.004  127.978 1.00 42.66  ? 58  DC  J "O4'" 1 
ATOM   4925  C "C3'" . DC  B 2 118 ? 113.739 81.921  128.525 1.00 46.82  ? 58  DC  J "C3'" 1 
ATOM   4926  O "O3'" . DC  B 2 118 ? 112.382 81.500  128.643 1.00 51.31  ? 58  DC  J "O3'" 1 
ATOM   4927  C "C2'" . DC  B 2 118 ? 114.498 81.430  129.743 1.00 47.42  ? 58  DC  J "C2'" 1 
ATOM   4928  C "C1'" . DC  B 2 118 ? 114.733 79.981  129.363 1.00 46.70  ? 58  DC  J "C1'" 1 
ATOM   4929  N N1    . DC  B 2 118 ? 115.827 79.293  130.070 1.00 48.76  ? 58  DC  J N1    1 
ATOM   4930  C C2    . DC  B 2 118 ? 115.693 77.923  130.332 1.00 51.64  ? 58  DC  J C2    1 
ATOM   4931  O O2    . DC  B 2 118 ? 114.667 77.338  129.966 1.00 51.80  ? 58  DC  J O2    1 
ATOM   4932  N N3    . DC  B 2 118 ? 116.684 77.276  130.978 1.00 53.05  ? 58  DC  J N3    1 
ATOM   4933  C C4    . DC  B 2 118 ? 117.774 77.938  131.361 1.00 53.09  ? 58  DC  J C4    1 
ATOM   4934  N N4    . DC  B 2 118 ? 118.726 77.254  131.994 1.00 57.16  ? 58  DC  J N4    1 
ATOM   4935  C C5    . DC  B 2 118 ? 117.939 79.331  131.110 1.00 52.60  ? 58  DC  J C5    1 
ATOM   4936  C C6    . DC  B 2 118 ? 116.946 79.964  130.467 1.00 51.03  ? 58  DC  J C6    1 
ATOM   4937  P P     . DA  B 2 119 ? 111.204 82.527  128.313 1.00 49.70  ? 59  DA  J P     1 
ATOM   4938  O OP1   . DA  B 2 119 ? 111.508 83.011  126.947 1.00 55.73  ? 59  DA  J OP1   1 
ATOM   4939  O OP2   . DA  B 2 119 ? 111.035 83.498  129.418 1.00 47.97  ? 59  DA  J OP2   1 
ATOM   4940  O "O5'" . DA  B 2 119 ? 109.911 81.605  128.249 1.00 55.76  ? 59  DA  J "O5'" 1 
ATOM   4941  C "C5'" . DA  B 2 119 ? 109.787 80.608  127.244 1.00 59.17  ? 59  DA  J "C5'" 1 
ATOM   4942  C "C4'" . DA  B 2 119 ? 109.132 79.377  127.818 1.00 62.96  ? 59  DA  J "C4'" 1 
ATOM   4943  O "O4'" . DA  B 2 119 ? 110.046 78.706  128.709 1.00 63.68  ? 59  DA  J "O4'" 1 
ATOM   4944  C "C3'" . DA  B 2 119 ? 107.876 79.644  128.641 1.00 63.48  ? 59  DA  J "C3'" 1 
ATOM   4945  O "O3'" . DA  B 2 119 ? 106.974 78.553  128.456 1.00 69.71  ? 59  DA  J "O3'" 1 
ATOM   4946  C "C2'" . DA  B 2 119 ? 108.398 79.703  130.066 1.00 62.46  ? 59  DA  J "C2'" 1 
ATOM   4947  C "C1'" . DA  B 2 119 ? 109.559 78.719  130.045 1.00 61.00  ? 59  DA  J "C1'" 1 
ATOM   4948  N N9    . DA  B 2 119 ? 110.693 79.072  130.901 1.00 60.66  ? 59  DA  J N9    1 
ATOM   4949  C C8    . DA  B 2 119 ? 111.230 80.313  131.129 1.00 57.41  ? 59  DA  J C8    1 
ATOM   4950  N N7    . DA  B 2 119 ? 112.306 80.293  131.870 1.00 56.77  ? 59  DA  J N7    1 
ATOM   4951  C C5    . DA  B 2 119 ? 112.481 78.952  132.167 1.00 60.09  ? 59  DA  J C5    1 
ATOM   4952  C C6    . DA  B 2 119 ? 113.456 78.265  132.905 1.00 60.29  ? 59  DA  J C6    1 
ATOM   4953  N N6    . DA  B 2 119 ? 114.495 78.854  133.491 1.00 60.15  ? 59  DA  J N6    1 
ATOM   4954  N N1    . DA  B 2 119 ? 113.329 76.928  133.016 1.00 62.09  ? 59  DA  J N1    1 
ATOM   4955  C C2    . DA  B 2 119 ? 112.298 76.332  132.418 1.00 60.11  ? 59  DA  J C2    1 
ATOM   4956  N N3    . DA  B 2 119 ? 111.325 76.865  131.694 1.00 62.77  ? 59  DA  J N3    1 
ATOM   4957  C C4    . DA  B 2 119 ? 111.477 78.194  131.601 1.00 59.51  ? 59  DA  J C4    1 
ATOM   4958  P P     . DG  B 2 120 ? 105.531 78.582  129.156 1.00 72.68  ? 60  DG  J P     1 
ATOM   4959  O OP1   . DG  B 2 120 ? 104.699 77.599  128.420 1.00 75.47  ? 60  DG  J OP1   1 
ATOM   4960  O OP2   . DG  B 2 120 ? 105.061 79.984  129.300 1.00 69.97  ? 60  DG  J OP2   1 
ATOM   4961  O "O5'" . DG  B 2 120 ? 105.824 78.002  130.604 1.00 73.61  ? 60  DG  J "O5'" 1 
ATOM   4962  C "C5'" . DG  B 2 120 ? 106.268 76.659  130.771 1.00 76.59  ? 60  DG  J "C5'" 1 
ATOM   4963  C "C4'" . DG  B 2 120 ? 106.254 76.303  132.238 1.00 77.44  ? 60  DG  J "C4'" 1 
ATOM   4964  O "O4'" . DG  B 2 120 ? 107.476 76.740  132.884 1.00 76.17  ? 60  DG  J "O4'" 1 
ATOM   4965  C "C3'" . DG  B 2 120 ? 105.106 76.980  132.985 1.00 79.04  ? 60  DG  J "C3'" 1 
ATOM   4966  O "O3'" . DG  B 2 120 ? 104.514 76.063  133.905 1.00 83.83  ? 60  DG  J "O3'" 1 
ATOM   4967  C "C2'" . DG  B 2 120 ? 105.787 78.132  133.708 1.00 77.07  ? 60  DG  J "C2'" 1 
ATOM   4968  C "C1'" . DG  B 2 120 ? 107.161 77.558  134.000 1.00 74.90  ? 60  DG  J "C1'" 1 
ATOM   4969  N N9    . DG  B 2 120 ? 108.225 78.552  134.160 1.00 71.43  ? 60  DG  J N9    1 
ATOM   4970  C C8    . DG  B 2 120 ? 108.185 79.881  133.809 1.00 69.05  ? 60  DG  J C8    1 
ATOM   4971  N N7    . DG  B 2 120 ? 109.283 80.523  134.106 1.00 66.03  ? 60  DG  J N7    1 
ATOM   4972  C C5    . DG  B 2 120 ? 110.101 79.560  134.678 1.00 67.61  ? 60  DG  J C5    1 
ATOM   4973  C C6    . DG  B 2 120 ? 111.423 79.661  135.194 1.00 67.93  ? 60  DG  J C6    1 
ATOM   4974  O O6    . DG  B 2 120 ? 112.153 80.653  135.252 1.00 63.67  ? 60  DG  J O6    1 
ATOM   4975  N N1    . DG  B 2 120 ? 111.877 78.441  135.676 1.00 69.98  ? 60  DG  J N1    1 
ATOM   4976  C C2    . DG  B 2 120 ? 111.157 77.271  135.668 1.00 71.53  ? 60  DG  J C2    1 
ATOM   4977  N N2    . DG  B 2 120 ? 111.774 76.194  136.178 1.00 72.13  ? 60  DG  J N2    1 
ATOM   4978  N N3    . DG  B 2 120 ? 109.926 77.163  135.194 1.00 70.29  ? 60  DG  J N3    1 
ATOM   4979  C C4    . DG  B 2 120 ? 109.465 78.337  134.716 1.00 69.33  ? 60  DG  J C4    1 
ATOM   4980  P P     . DG  B 2 121 ? 103.246 76.516  134.779 1.00 82.43  ? 61  DG  J P     1 
ATOM   4981  O OP1   . DG  B 2 121 ? 102.100 75.684  134.353 1.00 85.59  ? 61  DG  J OP1   1 
ATOM   4982  O OP2   . DG  B 2 121 ? 103.118 77.993  134.777 1.00 84.11  ? 61  DG  J OP2   1 
ATOM   4983  O "O5'" . DG  B 2 121 ? 103.681 76.060  136.230 1.00 86.38  ? 61  DG  J "O5'" 1 
ATOM   4984  C "C5'" . DG  B 2 121 ? 104.387 74.840  136.409 1.00 91.51  ? 61  DG  J "C5'" 1 
ATOM   4985  C "C4'" . DG  B 2 121 ? 105.065 74.841  137.754 1.00 95.95  ? 61  DG  J "C4'" 1 
ATOM   4986  O "O4'" . DG  B 2 121 ? 106.319 75.571  137.688 1.00 95.73  ? 61  DG  J "O4'" 1 
ATOM   4987  C "C3'" . DG  B 2 121 ? 104.217 75.531  138.821 1.00 99.26  ? 61  DG  J "C3'" 1 
ATOM   4988  O "O3'" . DG  B 2 121 ? 104.209 74.775  140.030 1.00 104.47 ? 61  DG  J "O3'" 1 
ATOM   4989  C "C2'" . DG  B 2 121 ? 104.900 76.874  139.005 1.00 98.11  ? 61  DG  J "C2'" 1 
ATOM   4990  C "C1'" . DG  B 2 121 ? 106.351 76.544  138.718 1.00 96.19  ? 61  DG  J "C1'" 1 
ATOM   4991  N N9    . DG  B 2 121 ? 107.127 77.690  138.249 1.00 94.37  ? 61  DG  J N9    1 
ATOM   4992  C C8    . DG  B 2 121 ? 106.705 78.679  137.396 1.00 93.93  ? 61  DG  J C8    1 
ATOM   4993  N N7    . DG  B 2 121 ? 107.598 79.612  137.211 1.00 93.47  ? 61  DG  J N7    1 
ATOM   4994  C C5    . DG  B 2 121 ? 108.681 79.209  137.976 1.00 92.70  ? 61  DG  J C5    1 
ATOM   4995  C C6    . DG  B 2 121 ? 109.939 79.828  138.184 1.00 92.04  ? 61  DG  J C6    1 
ATOM   4996  O O6    . DG  B 2 121 ? 110.353 80.900  137.731 1.00 90.29  ? 61  DG  J O6    1 
ATOM   4997  N N1    . DG  B 2 121 ? 110.750 79.071  139.022 1.00 92.14  ? 61  DG  J N1    1 
ATOM   4998  C C2    . DG  B 2 121 ? 110.396 77.877  139.595 1.00 92.93  ? 61  DG  J C2    1 
ATOM   4999  N N2    . DG  B 2 121 ? 111.327 77.293  140.357 1.00 93.70  ? 61  DG  J N2    1 
ATOM   5000  N N3    . DG  B 2 121 ? 109.218 77.296  139.427 1.00 93.96  ? 61  DG  J N3    1 
ATOM   5001  C C4    . DG  B 2 121 ? 108.415 78.013  138.609 1.00 93.79  ? 61  DG  J C4    1 
ATOM   5002  P P     . DT  B 2 122 ? 104.012 75.525  141.432 1.00 108.13 ? 62  DT  J P     1 
ATOM   5003  O OP1   . DT  B 2 122 ? 103.575 74.516  142.429 1.00 108.51 ? 62  DT  J OP1   1 
ATOM   5004  O OP2   . DT  B 2 122 ? 103.192 76.746  141.212 1.00 106.84 ? 62  DT  J OP2   1 
ATOM   5005  O "O5'" . DT  B 2 122 ? 105.494 75.968  141.787 1.00 108.42 ? 62  DT  J "O5'" 1 
ATOM   5006  C "C5'" . DT  B 2 122 ? 106.478 74.989  142.092 1.00 110.55 ? 62  DT  J "C5'" 1 
ATOM   5007  C "C4'" . DT  B 2 122 ? 107.199 75.377  143.356 1.00 112.61 ? 62  DT  J "C4'" 1 
ATOM   5008  O "O4'" . DT  B 2 122 ? 108.152 76.423  143.052 1.00 111.95 ? 62  DT  J "O4'" 1 
ATOM   5009  C "C3'" . DT  B 2 122 ? 106.250 75.948  144.406 1.00 114.10 ? 62  DT  J "C3'" 1 
ATOM   5010  O "O3'" . DT  B 2 122 ? 106.619 75.521  145.716 1.00 117.88 ? 62  DT  J "O3'" 1 
ATOM   5011  C "C2'" . DT  B 2 122 ? 106.402 77.449  144.244 1.00 112.79 ? 62  DT  J "C2'" 1 
ATOM   5012  C "C1'" . DT  B 2 122 ? 107.837 77.607  143.760 1.00 111.10 ? 62  DT  J "C1'" 1 
ATOM   5013  N N1    . DT  B 2 122 ? 108.028 78.740  142.837 1.00 109.16 ? 62  DT  J N1    1 
ATOM   5014  C C2    . DT  B 2 122 ? 109.225 79.409  142.868 1.00 108.26 ? 62  DT  J C2    1 
ATOM   5015  O O2    . DT  B 2 122 ? 110.141 79.096  143.608 1.00 108.86 ? 62  DT  J O2    1 
ATOM   5016  N N3    . DT  B 2 122 ? 109.314 80.463  141.994 1.00 108.05 ? 62  DT  J N3    1 
ATOM   5017  C C4    . DT  B 2 122 ? 108.344 80.902  141.113 1.00 107.42 ? 62  DT  J C4    1 
ATOM   5018  O O4    . DT  B 2 122 ? 108.562 81.875  140.395 1.00 106.64 ? 62  DT  J O4    1 
ATOM   5019  C C5    . DT  B 2 122 ? 107.115 80.145  141.124 1.00 107.76 ? 62  DT  J C5    1 
ATOM   5020  C C7    . DT  B 2 122 ? 106.009 80.538  140.199 1.00 107.44 ? 62  DT  J C7    1 
ATOM   5021  C C6    . DT  B 2 122 ? 107.022 79.114  141.973 1.00 108.59 ? 62  DT  J C6    1 
ATOM   5022  P P     . DG  B 2 123 ? 105.840 76.109  146.990 1.00 120.24 ? 63  DG  J P     1 
ATOM   5023  O OP1   . DG  B 2 123 ? 105.719 75.001  147.973 1.00 119.81 ? 63  DG  J OP1   1 
ATOM   5024  O OP2   . DG  B 2 123 ? 104.618 76.818  146.529 1.00 119.88 ? 63  DG  J OP2   1 
ATOM   5025  O "O5'" . DG  B 2 123 ? 106.861 77.191  147.556 1.00 120.24 ? 63  DG  J "O5'" 1 
ATOM   5026  C "C5'" . DG  B 2 123 ? 108.227 76.845  147.779 1.00 121.56 ? 63  DG  J "C5'" 1 
ATOM   5027  C "C4'" . DG  B 2 123 ? 108.989 78.043  148.291 1.00 123.14 ? 63  DG  J "C4'" 1 
ATOM   5028  O "O4'" . DG  B 2 123 ? 109.227 78.978  147.209 1.00 123.39 ? 63  DG  J "O4'" 1 
ATOM   5029  C "C3'" . DG  B 2 123 ? 108.248 78.819  149.377 1.00 124.02 ? 63  DG  J "C3'" 1 
ATOM   5030  O "O3'" . DG  B 2 123 ? 109.150 79.230  150.403 1.00 125.95 ? 63  DG  J "O3'" 1 
ATOM   5031  C "C2'" . DG  B 2 123 ? 107.686 80.019  148.639 1.00 123.92 ? 63  DG  J "C2'" 1 
ATOM   5032  C "C1'" . DG  B 2 123 ? 108.713 80.258  147.542 1.00 123.16 ? 63  DG  J "C1'" 1 
ATOM   5033  N N9    . DG  B 2 123 ? 108.142 80.841  146.330 1.00 121.92 ? 63  DG  J N9    1 
ATOM   5034  C C8    . DG  B 2 123 ? 106.992 80.440  145.694 1.00 121.43 ? 63  DG  J C8    1 
ATOM   5035  N N7    . DG  B 2 123 ? 106.712 81.156  144.639 1.00 121.10 ? 63  DG  J N7    1 
ATOM   5036  C C5    . DG  B 2 123 ? 107.741 82.086  144.570 1.00 120.49 ? 63  DG  J C5    1 
ATOM   5037  C C6    . DG  B 2 123 ? 107.972 83.129  143.637 1.00 120.10 ? 63  DG  J C6    1 
ATOM   5038  O O6    . DG  B 2 123 ? 107.291 83.450  142.656 1.00 120.22 ? 63  DG  J O6    1 
ATOM   5039  N N1    . DG  B 2 123 ? 109.131 83.834  143.935 1.00 119.18 ? 63  DG  J N1    1 
ATOM   5040  C C2    . DG  B 2 123 ? 109.962 83.573  144.995 1.00 118.87 ? 63  DG  J C2    1 
ATOM   5041  N N2    . DG  B 2 123 ? 111.034 84.373  145.108 1.00 118.60 ? 63  DG  J N2    1 
ATOM   5042  N N3    . DG  B 2 123 ? 109.760 82.603  145.876 1.00 119.33 ? 63  DG  J N3    1 
ATOM   5043  C C4    . DG  B 2 123 ? 108.637 81.903  145.603 1.00 120.52 ? 63  DG  J C4    1 
ATOM   5044  N N     . PRO C 3 1   ? 72.326  150.084 109.350 1.00 79.51  ? 38  PRO A N     1 
ATOM   5045  C CA    . PRO C 3 1   ? 73.439  149.112 109.423 1.00 78.15  ? 38  PRO A CA    1 
ATOM   5046  C C     . PRO C 3 1   ? 72.910  147.686 109.531 1.00 76.36  ? 38  PRO A C     1 
ATOM   5047  O O     . PRO C 3 1   ? 72.490  147.250 110.602 1.00 76.96  ? 38  PRO A O     1 
ATOM   5048  C CB    . PRO C 3 1   ? 74.266  149.479 110.647 1.00 79.21  ? 38  PRO A CB    1 
ATOM   5049  C CG    . PRO C 3 1   ? 73.209  150.137 111.533 1.00 79.80  ? 38  PRO A CG    1 
ATOM   5050  C CD    . PRO C 3 1   ? 72.335  150.943 110.549 1.00 80.36  ? 38  PRO A CD    1 
ATOM   5051  N N     . HIS C 3 2   ? 72.915  146.968 108.414 1.00 73.97  ? 39  HIS A N     1 
ATOM   5052  C CA    . HIS C 3 2   ? 72.441  145.591 108.399 1.00 71.30  ? 39  HIS A CA    1 
ATOM   5053  C C     . HIS C 3 2   ? 73.542  144.694 108.940 1.00 68.79  ? 39  HIS A C     1 
ATOM   5054  O O     . HIS C 3 2   ? 74.727  144.995 108.789 1.00 68.52  ? 39  HIS A O     1 
ATOM   5055  C CB    . HIS C 3 2   ? 72.081  145.165 106.975 1.00 72.31  ? 39  HIS A CB    1 
ATOM   5056  C CG    . HIS C 3 2   ? 71.746  143.712 106.851 1.00 75.22  ? 39  HIS A CG    1 
ATOM   5057  N ND1   . HIS C 3 2   ? 72.700  142.721 106.925 1.00 73.36  ? 39  HIS A ND1   1 
ATOM   5058  C CD2   . HIS C 3 2   ? 70.558  143.081 106.689 1.00 75.50  ? 39  HIS A CD2   1 
ATOM   5059  C CE1   . HIS C 3 2   ? 72.115  141.542 106.816 1.00 74.54  ? 39  HIS A CE1   1 
ATOM   5060  N NE2   . HIS C 3 2   ? 70.816  141.731 106.670 1.00 74.70  ? 39  HIS A NE2   1 
ATOM   5061  N N     . ARG C 3 3   ? 73.164  143.596 109.580 1.00 65.71  ? 40  ARG A N     1 
ATOM   5062  C CA    . ARG C 3 3   ? 74.184  142.710 110.115 1.00 63.09  ? 40  ARG A CA    1 
ATOM   5063  C C     . ARG C 3 3   ? 73.761  141.249 110.161 1.00 58.76  ? 40  ARG A C     1 
ATOM   5064  O O     . ARG C 3 3   ? 72.767  140.899 110.789 1.00 57.33  ? 40  ARG A O     1 
ATOM   5065  C CB    . ARG C 3 3   ? 74.592  143.183 111.506 1.00 64.17  ? 40  ARG A CB    1 
ATOM   5066  C CG    . ARG C 3 3   ? 75.972  142.735 111.923 1.00 66.19  ? 40  ARG A CG    1 
ATOM   5067  C CD    . ARG C 3 3   ? 76.300  143.179 113.339 1.00 63.81  ? 40  ARG A CD    1 
ATOM   5068  N NE    . ARG C 3 3   ? 77.573  142.620 113.783 1.00 61.14  ? 40  ARG A NE    1 
ATOM   5069  C CZ    . ARG C 3 3   ? 78.754  143.024 113.339 1.00 61.05  ? 40  ARG A CZ    1 
ATOM   5070  N NH1   . ARG C 3 3   ? 78.824  143.995 112.437 1.00 60.52  ? 40  ARG A NH1   1 
ATOM   5071  N NH2   . ARG C 3 3   ? 79.865  142.458 113.799 1.00 58.72  ? 40  ARG A NH2   1 
ATOM   5072  N N     . TYR C 3 4   ? 74.521  140.403 109.471 1.00 55.24  ? 41  TYR A N     1 
ATOM   5073  C CA    . TYR C 3 4   ? 74.245  138.966 109.453 1.00 49.50  ? 41  TYR A CA    1 
ATOM   5074  C C     . TYR C 3 4   ? 74.733  138.368 110.764 1.00 44.24  ? 41  TYR A C     1 
ATOM   5075  O O     . TYR C 3 4   ? 75.760  138.775 111.290 1.00 43.62  ? 41  TYR A O     1 
ATOM   5076  C CB    . TYR C 3 4   ? 74.958  138.304 108.268 1.00 45.15  ? 41  TYR A CB    1 
ATOM   5077  C CG    . TYR C 3 4   ? 74.282  138.581 106.945 1.00 44.06  ? 41  TYR A CG    1 
ATOM   5078  C CD1   . TYR C 3 4   ? 72.981  138.149 106.715 1.00 42.58  ? 41  TYR A CD1   1 
ATOM   5079  C CD2   . TYR C 3 4   ? 74.922  139.307 105.948 1.00 43.51  ? 41  TYR A CD2   1 
ATOM   5080  C CE1   . TYR C 3 4   ? 72.331  138.440 105.532 1.00 45.87  ? 41  TYR A CE1   1 
ATOM   5081  C CE2   . TYR C 3 4   ? 74.277  139.603 104.754 1.00 44.42  ? 41  TYR A CE2   1 
ATOM   5082  C CZ    . TYR C 3 4   ? 72.982  139.170 104.557 1.00 44.72  ? 41  TYR A CZ    1 
ATOM   5083  O OH    . TYR C 3 4   ? 72.313  139.487 103.398 1.00 50.85  ? 41  TYR A OH    1 
ATOM   5084  N N     . ARG C 3 5   ? 73.995  137.418 111.311 1.00 43.38  ? 42  ARG A N     1 
ATOM   5085  C CA    . ARG C 3 5   ? 74.429  136.820 112.564 1.00 45.68  ? 42  ARG A CA    1 
ATOM   5086  C C     . ARG C 3 5   ? 75.697  135.965 112.413 1.00 45.10  ? 42  ARG A C     1 
ATOM   5087  O O     . ARG C 3 5   ? 76.024  135.494 111.326 1.00 43.35  ? 42  ARG A O     1 
ATOM   5088  C CB    . ARG C 3 5   ? 73.302  135.996 113.174 1.00 47.72  ? 42  ARG A CB    1 
ATOM   5089  C CG    . ARG C 3 5   ? 72.107  136.854 113.548 1.00 55.89  ? 42  ARG A CG    1 
ATOM   5090  C CD    . ARG C 3 5   ? 71.397  136.299 114.749 1.00 61.62  ? 42  ARG A CD    1 
ATOM   5091  N NE    . ARG C 3 5   ? 70.975  134.927 114.506 1.00 68.00  ? 42  ARG A NE    1 
ATOM   5092  C CZ    . ARG C 3 5   ? 70.357  134.171 115.403 1.00 70.57  ? 42  ARG A CZ    1 
ATOM   5093  N NH1   . ARG C 3 5   ? 70.091  134.664 116.606 1.00 71.58  ? 42  ARG A NH1   1 
ATOM   5094  N NH2   . ARG C 3 5   ? 70.015  132.925 115.100 1.00 72.26  ? 42  ARG A NH2   1 
ATOM   5095  N N     . PRO C 3 6   ? 76.431  135.766 113.510 1.00 44.48  ? 43  PRO A N     1 
ATOM   5096  C CA    . PRO C 3 6   ? 77.649  134.963 113.424 1.00 42.73  ? 43  PRO A CA    1 
ATOM   5097  C C     . PRO C 3 6   ? 77.284  133.609 112.873 1.00 41.62  ? 43  PRO A C     1 
ATOM   5098  O O     . PRO C 3 6   ? 76.348  132.983 113.363 1.00 39.16  ? 43  PRO A O     1 
ATOM   5099  C CB    . PRO C 3 6   ? 78.113  134.887 114.872 1.00 43.63  ? 43  PRO A CB    1 
ATOM   5100  C CG    . PRO C 3 6   ? 77.573  136.199 115.461 1.00 42.53  ? 43  PRO A CG    1 
ATOM   5101  C CD    . PRO C 3 6   ? 76.190  136.209 114.893 1.00 42.51  ? 43  PRO A CD    1 
ATOM   5102  N N     . GLY C 3 7   ? 78.001  133.177 111.834 1.00 43.55  ? 44  GLY A N     1 
ATOM   5103  C CA    . GLY C 3 7   ? 77.739  131.879 111.238 1.00 41.00  ? 44  GLY A CA    1 
ATOM   5104  C C     . GLY C 3 7   ? 77.017  131.915 109.901 1.00 41.93  ? 44  GLY A C     1 
ATOM   5105  O O     . GLY C 3 7   ? 77.291  131.088 109.022 1.00 40.03  ? 44  GLY A O     1 
ATOM   5106  N N     . THR C 3 8   ? 76.106  132.873 109.733 1.00 39.80  ? 45  THR A N     1 
ATOM   5107  C CA    . THR C 3 8   ? 75.351  132.974 108.495 1.00 38.64  ? 45  THR A CA    1 
ATOM   5108  C C     . THR C 3 8   ? 76.277  133.157 107.297 1.00 37.87  ? 45  THR A C     1 
ATOM   5109  O O     . THR C 3 8   ? 76.093  132.532 106.266 1.00 40.67  ? 45  THR A O     1 
ATOM   5110  C CB    . THR C 3 8   ? 74.313  134.147 108.560 1.00 39.42  ? 45  THR A CB    1 
ATOM   5111  O OG1   . THR C 3 8   ? 73.315  133.836 109.542 1.00 38.30  ? 45  THR A OG1   1 
ATOM   5112  C CG2   . THR C 3 8   ? 73.610  134.346 107.224 1.00 38.21  ? 45  THR A CG2   1 
ATOM   5113  N N     . VAL C 3 9   ? 77.273  134.013 107.430 1.00 35.55  ? 46  VAL A N     1 
ATOM   5114  C CA    . VAL C 3 9   ? 78.185  134.258 106.330 1.00 38.36  ? 46  VAL A CA    1 
ATOM   5115  C C     . VAL C 3 9   ? 79.181  133.098 106.180 1.00 37.61  ? 46  VAL A C     1 
ATOM   5116  O O     . VAL C 3 9   ? 79.626  132.797 105.082 1.00 36.91  ? 46  VAL A O     1 
ATOM   5117  C CB    . VAL C 3 9   ? 78.945  135.586 106.531 1.00 37.98  ? 46  VAL A CB    1 
ATOM   5118  C CG1   . VAL C 3 9   ? 79.900  135.824 105.359 1.00 40.59  ? 46  VAL A CG1   1 
ATOM   5119  C CG2   . VAL C 3 9   ? 77.935  136.750 106.632 1.00 41.97  ? 46  VAL A CG2   1 
ATOM   5120  N N     . ALA C 3 10  ? 79.532  132.472 107.295 1.00 36.19  ? 47  ALA A N     1 
ATOM   5121  C CA    . ALA C 3 10  ? 80.450  131.344 107.269 1.00 37.95  ? 47  ALA A CA    1 
ATOM   5122  C C     . ALA C 3 10  ? 79.814  130.275 106.383 1.00 38.86  ? 47  ALA A C     1 
ATOM   5123  O O     . ALA C 3 10  ? 80.449  129.748 105.463 1.00 37.16  ? 47  ALA A O     1 
ATOM   5124  C CB    . ALA C 3 10  ? 80.648  130.810 108.685 1.00 34.46  ? 47  ALA A CB    1 
ATOM   5125  N N     . LEU C 3 11  ? 78.539  129.987 106.657 1.00 39.91  ? 48  LEU A N     1 
ATOM   5126  C CA    . LEU C 3 11  ? 77.799  128.979 105.908 1.00 40.38  ? 48  LEU A CA    1 
ATOM   5127  C C     . LEU C 3 11  ? 77.750  129.376 104.430 1.00 40.77  ? 48  LEU A C     1 
ATOM   5128  O O     . LEU C 3 11  ? 77.897  128.545 103.531 1.00 36.89  ? 48  LEU A O     1 
ATOM   5129  C CB    . LEU C 3 11  ? 76.398  128.846 106.497 1.00 40.34  ? 48  LEU A CB    1 
ATOM   5130  C CG    . LEU C 3 11  ? 75.983  127.532 107.179 1.00 46.64  ? 48  LEU A CG    1 
ATOM   5131  C CD1   . LEU C 3 11  ? 77.157  126.863 107.871 1.00 45.82  ? 48  LEU A CD1   1 
ATOM   5132  C CD2   . LEU C 3 11  ? 74.862  127.821 108.173 1.00 43.91  ? 48  LEU A CD2   1 
ATOM   5133  N N     . ARG C 3 12  ? 77.536  130.660 104.188 1.00 40.57  ? 49  ARG A N     1 
ATOM   5134  C CA    . ARG C 3 12  ? 77.496  131.172 102.838 1.00 38.86  ? 49  ARG A CA    1 
ATOM   5135  C C     . ARG C 3 12  ? 78.838  130.885 102.133 1.00 35.13  ? 49  ARG A C     1 
ATOM   5136  O O     . ARG C 3 12  ? 78.846  130.446 100.995 1.00 35.46  ? 49  ARG A O     1 
ATOM   5137  C CB    . ARG C 3 12  ? 77.182  132.678 102.889 1.00 42.73  ? 49  ARG A CB    1 
ATOM   5138  C CG    . ARG C 3 12  ? 77.325  133.418 101.587 1.00 44.58  ? 49  ARG A CG    1 
ATOM   5139  C CD    . ARG C 3 12  ? 76.196  134.424 101.393 1.00 47.95  ? 49  ARG A CD    1 
ATOM   5140  N NE    . ARG C 3 12  ? 76.154  135.519 102.354 1.00 45.45  ? 49  ARG A NE    1 
ATOM   5141  C CZ    . ARG C 3 12  ? 75.202  135.666 103.268 1.00 51.75  ? 49  ARG A CZ    1 
ATOM   5142  N NH1   . ARG C 3 12  ? 74.209  134.781 103.357 1.00 55.42  ? 49  ARG A NH1   1 
ATOM   5143  N NH2   . ARG C 3 12  ? 75.228  136.703 104.081 1.00 48.80  ? 49  ARG A NH2   1 
ATOM   5144  N N     . GLU C 3 13  ? 79.958  131.117 102.813 1.00 34.67  ? 50  GLU A N     1 
ATOM   5145  C CA    . GLU C 3 13  ? 81.282  130.864 102.235 1.00 34.33  ? 50  GLU A CA    1 
ATOM   5146  C C     . GLU C 3 13  ? 81.521  129.367 101.968 1.00 33.91  ? 50  GLU A C     1 
ATOM   5147  O O     . GLU C 3 13  ? 82.095  128.993 100.953 1.00 34.84  ? 50  GLU A O     1 
ATOM   5148  C CB    . GLU C 3 13  ? 82.373  131.407 103.160 1.00 35.63  ? 50  GLU A CB    1 
ATOM   5149  C CG    . GLU C 3 13  ? 82.520  132.911 103.123 1.00 40.44  ? 50  GLU A CG    1 
ATOM   5150  C CD    . GLU C 3 13  ? 83.368  133.442 104.257 1.00 45.77  ? 50  GLU A CD    1 
ATOM   5151  O OE1   . GLU C 3 13  ? 84.258  132.714 104.748 1.00 46.64  ? 50  GLU A OE1   1 
ATOM   5152  O OE2   . GLU C 3 13  ? 83.157  134.603 104.655 1.00 49.92  ? 50  GLU A OE2   1 
ATOM   5153  N N     . ILE C 3 14  ? 81.091  128.508 102.883 1.00 34.21  ? 51  ILE A N     1 
ATOM   5154  C CA    . ILE C 3 14  ? 81.260  127.068 102.681 1.00 32.91  ? 51  ILE A CA    1 
ATOM   5155  C C     . ILE C 3 14  ? 80.567  126.706 101.373 1.00 34.49  ? 51  ILE A C     1 
ATOM   5156  O O     . ILE C 3 14  ? 81.147  126.042 100.508 1.00 31.19  ? 51  ILE A O     1 
ATOM   5157  C CB    . ILE C 3 14  ? 80.621  126.252 103.842 1.00 32.81  ? 51  ILE A CB    1 
ATOM   5158  C CG1   . ILE C 3 14  ? 81.423  126.474 105.132 1.00 30.29  ? 51  ILE A CG1   1 
ATOM   5159  C CG2   . ILE C 3 14  ? 80.539  124.758 103.466 1.00 27.63  ? 51  ILE A CG2   1 
ATOM   5160  C CD1   . ILE C 3 14  ? 80.803  125.822 106.367 1.00 30.34  ? 51  ILE A CD1   1 
ATOM   5161  N N     . ARG C 3 15  ? 79.322  127.152 101.208 1.00 35.35  ? 52  ARG A N     1 
ATOM   5162  C CA    . ARG C 3 15  ? 78.594  126.823 99.990  1.00 36.06  ? 52  ARG A CA    1 
ATOM   5163  C C     . ARG C 3 15  ? 79.305  127.334 98.751  1.00 36.69  ? 52  ARG A C     1 
ATOM   5164  O O     . ARG C 3 15  ? 79.411  126.634 97.732  1.00 38.42  ? 52  ARG A O     1 
ATOM   5165  C CB    . ARG C 3 15  ? 77.162  127.373 100.065 1.00 39.78  ? 52  ARG A CB    1 
ATOM   5166  C CG    . ARG C 3 15  ? 76.306  126.582 101.041 1.00 43.83  ? 52  ARG A CG    1 
ATOM   5167  C CD    . ARG C 3 15  ? 74.854  127.061 101.107 1.00 50.46  ? 52  ARG A CD    1 
ATOM   5168  N NE    . ARG C 3 15  ? 74.070  126.182 101.977 1.00 52.05  ? 52  ARG A NE    1 
ATOM   5169  C CZ    . ARG C 3 15  ? 73.750  126.457 103.237 1.00 54.33  ? 52  ARG A CZ    1 
ATOM   5170  N NH1   . ARG C 3 15  ? 74.130  127.598 103.790 1.00 56.07  ? 52  ARG A NH1   1 
ATOM   5171  N NH2   . ARG C 3 15  ? 73.071  125.574 103.951 1.00 54.76  ? 52  ARG A NH2   1 
ATOM   5172  N N     . ARG C 3 16  ? 79.816  128.549 98.846  1.00 36.88  ? 53  ARG A N     1 
ATOM   5173  C CA    . ARG C 3 16  ? 80.524  129.146 97.738  1.00 38.98  ? 53  ARG A CA    1 
ATOM   5174  C C     . ARG C 3 16  ? 81.827  128.422 97.397  1.00 35.57  ? 53  ARG A C     1 
ATOM   5175  O O     . ARG C 3 16  ? 82.102  128.150 96.233  1.00 32.48  ? 53  ARG A O     1 
ATOM   5176  C CB    . ARG C 3 16  ? 80.846  130.615 98.035  1.00 40.34  ? 53  ARG A CB    1 
ATOM   5177  C CG    . ARG C 3 16  ? 81.805  131.233 97.016  1.00 44.09  ? 53  ARG A CG    1 
ATOM   5178  C CD    . ARG C 3 16  ? 82.225  132.631 97.431  1.00 51.98  ? 53  ARG A CD    1 
ATOM   5179  N NE    . ARG C 3 16  ? 83.261  133.162 96.545  1.00 58.78  ? 53  ARG A NE    1 
ATOM   5180  C CZ    . ARG C 3 16  ? 83.932  134.286 96.773  1.00 62.85  ? 53  ARG A CZ    1 
ATOM   5181  N NH1   . ARG C 3 16  ? 83.679  135.002 97.863  1.00 65.31  ? 53  ARG A NH1   1 
ATOM   5182  N NH2   . ARG C 3 16  ? 84.856  134.695 95.916  1.00 64.70  ? 53  ARG A NH2   1 
ATOM   5183  N N     . TYR C 3 17  ? 82.644  128.119 98.402  1.00 34.14  ? 54  TYR A N     1 
ATOM   5184  C CA    . TYR C 3 17  ? 83.907  127.477 98.083  1.00 33.66  ? 54  TYR A CA    1 
ATOM   5185  C C     . TYR C 3 17  ? 83.777  126.011 97.728  1.00 32.54  ? 54  TYR A C     1 
ATOM   5186  O O     . TYR C 3 17  ? 84.619  125.475 97.005  1.00 34.08  ? 54  TYR A O     1 
ATOM   5187  C CB    . TYR C 3 17  ? 84.936  127.722 99.191  1.00 33.46  ? 54  TYR A CB    1 
ATOM   5188  C CG    . TYR C 3 17  ? 85.389  129.160 99.231  1.00 33.57  ? 54  TYR A CG    1 
ATOM   5189  C CD1   . TYR C 3 17  ? 85.996  129.746 98.121  1.00 36.17  ? 54  TYR A CD1   1 
ATOM   5190  C CD2   . TYR C 3 17  ? 85.148  129.958 100.352 1.00 34.39  ? 54  TYR A CD2   1 
ATOM   5191  C CE1   . TYR C 3 17  ? 86.342  131.110 98.118  1.00 38.75  ? 54  TYR A CE1   1 
ATOM   5192  C CE2   . TYR C 3 17  ? 85.495  131.308 100.371 1.00 34.30  ? 54  TYR A CE2   1 
ATOM   5193  C CZ    . TYR C 3 17  ? 86.084  131.877 99.246  1.00 40.14  ? 54  TYR A CZ    1 
ATOM   5194  O OH    . TYR C 3 17  ? 86.391  133.206 99.244  1.00 40.01  ? 54  TYR A OH    1 
ATOM   5195  N N     . GLN C 3 18  ? 82.719  125.355 98.187  1.00 32.34  ? 55  GLN A N     1 
ATOM   5196  C CA    . GLN C 3 18  ? 82.543  123.959 97.815  1.00 30.65  ? 55  GLN A CA    1 
ATOM   5197  C C     . GLN C 3 18  ? 81.996  123.840 96.378  1.00 33.15  ? 55  GLN A C     1 
ATOM   5198  O O     . GLN C 3 18  ? 82.040  122.776 95.779  1.00 30.86  ? 55  GLN A O     1 
ATOM   5199  C CB    . GLN C 3 18  ? 81.631  123.240 98.813  1.00 27.96  ? 55  GLN A CB    1 
ATOM   5200  C CG    . GLN C 3 18  ? 82.245  123.098 100.214 1.00 26.73  ? 55  GLN A CG    1 
ATOM   5201  C CD    . GLN C 3 18  ? 81.442  122.176 101.120 1.00 32.27  ? 55  GLN A CD    1 
ATOM   5202  O OE1   . GLN C 3 18  ? 80.229  121.986 100.927 1.00 29.65  ? 55  GLN A OE1   1 
ATOM   5203  N NE2   . GLN C 3 18  ? 82.118  121.589 102.121 1.00 29.35  ? 55  GLN A NE2   1 
ATOM   5204  N N     . LYS C 3 19  ? 81.497  124.943 95.823  1.00 34.56  ? 56  LYS A N     1 
ATOM   5205  C CA    . LYS C 3 19  ? 80.987  124.941 94.455  1.00 37.73  ? 56  LYS A CA    1 
ATOM   5206  C C     . LYS C 3 19  ? 82.124  125.190 93.468  1.00 35.87  ? 56  LYS A C     1 
ATOM   5207  O O     . LYS C 3 19  ? 82.080  124.720 92.350  1.00 38.20  ? 56  LYS A O     1 
ATOM   5208  C CB    . LYS C 3 19  ? 79.942  126.056 94.231  1.00 41.57  ? 56  LYS A CB    1 
ATOM   5209  C CG    . LYS C 3 19  ? 78.541  125.740 94.714  1.00 52.52  ? 56  LYS A CG    1 
ATOM   5210  C CD    . LYS C 3 19  ? 77.611  126.944 94.520  1.00 55.70  ? 56  LYS A CD    1 
ATOM   5211  C CE    . LYS C 3 19  ? 76.248  126.709 95.156  1.00 59.87  ? 56  LYS A CE    1 
ATOM   5212  N NZ    . LYS C 3 19  ? 75.430  127.964 95.222  1.00 63.75  ? 56  LYS A NZ    1 
ATOM   5213  N N     . SER C 3 20  ? 83.147  125.923 93.884  1.00 35.36  ? 57  SER A N     1 
ATOM   5214  C CA    . SER C 3 20  ? 84.229  126.254 92.974  1.00 33.00  ? 57  SER A CA    1 
ATOM   5215  C C     . SER C 3 20  ? 85.483  125.399 93.108  1.00 34.17  ? 57  SER A C     1 
ATOM   5216  O O     . SER C 3 20  ? 85.608  124.586 94.026  1.00 35.46  ? 57  SER A O     1 
ATOM   5217  C CB    . SER C 3 20  ? 84.575  127.717 93.142  1.00 32.78  ? 57  SER A CB    1 
ATOM   5218  O OG    . SER C 3 20  ? 84.957  127.956 94.476  1.00 37.21  ? 57  SER A OG    1 
ATOM   5219  N N     . THR C 3 21  ? 86.409  125.598 92.181  1.00 32.90  ? 58  THR A N     1 
ATOM   5220  C CA    . THR C 3 21  ? 87.653  124.845 92.143  1.00 34.43  ? 58  THR A CA    1 
ATOM   5221  C C     . THR C 3 21  ? 88.940  125.678 92.113  1.00 35.60  ? 58  THR A C     1 
ATOM   5222  O O     . THR C 3 21  ? 90.043  125.109 92.122  1.00 33.42  ? 58  THR A O     1 
ATOM   5223  C CB    . THR C 3 21  ? 87.665  123.942 90.913  1.00 33.68  ? 58  THR A CB    1 
ATOM   5224  O OG1   . THR C 3 21  ? 87.710  124.760 89.738  1.00 37.67  ? 58  THR A OG1   1 
ATOM   5225  C CG2   . THR C 3 21  ? 86.382  123.083 90.860  1.00 30.27  ? 58  THR A CG2   1 
ATOM   5226  N N     . GLU C 3 22  ? 88.833  127.007 92.078  1.00 34.09  ? 59  GLU A N     1 
ATOM   5227  C CA    . GLU C 3 22  ? 90.067  127.809 92.007  1.00 38.05  ? 59  GLU A CA    1 
ATOM   5228  C C     . GLU C 3 22  ? 90.902  127.663 93.255  1.00 35.59  ? 59  GLU A C     1 
ATOM   5229  O O     . GLU C 3 22  ? 90.361  127.400 94.332  1.00 35.21  ? 59  GLU A O     1 
ATOM   5230  C CB    . GLU C 3 22  ? 89.798  129.310 91.799  1.00 39.14  ? 59  GLU A CB    1 
ATOM   5231  C CG    . GLU C 3 22  ? 88.363  129.768 91.941  1.00 52.80  ? 59  GLU A CG    1 
ATOM   5232  C CD    . GLU C 3 22  ? 87.781  129.576 93.333  1.00 54.19  ? 59  GLU A CD    1 
ATOM   5233  O OE1   . GLU C 3 22  ? 88.087  130.368 94.245  1.00 57.21  ? 59  GLU A OE1   1 
ATOM   5234  O OE2   . GLU C 3 22  ? 87.003  128.627 93.508  1.00 54.12  ? 59  GLU A OE2   1 
ATOM   5235  N N     . LEU C 3 23  ? 92.212  127.856 93.113  1.00 31.80  ? 60  LEU A N     1 
ATOM   5236  C CA    . LEU C 3 23  ? 93.107  127.774 94.242  1.00 32.13  ? 60  LEU A CA    1 
ATOM   5237  C C     . LEU C 3 23  ? 92.771  128.909 95.206  1.00 33.66  ? 60  LEU A C     1 
ATOM   5238  O O     . LEU C 3 23  ? 92.325  129.975 94.787  1.00 34.65  ? 60  LEU A O     1 
ATOM   5239  C CB    . LEU C 3 23  ? 94.553  127.825 93.759  1.00 35.61  ? 60  LEU A CB    1 
ATOM   5240  C CG    . LEU C 3 23  ? 94.858  126.633 92.830  1.00 36.25  ? 60  LEU A CG    1 
ATOM   5241  C CD1   . LEU C 3 23  ? 96.273  126.692 92.308  1.00 38.22  ? 60  LEU A CD1   1 
ATOM   5242  C CD2   . LEU C 3 23  ? 94.623  125.337 93.587  1.00 38.98  ? 60  LEU A CD2   1 
ATOM   5243  N N     . LEU C 3 24  ? 92.993  128.677 96.494  1.00 32.72  ? 61  LEU A N     1 
ATOM   5244  C CA    . LEU C 3 24  ? 92.620  129.630 97.518  1.00 32.86  ? 61  LEU A CA    1 
ATOM   5245  C C     . LEU C 3 24  ? 93.769  130.319 98.207  1.00 33.04  ? 61  LEU A C     1 
ATOM   5246  O O     . LEU C 3 24  ? 93.538  131.261 98.985  1.00 34.49  ? 61  LEU A O     1 
ATOM   5247  C CB    . LEU C 3 24  ? 91.718  128.929 98.546  1.00 35.78  ? 61  LEU A CB    1 
ATOM   5248  C CG    . LEU C 3 24  ? 90.505  128.248 97.894  1.00 34.10  ? 61  LEU A CG    1 
ATOM   5249  C CD1   . LEU C 3 24  ? 89.796  127.362 98.921  1.00 34.28  ? 61  LEU A CD1   1 
ATOM   5250  C CD2   . LEU C 3 24  ? 89.555  129.322 97.347  1.00 33.42  ? 61  LEU A CD2   1 
ATOM   5251  N N     . ILE C 3 25  ? 94.989  129.834 97.977  1.00 29.74  ? 62  ILE A N     1 
ATOM   5252  C CA    . ILE C 3 25  ? 96.171  130.493 98.522  1.00 32.34  ? 62  ILE A CA    1 
ATOM   5253  C C     . ILE C 3 25  ? 96.646  131.364 97.351  1.00 33.15  ? 62  ILE A C     1 
ATOM   5254  O O     . ILE C 3 25  ? 96.519  130.947 96.203  1.00 34.03  ? 62  ILE A O     1 
ATOM   5255  C CB    . ILE C 3 25  ? 97.317  129.502 98.876  1.00 30.19  ? 62  ILE A CB    1 
ATOM   5256  C CG1   . ILE C 3 25  ? 96.855  128.505 99.950  1.00 33.14  ? 62  ILE A CG1   1 
ATOM   5257  C CG2   . ILE C 3 25  ? 98.525  130.280 99.439  1.00 27.73  ? 62  ILE A CG2   1 
ATOM   5258  C CD1   . ILE C 3 25  ? 97.954  127.470 100.354 1.00 24.29  ? 62  ILE A CD1   1 
ATOM   5259  N N     . ARG C 3 26  ? 97.171  132.557 97.605  1.00 36.55  ? 63  ARG A N     1 
ATOM   5260  C CA    . ARG C 3 26  ? 97.629  133.379 96.472  1.00 37.82  ? 63  ARG A CA    1 
ATOM   5261  C C     . ARG C 3 26  ? 98.916  132.795 95.913  1.00 38.14  ? 63  ARG A C     1 
ATOM   5262  O O     . ARG C 3 26  ? 99.783  132.367 96.659  1.00 36.74  ? 63  ARG A O     1 
ATOM   5263  C CB    . ARG C 3 26  ? 97.847  134.832 96.880  1.00 40.12  ? 63  ARG A CB    1 
ATOM   5264  C CG    . ARG C 3 26  ? 96.549  135.595 97.043  1.00 45.72  ? 63  ARG A CG    1 
ATOM   5265  C CD    . ARG C 3 26  ? 96.274  135.843 98.468  1.00 49.96  ? 63  ARG A CD    1 
ATOM   5266  N NE    . ARG C 3 26  ? 97.281  136.733 99.014  1.00 56.85  ? 63  ARG A NE    1 
ATOM   5267  C CZ    . ARG C 3 26  ? 97.445  136.953 100.312 1.00 59.19  ? 63  ARG A CZ    1 
ATOM   5268  N NH1   . ARG C 3 26  ? 96.653  136.328 101.185 1.00 54.19  ? 63  ARG A NH1   1 
ATOM   5269  N NH2   . ARG C 3 26  ? 98.390  137.800 100.722 1.00 53.56  ? 63  ARG A NH2   1 
ATOM   5270  N N     . LYS C 3 27  ? 99.042  132.812 94.595  1.00 39.08  ? 64  LYS A N     1 
ATOM   5271  C CA    . LYS C 3 27  ? 100.181 132.205 93.928  1.00 41.62  ? 64  LYS A CA    1 
ATOM   5272  C C     . LYS C 3 27  ? 101.594 132.619 94.297  1.00 40.58  ? 64  LYS A C     1 
ATOM   5273  O O     . LYS C 3 27  ? 102.414 131.776 94.656  1.00 39.76  ? 64  LYS A O     1 
ATOM   5274  C CB    . LYS C 3 27  ? 99.983  132.316 92.420  1.00 45.75  ? 64  LYS A CB    1 
ATOM   5275  C CG    . LYS C 3 27  ? 98.737  131.565 91.968  1.00 59.54  ? 64  LYS A CG    1 
ATOM   5276  C CD    . LYS C 3 27  ? 98.655  131.459 90.450  1.00 63.49  ? 64  LYS A CD    1 
ATOM   5277  C CE    . LYS C 3 27  ? 97.516  130.546 90.022  1.00 66.82  ? 64  LYS A CE    1 
ATOM   5278  N NZ    . LYS C 3 27  ? 97.647  130.171 88.575  1.00 68.98  ? 64  LYS A NZ    1 
ATOM   5279  N N     . LEU C 3 28  ? 101.894 133.909 94.216  1.00 41.92  ? 65  LEU A N     1 
ATOM   5280  C CA    . LEU C 3 28  ? 103.250 134.362 94.522  1.00 37.93  ? 65  LEU A CA    1 
ATOM   5281  C C     . LEU C 3 28  ? 103.733 133.959 95.901  1.00 36.84  ? 65  LEU A C     1 
ATOM   5282  O O     . LEU C 3 28  ? 104.827 133.423 96.049  1.00 39.91  ? 65  LEU A O     1 
ATOM   5283  C CB    . LEU C 3 28  ? 103.356 135.883 94.366  1.00 41.34  ? 65  LEU A CB    1 
ATOM   5284  C CG    . LEU C 3 28  ? 104.680 136.503 94.816  1.00 41.41  ? 65  LEU A CG    1 
ATOM   5285  C CD1   . LEU C 3 28  ? 105.826 135.883 94.055  1.00 37.80  ? 65  LEU A CD1   1 
ATOM   5286  C CD2   . LEU C 3 28  ? 104.637 138.007 94.568  1.00 42.68  ? 65  LEU A CD2   1 
ATOM   5287  N N     . PRO C 3 29  ? 102.935 134.227 96.938  1.00 35.12  ? 66  PRO A N     1 
ATOM   5288  C CA    . PRO C 3 29  ? 103.348 133.865 98.295  1.00 35.27  ? 66  PRO A CA    1 
ATOM   5289  C C     . PRO C 3 29  ? 103.578 132.350 98.394  1.00 34.69  ? 66  PRO A C     1 
ATOM   5290  O O     . PRO C 3 29  ? 104.484 131.891 99.090  1.00 35.59  ? 66  PRO A O     1 
ATOM   5291  C CB    . PRO C 3 29  ? 102.169 134.321 99.152  1.00 34.67  ? 66  PRO A CB    1 
ATOM   5292  C CG    . PRO C 3 29  ? 101.519 135.385 98.316  1.00 39.04  ? 66  PRO A CG    1 
ATOM   5293  C CD    . PRO C 3 29  ? 101.597 134.829 96.935  1.00 34.02  ? 66  PRO A CD    1 
ATOM   5294  N N     . PHE C 3 30  ? 102.768 131.572 97.692  1.00 35.36  ? 67  PHE A N     1 
ATOM   5295  C CA    . PHE C 3 30  ? 102.953 130.119 97.747  1.00 34.86  ? 67  PHE A CA    1 
ATOM   5296  C C     . PHE C 3 30  ? 104.282 129.786 97.068  1.00 34.59  ? 67  PHE A C     1 
ATOM   5297  O O     . PHE C 3 30  ? 105.089 129.001 97.573  1.00 32.31  ? 67  PHE A O     1 
ATOM   5298  C CB    . PHE C 3 30  ? 101.808 129.388 97.040  1.00 33.09  ? 67  PHE A CB    1 
ATOM   5299  C CG    . PHE C 3 30  ? 101.909 127.884 97.136  1.00 35.00  ? 67  PHE A CG    1 
ATOM   5300  C CD1   . PHE C 3 30  ? 101.455 127.211 98.279  1.00 33.88  ? 67  PHE A CD1   1 
ATOM   5301  C CD2   . PHE C 3 30  ? 102.488 127.150 96.114  1.00 31.45  ? 67  PHE A CD2   1 
ATOM   5302  C CE1   . PHE C 3 30  ? 101.587 125.828 98.390  1.00 30.91  ? 67  PHE A CE1   1 
ATOM   5303  C CE2   . PHE C 3 30  ? 102.625 125.750 96.223  1.00 33.55  ? 67  PHE A CE2   1 
ATOM   5304  C CZ    . PHE C 3 30  ? 102.175 125.100 97.362  1.00 30.68  ? 67  PHE A CZ    1 
ATOM   5305  N N     . GLN C 3 31  ? 104.516 130.409 95.921  1.00 35.42  ? 68  GLN A N     1 
ATOM   5306  C CA    . GLN C 3 31  ? 105.746 130.178 95.179  1.00 36.68  ? 68  GLN A CA    1 
ATOM   5307  C C     . GLN C 3 31  ? 106.973 130.532 96.015  1.00 34.97  ? 68  GLN A C     1 
ATOM   5308  O O     . GLN C 3 31  ? 107.972 129.788 96.033  1.00 35.03  ? 68  GLN A O     1 
ATOM   5309  C CB    . GLN C 3 31  ? 105.744 130.986 93.884  1.00 41.19  ? 68  GLN A CB    1 
ATOM   5310  C CG    . GLN C 3 31  ? 106.818 130.530 92.913  1.00 51.00  ? 68  GLN A CG    1 
ATOM   5311  C CD    . GLN C 3 31  ? 106.571 131.012 91.511  1.00 56.79  ? 68  GLN A CD    1 
ATOM   5312  O OE1   . GLN C 3 31  ? 106.675 132.206 91.228  1.00 62.29  ? 68  GLN A OE1   1 
ATOM   5313  N NE2   . GLN C 3 31  ? 106.229 130.089 90.620  1.00 60.47  ? 68  GLN A NE2   1 
ATOM   5314  N N     . ARG C 3 32  ? 106.908 131.651 96.724  1.00 33.66  ? 69  ARG A N     1 
ATOM   5315  C CA    . ARG C 3 32  ? 108.045 132.053 97.551  1.00 34.33  ? 69  ARG A CA    1 
ATOM   5316  C C     . ARG C 3 32  ? 108.302 130.986 98.597  1.00 33.97  ? 69  ARG A C     1 
ATOM   5317  O O     . ARG C 3 32  ? 109.449 130.613 98.847  1.00 32.80  ? 69  ARG A O     1 
ATOM   5318  C CB    . ARG C 3 32  ? 107.778 133.370 98.292  1.00 35.60  ? 69  ARG A CB    1 
ATOM   5319  C CG    . ARG C 3 32  ? 107.924 134.651 97.459  1.00 42.59  ? 69  ARG A CG    1 
ATOM   5320  C CD    . ARG C 3 32  ? 108.206 135.830 98.402  1.00 42.45  ? 69  ARG A CD    1 
ATOM   5321  N NE    . ARG C 3 32  ? 107.152 135.985 99.397  1.00 42.53  ? 69  ARG A NE    1 
ATOM   5322  C CZ    . ARG C 3 32  ? 106.017 136.641 99.185  1.00 43.77  ? 69  ARG A CZ    1 
ATOM   5323  N NH1   . ARG C 3 32  ? 105.792 137.218 98.011  1.00 45.38  ? 69  ARG A NH1   1 
ATOM   5324  N NH2   . ARG C 3 32  ? 105.099 136.708 100.145 1.00 42.47  ? 69  ARG A NH2   1 
ATOM   5325  N N     . LEU C 3 33  ? 107.223 130.516 99.222  1.00 32.05  ? 70  LEU A N     1 
ATOM   5326  C CA    . LEU C 3 33  ? 107.336 129.502 100.258 1.00 32.39  ? 70  LEU A CA    1 
ATOM   5327  C C     . LEU C 3 33  ? 107.987 128.255 99.695  1.00 30.48  ? 70  LEU A C     1 
ATOM   5328  O O     . LEU C 3 33  ? 108.897 127.703 100.302 1.00 34.38  ? 70  LEU A O     1 
ATOM   5329  C CB    . LEU C 3 33  ? 105.952 129.164 100.822 1.00 33.91  ? 70  LEU A CB    1 
ATOM   5330  C CG    . LEU C 3 33  ? 105.916 128.101 101.927 1.00 32.69  ? 70  LEU A CG    1 
ATOM   5331  C CD1   . LEU C 3 33  ? 106.732 128.584 103.122 1.00 30.59  ? 70  LEU A CD1   1 
ATOM   5332  C CD2   . LEU C 3 33  ? 104.467 127.859 102.348 1.00 28.17  ? 70  LEU A CD2   1 
ATOM   5333  N N     . VAL C 3 34  ? 107.524 127.821 98.532  1.00 31.45  ? 71  VAL A N     1 
ATOM   5334  C CA    . VAL C 3 34  ? 108.069 126.639 97.870  1.00 32.76  ? 71  VAL A CA    1 
ATOM   5335  C C     . VAL C 3 34  ? 109.574 126.795 97.606  1.00 35.38  ? 71  VAL A C     1 
ATOM   5336  O O     . VAL C 3 34  ? 110.370 125.926 97.981  1.00 33.05  ? 71  VAL A O     1 
ATOM   5337  C CB    . VAL C 3 34  ? 107.300 126.389 96.542  1.00 33.61  ? 71  VAL A CB    1 
ATOM   5338  C CG1   . VAL C 3 34  ? 108.065 125.456 95.625  1.00 30.55  ? 71  VAL A CG1   1 
ATOM   5339  C CG2   . VAL C 3 34  ? 105.913 125.805 96.861  1.00 33.46  ? 71  VAL A CG2   1 
ATOM   5340  N N     . ARG C 3 35  ? 109.966 127.917 96.991  1.00 34.10  ? 72  ARG A N     1 
ATOM   5341  C CA    . ARG C 3 35  ? 111.386 128.164 96.690  1.00 32.61  ? 72  ARG A CA    1 
ATOM   5342  C C     . ARG C 3 35  ? 112.246 128.168 97.945  1.00 29.73  ? 72  ARG A C     1 
ATOM   5343  O O     . ARG C 3 35  ? 113.336 127.577 97.967  1.00 30.40  ? 72  ARG A O     1 
ATOM   5344  C CB    . ARG C 3 35  ? 111.559 129.499 95.939  1.00 33.17  ? 72  ARG A CB    1 
ATOM   5345  C CG    . ARG C 3 35  ? 111.035 129.443 94.530  1.00 34.41  ? 72  ARG A CG    1 
ATOM   5346  C CD    . ARG C 3 35  ? 110.925 130.831 93.915  1.00 40.56  ? 72  ARG A CD    1 
ATOM   5347  N NE    . ARG C 3 35  ? 110.214 130.767 92.643  1.00 42.46  ? 72  ARG A NE    1 
ATOM   5348  C CZ    . ARG C 3 35  ? 110.711 130.218 91.542  1.00 42.55  ? 72  ARG A CZ    1 
ATOM   5349  N NH1   . ARG C 3 35  ? 111.928 129.695 91.554  1.00 41.11  ? 72  ARG A NH1   1 
ATOM   5350  N NH2   . ARG C 3 35  ? 109.973 130.167 90.441  1.00 46.89  ? 72  ARG A NH2   1 
ATOM   5351  N N     . GLU C 3 36  ? 111.757 128.825 98.992  1.00 29.06  ? 73  GLU A N     1 
ATOM   5352  C CA    . GLU C 3 36  ? 112.494 128.885 100.237 1.00 31.60  ? 73  GLU A CA    1 
ATOM   5353  C C     . GLU C 3 36  ? 112.710 127.485 100.790 1.00 33.61  ? 73  GLU A C     1 
ATOM   5354  O O     . GLU C 3 36  ? 113.811 127.130 101.206 1.00 34.10  ? 73  GLU A O     1 
ATOM   5355  C CB    . GLU C 3 36  ? 111.736 129.738 101.244 1.00 35.93  ? 73  GLU A CB    1 
ATOM   5356  C CG    . GLU C 3 36  ? 112.224 129.625 102.666 1.00 42.04  ? 73  GLU A CG    1 
ATOM   5357  C CD    . GLU C 3 36  ? 111.419 130.508 103.590 1.00 46.90  ? 73  GLU A CD    1 
ATOM   5358  O OE1   . GLU C 3 36  ? 111.506 131.736 103.456 1.00 50.80  ? 73  GLU A OE1   1 
ATOM   5359  O OE2   . GLU C 3 36  ? 110.690 129.981 104.447 1.00 54.79  ? 73  GLU A OE2   1 
ATOM   5360  N N     . ILE C 3 37  ? 111.672 126.658 100.793 1.00 32.65  ? 74  ILE A N     1 
ATOM   5361  C CA    . ILE C 3 37  ? 111.872 125.304 101.322 1.00 29.97  ? 74  ILE A CA    1 
ATOM   5362  C C     . ILE C 3 37  ? 112.872 124.513 100.483 1.00 29.96  ? 74  ILE A C     1 
ATOM   5363  O O     . ILE C 3 37  ? 113.734 123.810 101.020 1.00 30.45  ? 74  ILE A O     1 
ATOM   5364  C CB    . ILE C 3 37  ? 110.538 124.532 101.388 1.00 29.15  ? 74  ILE A CB    1 
ATOM   5365  C CG1   . ILE C 3 37  ? 109.703 125.055 102.560 1.00 30.54  ? 74  ILE A CG1   1 
ATOM   5366  C CG2   . ILE C 3 37  ? 110.811 123.042 101.544 1.00 28.17  ? 74  ILE A CG2   1 
ATOM   5367  C CD1   . ILE C 3 37  ? 108.205 124.702 102.460 1.00 30.01  ? 74  ILE A CD1   1 
ATOM   5368  N N     . ALA C 3 38  ? 112.755 124.626 99.165  1.00 30.41  ? 75  ALA A N     1 
ATOM   5369  C CA    . ALA C 3 38  ? 113.635 123.900 98.252  1.00 31.59  ? 75  ALA A CA    1 
ATOM   5370  C C     . ALA C 3 38  ? 115.095 124.336 98.383  1.00 37.09  ? 75  ALA A C     1 
ATOM   5371  O O     . ALA C 3 38  ? 116.009 123.506 98.258  1.00 36.49  ? 75  ALA A O     1 
ATOM   5372  C CB    . ALA C 3 38  ? 113.165 124.094 96.810  1.00 34.21  ? 75  ALA A CB    1 
ATOM   5373  N N     . GLN C 3 39  ? 115.313 125.622 98.646  1.00 39.37  ? 76  GLN A N     1 
ATOM   5374  C CA    . GLN C 3 39  ? 116.673 126.155 98.774  1.00 42.16  ? 76  GLN A CA    1 
ATOM   5375  C C     . GLN C 3 39  ? 117.423 125.452 99.900  1.00 43.43  ? 76  GLN A C     1 
ATOM   5376  O O     . GLN C 3 39  ? 118.645 125.397 99.882  1.00 44.00  ? 76  GLN A O     1 
ATOM   5377  C CB    . GLN C 3 39  ? 116.642 127.675 99.024  1.00 45.13  ? 76  GLN A CB    1 
ATOM   5378  C CG    . GLN C 3 39  ? 118.030 128.347 99.149  1.00 49.04  ? 76  GLN A CG    1 
ATOM   5379  C CD    . GLN C 3 39  ? 118.628 128.803 97.809  1.00 52.86  ? 76  GLN A CD    1 
ATOM   5380  O OE1   . GLN C 3 39  ? 118.136 128.457 96.735  1.00 53.05  ? 76  GLN A OE1   1 
ATOM   5381  N NE2   . GLN C 3 39  ? 119.704 129.576 97.882  1.00 54.59  ? 76  GLN A NE2   1 
ATOM   5382  N N     . ASP C 3 40  ? 116.697 124.907 100.880 1.00 44.01  ? 77  ASP A N     1 
ATOM   5383  C CA    . ASP C 3 40  ? 117.346 124.195 101.981 1.00 42.31  ? 77  ASP A CA    1 
ATOM   5384  C C     . ASP C 3 40  ? 117.819 122.825 101.528 1.00 43.25  ? 77  ASP A C     1 
ATOM   5385  O O     . ASP C 3 40  ? 118.683 122.234 102.162 1.00 44.78  ? 77  ASP A O     1 
ATOM   5386  C CB    . ASP C 3 40  ? 116.392 124.011 103.165 1.00 48.80  ? 77  ASP A CB    1 
ATOM   5387  C CG    . ASP C 3 40  ? 116.109 125.310 103.910 1.00 53.58  ? 77  ASP A CG    1 
ATOM   5388  O OD1   . ASP C 3 40  ? 116.944 126.241 103.869 1.00 56.29  ? 77  ASP A OD1   1 
ATOM   5389  O OD2   . ASP C 3 40  ? 115.041 125.391 104.559 1.00 57.16  ? 77  ASP A OD2   1 
ATOM   5390  N N     . PHE C 3 41  ? 117.272 122.311 100.429 1.00 40.42  ? 78  PHE A N     1 
ATOM   5391  C CA    . PHE C 3 41  ? 117.674 120.988 99.960  1.00 39.72  ? 78  PHE A CA    1 
ATOM   5392  C C     . PHE C 3 41  ? 118.692 121.104 98.846  1.00 40.96  ? 78  PHE A C     1 
ATOM   5393  O O     . PHE C 3 41  ? 119.555 120.253 98.690  1.00 41.02  ? 78  PHE A O     1 
ATOM   5394  C CB    . PHE C 3 41  ? 116.454 120.193 99.468  1.00 37.54  ? 78  PHE A CB    1 
ATOM   5395  C CG    . PHE C 3 41  ? 115.389 120.010 100.516 1.00 38.85  ? 78  PHE A CG    1 
ATOM   5396  C CD1   . PHE C 3 41  ? 115.725 119.607 101.808 1.00 39.11  ? 78  PHE A CD1   1 
ATOM   5397  C CD2   . PHE C 3 41  ? 114.059 120.272 100.224 1.00 34.16  ? 78  PHE A CD2   1 
ATOM   5398  C CE1   . PHE C 3 41  ? 114.737 119.480 102.794 1.00 40.02  ? 78  PHE A CE1   1 
ATOM   5399  C CE2   . PHE C 3 41  ? 113.081 120.151 101.189 1.00 34.57  ? 78  PHE A CE2   1 
ATOM   5400  C CZ    . PHE C 3 41  ? 113.416 119.756 102.480 1.00 36.12  ? 78  PHE A CZ    1 
ATOM   5401  N N     . LYS C 3 42  ? 118.568 122.151 98.042  1.00 41.56  ? 79  LYS A N     1 
ATOM   5402  C CA    . LYS C 3 42  ? 119.525 122.372 96.970  1.00 41.68  ? 79  LYS A CA    1 
ATOM   5403  C C     . LYS C 3 42  ? 119.421 123.828 96.569  1.00 41.99  ? 79  LYS A C     1 
ATOM   5404  O O     . LYS C 3 42  ? 118.339 124.321 96.272  1.00 38.50  ? 79  LYS A O     1 
ATOM   5405  C CB    . LYS C 3 42  ? 119.254 121.465 95.767  1.00 41.68  ? 79  LYS A CB    1 
ATOM   5406  C CG    . LYS C 3 42  ? 120.376 121.528 94.754  1.00 43.57  ? 79  LYS A CG    1 
ATOM   5407  C CD    . LYS C 3 42  ? 120.141 120.640 93.555  1.00 54.03  ? 79  LYS A CD    1 
ATOM   5408  C CE    . LYS C 3 42  ? 121.373 120.631 92.657  1.00 58.08  ? 79  LYS A CE    1 
ATOM   5409  N NZ    . LYS C 3 42  ? 121.295 119.564 91.641  1.00 65.72  ? 79  LYS A NZ    1 
ATOM   5410  N N     . THR C 3 43  ? 120.555 124.521 96.588  1.00 43.13  ? 80  THR A N     1 
ATOM   5411  C CA    . THR C 3 43  ? 120.603 125.944 96.251  1.00 40.96  ? 80  THR A CA    1 
ATOM   5412  C C     . THR C 3 43  ? 120.554 126.165 94.746  1.00 42.40  ? 80  THR A C     1 
ATOM   5413  O O     . THR C 3 43  ? 120.817 125.255 93.968  1.00 43.04  ? 80  THR A O     1 
ATOM   5414  C CB    . THR C 3 43  ? 121.901 126.585 96.775  1.00 42.09  ? 80  THR A CB    1 
ATOM   5415  O OG1   . THR C 3 43  ? 123.032 125.948 96.159  1.00 41.85  ? 80  THR A OG1   1 
ATOM   5416  C CG2   . THR C 3 43  ? 122.011 126.412 98.287  1.00 41.82  ? 80  THR A CG2   1 
ATOM   5417  N N     . ASP C 3 44  ? 120.177 127.378 94.358  1.00 44.53  ? 81  ASP A N     1 
ATOM   5418  C CA    . ASP C 3 44  ? 120.141 127.805 92.959  1.00 44.70  ? 81  ASP A CA    1 
ATOM   5419  C C     . ASP C 3 44  ? 119.278 127.002 92.007  1.00 44.44  ? 81  ASP A C     1 
ATOM   5420  O O     . ASP C 3 44  ? 119.643 126.793 90.842  1.00 42.56  ? 81  ASP A O     1 
ATOM   5421  C CB    . ASP C 3 44  ? 121.576 127.885 92.418  1.00 44.29  ? 81  ASP A CB    1 
ATOM   5422  C CG    . ASP C 3 44  ? 121.663 128.624 91.088  1.00 45.55  ? 81  ASP A CG    1 
ATOM   5423  O OD1   . ASP C 3 44  ? 121.025 129.681 90.925  1.00 48.02  ? 81  ASP A OD1   1 
ATOM   5424  O OD2   . ASP C 3 44  ? 122.387 128.149 90.198  1.00 50.63  ? 81  ASP A OD2   1 
ATOM   5425  N N     . LEU C 3 45  ? 118.113 126.582 92.494  1.00 42.63  ? 82  LEU A N     1 
ATOM   5426  C CA    . LEU C 3 45  ? 117.182 125.808 91.692  1.00 39.20  ? 82  LEU A CA    1 
ATOM   5427  C C     . LEU C 3 45  ? 116.206 126.695 90.942  1.00 37.56  ? 82  LEU A C     1 
ATOM   5428  O O     . LEU C 3 45  ? 115.890 127.794 91.378  1.00 39.01  ? 82  LEU A O     1 
ATOM   5429  C CB    . LEU C 3 45  ? 116.346 124.880 92.590  1.00 41.09  ? 82  LEU A CB    1 
ATOM   5430  C CG    . LEU C 3 45  ? 116.921 123.561 93.100  1.00 41.13  ? 82  LEU A CG    1 
ATOM   5431  C CD1   . LEU C 3 45  ? 115.904 122.902 94.048  1.00 44.83  ? 82  LEU A CD1   1 
ATOM   5432  C CD2   . LEU C 3 45  ? 117.216 122.658 91.924  1.00 40.75  ? 82  LEU A CD2   1 
ATOM   5433  N N     . ARG C 3 46  ? 115.729 126.208 89.812  1.00 35.96  ? 83  ARG A N     1 
ATOM   5434  C CA    . ARG C 3 46  ? 114.687 126.905 89.080  1.00 37.00  ? 83  ARG A CA    1 
ATOM   5435  C C     . ARG C 3 46  ? 113.462 125.953 89.166  1.00 38.21  ? 83  ARG A C     1 
ATOM   5436  O O     . ARG C 3 46  ? 113.600 124.769 89.538  1.00 32.85  ? 83  ARG A O     1 
ATOM   5437  C CB    . ARG C 3 46  ? 115.108 127.124 87.619  1.00 40.28  ? 83  ARG A CB    1 
ATOM   5438  C CG    . ARG C 3 46  ? 116.364 128.023 87.482  1.00 45.08  ? 83  ARG A CG    1 
ATOM   5439  C CD    . ARG C 3 46  ? 116.758 128.260 86.032  1.00 50.67  ? 83  ARG A CD    1 
ATOM   5440  N NE    . ARG C 3 46  ? 115.811 129.156 85.368  1.00 59.32  ? 83  ARG A NE    1 
ATOM   5441  C CZ    . ARG C 3 46  ? 115.983 129.676 84.154  1.00 61.26  ? 83  ARG A CZ    1 
ATOM   5442  N NH1   . ARG C 3 46  ? 117.069 129.392 83.452  1.00 62.97  ? 83  ARG A NH1   1 
ATOM   5443  N NH2   . ARG C 3 46  ? 115.071 130.490 83.644  1.00 61.19  ? 83  ARG A NH2   1 
ATOM   5444  N N     . PHE C 3 47  ? 112.279 126.459 88.834  1.00 37.34  ? 84  PHE A N     1 
ATOM   5445  C CA    . PHE C 3 47  ? 111.068 125.647 88.860  1.00 37.40  ? 84  PHE A CA    1 
ATOM   5446  C C     . PHE C 3 47  ? 110.281 125.822 87.584  1.00 38.38  ? 84  PHE A C     1 
ATOM   5447  O O     . PHE C 3 47  ? 110.108 126.952 87.124  1.00 41.03  ? 84  PHE A O     1 
ATOM   5448  C CB    . PHE C 3 47  ? 110.139 126.051 90.023  1.00 34.94  ? 84  PHE A CB    1 
ATOM   5449  C CG    . PHE C 3 47  ? 110.519 125.459 91.348  1.00 34.57  ? 84  PHE A CG    1 
ATOM   5450  C CD1   . PHE C 3 47  ? 111.580 125.974 92.081  1.00 35.97  ? 84  PHE A CD1   1 
ATOM   5451  C CD2   . PHE C 3 47  ? 109.838 124.351 91.849  1.00 35.99  ? 84  PHE A CD2   1 
ATOM   5452  C CE1   . PHE C 3 47  ? 111.964 125.397 93.288  1.00 32.25  ? 84  PHE A CE1   1 
ATOM   5453  C CE2   . PHE C 3 47  ? 110.221 123.761 93.071  1.00 33.44  ? 84  PHE A CE2   1 
ATOM   5454  C CZ    . PHE C 3 47  ? 111.276 124.283 93.778  1.00 32.43  ? 84  PHE A CZ    1 
ATOM   5455  N N     . GLN C 3 48  ? 109.814 124.733 86.988  1.00 34.99  ? 85  GLN A N     1 
ATOM   5456  C CA    . GLN C 3 48  ? 108.976 124.922 85.832  1.00 35.52  ? 85  GLN A CA    1 
ATOM   5457  C C     . GLN C 3 48  ? 107.737 125.488 86.499  1.00 37.55  ? 85  GLN A C     1 
ATOM   5458  O O     . GLN C 3 48  ? 107.492 125.251 87.701  1.00 37.43  ? 85  GLN A O     1 
ATOM   5459  C CB    . GLN C 3 48  ? 108.615 123.610 85.153  1.00 38.37  ? 85  GLN A CB    1 
ATOM   5460  C CG    . GLN C 3 48  ? 109.761 122.886 84.514  1.00 39.33  ? 85  GLN A CG    1 
ATOM   5461  C CD    . GLN C 3 48  ? 109.282 121.735 83.665  1.00 42.25  ? 85  GLN A CD    1 
ATOM   5462  O OE1   . GLN C 3 48  ? 108.347 121.019 84.045  1.00 39.77  ? 85  GLN A OE1   1 
ATOM   5463  N NE2   . GLN C 3 48  ? 109.920 121.534 82.516  1.00 39.05  ? 85  GLN A NE2   1 
ATOM   5464  N N     . SER C 3 49  ? 106.956 126.238 85.736  1.00 35.08  ? 86  SER A N     1 
ATOM   5465  C CA    . SER C 3 49  ? 105.744 126.842 86.244  1.00 33.45  ? 86  SER A CA    1 
ATOM   5466  C C     . SER C 3 49  ? 104.737 125.771 86.656  1.00 31.05  ? 86  SER A C     1 
ATOM   5467  O O     . SER C 3 49  ? 104.031 125.916 87.649  1.00 31.46  ? 86  SER A O     1 
ATOM   5468  C CB    . SER C 3 49  ? 105.125 127.711 85.151  1.00 35.55  ? 86  SER A CB    1 
ATOM   5469  O OG    . SER C 3 49  ? 103.986 128.366 85.645  1.00 46.67  ? 86  SER A OG    1 
ATOM   5470  N N     . SER C 3 50  ? 104.659 124.705 85.878  1.00 29.40  ? 87  SER A N     1 
ATOM   5471  C CA    . SER C 3 50  ? 103.721 123.634 86.160  1.00 32.24  ? 87  SER A CA    1 
ATOM   5472  C C     . SER C 3 50  ? 104.098 122.867 87.433  1.00 30.56  ? 87  SER A C     1 
ATOM   5473  O O     . SER C 3 50  ? 103.241 122.255 88.063  1.00 30.58  ? 87  SER A O     1 
ATOM   5474  C CB    . SER C 3 50  ? 103.658 122.693 84.971  1.00 29.76  ? 87  SER A CB    1 
ATOM   5475  O OG    . SER C 3 50  ? 104.985 122.299 84.653  1.00 40.62  ? 87  SER A OG    1 
ATOM   5476  N N     . ALA C 3 51  ? 105.376 122.928 87.810  1.00 32.10  ? 88  ALA A N     1 
ATOM   5477  C CA    . ALA C 3 51  ? 105.875 122.268 89.015  1.00 30.23  ? 88  ALA A CA    1 
ATOM   5478  C C     . ALA C 3 51  ? 105.297 122.973 90.237  1.00 29.83  ? 88  ALA A C     1 
ATOM   5479  O O     . ALA C 3 51  ? 104.837 122.335 91.176  1.00 26.20  ? 88  ALA A O     1 
ATOM   5480  C CB    . ALA C 3 51  ? 107.404 122.325 89.067  1.00 26.77  ? 88  ALA A CB    1 
ATOM   5481  N N     . VAL C 3 52  ? 105.330 124.294 90.243  1.00 29.36  ? 89  VAL A N     1 
ATOM   5482  C CA    . VAL C 3 52  ? 104.777 125.022 91.375  1.00 29.57  ? 89  VAL A CA    1 
ATOM   5483  C C     . VAL C 3 52  ? 103.261 124.827 91.450  1.00 31.73  ? 89  VAL A C     1 
ATOM   5484  O O     . VAL C 3 52  ? 102.700 124.655 92.530  1.00 34.07  ? 89  VAL A O     1 
ATOM   5485  C CB    . VAL C 3 52  ? 105.092 126.541 91.305  1.00 32.25  ? 89  VAL A CB    1 
ATOM   5486  C CG1   . VAL C 3 52  ? 104.451 127.248 92.497  1.00 30.90  ? 89  VAL A CG1   1 
ATOM   5487  C CG2   . VAL C 3 52  ? 106.611 126.764 91.355  1.00 31.60  ? 89  VAL A CG2   1 
ATOM   5488  N N     . MET C 3 53  ? 102.597 124.848 90.302  1.00 32.36  ? 90  MET A N     1 
ATOM   5489  C CA    . MET C 3 53  ? 101.155 124.674 90.278  1.00 32.70  ? 90  MET A CA    1 
ATOM   5490  C C     . MET C 3 53  ? 100.749 123.285 90.778  1.00 29.10  ? 90  MET A C     1 
ATOM   5491  O O     . MET C 3 53  ? 99.793  123.163 91.506  1.00 29.51  ? 90  MET A O     1 
ATOM   5492  C CB    . MET C 3 53  ? 100.615 124.920 88.865  1.00 33.72  ? 90  MET A CB    1 
ATOM   5493  C CG    . MET C 3 53  ? 100.764 126.370 88.440  1.00 47.45  ? 90  MET A CG    1 
ATOM   5494  S SD    . MET C 3 53  ? 100.033 127.505 89.676  1.00 59.72  ? 90  MET A SD    1 
ATOM   5495  C CE    . MET C 3 53  ? 98.311  127.315 89.250  1.00 55.11  ? 90  MET A CE    1 
ATOM   5496  N N     . ALA C 3 54  ? 101.473 122.244 90.379  1.00 32.33  ? 91  ALA A N     1 
ATOM   5497  C CA    . ALA C 3 54  ? 101.178 120.892 90.847  1.00 29.61  ? 91  ALA A CA    1 
ATOM   5498  C C     . ALA C 3 54  ? 101.330 120.849 92.385  1.00 29.69  ? 91  ALA A C     1 
ATOM   5499  O O     . ALA C 3 54  ? 100.517 120.242 93.087  1.00 29.96  ? 91  ALA A O     1 
ATOM   5500  C CB    . ALA C 3 54  ? 102.139 119.891 90.192  1.00 28.87  ? 91  ALA A CB    1 
ATOM   5501  N N     . LEU C 3 55  ? 102.378 121.487 92.901  1.00 28.26  ? 92  LEU A N     1 
ATOM   5502  C CA    . LEU C 3 55  ? 102.607 121.517 94.341  1.00 29.76  ? 92  LEU A CA    1 
ATOM   5503  C C     . LEU C 3 55  ? 101.444 122.233 95.024  1.00 29.96  ? 92  LEU A C     1 
ATOM   5504  O O     . LEU C 3 55  ? 100.991 121.809 96.099  1.00 29.82  ? 92  LEU A O     1 
ATOM   5505  C CB    . LEU C 3 55  ? 103.941 122.227 94.680  1.00 25.49  ? 92  LEU A CB    1 
ATOM   5506  C CG    . LEU C 3 55  ? 105.227 121.397 94.530  1.00 31.94  ? 92  LEU A CG    1 
ATOM   5507  C CD1   . LEU C 3 55  ? 106.459 122.289 94.524  1.00 31.17  ? 92  LEU A CD1   1 
ATOM   5508  C CD2   . LEU C 3 55  ? 105.332 120.390 95.690  1.00 28.02  ? 92  LEU A CD2   1 
ATOM   5509  N N     . GLN C 3 56  ? 100.957 123.320 94.418  1.00 25.90  ? 93  GLN A N     1 
ATOM   5510  C CA    . GLN C 3 56  ? 99.840  124.033 95.023  1.00 29.09  ? 93  GLN A CA    1 
ATOM   5511  C C     . GLN C 3 56  ? 98.523  123.249 94.941  1.00 27.07  ? 93  GLN A C     1 
ATOM   5512  O O     . GLN C 3 56  ? 97.752  123.243 95.907  1.00 28.32  ? 93  GLN A O     1 
ATOM   5513  C CB    . GLN C 3 56  ? 99.634  125.439 94.407  1.00 27.42  ? 93  GLN A CB    1 
ATOM   5514  C CG    . GLN C 3 56  ? 98.937  126.393 95.395  1.00 27.26  ? 93  GLN A CG    1 
ATOM   5515  C CD    . GLN C 3 56  ? 98.775  127.817 94.868  1.00 36.11  ? 93  GLN A CD    1 
ATOM   5516  O OE1   . GLN C 3 56  ? 99.574  128.271 94.041  1.00 30.09  ? 93  GLN A OE1   1 
ATOM   5517  N NE2   . GLN C 3 56  ? 97.746  128.536 95.364  1.00 28.31  ? 93  GLN A NE2   1 
ATOM   5518  N N     . GLU C 3 57  ? 98.245  122.623 93.802  1.00 25.99  ? 94  GLU A N     1 
ATOM   5519  C CA    . GLU C 3 57  ? 97.026  121.817 93.684  1.00 28.34  ? 94  GLU A CA    1 
ATOM   5520  C C     . GLU C 3 57  ? 97.096  120.705 94.739  1.00 28.45  ? 94  GLU A C     1 
ATOM   5521  O O     . GLU C 3 57  ? 96.126  120.466 95.443  1.00 26.92  ? 94  GLU A O     1 
ATOM   5522  C CB    . GLU C 3 57  ? 96.902  121.178 92.295  1.00 26.39  ? 94  GLU A CB    1 
ATOM   5523  C CG    . GLU C 3 57  ? 96.505  122.171 91.173  1.00 33.57  ? 94  GLU A CG    1 
ATOM   5524  C CD    . GLU C 3 57  ? 95.034  122.535 91.170  1.00 36.69  ? 94  GLU A CD    1 
ATOM   5525  O OE1   . GLU C 3 57  ? 94.687  123.546 90.518  1.00 34.75  ? 94  GLU A OE1   1 
ATOM   5526  O OE2   . GLU C 3 57  ? 94.210  121.803 91.783  1.00 35.25  ? 94  GLU A OE2   1 
ATOM   5527  N N     . ALA C 3 58  ? 98.255  120.051 94.863  1.00 26.13  ? 95  ALA A N     1 
ATOM   5528  C CA    . ALA C 3 58  ? 98.383  118.966 95.850  1.00 28.32  ? 95  ALA A CA    1 
ATOM   5529  C C     . ALA C 3 58  ? 98.299  119.452 97.300  1.00 27.58  ? 95  ALA A C     1 
ATOM   5530  O O     . ALA C 3 58  ? 97.639  118.812 98.144  1.00 25.42  ? 95  ALA A O     1 
ATOM   5531  C CB    . ALA C 3 58  ? 99.674  118.203 95.627  1.00 24.35  ? 95  ALA A CB    1 
ATOM   5532  N N     . SER C 3 59  ? 98.937  120.591 97.579  1.00 24.05  ? 96  SER A N     1 
ATOM   5533  C CA    . SER C 3 59  ? 98.961  121.147 98.923  1.00 25.96  ? 96  SER A CA    1 
ATOM   5534  C C     . SER C 3 59  ? 97.577  121.590 99.325  1.00 25.90  ? 96  SER A C     1 
ATOM   5535  O O     . SER C 3 59  ? 97.136  121.327 100.441 1.00 22.63  ? 96  SER A O     1 
ATOM   5536  C CB    . SER C 3 59  ? 99.936  122.345 99.018  1.00 24.39  ? 96  SER A CB    1 
ATOM   5537  O OG    . SER C 3 59  ? 101.257 121.910 98.745  1.00 27.17  ? 96  SER A OG    1 
ATOM   5538  N N     . GLU C 3 60  ? 96.861  122.243 98.409  1.00 24.36  ? 97  GLU A N     1 
ATOM   5539  C CA    . GLU C 3 60  ? 95.525  122.684 98.767  1.00 25.25  ? 97  GLU A CA    1 
ATOM   5540  C C     . GLU C 3 60  ? 94.553  121.521 98.952  1.00 26.19  ? 97  GLU A C     1 
ATOM   5541  O O     . GLU C 3 60  ? 93.739  121.532 99.871  1.00 25.50  ? 97  GLU A O     1 
ATOM   5542  C CB    . GLU C 3 60  ? 94.980  123.702 97.742  1.00 26.70  ? 97  GLU A CB    1 
ATOM   5543  C CG    . GLU C 3 60  ? 95.728  125.018 97.898  1.00 29.14  ? 97  GLU A CG    1 
ATOM   5544  C CD    . GLU C 3 60  ? 95.015  126.226 97.310  1.00 33.03  ? 97  GLU A CD    1 
ATOM   5545  O OE1   . GLU C 3 60  ? 93.765  126.235 97.188  1.00 26.38  ? 97  GLU A OE1   1 
ATOM   5546  O OE2   . GLU C 3 60  ? 95.742  127.191 97.007  1.00 31.51  ? 97  GLU A OE2   1 
ATOM   5547  N N     . ALA C 3 61  ? 94.640  120.514 98.094  1.00 23.39  ? 98  ALA A N     1 
ATOM   5548  C CA    . ALA C 3 61  ? 93.722  119.388 98.226  1.00 25.00  ? 98  ALA A CA    1 
ATOM   5549  C C     . ALA C 3 61  ? 94.014  118.675 99.572  1.00 23.63  ? 98  ALA A C     1 
ATOM   5550  O O     . ALA C 3 61  ? 93.097  118.225 100.269 1.00 21.20  ? 98  ALA A O     1 
ATOM   5551  C CB    . ALA C 3 61  ? 93.899  118.445 97.032  1.00 22.36  ? 98  ALA A CB    1 
ATOM   5552  N N     . TYR C 3 62  ? 95.294  118.633 99.946  1.00 23.32  ? 99  TYR A N     1 
ATOM   5553  C CA    . TYR C 3 62  ? 95.710  118.000 101.200 1.00 23.52  ? 99  TYR A CA    1 
ATOM   5554  C C     . TYR C 3 62  ? 95.097  118.763 102.387 1.00 26.45  ? 99  TYR A C     1 
ATOM   5555  O O     . TYR C 3 62  ? 94.476  118.170 103.278 1.00 24.97  ? 99  TYR A O     1 
ATOM   5556  C CB    . TYR C 3 62  ? 97.243  118.029 101.328 1.00 23.98  ? 99  TYR A CB    1 
ATOM   5557  C CG    . TYR C 3 62  ? 97.763  117.723 102.727 1.00 23.63  ? 99  TYR A CG    1 
ATOM   5558  C CD1   . TYR C 3 62  ? 97.781  116.421 103.227 1.00 24.23  ? 99  TYR A CD1   1 
ATOM   5559  C CD2   . TYR C 3 62  ? 98.190  118.747 103.558 1.00 25.98  ? 99  TYR A CD2   1 
ATOM   5560  C CE1   . TYR C 3 62  ? 98.202  116.159 104.513 1.00 24.92  ? 99  TYR A CE1   1 
ATOM   5561  C CE2   . TYR C 3 62  ? 98.616  118.497 104.844 1.00 28.41  ? 99  TYR A CE2   1 
ATOM   5562  C CZ    . TYR C 3 62  ? 98.620  117.197 105.311 1.00 27.24  ? 99  TYR A CZ    1 
ATOM   5563  O OH    . TYR C 3 62  ? 99.077  116.979 106.574 1.00 26.42  ? 99  TYR A OH    1 
ATOM   5564  N N     . LEU C 3 63  ? 95.239  120.082 102.387 1.00 23.58  ? 100 LEU A N     1 
ATOM   5565  C CA    . LEU C 3 63  ? 94.728  120.863 103.512 1.00 23.10  ? 100 LEU A CA    1 
ATOM   5566  C C     . LEU C 3 63  ? 93.229  120.850 103.606 1.00 21.68  ? 100 LEU A C     1 
ATOM   5567  O O     . LEU C 3 63  ? 92.678  120.825 104.709 1.00 25.16  ? 100 LEU A O     1 
ATOM   5568  C CB    . LEU C 3 63  ? 95.217  122.320 103.454 1.00 25.51  ? 100 LEU A CB    1 
ATOM   5569  C CG    . LEU C 3 63  ? 96.714  122.531 103.717 1.00 29.02  ? 100 LEU A CG    1 
ATOM   5570  C CD1   . LEU C 3 63  ? 97.053  124.037 103.591 1.00 29.64  ? 100 LEU A CD1   1 
ATOM   5571  C CD2   . LEU C 3 63  ? 97.080  122.039 105.116 1.00 23.70  ? 100 LEU A CD2   1 
ATOM   5572  N N     . VAL C 3 64  ? 92.558  120.889 102.461 1.00 22.24  ? 101 VAL A N     1 
ATOM   5573  C CA    . VAL C 3 64  ? 91.087  120.889 102.440 1.00 24.91  ? 101 VAL A CA    1 
ATOM   5574  C C     . VAL C 3 64  ? 90.567  119.553 103.023 1.00 24.58  ? 101 VAL A C     1 
ATOM   5575  O O     . VAL C 3 64  ? 89.666  119.521 103.865 1.00 25.95  ? 101 VAL A O     1 
ATOM   5576  C CB    . VAL C 3 64  ? 90.573  121.049 101.000 1.00 25.66  ? 101 VAL A CB    1 
ATOM   5577  C CG1   . VAL C 3 64  ? 89.086  120.686 100.943 1.00 26.11  ? 101 VAL A CG1   1 
ATOM   5578  C CG2   . VAL C 3 64  ? 90.815  122.508 100.516 1.00 26.96  ? 101 VAL A CG2   1 
ATOM   5579  N N     . GLY C 3 65  ? 91.133  118.445 102.573 1.00 24.39  ? 102 GLY A N     1 
ATOM   5580  C CA    . GLY C 3 65  ? 90.704  117.141 103.104 1.00 22.62  ? 102 GLY A CA    1 
ATOM   5581  C C     . GLY C 3 65  ? 91.085  117.025 104.584 1.00 23.86  ? 102 GLY A C     1 
ATOM   5582  O O     . GLY C 3 65  ? 90.359  116.391 105.358 1.00 23.78  ? 102 GLY A O     1 
ATOM   5583  N N     . LEU C 3 66  ? 92.217  117.618 104.978 1.00 20.86  ? 103 LEU A N     1 
ATOM   5584  C CA    . LEU C 3 66  ? 92.610  117.578 106.394 1.00 20.96  ? 103 LEU A CA    1 
ATOM   5585  C C     . LEU C 3 66  ? 91.607  118.396 107.225 1.00 23.93  ? 103 LEU A C     1 
ATOM   5586  O O     . LEU C 3 66  ? 91.266  118.041 108.365 1.00 23.09  ? 103 LEU A O     1 
ATOM   5587  C CB    . LEU C 3 66  ? 94.027  118.135 106.597 1.00 20.69  ? 103 LEU A CB    1 
ATOM   5588  C CG    . LEU C 3 66  ? 94.474  118.307 108.064 1.00 24.62  ? 103 LEU A CG    1 
ATOM   5589  C CD1   . LEU C 3 66  ? 94.535  116.901 108.782 1.00 24.13  ? 103 LEU A CD1   1 
ATOM   5590  C CD2   . LEU C 3 66  ? 95.860  118.976 108.085 1.00 20.13  ? 103 LEU A CD2   1 
ATOM   5591  N N     . PHE C 3 67  ? 91.138  119.504 106.658 1.00 22.27  ? 104 PHE A N     1 
ATOM   5592  C CA    . PHE C 3 67  ? 90.147  120.315 107.358 1.00 22.07  ? 104 PHE A CA    1 
ATOM   5593  C C     . PHE C 3 67  ? 88.827  119.561 107.519 1.00 21.24  ? 104 PHE A C     1 
ATOM   5594  O O     . PHE C 3 67  ? 88.109  119.753 108.503 1.00 26.45  ? 104 PHE A O     1 
ATOM   5595  C CB    . PHE C 3 67  ? 89.930  121.635 106.621 1.00 21.90  ? 104 PHE A CB    1 
ATOM   5596  C CG    . PHE C 3 67  ? 90.905  122.712 107.033 1.00 22.45  ? 104 PHE A CG    1 
ATOM   5597  C CD1   . PHE C 3 67  ? 91.144  122.956 108.368 1.00 22.59  ? 104 PHE A CD1   1 
ATOM   5598  C CD2   . PHE C 3 67  ? 91.610  123.453 106.074 1.00 24.90  ? 104 PHE A CD2   1 
ATOM   5599  C CE1   . PHE C 3 67  ? 92.077  123.908 108.777 1.00 24.49  ? 104 PHE A CE1   1 
ATOM   5600  C CE2   . PHE C 3 67  ? 92.544  124.413 106.464 1.00 25.18  ? 104 PHE A CE2   1 
ATOM   5601  C CZ    . PHE C 3 67  ? 92.781  124.636 107.826 1.00 27.21  ? 104 PHE A CZ    1 
ATOM   5602  N N     . GLU C 3 68  ? 88.491  118.718 106.558 1.00 21.85  ? 105 GLU A N     1 
ATOM   5603  C CA    . GLU C 3 68  ? 87.278  117.915 106.653 1.00 24.01  ? 105 GLU A CA    1 
ATOM   5604  C C     . GLU C 3 68  ? 87.444  116.980 107.870 1.00 23.50  ? 105 GLU A C     1 
ATOM   5605  O O     . GLU C 3 68  ? 86.567  116.907 108.722 1.00 25.50  ? 105 GLU A O     1 
ATOM   5606  C CB    . GLU C 3 68  ? 87.071  117.075 105.377 1.00 23.69  ? 105 GLU A CB    1 
ATOM   5607  C CG    . GLU C 3 68  ? 86.873  117.896 104.080 1.00 31.65  ? 105 GLU A CG    1 
ATOM   5608  C CD    . GLU C 3 68  ? 86.858  117.017 102.808 1.00 37.21  ? 105 GLU A CD    1 
ATOM   5609  O OE1   . GLU C 3 68  ? 87.067  115.795 102.938 1.00 34.77  ? 105 GLU A OE1   1 
ATOM   5610  O OE2   . GLU C 3 68  ? 86.649  117.547 101.691 1.00 34.51  ? 105 GLU A OE2   1 
ATOM   5611  N N     . ASP C 3 69  ? 88.571  116.276 107.961 1.00 24.08  ? 106 ASP A N     1 
ATOM   5612  C CA    . ASP C 3 69  ? 88.798  115.357 109.109 1.00 23.69  ? 106 ASP A CA    1 
ATOM   5613  C C     . ASP C 3 69  ? 88.861  116.115 110.442 1.00 22.79  ? 106 ASP A C     1 
ATOM   5614  O O     . ASP C 3 69  ? 88.389  115.646 111.489 1.00 24.26  ? 106 ASP A O     1 
ATOM   5615  C CB    . ASP C 3 69  ? 90.110  114.604 108.927 1.00 21.10  ? 106 ASP A CB    1 
ATOM   5616  C CG    . ASP C 3 69  ? 90.087  113.704 107.721 1.00 24.05  ? 106 ASP A CG    1 
ATOM   5617  O OD1   . ASP C 3 69  ? 89.002  113.542 107.102 1.00 28.43  ? 106 ASP A OD1   1 
ATOM   5618  O OD2   . ASP C 3 69  ? 91.153  113.145 107.393 1.00 27.75  ? 106 ASP A OD2   1 
ATOM   5619  N N     . THR C 3 70  ? 89.485  117.282 110.397 1.00 22.82  ? 107 THR A N     1 
ATOM   5620  C CA    . THR C 3 70  ? 89.612  118.134 111.572 1.00 25.13  ? 107 THR A CA    1 
ATOM   5621  C C     . THR C 3 70  ? 88.186  118.478 112.045 1.00 24.73  ? 107 THR A C     1 
ATOM   5622  O O     . THR C 3 70  ? 87.836  118.354 113.229 1.00 26.19  ? 107 THR A O     1 
ATOM   5623  C CB    . THR C 3 70  ? 90.426  119.400 111.174 1.00 27.96  ? 107 THR A CB    1 
ATOM   5624  O OG1   . THR C 3 70  ? 91.776  118.996 110.865 1.00 23.22  ? 107 THR A OG1   1 
ATOM   5625  C CG2   . THR C 3 70  ? 90.411  120.455 112.261 1.00 23.91  ? 107 THR A CG2   1 
ATOM   5626  N N     . ASN C 3 71  ? 87.348  118.851 111.099 1.00 24.50  ? 108 ASN A N     1 
ATOM   5627  C CA    . ASN C 3 71  ? 85.966  119.205 111.403 1.00 24.07  ? 108 ASN A CA    1 
ATOM   5628  C C     . ASN C 3 71  ? 85.191  118.016 112.051 1.00 24.75  ? 108 ASN A C     1 
ATOM   5629  O O     . ASN C 3 71  ? 84.443  118.182 113.039 1.00 22.44  ? 108 ASN A O     1 
ATOM   5630  C CB    . ASN C 3 71  ? 85.275  119.675 110.116 1.00 24.55  ? 108 ASN A CB    1 
ATOM   5631  C CG    . ASN C 3 71  ? 84.149  120.628 110.411 1.00 28.87  ? 108 ASN A CG    1 
ATOM   5632  O OD1   . ASN C 3 71  ? 84.262  121.440 111.334 1.00 27.68  ? 108 ASN A OD1   1 
ATOM   5633  N ND2   . ASN C 3 71  ? 83.072  120.551 109.647 1.00 29.10  ? 108 ASN A ND2   1 
ATOM   5634  N N     . LEU C 3 72  ? 85.377  116.820 111.523 1.00 18.78  ? 109 LEU A N     1 
ATOM   5635  C CA    . LEU C 3 72  ? 84.728  115.666 112.124 1.00 21.19  ? 109 LEU A CA    1 
ATOM   5636  C C     . LEU C 3 72  ? 85.233  115.473 113.566 1.00 23.77  ? 109 LEU A C     1 
ATOM   5637  O O     . LEU C 3 72  ? 84.462  115.075 114.425 1.00 24.32  ? 109 LEU A O     1 
ATOM   5638  C CB    . LEU C 3 72  ? 85.013  114.396 111.318 1.00 22.71  ? 109 LEU A CB    1 
ATOM   5639  C CG    . LEU C 3 72  ? 84.386  114.402 109.916 1.00 29.73  ? 109 LEU A CG    1 
ATOM   5640  C CD1   . LEU C 3 72  ? 84.722  113.105 109.174 1.00 25.80  ? 109 LEU A CD1   1 
ATOM   5641  C CD2   . LEU C 3 72  ? 82.868  114.547 110.075 1.00 24.92  ? 109 LEU A CD2   1 
ATOM   5642  N N     . CYS C 3 73  ? 86.514  115.762 113.828 1.00 22.93  ? 110 CYS A N     1 
ATOM   5643  C CA    . CYS C 3 73  ? 87.054  115.612 115.183 1.00 24.00  ? 110 CYS A CA    1 
ATOM   5644  C C     . CYS C 3 73  ? 86.469  116.646 116.167 1.00 25.62  ? 110 CYS A C     1 
ATOM   5645  O O     . CYS C 3 73  ? 86.153  116.331 117.314 1.00 24.05  ? 110 CYS A O     1 
ATOM   5646  C CB    . CYS C 3 73  ? 88.581  115.720 115.164 1.00 24.74  ? 110 CYS A CB    1 
ATOM   5647  S SG    . CYS C 3 73  ? 89.351  114.315 114.292 1.00 22.98  ? 110 CYS A SG    1 
ATOM   5648  N N     . ALA C 3 74  ? 86.320  117.873 115.708 1.00 25.95  ? 111 ALA A N     1 
ATOM   5649  C CA    . ALA C 3 74  ? 85.740  118.925 116.556 1.00 27.71  ? 111 ALA A CA    1 
ATOM   5650  C C     . ALA C 3 74  ? 84.284  118.543 116.841 1.00 24.81  ? 111 ALA A C     1 
ATOM   5651  O O     . ALA C 3 74  ? 83.830  118.616 117.976 1.00 28.64  ? 111 ALA A O     1 
ATOM   5652  C CB    . ALA C 3 74  ? 85.801  120.250 115.842 1.00 27.31  ? 111 ALA A CB    1 
ATOM   5653  N N     . ILE C 3 75  ? 83.563  118.106 115.815 1.00 26.52  ? 112 ILE A N     1 
ATOM   5654  C CA    . ILE C 3 75  ? 82.172  117.699 115.993 1.00 27.03  ? 112 ILE A CA    1 
ATOM   5655  C C     . ILE C 3 75  ? 82.063  116.489 116.918 1.00 29.33  ? 112 ILE A C     1 
ATOM   5656  O O     . ILE C 3 75  ? 81.121  116.367 117.699 1.00 27.65  ? 112 ILE A O     1 
ATOM   5657  C CB    . ILE C 3 75  ? 81.493  117.380 114.630 1.00 28.32  ? 112 ILE A CB    1 
ATOM   5658  C CG1   . ILE C 3 75  ? 81.350  118.672 113.817 1.00 25.59  ? 112 ILE A CG1   1 
ATOM   5659  C CG2   . ILE C 3 75  ? 80.091  116.761 114.860 1.00 31.49  ? 112 ILE A CG2   1 
ATOM   5660  C CD1   . ILE C 3 75  ? 80.845  118.448 112.376 1.00 26.02  ? 112 ILE A CD1   1 
ATOM   5661  N N     . HIS C 3 76  ? 83.055  115.604 116.860 1.00 28.57  ? 113 HIS A N     1 
ATOM   5662  C CA    . HIS C 3 76  ? 83.042  114.435 117.704 1.00 25.77  ? 113 HIS A CA    1 
ATOM   5663  C C     . HIS C 3 76  ? 83.071  114.888 119.176 1.00 27.16  ? 113 HIS A C     1 
ATOM   5664  O O     . HIS C 3 76  ? 82.475  114.250 120.052 1.00 25.99  ? 113 HIS A O     1 
ATOM   5665  C CB    . HIS C 3 76  ? 84.269  113.574 117.408 1.00 25.76  ? 113 HIS A CB    1 
ATOM   5666  C CG    . HIS C 3 76  ? 84.289  112.276 118.158 1.00 22.92  ? 113 HIS A CG    1 
ATOM   5667  N ND1   . HIS C 3 76  ? 83.437  111.240 117.860 1.00 24.23  ? 113 HIS A ND1   1 
ATOM   5668  C CD2   . HIS C 3 76  ? 85.098  111.828 119.152 1.00 23.37  ? 113 HIS A CD2   1 
ATOM   5669  C CE1   . HIS C 3 76  ? 83.716  110.201 118.632 1.00 22.39  ? 113 HIS A CE1   1 
ATOM   5670  N NE2   . HIS C 3 76  ? 84.718  110.532 119.428 1.00 22.84  ? 113 HIS A NE2   1 
ATOM   5671  N N     . ALA C 3 77  ? 83.769  115.984 119.447 1.00 27.25  ? 114 ALA A N     1 
ATOM   5672  C CA    . ALA C 3 77  ? 83.878  116.489 120.810 1.00 28.36  ? 114 ALA A CA    1 
ATOM   5673  C C     . ALA C 3 77  ? 82.728  117.457 121.108 1.00 29.08  ? 114 ALA A C     1 
ATOM   5674  O O     . ALA C 3 77  ? 82.791  118.232 122.039 1.00 30.81  ? 114 ALA A O     1 
ATOM   5675  C CB    . ALA C 3 77  ? 85.235  117.175 121.016 1.00 27.31  ? 114 ALA A CB    1 
ATOM   5676  N N     . LYS C 3 78  ? 81.669  117.390 120.316 1.00 29.71  ? 115 LYS A N     1 
ATOM   5677  C CA    . LYS C 3 78  ? 80.515  118.253 120.510 1.00 34.64  ? 115 LYS A CA    1 
ATOM   5678  C C     . LYS C 3 78  ? 80.794  119.734 120.337 1.00 35.32  ? 115 LYS A C     1 
ATOM   5679  O O     . LYS C 3 78  ? 80.162  120.561 120.995 1.00 35.96  ? 115 LYS A O     1 
ATOM   5680  C CB    . LYS C 3 78  ? 79.887  118.010 121.893 1.00 38.38  ? 115 LYS A CB    1 
ATOM   5681  C CG    . LYS C 3 78  ? 79.370  116.582 122.078 1.00 44.63  ? 115 LYS A CG    1 
ATOM   5682  C CD    . LYS C 3 78  ? 79.084  116.301 123.548 1.00 51.46  ? 115 LYS A CD    1 
ATOM   5683  C CE    . LYS C 3 78  ? 78.366  114.975 123.739 1.00 54.88  ? 115 LYS A CE    1 
ATOM   5684  N NZ    . LYS C 3 78  ? 78.030  114.774 125.181 1.00 58.75  ? 115 LYS A NZ    1 
ATOM   5685  N N     . ARG C 3 79  ? 81.733  120.078 119.463 1.00 32.00  ? 116 ARG A N     1 
ATOM   5686  C CA    . ARG C 3 79  ? 82.024  121.487 119.196 1.00 31.32  ? 116 ARG A CA    1 
ATOM   5687  C C     . ARG C 3 79  ? 81.714  121.740 117.725 1.00 31.40  ? 116 ARG A C     1 
ATOM   5688  O O     . ARG C 3 79  ? 81.391  120.813 116.971 1.00 31.29  ? 116 ARG A O     1 
ATOM   5689  C CB    . ARG C 3 79  ? 83.502  121.818 119.464 1.00 29.95  ? 116 ARG A CB    1 
ATOM   5690  C CG    . ARG C 3 79  ? 83.892  121.874 120.939 1.00 31.80  ? 116 ARG A CG    1 
ATOM   5691  C CD    . ARG C 3 79  ? 85.347  122.231 121.162 1.00 30.27  ? 116 ARG A CD    1 
ATOM   5692  N NE    . ARG C 3 79  ? 86.252  121.075 121.086 1.00 28.57  ? 116 ARG A NE    1 
ATOM   5693  C CZ    . ARG C 3 79  ? 86.945  120.725 120.002 1.00 31.68  ? 116 ARG A CZ    1 
ATOM   5694  N NH1   . ARG C 3 79  ? 86.841  121.433 118.880 1.00 26.21  ? 116 ARG A NH1   1 
ATOM   5695  N NH2   . ARG C 3 79  ? 87.787  119.685 120.053 1.00 31.19  ? 116 ARG A NH2   1 
ATOM   5696  N N     . VAL C 3 80  ? 81.780  122.999 117.317 1.00 32.07  ? 117 VAL A N     1 
ATOM   5697  C CA    . VAL C 3 80  ? 81.571  123.324 115.921 1.00 30.47  ? 117 VAL A CA    1 
ATOM   5698  C C     . VAL C 3 80  ? 82.759  124.209 115.537 1.00 29.56  ? 117 VAL A C     1 
ATOM   5699  O O     . VAL C 3 80  ? 82.863  124.709 114.432 1.00 30.67  ? 117 VAL A O     1 
ATOM   5700  C CB    . VAL C 3 80  ? 80.203  124.043 115.698 1.00 34.71  ? 117 VAL A CB    1 
ATOM   5701  C CG1   . VAL C 3 80  ? 79.064  123.100 116.065 1.00 29.70  ? 117 VAL A CG1   1 
ATOM   5702  C CG2   . VAL C 3 80  ? 80.106  125.309 116.545 1.00 31.21  ? 117 VAL A CG2   1 
ATOM   5703  N N     . THR C 3 81  ? 83.676  124.362 116.476 1.00 29.71  ? 118 THR A N     1 
ATOM   5704  C CA    . THR C 3 81  ? 84.867  125.172 116.274 1.00 30.69  ? 118 THR A CA    1 
ATOM   5705  C C     . THR C 3 81  ? 86.089  124.264 116.220 1.00 31.94  ? 118 THR A C     1 
ATOM   5706  O O     . THR C 3 81  ? 86.392  123.550 117.194 1.00 31.21  ? 118 THR A O     1 
ATOM   5707  C CB    . THR C 3 81  ? 85.099  126.157 117.450 1.00 29.75  ? 118 THR A CB    1 
ATOM   5708  O OG1   . THR C 3 81  ? 83.906  126.891 117.711 1.00 32.82  ? 118 THR A OG1   1 
ATOM   5709  C CG2   . THR C 3 81  ? 86.201  127.121 117.135 1.00 28.72  ? 118 THR A CG2   1 
ATOM   5710  N N     . ILE C 3 82  ? 86.794  124.280 115.093 1.00 29.36  ? 119 ILE A N     1 
ATOM   5711  C CA    . ILE C 3 82  ? 87.999  123.471 115.018 1.00 29.65  ? 119 ILE A CA    1 
ATOM   5712  C C     . ILE C 3 82  ? 89.118  124.102 115.831 1.00 30.12  ? 119 ILE A C     1 
ATOM   5713  O O     . ILE C 3 82  ? 89.285  125.325 115.863 1.00 30.00  ? 119 ILE A O     1 
ATOM   5714  C CB    . ILE C 3 82  ? 88.488  123.266 113.566 1.00 27.87  ? 119 ILE A CB    1 
ATOM   5715  C CG1   . ILE C 3 82  ? 88.724  124.593 112.860 1.00 23.90  ? 119 ILE A CG1   1 
ATOM   5716  C CG2   . ILE C 3 82  ? 87.477  122.439 112.826 1.00 24.73  ? 119 ILE A CG2   1 
ATOM   5717  C CD1   . ILE C 3 82  ? 89.515  124.437 111.552 1.00 27.85  ? 119 ILE A CD1   1 
ATOM   5718  N N     . MET C 3 83  ? 89.886  123.245 116.491 1.00 27.47  ? 120 MET A N     1 
ATOM   5719  C CA    . MET C 3 83  ? 90.988  123.689 117.295 1.00 26.91  ? 120 MET A CA    1 
ATOM   5720  C C     . MET C 3 83  ? 92.249  122.911 116.936 1.00 27.59  ? 120 MET A C     1 
ATOM   5721  O O     . MET C 3 83  ? 92.204  121.853 116.292 1.00 25.63  ? 120 MET A O     1 
ATOM   5722  C CB    . MET C 3 83  ? 90.658  123.497 118.770 1.00 27.26  ? 120 MET A CB    1 
ATOM   5723  C CG    . MET C 3 83  ? 89.369  124.203 119.176 1.00 32.82  ? 120 MET A CG    1 
ATOM   5724  S SD    . MET C 3 83  ? 88.912  123.842 120.863 1.00 37.46  ? 120 MET A SD    1 
ATOM   5725  C CE    . MET C 3 83  ? 87.483  124.997 121.096 1.00 40.94  ? 120 MET A CE    1 
ATOM   5726  N N     . PRO C 3 84  ? 93.392  123.422 117.359 1.00 26.77  ? 121 PRO A N     1 
ATOM   5727  C CA    . PRO C 3 84  ? 94.613  122.700 117.028 1.00 28.56  ? 121 PRO A CA    1 
ATOM   5728  C C     . PRO C 3 84  ? 94.545  121.216 117.424 1.00 31.29  ? 121 PRO A C     1 
ATOM   5729  O O     . PRO C 3 84  ? 95.049  120.347 116.694 1.00 30.76  ? 121 PRO A O     1 
ATOM   5730  C CB    . PRO C 3 84  ? 95.673  123.462 117.809 1.00 28.88  ? 121 PRO A CB    1 
ATOM   5731  C CG    . PRO C 3 84  ? 95.179  124.901 117.691 1.00 27.83  ? 121 PRO A CG    1 
ATOM   5732  C CD    . PRO C 3 84  ? 93.694  124.702 118.028 1.00 30.77  ? 121 PRO A CD    1 
ATOM   5733  N N     . LYS C 3 85  ? 93.922  120.914 118.558 1.00 27.54  ? 122 LYS A N     1 
ATOM   5734  C CA    . LYS C 3 85  ? 93.892  119.506 118.983 1.00 28.30  ? 122 LYS A CA    1 
ATOM   5735  C C     . LYS C 3 85  ? 93.086  118.646 118.028 1.00 26.37  ? 122 LYS A C     1 
ATOM   5736  O O     . LYS C 3 85  ? 93.254  117.429 117.988 1.00 27.57  ? 122 LYS A O     1 
ATOM   5737  C CB    . LYS C 3 85  ? 93.360  119.378 120.403 1.00 26.87  ? 122 LYS A CB    1 
ATOM   5738  C CG    . LYS C 3 85  ? 91.989  119.973 120.624 1.00 32.09  ? 122 LYS A CG    1 
ATOM   5739  C CD    . LYS C 3 85  ? 91.612  119.880 122.095 1.00 37.72  ? 122 LYS A CD    1 
ATOM   5740  C CE    . LYS C 3 85  ? 90.305  120.565 122.361 1.00 45.59  ? 122 LYS A CE    1 
ATOM   5741  N NZ    . LYS C 3 85  ? 89.921  120.425 123.788 1.00 52.04  ? 122 LYS A NZ    1 
ATOM   5742  N N     . ASP C 3 86  ? 92.196  119.272 117.257 1.00 25.47  ? 123 ASP A N     1 
ATOM   5743  C CA    . ASP C 3 86  ? 91.429  118.511 116.279 1.00 24.33  ? 123 ASP A CA    1 
ATOM   5744  C C     . ASP C 3 86  ? 92.319  118.155 115.093 1.00 24.14  ? 123 ASP A C     1 
ATOM   5745  O O     . ASP C 3 86  ? 92.234  117.060 114.574 1.00 19.51  ? 123 ASP A O     1 
ATOM   5746  C CB    . ASP C 3 86  ? 90.240  119.303 115.785 1.00 20.99  ? 123 ASP A CB    1 
ATOM   5747  C CG    . ASP C 3 86  ? 89.286  119.642 116.896 1.00 27.84  ? 123 ASP A CG    1 
ATOM   5748  O OD1   . ASP C 3 86  ? 88.990  118.732 117.718 1.00 24.32  ? 123 ASP A OD1   1 
ATOM   5749  O OD2   . ASP C 3 86  ? 88.823  120.807 116.927 1.00 24.46  ? 123 ASP A OD2   1 
ATOM   5750  N N     . ILE C 3 87  ? 93.165  119.092 114.659 1.00 21.48  ? 124 ILE A N     1 
ATOM   5751  C CA    . ILE C 3 87  ? 94.051  118.817 113.529 1.00 21.98  ? 124 ILE A CA    1 
ATOM   5752  C C     . ILE C 3 87  ? 95.054  117.738 113.973 1.00 22.38  ? 124 ILE A C     1 
ATOM   5753  O O     . ILE C 3 87  ? 95.405  116.859 113.204 1.00 24.17  ? 124 ILE A O     1 
ATOM   5754  C CB    . ILE C 3 87  ? 94.865  120.104 113.117 1.00 23.10  ? 124 ILE A CB    1 
ATOM   5755  C CG1   . ILE C 3 87  ? 93.944  121.131 112.469 1.00 27.86  ? 124 ILE A CG1   1 
ATOM   5756  C CG2   . ILE C 3 87  ? 96.012  119.744 112.180 1.00 23.67  ? 124 ILE A CG2   1 
ATOM   5757  C CD1   . ILE C 3 87  ? 94.667  122.456 112.146 1.00 30.03  ? 124 ILE A CD1   1 
ATOM   5758  N N     . GLN C 3 88  ? 95.527  117.848 115.209 1.00 22.48  ? 125 GLN A N     1 
ATOM   5759  C CA    . GLN C 3 88  ? 96.506  116.909 115.755 1.00 26.48  ? 125 GLN A CA    1 
ATOM   5760  C C     . GLN C 3 88  ? 95.909  115.515 115.844 1.00 23.17  ? 125 GLN A C     1 
ATOM   5761  O O     . GLN C 3 88  ? 96.548  114.567 115.467 1.00 23.56  ? 125 GLN A O     1 
ATOM   5762  C CB    . GLN C 3 88  ? 97.002  117.386 117.128 1.00 31.02  ? 125 GLN A CB    1 
ATOM   5763  C CG    . GLN C 3 88  ? 97.937  118.635 117.022 1.00 34.08  ? 125 GLN A CG    1 
ATOM   5764  C CD    . GLN C 3 88  ? 97.947  119.488 118.299 1.00 40.29  ? 125 GLN A CD    1 
ATOM   5765  O OE1   . GLN C 3 88  ? 97.562  119.029 119.363 1.00 39.56  ? 125 GLN A OE1   1 
ATOM   5766  N NE2   . GLN C 3 88  ? 98.400  120.743 118.182 1.00 43.36  ? 125 GLN A NE2   1 
ATOM   5767  N N     . LEU C 3 89  ? 94.681  115.403 116.324 1.00 21.29  ? 126 LEU A N     1 
ATOM   5768  C CA    . LEU C 3 89  ? 94.023  114.096 116.392 1.00 22.09  ? 126 LEU A CA    1 
ATOM   5769  C C     . LEU C 3 89  ? 93.925  113.510 114.974 1.00 22.69  ? 126 LEU A C     1 
ATOM   5770  O O     . LEU C 3 89  ? 94.300  112.351 114.737 1.00 22.68  ? 126 LEU A O     1 
ATOM   5771  C CB    . LEU C 3 89  ? 92.607  114.218 116.968 1.00 24.40  ? 126 LEU A CB    1 
ATOM   5772  C CG    . LEU C 3 89  ? 91.847  112.880 117.059 1.00 25.11  ? 126 LEU A CG    1 
ATOM   5773  C CD1   . LEU C 3 89  ? 92.683  111.891 117.900 1.00 24.34  ? 126 LEU A CD1   1 
ATOM   5774  C CD2   . LEU C 3 89  ? 90.441  113.092 117.697 1.00 21.76  ? 126 LEU A CD2   1 
ATOM   5775  N N     . ALA C 3 90  ? 93.420  114.300 114.028 1.00 23.45  ? 127 ALA A N     1 
ATOM   5776  C CA    . ALA C 3 90  ? 93.287  113.805 112.651 1.00 22.75  ? 127 ALA A CA    1 
ATOM   5777  C C     . ALA C 3 90  ? 94.623  113.338 112.066 1.00 25.92  ? 127 ALA A C     1 
ATOM   5778  O O     . ALA C 3 90  ? 94.708  112.250 111.472 1.00 22.25  ? 127 ALA A O     1 
ATOM   5779  C CB    . ALA C 3 90  ? 92.673  114.887 111.753 1.00 22.76  ? 127 ALA A CB    1 
ATOM   5780  N N     . ARG C 3 91  ? 95.689  114.122 112.278 1.00 24.80  ? 128 ARG A N     1 
ATOM   5781  C CA    . ARG C 3 91  ? 96.972  113.748 111.711 1.00 23.71  ? 128 ARG A CA    1 
ATOM   5782  C C     . ARG C 3 91  ? 97.520  112.492 112.372 1.00 27.34  ? 128 ARG A C     1 
ATOM   5783  O O     . ARG C 3 91  ? 98.181  111.666 111.726 1.00 26.49  ? 128 ARG A O     1 
ATOM   5784  C CB    . ARG C 3 91  ? 97.999  114.888 111.820 1.00 22.86  ? 128 ARG A CB    1 
ATOM   5785  C CG    . ARG C 3 91  ? 97.641  116.061 110.904 1.00 23.13  ? 128 ARG A CG    1 
ATOM   5786  C CD    . ARG C 3 91  ? 98.746  117.110 110.856 1.00 30.40  ? 128 ARG A CD    1 
ATOM   5787  N NE    . ARG C 3 91  ? 99.907  116.611 110.133 1.00 30.87  ? 128 ARG A NE    1 
ATOM   5788  C CZ    . ARG C 3 91  ? 101.149 116.640 110.596 1.00 33.84  ? 128 ARG A CZ    1 
ATOM   5789  N NH1   . ARG C 3 91  ? 101.417 117.141 111.789 1.00 32.50  ? 128 ARG A NH1   1 
ATOM   5790  N NH2   . ARG C 3 91  ? 102.134 116.173 109.848 1.00 36.45  ? 128 ARG A NH2   1 
ATOM   5791  N N     . ARG C 3 92  ? 97.296  112.368 113.671 1.00 26.07  ? 129 ARG A N     1 
ATOM   5792  C CA    . ARG C 3 92  ? 97.776  111.187 114.364 1.00 27.30  ? 129 ARG A CA    1 
ATOM   5793  C C     . ARG C 3 92  ? 97.083  109.918 113.848 1.00 26.57  ? 129 ARG A C     1 
ATOM   5794  O O     . ARG C 3 92  ? 97.727  108.899 113.599 1.00 26.06  ? 129 ARG A O     1 
ATOM   5795  C CB    . ARG C 3 92  ? 97.550  111.350 115.868 1.00 30.83  ? 129 ARG A CB    1 
ATOM   5796  C CG    . ARG C 3 92  ? 97.465  110.043 116.618 1.00 35.90  ? 129 ARG A CG    1 
ATOM   5797  C CD    . ARG C 3 92  ? 98.734  109.198 116.510 1.00 38.12  ? 129 ARG A CD    1 
ATOM   5798  N NE    . ARG C 3 92  ? 98.601  107.979 117.308 1.00 36.59  ? 129 ARG A NE    1 
ATOM   5799  C CZ    . ARG C 3 92  ? 97.886  106.919 116.936 1.00 39.03  ? 129 ARG A CZ    1 
ATOM   5800  N NH1   . ARG C 3 92  ? 97.258  106.933 115.763 1.00 29.97  ? 129 ARG A NH1   1 
ATOM   5801  N NH2   . ARG C 3 92  ? 97.773  105.860 117.749 1.00 38.78  ? 129 ARG A NH2   1 
ATOM   5802  N N     . ILE C 3 93  ? 95.774  109.980 113.665 1.00 23.93  ? 130 ILE A N     1 
ATOM   5803  C CA    . ILE C 3 93  ? 95.038  108.819 113.199 1.00 25.65  ? 130 ILE A CA    1 
ATOM   5804  C C     . ILE C 3 93  ? 95.374  108.503 111.742 1.00 28.26  ? 130 ILE A C     1 
ATOM   5805  O O     . ILE C 3 93  ? 95.415  107.333 111.351 1.00 26.68  ? 130 ILE A O     1 
ATOM   5806  C CB    . ILE C 3 93  ? 93.533  109.026 113.387 1.00 27.37  ? 130 ILE A CB    1 
ATOM   5807  C CG1   . ILE C 3 93  ? 93.214  109.053 114.895 1.00 28.18  ? 130 ILE A CG1   1 
ATOM   5808  C CG2   . ILE C 3 93  ? 92.761  107.898 112.710 1.00 25.27  ? 130 ILE A CG2   1 
ATOM   5809  C CD1   . ILE C 3 93  ? 91.884  109.685 115.185 1.00 33.57  ? 130 ILE A CD1   1 
ATOM   5810  N N     . ARG C 3 94  ? 95.607  109.540 110.944 1.00 26.29  ? 131 ARG A N     1 
ATOM   5811  C CA    . ARG C 3 94  ? 96.011  109.343 109.557 1.00 27.17  ? 131 ARG A CA    1 
ATOM   5812  C C     . ARG C 3 94  ? 97.390  108.707 109.536 1.00 30.56  ? 131 ARG A C     1 
ATOM   5813  O O     . ARG C 3 94  ? 97.827  108.203 108.513 1.00 33.28  ? 131 ARG A O     1 
ATOM   5814  C CB    . ARG C 3 94  ? 96.124  110.672 108.830 1.00 28.82  ? 131 ARG A CB    1 
ATOM   5815  C CG    . ARG C 3 94  ? 94.829  111.319 108.475 1.00 29.61  ? 131 ARG A CG    1 
ATOM   5816  C CD    . ARG C 3 94  ? 95.093  112.743 108.057 1.00 27.18  ? 131 ARG A CD    1 
ATOM   5817  N NE    . ARG C 3 94  ? 93.983  113.213 107.270 1.00 31.82  ? 131 ARG A NE    1 
ATOM   5818  C CZ    . ARG C 3 94  ? 94.112  113.938 106.165 1.00 31.37  ? 131 ARG A CZ    1 
ATOM   5819  N NH1   . ARG C 3 94  ? 95.327  114.284 105.742 1.00 21.72  ? 131 ARG A NH1   1 
ATOM   5820  N NH2   . ARG C 3 94  ? 93.033  114.270 105.471 1.00 27.44  ? 131 ARG A NH2   1 
ATOM   5821  N N     . GLY C 3 95  ? 98.102  108.758 110.653 1.00 32.89  ? 132 GLY A N     1 
ATOM   5822  C CA    . GLY C 3 95  ? 99.429  108.175 110.672 1.00 35.59  ? 132 GLY A CA    1 
ATOM   5823  C C     . GLY C 3 95  ? 100.479 109.162 110.182 1.00 39.92  ? 132 GLY A C     1 
ATOM   5824  O O     . GLY C 3 95  ? 101.583 108.767 109.802 1.00 39.65  ? 132 GLY A O     1 
ATOM   5825  N N     . GLU C 3 96  ? 100.154 110.449 110.184 1.00 37.36  ? 133 GLU A N     1 
ATOM   5826  C CA    . GLU C 3 96  ? 101.125 111.441 109.737 1.00 41.86  ? 133 GLU A CA    1 
ATOM   5827  C C     . GLU C 3 96  ? 101.942 111.856 110.944 1.00 47.70  ? 133 GLU A C     1 
ATOM   5828  O O     . GLU C 3 96  ? 103.038 112.395 110.809 1.00 49.18  ? 133 GLU A O     1 
ATOM   5829  C CB    . GLU C 3 96  ? 100.423 112.665 109.121 1.00 36.90  ? 133 GLU A CB    1 
ATOM   5830  C CG    . GLU C 3 96  ? 99.736  112.396 107.760 1.00 32.06  ? 133 GLU A CG    1 
ATOM   5831  C CD    . GLU C 3 96  ? 98.921  113.593 107.266 1.00 35.40  ? 133 GLU A CD    1 
ATOM   5832  O OE1   . GLU C 3 96  ? 99.213  114.735 107.683 1.00 31.89  ? 133 GLU A OE1   1 
ATOM   5833  O OE2   . GLU C 3 96  ? 98.006  113.395 106.441 1.00 31.44  ? 133 GLU A OE2   1 
ATOM   5834  N N     . ARG C 3 97  ? 101.374 111.595 112.118 1.00 53.50  ? 134 ARG A N     1 
ATOM   5835  C CA    . ARG C 3 97  ? 101.977 111.891 113.426 1.00 60.23  ? 134 ARG A CA    1 
ATOM   5836  C C     . ARG C 3 97  ? 102.326 110.550 114.068 1.00 61.36  ? 134 ARG A C     1 
ATOM   5837  O O     . ARG C 3 97  ? 103.314 110.430 114.790 1.00 64.05  ? 134 ARG A O     1 
ATOM   5838  C CB    . ARG C 3 97  ? 100.975 112.601 114.359 1.00 58.38  ? 134 ARG A CB    1 
ATOM   5839  C CG    . ARG C 3 97  ? 100.901 114.118 114.293 1.00 61.72  ? 134 ARG A CG    1 
ATOM   5840  C CD    . ARG C 3 97  ? 99.846  114.623 115.307 1.00 61.00  ? 134 ARG A CD    1 
ATOM   5841  N NE    . ARG C 3 97  ? 99.853  116.072 115.534 1.00 65.86  ? 134 ARG A NE    1 
ATOM   5842  C CZ    . ARG C 3 97  ? 99.824  116.998 114.576 1.00 62.76  ? 134 ARG A CZ    1 
ATOM   5843  N NH1   . ARG C 3 97  ? 99.797  116.640 113.311 1.00 65.88  ? 134 ARG A NH1   1 
ATOM   5844  N NH2   . ARG C 3 97  ? 99.787  118.286 114.883 1.00 64.73  ? 134 ARG A NH2   1 
ATOM   5845  N N     . ALA C 3 98  ? 101.491 109.549 113.819 1.00 63.36  ? 135 ALA A N     1 
ATOM   5846  C CA    . ALA C 3 98  ? 101.718 108.217 114.375 1.00 68.02  ? 135 ALA A CA    1 
ATOM   5847  C C     . ALA C 3 98  ? 102.862 107.489 113.659 1.00 71.15  ? 135 ALA A C     1 
ATOM   5848  O O     . ALA C 3 98  ? 103.925 107.287 114.298 1.00 72.52  ? 135 ALA A O     1 
ATOM   5849  C CB    . ALA C 3 98  ? 100.445 107.396 114.288 1.00 65.20  ? 135 ALA A CB    1 
ATOM   5850  O OXT   . ALA C 3 98  ? 102.685 107.136 112.467 1.00 73.08  ? 135 ALA A OXT   1 
ATOM   5851  N N     . VAL D 4 6   ? 107.038 147.117 104.985 1.00 93.99  ? 21  VAL B N     1 
ATOM   5852  C CA    . VAL D 4 6   ? 106.964 146.150 106.117 1.00 94.15  ? 21  VAL B CA    1 
ATOM   5853  C C     . VAL D 4 6   ? 107.352 144.750 105.650 1.00 93.64  ? 21  VAL B C     1 
ATOM   5854  O O     . VAL D 4 6   ? 106.748 144.210 104.724 1.00 94.46  ? 21  VAL B O     1 
ATOM   5855  C CB    . VAL D 4 6   ? 105.537 146.092 106.701 1.00 94.77  ? 21  VAL B CB    1 
ATOM   5856  C CG1   . VAL D 4 6   ? 105.508 145.170 107.902 1.00 95.84  ? 21  VAL B CG1   1 
ATOM   5857  C CG2   . VAL D 4 6   ? 105.074 147.487 107.087 1.00 95.30  ? 21  VAL B CG2   1 
ATOM   5858  N N     . LEU D 4 7   ? 108.363 144.167 106.291 1.00 91.88  ? 22  LEU B N     1 
ATOM   5859  C CA    . LEU D 4 7   ? 108.824 142.829 105.935 1.00 90.18  ? 22  LEU B CA    1 
ATOM   5860  C C     . LEU D 4 7   ? 107.715 141.781 106.058 1.00 88.11  ? 22  LEU B C     1 
ATOM   5861  O O     . LEU D 4 7   ? 106.542 142.127 106.222 1.00 88.44  ? 22  LEU B O     1 
ATOM   5862  C CB    . LEU D 4 7   ? 110.025 142.442 106.806 1.00 91.82  ? 22  LEU B CB    1 
ATOM   5863  C CG    . LEU D 4 7   ? 110.051 142.952 108.249 1.00 93.38  ? 22  LEU B CG    1 
ATOM   5864  C CD1   . LEU D 4 7   ? 108.802 142.499 108.999 1.00 94.55  ? 22  LEU B CD1   1 
ATOM   5865  C CD2   . LEU D 4 7   ? 111.309 142.438 108.933 1.00 93.50  ? 22  LEU B CD2   1 
ATOM   5866  N N     . ARG D 4 8   ? 108.081 140.502 105.981 1.00 84.18  ? 23  ARG B N     1 
ATOM   5867  C CA    . ARG D 4 8   ? 107.090 139.432 106.061 1.00 80.84  ? 23  ARG B CA    1 
ATOM   5868  C C     . ARG D 4 8   ? 107.703 138.041 105.883 1.00 77.02  ? 23  ARG B C     1 
ATOM   5869  O O     . ARG D 4 8   ? 108.249 137.723 104.827 1.00 76.68  ? 23  ARG B O     1 
ATOM   5870  C CB    . ARG D 4 8   ? 106.029 139.652 104.980 1.00 82.63  ? 23  ARG B CB    1 
ATOM   5871  C CG    . ARG D 4 8   ? 104.850 138.697 105.007 1.00 85.54  ? 23  ARG B CG    1 
ATOM   5872  C CD    . ARG D 4 8   ? 103.923 138.974 106.175 1.00 87.49  ? 23  ARG B CD    1 
ATOM   5873  N NE    . ARG D 4 8   ? 102.543 138.628 105.840 1.00 89.85  ? 23  ARG B NE    1 
ATOM   5874  C CZ    . ARG D 4 8   ? 101.512 138.768 106.669 1.00 90.61  ? 23  ARG B CZ    1 
ATOM   5875  N NH1   . ARG D 4 8   ? 101.698 139.240 107.897 1.00 90.46  ? 23  ARG B NH1   1 
ATOM   5876  N NH2   . ARG D 4 8   ? 100.292 138.455 106.260 1.00 89.48  ? 23  ARG B NH2   1 
ATOM   5877  N N     . ASP D 4 9   ? 107.609 137.216 106.919 1.00 72.59  ? 24  ASP B N     1 
ATOM   5878  C CA    . ASP D 4 9   ? 108.130 135.851 106.867 1.00 66.72  ? 24  ASP B CA    1 
ATOM   5879  C C     . ASP D 4 9   ? 107.287 135.132 105.808 1.00 59.87  ? 24  ASP B C     1 
ATOM   5880  O O     . ASP D 4 9   ? 106.065 135.228 105.838 1.00 57.87  ? 24  ASP B O     1 
ATOM   5881  C CB    . ASP D 4 9   ? 107.948 135.193 108.231 1.00 70.78  ? 24  ASP B CB    1 
ATOM   5882  C CG    . ASP D 4 9   ? 108.846 134.003 108.430 1.00 73.44  ? 24  ASP B CG    1 
ATOM   5883  O OD1   . ASP D 4 9   ? 108.838 133.097 107.570 1.00 76.10  ? 24  ASP B OD1   1 
ATOM   5884  O OD2   . ASP D 4 9   ? 109.556 133.973 109.456 1.00 75.76  ? 24  ASP B OD2   1 
ATOM   5885  N N     . ASN D 4 10  ? 107.933 134.422 104.882 1.00 54.71  ? 25  ASN B N     1 
ATOM   5886  C CA    . ASN D 4 10  ? 107.234 133.732 103.786 1.00 49.15  ? 25  ASN B CA    1 
ATOM   5887  C C     . ASN D 4 10  ? 106.060 132.844 104.170 1.00 46.40  ? 25  ASN B C     1 
ATOM   5888  O O     . ASN D 4 10  ? 104.995 132.937 103.570 1.00 46.31  ? 25  ASN B O     1 
ATOM   5889  C CB    . ASN D 4 10  ? 108.216 132.912 102.945 1.00 46.00  ? 25  ASN B CB    1 
ATOM   5890  C CG    . ASN D 4 10  ? 109.129 133.782 102.094 1.00 47.90  ? 25  ASN B CG    1 
ATOM   5891  O OD1   . ASN D 4 10  ? 108.675 134.692 101.398 1.00 40.84  ? 25  ASN B OD1   1 
ATOM   5892  N ND2   . ASN D 4 10  ? 110.422 133.492 102.138 1.00 43.90  ? 25  ASN B ND2   1 
ATOM   5893  N N     . ILE D 4 11  ? 106.253 131.975 105.151 1.00 44.95  ? 26  ILE B N     1 
ATOM   5894  C CA    . ILE D 4 11  ? 105.180 131.102 105.594 1.00 43.83  ? 26  ILE B CA    1 
ATOM   5895  C C     . ILE D 4 11  ? 104.026 131.968 106.095 1.00 44.01  ? 26  ILE B C     1 
ATOM   5896  O O     . ILE D 4 11  ? 102.883 131.526 106.097 1.00 42.30  ? 26  ILE B O     1 
ATOM   5897  C CB    . ILE D 4 11  ? 105.664 130.144 106.709 1.00 45.06  ? 26  ILE B CB    1 
ATOM   5898  C CG1   . ILE D 4 11  ? 104.563 129.141 107.075 1.00 44.05  ? 26  ILE B CG1   1 
ATOM   5899  C CG2   . ILE D 4 11  ? 106.041 130.927 107.944 1.00 44.61  ? 26  ILE B CG2   1 
ATOM   5900  C CD1   . ILE D 4 11  ? 104.193 128.182 105.987 1.00 41.19  ? 26  ILE B CD1   1 
ATOM   5901  N N     . GLN D 4 12  ? 104.308 133.211 106.499 1.00 43.18  ? 27  GLN B N     1 
ATOM   5902  C CA    . GLN D 4 12  ? 103.240 134.098 106.956 1.00 41.50  ? 27  GLN B CA    1 
ATOM   5903  C C     . GLN D 4 12  ? 102.475 134.612 105.749 1.00 43.23  ? 27  GLN B C     1 
ATOM   5904  O O     . GLN D 4 12  ? 101.381 135.195 105.884 1.00 45.36  ? 27  GLN B O     1 
ATOM   5905  C CB    . GLN D 4 12  ? 103.788 135.267 107.778 1.00 43.89  ? 27  GLN B CB    1 
ATOM   5906  C CG    . GLN D 4 12  ? 104.302 134.857 109.171 1.00 45.23  ? 27  GLN B CG    1 
ATOM   5907  C CD    . GLN D 4 12  ? 103.265 134.078 109.991 1.00 45.01  ? 27  GLN B CD    1 
ATOM   5908  O OE1   . GLN D 4 12  ? 102.077 134.409 109.997 1.00 45.33  ? 27  GLN B OE1   1 
ATOM   5909  N NE2   . GLN D 4 12  ? 103.722 133.049 110.691 1.00 39.47  ? 27  GLN B NE2   1 
ATOM   5910  N N     . GLY D 4 13  ? 103.041 134.390 104.566 1.00 40.37  ? 28  GLY B N     1 
ATOM   5911  C CA    . GLY D 4 13  ? 102.363 134.788 103.345 1.00 39.66  ? 28  GLY B CA    1 
ATOM   5912  C C     . GLY D 4 13  ? 101.136 133.912 103.129 1.00 39.94  ? 28  GLY B C     1 
ATOM   5913  O O     . GLY D 4 13  ? 100.280 134.211 102.283 1.00 38.38  ? 28  GLY B O     1 
ATOM   5914  N N     . ILE D 4 14  ? 101.066 132.786 103.851 1.00 38.72  ? 29  ILE B N     1 
ATOM   5915  C CA    . ILE D 4 14  ? 99.897  131.907 103.768 1.00 35.87  ? 29  ILE B CA    1 
ATOM   5916  C C     . ILE D 4 14  ? 99.084  132.599 104.832 1.00 34.67  ? 29  ILE B C     1 
ATOM   5917  O O     . ILE D 4 14  ? 99.286  132.384 106.029 1.00 35.72  ? 29  ILE B O     1 
ATOM   5918  C CB    . ILE D 4 14  ? 100.213 130.437 104.211 1.00 36.06  ? 29  ILE B CB    1 
ATOM   5919  C CG1   . ILE D 4 14  ? 101.385 129.889 103.401 1.00 32.59  ? 29  ILE B CG1   1 
ATOM   5920  C CG2   . ILE D 4 14  ? 98.988  129.542 103.948 1.00 31.94  ? 29  ILE B CG2   1 
ATOM   5921  C CD1   . ILE D 4 14  ? 101.233 130.097 101.921 1.00 35.41  ? 29  ILE B CD1   1 
ATOM   5922  N N     . THR D 4 15  ? 98.171  133.450 104.391 1.00 35.84  ? 30  THR B N     1 
ATOM   5923  C CA    . THR D 4 15  ? 97.403  134.280 105.315 1.00 36.22  ? 30  THR B CA    1 
ATOM   5924  C C     . THR D 4 15  ? 96.185  133.679 105.977 1.00 38.04  ? 30  THR B C     1 
ATOM   5925  O O     . THR D 4 15  ? 95.644  132.657 105.545 1.00 39.08  ? 30  THR B O     1 
ATOM   5926  C CB    . THR D 4 15  ? 96.947  135.545 104.594 1.00 37.54  ? 30  THR B CB    1 
ATOM   5927  O OG1   . THR D 4 15  ? 96.101  135.154 103.509 1.00 38.24  ? 30  THR B OG1   1 
ATOM   5928  C CG2   . THR D 4 15  ? 98.158  136.328 104.040 1.00 38.38  ? 30  THR B CG2   1 
ATOM   5929  N N     . LYS D 4 16  ? 95.731  134.353 107.025 1.00 36.90  ? 31  LYS B N     1 
ATOM   5930  C CA    . LYS D 4 16  ? 94.567  133.908 107.756 1.00 37.71  ? 31  LYS B CA    1 
ATOM   5931  C C     . LYS D 4 16  ? 93.393  133.730 106.806 1.00 38.68  ? 31  LYS B C     1 
ATOM   5932  O O     . LYS D 4 16  ? 92.669  132.725 106.889 1.00 39.70  ? 31  LYS B O     1 
ATOM   5933  C CB    . LYS D 4 16  ? 94.220  134.910 108.871 1.00 39.35  ? 31  LYS B CB    1 
ATOM   5934  C CG    . LYS D 4 16  ? 92.828  134.740 109.452 1.00 43.88  ? 31  LYS B CG    1 
ATOM   5935  C CD    . LYS D 4 16  ? 92.604  135.675 110.652 1.00 50.35  ? 31  LYS B CD    1 
ATOM   5936  C CE    . LYS D 4 16  ? 91.226  135.483 111.266 1.00 52.15  ? 31  LYS B CE    1 
ATOM   5937  N NZ    . LYS D 4 16  ? 90.970  136.423 112.402 1.00 53.05  ? 31  LYS B NZ    1 
ATOM   5938  N N     . PRO D 4 17  ? 93.168  134.700 105.897 1.00 36.69  ? 32  PRO B N     1 
ATOM   5939  C CA    . PRO D 4 17  ? 92.041  134.559 104.965 1.00 35.25  ? 32  PRO B CA    1 
ATOM   5940  C C     . PRO D 4 17  ? 92.183  133.378 104.005 1.00 32.29  ? 32  PRO B C     1 
ATOM   5941  O O     . PRO D 4 17  ? 91.214  132.733 103.668 1.00 36.51  ? 32  PRO B O     1 
ATOM   5942  C CB    . PRO D 4 17  ? 92.029  135.901 104.225 1.00 38.66  ? 32  PRO B CB    1 
ATOM   5943  C CG    . PRO D 4 17  ? 92.578  136.852 105.246 1.00 39.27  ? 32  PRO B CG    1 
ATOM   5944  C CD    . PRO D 4 17  ? 93.712  136.074 105.869 1.00 37.64  ? 32  PRO B CD    1 
ATOM   5945  N N     . ALA D 4 18  ? 93.396  133.113 103.547 1.00 33.36  ? 33  ALA B N     1 
ATOM   5946  C CA    . ALA D 4 18  ? 93.615  132.005 102.634 1.00 32.09  ? 33  ALA B CA    1 
ATOM   5947  C C     . ALA D 4 18  ? 93.311  130.696 103.384 1.00 31.33  ? 33  ALA B C     1 
ATOM   5948  O O     . ALA D 4 18  ? 92.680  129.787 102.844 1.00 31.28  ? 33  ALA B O     1 
ATOM   5949  C CB    . ALA D 4 18  ? 95.043  132.018 102.180 1.00 33.27  ? 33  ALA B CB    1 
ATOM   5950  N N     . ILE D 4 19  ? 93.749  130.621 104.639 1.00 29.92  ? 34  ILE B N     1 
ATOM   5951  C CA    . ILE D 4 19  ? 93.536  129.418 105.446 1.00 31.50  ? 34  ILE B CA    1 
ATOM   5952  C C     . ILE D 4 19  ? 92.050  129.226 105.717 1.00 34.46  ? 34  ILE B C     1 
ATOM   5953  O O     . ILE D 4 19  ? 91.537  128.110 105.652 1.00 34.35  ? 34  ILE B O     1 
ATOM   5954  C CB    . ILE D 4 19  ? 94.354  129.491 106.755 1.00 28.85  ? 34  ILE B CB    1 
ATOM   5955  C CG1   . ILE D 4 19  ? 95.838  129.595 106.384 1.00 29.75  ? 34  ILE B CG1   1 
ATOM   5956  C CG2   . ILE D 4 19  ? 94.124  128.235 107.619 1.00 30.14  ? 34  ILE B CG2   1 
ATOM   5957  C CD1   . ILE D 4 19  ? 96.773  129.893 107.523 1.00 29.44  ? 34  ILE B CD1   1 
ATOM   5958  N N     . ARG D 4 20  ? 91.345  130.318 105.980 1.00 32.07  ? 35  ARG B N     1 
ATOM   5959  C CA    . ARG D 4 20  ? 89.926  130.227 106.235 1.00 32.21  ? 35  ARG B CA    1 
ATOM   5960  C C     . ARG D 4 20  ? 89.201  129.734 104.992 1.00 32.61  ? 35  ARG B C     1 
ATOM   5961  O O     . ARG D 4 20  ? 88.279  128.927 105.090 1.00 35.05  ? 35  ARG B O     1 
ATOM   5962  C CB    . ARG D 4 20  ? 89.374  131.593 106.697 1.00 36.66  ? 35  ARG B CB    1 
ATOM   5963  C CG    . ARG D 4 20  ? 87.868  131.764 106.573 1.00 41.84  ? 35  ARG B CG    1 
ATOM   5964  C CD    . ARG D 4 20  ? 87.404  133.115 107.184 1.00 50.41  ? 35  ARG B CD    1 
ATOM   5965  N NE    . ARG D 4 20  ? 87.732  133.168 108.607 1.00 52.54  ? 35  ARG B NE    1 
ATOM   5966  C CZ    . ARG D 4 20  ? 86.879  133.488 109.579 1.00 57.23  ? 35  ARG B CZ    1 
ATOM   5967  N NH1   . ARG D 4 20  ? 85.618  133.812 109.309 1.00 59.53  ? 35  ARG B NH1   1 
ATOM   5968  N NH2   . ARG D 4 20  ? 87.277  133.432 110.839 1.00 60.37  ? 35  ARG B NH2   1 
ATOM   5969  N N     . ARG D 4 21  ? 89.608  130.197 103.814 1.00 31.50  ? 36  ARG B N     1 
ATOM   5970  C CA    . ARG D 4 21  ? 88.944  129.745 102.602 1.00 30.84  ? 36  ARG B CA    1 
ATOM   5971  C C     . ARG D 4 21  ? 89.136  128.235 102.466 1.00 28.43  ? 36  ARG B C     1 
ATOM   5972  O O     . ARG D 4 21  ? 88.190  127.534 102.139 1.00 28.69  ? 36  ARG B O     1 
ATOM   5973  C CB    . ARG D 4 21  ? 89.493  130.448 101.342 1.00 33.97  ? 36  ARG B CB    1 
ATOM   5974  C CG    . ARG D 4 21  ? 89.178  131.953 101.228 1.00 35.93  ? 36  ARG B CG    1 
ATOM   5975  C CD    . ARG D 4 21  ? 89.526  132.509 99.810  1.00 32.71  ? 36  ARG B CD    1 
ATOM   5976  N NE    . ARG D 4 21  ? 90.953  132.708 99.577  1.00 33.66  ? 36  ARG B NE    1 
ATOM   5977  C CZ    . ARG D 4 21  ? 91.654  133.767 100.001 1.00 38.31  ? 36  ARG B CZ    1 
ATOM   5978  N NH1   . ARG D 4 21  ? 91.060  134.734 100.690 1.00 35.53  ? 36  ARG B NH1   1 
ATOM   5979  N NH2   . ARG D 4 21  ? 92.952  133.869 99.720  1.00 32.69  ? 36  ARG B NH2   1 
ATOM   5980  N N     . LEU D 4 22  ? 90.364  127.757 102.685 1.00 26.20  ? 37  LEU B N     1 
ATOM   5981  C CA    . LEU D 4 22  ? 90.658  126.313 102.590 1.00 27.27  ? 37  LEU B CA    1 
ATOM   5982  C C     . LEU D 4 22  ? 89.727  125.571 103.543 1.00 26.81  ? 37  LEU B C     1 
ATOM   5983  O O     . LEU D 4 22  ? 89.073  124.601 103.170 1.00 28.29  ? 37  LEU B O     1 
ATOM   5984  C CB    . LEU D 4 22  ? 92.100  126.043 102.968 1.00 25.13  ? 37  LEU B CB    1 
ATOM   5985  C CG    . LEU D 4 22  ? 93.096  126.514 101.898 1.00 31.44  ? 37  LEU B CG    1 
ATOM   5986  C CD1   . LEU D 4 22  ? 94.503  126.593 102.487 1.00 33.37  ? 37  LEU B CD1   1 
ATOM   5987  C CD2   . LEU D 4 22  ? 93.024  125.576 100.693 1.00 25.47  ? 37  LEU B CD2   1 
ATOM   5988  N N     . ALA D 4 23  ? 89.640  126.081 104.769 1.00 27.22  ? 38  ALA B N     1 
ATOM   5989  C CA    . ALA D 4 23  ? 88.784  125.494 105.777 1.00 26.02  ? 38  ALA B CA    1 
ATOM   5990  C C     . ALA D 4 23  ? 87.317  125.487 105.328 1.00 27.30  ? 38  ALA B C     1 
ATOM   5991  O O     . ALA D 4 23  ? 86.607  124.490 105.536 1.00 24.74  ? 38  ALA B O     1 
ATOM   5992  C CB    . ALA D 4 23  ? 88.963  126.248 107.137 1.00 25.02  ? 38  ALA B CB    1 
ATOM   5993  N N     . ARG D 4 24  ? 86.859  126.571 104.687 1.00 26.47  ? 39  ARG B N     1 
ATOM   5994  C CA    . ARG D 4 24  ? 85.471  126.627 104.206 1.00 25.38  ? 39  ARG B CA    1 
ATOM   5995  C C     . ARG D 4 24  ? 85.208  125.534 103.172 1.00 26.22  ? 39  ARG B C     1 
ATOM   5996  O O     . ARG D 4 24  ? 84.203  124.853 103.234 1.00 26.48  ? 39  ARG B O     1 
ATOM   5997  C CB    . ARG D 4 24  ? 85.155  128.001 103.593 1.00 31.04  ? 39  ARG B CB    1 
ATOM   5998  C CG    . ARG D 4 24  ? 85.200  129.147 104.599 1.00 31.49  ? 39  ARG B CG    1 
ATOM   5999  C CD    . ARG D 4 24  ? 83.971  129.167 105.529 1.00 33.83  ? 39  ARG B CD    1 
ATOM   6000  N NE    . ARG D 4 24  ? 83.999  130.378 106.334 1.00 35.46  ? 39  ARG B NE    1 
ATOM   6001  C CZ    . ARG D 4 24  ? 84.349  130.434 107.614 1.00 40.64  ? 39  ARG B CZ    1 
ATOM   6002  N NH1   . ARG D 4 24  ? 84.681  129.329 108.285 1.00 33.92  ? 39  ARG B NH1   1 
ATOM   6003  N NH2   . ARG D 4 24  ? 84.466  131.617 108.199 1.00 36.14  ? 39  ARG B NH2   1 
ATOM   6004  N N     . ARG D 4 25  ? 86.112  125.369 102.209 1.00 26.59  ? 40  ARG B N     1 
ATOM   6005  C CA    . ARG D 4 25  ? 85.934  124.330 101.198 1.00 24.97  ? 40  ARG B CA    1 
ATOM   6006  C C     . ARG D 4 25  ? 85.919  122.969 101.911 1.00 25.31  ? 40  ARG B C     1 
ATOM   6007  O O     . ARG D 4 25  ? 85.297  122.016 101.427 1.00 26.82  ? 40  ARG B O     1 
ATOM   6008  C CB    . ARG D 4 25  ? 87.076  124.367 100.184 1.00 23.22  ? 40  ARG B CB    1 
ATOM   6009  C CG    . ARG D 4 25  ? 86.929  123.361 99.055  1.00 26.82  ? 40  ARG B CG    1 
ATOM   6010  C CD    . ARG D 4 25  ? 87.900  123.711 97.893  1.00 31.49  ? 40  ARG B CD    1 
ATOM   6011  N NE    . ARG D 4 25  ? 87.351  124.762 97.033  1.00 33.59  ? 40  ARG B NE    1 
ATOM   6012  C CZ    . ARG D 4 25  ? 88.047  125.463 96.133  1.00 33.91  ? 40  ARG B CZ    1 
ATOM   6013  N NH1   . ARG D 4 25  ? 89.360  125.260 95.944  1.00 27.84  ? 40  ARG B NH1   1 
ATOM   6014  N NH2   . ARG D 4 25  ? 87.413  126.367 95.392  1.00 35.50  ? 40  ARG B NH2   1 
ATOM   6015  N N     . GLY D 4 26  ? 86.601  122.908 103.055 1.00 26.46  ? 41  GLY B N     1 
ATOM   6016  C CA    . GLY D 4 26  ? 86.634  121.695 103.864 1.00 27.73  ? 41  GLY B CA    1 
ATOM   6017  C C     . GLY D 4 26  ? 85.405  121.561 104.771 1.00 28.29  ? 41  GLY B C     1 
ATOM   6018  O O     . GLY D 4 26  ? 85.351  120.682 105.623 1.00 28.41  ? 41  GLY B O     1 
ATOM   6019  N N     . GLY D 4 27  ? 84.432  122.459 104.605 1.00 28.47  ? 42  GLY B N     1 
ATOM   6020  C CA    . GLY D 4 27  ? 83.205  122.408 105.386 1.00 29.12  ? 42  GLY B CA    1 
ATOM   6021  C C     . GLY D 4 27  ? 83.209  122.991 106.790 1.00 31.18  ? 42  GLY B C     1 
ATOM   6022  O O     . GLY D 4 27  ? 82.250  122.782 107.540 1.00 31.25  ? 42  GLY B O     1 
ATOM   6023  N N     . VAL D 4 28  ? 84.276  123.710 107.138 1.00 28.89  ? 43  VAL B N     1 
ATOM   6024  C CA    . VAL D 4 28  ? 84.455  124.307 108.453 1.00 28.79  ? 43  VAL B CA    1 
ATOM   6025  C C     . VAL D 4 28  ? 83.715  125.630 108.693 1.00 30.94  ? 43  VAL B C     1 
ATOM   6026  O O     . VAL D 4 28  ? 83.891  126.596 107.944 1.00 30.12  ? 43  VAL B O     1 
ATOM   6027  C CB    . VAL D 4 28  ? 85.961  124.493 108.715 1.00 30.48  ? 43  VAL B CB    1 
ATOM   6028  C CG1   . VAL D 4 28  ? 86.203  125.242 110.016 1.00 28.09  ? 43  VAL B CG1   1 
ATOM   6029  C CG2   . VAL D 4 28  ? 86.628  123.107 108.770 1.00 28.92  ? 43  VAL B CG2   1 
ATOM   6030  N N     . LYS D 4 29  ? 82.912  125.663 109.757 1.00 31.67  ? 44  LYS B N     1 
ATOM   6031  C CA    . LYS D 4 29  ? 82.094  126.837 110.112 1.00 32.05  ? 44  LYS B CA    1 
ATOM   6032  C C     . LYS D 4 29  ? 82.685  127.848 111.103 1.00 33.43  ? 44  LYS B C     1 
ATOM   6033  O O     . LYS D 4 29  ? 82.421  129.051 111.017 1.00 33.98  ? 44  LYS B O     1 
ATOM   6034  C CB    . LYS D 4 29  ? 80.739  126.373 110.661 1.00 33.03  ? 44  LYS B CB    1 
ATOM   6035  C CG    . LYS D 4 29  ? 79.775  127.509 111.026 1.00 38.90  ? 44  LYS B CG    1 
ATOM   6036  C CD    . LYS D 4 29  ? 78.422  126.944 111.455 1.00 36.69  ? 44  LYS B CD    1 
ATOM   6037  C CE    . LYS D 4 29  ? 77.382  128.039 111.719 1.00 38.26  ? 44  LYS B CE    1 
ATOM   6038  N NZ    . LYS D 4 29  ? 76.077  127.443 112.124 1.00 33.92  ? 44  LYS B NZ    1 
ATOM   6039  N N     . ARG D 4 30  ? 83.476  127.376 112.048 1.00 32.52  ? 45  ARG B N     1 
ATOM   6040  C CA    . ARG D 4 30  ? 84.028  128.271 113.054 1.00 33.07  ? 45  ARG B CA    1 
ATOM   6041  C C     . ARG D 4 30  ? 85.451  127.827 113.311 1.00 33.85  ? 45  ARG B C     1 
ATOM   6042  O O     . ARG D 4 30  ? 85.723  126.621 113.416 1.00 29.95  ? 45  ARG B O     1 
ATOM   6043  C CB    . ARG D 4 30  ? 83.182  128.176 114.323 1.00 32.29  ? 45  ARG B CB    1 
ATOM   6044  C CG    . ARG D 4 30  ? 83.300  129.373 115.233 1.00 34.25  ? 45  ARG B CG    1 
ATOM   6045  C CD    . ARG D 4 30  ? 82.113  129.395 116.200 1.00 34.14  ? 45  ARG B CD    1 
ATOM   6046  N NE    . ARG D 4 30  ? 82.168  130.510 117.127 1.00 33.60  ? 45  ARG B NE    1 
ATOM   6047  C CZ    . ARG D 4 30  ? 82.907  130.531 118.231 1.00 39.59  ? 45  ARG B CZ    1 
ATOM   6048  N NH1   . ARG D 4 30  ? 83.674  129.489 118.574 1.00 33.37  ? 45  ARG B NH1   1 
ATOM   6049  N NH2   . ARG D 4 30  ? 82.890  131.614 118.998 1.00 42.86  ? 45  ARG B NH2   1 
ATOM   6050  N N     . ILE D 4 31  ? 86.350  128.803 113.415 1.00 31.62  ? 46  ILE B N     1 
ATOM   6051  C CA    . ILE D 4 31  ? 87.766  128.549 113.566 1.00 32.36  ? 46  ILE B CA    1 
ATOM   6052  C C     . ILE D 4 31  ? 88.452  129.211 114.772 1.00 34.13  ? 46  ILE B C     1 
ATOM   6053  O O     . ILE D 4 31  ? 88.281  130.407 115.016 1.00 37.99  ? 46  ILE B O     1 
ATOM   6054  C CB    . ILE D 4 31  ? 88.432  129.008 112.260 1.00 33.13  ? 46  ILE B CB    1 
ATOM   6055  C CG1   . ILE D 4 31  ? 87.728  128.328 111.079 1.00 32.27  ? 46  ILE B CG1   1 
ATOM   6056  C CG2   . ILE D 4 31  ? 89.912  128.790 112.302 1.00 29.65  ? 46  ILE B CG2   1 
ATOM   6057  C CD1   . ILE D 4 31  ? 88.187  128.875 109.688 1.00 36.92  ? 46  ILE B CD1   1 
ATOM   6058  N N     . SER D 4 32  ? 89.233  128.426 115.510 1.00 31.87  ? 47  SER B N     1 
ATOM   6059  C CA    . SER D 4 32  ? 89.977  128.886 116.677 1.00 32.70  ? 47  SER B CA    1 
ATOM   6060  C C     . SER D 4 32  ? 91.146  129.719 116.170 1.00 34.14  ? 47  SER B C     1 
ATOM   6061  O O     . SER D 4 32  ? 91.757  129.389 115.144 1.00 33.38  ? 47  SER B O     1 
ATOM   6062  C CB    . SER D 4 32  ? 90.495  127.684 117.472 1.00 31.27  ? 47  SER B CB    1 
ATOM   6063  O OG    . SER D 4 32  ? 91.485  128.055 118.419 1.00 36.95  ? 47  SER B OG    1 
ATOM   6064  N N     . GLY D 4 33  ? 91.459  130.803 116.884 1.00 34.36  ? 48  GLY B N     1 
ATOM   6065  C CA    . GLY D 4 33  ? 92.525  131.682 116.443 1.00 32.65  ? 48  GLY B CA    1 
ATOM   6066  C C     . GLY D 4 33  ? 93.844  130.978 116.256 1.00 34.95  ? 48  GLY B C     1 
ATOM   6067  O O     . GLY D 4 33  ? 94.643  131.361 115.384 1.00 39.00  ? 48  GLY B O     1 
ATOM   6068  N N     . LEU D 4 34  ? 94.074  129.945 117.060 1.00 33.44  ? 49  LEU B N     1 
ATOM   6069  C CA    . LEU D 4 34  ? 95.317  129.167 117.017 1.00 33.63  ? 49  LEU B CA    1 
ATOM   6070  C C     . LEU D 4 34  ? 95.472  128.256 115.781 1.00 32.88  ? 49  LEU B C     1 
ATOM   6071  O O     . LEU D 4 34  ? 96.558  127.757 115.487 1.00 32.07  ? 49  LEU B O     1 
ATOM   6072  C CB    . LEU D 4 34  ? 95.431  128.329 118.296 1.00 33.88  ? 49  LEU B CB    1 
ATOM   6073  C CG    . LEU D 4 34  ? 95.464  129.129 119.611 1.00 36.11  ? 49  LEU B CG    1 
ATOM   6074  C CD1   . LEU D 4 34  ? 95.465  128.196 120.804 1.00 38.82  ? 49  LEU B CD1   1 
ATOM   6075  C CD2   . LEU D 4 34  ? 96.713  130.015 119.630 1.00 36.89  ? 49  LEU B CD2   1 
ATOM   6076  N N     . ILE D 4 35  ? 94.382  128.066 115.056 1.00 33.64  ? 50  ILE B N     1 
ATOM   6077  C CA    . ILE D 4 35  ? 94.373  127.227 113.859 1.00 32.31  ? 50  ILE B CA    1 
ATOM   6078  C C     . ILE D 4 35  ? 95.355  127.709 112.795 1.00 33.14  ? 50  ILE B C     1 
ATOM   6079  O O     . ILE D 4 35  ? 96.079  126.907 112.203 1.00 32.30  ? 50  ILE B O     1 
ATOM   6080  C CB    . ILE D 4 35  ? 92.933  127.178 113.249 1.00 30.64  ? 50  ILE B CB    1 
ATOM   6081  C CG1   . ILE D 4 35  ? 92.036  126.305 114.126 1.00 30.22  ? 50  ILE B CG1   1 
ATOM   6082  C CG2   . ILE D 4 35  ? 92.972  126.718 111.791 1.00 26.25  ? 50  ILE B CG2   1 
ATOM   6083  C CD1   . ILE D 4 35  ? 92.421  124.804 114.102 1.00 32.43  ? 50  ILE B CD1   1 
ATOM   6084  N N     . TYR D 4 36  ? 95.425  129.023 112.580 1.00 33.11  ? 51  TYR B N     1 
ATOM   6085  C CA    . TYR D 4 36  ? 96.293  129.537 111.527 1.00 31.21  ? 51  TYR B CA    1 
ATOM   6086  C C     . TYR D 4 36  ? 97.732  129.154 111.648 1.00 29.16  ? 51  TYR B C     1 
ATOM   6087  O O     . TYR D 4 36  ? 98.318  128.684 110.678 1.00 31.36  ? 51  TYR B O     1 
ATOM   6088  C CB    . TYR D 4 36  ? 96.124  131.059 111.381 1.00 31.56  ? 51  TYR B CB    1 
ATOM   6089  C CG    . TYR D 4 36  ? 94.664  131.398 111.292 1.00 29.75  ? 51  TYR B CG    1 
ATOM   6090  C CD1   . TYR D 4 36  ? 93.897  130.961 110.220 1.00 27.69  ? 51  TYR B CD1   1 
ATOM   6091  C CD2   . TYR D 4 36  ? 94.016  132.024 112.357 1.00 30.69  ? 51  TYR B CD2   1 
ATOM   6092  C CE1   . TYR D 4 36  ? 92.523  131.129 110.215 1.00 30.34  ? 51  TYR B CE1   1 
ATOM   6093  C CE2   . TYR D 4 36  ? 92.650  132.186 112.362 1.00 26.09  ? 51  TYR B CE2   1 
ATOM   6094  C CZ    . TYR D 4 36  ? 91.905  131.743 111.304 1.00 30.44  ? 51  TYR B CZ    1 
ATOM   6095  O OH    . TYR D 4 36  ? 90.532  131.878 111.359 1.00 32.84  ? 51  TYR B OH    1 
ATOM   6096  N N     . GLU D 4 37  ? 98.323  129.326 112.815 1.00 31.91  ? 52  GLU B N     1 
ATOM   6097  C CA    . GLU D 4 37  ? 99.715  128.951 112.943 1.00 31.26  ? 52  GLU B CA    1 
ATOM   6098  C C     . GLU D 4 37  ? 99.859  127.442 112.828 1.00 30.17  ? 52  GLU B C     1 
ATOM   6099  O O     . GLU D 4 37  ? 100.771 126.962 112.182 1.00 27.58  ? 52  GLU B O     1 
ATOM   6100  C CB    . GLU D 4 37  ? 100.309 129.447 114.262 1.00 36.24  ? 52  GLU B CB    1 
ATOM   6101  C CG    . GLU D 4 37  ? 100.661 130.916 114.237 1.00 39.57  ? 52  GLU B CG    1 
ATOM   6102  C CD    . GLU D 4 37  ? 101.766 131.217 113.256 1.00 43.81  ? 52  GLU B CD    1 
ATOM   6103  O OE1   . GLU D 4 37  ? 102.919 130.817 113.522 1.00 48.19  ? 52  GLU B OE1   1 
ATOM   6104  O OE2   . GLU D 4 37  ? 101.478 131.842 112.216 1.00 43.91  ? 52  GLU B OE2   1 
ATOM   6105  N N     . GLU D 4 38  ? 98.935  126.694 113.414 1.00 33.09  ? 53  GLU B N     1 
ATOM   6106  C CA    . GLU D 4 38  ? 99.001  125.229 113.351 1.00 29.49  ? 53  GLU B CA    1 
ATOM   6107  C C     . GLU D 4 38  ? 99.002  124.761 111.889 1.00 30.77  ? 53  GLU B C     1 
ATOM   6108  O O     . GLU D 4 38  ? 99.762  123.856 111.500 1.00 29.43  ? 53  GLU B O     1 
ATOM   6109  C CB    . GLU D 4 38  ? 97.792  124.622 114.072 1.00 31.51  ? 53  GLU B CB    1 
ATOM   6110  C CG    . GLU D 4 38  ? 97.883  123.124 114.258 1.00 33.08  ? 53  GLU B CG    1 
ATOM   6111  C CD    . GLU D 4 38  ? 98.791  122.752 115.420 1.00 41.79  ? 53  GLU B CD    1 
ATOM   6112  O OE1   . GLU D 4 38  ? 99.321  123.679 116.080 1.00 43.11  ? 53  GLU B OE1   1 
ATOM   6113  O OE2   . GLU D 4 38  ? 98.959  121.541 115.687 1.00 44.22  ? 53  GLU B OE2   1 
ATOM   6114  N N     . THR D 4 39  ? 98.149  125.395 111.088 1.00 29.05  ? 54  THR B N     1 
ATOM   6115  C CA    . THR D 4 39  ? 98.011  125.053 109.685 1.00 28.91  ? 54  THR B CA    1 
ATOM   6116  C C     . THR D 4 39  ? 99.299  125.340 108.932 1.00 30.73  ? 54  THR B C     1 
ATOM   6117  O O     . THR D 4 39  ? 99.748  124.527 108.124 1.00 28.46  ? 54  THR B O     1 
ATOM   6118  C CB    . THR D 4 39  ? 96.836  125.819 109.063 1.00 28.27  ? 54  THR B CB    1 
ATOM   6119  O OG1   . THR D 4 39  ? 95.634  125.426 109.729 1.00 29.60  ? 54  THR B OG1   1 
ATOM   6120  C CG2   . THR D 4 39  ? 96.705  125.533 107.570 1.00 25.91  ? 54  THR B CG2   1 
ATOM   6121  N N     . ARG D 4 40  ? 99.907  126.485 109.220 1.00 30.71  ? 55  ARG B N     1 
ATOM   6122  C CA    . ARG D 4 40  ? 101.157 126.841 108.567 1.00 30.88  ? 55  ARG B CA    1 
ATOM   6123  C C     . ARG D 4 40  ? 102.204 125.791 108.848 1.00 28.95  ? 55  ARG B C     1 
ATOM   6124  O O     . ARG D 4 40  ? 102.929 125.376 107.940 1.00 32.37  ? 55  ARG B O     1 
ATOM   6125  C CB    . ARG D 4 40  ? 101.652 128.221 109.044 1.00 30.97  ? 55  ARG B CB    1 
ATOM   6126  C CG    . ARG D 4 40  ? 100.761 129.357 108.564 1.00 28.78  ? 55  ARG B CG    1 
ATOM   6127  C CD    . ARG D 4 40  ? 101.301 130.794 108.911 1.00 37.41  ? 55  ARG B CD    1 
ATOM   6128  N NE    . ARG D 4 40  ? 100.311 131.784 108.476 1.00 34.08  ? 55  ARG B NE    1 
ATOM   6129  C CZ    . ARG D 4 40  ? 99.525  132.462 109.300 1.00 33.87  ? 55  ARG B CZ    1 
ATOM   6130  N NH1   . ARG D 4 40  ? 99.631  132.290 110.611 1.00 33.99  ? 55  ARG B NH1   1 
ATOM   6131  N NH2   . ARG D 4 40  ? 98.576  133.253 108.815 1.00 35.49  ? 55  ARG B NH2   1 
ATOM   6132  N N     . GLY D 4 41  ? 102.275 125.355 110.100 1.00 25.31  ? 56  GLY B N     1 
ATOM   6133  C CA    . GLY D 4 41  ? 103.250 124.342 110.474 1.00 28.65  ? 56  GLY B CA    1 
ATOM   6134  C C     . GLY D 4 41  ? 102.996 123.054 109.713 1.00 28.37  ? 56  GLY B C     1 
ATOM   6135  O O     . GLY D 4 41  ? 103.917 122.412 109.184 1.00 28.80  ? 56  GLY B O     1 
ATOM   6136  N N     . VAL D 4 42  ? 101.728 122.670 109.638 1.00 27.31  ? 57  VAL B N     1 
ATOM   6137  C CA    . VAL D 4 42  ? 101.369 121.449 108.921 1.00 25.91  ? 57  VAL B CA    1 
ATOM   6138  C C     . VAL D 4 42  ? 101.704 121.577 107.443 1.00 23.97  ? 57  VAL B C     1 
ATOM   6139  O O     . VAL D 4 42  ? 102.296 120.667 106.853 1.00 25.19  ? 57  VAL B O     1 
ATOM   6140  C CB    . VAL D 4 42  ? 99.860  121.137 109.134 1.00 26.79  ? 57  VAL B CB    1 
ATOM   6141  C CG1   . VAL D 4 42  ? 99.378  120.090 108.142 1.00 30.51  ? 57  VAL B CG1   1 
ATOM   6142  C CG2   . VAL D 4 42  ? 99.653  120.647 110.558 1.00 24.15  ? 57  VAL B CG2   1 
ATOM   6143  N N     . LEU D 4 43  ? 101.366 122.716 106.837 1.00 25.72  ? 58  LEU B N     1 
ATOM   6144  C CA    . LEU D 4 43  ? 101.663 122.903 105.418 1.00 24.75  ? 58  LEU B CA    1 
ATOM   6145  C C     . LEU D 4 43  ? 103.170 122.877 105.127 1.00 25.65  ? 58  LEU B C     1 
ATOM   6146  O O     . LEU D 4 43  ? 103.618 122.327 104.120 1.00 26.70  ? 58  LEU B O     1 
ATOM   6147  C CB    . LEU D 4 43  ? 101.068 124.226 104.910 1.00 27.89  ? 58  LEU B CB    1 
ATOM   6148  C CG    . LEU D 4 43  ? 101.493 124.650 103.499 1.00 29.23  ? 58  LEU B CG    1 
ATOM   6149  C CD1   . LEU D 4 43  ? 101.111 123.612 102.432 1.00 26.72  ? 58  LEU B CD1   1 
ATOM   6150  C CD2   . LEU D 4 43  ? 100.825 125.965 103.180 1.00 32.94  ? 58  LEU B CD2   1 
ATOM   6151  N N     . LYS D 4 44  ? 103.969 123.443 106.020 1.00 27.76  ? 59  LYS B N     1 
ATOM   6152  C CA    . LYS D 4 44  ? 105.408 123.441 105.808 1.00 28.62  ? 59  LYS B CA    1 
ATOM   6153  C C     . LYS D 4 44  ? 105.967 122.014 105.796 1.00 26.28  ? 59  LYS B C     1 
ATOM   6154  O O     . LYS D 4 44  ? 106.833 121.670 104.989 1.00 25.07  ? 59  LYS B O     1 
ATOM   6155  C CB    . LYS D 4 44  ? 106.083 124.259 106.899 1.00 30.32  ? 59  LYS B CB    1 
ATOM   6156  C CG    . LYS D 4 44  ? 107.584 124.417 106.757 1.00 37.38  ? 59  LYS B CG    1 
ATOM   6157  C CD    . LYS D 4 44  ? 108.069 125.565 107.690 1.00 43.98  ? 59  LYS B CD    1 
ATOM   6158  C CE    . LYS D 4 44  ? 109.578 125.532 107.958 1.00 47.52  ? 59  LYS B CE    1 
ATOM   6159  N NZ    . LYS D 4 44  ? 109.974 124.437 108.912 1.00 51.06  ? 59  LYS B NZ    1 
ATOM   6160  N N     . VAL D 4 45  ? 105.488 121.194 106.718 1.00 27.29  ? 60  VAL B N     1 
ATOM   6161  C CA    . VAL D 4 45  ? 105.933 119.804 106.801 1.00 26.52  ? 60  VAL B CA    1 
ATOM   6162  C C     . VAL D 4 45  ? 105.528 119.093 105.507 1.00 25.23  ? 60  VAL B C     1 
ATOM   6163  O O     . VAL D 4 45  ? 106.310 118.342 104.923 1.00 26.68  ? 60  VAL B O     1 
ATOM   6164  C CB    . VAL D 4 45  ? 105.279 119.097 108.003 1.00 29.26  ? 60  VAL B CB    1 
ATOM   6165  C CG1   . VAL D 4 45  ? 105.492 117.591 107.896 1.00 32.39  ? 60  VAL B CG1   1 
ATOM   6166  C CG2   . VAL D 4 45  ? 105.881 119.636 109.310 1.00 31.27  ? 60  VAL B CG2   1 
ATOM   6167  N N     . PHE D 4 46  ? 104.312 119.343 105.050 1.00 23.95  ? 61  PHE B N     1 
ATOM   6168  C CA    . PHE D 4 46  ? 103.843 118.734 103.818 1.00 26.36  ? 61  PHE B CA    1 
ATOM   6169  C C     . PHE D 4 46  ? 104.766 119.109 102.658 1.00 27.88  ? 61  PHE B C     1 
ATOM   6170  O O     . PHE D 4 46  ? 105.185 118.263 101.890 1.00 26.66  ? 61  PHE B O     1 
ATOM   6171  C CB    . PHE D 4 46  ? 102.412 119.214 103.477 1.00 25.76  ? 61  PHE B CB    1 
ATOM   6172  C CG    . PHE D 4 46  ? 101.858 118.604 102.204 1.00 27.78  ? 61  PHE B CG    1 
ATOM   6173  C CD1   . PHE D 4 46  ? 101.202 117.371 102.240 1.00 23.72  ? 61  PHE B CD1   1 
ATOM   6174  C CD2   . PHE D 4 46  ? 101.998 119.260 100.978 1.00 26.39  ? 61  PHE B CD2   1 
ATOM   6175  C CE1   . PHE D 4 46  ? 100.684 116.789 101.070 1.00 27.75  ? 61  PHE B CE1   1 
ATOM   6176  C CE2   . PHE D 4 46  ? 101.487 118.696 99.786  1.00 29.61  ? 61  PHE B CE2   1 
ATOM   6177  C CZ    . PHE D 4 46  ? 100.824 117.455 99.824  1.00 25.87  ? 61  PHE B CZ    1 
ATOM   6178  N N     . LEU D 4 47  ? 105.069 120.396 102.514 1.00 29.37  ? 62  LEU B N     1 
ATOM   6179  C CA    . LEU D 4 47  ? 105.923 120.846 101.416 1.00 25.66  ? 62  LEU B CA    1 
ATOM   6180  C C     . LEU D 4 47  ? 107.345 120.337 101.564 1.00 27.71  ? 62  LEU B C     1 
ATOM   6181  O O     . LEU D 4 47  ? 107.955 119.925 100.574 1.00 28.76  ? 62  LEU B O     1 
ATOM   6182  C CB    . LEU D 4 47  ? 105.892 122.392 101.307 1.00 25.99  ? 62  LEU B CB    1 
ATOM   6183  C CG    . LEU D 4 47  ? 104.551 122.920 100.766 1.00 27.57  ? 62  LEU B CG    1 
ATOM   6184  C CD1   . LEU D 4 47  ? 104.485 124.424 100.934 1.00 27.37  ? 62  LEU B CD1   1 
ATOM   6185  C CD2   . LEU D 4 47  ? 104.374 122.506 99.285  1.00 25.50  ? 62  LEU B CD2   1 
ATOM   6186  N N     . GLU D 4 48  ? 107.888 120.355 102.782 1.00 25.07  ? 63  GLU B N     1 
ATOM   6187  C CA    . GLU D 4 48  ? 109.232 119.828 102.982 1.00 27.71  ? 63  GLU B CA    1 
ATOM   6188  C C     . GLU D 4 48  ? 109.304 118.387 102.509 1.00 28.35  ? 63  GLU B C     1 
ATOM   6189  O O     . GLU D 4 48  ? 110.203 118.030 101.755 1.00 27.37  ? 63  GLU B O     1 
ATOM   6190  C CB    . GLU D 4 48  ? 109.646 119.897 104.457 1.00 28.47  ? 63  GLU B CB    1 
ATOM   6191  C CG    . GLU D 4 48  ? 109.791 121.310 104.961 1.00 34.61  ? 63  GLU B CG    1 
ATOM   6192  C CD    . GLU D 4 48  ? 110.016 121.396 106.451 1.00 39.98  ? 63  GLU B CD    1 
ATOM   6193  O OE1   . GLU D 4 48  ? 109.470 120.545 107.183 1.00 36.88  ? 63  GLU B OE1   1 
ATOM   6194  O OE2   . GLU D 4 48  ? 110.722 122.334 106.893 1.00 38.49  ? 63  GLU B OE2   1 
ATOM   6195  N N     . ASN D 4 49  ? 108.335 117.554 102.903 1.00 27.73  ? 64  ASN B N     1 
ATOM   6196  C CA    . ASN D 4 49  ? 108.371 116.150 102.478 1.00 27.36  ? 64  ASN B CA    1 
ATOM   6197  C C     . ASN D 4 49  ? 108.258 115.966 100.971 1.00 27.06  ? 64  ASN B C     1 
ATOM   6198  O O     . ASN D 4 49  ? 109.016 115.211 100.390 1.00 26.93  ? 64  ASN B O     1 
ATOM   6199  C CB    . ASN D 4 49  ? 107.277 115.333 103.174 1.00 28.90  ? 64  ASN B CB    1 
ATOM   6200  C CG    . ASN D 4 49  ? 107.483 115.267 104.679 1.00 32.81  ? 64  ASN B CG    1 
ATOM   6201  O OD1   . ASN D 4 49  ? 108.601 115.384 105.151 1.00 39.57  ? 64  ASN B OD1   1 
ATOM   6202  N ND2   . ASN D 4 49  ? 106.411 115.063 105.429 1.00 35.32  ? 64  ASN B ND2   1 
ATOM   6203  N N     . VAL D 4 50  ? 107.307 116.641 100.341 1.00 24.68  ? 65  VAL B N     1 
ATOM   6204  C CA    . VAL D 4 50  ? 107.152 116.499 98.898  1.00 24.92  ? 65  VAL B CA    1 
ATOM   6205  C C     . VAL D 4 50  ? 108.347 117.128 98.117  1.00 25.02  ? 65  VAL B C     1 
ATOM   6206  O O     . VAL D 4 50  ? 108.882 116.520 97.185  1.00 23.36  ? 65  VAL B O     1 
ATOM   6207  C CB    . VAL D 4 50  ? 105.811 117.149 98.435  1.00 29.39  ? 65  VAL B CB    1 
ATOM   6208  C CG1   . VAL D 4 50  ? 105.640 117.010 96.922  1.00 24.28  ? 65  VAL B CG1   1 
ATOM   6209  C CG2   . VAL D 4 50  ? 104.617 116.452 99.151  1.00 32.36  ? 65  VAL B CG2   1 
ATOM   6210  N N     . ILE D 4 51  ? 108.758 118.330 98.500  1.00 25.44  ? 66  ILE B N     1 
ATOM   6211  C CA    . ILE D 4 51  ? 109.869 119.021 97.796  1.00 26.31  ? 66  ILE B CA    1 
ATOM   6212  C C     . ILE D 4 51  ? 111.194 118.279 97.951  1.00 27.77  ? 66  ILE B C     1 
ATOM   6213  O O     . ILE D 4 51  ? 111.956 118.132 96.989  1.00 27.41  ? 66  ILE B O     1 
ATOM   6214  C CB    . ILE D 4 51  ? 109.997 120.500 98.271  1.00 25.53  ? 66  ILE B CB    1 
ATOM   6215  C CG1   . ILE D 4 51  ? 108.733 121.242 97.843  1.00 25.58  ? 66  ILE B CG1   1 
ATOM   6216  C CG2   . ILE D 4 51  ? 111.234 121.206 97.601  1.00 26.62  ? 66  ILE B CG2   1 
ATOM   6217  C CD1   . ILE D 4 51  ? 108.528 122.563 98.547  1.00 31.56  ? 66  ILE B CD1   1 
ATOM   6218  N N     . ARG D 4 52  ? 111.448 117.759 99.143  1.00 24.14  ? 67  ARG B N     1 
ATOM   6219  C CA    . ARG D 4 52  ? 112.675 117.013 99.337  1.00 27.31  ? 67  ARG B CA    1 
ATOM   6220  C C     . ARG D 4 52  ? 112.753 115.926 98.250  1.00 26.99  ? 67  ARG B C     1 
ATOM   6221  O O     . ARG D 4 52  ? 113.749 115.841 97.538  1.00 27.08  ? 67  ARG B O     1 
ATOM   6222  C CB    . ARG D 4 52  ? 112.718 116.375 100.746 1.00 28.29  ? 67  ARG B CB    1 
ATOM   6223  C CG    . ARG D 4 52  ? 113.951 115.529 100.982 1.00 33.55  ? 67  ARG B CG    1 
ATOM   6224  C CD    . ARG D 4 52  ? 113.882 114.781 102.285 1.00 39.30  ? 67  ARG B CD    1 
ATOM   6225  N NE    . ARG D 4 52  ? 113.866 115.677 103.434 1.00 47.95  ? 67  ARG B NE    1 
ATOM   6226  C CZ    . ARG D 4 52  ? 112.798 115.895 104.198 1.00 51.16  ? 67  ARG B CZ    1 
ATOM   6227  N NH1   . ARG D 4 52  ? 111.655 115.274 103.934 1.00 47.45  ? 67  ARG B NH1   1 
ATOM   6228  N NH2   . ARG D 4 52  ? 112.877 116.729 105.225 1.00 50.60  ? 67  ARG B NH2   1 
ATOM   6229  N N     . ASP D 4 53  ? 111.701 115.115 98.091  1.00 22.25  ? 68  ASP B N     1 
ATOM   6230  C CA    . ASP D 4 53  ? 111.737 114.042 97.092  1.00 22.01  ? 68  ASP B CA    1 
ATOM   6231  C C     . ASP D 4 53  ? 111.805 114.582 95.675  1.00 23.04  ? 68  ASP B C     1 
ATOM   6232  O O     . ASP D 4 53  ? 112.529 114.055 94.844  1.00 23.78  ? 68  ASP B O     1 
ATOM   6233  C CB    . ASP D 4 53  ? 110.524 113.109 97.219  1.00 21.51  ? 68  ASP B CB    1 
ATOM   6234  C CG    . ASP D 4 53  ? 110.592 112.213 98.467  1.00 27.36  ? 68  ASP B CG    1 
ATOM   6235  O OD1   . ASP D 4 53  ? 111.575 112.329 99.227  1.00 22.59  ? 68  ASP B OD1   1 
ATOM   6236  O OD2   . ASP D 4 53  ? 109.661 111.393 98.679  1.00 27.38  ? 68  ASP B OD2   1 
ATOM   6237  N N     . ALA D 4 54  ? 111.038 115.619 95.395  1.00 21.68  ? 69  ALA B N     1 
ATOM   6238  C CA    . ALA D 4 54  ? 111.073 116.187 94.050  1.00 26.40  ? 69  ALA B CA    1 
ATOM   6239  C C     . ALA D 4 54  ? 112.523 116.589 93.691  1.00 24.98  ? 69  ALA B C     1 
ATOM   6240  O O     . ALA D 4 54  ? 113.010 116.279 92.608  1.00 23.14  ? 69  ALA B O     1 
ATOM   6241  C CB    . ALA D 4 54  ? 110.171 117.416 93.973  1.00 22.78  ? 69  ALA B CB    1 
ATOM   6242  N N     . VAL D 4 55  ? 113.181 117.290 94.613  1.00 26.90  ? 70  VAL B N     1 
ATOM   6243  C CA    . VAL D 4 55  ? 114.552 117.754 94.388  1.00 26.92  ? 70  VAL B CA    1 
ATOM   6244  C C     . VAL D 4 55  ? 115.503 116.569 94.269  1.00 30.07  ? 70  VAL B C     1 
ATOM   6245  O O     . VAL D 4 55  ? 116.481 116.625 93.508  1.00 29.77  ? 70  VAL B O     1 
ATOM   6246  C CB    . VAL D 4 55  ? 114.991 118.704 95.506  1.00 29.15  ? 70  VAL B CB    1 
ATOM   6247  C CG1   . VAL D 4 55  ? 116.489 119.106 95.322  1.00 30.71  ? 70  VAL B CG1   1 
ATOM   6248  C CG2   . VAL D 4 55  ? 114.089 119.968 95.450  1.00 28.51  ? 70  VAL B CG2   1 
ATOM   6249  N N     . THR D 4 56  ? 115.210 115.484 94.992  1.00 26.54  ? 71  THR B N     1 
ATOM   6250  C CA    . THR D 4 56  ? 116.037 114.300 94.871  1.00 25.60  ? 71  THR B CA    1 
ATOM   6251  C C     . THR D 4 56  ? 115.925 113.783 93.431  1.00 27.49  ? 71  THR B C     1 
ATOM   6252  O O     . THR D 4 56  ? 116.919 113.317 92.840  1.00 26.98  ? 71  THR B O     1 
ATOM   6253  C CB    . THR D 4 56  ? 115.592 113.253 95.899  1.00 27.91  ? 71  THR B CB    1 
ATOM   6254  O OG1   . THR D 4 56  ? 115.896 113.762 97.204  1.00 28.82  ? 71  THR B OG1   1 
ATOM   6255  C CG2   . THR D 4 56  ? 116.295 111.910 95.697  1.00 24.25  ? 71  THR B CG2   1 
ATOM   6256  N N     . TYR D 4 57  ? 114.737 113.870 92.829  1.00 25.54  ? 72  TYR B N     1 
ATOM   6257  C CA    . TYR D 4 57  ? 114.613 113.408 91.450  1.00 26.41  ? 72  TYR B CA    1 
ATOM   6258  C C     . TYR D 4 57  ? 115.320 114.424 90.519  1.00 29.16  ? 72  TYR B C     1 
ATOM   6259  O O     . TYR D 4 57  ? 115.944 114.043 89.529  1.00 29.15  ? 72  TYR B O     1 
ATOM   6260  C CB    . TYR D 4 57  ? 113.149 113.273 91.011  1.00 26.10  ? 72  TYR B CB    1 
ATOM   6261  C CG    . TYR D 4 57  ? 112.426 112.048 91.556  1.00 28.15  ? 72  TYR B CG    1 
ATOM   6262  C CD1   . TYR D 4 57  ? 112.802 110.752 91.158  1.00 27.97  ? 72  TYR B CD1   1 
ATOM   6263  C CD2   . TYR D 4 57  ? 111.344 112.188 92.434  1.00 25.52  ? 72  TYR B CD2   1 
ATOM   6264  C CE1   . TYR D 4 57  ? 112.126 109.635 91.623  1.00 26.17  ? 72  TYR B CE1   1 
ATOM   6265  C CE2   . TYR D 4 57  ? 110.655 111.077 92.894  1.00 27.40  ? 72  TYR B CE2   1 
ATOM   6266  C CZ    . TYR D 4 57  ? 111.054 109.808 92.489  1.00 25.41  ? 72  TYR B CZ    1 
ATOM   6267  O OH    . TYR D 4 57  ? 110.383 108.712 92.955  1.00 28.81  ? 72  TYR B OH    1 
ATOM   6268  N N     . THR D 4 58  ? 115.213 115.712 90.851  1.00 31.97  ? 73  THR B N     1 
ATOM   6269  C CA    . THR D 4 58  ? 115.848 116.770 90.051  1.00 32.84  ? 73  THR B CA    1 
ATOM   6270  C C     . THR D 4 58  ? 117.363 116.514 89.983  1.00 36.22  ? 73  THR B C     1 
ATOM   6271  O O     . THR D 4 58  ? 117.966 116.452 88.897  1.00 35.58  ? 73  THR B O     1 
ATOM   6272  C CB    . THR D 4 58  ? 115.617 118.150 90.687  1.00 31.61  ? 73  THR B CB    1 
ATOM   6273  O OG1   . THR D 4 58  ? 114.204 118.401 90.793  1.00 27.54  ? 73  THR B OG1   1 
ATOM   6274  C CG2   . THR D 4 58  ? 116.268 119.242 89.830  1.00 30.51  ? 73  THR B CG2   1 
ATOM   6275  N N     . GLU D 4 59  ? 117.970 116.340 91.148  1.00 34.77  ? 74  GLU B N     1 
ATOM   6276  C CA    . GLU D 4 59  ? 119.403 116.111 91.212  1.00 36.32  ? 74  GLU B CA    1 
ATOM   6277  C C     . GLU D 4 59  ? 119.821 114.822 90.531  1.00 36.89  ? 74  GLU B C     1 
ATOM   6278  O O     . GLU D 4 59  ? 120.845 114.785 89.846  1.00 33.78  ? 74  GLU B O     1 
ATOM   6279  C CB    . GLU D 4 59  ? 119.883 116.095 92.658  1.00 37.44  ? 74  GLU B CB    1 
ATOM   6280  C CG    . GLU D 4 59  ? 119.646 117.388 93.391  1.00 49.28  ? 74  GLU B CG    1 
ATOM   6281  C CD    . GLU D 4 59  ? 120.634 117.583 94.523  1.00 56.83  ? 74  GLU B CD    1 
ATOM   6282  O OE1   . GLU D 4 59  ? 121.839 117.775 94.232  1.00 62.17  ? 74  GLU B OE1   1 
ATOM   6283  O OE2   . GLU D 4 59  ? 120.214 117.541 95.695  1.00 58.23  ? 74  GLU B OE2   1 
ATOM   6284  N N     . HIS D 4 60  ? 119.048 113.753 90.718  1.00 33.06  ? 75  HIS B N     1 
ATOM   6285  C CA    . HIS D 4 60  ? 119.411 112.515 90.068  1.00 34.75  ? 75  HIS B CA    1 
ATOM   6286  C C     . HIS D 4 60  ? 119.453 112.698 88.543  1.00 35.92  ? 75  HIS B C     1 
ATOM   6287  O O     . HIS D 4 60  ? 120.210 112.026 87.856  1.00 36.87  ? 75  HIS B O     1 
ATOM   6288  C CB    . HIS D 4 60  ? 118.408 111.410 90.345  1.00 31.58  ? 75  HIS B CB    1 
ATOM   6289  C CG    . HIS D 4 60  ? 118.818 110.097 89.764  1.00 29.57  ? 75  HIS B CG    1 
ATOM   6290  N ND1   . HIS D 4 60  ? 119.685 109.244 90.410  1.00 33.33  ? 75  HIS B ND1   1 
ATOM   6291  C CD2   . HIS D 4 60  ? 118.573 109.537 88.559  1.00 31.16  ? 75  HIS B CD2   1 
ATOM   6292  C CE1   . HIS D 4 60  ? 119.964 108.219 89.626  1.00 30.03  ? 75  HIS B CE1   1 
ATOM   6293  N NE2   . HIS D 4 60  ? 119.303 108.370 88.497  1.00 31.03  ? 75  HIS B NE2   1 
ATOM   6294  N N     . ALA D 4 61  ? 118.599 113.570 88.024  1.00 34.12  ? 76  ALA B N     1 
ATOM   6295  C CA    . ALA D 4 61  ? 118.531 113.791 86.585  1.00 38.05  ? 76  ALA B CA    1 
ATOM   6296  C C     . ALA D 4 61  ? 119.587 114.796 86.148  1.00 39.12  ? 76  ALA B C     1 
ATOM   6297  O O     . ALA D 4 61  ? 119.643 115.168 84.982  1.00 37.97  ? 76  ALA B O     1 
ATOM   6298  C CB    . ALA D 4 61  ? 117.131 114.300 86.191  1.00 35.31  ? 76  ALA B CB    1 
ATOM   6299  N N     . LYS D 4 62  ? 120.390 115.258 87.097  1.00 37.58  ? 77  LYS B N     1 
ATOM   6300  C CA    . LYS D 4 62  ? 121.437 116.226 86.796  1.00 42.46  ? 77  LYS B CA    1 
ATOM   6301  C C     . LYS D 4 62  ? 120.849 117.533 86.273  1.00 41.34  ? 77  LYS B C     1 
ATOM   6302  O O     . LYS D 4 62  ? 121.431 118.169 85.401  1.00 40.61  ? 77  LYS B O     1 
ATOM   6303  C CB    . LYS D 4 62  ? 122.406 115.640 85.757  1.00 43.11  ? 77  LYS B CB    1 
ATOM   6304  C CG    . LYS D 4 62  ? 123.094 114.354 86.198  1.00 48.93  ? 77  LYS B CG    1 
ATOM   6305  C CD    . LYS D 4 62  ? 123.791 113.670 85.021  1.00 54.57  ? 77  LYS B CD    1 
ATOM   6306  C CE    . LYS D 4 62  ? 124.515 112.392 85.450  1.00 57.67  ? 77  LYS B CE    1 
ATOM   6307  N NZ    . LYS D 4 62  ? 125.172 111.702 84.287  1.00 58.08  ? 77  LYS B NZ    1 
ATOM   6308  N N     . ARG D 4 63  ? 119.696 117.934 86.804  1.00 37.66  ? 78  ARG B N     1 
ATOM   6309  C CA    . ARG D 4 63  ? 119.079 119.171 86.372  1.00 36.52  ? 78  ARG B CA    1 
ATOM   6310  C C     . ARG D 4 63  ? 119.155 120.226 87.450  1.00 36.69  ? 78  ARG B C     1 
ATOM   6311  O O     . ARG D 4 63  ? 119.472 119.949 88.601  1.00 35.91  ? 78  ARG B O     1 
ATOM   6312  C CB    . ARG D 4 63  ? 117.609 118.955 85.968  1.00 37.99  ? 78  ARG B CB    1 
ATOM   6313  C CG    . ARG D 4 63  ? 117.407 118.216 84.637  1.00 36.98  ? 78  ARG B CG    1 
ATOM   6314  C CD    . ARG D 4 63  ? 115.922 118.129 84.229  1.00 35.26  ? 78  ARG B CD    1 
ATOM   6315  N NE    . ARG D 4 63  ? 115.246 116.898 84.658  1.00 37.19  ? 78  ARG B NE    1 
ATOM   6316  C CZ    . ARG D 4 63  ? 114.509 116.768 85.767  1.00 37.45  ? 78  ARG B CZ    1 
ATOM   6317  N NH1   . ARG D 4 63  ? 114.325 117.796 86.601  1.00 29.46  ? 78  ARG B NH1   1 
ATOM   6318  N NH2   . ARG D 4 63  ? 113.933 115.599 86.039  1.00 33.77  ? 78  ARG B NH2   1 
ATOM   6319  N N     . LYS D 4 64  ? 118.878 121.458 87.059  1.00 35.86  ? 79  LYS B N     1 
ATOM   6320  C CA    . LYS D 4 64  ? 118.886 122.561 87.991  1.00 35.32  ? 79  LYS B CA    1 
ATOM   6321  C C     . LYS D 4 64  ? 117.464 123.085 88.086  1.00 33.88  ? 79  LYS B C     1 
ATOM   6322  O O     . LYS D 4 64  ? 117.196 124.006 88.844  1.00 36.40  ? 79  LYS B O     1 
ATOM   6323  C CB    . LYS D 4 64  ? 119.814 123.664 87.487  1.00 42.32  ? 79  LYS B CB    1 
ATOM   6324  C CG    . LYS D 4 64  ? 121.257 123.209 87.254  1.00 47.16  ? 79  LYS B CG    1 
ATOM   6325  C CD    . LYS D 4 64  ? 122.175 124.397 87.005  1.00 52.05  ? 79  LYS B CD    1 
ATOM   6326  C CE    . LYS D 4 64  ? 123.546 123.932 86.516  1.00 58.33  ? 79  LYS B CE    1 
ATOM   6327  N NZ    . LYS D 4 64  ? 124.550 125.055 86.460  1.00 63.12  ? 79  LYS B NZ    1 
ATOM   6328  N N     . THR D 4 65  ? 116.568 122.495 87.301  1.00 28.39  ? 80  THR B N     1 
ATOM   6329  C CA    . THR D 4 65  ? 115.168 122.892 87.272  1.00 32.85  ? 80  THR B CA    1 
ATOM   6330  C C     . THR D 4 65  ? 114.221 121.765 87.736  1.00 31.58  ? 80  THR B C     1 
ATOM   6331  O O     . THR D 4 65  ? 114.207 120.678 87.155  1.00 31.15  ? 80  THR B O     1 
ATOM   6332  C CB    . THR D 4 65  ? 114.714 123.278 85.839  1.00 34.96  ? 80  THR B CB    1 
ATOM   6333  O OG1   . THR D 4 65  ? 115.589 124.275 85.307  1.00 41.96  ? 80  THR B OG1   1 
ATOM   6334  C CG2   . THR D 4 65  ? 113.279 123.816 85.839  1.00 33.17  ? 80  THR B CG2   1 
ATOM   6335  N N     . VAL D 4 66  ? 113.442 122.035 88.781  1.00 32.46  ? 81  VAL B N     1 
ATOM   6336  C CA    . VAL D 4 66  ? 112.443 121.084 89.280  1.00 29.25  ? 81  VAL B CA    1 
ATOM   6337  C C     . VAL D 4 66  ? 111.282 121.063 88.285  1.00 30.10  ? 81  VAL B C     1 
ATOM   6338  O O     . VAL D 4 66  ? 110.645 122.086 88.030  1.00 31.69  ? 81  VAL B O     1 
ATOM   6339  C CB    . VAL D 4 66  ? 111.886 121.519 90.648  1.00 29.94  ? 81  VAL B CB    1 
ATOM   6340  C CG1   . VAL D 4 66  ? 110.752 120.559 91.084  1.00 29.00  ? 81  VAL B CG1   1 
ATOM   6341  C CG2   . VAL D 4 66  ? 113.014 121.500 91.683  1.00 28.65  ? 81  VAL B CG2   1 
ATOM   6342  N N     . THR D 4 67  ? 111.000 119.908 87.708  1.00 28.00  ? 82  THR B N     1 
ATOM   6343  C CA    . THR D 4 67  ? 109.920 119.826 86.729  1.00 30.90  ? 82  THR B CA    1 
ATOM   6344  C C     . THR D 4 67  ? 108.648 119.308 87.368  1.00 31.93  ? 82  THR B C     1 
ATOM   6345  O O     . THR D 4 67  ? 108.686 118.747 88.466  1.00 27.57  ? 82  THR B O     1 
ATOM   6346  C CB    . THR D 4 67  ? 110.261 118.858 85.617  1.00 30.59  ? 82  THR B CB    1 
ATOM   6347  O OG1   . THR D 4 67  ? 110.454 117.558 86.192  1.00 30.59  ? 82  THR B OG1   1 
ATOM   6348  C CG2   . THR D 4 67  ? 111.565 119.268 84.906  1.00 32.68  ? 82  THR B CG2   1 
ATOM   6349  N N     . ALA D 4 68  ? 107.538 119.492 86.660  1.00 31.45  ? 83  ALA B N     1 
ATOM   6350  C CA    . ALA D 4 68  ? 106.239 119.021 87.126  1.00 30.06  ? 83  ALA B CA    1 
ATOM   6351  C C     . ALA D 4 68  ? 106.354 117.525 87.373  1.00 30.23  ? 83  ALA B C     1 
ATOM   6352  O O     . ALA D 4 68  ? 105.790 117.027 88.339  1.00 32.44  ? 83  ALA B O     1 
ATOM   6353  C CB    . ALA D 4 68  ? 105.129 119.281 86.052  1.00 31.00  ? 83  ALA B CB    1 
ATOM   6354  N N     . MET D 4 69  ? 107.064 116.817 86.493  1.00 27.81  ? 84  MET B N     1 
ATOM   6355  C CA    . MET D 4 69  ? 107.211 115.381 86.638  1.00 28.48  ? 84  MET B CA    1 
ATOM   6356  C C     . MET D 4 69  ? 107.952 115.019 87.921  1.00 30.63  ? 84  MET B C     1 
ATOM   6357  O O     . MET D 4 69  ? 107.594 114.024 88.583  1.00 28.95  ? 84  MET B O     1 
ATOM   6358  C CB    . MET D 4 69  ? 107.912 114.759 85.427  1.00 32.11  ? 84  MET B CB    1 
ATOM   6359  C CG    . MET D 4 69  ? 107.016 114.610 84.180  1.00 39.61  ? 84  MET B CG    1 
ATOM   6360  S SD    . MET D 4 69  ? 105.314 113.969 84.446  1.00 43.62  ? 84  MET B SD    1 
ATOM   6361  C CE    . MET D 4 69  ? 105.579 112.202 84.863  1.00 46.08  ? 84  MET B CE    1 
ATOM   6362  N N     . ASP D 4 70  ? 108.972 115.802 88.281  1.00 24.21  ? 85  ASP B N     1 
ATOM   6363  C CA    . ASP D 4 70  ? 109.672 115.544 89.533  1.00 28.33  ? 85  ASP B CA    1 
ATOM   6364  C C     . ASP D 4 70  ? 108.605 115.653 90.650  1.00 27.65  ? 85  ASP B C     1 
ATOM   6365  O O     . ASP D 4 70  ? 108.588 114.874 91.580  1.00 27.82  ? 85  ASP B O     1 
ATOM   6366  C CB    . ASP D 4 70  ? 110.752 116.593 89.846  1.00 24.09  ? 85  ASP B CB    1 
ATOM   6367  C CG    . ASP D 4 70  ? 111.935 116.569 88.867  1.00 28.02  ? 85  ASP B CG    1 
ATOM   6368  O OD1   . ASP D 4 70  ? 112.210 115.514 88.276  1.00 29.31  ? 85  ASP B OD1   1 
ATOM   6369  O OD2   . ASP D 4 70  ? 112.616 117.616 88.732  1.00 31.66  ? 85  ASP B OD2   1 
ATOM   6370  N N     . VAL D 4 71  ? 107.747 116.654 90.574  1.00 24.14  ? 86  VAL B N     1 
ATOM   6371  C CA    . VAL D 4 71  ? 106.721 116.810 91.611  1.00 25.81  ? 86  VAL B CA    1 
ATOM   6372  C C     . VAL D 4 71  ? 105.690 115.654 91.591  1.00 26.64  ? 86  VAL B C     1 
ATOM   6373  O O     . VAL D 4 71  ? 105.354 115.097 92.625  1.00 27.69  ? 86  VAL B O     1 
ATOM   6374  C CB    . VAL D 4 71  ? 106.028 118.165 91.457  1.00 25.43  ? 86  VAL B CB    1 
ATOM   6375  C CG1   . VAL D 4 71  ? 104.849 118.283 92.409  1.00 25.00  ? 86  VAL B CG1   1 
ATOM   6376  C CG2   . VAL D 4 71  ? 107.042 119.272 91.788  1.00 24.59  ? 86  VAL B CG2   1 
ATOM   6377  N N     . VAL D 4 72  ? 105.225 115.277 90.405  1.00 28.01  ? 87  VAL B N     1 
ATOM   6378  C CA    . VAL D 4 72  ? 104.269 114.184 90.248  1.00 24.38  ? 87  VAL B CA    1 
ATOM   6379  C C     . VAL D 4 72  ? 104.807 112.868 90.803  1.00 25.87  ? 87  VAL B C     1 
ATOM   6380  O O     . VAL D 4 72  ? 104.069 112.099 91.439  1.00 26.62  ? 87  VAL B O     1 
ATOM   6381  C CB    . VAL D 4 72  ? 103.946 113.995 88.754  1.00 23.94  ? 87  VAL B CB    1 
ATOM   6382  C CG1   . VAL D 4 72  ? 103.088 112.707 88.516  1.00 24.49  ? 87  VAL B CG1   1 
ATOM   6383  C CG2   . VAL D 4 72  ? 103.218 115.222 88.282  1.00 23.39  ? 87  VAL B CG2   1 
ATOM   6384  N N     . TYR D 4 73  ? 106.087 112.605 90.560  1.00 26.24  ? 88  TYR B N     1 
ATOM   6385  C CA    . TYR D 4 73  ? 106.697 111.381 91.023  1.00 27.94  ? 88  TYR B CA    1 
ATOM   6386  C C     . TYR D 4 73  ? 106.840 111.471 92.529  1.00 26.57  ? 88  TYR B C     1 
ATOM   6387  O O     . TYR D 4 73  ? 106.660 110.492 93.223  1.00 25.13  ? 88  TYR B O     1 
ATOM   6388  C CB    . TYR D 4 73  ? 108.087 111.190 90.399  1.00 30.79  ? 88  TYR B CB    1 
ATOM   6389  C CG    . TYR D 4 73  ? 108.084 110.981 88.894  1.00 31.85  ? 88  TYR B CG    1 
ATOM   6390  C CD1   . TYR D 4 73  ? 107.120 110.185 88.281  1.00 32.86  ? 88  TYR B CD1   1 
ATOM   6391  C CD2   . TYR D 4 73  ? 109.070 111.547 88.100  1.00 32.19  ? 88  TYR B CD2   1 
ATOM   6392  C CE1   . TYR D 4 73  ? 107.141 109.957 86.908  1.00 36.84  ? 88  TYR B CE1   1 
ATOM   6393  C CE2   . TYR D 4 73  ? 109.105 111.331 86.731  1.00 34.91  ? 88  TYR B CE2   1 
ATOM   6394  C CZ    . TYR D 4 73  ? 108.144 110.539 86.139  1.00 38.17  ? 88  TYR B CZ    1 
ATOM   6395  O OH    . TYR D 4 73  ? 108.189 110.337 84.776  1.00 43.05  ? 88  TYR B OH    1 
ATOM   6396  N N     . ALA D 4 74  ? 107.173 112.655 93.030  1.00 24.42  ? 89  ALA B N     1 
ATOM   6397  C CA    . ALA D 4 74  ? 107.326 112.827 94.474  1.00 25.11  ? 89  ALA B CA    1 
ATOM   6398  C C     . ALA D 4 74  ? 105.985 112.597 95.151  1.00 25.12  ? 89  ALA B C     1 
ATOM   6399  O O     . ALA D 4 74  ? 105.899 111.889 96.145  1.00 23.48  ? 89  ALA B O     1 
ATOM   6400  C CB    . ALA D 4 74  ? 107.819 114.224 94.790  1.00 22.69  ? 89  ALA B CB    1 
ATOM   6401  N N     . LEU D 4 75  ? 104.942 113.215 94.621  1.00 23.22  ? 90  LEU B N     1 
ATOM   6402  C CA    . LEU D 4 75  ? 103.601 113.059 95.220  1.00 24.86  ? 90  LEU B CA    1 
ATOM   6403  C C     . LEU D 4 75  ? 103.152 111.607 95.174  1.00 24.76  ? 90  LEU B C     1 
ATOM   6404  O O     . LEU D 4 75  ? 102.604 111.062 96.147  1.00 27.23  ? 90  LEU B O     1 
ATOM   6405  C CB    . LEU D 4 75  ? 102.590 113.943 94.484  1.00 22.75  ? 90  LEU B CB    1 
ATOM   6406  C CG    . LEU D 4 75  ? 102.799 115.438 94.767  1.00 23.79  ? 90  LEU B CG    1 
ATOM   6407  C CD1   . LEU D 4 75  ? 102.079 116.241 93.710  1.00 23.62  ? 90  LEU B CD1   1 
ATOM   6408  C CD2   . LEU D 4 75  ? 102.292 115.823 96.204  1.00 22.31  ? 90  LEU B CD2   1 
ATOM   6409  N N     . LYS D 4 76  ? 103.413 110.959 94.049  1.00 26.07  ? 91  LYS B N     1 
ATOM   6410  C CA    . LYS D 4 76  ? 103.022 109.572 93.912  1.00 25.99  ? 91  LYS B CA    1 
ATOM   6411  C C     . LYS D 4 76  ? 103.692 108.665 94.936  1.00 29.73  ? 91  LYS B C     1 
ATOM   6412  O O     . LYS D 4 76  ? 103.007 107.816 95.536  1.00 26.08  ? 91  LYS B O     1 
ATOM   6413  C CB    . LYS D 4 76  ? 103.304 109.045 92.503  1.00 28.11  ? 91  LYS B CB    1 
ATOM   6414  C CG    . LYS D 4 76  ? 103.067 107.554 92.403  1.00 32.43  ? 91  LYS B CG    1 
ATOM   6415  C CD    . LYS D 4 76  ? 102.486 107.118 91.066  1.00 47.71  ? 91  LYS B CD    1 
ATOM   6416  C CE    . LYS D 4 76  ? 103.375 107.420 89.879  1.00 48.38  ? 91  LYS B CE    1 
ATOM   6417  N NZ    . LYS D 4 76  ? 102.833 106.729 88.671  1.00 48.07  ? 91  LYS B NZ    1 
ATOM   6418  N N     . ARG D 4 77  ? 105.004 108.823 95.157  1.00 24.88  ? 92  ARG B N     1 
ATOM   6419  C CA    . ARG D 4 77  ? 105.637 107.931 96.117  1.00 28.46  ? 92  ARG B CA    1 
ATOM   6420  C C     . ARG D 4 77  ? 105.196 108.251 97.526  1.00 30.51  ? 92  ARG B C     1 
ATOM   6421  O O     . ARG D 4 77  ? 105.313 107.408 98.411  1.00 30.16  ? 92  ARG B O     1 
ATOM   6422  C CB    . ARG D 4 77  ? 107.183 107.917 96.012  1.00 29.64  ? 92  ARG B CB    1 
ATOM   6423  C CG    . ARG D 4 77  ? 107.914 109.212 96.346  1.00 30.43  ? 92  ARG B CG    1 
ATOM   6424  C CD    . ARG D 4 77  ? 109.438 108.990 96.203  1.00 29.19  ? 92  ARG B CD    1 
ATOM   6425  N NE    . ARG D 4 77  ? 109.821 107.769 96.913  1.00 28.31  ? 92  ARG B NE    1 
ATOM   6426  C CZ    . ARG D 4 77  ? 109.845 107.658 98.243  1.00 33.03  ? 92  ARG B CZ    1 
ATOM   6427  N NH1   . ARG D 4 77  ? 109.542 108.695 99.019  1.00 29.37  ? 92  ARG B NH1   1 
ATOM   6428  N NH2   . ARG D 4 77  ? 110.087 106.483 98.807  1.00 32.40  ? 92  ARG B NH2   1 
ATOM   6429  N N     . GLN D 4 78  ? 104.674 109.453 97.743  1.00 27.28  ? 93  GLN B N     1 
ATOM   6430  C CA    . GLN D 4 78  ? 104.188 109.813 99.081  1.00 28.35  ? 93  GLN B CA    1 
ATOM   6431  C C     . GLN D 4 78  ? 102.705 109.402 99.245  1.00 26.02  ? 93  GLN B C     1 
ATOM   6432  O O     . GLN D 4 78  ? 102.074 109.765 100.212 1.00 29.46  ? 93  GLN B O     1 
ATOM   6433  C CB    . GLN D 4 78  ? 104.300 111.332 99.305  1.00 33.33  ? 93  GLN B CB    1 
ATOM   6434  C CG    . GLN D 4 78  ? 105.715 111.928 99.344  1.00 40.62  ? 93  GLN B CG    1 
ATOM   6435  C CD    . GLN D 4 78  ? 106.386 111.796 100.704 1.00 43.32  ? 93  GLN B CD    1 
ATOM   6436  O OE1   . GLN D 4 78  ? 105.741 111.939 101.741 1.00 45.23  ? 93  GLN B OE1   1 
ATOM   6437  N NE2   . GLN D 4 78  ? 107.688 111.547 100.704 1.00 41.23  ? 93  GLN B NE2   1 
ATOM   6438  N N     . GLY D 4 79  ? 102.151 108.689 98.279  1.00 27.87  ? 94  GLY B N     1 
ATOM   6439  C CA    . GLY D 4 79  ? 100.765 108.251 98.337  1.00 27.19  ? 94  GLY B CA    1 
ATOM   6440  C C     . GLY D 4 79  ? 99.788  109.392 98.103  1.00 29.93  ? 94  GLY B C     1 
ATOM   6441  O O     . GLY D 4 79  ? 98.664  109.342 98.588  1.00 28.57  ? 94  GLY B O     1 
ATOM   6442  N N     . ARG D 4 80  ? 100.216 110.422 97.368  1.00 26.68  ? 95  ARG B N     1 
ATOM   6443  C CA    . ARG D 4 80  ? 99.389  111.585 97.084  1.00 25.72  ? 95  ARG B CA    1 
ATOM   6444  C C     . ARG D 4 80  ? 99.281  111.819 95.557  1.00 25.47  ? 95  ARG B C     1 
ATOM   6445  O O     . ARG D 4 80  ? 99.376  112.956 95.091  1.00 27.70  ? 95  ARG B O     1 
ATOM   6446  C CB    . ARG D 4 80  ? 99.988  112.838 97.729  1.00 29.44  ? 95  ARG B CB    1 
ATOM   6447  C CG    . ARG D 4 80  ? 100.225 112.854 99.273  1.00 31.18  ? 95  ARG B CG    1 
ATOM   6448  C CD    . ARG D 4 80  ? 99.002  113.025 100.147 1.00 34.37  ? 95  ARG B CD    1 
ATOM   6449  N NE    . ARG D 4 80  ? 98.003  113.931 99.584  1.00 41.14  ? 95  ARG B NE    1 
ATOM   6450  C CZ    . ARG D 4 80  ? 96.752  114.027 100.030 1.00 37.52  ? 95  ARG B CZ    1 
ATOM   6451  N NH1   . ARG D 4 80  ? 96.345  113.276 101.050 1.00 42.02  ? 95  ARG B NH1   1 
ATOM   6452  N NH2   . ARG D 4 80  ? 95.900  114.858 99.449  1.00 40.14  ? 95  ARG B NH2   1 
ATOM   6453  N N     . THR D 4 81  ? 99.075  110.745 94.806  1.00 24.94  ? 96  THR B N     1 
ATOM   6454  C CA    . THR D 4 81  ? 98.955  110.775 93.349  1.00 26.42  ? 96  THR B CA    1 
ATOM   6455  C C     . THR D 4 81  ? 98.134  111.945 92.827  1.00 28.73  ? 96  THR B C     1 
ATOM   6456  O O     . THR D 4 81  ? 96.976  112.183 93.234  1.00 26.76  ? 96  THR B O     1 
ATOM   6457  C CB    . THR D 4 81  ? 98.309  109.503 92.808  1.00 28.27  ? 96  THR B CB    1 
ATOM   6458  O OG1   . THR D 4 81  ? 99.152  108.385 93.102  1.00 27.25  ? 96  THR B OG1   1 
ATOM   6459  C CG2   . THR D 4 81  ? 98.147  109.600 91.286  1.00 30.60  ? 96  THR B CG2   1 
ATOM   6460  N N     . LEU D 4 82  ? 98.726  112.678 91.906  1.00 22.61  ? 97  LEU B N     1 
ATOM   6461  C CA    . LEU D 4 82  ? 98.029  113.820 91.380  1.00 21.20  ? 97  LEU B CA    1 
ATOM   6462  C C     . LEU D 4 82  ? 97.841  113.663 89.874  1.00 23.61  ? 97  LEU B C     1 
ATOM   6463  O O     . LEU D 4 82  ? 98.805  113.380 89.172  1.00 24.08  ? 97  LEU B O     1 
ATOM   6464  C CB    . LEU D 4 82  ? 98.869  115.068 91.659  1.00 22.05  ? 97  LEU B CB    1 
ATOM   6465  C CG    . LEU D 4 82  ? 98.377  116.378 91.038  1.00 24.10  ? 97  LEU B CG    1 
ATOM   6466  C CD1   . LEU D 4 82  ? 97.134  116.857 91.725  1.00 20.44  ? 97  LEU B CD1   1 
ATOM   6467  C CD2   . LEU D 4 82  ? 99.493  117.432 91.188  1.00 25.79  ? 97  LEU B CD2   1 
ATOM   6468  N N     . TYR D 4 83  ? 96.616  113.872 89.393  1.00 24.78  ? 98  TYR B N     1 
ATOM   6469  C CA    . TYR D 4 83  ? 96.328  113.797 87.958  1.00 25.17  ? 98  TYR B CA    1 
ATOM   6470  C C     . TYR D 4 83  ? 96.279  115.232 87.377  1.00 26.31  ? 98  TYR B C     1 
ATOM   6471  O O     . TYR D 4 83  ? 95.873  116.176 88.048  1.00 24.33  ? 98  TYR B O     1 
ATOM   6472  C CB    . TYR D 4 83  ? 94.955  113.152 87.684  1.00 24.39  ? 98  TYR B CB    1 
ATOM   6473  C CG    . TYR D 4 83  ? 94.800  111.652 87.891  1.00 23.15  ? 98  TYR B CG    1 
ATOM   6474  C CD1   . TYR D 4 83  ? 95.869  110.843 88.250  1.00 26.50  ? 98  TYR B CD1   1 
ATOM   6475  C CD2   . TYR D 4 83  ? 93.564  111.048 87.702  1.00 22.64  ? 98  TYR B CD2   1 
ATOM   6476  C CE1   . TYR D 4 83  ? 95.702  109.446 88.407  1.00 24.96  ? 98  TYR B CE1   1 
ATOM   6477  C CE2   . TYR D 4 83  ? 93.393  109.681 87.859  1.00 27.78  ? 98  TYR B CE2   1 
ATOM   6478  C CZ    . TYR D 4 83  ? 94.462  108.890 88.208  1.00 26.27  ? 98  TYR B CZ    1 
ATOM   6479  O OH    . TYR D 4 83  ? 94.250  107.542 88.359  1.00 30.20  ? 98  TYR B OH    1 
ATOM   6480  N N     . GLY D 4 84  ? 96.681  115.372 86.122  1.00 28.52  ? 99  GLY B N     1 
ATOM   6481  C CA    . GLY D 4 84  ? 96.625  116.649 85.457  1.00 32.21  ? 99  GLY B CA    1 
ATOM   6482  C C     . GLY D 4 84  ? 97.942  117.303 85.093  1.00 36.34  ? 99  GLY B C     1 
ATOM   6483  O O     . GLY D 4 84  ? 97.939  118.280 84.350  1.00 35.51  ? 99  GLY B O     1 
ATOM   6484  N N     . PHE D 4 85  ? 99.062  116.777 85.577  1.00 35.21  ? 100 PHE B N     1 
ATOM   6485  C CA    . PHE D 4 85  ? 100.336 117.416 85.287  1.00 34.42  ? 100 PHE B CA    1 
ATOM   6486  C C     . PHE D 4 85  ? 101.356 116.506 84.614  1.00 35.90  ? 100 PHE B C     1 
ATOM   6487  O O     . PHE D 4 85  ? 102.539 116.757 84.691  1.00 35.73  ? 100 PHE B O     1 
ATOM   6488  C CB    . PHE D 4 85  ? 100.932 118.024 86.571  1.00 31.18  ? 100 PHE B CB    1 
ATOM   6489  C CG    . PHE D 4 85  ? 100.153 119.201 87.111  1.00 31.58  ? 100 PHE B CG    1 
ATOM   6490  C CD1   . PHE D 4 85  ? 99.034  119.014 87.915  1.00 30.43  ? 100 PHE B CD1   1 
ATOM   6491  C CD2   . PHE D 4 85  ? 100.501 120.497 86.750  1.00 31.38  ? 100 PHE B CD2   1 
ATOM   6492  C CE1   . PHE D 4 85  ? 98.275  120.086 88.340  1.00 31.22  ? 100 PHE B CE1   1 
ATOM   6493  C CE2   . PHE D 4 85  ? 99.749  121.588 87.170  1.00 33.67  ? 100 PHE B CE2   1 
ATOM   6494  C CZ    . PHE D 4 85  ? 98.630  121.386 87.966  1.00 35.27  ? 100 PHE B CZ    1 
ATOM   6495  N N     . GLY D 4 86  ? 100.889 115.481 83.913  1.00 37.10  ? 101 GLY B N     1 
ATOM   6496  C CA    . GLY D 4 86  ? 101.816 114.580 83.252  1.00 41.39  ? 101 GLY B CA    1 
ATOM   6497  C C     . GLY D 4 86  ? 101.927 113.289 84.037  1.00 46.25  ? 101 GLY B C     1 
ATOM   6498  O O     . GLY D 4 86  ? 101.484 113.229 85.190  1.00 46.18  ? 101 GLY B O     1 
ATOM   6499  N N     . GLY D 4 87  ? 102.509 112.262 83.416  1.00 48.42  ? 102 GLY B N     1 
ATOM   6500  C CA    . GLY D 4 87  ? 102.666 110.978 84.072  1.00 49.77  ? 102 GLY B CA    1 
ATOM   6501  C C     . GLY D 4 87  ? 101.437 110.113 83.878  1.00 52.45  ? 102 GLY B C     1 
ATOM   6502  O O     . GLY D 4 87  ? 101.429 108.956 84.369  1.00 53.99  ? 102 GLY B O     1 
ATOM   6503  O OXT   . GLY D 4 87  ? 100.479 110.595 83.236  1.00 52.55  ? 102 GLY B OXT   1 
ATOM   6504  N N     . ALA E 5 1   ? 140.944 82.597  94.052  1.00 68.45  ? 14  ALA C N     1 
ATOM   6505  C CA    . ALA E 5 1   ? 139.783 83.468  93.704  1.00 69.26  ? 14  ALA C CA    1 
ATOM   6506  C C     . ALA E 5 1   ? 139.267 84.205  94.933  1.00 68.25  ? 14  ALA C C     1 
ATOM   6507  O O     . ALA E 5 1   ? 139.679 83.929  96.063  1.00 70.22  ? 14  ALA C O     1 
ATOM   6508  C CB    . ALA E 5 1   ? 138.656 82.627  93.099  1.00 66.91  ? 14  ALA C CB    1 
ATOM   6509  N N     . LYS E 5 2   ? 138.363 85.147  94.703  1.00 65.04  ? 15  LYS C N     1 
ATOM   6510  C CA    . LYS E 5 2   ? 137.763 85.910  95.787  1.00 62.85  ? 15  LYS C CA    1 
ATOM   6511  C C     . LYS E 5 2   ? 136.349 86.351  95.432  1.00 57.95  ? 15  LYS C C     1 
ATOM   6512  O O     . LYS E 5 2   ? 136.064 86.720  94.293  1.00 56.19  ? 15  LYS C O     1 
ATOM   6513  C CB    . LYS E 5 2   ? 138.633 87.119  96.144  1.00 65.20  ? 15  LYS C CB    1 
ATOM   6514  C CG    . LYS E 5 2   ? 139.800 86.747  97.042  1.00 70.18  ? 15  LYS C CG    1 
ATOM   6515  C CD    . LYS E 5 2   ? 140.666 87.937  97.407  1.00 73.89  ? 15  LYS C CD    1 
ATOM   6516  C CE    . LYS E 5 2   ? 141.803 87.495  98.324  1.00 76.14  ? 15  LYS C CE    1 
ATOM   6517  N NZ    . LYS E 5 2   ? 142.849 88.544  98.493  1.00 78.45  ? 15  LYS C NZ    1 
ATOM   6518  N N     . THR E 5 3   ? 135.469 86.292  96.422  1.00 52.97  ? 16  THR C N     1 
ATOM   6519  C CA    . THR E 5 3   ? 134.075 86.673  96.231  1.00 47.09  ? 16  THR C CA    1 
ATOM   6520  C C     . THR E 5 3   ? 133.966 88.169  96.017  1.00 41.17  ? 16  THR C C     1 
ATOM   6521  O O     . THR E 5 3   ? 134.815 88.951  96.459  1.00 37.09  ? 16  THR C O     1 
ATOM   6522  C CB    . THR E 5 3   ? 133.221 86.332  97.462  1.00 49.43  ? 16  THR C CB    1 
ATOM   6523  O OG1   . THR E 5 3   ? 133.717 87.064  98.592  1.00 46.75  ? 16  THR C OG1   1 
ATOM   6524  C CG2   . THR E 5 3   ? 133.248 84.838  97.751  1.00 47.95  ? 16  THR C CG2   1 
ATOM   6525  N N     . ARG E 5 4   ? 132.911 88.581  95.337  1.00 39.14  ? 17  ARG C N     1 
ATOM   6526  C CA    . ARG E 5 4   ? 132.729 90.008  95.134  1.00 36.56  ? 17  ARG C CA    1 
ATOM   6527  C C     . ARG E 5 4   ? 132.446 90.636  96.518  1.00 32.36  ? 17  ARG C C     1 
ATOM   6528  O O     . ARG E 5 4   ? 132.718 91.803  96.754  1.00 32.25  ? 17  ARG C O     1 
ATOM   6529  C CB    . ARG E 5 4   ? 131.576 90.244  94.155  1.00 41.41  ? 17  ARG C CB    1 
ATOM   6530  C CG    . ARG E 5 4   ? 131.889 89.796  92.744  1.00 43.11  ? 17  ARG C CG    1 
ATOM   6531  C CD    . ARG E 5 4   ? 130.951 90.466  91.744  1.00 43.82  ? 17  ARG C CD    1 
ATOM   6532  N NE    . ARG E 5 4   ? 129.844 89.583  91.434  1.00 45.66  ? 17  ARG C NE    1 
ATOM   6533  C CZ    . ARG E 5 4   ? 128.718 89.972  90.851  1.00 44.58  ? 17  ARG C CZ    1 
ATOM   6534  N NH1   . ARG E 5 4   ? 128.547 91.234  90.523  1.00 40.63  ? 17  ARG C NH1   1 
ATOM   6535  N NH2   . ARG E 5 4   ? 127.780 89.085  90.591  1.00 46.14  ? 17  ARG C NH2   1 
ATOM   6536  N N     . SER E 5 5   ? 131.913 89.844  97.430  1.00 30.63  ? 18  SER C N     1 
ATOM   6537  C CA    . SER E 5 5   ? 131.645 90.356  98.771  1.00 33.52  ? 18  SER C CA    1 
ATOM   6538  C C     . SER E 5 5   ? 132.990 90.688  99.456  1.00 34.21  ? 18  SER C C     1 
ATOM   6539  O O     . SER E 5 5   ? 133.128 91.756  100.063 1.00 33.03  ? 18  SER C O     1 
ATOM   6540  C CB    . SER E 5 5   ? 130.865 89.325  99.594  1.00 30.82  ? 18  SER C CB    1 
ATOM   6541  O OG    . SER E 5 5   ? 129.499 89.258  99.190  1.00 34.11  ? 18  SER C OG    1 
ATOM   6542  N N     . SER E 5 6   ? 133.982 89.798  99.345  1.00 33.63  ? 19  SER C N     1 
ATOM   6543  C CA    . SER E 5 6   ? 135.275 90.091  99.968  1.00 37.29  ? 19  SER C CA    1 
ATOM   6544  C C     . SER E 5 6   ? 135.936 91.311  99.327  1.00 34.91  ? 19  SER C C     1 
ATOM   6545  O O     . SER E 5 6   ? 136.415 92.190  100.029 1.00 36.00  ? 19  SER C O     1 
ATOM   6546  C CB    . SER E 5 6   ? 136.207 88.863  99.947  1.00 38.99  ? 19  SER C CB    1 
ATOM   6547  O OG    . SER E 5 6   ? 136.304 88.300  98.663  1.00 48.03  ? 19  SER C OG    1 
ATOM   6548  N N     . ARG E 5 7   ? 135.924 91.404  98.001  1.00 35.93  ? 20  ARG C N     1 
ATOM   6549  C CA    . ARG E 5 7   ? 136.498 92.578  97.337  1.00 36.04  ? 20  ARG C CA    1 
ATOM   6550  C C     . ARG E 5 7   ? 135.825 93.865  97.790  1.00 35.55  ? 20  ARG C C     1 
ATOM   6551  O O     . ARG E 5 7   ? 136.439 94.936  97.798  1.00 35.56  ? 20  ARG C O     1 
ATOM   6552  C CB    . ARG E 5 7   ? 136.337 92.498  95.822  1.00 40.37  ? 20  ARG C CB    1 
ATOM   6553  C CG    . ARG E 5 7   ? 137.222 91.517  95.110  1.00 48.97  ? 20  ARG C CG    1 
ATOM   6554  C CD    . ARG E 5 7   ? 136.838 91.513  93.634  1.00 55.67  ? 20  ARG C CD    1 
ATOM   6555  N NE    . ARG E 5 7   ? 137.313 90.324  92.933  1.00 63.17  ? 20  ARG C NE    1 
ATOM   6556  C CZ    . ARG E 5 7   ? 138.548 90.174  92.462  1.00 66.58  ? 20  ARG C CZ    1 
ATOM   6557  N NH1   . ARG E 5 7   ? 139.453 91.138  92.614  1.00 67.64  ? 20  ARG C NH1   1 
ATOM   6558  N NH2   . ARG E 5 7   ? 138.874 89.062  91.821  1.00 67.91  ? 20  ARG C NH2   1 
ATOM   6559  N N     . ALA E 5 8   ? 134.544 93.795  98.137  1.00 34.93  ? 21  ALA C N     1 
ATOM   6560  C CA    . ALA E 5 8   ? 133.849 95.014  98.580  1.00 33.05  ? 21  ALA C CA    1 
ATOM   6561  C C     . ALA E 5 8   ? 133.903 95.189  100.102 1.00 31.77  ? 21  ALA C C     1 
ATOM   6562  O O     . ALA E 5 8   ? 133.443 96.203  100.619 1.00 33.06  ? 21  ALA C O     1 
ATOM   6563  C CB    . ALA E 5 8   ? 132.373 94.982  98.119  1.00 32.11  ? 21  ALA C CB    1 
ATOM   6564  N N     . GLY E 5 9   ? 134.433 94.189  100.811 1.00 32.06  ? 22  GLY C N     1 
ATOM   6565  C CA    . GLY E 5 9   ? 134.509 94.264  102.272 1.00 32.32  ? 22  GLY C CA    1 
ATOM   6566  C C     . GLY E 5 9   ? 133.172 94.038  102.986 1.00 30.04  ? 22  GLY C C     1 
ATOM   6567  O O     . GLY E 5 9   ? 132.951 94.521  104.111 1.00 29.80  ? 22  GLY C O     1 
ATOM   6568  N N     . LEU E 5 10  ? 132.291 93.273  102.343 1.00 31.45  ? 23  LEU C N     1 
ATOM   6569  C CA    . LEU E 5 10  ? 130.960 93.004  102.873 1.00 31.42  ? 23  LEU C CA    1 
ATOM   6570  C C     . LEU E 5 10  ? 130.743 91.597  103.373 1.00 32.52  ? 23  LEU C C     1 
ATOM   6571  O O     . LEU E 5 10  ? 131.432 90.663  102.971 1.00 33.31  ? 23  LEU C O     1 
ATOM   6572  C CB    . LEU E 5 10  ? 129.908 93.289  101.788 1.00 29.29  ? 23  LEU C CB    1 
ATOM   6573  C CG    . LEU E 5 10  ? 129.870 94.739  101.306 1.00 27.35  ? 23  LEU C CG    1 
ATOM   6574  C CD1   . LEU E 5 10  ? 128.860 94.935  100.141 1.00 25.56  ? 23  LEU C CD1   1 
ATOM   6575  C CD2   . LEU E 5 10  ? 129.463 95.616  102.514 1.00 26.73  ? 23  LEU C CD2   1 
ATOM   6576  N N     . GLN E 5 11  ? 129.744 91.472  104.243 1.00 31.69  ? 24  GLN C N     1 
ATOM   6577  C CA    . GLN E 5 11  ? 129.324 90.209  104.812 1.00 30.73  ? 24  GLN C CA    1 
ATOM   6578  C C     . GLN E 5 11  ? 128.172 89.723  103.931 1.00 31.40  ? 24  GLN C C     1 
ATOM   6579  O O     . GLN E 5 11  ? 128.060 88.533  103.683 1.00 31.98  ? 24  GLN C O     1 
ATOM   6580  C CB    . GLN E 5 11  ? 128.809 90.416  106.240 1.00 33.63  ? 24  GLN C CB    1 
ATOM   6581  C CG    . GLN E 5 11  ? 129.877 90.874  107.241 1.00 36.57  ? 24  GLN C CG    1 
ATOM   6582  C CD    . GLN E 5 11  ? 131.072 89.957  107.212 1.00 33.96  ? 24  GLN C CD    1 
ATOM   6583  O OE1   . GLN E 5 11  ? 130.962 88.782  107.479 1.00 32.74  ? 24  GLN C OE1   1 
ATOM   6584  N NE2   . GLN E 5 11  ? 132.220 90.501  106.877 1.00 40.83  ? 24  GLN C NE2   1 
ATOM   6585  N N     . PHE E 5 12  ? 127.295 90.647  103.503 1.00 28.02  ? 25  PHE C N     1 
ATOM   6586  C CA    . PHE E 5 12  ? 126.167 90.274  102.636 1.00 25.92  ? 25  PHE C CA    1 
ATOM   6587  C C     . PHE E 5 12  ? 126.696 89.861  101.247 1.00 29.54  ? 25  PHE C C     1 
ATOM   6588  O O     . PHE E 5 12  ? 127.687 90.411  100.763 1.00 30.04  ? 25  PHE C O     1 
ATOM   6589  C CB    . PHE E 5 12  ? 125.135 91.427  102.575 1.00 22.62  ? 25  PHE C CB    1 
ATOM   6590  C CG    . PHE E 5 12  ? 124.081 91.362  103.675 1.00 27.81  ? 25  PHE C CG    1 
ATOM   6591  C CD1   . PHE E 5 12  ? 124.441 91.097  105.004 1.00 27.31  ? 25  PHE C CD1   1 
ATOM   6592  C CD2   . PHE E 5 12  ? 122.722 91.507  103.371 1.00 30.24  ? 25  PHE C CD2   1 
ATOM   6593  C CE1   . PHE E 5 12  ? 123.471 90.965  106.019 1.00 28.69  ? 25  PHE C CE1   1 
ATOM   6594  C CE2   . PHE E 5 12  ? 121.730 91.383  104.367 1.00 31.24  ? 25  PHE C CE2   1 
ATOM   6595  C CZ    . PHE E 5 12  ? 122.097 91.106  105.702 1.00 28.62  ? 25  PHE C CZ    1 
ATOM   6596  N N     . PRO E 5 13  ? 126.013 88.906  100.577 1.00 31.86  ? 26  PRO C N     1 
ATOM   6597  C CA    . PRO E 5 13  ? 126.367 88.353  99.258  1.00 30.40  ? 26  PRO C CA    1 
ATOM   6598  C C     . PRO E 5 13  ? 126.117 89.210  98.036  1.00 33.49  ? 26  PRO C C     1 
ATOM   6599  O O     . PRO E 5 13  ? 124.974 89.306  97.571  1.00 31.95  ? 26  PRO C O     1 
ATOM   6600  C CB    . PRO E 5 13  ? 125.560 87.072  99.207  1.00 30.71  ? 26  PRO C CB    1 
ATOM   6601  C CG    . PRO E 5 13  ? 124.259 87.523  99.805  1.00 34.21  ? 26  PRO C CG    1 
ATOM   6602  C CD    . PRO E 5 13  ? 124.691 88.410  101.000 1.00 29.49  ? 26  PRO C CD    1 
ATOM   6603  N N     . VAL E 5 14  ? 127.183 89.793  97.491  1.00 29.66  ? 27  VAL C N     1 
ATOM   6604  C CA    . VAL E 5 14  ? 127.035 90.642  96.323  1.00 32.51  ? 27  VAL C CA    1 
ATOM   6605  C C     . VAL E 5 14  ? 126.535 89.827  95.132  1.00 34.94  ? 27  VAL C C     1 
ATOM   6606  O O     . VAL E 5 14  ? 125.663 90.290  94.382  1.00 29.47  ? 27  VAL C O     1 
ATOM   6607  C CB    . VAL E 5 14  ? 128.335 91.293  95.972  1.00 32.05  ? 27  VAL C CB    1 
ATOM   6608  C CG1   . VAL E 5 14  ? 128.206 92.021  94.637  1.00 32.45  ? 27  VAL C CG1   1 
ATOM   6609  C CG2   . VAL E 5 14  ? 128.731 92.267  97.100  1.00 30.30  ? 27  VAL C CG2   1 
ATOM   6610  N N     . GLY E 5 15  ? 127.077 88.612  94.982  1.00 31.61  ? 28  GLY C N     1 
ATOM   6611  C CA    . GLY E 5 15  ? 126.679 87.755  93.885  1.00 32.35  ? 28  GLY C CA    1 
ATOM   6612  C C     . GLY E 5 15  ? 125.189 87.478  93.904  1.00 33.65  ? 28  GLY C C     1 
ATOM   6613  O O     . GLY E 5 15  ? 124.503 87.590  92.890  1.00 32.43  ? 28  GLY C O     1 
ATOM   6614  N N     . ARG E 5 16  ? 124.687 87.094  95.063  1.00 32.58  ? 29  ARG C N     1 
ATOM   6615  C CA    . ARG E 5 16  ? 123.267 86.813  95.229  1.00 33.10  ? 29  ARG C CA    1 
ATOM   6616  C C     . ARG E 5 16  ? 122.425 88.051  94.899  1.00 33.88  ? 29  ARG C C     1 
ATOM   6617  O O     . ARG E 5 16  ? 121.453 87.975  94.129  1.00 33.98  ? 29  ARG C O     1 
ATOM   6618  C CB    . ARG E 5 16  ? 122.999 86.422  96.665  1.00 33.89  ? 29  ARG C CB    1 
ATOM   6619  C CG    . ARG E 5 16  ? 121.586 85.992  96.949  1.00 37.69  ? 29  ARG C CG    1 
ATOM   6620  C CD    . ARG E 5 16  ? 121.646 84.602  97.439  1.00 39.27  ? 29  ARG C CD    1 
ATOM   6621  N NE    . ARG E 5 16  ? 121.078 84.476  98.749  1.00 46.35  ? 29  ARG C NE    1 
ATOM   6622  C CZ    . ARG E 5 16  ? 121.215 83.416  99.530  1.00 42.14  ? 29  ARG C CZ    1 
ATOM   6623  N NH1   . ARG E 5 16  ? 121.929 82.354  99.147  1.00 45.95  ? 29  ARG C NH1   1 
ATOM   6624  N NH2   . ARG E 5 16  ? 120.596 83.412  100.690 1.00 48.80  ? 29  ARG C NH2   1 
ATOM   6625  N N     . VAL E 5 17  ? 122.788 89.182  95.498  1.00 29.49  ? 30  VAL C N     1 
ATOM   6626  C CA    . VAL E 5 17  ? 122.049 90.404  95.262  1.00 31.34  ? 30  VAL C CA    1 
ATOM   6627  C C     . VAL E 5 17  ? 122.021 90.811  93.777  1.00 34.46  ? 30  VAL C C     1 
ATOM   6628  O O     . VAL E 5 17  ? 120.988 91.288  93.302  1.00 34.48  ? 30  VAL C O     1 
ATOM   6629  C CB    . VAL E 5 17  ? 122.577 91.549  96.142  1.00 28.52  ? 30  VAL C CB    1 
ATOM   6630  C CG1   . VAL E 5 17  ? 121.955 92.890  95.699  1.00 25.07  ? 30  VAL C CG1   1 
ATOM   6631  C CG2   . VAL E 5 17  ? 122.207 91.252  97.586  1.00 23.84  ? 30  VAL C CG2   1 
ATOM   6632  N N     . HIS E 5 18  ? 123.131 90.611  93.059  1.00 32.79  ? 31  HIS C N     1 
ATOM   6633  C CA    . HIS E 5 18  ? 123.214 90.919  91.620  1.00 35.98  ? 31  HIS C CA    1 
ATOM   6634  C C     . HIS E 5 18  ? 122.186 90.031  90.896  1.00 35.57  ? 31  HIS C C     1 
ATOM   6635  O O     . HIS E 5 18  ? 121.420 90.484  90.044  1.00 36.36  ? 31  HIS C O     1 
ATOM   6636  C CB    . HIS E 5 18  ? 124.613 90.581  91.078  1.00 40.02  ? 31  HIS C CB    1 
ATOM   6637  C CG    . HIS E 5 18  ? 124.984 91.314  89.823  1.00 42.36  ? 31  HIS C CG    1 
ATOM   6638  N ND1   . HIS E 5 18  ? 124.049 91.852  88.964  1.00 46.96  ? 31  HIS C ND1   1 
ATOM   6639  C CD2   . HIS E 5 18  ? 126.193 91.627  89.301  1.00 43.63  ? 31  HIS C CD2   1 
ATOM   6640  C CE1   . HIS E 5 18  ? 124.667 92.477  87.975  1.00 43.98  ? 31  HIS C CE1   1 
ATOM   6641  N NE2   . HIS E 5 18  ? 125.968 92.355  88.157  1.00 46.95  ? 31  HIS C NE2   1 
ATOM   6642  N N     . ARG E 5 19  ? 122.179 88.760  91.258  1.00 35.28  ? 32  ARG C N     1 
ATOM   6643  C CA    . ARG E 5 19  ? 121.277 87.790  90.651  1.00 37.35  ? 32  ARG C CA    1 
ATOM   6644  C C     . ARG E 5 19  ? 119.820 88.153  90.910  1.00 37.52  ? 32  ARG C C     1 
ATOM   6645  O O     . ARG E 5 19  ? 119.001 88.164  89.999  1.00 39.28  ? 32  ARG C O     1 
ATOM   6646  C CB    . ARG E 5 19  ? 121.560 86.414  91.225  1.00 39.74  ? 32  ARG C CB    1 
ATOM   6647  C CG    . ARG E 5 19  ? 120.890 85.285  90.511  1.00 42.46  ? 32  ARG C CG    1 
ATOM   6648  C CD    . ARG E 5 19  ? 121.056 84.031  91.335  1.00 51.62  ? 32  ARG C CD    1 
ATOM   6649  N NE    . ARG E 5 19  ? 119.832 83.797  92.075  1.00 53.26  ? 32  ARG C NE    1 
ATOM   6650  C CZ    . ARG E 5 19  ? 119.770 83.497  93.362  1.00 52.56  ? 32  ARG C CZ    1 
ATOM   6651  N NH1   . ARG E 5 19  ? 120.876 83.384  94.085  1.00 50.26  ? 32  ARG C NH1   1 
ATOM   6652  N NH2   . ARG E 5 19  ? 118.583 83.335  93.923  1.00 56.60  ? 32  ARG C NH2   1 
ATOM   6653  N N     . LEU E 5 20  ? 119.495 88.421  92.167  1.00 34.17  ? 33  LEU C N     1 
ATOM   6654  C CA    . LEU E 5 20  ? 118.143 88.789  92.513  1.00 33.87  ? 33  LEU C CA    1 
ATOM   6655  C C     . LEU E 5 20  ? 117.737 90.041  91.762  1.00 32.29  ? 33  LEU C C     1 
ATOM   6656  O O     . LEU E 5 20  ? 116.592 90.131  91.332  1.00 33.64  ? 33  LEU C O     1 
ATOM   6657  C CB    . LEU E 5 20  ? 118.017 88.988  94.023  1.00 33.33  ? 33  LEU C CB    1 
ATOM   6658  C CG    . LEU E 5 20  ? 118.115 87.654  94.777  1.00 33.82  ? 33  LEU C CG    1 
ATOM   6659  C CD1   . LEU E 5 20  ? 118.227 87.911  96.272  1.00 37.12  ? 33  LEU C CD1   1 
ATOM   6660  C CD2   . LEU E 5 20  ? 116.890 86.792  94.462  1.00 36.35  ? 33  LEU C CD2   1 
ATOM   6661  N N     . LEU E 5 21  ? 118.654 90.996  91.577  1.00 28.33  ? 34  LEU C N     1 
ATOM   6662  C CA    . LEU E 5 21  ? 118.294 92.213  90.843  1.00 28.27  ? 34  LEU C CA    1 
ATOM   6663  C C     . LEU E 5 21  ? 117.942 91.881  89.381  1.00 35.65  ? 34  LEU C C     1 
ATOM   6664  O O     . LEU E 5 21  ? 116.985 92.426  88.825  1.00 36.17  ? 34  LEU C O     1 
ATOM   6665  C CB    . LEU E 5 21  ? 119.418 93.243  90.875  1.00 27.92  ? 34  LEU C CB    1 
ATOM   6666  C CG    . LEU E 5 21  ? 119.671 94.054  92.160  1.00 31.20  ? 34  LEU C CG    1 
ATOM   6667  C CD1   . LEU E 5 21  ? 120.940 94.942  92.022  1.00 27.63  ? 34  LEU C CD1   1 
ATOM   6668  C CD2   . LEU E 5 21  ? 118.449 94.909  92.442  1.00 27.41  ? 34  LEU C CD2   1 
ATOM   6669  N N     . ARG E 5 22  ? 118.711 90.987  88.762  1.00 37.93  ? 35  ARG C N     1 
ATOM   6670  C CA    . ARG E 5 22  ? 118.445 90.592  87.380  1.00 42.01  ? 35  ARG C CA    1 
ATOM   6671  C C     . ARG E 5 22  ? 117.132 89.835  87.266  1.00 43.70  ? 35  ARG C C     1 
ATOM   6672  O O     . ARG E 5 22  ? 116.322 90.114  86.390  1.00 49.01  ? 35  ARG C O     1 
ATOM   6673  C CB    . ARG E 5 22  ? 119.559 89.702  86.833  1.00 44.37  ? 35  ARG C CB    1 
ATOM   6674  C CG    . ARG E 5 22  ? 120.918 90.359  86.640  1.00 44.61  ? 35  ARG C CG    1 
ATOM   6675  C CD    . ARG E 5 22  ? 121.843 89.354  85.968  1.00 53.98  ? 35  ARG C CD    1 
ATOM   6676  N NE    . ARG E 5 22  ? 123.249 89.749  85.974  1.00 56.73  ? 35  ARG C NE    1 
ATOM   6677  C CZ    . ARG E 5 22  ? 123.732 90.832  85.376  1.00 58.44  ? 35  ARG C CZ    1 
ATOM   6678  N NH1   . ARG E 5 22  ? 122.917 91.651  84.726  1.00 60.76  ? 35  ARG C NH1   1 
ATOM   6679  N NH2   . ARG E 5 22  ? 125.037 91.078  85.407  1.00 58.45  ? 35  ARG C NH2   1 
ATOM   6680  N N     . LYS E 5 23  ? 116.898 88.880  88.151  1.00 44.19  ? 36  LYS C N     1 
ATOM   6681  C CA    . LYS E 5 23  ? 115.670 88.113  88.069  1.00 46.85  ? 36  LYS C CA    1 
ATOM   6682  C C     . LYS E 5 23  ? 114.413 88.903  88.395  1.00 46.43  ? 36  LYS C C     1 
ATOM   6683  O O     . LYS E 5 23  ? 113.317 88.535  87.962  1.00 46.13  ? 36  LYS C O     1 
ATOM   6684  C CB    . LYS E 5 23  ? 115.757 86.900  88.985  1.00 52.47  ? 36  LYS C CB    1 
ATOM   6685  C CG    . LYS E 5 23  ? 115.825 87.233  90.457  1.00 58.49  ? 36  LYS C CG    1 
ATOM   6686  C CD    . LYS E 5 23  ? 116.304 86.021  91.262  1.00 63.28  ? 36  LYS C CD    1 
ATOM   6687  C CE    . LYS E 5 23  ? 115.299 84.882  91.249  1.00 61.97  ? 36  LYS C CE    1 
ATOM   6688  N NZ    . LYS E 5 23  ? 115.840 83.706  91.987  1.00 65.48  ? 36  LYS C NZ    1 
ATOM   6689  N N     . GLY E 5 24  ? 114.565 89.995  89.143  1.00 44.34  ? 37  GLY C N     1 
ATOM   6690  C CA    . GLY E 5 24  ? 113.415 90.794  89.525  1.00 40.26  ? 37  GLY C CA    1 
ATOM   6691  C C     . GLY E 5 24  ? 112.815 91.670  88.437  1.00 41.62  ? 37  GLY C C     1 
ATOM   6692  O O     . GLY E 5 24  ? 111.790 92.306  88.654  1.00 41.24  ? 37  GLY C O     1 
ATOM   6693  N N     . ASN E 5 25  ? 113.451 91.740  87.277  1.00 39.06  ? 38  ASN C N     1 
ATOM   6694  C CA    . ASN E 5 25  ? 112.919 92.564  86.195  1.00 43.11  ? 38  ASN C CA    1 
ATOM   6695  C C     . ASN E 5 25  ? 112.796 94.025  86.568  1.00 40.78  ? 38  ASN C C     1 
ATOM   6696  O O     . ASN E 5 25  ? 111.773 94.662  86.307  1.00 43.12  ? 38  ASN C O     1 
ATOM   6697  C CB    . ASN E 5 25  ? 111.542 92.074  85.750  1.00 48.25  ? 38  ASN C CB    1 
ATOM   6698  C CG    . ASN E 5 25  ? 111.619 90.825  84.909  1.00 52.37  ? 38  ASN C CG    1 
ATOM   6699  O OD1   . ASN E 5 25  ? 111.485 89.716  85.413  1.00 53.93  ? 38  ASN C OD1   1 
ATOM   6700  N ND2   . ASN E 5 25  ? 111.851 91.003  83.605  1.00 56.00  ? 38  ASN C ND2   1 
ATOM   6701  N N     . TYR E 5 26  ? 113.842 94.565  87.171  1.00 36.48  ? 39  TYR C N     1 
ATOM   6702  C CA    . TYR E 5 26  ? 113.837 95.967  87.556  1.00 32.88  ? 39  TYR C CA    1 
ATOM   6703  C C     . TYR E 5 26  ? 114.313 96.845  86.410  1.00 31.51  ? 39  TYR C C     1 
ATOM   6704  O O     . TYR E 5 26  ? 113.896 97.990  86.287  1.00 33.29  ? 39  TYR C O     1 
ATOM   6705  C CB    . TYR E 5 26  ? 114.722 96.143  88.797  1.00 26.45  ? 39  TYR C CB    1 
ATOM   6706  C CG    . TYR E 5 26  ? 114.190 95.324  89.970  1.00 30.02  ? 39  TYR C CG    1 
ATOM   6707  C CD1   . TYR E 5 26  ? 113.065 95.742  90.665  1.00 30.12  ? 39  TYR C CD1   1 
ATOM   6708  C CD2   . TYR E 5 26  ? 114.812 94.141  90.376  1.00 28.11  ? 39  TYR C CD2   1 
ATOM   6709  C CE1   . TYR E 5 26  ? 112.563 95.019  91.736  1.00 31.61  ? 39  TYR C CE1   1 
ATOM   6710  C CE2   . TYR E 5 26  ? 114.313 93.405  91.461  1.00 30.77  ? 39  TYR C CE2   1 
ATOM   6711  C CZ    . TYR E 5 26  ? 113.192 93.857  92.130  1.00 33.49  ? 39  TYR C CZ    1 
ATOM   6712  O OH    . TYR E 5 26  ? 112.688 93.170  93.209  1.00 37.51  ? 39  TYR C OH    1 
ATOM   6713  N N     . ALA E 5 27  ? 115.176 96.308  85.556  1.00 30.86  ? 40  ALA C N     1 
ATOM   6714  C CA    . ALA E 5 27  ? 115.698 97.080  84.418  1.00 32.92  ? 40  ALA C CA    1 
ATOM   6715  C C     . ALA E 5 27  ? 116.312 96.121  83.420  1.00 33.88  ? 40  ALA C C     1 
ATOM   6716  O O     . ALA E 5 27  ? 116.563 94.957  83.734  1.00 33.37  ? 40  ALA C O     1 
ATOM   6717  C CB    . ALA E 5 27  ? 116.767 98.086  84.879  1.00 32.03  ? 40  ALA C CB    1 
ATOM   6718  N N     . GLU E 5 28  ? 116.558 96.596  82.212  1.00 36.86  ? 41  GLU C N     1 
ATOM   6719  C CA    . GLU E 5 28  ? 117.154 95.706  81.225  1.00 39.61  ? 41  GLU C CA    1 
ATOM   6720  C C     . GLU E 5 28  ? 118.560 95.341  81.661  1.00 38.04  ? 41  GLU C C     1 
ATOM   6721  O O     . GLU E 5 28  ? 118.974 94.212  81.499  1.00 40.98  ? 41  GLU C O     1 
ATOM   6722  C CB    . GLU E 5 28  ? 117.197 96.369  79.837  1.00 43.52  ? 41  GLU C CB    1 
ATOM   6723  C CG    . GLU E 5 28  ? 115.825 96.507  79.184  1.00 55.17  ? 41  GLU C CG    1 
ATOM   6724  C CD    . GLU E 5 28  ? 115.061 95.183  79.128  1.00 61.78  ? 41  GLU C CD    1 
ATOM   6725  O OE1   . GLU E 5 28  ? 115.584 94.220  78.513  1.00 63.09  ? 41  GLU C OE1   1 
ATOM   6726  O OE2   . GLU E 5 28  ? 113.944 95.104  79.700  1.00 62.03  ? 41  GLU C OE2   1 
ATOM   6727  N N     . ARG E 5 29  ? 119.276 96.300  82.239  1.00 36.93  ? 42  ARG C N     1 
ATOM   6728  C CA    . ARG E 5 29  ? 120.657 96.082  82.661  1.00 37.54  ? 42  ARG C CA    1 
ATOM   6729  C C     . ARG E 5 29  ? 120.886 96.480  84.118  1.00 36.91  ? 42  ARG C C     1 
ATOM   6730  O O     . ARG E 5 29  ? 120.258 97.412  84.618  1.00 33.86  ? 42  ARG C O     1 
ATOM   6731  C CB    . ARG E 5 29  ? 121.621 96.924  81.812  1.00 39.31  ? 42  ARG C CB    1 
ATOM   6732  C CG    . ARG E 5 29  ? 121.613 96.677  80.301  1.00 44.69  ? 42  ARG C CG    1 
ATOM   6733  C CD    . ARG E 5 29  ? 122.733 97.485  79.627  1.00 46.06  ? 42  ARG C CD    1 
ATOM   6734  N NE    . ARG E 5 29  ? 123.091 96.916  78.331  1.00 56.34  ? 42  ARG C NE    1 
ATOM   6735  C CZ    . ARG E 5 29  ? 124.233 97.137  77.682  1.00 55.21  ? 42  ARG C CZ    1 
ATOM   6736  N NH1   . ARG E 5 29  ? 125.167 97.929  78.195  1.00 56.41  ? 42  ARG C NH1   1 
ATOM   6737  N NH2   . ARG E 5 29  ? 124.440 96.549  76.513  1.00 56.82  ? 42  ARG C NH2   1 
ATOM   6738  N N     . VAL E 5 30  ? 121.819 95.792  84.768  1.00 36.08  ? 43  VAL C N     1 
ATOM   6739  C CA    . VAL E 5 30  ? 122.191 96.083  86.146  1.00 36.25  ? 43  VAL C CA    1 
ATOM   6740  C C     . VAL E 5 30  ? 123.703 96.198  86.201  1.00 35.21  ? 43  VAL C C     1 
ATOM   6741  O O     . VAL E 5 30  ? 124.388 95.229  85.967  1.00 36.17  ? 43  VAL C O     1 
ATOM   6742  C CB    . VAL E 5 30  ? 121.769 94.960  87.111  1.00 36.82  ? 43  VAL C CB    1 
ATOM   6743  C CG1   . VAL E 5 30  ? 122.277 95.276  88.536  1.00 31.64  ? 43  VAL C CG1   1 
ATOM   6744  C CG2   . VAL E 5 30  ? 120.248 94.813  87.095  1.00 39.18  ? 43  VAL C CG2   1 
ATOM   6745  N N     . GLY E 5 31  ? 124.211 97.380  86.517  1.00 35.00  ? 44  GLY C N     1 
ATOM   6746  C CA    . GLY E 5 31  ? 125.646 97.575  86.595  1.00 36.02  ? 44  GLY C CA    1 
ATOM   6747  C C     . GLY E 5 31  ? 126.313 96.837  87.738  1.00 35.32  ? 44  GLY C C     1 
ATOM   6748  O O     . GLY E 5 31  ? 125.677 96.511  88.738  1.00 34.56  ? 44  GLY C O     1 
ATOM   6749  N N     . ALA E 5 32  ? 127.620 96.601  87.603  1.00 36.28  ? 45  ALA C N     1 
ATOM   6750  C CA    . ALA E 5 32  ? 128.388 95.868  88.616  1.00 34.80  ? 45  ALA C CA    1 
ATOM   6751  C C     . ALA E 5 32  ? 128.374 96.479  90.019  1.00 29.93  ? 45  ALA C C     1 
ATOM   6752  O O     . ALA E 5 32  ? 128.377 95.755  90.993  1.00 33.70  ? 45  ALA C O     1 
ATOM   6753  C CB    . ALA E 5 32  ? 129.837 95.695  88.139  1.00 37.05  ? 45  ALA C CB    1 
ATOM   6754  N N     . GLY E 5 33  ? 128.384 97.799  90.114  1.00 27.66  ? 46  GLY C N     1 
ATOM   6755  C CA    . GLY E 5 33  ? 128.374 98.450  91.411  1.00 30.67  ? 46  GLY C CA    1 
ATOM   6756  C C     . GLY E 5 33  ? 127.020 98.472  92.133  1.00 31.26  ? 46  GLY C C     1 
ATOM   6757  O O     . GLY E 5 33  ? 126.966 98.668  93.352  1.00 30.75  ? 46  GLY C O     1 
ATOM   6758  N N     . ALA E 5 34  ? 125.935 98.246  91.395  1.00 28.36  ? 47  ALA C N     1 
ATOM   6759  C CA    . ALA E 5 34  ? 124.601 98.255  91.970  1.00 26.35  ? 47  ALA C CA    1 
ATOM   6760  C C     . ALA E 5 34  ? 124.430 97.233  93.080  1.00 25.52  ? 47  ALA C C     1 
ATOM   6761  O O     . ALA E 5 34  ? 124.026 97.578  94.186  1.00 28.30  ? 47  ALA C O     1 
ATOM   6762  C CB    . ALA E 5 34  ? 123.551 98.008  90.879  1.00 26.10  ? 47  ALA C CB    1 
ATOM   6763  N N     . PRO E 5 35  ? 124.733 95.969  92.803  1.00 24.34  ? 48  PRO C N     1 
ATOM   6764  C CA    . PRO E 5 35  ? 124.574 94.961  93.849  1.00 24.79  ? 48  PRO C CA    1 
ATOM   6765  C C     . PRO E 5 35  ? 125.524 95.190  95.027  1.00 27.46  ? 48  PRO C C     1 
ATOM   6766  O O     . PRO E 5 35  ? 125.197 94.853  96.147  1.00 27.32  ? 48  PRO C O     1 
ATOM   6767  C CB    . PRO E 5 35  ? 124.812 93.639  93.108  1.00 27.14  ? 48  PRO C CB    1 
ATOM   6768  C CG    . PRO E 5 35  ? 125.740 94.028  91.964  1.00 28.08  ? 48  PRO C CG    1 
ATOM   6769  C CD    . PRO E 5 35  ? 125.227 95.388  91.535  1.00 27.90  ? 48  PRO C CD    1 
ATOM   6770  N N     . VAL E 5 36  ? 126.690 95.779  94.768  1.00 28.09  ? 49  VAL C N     1 
ATOM   6771  C CA    . VAL E 5 36  ? 127.634 96.040  95.836  1.00 25.52  ? 49  VAL C CA    1 
ATOM   6772  C C     . VAL E 5 36  ? 127.030 97.085  96.752  1.00 26.09  ? 49  VAL C C     1 
ATOM   6773  O O     . VAL E 5 36  ? 126.973 96.905  97.968  1.00 26.47  ? 49  VAL C O     1 
ATOM   6774  C CB    . VAL E 5 36  ? 128.998 96.556  95.303  1.00 29.14  ? 49  VAL C CB    1 
ATOM   6775  C CG1   . VAL E 5 36  ? 129.893 97.049  96.508  1.00 27.52  ? 49  VAL C CG1   1 
ATOM   6776  C CG2   . VAL E 5 36  ? 129.722 95.419  94.525  1.00 24.24  ? 49  VAL C CG2   1 
ATOM   6777  N N     . TYR E 5 37  ? 126.568 98.184  96.163  1.00 24.09  ? 50  TYR C N     1 
ATOM   6778  C CA    . TYR E 5 37  ? 125.976 99.256  96.933  1.00 26.81  ? 50  TYR C CA    1 
ATOM   6779  C C     . TYR E 5 37  ? 124.738 98.741  97.706  1.00 28.75  ? 50  TYR C C     1 
ATOM   6780  O O     . TYR E 5 37  ? 124.579 99.002  98.903  1.00 27.66  ? 50  TYR C O     1 
ATOM   6781  C CB    . TYR E 5 37  ? 125.587 100.395 95.993  1.00 21.16  ? 50  TYR C CB    1 
ATOM   6782  C CG    . TYR E 5 37  ? 125.407 101.719 96.679  1.00 26.43  ? 50  TYR C CG    1 
ATOM   6783  C CD1   . TYR E 5 37  ? 124.407 101.911 97.634  1.00 28.08  ? 50  TYR C CD1   1 
ATOM   6784  C CD2   . TYR E 5 37  ? 126.208 102.810 96.330  1.00 26.58  ? 50  TYR C CD2   1 
ATOM   6785  C CE1   . TYR E 5 37  ? 124.204 103.150 98.215  1.00 25.17  ? 50  TYR C CE1   1 
ATOM   6786  C CE2   . TYR E 5 37  ? 126.017 104.055 96.901  1.00 30.14  ? 50  TYR C CE2   1 
ATOM   6787  C CZ    . TYR E 5 37  ? 125.006 104.223 97.848  1.00 31.45  ? 50  TYR C CZ    1 
ATOM   6788  O OH    . TYR E 5 37  ? 124.795 105.475 98.377  1.00 28.95  ? 50  TYR C OH    1 
ATOM   6789  N N     . LEU E 5 38  ? 123.883 97.985  97.018  1.00 26.96  ? 51  LEU C N     1 
ATOM   6790  C CA    . LEU E 5 38  ? 122.681 97.478  97.653  1.00 26.13  ? 51  LEU C CA    1 
ATOM   6791  C C     . LEU E 5 38  ? 122.983 96.500  98.791  1.00 27.50  ? 51  LEU C C     1 
ATOM   6792  O O     . LEU E 5 38  ? 122.398 96.622  99.880  1.00 26.31  ? 51  LEU C O     1 
ATOM   6793  C CB    . LEU E 5 38  ? 121.747 96.833  96.596  1.00 25.58  ? 51  LEU C CB    1 
ATOM   6794  C CG    . LEU E 5 38  ? 120.382 96.306  97.094  1.00 24.86  ? 51  LEU C CG    1 
ATOM   6795  C CD1   . LEU E 5 38  ? 119.607 97.419  97.875  1.00 23.59  ? 51  LEU C CD1   1 
ATOM   6796  C CD2   . LEU E 5 38  ? 119.554 95.852  95.884  1.00 22.95  ? 51  LEU C CD2   1 
ATOM   6797  N N     . ALA E 5 39  ? 123.882 95.534  98.558  1.00 26.56  ? 52  ALA C N     1 
ATOM   6798  C CA    . ALA E 5 39  ? 124.242 94.575  99.617  1.00 26.76  ? 52  ALA C CA    1 
ATOM   6799  C C     . ALA E 5 39  ? 124.776 95.333  100.834 1.00 25.14  ? 52  ALA C C     1 
ATOM   6800  O O     . ALA E 5 39  ? 124.467 94.995  101.966 1.00 24.80  ? 52  ALA C O     1 
ATOM   6801  C CB    . ALA E 5 39  ? 125.312 93.614  99.116  1.00 25.47  ? 52  ALA C CB    1 
ATOM   6802  N N     . ALA E 5 40  ? 125.566 96.374  100.588 1.00 26.97  ? 53  ALA C N     1 
ATOM   6803  C CA    . ALA E 5 40  ? 126.141 97.177  101.658 1.00 25.72  ? 53  ALA C CA    1 
ATOM   6804  C C     . ALA E 5 40  ? 125.046 97.836  102.496 1.00 26.96  ? 53  ALA C C     1 
ATOM   6805  O O     . ALA E 5 40  ? 125.091 97.832  103.739 1.00 25.16  ? 53  ALA C O     1 
ATOM   6806  C CB    . ALA E 5 40  ? 127.075 98.246  101.070 1.00 20.72  ? 53  ALA C CB    1 
ATOM   6807  N N     . VAL E 5 41  ? 124.059 98.410  101.826 1.00 24.65  ? 54  VAL C N     1 
ATOM   6808  C CA    . VAL E 5 41  ? 122.953 99.073  102.523 1.00 23.96  ? 54  VAL C CA    1 
ATOM   6809  C C     . VAL E 5 41  ? 122.126 98.082  103.340 1.00 24.46  ? 54  VAL C C     1 
ATOM   6810  O O     . VAL E 5 41  ? 121.749 98.358  104.481 1.00 26.02  ? 54  VAL C O     1 
ATOM   6811  C CB    . VAL E 5 41  ? 122.038 99.830  101.512 1.00 25.62  ? 54  VAL C CB    1 
ATOM   6812  C CG1   . VAL E 5 41  ? 120.667 100.209 102.164 1.00 26.36  ? 54  VAL C CG1   1 
ATOM   6813  C CG2   . VAL E 5 41  ? 122.763 101.097 101.036 1.00 21.71  ? 54  VAL C CG2   1 
ATOM   6814  N N     . LEU E 5 42  ? 121.837 96.933  102.755 1.00 24.51  ? 55  LEU C N     1 
ATOM   6815  C CA    . LEU E 5 42  ? 121.050 95.915  103.436 1.00 24.09  ? 55  LEU C CA    1 
ATOM   6816  C C     . LEU E 5 42  ? 121.804 95.448  104.675 1.00 28.07  ? 55  LEU C C     1 
ATOM   6817  O O     . LEU E 5 42  ? 121.209 95.255  105.732 1.00 25.61  ? 55  LEU C O     1 
ATOM   6818  C CB    . LEU E 5 42  ? 120.810 94.735  102.499 1.00 25.03  ? 55  LEU C CB    1 
ATOM   6819  C CG    . LEU E 5 42  ? 119.889 95.039  101.292 1.00 21.91  ? 55  LEU C CG    1 
ATOM   6820  C CD1   . LEU E 5 42  ? 119.958 93.867  100.361 1.00 24.63  ? 55  LEU C CD1   1 
ATOM   6821  C CD2   . LEU E 5 42  ? 118.449 95.309  101.719 1.00 23.81  ? 55  LEU C CD2   1 
ATOM   6822  N N     . GLU E 5 43  ? 123.107 95.256  104.515 1.00 25.24  ? 56  GLU C N     1 
ATOM   6823  C CA    . GLU E 5 43  ? 123.971 94.834  105.610 1.00 26.16  ? 56  GLU C CA    1 
ATOM   6824  C C     . GLU E 5 43  ? 123.967 95.892  106.691 1.00 22.17  ? 56  GLU C C     1 
ATOM   6825  O O     . GLU E 5 43  ? 123.880 95.577  107.852 1.00 24.94  ? 56  GLU C O     1 
ATOM   6826  C CB    . GLU E 5 43  ? 125.406 94.614  105.118 1.00 28.85  ? 56  GLU C CB    1 
ATOM   6827  C CG    . GLU E 5 43  ? 126.332 94.018  106.213 1.00 27.78  ? 56  GLU C CG    1 
ATOM   6828  C CD    . GLU E 5 43  ? 127.736 93.779  105.697 1.00 32.26  ? 56  GLU C CD    1 
ATOM   6829  O OE1   . GLU E 5 43  ? 127.867 93.102  104.653 1.00 30.71  ? 56  GLU C OE1   1 
ATOM   6830  O OE2   . GLU E 5 43  ? 128.696 94.282  106.327 1.00 27.17  ? 56  GLU C OE2   1 
ATOM   6831  N N     . TYR E 5 44  ? 124.032 97.152  106.307 1.00 23.71  ? 57  TYR C N     1 
ATOM   6832  C CA    . TYR E 5 44  ? 124.060 98.237  107.288 1.00 24.64  ? 57  TYR C CA    1 
ATOM   6833  C C     . TYR E 5 44  ? 122.748 98.310  108.041 1.00 27.01  ? 57  TYR C C     1 
ATOM   6834  O O     . TYR E 5 44  ? 122.732 98.505  109.280 1.00 24.62  ? 57  TYR C O     1 
ATOM   6835  C CB    . TYR E 5 44  ? 124.299 99.580  106.592 1.00 26.90  ? 57  TYR C CB    1 
ATOM   6836  C CG    . TYR E 5 44  ? 123.869 100.760 107.406 1.00 28.79  ? 57  TYR C CG    1 
ATOM   6837  C CD1   . TYR E 5 44  ? 124.598 101.167 108.545 1.00 33.79  ? 57  TYR C CD1   1 
ATOM   6838  C CD2   . TYR E 5 44  ? 122.697 101.434 107.097 1.00 31.43  ? 57  TYR C CD2   1 
ATOM   6839  C CE1   . TYR E 5 44  ? 124.119 102.232 109.364 1.00 34.31  ? 57  TYR C CE1   1 
ATOM   6840  C CE2   . TYR E 5 44  ? 122.222 102.481 107.889 1.00 30.10  ? 57  TYR C CE2   1 
ATOM   6841  C CZ    . TYR E 5 44  ? 122.925 102.869 109.017 1.00 34.37  ? 57  TYR C CZ    1 
ATOM   6842  O OH    . TYR E 5 44  ? 122.399 103.882 109.798 1.00 36.13  ? 57  TYR C OH    1 
ATOM   6843  N N     . LEU E 5 45  ? 121.633 98.192  107.310 1.00 21.84  ? 58  LEU C N     1 
ATOM   6844  C CA    . LEU E 5 45  ? 120.354 98.253  108.014 1.00 21.04  ? 58  LEU C CA    1 
ATOM   6845  C C     . LEU E 5 45  ? 120.214 97.031  108.893 1.00 17.31  ? 58  LEU C C     1 
ATOM   6846  O O     . LEU E 5 45  ? 119.638 97.122  109.981 1.00 23.44  ? 58  LEU C O     1 
ATOM   6847  C CB    . LEU E 5 45  ? 119.171 98.328  107.036 1.00 20.65  ? 58  LEU C CB    1 
ATOM   6848  C CG    . LEU E 5 45  ? 119.112 99.612  106.225 1.00 21.69  ? 58  LEU C CG    1 
ATOM   6849  C CD1   . LEU E 5 45  ? 118.039 99.508  105.099 1.00 22.29  ? 58  LEU C CD1   1 
ATOM   6850  C CD2   . LEU E 5 45  ? 118.807 100.796 107.205 1.00 22.62  ? 58  LEU C CD2   1 
ATOM   6851  N N     . THR E 5 46  ? 120.734 95.877  108.486 1.00 20.52  ? 59  THR C N     1 
ATOM   6852  C CA    . THR E 5 46  ? 120.516 94.760  109.377 1.00 23.08  ? 59  THR C CA    1 
ATOM   6853  C C     . THR E 5 46  ? 121.402 94.898  110.642 1.00 25.28  ? 59  THR C C     1 
ATOM   6854  O O     . THR E 5 46  ? 120.979 94.514  111.746 1.00 25.35  ? 59  THR C O     1 
ATOM   6855  C CB    . THR E 5 46  ? 120.679 93.337  108.721 1.00 32.00  ? 59  THR C CB    1 
ATOM   6856  O OG1   . THR E 5 46  ? 122.003 92.847  108.926 1.00 44.97  ? 59  THR C OG1   1 
ATOM   6857  C CG2   . THR E 5 46  ? 120.285 93.316  107.269 1.00 19.36  ? 59  THR C CG2   1 
ATOM   6858  N N     . ALA E 5 47  ? 122.598 95.480  110.488 1.00 23.93  ? 60  ALA C N     1 
ATOM   6859  C CA    . ALA E 5 47  ? 123.505 95.707  111.639 1.00 21.91  ? 60  ALA C CA    1 
ATOM   6860  C C     . ALA E 5 47  ? 122.795 96.619  112.623 1.00 20.97  ? 60  ALA C C     1 
ATOM   6861  O O     . ALA E 5 47  ? 122.794 96.382  113.824 1.00 21.53  ? 60  ALA C O     1 
ATOM   6862  C CB    . ALA E 5 47  ? 124.839 96.387  111.146 1.00 20.71  ? 60  ALA C CB    1 
ATOM   6863  N N     . GLU E 5 48  ? 122.148 97.664  112.104 1.00 21.33  ? 61  GLU C N     1 
ATOM   6864  C CA    . GLU E 5 48  ? 121.462 98.620  112.953 1.00 22.53  ? 61  GLU C CA    1 
ATOM   6865  C C     . GLU E 5 48  ? 120.309 98.000  113.748 1.00 23.14  ? 61  GLU C C     1 
ATOM   6866  O O     . GLU E 5 48  ? 120.154 98.261  114.977 1.00 20.84  ? 61  GLU C O     1 
ATOM   6867  C CB    . GLU E 5 48  ? 120.927 99.745  112.089 1.00 24.66  ? 61  GLU C CB    1 
ATOM   6868  C CG    . GLU E 5 48  ? 120.137 100.747 112.837 1.00 31.84  ? 61  GLU C CG    1 
ATOM   6869  C CD    . GLU E 5 48  ? 121.019 101.727 113.569 1.00 42.90  ? 61  GLU C CD    1 
ATOM   6870  O OE1   . GLU E 5 48  ? 122.258 101.566 113.480 1.00 46.89  ? 61  GLU C OE1   1 
ATOM   6871  O OE2   . GLU E 5 48  ? 120.475 102.639 114.229 1.00 41.05  ? 61  GLU C OE2   1 
ATOM   6872  N N     . ILE E 5 49  ? 119.469 97.217  113.063 1.00 20.92  ? 62  ILE C N     1 
ATOM   6873  C CA    . ILE E 5 49  ? 118.349 96.606  113.773 1.00 19.84  ? 62  ILE C CA    1 
ATOM   6874  C C     . ILE E 5 49  ? 118.810 95.568  114.772 1.00 18.97  ? 62  ILE C C     1 
ATOM   6875  O O     . ILE E 5 49  ? 118.260 95.490  115.882 1.00 20.29  ? 62  ILE C O     1 
ATOM   6876  C CB    . ILE E 5 49  ? 117.266 96.009  112.793 1.00 23.60  ? 62  ILE C CB    1 
ATOM   6877  C CG1   . ILE E 5 49  ? 116.108 95.444  113.624 1.00 27.06  ? 62  ILE C CG1   1 
ATOM   6878  C CG2   . ILE E 5 49  ? 117.794 94.816  111.991 1.00 23.30  ? 62  ILE C CG2   1 
ATOM   6879  C CD1   . ILE E 5 49  ? 114.782 95.244  112.781 1.00 32.71  ? 62  ILE C CD1   1 
ATOM   6880  N N     . LEU E 5 50  ? 119.821 94.778  114.420 1.00 16.96  ? 63  LEU C N     1 
ATOM   6881  C CA    . LEU E 5 50  ? 120.340 93.770  115.381 1.00 20.89  ? 63  LEU C CA    1 
ATOM   6882  C C     . LEU E 5 50  ? 121.054 94.443  116.569 1.00 21.12  ? 63  LEU C C     1 
ATOM   6883  O O     . LEU E 5 50  ? 120.996 93.955  117.702 1.00 23.34  ? 63  LEU C O     1 
ATOM   6884  C CB    . LEU E 5 50  ? 121.316 92.809  114.696 1.00 19.22  ? 63  LEU C CB    1 
ATOM   6885  C CG    . LEU E 5 50  ? 120.675 91.893  113.640 1.00 21.07  ? 63  LEU C CG    1 
ATOM   6886  C CD1   . LEU E 5 50  ? 121.752 91.094  112.907 1.00 20.05  ? 63  LEU C CD1   1 
ATOM   6887  C CD2   . LEU E 5 50  ? 119.684 90.976  114.360 1.00 21.99  ? 63  LEU C CD2   1 
ATOM   6888  N N     . GLU E 5 51  ? 121.713 95.576  116.326 1.00 22.44  ? 64  GLU C N     1 
ATOM   6889  C CA    . GLU E 5 51  ? 122.369 96.270  117.432 1.00 22.16  ? 64  GLU C CA    1 
ATOM   6890  C C     . GLU E 5 51  ? 121.287 96.619  118.449 1.00 23.94  ? 64  GLU C C     1 
ATOM   6891  O O     . GLU E 5 51  ? 121.372 96.280  119.631 1.00 22.19  ? 64  GLU C O     1 
ATOM   6892  C CB    . GLU E 5 51  ? 123.049 97.562  116.942 1.00 20.36  ? 64  GLU C CB    1 
ATOM   6893  C CG    . GLU E 5 51  ? 123.601 98.410  118.081 1.00 26.82  ? 64  GLU C CG    1 
ATOM   6894  C CD    . GLU E 5 51  ? 124.813 97.753  118.810 1.00 29.19  ? 64  GLU C CD    1 
ATOM   6895  O OE1   . GLU E 5 51  ? 125.281 98.317  119.779 1.00 38.46  ? 64  GLU C OE1   1 
ATOM   6896  O OE2   . GLU E 5 51  ? 125.305 96.692  118.407 1.00 36.58  ? 64  GLU C OE2   1 
ATOM   6897  N N     . LEU E 5 52  ? 120.249 97.310  117.998 1.00 21.19  ? 65  LEU C N     1 
ATOM   6898  C CA    . LEU E 5 52  ? 119.161 97.684  118.914 1.00 23.02  ? 65  LEU C CA    1 
ATOM   6899  C C     . LEU E 5 52  ? 118.364 96.525  119.498 1.00 16.77  ? 65  LEU C C     1 
ATOM   6900  O O     . LEU E 5 52  ? 117.950 96.588  120.654 1.00 20.37  ? 65  LEU C O     1 
ATOM   6901  C CB    . LEU E 5 52  ? 118.185 98.640  118.219 1.00 21.60  ? 65  LEU C CB    1 
ATOM   6902  C CG    . LEU E 5 52  ? 118.875 99.915  117.718 1.00 25.33  ? 65  LEU C CG    1 
ATOM   6903  C CD1   . LEU E 5 52  ? 117.918 100.736 116.809 1.00 19.76  ? 65  LEU C CD1   1 
ATOM   6904  C CD2   . LEU E 5 52  ? 119.333 100.714 118.923 1.00 27.80  ? 65  LEU C CD2   1 
ATOM   6905  N N     . ALA E 5 53  ? 118.107 95.493  118.715 1.00 19.99  ? 66  ALA C N     1 
ATOM   6906  C CA    . ALA E 5 53  ? 117.331 94.360  119.241 1.00 24.25  ? 66  ALA C CA    1 
ATOM   6907  C C     . ALA E 5 53  ? 118.160 93.591  120.278 1.00 23.46  ? 66  ALA C C     1 
ATOM   6908  O O     . ALA E 5 53  ? 117.631 93.172  121.288 1.00 24.40  ? 66  ALA C O     1 
ATOM   6909  C CB    . ALA E 5 53  ? 116.911 93.422  118.118 1.00 21.90  ? 66  ALA C CB    1 
ATOM   6910  N N     . GLY E 5 54  ? 119.455 93.397  120.033 1.00 26.49  ? 67  GLY C N     1 
ATOM   6911  C CA    . GLY E 5 54  ? 120.269 92.728  121.046 1.00 23.05  ? 67  GLY C CA    1 
ATOM   6912  C C     . GLY E 5 54  ? 120.272 93.566  122.328 1.00 23.05  ? 67  GLY C C     1 
ATOM   6913  O O     . GLY E 5 54  ? 120.322 93.012  123.424 1.00 25.49  ? 67  GLY C O     1 
ATOM   6914  N N     . ASN E 5 55  ? 120.229 94.897  122.227 1.00 23.04  ? 68  ASN C N     1 
ATOM   6915  C CA    . ASN E 5 55  ? 120.206 95.715  123.445 1.00 23.27  ? 68  ASN C CA    1 
ATOM   6916  C C     . ASN E 5 55  ? 118.864 95.493  124.164 1.00 28.98  ? 68  ASN C C     1 
ATOM   6917  O O     . ASN E 5 55  ? 118.818 95.391  125.401 1.00 28.82  ? 68  ASN C O     1 
ATOM   6918  C CB    . ASN E 5 55  ? 120.365 97.218  123.141 1.00 24.15  ? 68  ASN C CB    1 
ATOM   6919  C CG    . ASN E 5 55  ? 121.765 97.593  122.613 1.00 27.84  ? 68  ASN C CG    1 
ATOM   6920  O OD1   . ASN E 5 55  ? 122.692 96.800  122.633 1.00 28.73  ? 68  ASN C OD1   1 
ATOM   6921  N ND2   . ASN E 5 55  ? 121.893 98.803  122.121 1.00 27.18  ? 68  ASN C ND2   1 
ATOM   6922  N N     . ALA E 5 56  ? 117.763 95.418  123.395 1.00 26.89  ? 69  ALA C N     1 
ATOM   6923  C CA    . ALA E 5 56  ? 116.444 95.188  124.019 1.00 28.22  ? 69  ALA C CA    1 
ATOM   6924  C C     . ALA E 5 56  ? 116.489 93.824  124.700 1.00 27.74  ? 69  ALA C C     1 
ATOM   6925  O O     . ALA E 5 56  ? 115.974 93.656  125.803 1.00 29.76  ? 69  ALA C O     1 
ATOM   6926  C CB    . ALA E 5 56  ? 115.301 95.219  122.955 1.00 27.75  ? 69  ALA C CB    1 
ATOM   6927  N N     . ALA E 5 57  ? 117.126 92.852  124.063 1.00 25.40  ? 70  ALA C N     1 
ATOM   6928  C CA    . ALA E 5 57  ? 117.199 91.527  124.666 1.00 28.32  ? 70  ALA C CA    1 
ATOM   6929  C C     . ALA E 5 57  ? 117.991 91.599  125.971 1.00 31.69  ? 70  ALA C C     1 
ATOM   6930  O O     . ALA E 5 57  ? 117.588 91.032  126.989 1.00 31.09  ? 70  ALA C O     1 
ATOM   6931  C CB    . ALA E 5 57  ? 117.846 90.524  123.696 1.00 26.77  ? 70  ALA C CB    1 
ATOM   6932  N N     . ARG E 5 58  ? 119.120 92.309  125.949 1.00 33.24  ? 71  ARG C N     1 
ATOM   6933  C CA    . ARG E 5 58  ? 119.925 92.445  127.152 1.00 33.28  ? 71  ARG C CA    1 
ATOM   6934  C C     . ARG E 5 58  ? 119.105 93.121  128.234 1.00 31.71  ? 71  ARG C C     1 
ATOM   6935  O O     . ARG E 5 58  ? 119.140 92.693  129.386 1.00 33.06  ? 71  ARG C O     1 
ATOM   6936  C CB    . ARG E 5 58  ? 121.192 93.269  126.893 1.00 38.54  ? 71  ARG C CB    1 
ATOM   6937  C CG    . ARG E 5 58  ? 122.074 93.409  128.137 1.00 42.97  ? 71  ARG C CG    1 
ATOM   6938  C CD    . ARG E 5 58  ? 123.382 94.170  127.873 1.00 48.03  ? 71  ARG C CD    1 
ATOM   6939  N NE    . ARG E 5 58  ? 123.134 95.564  127.508 1.00 56.72  ? 71  ARG C NE    1 
ATOM   6940  C CZ    . ARG E 5 58  ? 122.921 96.552  128.378 1.00 61.36  ? 71  ARG C CZ    1 
ATOM   6941  N NH1   . ARG E 5 58  ? 122.923 96.320  129.683 1.00 59.53  ? 71  ARG C NH1   1 
ATOM   6942  N NH2   . ARG E 5 58  ? 122.696 97.783  127.937 1.00 61.50  ? 71  ARG C NH2   1 
ATOM   6943  N N     . ASP E 5 59  ? 118.379 94.178  127.865 1.00 35.37  ? 72  ASP C N     1 
ATOM   6944  C CA    . ASP E 5 59  ? 117.532 94.916  128.809 1.00 35.99  ? 72  ASP C CA    1 
ATOM   6945  C C     . ASP E 5 59  ? 116.527 93.973  129.485 1.00 39.00  ? 72  ASP C C     1 
ATOM   6946  O O     . ASP E 5 59  ? 116.136 94.184  130.618 1.00 38.50  ? 72  ASP C O     1 
ATOM   6947  C CB    . ASP E 5 59  ? 116.704 95.998  128.094 1.00 38.73  ? 72  ASP C CB    1 
ATOM   6948  C CG    . ASP E 5 59  ? 117.536 97.180  127.590 1.00 38.91  ? 72  ASP C CG    1 
ATOM   6949  O OD1   . ASP E 5 59  ? 118.672 97.392  128.058 1.00 35.80  ? 72  ASP C OD1   1 
ATOM   6950  O OD2   . ASP E 5 59  ? 117.020 97.918  126.719 1.00 41.41  ? 72  ASP C OD2   1 
ATOM   6951  N N     . ASN E 5 60  ? 116.094 92.951  128.756 1.00 39.30  ? 73  ASN C N     1 
ATOM   6952  C CA    . ASN E 5 60  ? 115.111 92.004  129.245 1.00 42.51  ? 73  ASN C CA    1 
ATOM   6953  C C     . ASN E 5 60  ? 115.784 90.751  129.788 1.00 43.45  ? 73  ASN C C     1 
ATOM   6954  O O     . ASN E 5 60  ? 115.139 89.712  129.966 1.00 43.26  ? 73  ASN C O     1 
ATOM   6955  C CB    . ASN E 5 60  ? 114.135 91.663  128.108 1.00 45.62  ? 73  ASN C CB    1 
ATOM   6956  C CG    . ASN E 5 60  ? 113.222 92.832  127.747 1.00 51.80  ? 73  ASN C CG    1 
ATOM   6957  O OD1   . ASN E 5 60  ? 112.201 93.056  128.404 1.00 56.49  ? 73  ASN C OD1   1 
ATOM   6958  N ND2   . ASN E 5 60  ? 113.593 93.597  126.716 1.00 49.43  ? 73  ASN C ND2   1 
ATOM   6959  N N     . LYS E 5 61  ? 117.089 90.853  130.032 1.00 41.81  ? 74  LYS C N     1 
ATOM   6960  C CA    . LYS E 5 61  ? 117.861 89.752  130.586 1.00 42.14  ? 74  LYS C CA    1 
ATOM   6961  C C     . LYS E 5 61  ? 117.827 88.474  129.767 1.00 42.17  ? 74  LYS C C     1 
ATOM   6962  O O     . LYS E 5 61  ? 117.912 87.370  130.316 1.00 43.88  ? 74  LYS C O     1 
ATOM   6963  C CB    . LYS E 5 61  ? 117.379 89.470  132.009 1.00 48.68  ? 74  LYS C CB    1 
ATOM   6964  C CG    . LYS E 5 61  ? 117.469 90.712  132.903 1.00 53.06  ? 74  LYS C CG    1 
ATOM   6965  C CD    . LYS E 5 61  ? 116.848 90.505  134.269 1.00 59.61  ? 74  LYS C CD    1 
ATOM   6966  C CE    . LYS E 5 61  ? 116.838 91.811  135.052 1.00 62.45  ? 74  LYS C CE    1 
ATOM   6967  N NZ    . LYS E 5 61  ? 115.719 91.860  136.033 1.00 63.91  ? 74  LYS C NZ    1 
ATOM   6968  N N     . LYS E 5 62  ? 117.725 88.619  128.450 1.00 37.65  ? 75  LYS C N     1 
ATOM   6969  C CA    . LYS E 5 62  ? 117.692 87.475  127.559 1.00 33.09  ? 75  LYS C CA    1 
ATOM   6970  C C     . LYS E 5 62  ? 118.925 87.503  126.686 1.00 33.40  ? 75  LYS C C     1 
ATOM   6971  O O     . LYS E 5 62  ? 119.433 88.566  126.364 1.00 33.26  ? 75  LYS C O     1 
ATOM   6972  C CB    . LYS E 5 62  ? 116.441 87.530  126.672 1.00 36.28  ? 75  LYS C CB    1 
ATOM   6973  C CG    . LYS E 5 62  ? 115.142 87.632  127.462 1.00 37.75  ? 75  LYS C CG    1 
ATOM   6974  C CD    . LYS E 5 62  ? 114.742 86.290  128.045 1.00 46.72  ? 75  LYS C CD    1 
ATOM   6975  C CE    . LYS E 5 62  ? 113.408 86.385  128.804 1.00 50.57  ? 75  LYS C CE    1 
ATOM   6976  N NZ    . LYS E 5 62  ? 113.580 87.075  130.118 1.00 54.51  ? 75  LYS C NZ    1 
ATOM   6977  N N     . THR E 5 63  ? 119.364 86.328  126.265 1.00 29.77  ? 76  THR C N     1 
ATOM   6978  C CA    . THR E 5 63  ? 120.541 86.185  125.424 1.00 34.43  ? 76  THR C CA    1 
ATOM   6979  C C     . THR E 5 63  ? 120.153 85.921  123.984 1.00 33.08  ? 76  THR C C     1 
ATOM   6980  O O     . THR E 5 63  ? 120.982 86.048  123.050 1.00 33.02  ? 76  THR C O     1 
ATOM   6981  C CB    . THR E 5 63  ? 121.404 85.035  125.968 1.00 35.72  ? 76  THR C CB    1 
ATOM   6982  O OG1   . THR E 5 63  ? 122.198 85.554  127.046 1.00 45.10  ? 76  THR C OG1   1 
ATOM   6983  C CG2   . THR E 5 63  ? 122.275 84.442  124.913 1.00 43.01  ? 76  THR C CG2   1 
ATOM   6984  N N     . ARG E 5 64  ? 118.887 85.567  123.793 1.00 28.49  ? 77  ARG C N     1 
ATOM   6985  C CA    . ARG E 5 64  ? 118.405 85.268  122.452 1.00 29.16  ? 77  ARG C CA    1 
ATOM   6986  C C     . ARG E 5 64  ? 117.366 86.306  122.007 1.00 26.23  ? 77  ARG C C     1 
ATOM   6987  O O     . ARG E 5 64  ? 116.363 86.559  122.696 1.00 22.07  ? 77  ARG C O     1 
ATOM   6988  C CB    . ARG E 5 64  ? 117.780 83.861  122.430 1.00 33.93  ? 77  ARG C CB    1 
ATOM   6989  C CG    . ARG E 5 64  ? 117.274 83.406  121.073 1.00 38.73  ? 77  ARG C CG    1 
ATOM   6990  C CD    . ARG E 5 64  ? 116.580 82.051  121.165 1.00 38.34  ? 77  ARG C CD    1 
ATOM   6991  N NE    . ARG E 5 64  ? 117.519 81.012  121.553 1.00 37.57  ? 77  ARG C NE    1 
ATOM   6992  C CZ    . ARG E 5 64  ? 117.280 80.071  122.469 1.00 41.46  ? 77  ARG C CZ    1 
ATOM   6993  N NH1   . ARG E 5 64  ? 116.123 80.025  123.112 1.00 39.26  ? 77  ARG C NH1   1 
ATOM   6994  N NH2   . ARG E 5 64  ? 118.205 79.158  122.730 1.00 39.56  ? 77  ARG C NH2   1 
ATOM   6995  N N     . ILE E 5 65  ? 117.618 86.888  120.846 1.00 24.88  ? 78  ILE C N     1 
ATOM   6996  C CA    . ILE E 5 65  ? 116.710 87.870  120.262 1.00 24.17  ? 78  ILE C CA    1 
ATOM   6997  C C     . ILE E 5 65  ? 115.425 87.159  119.782 1.00 22.00  ? 78  ILE C C     1 
ATOM   6998  O O     . ILE E 5 65  ? 115.488 86.123  119.068 1.00 20.63  ? 78  ILE C O     1 
ATOM   6999  C CB    . ILE E 5 65  ? 117.365 88.559  119.085 1.00 22.66  ? 78  ILE C CB    1 
ATOM   7000  C CG1   . ILE E 5 65  ? 118.414 89.579  119.608 1.00 23.51  ? 78  ILE C CG1   1 
ATOM   7001  C CG2   . ILE E 5 65  ? 116.283 89.302  118.269 1.00 24.34  ? 78  ILE C CG2   1 
ATOM   7002  C CD1   . ILE E 5 65  ? 119.316 90.102  118.502 1.00 19.44  ? 78  ILE C CD1   1 
ATOM   7003  N N     . ILE E 5 66  ? 114.275 87.666  120.223 1.00 22.50  ? 79  ILE C N     1 
ATOM   7004  C CA    . ILE E 5 66  ? 112.985 87.102  119.791 1.00 22.83  ? 79  ILE C CA    1 
ATOM   7005  C C     . ILE E 5 66  ? 112.210 88.230  119.086 1.00 25.02  ? 79  ILE C C     1 
ATOM   7006  O O     . ILE E 5 66  ? 112.642 89.397  119.126 1.00 21.25  ? 79  ILE C O     1 
ATOM   7007  C CB    . ILE E 5 66  ? 112.154 86.514  120.990 1.00 22.19  ? 79  ILE C CB    1 
ATOM   7008  C CG1   . ILE E 5 66  ? 111.843 87.586  122.033 1.00 21.18  ? 79  ILE C CG1   1 
ATOM   7009  C CG2   . ILE E 5 66  ? 112.948 85.353  121.619 1.00 24.69  ? 79  ILE C CG2   1 
ATOM   7010  C CD1   . ILE E 5 66  ? 110.747 87.167  123.178 1.00 21.10  ? 79  ILE C CD1   1 
ATOM   7011  N N     . PRO E 5 67  ? 111.054 87.912  118.455 1.00 21.46  ? 80  PRO C N     1 
ATOM   7012  C CA    . PRO E 5 67  ? 110.333 89.008  117.774 1.00 17.12  ? 80  PRO C CA    1 
ATOM   7013  C C     . PRO E 5 67  ? 110.023 90.191  118.636 1.00 14.76  ? 80  PRO C C     1 
ATOM   7014  O O     . PRO E 5 67  ? 110.086 91.319  118.172 1.00 17.73  ? 80  PRO C O     1 
ATOM   7015  C CB    . PRO E 5 67  ? 109.068 88.322  117.195 1.00 18.27  ? 80  PRO C CB    1 
ATOM   7016  C CG    . PRO E 5 67  ? 109.596 86.892  116.859 1.00 18.13  ? 80  PRO C CG    1 
ATOM   7017  C CD    . PRO E 5 67  ? 110.509 86.580  118.099 1.00 21.02  ? 80  PRO C CD    1 
ATOM   7018  N N     . ARG E 5 68  ? 109.634 89.977  119.892 1.00 16.68  ? 81  ARG C N     1 
ATOM   7019  C CA    . ARG E 5 68  ? 109.356 91.116  120.754 1.00 17.60  ? 81  ARG C CA    1 
ATOM   7020  C C     . ARG E 5 68  ? 110.554 92.089  120.786 1.00 20.24  ? 81  ARG C C     1 
ATOM   7021  O O     . ARG E 5 68  ? 110.368 93.310  120.855 1.00 20.57  ? 81  ARG C O     1 
ATOM   7022  C CB    . ARG E 5 68  ? 109.038 90.672  122.224 1.00 21.85  ? 81  ARG C CB    1 
ATOM   7023  C CG    . ARG E 5 68  ? 109.414 91.749  123.259 1.00 28.24  ? 81  ARG C CG    1 
ATOM   7024  C CD    . ARG E 5 68  ? 108.343 92.461  124.172 1.00 36.22  ? 81  ARG C CD    1 
ATOM   7025  N NE    . ARG E 5 68  ? 107.350 93.160  123.422 1.00 33.52  ? 81  ARG C NE    1 
ATOM   7026  C CZ    . ARG E 5 68  ? 106.496 94.099  123.835 1.00 31.85  ? 81  ARG C CZ    1 
ATOM   7027  N NH1   . ARG E 5 68  ? 106.435 94.590  125.077 1.00 26.21  ? 81  ARG C NH1   1 
ATOM   7028  N NH2   . ARG E 5 68  ? 105.612 94.515  122.935 1.00 27.41  ? 81  ARG C NH2   1 
ATOM   7029  N N     . HIS E 5 69  ? 111.784 91.569  120.755 1.00 22.94  ? 82  HIS C N     1 
ATOM   7030  C CA    . HIS E 5 69  ? 112.984 92.459  120.845 1.00 22.54  ? 82  HIS C CA    1 
ATOM   7031  C C     . HIS E 5 69  ? 113.165 93.240  119.574 1.00 24.65  ? 82  HIS C C     1 
ATOM   7032  O O     . HIS E 5 69  ? 113.628 94.388  119.604 1.00 23.29  ? 82  HIS C O     1 
ATOM   7033  C CB    . HIS E 5 69  ? 114.260 91.626  121.124 1.00 19.06  ? 82  HIS C CB    1 
ATOM   7034  C CG    . HIS E 5 69  ? 114.177 90.863  122.402 1.00 18.72  ? 82  HIS C CG    1 
ATOM   7035  N ND1   . HIS E 5 69  ? 114.699 89.598  122.550 1.00 21.58  ? 82  HIS C ND1   1 
ATOM   7036  C CD2   . HIS E 5 69  ? 113.583 91.169  123.577 1.00 23.21  ? 82  HIS C CD2   1 
ATOM   7037  C CE1   . HIS E 5 69  ? 114.415 89.150  123.760 1.00 21.53  ? 82  HIS C CE1   1 
ATOM   7038  N NE2   . HIS E 5 69  ? 113.737 90.082  124.405 1.00 22.30  ? 82  HIS C NE2   1 
ATOM   7039  N N     . LEU E 5 70  ? 112.848 92.601  118.449 1.00 20.11  ? 83  LEU C N     1 
ATOM   7040  C CA    . LEU E 5 70  ? 112.907 93.302  117.180 1.00 19.83  ? 83  LEU C CA    1 
ATOM   7041  C C     . LEU E 5 70  ? 111.862 94.423  117.216 1.00 21.49  ? 83  LEU C C     1 
ATOM   7042  O O     . LEU E 5 70  ? 112.135 95.562  116.803 1.00 21.94  ? 83  LEU C O     1 
ATOM   7043  C CB    . LEU E 5 70  ? 112.625 92.331  116.044 1.00 18.60  ? 83  LEU C CB    1 
ATOM   7044  C CG    . LEU E 5 70  ? 113.709 91.272  115.826 1.00 24.86  ? 83  LEU C CG    1 
ATOM   7045  C CD1   . LEU E 5 70  ? 113.285 90.284  114.749 1.00 20.02  ? 83  LEU C CD1   1 
ATOM   7046  C CD2   . LEU E 5 70  ? 115.014 91.985  115.493 1.00 20.52  ? 83  LEU C CD2   1 
ATOM   7047  N N     . GLN E 5 71  ? 110.675 94.141  117.757 1.00 19.66  ? 84  GLN C N     1 
ATOM   7048  C CA    . GLN E 5 71  ? 109.624 95.172  117.819 1.00 19.07  ? 84  GLN C CA    1 
ATOM   7049  C C     . GLN E 5 71  ? 109.993 96.315  118.767 1.00 19.75  ? 84  GLN C C     1 
ATOM   7050  O O     . GLN E 5 71  ? 109.829 97.487  118.430 1.00 20.74  ? 84  GLN C O     1 
ATOM   7051  C CB    . GLN E 5 71  ? 108.273 94.552  118.270 1.00 22.63  ? 84  GLN C CB    1 
ATOM   7052  C CG    . GLN E 5 71  ? 107.208 95.610  118.610 1.00 21.32  ? 84  GLN C CG    1 
ATOM   7053  C CD    . GLN E 5 71  ? 106.446 96.103  117.372 1.00 22.96  ? 84  GLN C CD    1 
ATOM   7054  O OE1   . GLN E 5 71  ? 107.002 96.134  116.278 1.00 18.94  ? 84  GLN C OE1   1 
ATOM   7055  N NE2   . GLN E 5 71  ? 105.175 96.512  117.555 1.00 17.42  ? 84  GLN C NE2   1 
ATOM   7056  N N     . LEU E 5 72  ? 110.459 95.998  119.975 1.00 18.78  ? 85  LEU C N     1 
ATOM   7057  C CA    . LEU E 5 72  ? 110.865 97.068  120.877 1.00 19.58  ? 85  LEU C CA    1 
ATOM   7058  C C     . LEU E 5 72  ? 111.932 97.939  120.218 1.00 19.13  ? 85  LEU C C     1 
ATOM   7059  O O     . LEU E 5 72  ? 111.895 99.142  120.348 1.00 23.31  ? 85  LEU C O     1 
ATOM   7060  C CB    . LEU E 5 72  ? 111.446 96.511  122.204 1.00 24.12  ? 85  LEU C CB    1 
ATOM   7061  C CG    . LEU E 5 72  ? 110.460 95.709  123.071 1.00 26.06  ? 85  LEU C CG    1 
ATOM   7062  C CD1   . LEU E 5 72  ? 111.169 95.124  124.296 1.00 29.15  ? 85  LEU C CD1   1 
ATOM   7063  C CD2   . LEU E 5 72  ? 109.333 96.604  123.491 1.00 27.43  ? 85  LEU C CD2   1 
ATOM   7064  N N     . ALA E 5 73  ? 112.863 97.325  119.496 1.00 19.45  ? 86  ALA C N     1 
ATOM   7065  C CA    . ALA E 5 73  ? 113.978 98.055  118.853 1.00 23.73  ? 86  ALA C CA    1 
ATOM   7066  C C     . ALA E 5 73  ? 113.476 99.016  117.778 1.00 23.28  ? 86  ALA C C     1 
ATOM   7067  O O     . ALA E 5 73  ? 113.850 100.191 117.690 1.00 20.84  ? 86  ALA C O     1 
ATOM   7068  C CB    . ALA E 5 73  ? 114.975 97.045  118.228 1.00 20.87  ? 86  ALA C CB    1 
ATOM   7069  N N     . VAL E 5 74  ? 112.622 98.486  116.931 1.00 21.38  ? 87  VAL C N     1 
ATOM   7070  C CA    . VAL E 5 74  ? 112.035 99.264  115.869 1.00 17.10  ? 87  VAL C CA    1 
ATOM   7071  C C     . VAL E 5 74  ? 111.115 100.346 116.390 1.00 17.86  ? 87  VAL C C     1 
ATOM   7072  O O     . VAL E 5 74  ? 111.250 101.527 115.998 1.00 20.61  ? 87  VAL C O     1 
ATOM   7073  C CB    . VAL E 5 74  ? 111.261 98.303  114.913 1.00 17.57  ? 87  VAL C CB    1 
ATOM   7074  C CG1   . VAL E 5 74  ? 110.361 99.078  113.971 1.00 19.02  ? 87  VAL C CG1   1 
ATOM   7075  C CG2   . VAL E 5 74  ? 112.277 97.505  114.113 1.00 20.95  ? 87  VAL C CG2   1 
ATOM   7076  N N     . ARG E 5 75  ? 110.186 99.989  117.285 1.00 17.11  ? 88  ARG C N     1 
ATOM   7077  C CA    . ARG E 5 75  ? 109.232 100.991 117.741 1.00 19.66  ? 88  ARG C CA    1 
ATOM   7078  C C     . ARG E 5 75  ? 109.826 102.046 118.660 1.00 21.66  ? 88  ARG C C     1 
ATOM   7079  O O     . ARG E 5 75  ? 109.324 103.155 118.723 1.00 18.66  ? 88  ARG C O     1 
ATOM   7080  C CB    . ARG E 5 75  ? 108.001 100.355 118.386 1.00 18.23  ? 88  ARG C CB    1 
ATOM   7081  C CG    . ARG E 5 75  ? 107.258 99.340  117.433 1.00 17.53  ? 88  ARG C CG    1 
ATOM   7082  C CD    . ARG E 5 75  ? 107.000 99.945  116.021 1.00 20.06  ? 88  ARG C CD    1 
ATOM   7083  N NE    . ARG E 5 75  ? 106.703 98.913  115.013 1.00 19.49  ? 88  ARG C NE    1 
ATOM   7084  C CZ    . ARG E 5 75  ? 106.632 99.127  113.698 1.00 19.69  ? 88  ARG C CZ    1 
ATOM   7085  N NH1   . ARG E 5 75  ? 106.820 100.338 113.188 1.00 17.71  ? 88  ARG C NH1   1 
ATOM   7086  N NH2   . ARG E 5 75  ? 106.436 98.108  112.884 1.00 19.59  ? 88  ARG C NH2   1 
ATOM   7087  N N     . ASN E 5 76  ? 110.886 101.706 119.380 1.00 20.95  ? 89  ASN C N     1 
ATOM   7088  C CA    . ASN E 5 76  ? 111.515 102.720 120.223 1.00 24.98  ? 89  ASN C CA    1 
ATOM   7089  C C     . ASN E 5 76  ? 112.509 103.595 119.443 1.00 27.51  ? 89  ASN C C     1 
ATOM   7090  O O     . ASN E 5 76  ? 113.059 104.542 119.990 1.00 27.32  ? 89  ASN C O     1 
ATOM   7091  C CB    . ASN E 5 76  ? 112.231 102.069 121.390 1.00 23.84  ? 89  ASN C CB    1 
ATOM   7092  C CG    . ASN E 5 76  ? 111.281 101.706 122.492 1.00 23.41  ? 89  ASN C CG    1 
ATOM   7093  O OD1   . ASN E 5 76  ? 110.493 102.527 122.900 1.00 25.14  ? 89  ASN C OD1   1 
ATOM   7094  N ND2   . ASN E 5 76  ? 111.348 100.487 122.972 1.00 26.00  ? 89  ASN C ND2   1 
ATOM   7095  N N     . ASP E 5 77  ? 112.740 103.280 118.167 1.00 26.30  ? 90  ASP C N     1 
ATOM   7096  C CA    . ASP E 5 77  ? 113.691 104.069 117.358 1.00 24.30  ? 90  ASP C CA    1 
ATOM   7097  C C     . ASP E 5 77  ? 112.912 104.855 116.317 1.00 25.15  ? 90  ASP C C     1 
ATOM   7098  O O     . ASP E 5 77  ? 112.280 104.273 115.431 1.00 24.15  ? 90  ASP C O     1 
ATOM   7099  C CB    . ASP E 5 77  ? 114.671 103.156 116.634 1.00 21.78  ? 90  ASP C CB    1 
ATOM   7100  C CG    . ASP E 5 77  ? 115.701 103.948 115.819 1.00 30.04  ? 90  ASP C CG    1 
ATOM   7101  O OD1   . ASP E 5 77  ? 116.628 104.514 116.413 1.00 28.13  ? 90  ASP C OD1   1 
ATOM   7102  O OD2   . ASP E 5 77  ? 115.571 104.044 114.596 1.00 26.64  ? 90  ASP C OD2   1 
ATOM   7103  N N     . GLU E 5 78  ? 112.968 106.171 116.401 1.00 24.89  ? 91  GLU C N     1 
ATOM   7104  C CA    . GLU E 5 78  ? 112.221 107.004 115.488 1.00 27.05  ? 91  GLU C CA    1 
ATOM   7105  C C     . GLU E 5 78  ? 112.345 106.672 114.003 1.00 27.77  ? 91  GLU C C     1 
ATOM   7106  O O     . GLU E 5 78  ? 111.336 106.568 113.304 1.00 27.23  ? 91  GLU C O     1 
ATOM   7107  C CB    . GLU E 5 78  ? 112.587 108.464 115.716 1.00 34.26  ? 91  GLU C CB    1 
ATOM   7108  C CG    . GLU E 5 78  ? 111.413 109.289 116.142 1.00 46.67  ? 91  GLU C CG    1 
ATOM   7109  C CD    . GLU E 5 78  ? 111.807 110.697 116.548 1.00 55.05  ? 91  GLU C CD    1 
ATOM   7110  O OE1   . GLU E 5 78  ? 112.359 111.433 115.694 1.00 54.38  ? 91  GLU C OE1   1 
ATOM   7111  O OE2   . GLU E 5 78  ? 111.557 111.055 117.723 1.00 59.30  ? 91  GLU C OE2   1 
ATOM   7112  N N     . GLU E 5 79  ? 113.568 106.510 113.509 1.00 26.02  ? 92  GLU C N     1 
ATOM   7113  C CA    . GLU E 5 79  ? 113.748 106.230 112.081 1.00 26.82  ? 92  GLU C CA    1 
ATOM   7114  C C     . GLU E 5 79  ? 113.341 104.826 111.648 1.00 23.84  ? 92  GLU C C     1 
ATOM   7115  O O     . GLU E 5 79  ? 112.719 104.659 110.617 1.00 22.93  ? 92  GLU C O     1 
ATOM   7116  C CB    . GLU E 5 79  ? 115.196 106.549 111.650 1.00 27.45  ? 92  GLU C CB    1 
ATOM   7117  C CG    . GLU E 5 79  ? 115.601 107.970 112.064 1.00 36.07  ? 92  GLU C CG    1 
ATOM   7118  C CD    . GLU E 5 79  ? 116.703 108.584 111.204 1.00 41.08  ? 92  GLU C CD    1 
ATOM   7119  O OE1   . GLU E 5 79  ? 117.621 107.844 110.796 1.00 43.16  ? 92  GLU C OE1   1 
ATOM   7120  O OE2   . GLU E 5 79  ? 116.642 109.819 110.955 1.00 43.10  ? 92  GLU C OE2   1 
ATOM   7121  N N     . LEU E 5 80  ? 113.698 103.812 112.417 1.00 22.53  ? 93  LEU C N     1 
ATOM   7122  C CA    . LEU E 5 80  ? 113.292 102.466 112.043 1.00 23.42  ? 93  LEU C CA    1 
ATOM   7123  C C     . LEU E 5 80  ? 111.745 102.361 112.128 1.00 20.57  ? 93  LEU C C     1 
ATOM   7124  O O     . LEU E 5 80  ? 111.106 101.741 111.297 1.00 20.92  ? 93  LEU C O     1 
ATOM   7125  C CB    . LEU E 5 80  ? 113.955 101.447 112.963 1.00 22.65  ? 93  LEU C CB    1 
ATOM   7126  C CG    . LEU E 5 80  ? 115.445 101.192 112.678 1.00 22.49  ? 93  LEU C CG    1 
ATOM   7127  C CD1   . LEU E 5 80  ? 115.960 100.189 113.701 1.00 24.89  ? 93  LEU C CD1   1 
ATOM   7128  C CD2   . LEU E 5 80  ? 115.616 100.629 111.252 1.00 20.75  ? 93  LEU C CD2   1 
ATOM   7129  N N     . ASN E 5 81  ? 111.153 102.992 113.132 1.00 21.66  ? 94  ASN C N     1 
ATOM   7130  C CA    . ASN E 5 81  ? 109.705 102.995 113.250 1.00 21.63  ? 94  ASN C CA    1 
ATOM   7131  C C     . ASN E 5 81  ? 109.045 103.571 111.983 1.00 25.81  ? 94  ASN C C     1 
ATOM   7132  O O     . ASN E 5 81  ? 108.045 103.028 111.471 1.00 23.06  ? 94  ASN C O     1 
ATOM   7133  C CB    . ASN E 5 81  ? 109.275 103.813 114.439 1.00 21.76  ? 94  ASN C CB    1 
ATOM   7134  C CG    . ASN E 5 81  ? 107.761 103.799 114.620 1.00 27.92  ? 94  ASN C CG    1 
ATOM   7135  O OD1   . ASN E 5 81  ? 107.138 102.734 114.735 1.00 23.54  ? 94  ASN C OD1   1 
ATOM   7136  N ND2   . ASN E 5 81  ? 107.178 104.963 114.659 1.00 23.98  ? 94  ASN C ND2   1 
ATOM   7137  N N     . LYS E 5 82  ? 109.608 104.660 111.465 1.00 23.63  ? 95  LYS C N     1 
ATOM   7138  C CA    . LYS E 5 82  ? 109.082 105.257 110.256 1.00 27.38  ? 95  LYS C CA    1 
ATOM   7139  C C     . LYS E 5 82  ? 109.298 104.335 109.038 1.00 26.91  ? 95  LYS C C     1 
ATOM   7140  O O     . LYS E 5 82  ? 108.367 104.057 108.265 1.00 26.27  ? 95  LYS C O     1 
ATOM   7141  C CB    . LYS E 5 82  ? 109.734 106.629 110.047 1.00 34.31  ? 95  LYS C CB    1 
ATOM   7142  C CG    . LYS E 5 82  ? 109.175 107.435 108.886 1.00 42.14  ? 95  LYS C CG    1 
ATOM   7143  C CD    . LYS E 5 82  ? 109.576 108.918 109.074 1.00 54.21  ? 95  LYS C CD    1 
ATOM   7144  C CE    . LYS E 5 82  ? 108.889 109.841 108.072 1.00 59.55  ? 95  LYS C CE    1 
ATOM   7145  N NZ    . LYS E 5 82  ? 108.919 111.273 108.525 1.00 64.03  ? 95  LYS C NZ    1 
ATOM   7146  N N     . LEU E 5 83  ? 110.513 103.826 108.877 1.00 22.62  ? 96  LEU C N     1 
ATOM   7147  C CA    . LEU E 5 83  ? 110.796 102.932 107.753 1.00 20.18  ? 96  LEU C CA    1 
ATOM   7148  C C     . LEU E 5 83  ? 109.861 101.721 107.772 1.00 20.54  ? 96  LEU C C     1 
ATOM   7149  O O     . LEU E 5 83  ? 109.490 101.210 106.722 1.00 22.22  ? 96  LEU C O     1 
ATOM   7150  C CB    . LEU E 5 83  ? 112.250 102.430 107.806 1.00 19.20  ? 96  LEU C CB    1 
ATOM   7151  C CG    . LEU E 5 83  ? 112.620 101.397 106.739 1.00 23.04  ? 96  LEU C CG    1 
ATOM   7152  C CD1   . LEU E 5 83  ? 112.689 102.102 105.359 1.00 22.44  ? 96  LEU C CD1   1 
ATOM   7153  C CD2   . LEU E 5 83  ? 113.988 100.753 107.078 1.00 22.32  ? 96  LEU C CD2   1 
ATOM   7154  N N     . LEU E 5 84  ? 109.492 101.263 108.968 1.00 20.38  ? 97  LEU C N     1 
ATOM   7155  C CA    . LEU E 5 84  ? 108.616 100.097 109.101 1.00 20.82  ? 97  LEU C CA    1 
ATOM   7156  C C     . LEU E 5 84  ? 107.244 100.538 109.602 1.00 20.76  ? 97  LEU C C     1 
ATOM   7157  O O     . LEU E 5 84  ? 106.553 99.777  110.299 1.00 20.21  ? 97  LEU C O     1 
ATOM   7158  C CB    . LEU E 5 84  ? 109.242 99.073  110.075 1.00 19.73  ? 97  LEU C CB    1 
ATOM   7159  C CG    . LEU E 5 84  ? 110.678 98.621  109.638 1.00 28.03  ? 97  LEU C CG    1 
ATOM   7160  C CD1   . LEU E 5 84  ? 111.167 97.466  110.536 1.00 27.43  ? 97  LEU C CD1   1 
ATOM   7161  C CD2   . LEU E 5 84  ? 110.687 98.156  108.201 1.00 25.76  ? 97  LEU C CD2   1 
ATOM   7162  N N     . GLY E 5 85  ? 106.840 101.756 109.216 1.00 19.46  ? 98  GLY C N     1 
ATOM   7163  C CA    . GLY E 5 85  ? 105.583 102.305 109.687 1.00 20.58  ? 98  GLY C CA    1 
ATOM   7164  C C     . GLY E 5 85  ? 104.339 101.524 109.269 1.00 23.59  ? 98  GLY C C     1 
ATOM   7165  O O     . GLY E 5 85  ? 103.323 101.597 109.922 1.00 21.83  ? 98  GLY C O     1 
ATOM   7166  N N     . ARG E 5 86  ? 104.440 100.748 108.203 1.00 18.48  ? 99  ARG C N     1 
ATOM   7167  C CA    . ARG E 5 86  ? 103.301 99.992  107.711 1.00 22.22  ? 99  ARG C CA    1 
ATOM   7168  C C     . ARG E 5 86  ? 103.650 98.525  107.691 1.00 23.20  ? 99  ARG C C     1 
ATOM   7169  O O     . ARG E 5 86  ? 103.208 97.765  106.849 1.00 25.01  ? 99  ARG C O     1 
ATOM   7170  C CB    . ARG E 5 86  ? 102.931 100.508 106.321 1.00 27.39  ? 99  ARG C CB    1 
ATOM   7171  C CG    . ARG E 5 86  ? 102.307 101.902 106.420 1.00 33.87  ? 99  ARG C CG    1 
ATOM   7172  C CD    . ARG E 5 86  ? 102.006 102.517 105.057 1.00 51.84  ? 99  ARG C CD    1 
ATOM   7173  N NE    . ARG E 5 86  ? 100.808 103.365 105.087 1.00 58.57  ? 99  ARG C NE    1 
ATOM   7174  C CZ    . ARG E 5 86  ? 100.423 104.144 104.081 1.00 62.28  ? 99  ARG C CZ    1 
ATOM   7175  N NH1   . ARG E 5 86  ? 101.138 104.193 102.959 1.00 64.71  ? 99  ARG C NH1   1 
ATOM   7176  N NH2   . ARG E 5 86  ? 99.328  104.878 104.194 1.00 64.99  ? 99  ARG C NH2   1 
ATOM   7177  N N     . VAL E 5 87  ? 104.473 98.123  108.639 1.00 19.86  ? 100 VAL C N     1 
ATOM   7178  C CA    . VAL E 5 87  ? 104.889 96.733  108.689 1.00 18.18  ? 100 VAL C CA    1 
ATOM   7179  C C     . VAL E 5 87  ? 104.478 96.187  110.029 1.00 19.11  ? 100 VAL C C     1 
ATOM   7180  O O     . VAL E 5 87  ? 104.606 96.883  111.046 1.00 19.55  ? 100 VAL C O     1 
ATOM   7181  C CB    . VAL E 5 87  ? 106.428 96.612  108.604 1.00 20.38  ? 100 VAL C CB    1 
ATOM   7182  C CG1   . VAL E 5 87  ? 106.865 95.276  109.144 1.00 20.31  ? 100 VAL C CG1   1 
ATOM   7183  C CG2   . VAL E 5 87  ? 106.876 96.772  107.159 1.00 17.81  ? 100 VAL C CG2   1 
ATOM   7184  N N     . THR E 5 88  ? 104.028 94.940  110.037 1.00 17.80  ? 101 THR C N     1 
ATOM   7185  C CA    . THR E 5 88  ? 103.638 94.311  111.283 1.00 15.58  ? 101 THR C CA    1 
ATOM   7186  C C     . THR E 5 88  ? 104.660 93.214  111.560 1.00 20.54  ? 101 THR C C     1 
ATOM   7187  O O     . THR E 5 88  ? 104.870 92.355  110.723 1.00 19.49  ? 101 THR C O     1 
ATOM   7188  C CB    . THR E 5 88  ? 102.237 93.628  111.162 1.00 19.15  ? 101 THR C CB    1 
ATOM   7189  O OG1   . THR E 5 88  ? 101.233 94.626  110.945 1.00 17.68  ? 101 THR C OG1   1 
ATOM   7190  C CG2   . THR E 5 88  ? 101.907 92.864  112.439 1.00 13.76  ? 101 THR C CG2   1 
ATOM   7191  N N     . ILE E 5 89  ? 105.314 93.283  112.711 1.00 19.93  ? 102 ILE C N     1 
ATOM   7192  C CA    . ILE E 5 89  ? 106.252 92.247  113.124 1.00 19.38  ? 102 ILE C CA    1 
ATOM   7193  C C     . ILE E 5 89  ? 105.422 91.229  113.924 1.00 15.68  ? 102 ILE C C     1 
ATOM   7194  O O     . ILE E 5 89  ? 104.893 91.529  114.982 1.00 17.26  ? 102 ILE C O     1 
ATOM   7195  C CB    . ILE E 5 89  ? 107.378 92.837  114.017 1.00 20.82  ? 102 ILE C CB    1 
ATOM   7196  C CG1   . ILE E 5 89  ? 108.289 93.744  113.151 1.00 18.39  ? 102 ILE C CG1   1 
ATOM   7197  C CG2   . ILE E 5 89  ? 108.171 91.696  114.661 1.00 20.73  ? 102 ILE C CG2   1 
ATOM   7198  C CD1   . ILE E 5 89  ? 109.345 94.552  113.968 1.00 22.21  ? 102 ILE C CD1   1 
ATOM   7199  N N     . ALA E 5 90  ? 105.239 90.045  113.361 1.00 21.29  ? 103 ALA C N     1 
ATOM   7200  C CA    . ALA E 5 90  ? 104.483 88.976  114.045 1.00 19.36  ? 103 ALA C CA    1 
ATOM   7201  C C     . ALA E 5 90  ? 105.091 88.718  115.425 1.00 24.83  ? 103 ALA C C     1 
ATOM   7202  O O     . ALA E 5 90  ? 106.319 88.714  115.561 1.00 23.35  ? 103 ALA C O     1 
ATOM   7203  C CB    . ALA E 5 90  ? 104.566 87.668  113.211 1.00 18.84  ? 103 ALA C CB    1 
ATOM   7204  N N     . GLN E 5 91  ? 104.224 88.469  116.406 1.00 20.09  ? 104 GLN C N     1 
ATOM   7205  C CA    . GLN E 5 91  ? 104.585 88.189  117.794 1.00 21.07  ? 104 GLN C CA    1 
ATOM   7206  C C     . GLN E 5 91  ? 105.415 89.294  118.376 1.00 19.84  ? 104 GLN C C     1 
ATOM   7207  O O     . GLN E 5 91  ? 106.291 89.066  119.221 1.00 19.85  ? 104 GLN C O     1 
ATOM   7208  C CB    . GLN E 5 91  ? 105.323 86.840  117.892 1.00 24.31  ? 104 GLN C CB    1 
ATOM   7209  C CG    . GLN E 5 91  ? 104.330 85.654  117.914 1.00 32.90  ? 104 GLN C CG    1 
ATOM   7210  C CD    . GLN E 5 91  ? 103.361 85.776  119.116 1.00 35.24  ? 104 GLN C CD    1 
ATOM   7211  O OE1   . GLN E 5 91  ? 103.782 85.621  120.286 1.00 33.48  ? 104 GLN C OE1   1 
ATOM   7212  N NE2   . GLN E 5 91  ? 102.071 86.099  118.834 1.00 24.72  ? 104 GLN C NE2   1 
ATOM   7213  N N     . GLY E 5 92  ? 105.115 90.512  117.949 1.00 20.95  ? 105 GLY C N     1 
ATOM   7214  C CA    . GLY E 5 92  ? 105.856 91.648  118.439 1.00 19.38  ? 105 GLY C CA    1 
ATOM   7215  C C     . GLY E 5 92  ? 105.192 92.360  119.588 1.00 22.04  ? 105 GLY C C     1 
ATOM   7216  O O     . GLY E 5 92  ? 105.869 93.026  120.384 1.00 20.00  ? 105 GLY C O     1 
ATOM   7217  N N     . GLY E 5 93  ? 103.862 92.236  119.696 1.00 16.76  ? 106 GLY C N     1 
ATOM   7218  C CA    . GLY E 5 93  ? 103.181 92.952  120.760 1.00 12.72  ? 106 GLY C CA    1 
ATOM   7219  C C     . GLY E 5 93  ? 103.321 94.441  120.474 1.00 18.35  ? 106 GLY C C     1 
ATOM   7220  O O     . GLY E 5 93  ? 103.651 94.817  119.333 1.00 18.37  ? 106 GLY C O     1 
ATOM   7221  N N     . VAL E 5 94  ? 103.072 95.287  121.468 1.00 15.94  ? 107 VAL C N     1 
ATOM   7222  C CA    . VAL E 5 94  ? 103.142 96.733  121.289 1.00 21.43  ? 107 VAL C CA    1 
ATOM   7223  C C     . VAL E 5 94  ? 103.978 97.296  122.426 1.00 22.34  ? 107 VAL C C     1 
ATOM   7224  O O     . VAL E 5 94  ? 104.337 96.564  123.366 1.00 19.80  ? 107 VAL C O     1 
ATOM   7225  C CB    . VAL E 5 94  ? 101.749 97.408  121.380 1.00 23.64  ? 107 VAL C CB    1 
ATOM   7226  C CG1   . VAL E 5 94  ? 100.765 96.774  120.338 1.00 24.17  ? 107 VAL C CG1   1 
ATOM   7227  C CG2   . VAL E 5 94  ? 101.178 97.247  122.812 1.00 21.10  ? 107 VAL C CG2   1 
ATOM   7228  N N     . LEU E 5 95  ? 104.287 98.588  122.331 1.00 22.98  ? 108 LEU C N     1 
ATOM   7229  C CA    . LEU E 5 95  ? 105.049 99.282  123.378 1.00 24.98  ? 108 LEU C CA    1 
ATOM   7230  C C     . LEU E 5 95  ? 104.137 99.636  124.548 1.00 25.12  ? 108 LEU C C     1 
ATOM   7231  O O     . LEU E 5 95  ? 102.999 100.064 124.344 1.00 23.88  ? 108 LEU C O     1 
ATOM   7232  C CB    . LEU E 5 95  ? 105.612 100.619 122.872 1.00 23.76  ? 108 LEU C CB    1 
ATOM   7233  C CG    . LEU E 5 95  ? 106.602 100.654 121.718 1.00 25.16  ? 108 LEU C CG    1 
ATOM   7234  C CD1   . LEU E 5 95  ? 107.100 102.112 121.563 1.00 28.94  ? 108 LEU C CD1   1 
ATOM   7235  C CD2   . LEU E 5 95  ? 107.762 99.695  121.987 1.00 24.70  ? 108 LEU C CD2   1 
ATOM   7236  N N     . PRO E 5 96  ? 104.628 99.484  125.791 1.00 25.24  ? 109 PRO C N     1 
ATOM   7237  C CA    . PRO E 5 96  ? 103.793 99.833  126.947 1.00 24.75  ? 109 PRO C CA    1 
ATOM   7238  C C     . PRO E 5 96  ? 103.501 101.314 126.821 1.00 30.23  ? 109 PRO C C     1 
ATOM   7239  O O     . PRO E 5 96  ? 104.413 102.104 126.613 1.00 30.33  ? 109 PRO C O     1 
ATOM   7240  C CB    . PRO E 5 96  ? 104.699 99.496  128.134 1.00 29.95  ? 109 PRO C CB    1 
ATOM   7241  C CG    . PRO E 5 96  ? 105.346 98.211  127.635 1.00 29.12  ? 109 PRO C CG    1 
ATOM   7242  C CD    . PRO E 5 96  ? 105.732 98.587  126.195 1.00 25.77  ? 109 PRO C CD    1 
ATOM   7243  N N     . ASN E 5 97  ? 102.237 101.697 126.901 1.00 28.86  ? 110 ASN C N     1 
ATOM   7244  C CA    . ASN E 5 97  ? 101.878 103.103 126.739 1.00 32.24  ? 110 ASN C CA    1 
ATOM   7245  C C     . ASN E 5 97  ? 100.433 103.279 127.193 1.00 33.77  ? 110 ASN C C     1 
ATOM   7246  O O     . ASN E 5 97  ? 99.513  102.827 126.513 1.00 32.30  ? 110 ASN C O     1 
ATOM   7247  C CB    . ASN E 5 97  ? 102.013 103.502 125.263 1.00 36.29  ? 110 ASN C CB    1 
ATOM   7248  C CG    . ASN E 5 97  ? 101.798 104.998 125.020 1.00 43.49  ? 110 ASN C CG    1 
ATOM   7249  O OD1   . ASN E 5 97  ? 102.099 105.826 125.871 1.00 47.99  ? 110 ASN C OD1   1 
ATOM   7250  N ND2   . ASN E 5 97  ? 101.304 105.342 123.840 1.00 42.68  ? 110 ASN C ND2   1 
ATOM   7251  N N     . ILE E 5 98  ? 100.247 103.880 128.370 1.00 31.73  ? 111 ILE C N     1 
ATOM   7252  C CA    . ILE E 5 98  ? 98.913  104.129 128.914 1.00 29.62  ? 111 ILE C CA    1 
ATOM   7253  C C     . ILE E 5 98  ? 98.668  105.631 128.880 1.00 33.12  ? 111 ILE C C     1 
ATOM   7254  O O     . ILE E 5 98  ? 99.436  106.408 129.450 1.00 32.66  ? 111 ILE C O     1 
ATOM   7255  C CB    . ILE E 5 98  ? 98.799  103.642 130.369 1.00 29.99  ? 111 ILE C CB    1 
ATOM   7256  C CG1   . ILE E 5 98  ? 99.045  102.133 130.441 1.00 28.08  ? 111 ILE C CG1   1 
ATOM   7257  C CG2   . ILE E 5 98  ? 97.441  103.944 130.908 1.00 33.07  ? 111 ILE C CG2   1 
ATOM   7258  C CD1   . ILE E 5 98  ? 98.986  101.551 131.857 1.00 31.19  ? 111 ILE C CD1   1 
ATOM   7259  N N     . GLN E 5 99  ? 97.629  106.063 128.183 1.00 27.47  ? 112 GLN C N     1 
ATOM   7260  C CA    . GLN E 5 99  ? 97.343  107.494 128.123 1.00 27.24  ? 112 GLN C CA    1 
ATOM   7261  C C     . GLN E 5 99  ? 97.171  108.061 129.538 1.00 31.55  ? 112 GLN C C     1 
ATOM   7262  O O     . GLN E 5 99  ? 96.483  107.478 130.386 1.00 30.75  ? 112 GLN C O     1 
ATOM   7263  C CB    . GLN E 5 99  ? 96.082  107.713 127.290 1.00 30.60  ? 112 GLN C CB    1 
ATOM   7264  C CG    . GLN E 5 99  ? 96.231  107.183 125.841 1.00 30.35  ? 112 GLN C CG    1 
ATOM   7265  C CD    . GLN E 5 99  ? 97.284  107.957 125.056 1.00 34.70  ? 112 GLN C CD    1 
ATOM   7266  O OE1   . GLN E 5 99  ? 97.244  109.176 125.011 1.00 28.22  ? 112 GLN C OE1   1 
ATOM   7267  N NE2   . GLN E 5 99  ? 98.233  107.241 124.437 1.00 34.39  ? 112 GLN C NE2   1 
ATOM   7268  N N     . SER E 5 100 ? 97.809  109.199 129.795 1.00 31.79  ? 113 SER C N     1 
ATOM   7269  C CA    . SER E 5 100 ? 97.745  109.855 131.102 1.00 33.50  ? 113 SER C CA    1 
ATOM   7270  C C     . SER E 5 100 ? 96.396  109.977 131.782 1.00 31.74  ? 113 SER C C     1 
ATOM   7271  O O     . SER E 5 100 ? 96.263  109.600 132.943 1.00 32.78  ? 113 SER C O     1 
ATOM   7272  C CB    . SER E 5 100 ? 98.343  111.268 131.005 1.00 35.57  ? 113 SER C CB    1 
ATOM   7273  O OG    . SER E 5 100 ? 99.688  111.170 130.605 1.00 44.27  ? 113 SER C OG    1 
ATOM   7274  N N     . VAL E 5 101 ? 95.396  110.499 131.082 1.00 29.77  ? 114 VAL C N     1 
ATOM   7275  C CA    . VAL E 5 101 ? 94.087  110.712 131.702 1.00 30.87  ? 114 VAL C CA    1 
ATOM   7276  C C     . VAL E 5 101 ? 93.455  109.488 132.289 1.00 32.34  ? 114 VAL C C     1 
ATOM   7277  O O     . VAL E 5 101 ? 92.507  109.602 133.065 1.00 30.56  ? 114 VAL C O     1 
ATOM   7278  C CB    . VAL E 5 101 ? 93.060  111.283 130.717 1.00 36.11  ? 114 VAL C CB    1 
ATOM   7279  C CG1   . VAL E 5 101 ? 93.546  112.617 130.198 1.00 38.85  ? 114 VAL C CG1   1 
ATOM   7280  C CG2   . VAL E 5 101 ? 92.843  110.297 129.561 1.00 34.88  ? 114 VAL C CG2   1 
ATOM   7281  N N     . LEU E 5 102 ? 93.951  108.320 131.877 1.00 31.27  ? 115 LEU C N     1 
ATOM   7282  C CA    . LEU E 5 102 ? 93.418  107.047 132.353 1.00 32.01  ? 115 LEU C CA    1 
ATOM   7283  C C     . LEU E 5 102 ? 94.013  106.606 133.692 1.00 33.35  ? 115 LEU C C     1 
ATOM   7284  O O     . LEU E 5 102 ? 93.519  105.652 134.300 1.00 31.91  ? 115 LEU C O     1 
ATOM   7285  C CB    . LEU E 5 102 ? 93.665  105.951 131.301 1.00 27.64  ? 115 LEU C CB    1 
ATOM   7286  C CG    . LEU E 5 102 ? 93.001  106.196 129.928 1.00 29.47  ? 115 LEU C CG    1 
ATOM   7287  C CD1   . LEU E 5 102 ? 93.300  104.994 129.017 1.00 26.36  ? 115 LEU C CD1   1 
ATOM   7288  C CD2   . LEU E 5 102 ? 91.459  106.361 130.099 1.00 25.07  ? 115 LEU C CD2   1 
ATOM   7289  N N     . LEU E 5 103 ? 95.081  107.270 134.139 1.00 33.89  ? 116 LEU C N     1 
ATOM   7290  C CA    . LEU E 5 103 ? 95.680  106.885 135.417 1.00 38.21  ? 116 LEU C CA    1 
ATOM   7291  C C     . LEU E 5 103 ? 94.818  107.402 136.563 1.00 38.74  ? 116 LEU C C     1 
ATOM   7292  O O     . LEU E 5 103 ? 94.118  108.402 136.422 1.00 39.21  ? 116 LEU C O     1 
ATOM   7293  C CB    . LEU E 5 103 ? 97.103  107.432 135.550 1.00 37.70  ? 116 LEU C CB    1 
ATOM   7294  C CG    . LEU E 5 103 ? 98.109  106.960 134.494 1.00 41.03  ? 116 LEU C CG    1 
ATOM   7295  C CD1   . LEU E 5 103 ? 99.409  107.736 134.658 1.00 41.45  ? 116 LEU C CD1   1 
ATOM   7296  C CD2   . LEU E 5 103 ? 98.352  105.474 134.600 1.00 36.71  ? 116 LEU C CD2   1 
ATOM   7297  N N     . PRO E 5 104 ? 94.855  106.727 137.714 1.00 44.19  ? 117 PRO C N     1 
ATOM   7298  C CA    . PRO E 5 104 ? 94.039  107.180 138.844 1.00 50.71  ? 117 PRO C CA    1 
ATOM   7299  C C     . PRO E 5 104 ? 94.559  108.442 139.533 1.00 56.92  ? 117 PRO C C     1 
ATOM   7300  O O     . PRO E 5 104 ? 95.486  109.089 139.056 1.00 55.51  ? 117 PRO C O     1 
ATOM   7301  C CB    . PRO E 5 104 ? 94.047  105.967 139.770 1.00 47.20  ? 117 PRO C CB    1 
ATOM   7302  C CG    . PRO E 5 104 ? 95.406  105.411 139.572 1.00 45.71  ? 117 PRO C CG    1 
ATOM   7303  C CD    . PRO E 5 104 ? 95.667  105.549 138.079 1.00 44.51  ? 117 PRO C CD    1 
ATOM   7304  N N     . LYS E 5 105 ? 93.935  108.774 140.661 1.00 66.99  ? 118 LYS C N     1 
ATOM   7305  C CA    . LYS E 5 105 ? 94.307  109.921 141.496 1.00 73.27  ? 118 LYS C CA    1 
ATOM   7306  C C     . LYS E 5 105 ? 94.408  111.254 140.770 1.00 77.40  ? 118 LYS C C     1 
ATOM   7307  O O     . LYS E 5 105 ? 93.662  111.535 139.831 1.00 78.15  ? 118 LYS C O     1 
ATOM   7308  C CB    . LYS E 5 105 ? 95.639  109.648 142.199 1.00 74.40  ? 118 LYS C CB    1 
ATOM   7309  C CG    . LYS E 5 105 ? 95.707  108.327 142.948 1.00 79.30  ? 118 LYS C CG    1 
ATOM   7310  C CD    . LYS E 5 105 ? 97.073  108.146 143.596 1.00 83.05  ? 118 LYS C CD    1 
ATOM   7311  C CE    . LYS E 5 105 ? 97.187  106.805 144.314 1.00 86.60  ? 118 LYS C CE    1 
ATOM   7312  N NZ    . LYS E 5 105 ? 98.499  106.650 145.024 1.00 87.44  ? 118 LYS C NZ    1 
ATOM   7313  N N     . LYS E 5 106 ? 95.345  112.076 141.236 1.00 81.28  ? 119 LYS C N     1 
ATOM   7314  C CA    . LYS E 5 106 ? 95.586  113.401 140.681 1.00 85.26  ? 119 LYS C CA    1 
ATOM   7315  C C     . LYS E 5 106 ? 96.981  113.892 141.056 1.00 87.93  ? 119 LYS C C     1 
ATOM   7316  O O     . LYS E 5 106 ? 97.622  113.341 141.954 1.00 88.64  ? 119 LYS C O     1 
ATOM   7317  C CB    . LYS E 5 106 ? 94.534  114.392 141.198 1.00 85.79  ? 119 LYS C CB    1 
ATOM   7318  C CG    . LYS E 5 106 ? 94.207  114.263 142.687 1.00 85.35  ? 119 LYS C CG    1 
ATOM   7319  C CD    . LYS E 5 106 ? 93.249  113.105 142.946 1.00 85.87  ? 119 LYS C CD    1 
ATOM   7320  C CE    . LYS E 5 106 ? 93.002  112.883 144.425 1.00 85.04  ? 119 LYS C CE    1 
ATOM   7321  N NZ    . LYS E 5 106 ? 92.076  111.740 144.658 1.00 85.12  ? 119 LYS C NZ    1 
ATOM   7322  N N     . THR E 5 107 ? 97.440  114.935 140.367 1.00 90.19  ? 120 THR C N     1 
ATOM   7323  C CA    . THR E 5 107 ? 98.762  115.510 140.607 1.00 91.99  ? 120 THR C CA    1 
ATOM   7324  C C     . THR E 5 107 ? 99.853  114.557 140.133 1.00 92.22  ? 120 THR C C     1 
ATOM   7325  O O     . THR E 5 107 ? 99.864  113.401 140.607 1.00 92.49  ? 120 THR C O     1 
ATOM   7326  C CB    . THR E 5 107 ? 98.989  115.813 142.108 1.00 93.00  ? 120 THR C CB    1 
ATOM   7327  O OG1   . THR E 5 107 ? 98.039  116.790 142.548 1.00 94.43  ? 120 THR C OG1   1 
ATOM   7328  C CG2   . THR E 5 107 ? 100.397 116.345 142.340 1.00 93.86  ? 120 THR C CG2   1 
ATOM   7329  N N     . THR F 6 1   ? 113.548 71.496  96.140  1.00 72.63  ? 29  THR D N     1 
ATOM   7330  C CA    . THR F 6 1   ? 114.171 72.729  95.582  1.00 72.40  ? 29  THR D CA    1 
ATOM   7331  C C     . THR F 6 1   ? 114.746 73.566  96.718  1.00 71.22  ? 29  THR D C     1 
ATOM   7332  O O     . THR F 6 1   ? 114.073 73.818  97.720  1.00 70.60  ? 29  THR D O     1 
ATOM   7333  C CB    . THR F 6 1   ? 113.141 73.583  94.815  1.00 75.35  ? 29  THR D CB    1 
ATOM   7334  O OG1   . THR F 6 1   ? 113.812 74.665  94.154  1.00 79.51  ? 29  THR D OG1   1 
ATOM   7335  C CG2   . THR F 6 1   ? 112.113 74.165  95.773  1.00 77.19  ? 29  THR D CG2   1 
ATOM   7336  N N     . ARG F 6 2   ? 115.993 73.991  96.558  1.00 69.14  ? 30  ARG D N     1 
ATOM   7337  C CA    . ARG F 6 2   ? 116.662 74.792  97.571  1.00 66.37  ? 30  ARG D CA    1 
ATOM   7338  C C     . ARG F 6 2   ? 115.978 76.148  97.726  1.00 64.19  ? 30  ARG D C     1 
ATOM   7339  O O     . ARG F 6 2   ? 115.691 76.822  96.738  1.00 64.79  ? 30  ARG D O     1 
ATOM   7340  C CB    . ARG F 6 2   ? 118.128 75.016  97.180  1.00 67.25  ? 30  ARG D CB    1 
ATOM   7341  C CG    . ARG F 6 2   ? 118.297 75.890  95.943  1.00 67.32  ? 30  ARG D CG    1 
ATOM   7342  C CD    . ARG F 6 2   ? 119.754 76.177  95.611  1.00 67.06  ? 30  ARG D CD    1 
ATOM   7343  N NE    . ARG F 6 2   ? 120.468 76.837  96.698  1.00 64.97  ? 30  ARG D NE    1 
ATOM   7344  C CZ    . ARG F 6 2   ? 121.690 77.345  96.587  1.00 65.69  ? 30  ARG D CZ    1 
ATOM   7345  N NH1   . ARG F 6 2   ? 122.338 77.280  95.434  1.00 68.65  ? 30  ARG D NH1   1 
ATOM   7346  N NH2   . ARG F 6 2   ? 122.276 77.909  97.629  1.00 69.71  ? 30  ARG D NH2   1 
ATOM   7347  N N     . LYS F 6 3   ? 115.706 76.543  98.965  1.00 61.53  ? 31  LYS D N     1 
ATOM   7348  C CA    . LYS F 6 3   ? 115.098 77.839  99.212  1.00 57.20  ? 31  LYS D CA    1 
ATOM   7349  C C     . LYS F 6 3   ? 116.107 78.715  99.947  1.00 53.43  ? 31  LYS D C     1 
ATOM   7350  O O     . LYS F 6 3   ? 116.536 78.402  101.048 1.00 53.80  ? 31  LYS D O     1 
ATOM   7351  C CB    . LYS F 6 3   ? 113.799 77.697  100.014 1.00 59.69  ? 31  LYS D CB    1 
ATOM   7352  C CG    . LYS F 6 3   ? 113.926 77.109  101.403 1.00 63.66  ? 31  LYS D CG    1 
ATOM   7353  C CD    . LYS F 6 3   ? 112.543 76.901  102.009 1.00 66.14  ? 31  LYS D CD    1 
ATOM   7354  C CE    . LYS F 6 3   ? 112.601 76.119  103.313 1.00 67.84  ? 31  LYS D CE    1 
ATOM   7355  N NZ    . LYS F 6 3   ? 111.246 75.993  103.932 1.00 68.69  ? 31  LYS D NZ    1 
ATOM   7356  N N     . GLU F 6 4   ? 116.484 79.818  99.316  1.00 48.94  ? 32  GLU D N     1 
ATOM   7357  C CA    . GLU F 6 4   ? 117.460 80.732  99.881  1.00 45.85  ? 32  GLU D CA    1 
ATOM   7358  C C     . GLU F 6 4   ? 116.902 81.661  100.957 1.00 42.56  ? 32  GLU D C     1 
ATOM   7359  O O     . GLU F 6 4   ? 115.716 81.936  101.013 1.00 41.36  ? 32  GLU D O     1 
ATOM   7360  C CB    . GLU F 6 4   ? 118.024 81.654  98.811  1.00 47.70  ? 32  GLU D CB    1 
ATOM   7361  C CG    . GLU F 6 4   ? 118.473 81.069  97.505  1.00 49.19  ? 32  GLU D CG    1 
ATOM   7362  C CD    . GLU F 6 4   ? 118.779 82.191  96.532  1.00 53.09  ? 32  GLU D CD    1 
ATOM   7363  O OE1   . GLU F 6 4   ? 117.868 83.034  96.307  1.00 53.13  ? 32  GLU D OE1   1 
ATOM   7364  O OE2   . GLU F 6 4   ? 119.913 82.247  96.015  1.00 47.80  ? 32  GLU D OE2   1 
ATOM   7365  N N     . SER F 6 5   ? 117.800 82.176  101.784 1.00 39.55  ? 33  SER D N     1 
ATOM   7366  C CA    . SER F 6 5   ? 117.425 83.142  102.800 1.00 39.43  ? 33  SER D CA    1 
ATOM   7367  C C     . SER F 6 5   ? 118.700 83.874  103.183 1.00 36.12  ? 33  SER D C     1 
ATOM   7368  O O     . SER F 6 5   ? 119.801 83.398  102.928 1.00 32.53  ? 33  SER D O     1 
ATOM   7369  C CB    . SER F 6 5   ? 116.795 82.469  104.014 1.00 38.82  ? 33  SER D CB    1 
ATOM   7370  O OG    . SER F 6 5   ? 117.668 82.445  105.122 1.00 42.06  ? 33  SER D OG    1 
ATOM   7371  N N     . TYR F 6 6   ? 118.543 85.048  103.760 1.00 32.16  ? 34  TYR D N     1 
ATOM   7372  C CA    . TYR F 6 6   ? 119.689 85.832  104.176 1.00 29.39  ? 34  TYR D CA    1 
ATOM   7373  C C     . TYR F 6 6   ? 120.179 85.396  105.569 1.00 28.14  ? 34  TYR D C     1 
ATOM   7374  O O     . TYR F 6 6   ? 121.115 85.982  106.123 1.00 27.61  ? 34  TYR D O     1 
ATOM   7375  C CB    . TYR F 6 6   ? 119.319 87.303  104.198 1.00 27.00  ? 34  TYR D CB    1 
ATOM   7376  C CG    . TYR F 6 6   ? 119.143 87.893  102.835 1.00 29.57  ? 34  TYR D CG    1 
ATOM   7377  C CD1   . TYR F 6 6   ? 120.243 88.340  102.097 1.00 31.69  ? 34  TYR D CD1   1 
ATOM   7378  C CD2   . TYR F 6 6   ? 117.874 88.039  102.276 1.00 30.12  ? 34  TYR D CD2   1 
ATOM   7379  C CE1   . TYR F 6 6   ? 120.076 88.933  100.827 1.00 32.09  ? 34  TYR D CE1   1 
ATOM   7380  C CE2   . TYR F 6 6   ? 117.702 88.634  101.020 1.00 28.21  ? 34  TYR D CE2   1 
ATOM   7381  C CZ    . TYR F 6 6   ? 118.795 89.077  100.310 1.00 30.55  ? 34  TYR D CZ    1 
ATOM   7382  O OH    . TYR F 6 6   ? 118.601 89.682  99.088  1.00 27.80  ? 34  TYR D OH    1 
ATOM   7383  N N     . ALA F 6 7   ? 119.553 84.362  106.119 1.00 25.41  ? 35  ALA D N     1 
ATOM   7384  C CA    . ALA F 6 7   ? 119.882 83.893  107.452 1.00 29.78  ? 35  ALA D CA    1 
ATOM   7385  C C     . ALA F 6 7   ? 121.381 83.862  107.849 1.00 30.78  ? 35  ALA D C     1 
ATOM   7386  O O     . ALA F 6 7   ? 121.752 84.467  108.862 1.00 31.72  ? 35  ALA D O     1 
ATOM   7387  C CB    . ALA F 6 7   ? 119.241 82.521  107.695 1.00 28.12  ? 35  ALA D CB    1 
ATOM   7388  N N     . ILE F 6 8   ? 122.233 83.191  107.075 1.00 30.68  ? 36  ILE D N     1 
ATOM   7389  C CA    . ILE F 6 8   ? 123.656 83.103  107.453 1.00 31.87  ? 36  ILE D CA    1 
ATOM   7390  C C     . ILE F 6 8   ? 124.354 84.458  107.463 1.00 29.86  ? 36  ILE D C     1 
ATOM   7391  O O     . ILE F 6 8   ? 125.286 84.671  108.238 1.00 31.50  ? 36  ILE D O     1 
ATOM   7392  C CB    . ILE F 6 8   ? 124.475 82.110  106.545 1.00 36.03  ? 36  ILE D CB    1 
ATOM   7393  C CG1   . ILE F 6 8   ? 124.532 82.608  105.108 1.00 40.62  ? 36  ILE D CG1   1 
ATOM   7394  C CG2   . ILE F 6 8   ? 123.854 80.737  106.563 1.00 33.93  ? 36  ILE D CG2   1 
ATOM   7395  C CD1   . ILE F 6 8   ? 125.461 81.732  104.204 1.00 43.36  ? 36  ILE D CD1   1 
ATOM   7396  N N     . TYR F 6 9   ? 123.897 85.382  106.626 1.00 26.60  ? 37  TYR D N     1 
ATOM   7397  C CA    . TYR F 6 9   ? 124.505 86.701  106.586 1.00 27.75  ? 37  TYR D CA    1 
ATOM   7398  C C     . TYR F 6 9   ? 123.980 87.535  107.738 1.00 30.85  ? 37  TYR D C     1 
ATOM   7399  O O     . TYR F 6 9   ? 124.712 88.373  108.303 1.00 29.49  ? 37  TYR D O     1 
ATOM   7400  C CB    . TYR F 6 9   ? 124.213 87.383  105.257 1.00 27.02  ? 37  TYR D CB    1 
ATOM   7401  C CG    . TYR F 6 9   ? 124.500 86.484  104.070 1.00 30.70  ? 37  TYR D CG    1 
ATOM   7402  C CD1   . TYR F 6 9   ? 125.803 86.138  103.724 1.00 30.08  ? 37  TYR D CD1   1 
ATOM   7403  C CD2   . TYR F 6 9   ? 123.449 85.924  103.335 1.00 34.99  ? 37  TYR D CD2   1 
ATOM   7404  C CE1   . TYR F 6 9   ? 126.054 85.241  102.666 1.00 34.44  ? 37  TYR D CE1   1 
ATOM   7405  C CE2   . TYR F 6 9   ? 123.682 85.042  102.295 1.00 34.13  ? 37  TYR D CE2   1 
ATOM   7406  C CZ    . TYR F 6 9   ? 124.981 84.700  101.967 1.00 39.66  ? 37  TYR D CZ    1 
ATOM   7407  O OH    . TYR F 6 9   ? 125.181 83.789  100.960 1.00 42.81  ? 37  TYR D OH    1 
ATOM   7408  N N     . VAL F 6 10  ? 122.711 87.324  108.096 1.00 25.69  ? 38  VAL D N     1 
ATOM   7409  C CA    . VAL F 6 10  ? 122.150 88.057  109.230 1.00 24.42  ? 38  VAL D CA    1 
ATOM   7410  C C     . VAL F 6 10  ? 122.924 87.591  110.462 1.00 26.35  ? 38  VAL D C     1 
ATOM   7411  O O     . VAL F 6 10  ? 123.293 88.386  111.308 1.00 25.46  ? 38  VAL D O     1 
ATOM   7412  C CB    . VAL F 6 10  ? 120.626 87.743  109.408 1.00 23.93  ? 38  VAL D CB    1 
ATOM   7413  C CG1   . VAL F 6 10  ? 120.155 88.192  110.770 1.00 23.24  ? 38  VAL D CG1   1 
ATOM   7414  C CG2   . VAL F 6 10  ? 119.831 88.451  108.292 1.00 23.91  ? 38  VAL D CG2   1 
ATOM   7415  N N     . TYR F 6 11  ? 123.169 86.288  110.544 1.00 28.54  ? 39  TYR D N     1 
ATOM   7416  C CA    . TYR F 6 11  ? 123.879 85.705  111.680 1.00 29.56  ? 39  TYR D CA    1 
ATOM   7417  C C     . TYR F 6 11  ? 125.313 86.265  111.791 1.00 28.76  ? 39  TYR D C     1 
ATOM   7418  O O     . TYR F 6 11  ? 125.766 86.595  112.880 1.00 31.19  ? 39  TYR D O     1 
ATOM   7419  C CB    . TYR F 6 11  ? 123.924 84.180  111.562 1.00 33.05  ? 39  TYR D CB    1 
ATOM   7420  C CG    . TYR F 6 11  ? 124.021 83.531  112.916 1.00 40.04  ? 39  TYR D CG    1 
ATOM   7421  C CD1   . TYR F 6 11  ? 122.927 83.536  113.765 1.00 43.19  ? 39  TYR D CD1   1 
ATOM   7422  C CD2   . TYR F 6 11  ? 125.252 83.094  113.424 1.00 45.74  ? 39  TYR D CD2   1 
ATOM   7423  C CE1   . TYR F 6 11  ? 123.033 83.160  115.089 1.00 50.44  ? 39  TYR D CE1   1 
ATOM   7424  C CE2   . TYR F 6 11  ? 125.380 82.703  114.773 1.00 48.86  ? 39  TYR D CE2   1 
ATOM   7425  C CZ    . TYR F 6 11  ? 124.256 82.752  115.595 1.00 52.25  ? 39  TYR D CZ    1 
ATOM   7426  O OH    . TYR F 6 11  ? 124.330 82.454  116.933 1.00 57.47  ? 39  TYR D OH    1 
ATOM   7427  N N     . LYS F 6 12  ? 125.999 86.400  110.663 1.00 28.76  ? 40  LYS D N     1 
ATOM   7428  C CA    . LYS F 6 12  ? 127.360 86.938  110.668 1.00 31.02  ? 40  LYS D CA    1 
ATOM   7429  C C     . LYS F 6 12  ? 127.358 88.348  111.217 1.00 33.15  ? 40  LYS D C     1 
ATOM   7430  O O     . LYS F 6 12  ? 128.200 88.736  112.050 1.00 29.73  ? 40  LYS D O     1 
ATOM   7431  C CB    . LYS F 6 12  ? 127.932 86.929  109.254 1.00 31.42  ? 40  LYS D CB    1 
ATOM   7432  C CG    . LYS F 6 12  ? 128.329 85.548  108.790 1.00 32.93  ? 40  LYS D CG    1 
ATOM   7433  C CD    . LYS F 6 12  ? 128.951 85.586  107.378 1.00 39.43  ? 40  LYS D CD    1 
ATOM   7434  C CE    . LYS F 6 12  ? 129.314 84.168  106.938 1.00 44.56  ? 40  LYS D CE    1 
ATOM   7435  N NZ    . LYS F 6 12  ? 129.942 84.097  105.581 1.00 51.44  ? 40  LYS D NZ    1 
ATOM   7436  N N     . VAL F 6 13  ? 126.385 89.131  110.778 1.00 30.13  ? 41  VAL D N     1 
ATOM   7437  C CA    . VAL F 6 13  ? 126.308 90.494  111.266 1.00 25.00  ? 41  VAL D CA    1 
ATOM   7438  C C     . VAL F 6 13  ? 125.917 90.480  112.728 1.00 26.84  ? 41  VAL D C     1 
ATOM   7439  O O     . VAL F 6 13  ? 126.466 91.237  113.536 1.00 26.16  ? 41  VAL D O     1 
ATOM   7440  C CB    . VAL F 6 13  ? 125.315 91.311  110.416 1.00 27.74  ? 41  VAL D CB    1 
ATOM   7441  C CG1   . VAL F 6 13  ? 125.170 92.705  110.980 1.00 22.47  ? 41  VAL D CG1   1 
ATOM   7442  C CG2   . VAL F 6 13  ? 125.840 91.363  108.959 1.00 23.74  ? 41  VAL D CG2   1 
ATOM   7443  N N     . LEU F 6 14  ? 124.978 89.616  113.107 1.00 23.80  ? 42  LEU D N     1 
ATOM   7444  C CA    . LEU F 6 14  ? 124.607 89.575  114.531 1.00 23.68  ? 42  LEU D CA    1 
ATOM   7445  C C     . LEU F 6 14  ? 125.888 89.376  115.400 1.00 26.07  ? 42  LEU D C     1 
ATOM   7446  O O     . LEU F 6 14  ? 126.100 90.063  116.406 1.00 24.13  ? 42  LEU D O     1 
ATOM   7447  C CB    . LEU F 6 14  ? 123.659 88.409  114.817 1.00 20.31  ? 42  LEU D CB    1 
ATOM   7448  C CG    . LEU F 6 14  ? 123.338 88.169  116.293 1.00 25.43  ? 42  LEU D CG    1 
ATOM   7449  C CD1   . LEU F 6 14  ? 122.861 89.445  116.959 1.00 21.67  ? 42  LEU D CD1   1 
ATOM   7450  C CD2   . LEU F 6 14  ? 122.299 87.079  116.415 1.00 23.18  ? 42  LEU D CD2   1 
ATOM   7451  N N     . LYS F 6 15  ? 126.718 88.440  114.978 1.00 28.24  ? 43  LYS D N     1 
ATOM   7452  C CA    . LYS F 6 15  ? 127.947 88.108  115.700 1.00 33.98  ? 43  LYS D CA    1 
ATOM   7453  C C     . LYS F 6 15  ? 128.909 89.270  115.752 1.00 32.98  ? 43  LYS D C     1 
ATOM   7454  O O     . LYS F 6 15  ? 129.644 89.414  116.730 1.00 33.72  ? 43  LYS D O     1 
ATOM   7455  C CB    . LYS F 6 15  ? 128.615 86.860  115.099 1.00 37.48  ? 43  LYS D CB    1 
ATOM   7456  C CG    . LYS F 6 15  ? 127.822 85.555  115.398 1.00 37.58  ? 43  LYS D CG    1 
ATOM   7457  C CD    . LYS F 6 15  ? 127.186 85.679  116.788 1.00 44.06  ? 43  LYS D CD    1 
ATOM   7458  C CE    . LYS F 6 15  ? 126.602 84.388  117.320 1.00 46.84  ? 43  LYS D CE    1 
ATOM   7459  N NZ    . LYS F 6 15  ? 126.167 84.569  118.750 1.00 43.55  ? 43  LYS D NZ    1 
ATOM   7460  N N     . GLN F 6 16  ? 128.873 90.149  114.763 1.00 29.53  ? 44  GLN D N     1 
ATOM   7461  C CA    . GLN F 6 16  ? 129.771 91.304  114.822 1.00 28.23  ? 44  GLN D CA    1 
ATOM   7462  C C     . GLN F 6 16  ? 129.319 92.347  115.853 1.00 28.09  ? 44  GLN D C     1 
ATOM   7463  O O     . GLN F 6 16  ? 130.134 92.935  116.586 1.00 25.56  ? 44  GLN D O     1 
ATOM   7464  C CB    . GLN F 6 16  ? 129.874 91.981  113.458 1.00 25.91  ? 44  GLN D CB    1 
ATOM   7465  C CG    . GLN F 6 16  ? 130.552 91.170  112.359 1.00 31.16  ? 44  GLN D CG    1 
ATOM   7466  C CD    . GLN F 6 16  ? 130.609 91.942  111.034 1.00 31.73  ? 44  GLN D CD    1 
ATOM   7467  O OE1   . GLN F 6 16  ? 129.615 92.559  110.627 1.00 38.07  ? 44  GLN D OE1   1 
ATOM   7468  N NE2   . GLN F 6 16  ? 131.759 91.909  110.360 1.00 27.72  ? 44  GLN D NE2   1 
ATOM   7469  N N     . VAL F 6 17  ? 128.009 92.563  115.955 1.00 23.14  ? 45  VAL D N     1 
ATOM   7470  C CA    . VAL F 6 17  ? 127.539 93.581  116.866 1.00 21.01  ? 45  VAL D CA    1 
ATOM   7471  C C     . VAL F 6 17  ? 127.345 93.191  118.322 1.00 21.13  ? 45  VAL D C     1 
ATOM   7472  O O     . VAL F 6 17  ? 127.636 94.017  119.260 1.00 26.29  ? 45  VAL D O     1 
ATOM   7473  C CB    . VAL F 6 17  ? 126.229 94.212  116.368 1.00 25.10  ? 45  VAL D CB    1 
ATOM   7474  C CG1   . VAL F 6 17  ? 126.462 94.822  114.939 1.00 25.01  ? 45  VAL D CG1   1 
ATOM   7475  C CG2   . VAL F 6 17  ? 125.101 93.113  116.264 1.00 22.43  ? 45  VAL D CG2   1 
ATOM   7476  N N     . HIS F 6 18  ? 126.928 91.944  118.484 1.00 22.13  ? 46  HIS D N     1 
ATOM   7477  C CA    . HIS F 6 18  ? 126.587 91.294  119.759 1.00 24.70  ? 46  HIS D CA    1 
ATOM   7478  C C     . HIS F 6 18  ? 127.080 89.847  119.741 1.00 25.82  ? 46  HIS D C     1 
ATOM   7479  O O     . HIS F 6 18  ? 126.290 88.892  119.612 1.00 26.82  ? 46  HIS D O     1 
ATOM   7480  C CB    . HIS F 6 18  ? 125.068 91.305  119.938 1.00 22.93  ? 46  HIS D CB    1 
ATOM   7481  C CG    . HIS F 6 18  ? 124.514 92.673  120.187 1.00 26.31  ? 46  HIS D CG    1 
ATOM   7482  N ND1   . HIS F 6 18  ? 124.998 93.493  121.191 1.00 23.41  ? 46  HIS D ND1   1 
ATOM   7483  C CD2   . HIS F 6 18  ? 123.418 93.294  119.682 1.00 25.87  ? 46  HIS D CD2   1 
ATOM   7484  C CE1   . HIS F 6 18  ? 124.213 94.550  121.309 1.00 27.01  ? 46  HIS D CE1   1 
ATOM   7485  N NE2   . HIS F 6 18  ? 123.243 94.451  120.407 1.00 29.16  ? 46  HIS D NE2   1 
ATOM   7486  N N     . PRO F 6 19  ? 128.397 89.663  119.936 1.00 27.73  ? 47  PRO D N     1 
ATOM   7487  C CA    . PRO F 6 19  ? 129.082 88.363  119.939 1.00 27.54  ? 47  PRO D CA    1 
ATOM   7488  C C     . PRO F 6 19  ? 128.461 87.208  120.688 1.00 24.29  ? 47  PRO D C     1 
ATOM   7489  O O     . PRO F 6 19  ? 128.526 86.080  120.234 1.00 26.29  ? 47  PRO D O     1 
ATOM   7490  C CB    . PRO F 6 19  ? 130.487 88.696  120.482 1.00 27.32  ? 47  PRO D CB    1 
ATOM   7491  C CG    . PRO F 6 19  ? 130.691 90.099  120.027 1.00 29.14  ? 47  PRO D CG    1 
ATOM   7492  C CD    . PRO F 6 19  ? 129.327 90.767  120.295 1.00 21.62  ? 47  PRO D CD    1 
ATOM   7493  N N     . ASP F 6 20  ? 127.861 87.478  121.829 1.00 26.19  ? 48  ASP D N     1 
ATOM   7494  C CA    . ASP F 6 20  ? 127.284 86.413  122.636 1.00 28.39  ? 48  ASP D CA    1 
ATOM   7495  C C     . ASP F 6 20  ? 125.752 86.389  122.626 1.00 29.11  ? 48  ASP D C     1 
ATOM   7496  O O     . ASP F 6 20  ? 125.135 85.834  123.531 1.00 26.88  ? 48  ASP D O     1 
ATOM   7497  C CB    . ASP F 6 20  ? 127.748 86.562  124.085 1.00 31.25  ? 48  ASP D CB    1 
ATOM   7498  C CG    . ASP F 6 20  ? 129.266 86.634  124.200 1.00 38.02  ? 48  ASP D CG    1 
ATOM   7499  O OD1   . ASP F 6 20  ? 129.935 85.829  123.539 1.00 37.02  ? 48  ASP D OD1   1 
ATOM   7500  O OD2   . ASP F 6 20  ? 129.776 87.496  124.943 1.00 42.01  ? 48  ASP D OD2   1 
ATOM   7501  N N     . THR F 6 21  ? 125.150 86.994  121.614 1.00 28.92  ? 49  THR D N     1 
ATOM   7502  C CA    . THR F 6 21  ? 123.687 87.057  121.527 1.00 25.64  ? 49  THR D CA    1 
ATOM   7503  C C     . THR F 6 21  ? 123.229 86.155  120.372 1.00 25.00  ? 49  THR D C     1 
ATOM   7504  O O     . THR F 6 21  ? 123.821 86.160  119.292 1.00 26.29  ? 49  THR D O     1 
ATOM   7505  C CB    . THR F 6 21  ? 123.250 88.515  121.243 1.00 28.76  ? 49  THR D CB    1 
ATOM   7506  O OG1   . THR F 6 21  ? 123.664 89.356  122.327 1.00 28.08  ? 49  THR D OG1   1 
ATOM   7507  C CG2   . THR F 6 21  ? 121.690 88.631  121.030 1.00 23.38  ? 49  THR D CG2   1 
ATOM   7508  N N     . GLY F 6 22  ? 122.216 85.339  120.611 1.00 25.90  ? 50  GLY D N     1 
ATOM   7509  C CA    . GLY F 6 22  ? 121.695 84.513  119.530 1.00 25.88  ? 50  GLY D CA    1 
ATOM   7510  C C     . GLY F 6 22  ? 120.364 85.099  118.976 1.00 25.98  ? 50  GLY D C     1 
ATOM   7511  O O     . GLY F 6 22  ? 119.964 86.216  119.336 1.00 23.66  ? 50  GLY D O     1 
ATOM   7512  N N     . ILE F 6 23  ? 119.672 84.357  118.125 1.00 27.35  ? 51  ILE D N     1 
ATOM   7513  C CA    . ILE F 6 23  ? 118.389 84.827  117.565 1.00 29.10  ? 51  ILE D CA    1 
ATOM   7514  C C     . ILE F 6 23  ? 117.488 83.580  117.327 1.00 29.81  ? 51  ILE D C     1 
ATOM   7515  O O     . ILE F 6 23  ? 117.971 82.544  116.892 1.00 26.78  ? 51  ILE D O     1 
ATOM   7516  C CB    . ILE F 6 23  ? 118.656 85.662  116.284 1.00 28.71  ? 51  ILE D CB    1 
ATOM   7517  C CG1   . ILE F 6 23  ? 117.348 86.144  115.643 1.00 28.40  ? 51  ILE D CG1   1 
ATOM   7518  C CG2   . ILE F 6 23  ? 119.530 84.845  115.282 1.00 26.75  ? 51  ILE D CG2   1 
ATOM   7519  C CD1   . ILE F 6 23  ? 117.605 87.137  114.468 1.00 23.07  ? 51  ILE D CD1   1 
ATOM   7520  N N     . SER F 6 24  ? 116.212 83.671  117.701 1.00 26.77  ? 52  SER D N     1 
ATOM   7521  C CA    . SER F 6 24  ? 115.285 82.556  117.564 1.00 27.29  ? 52  SER D CA    1 
ATOM   7522  C C     . SER F 6 24  ? 114.955 82.425  116.094 1.00 30.37  ? 52  SER D C     1 
ATOM   7523  O O     . SER F 6 24  ? 115.246 83.343  115.318 1.00 26.85  ? 52  SER D O     1 
ATOM   7524  C CB    . SER F 6 24  ? 114.024 82.806  118.390 1.00 26.64  ? 52  SER D CB    1 
ATOM   7525  O OG    . SER F 6 24  ? 113.139 83.717  117.753 1.00 29.04  ? 52  SER D OG    1 
ATOM   7526  N N     . SER F 6 25  ? 114.378 81.291  115.696 1.00 28.48  ? 53  SER D N     1 
ATOM   7527  C CA    . SER F 6 25  ? 114.066 81.109  114.295 1.00 29.81  ? 53  SER D CA    1 
ATOM   7528  C C     . SER F 6 25  ? 112.969 82.095  113.859 1.00 28.81  ? 53  SER D C     1 
ATOM   7529  O O     . SER F 6 25  ? 113.017 82.618  112.743 1.00 27.69  ? 53  SER D O     1 
ATOM   7530  C CB    . SER F 6 25  ? 113.638 79.651  114.007 1.00 31.35  ? 53  SER D CB    1 
ATOM   7531  O OG    . SER F 6 25  ? 112.481 79.323  114.753 1.00 35.25  ? 53  SER D OG    1 
ATOM   7532  N N     . LYS F 6 26  ? 112.004 82.380  114.728 1.00 26.88  ? 54  LYS D N     1 
ATOM   7533  C CA    . LYS F 6 26  ? 110.934 83.303  114.323 1.00 26.88  ? 54  LYS D CA    1 
ATOM   7534  C C     . LYS F 6 26  ? 111.492 84.710  114.108 1.00 25.46  ? 54  LYS D C     1 
ATOM   7535  O O     . LYS F 6 26  ? 111.068 85.413  113.179 1.00 25.81  ? 54  LYS D O     1 
ATOM   7536  C CB    . LYS F 6 26  ? 109.829 83.314  115.367 1.00 31.54  ? 54  LYS D CB    1 
ATOM   7537  C CG    . LYS F 6 26  ? 109.129 81.970  115.492 1.00 38.51  ? 54  LYS D CG    1 
ATOM   7538  C CD    . LYS F 6 26  ? 108.091 81.992  116.588 1.00 45.20  ? 54  LYS D CD    1 
ATOM   7539  C CE    . LYS F 6 26  ? 107.271 80.705  116.603 1.00 46.87  ? 54  LYS D CE    1 
ATOM   7540  N NZ    . LYS F 6 26  ? 106.365 80.682  117.786 1.00 57.57  ? 54  LYS D NZ    1 
ATOM   7541  N N     . ALA F 6 27  ? 112.460 85.127  114.949 1.00 25.75  ? 55  ALA D N     1 
ATOM   7542  C CA    . ALA F 6 27  ? 113.076 86.457  114.771 1.00 20.41  ? 55  ALA D CA    1 
ATOM   7543  C C     . ALA F 6 27  ? 113.901 86.454  113.517 1.00 20.23  ? 55  ALA D C     1 
ATOM   7544  O O     . ALA F 6 27  ? 113.947 87.460  112.818 1.00 23.04  ? 55  ALA D O     1 
ATOM   7545  C CB    . ALA F 6 27  ? 113.998 86.852  115.975 1.00 20.12  ? 55  ALA D CB    1 
ATOM   7546  N N     . MET F 6 28  ? 114.568 85.338  113.212 1.00 20.63  ? 56  MET D N     1 
ATOM   7547  C CA    . MET F 6 28  ? 115.371 85.271  111.988 1.00 20.51  ? 56  MET D CA    1 
ATOM   7548  C C     . MET F 6 28  ? 114.410 85.341  110.795 1.00 23.11  ? 56  MET D C     1 
ATOM   7549  O O     . MET F 6 28  ? 114.728 85.933  109.766 1.00 24.65  ? 56  MET D O     1 
ATOM   7550  C CB    . MET F 6 28  ? 116.195 83.964  111.916 1.00 21.71  ? 56  MET D CB    1 
ATOM   7551  C CG    . MET F 6 28  ? 117.044 83.852  110.661 1.00 23.61  ? 56  MET D CG    1 
ATOM   7552  S SD    . MET F 6 28  ? 118.205 85.224  110.468 1.00 29.00  ? 56  MET D SD    1 
ATOM   7553  C CE    . MET F 6 28  ? 119.737 84.482  111.362 1.00 28.84  ? 56  MET D CE    1 
ATOM   7554  N N     . SER F 6 29  ? 113.232 84.755  110.937 1.00 19.14  ? 57  SER D N     1 
ATOM   7555  C CA    . SER F 6 29  ? 112.277 84.828  109.829 1.00 26.01  ? 57  SER D CA    1 
ATOM   7556  C C     . SER F 6 29  ? 111.856 86.289  109.636 1.00 22.02  ? 57  SER D C     1 
ATOM   7557  O O     . SER F 6 29  ? 111.728 86.778  108.504 1.00 26.39  ? 57  SER D O     1 
ATOM   7558  C CB    . SER F 6 29  ? 111.043 83.951  110.099 1.00 26.57  ? 57  SER D CB    1 
ATOM   7559  O OG    . SER F 6 29  ? 110.255 83.951  108.909 1.00 34.08  ? 57  SER D OG    1 
ATOM   7560  N N     . ILE F 6 30  ? 111.662 86.997  110.739 1.00 20.27  ? 58  ILE D N     1 
ATOM   7561  C CA    . ILE F 6 30  ? 111.324 88.401  110.639 1.00 21.28  ? 58  ILE D CA    1 
ATOM   7562  C C     . ILE F 6 30  ? 112.495 89.173  109.974 1.00 22.61  ? 58  ILE D C     1 
ATOM   7563  O O     . ILE F 6 30  ? 112.265 90.027  109.095 1.00 20.92  ? 58  ILE D O     1 
ATOM   7564  C CB    . ILE F 6 30  ? 111.009 88.953  112.009 1.00 22.49  ? 58  ILE D CB    1 
ATOM   7565  C CG1   . ILE F 6 30  ? 109.646 88.392  112.471 1.00 28.92  ? 58  ILE D CG1   1 
ATOM   7566  C CG2   . ILE F 6 30  ? 110.947 90.502  111.971 1.00 17.14  ? 58  ILE D CG2   1 
ATOM   7567  C CD1   . ILE F 6 30  ? 109.508 88.401  113.938 1.00 30.29  ? 58  ILE D CD1   1 
ATOM   7568  N N     . MET F 6 31  ? 113.744 88.859  110.360 1.00 18.74  ? 59  MET D N     1 
ATOM   7569  C CA    . MET F 6 31  ? 114.879 89.547  109.750 1.00 21.16  ? 59  MET D CA    1 
ATOM   7570  C C     . MET F 6 31  ? 114.953 89.219  108.245 1.00 21.85  ? 59  MET D C     1 
ATOM   7571  O O     . MET F 6 31  ? 115.318 90.071  107.459 1.00 19.55  ? 59  MET D O     1 
ATOM   7572  C CB    . MET F 6 31  ? 116.217 89.153  110.434 1.00 21.63  ? 59  MET D CB    1 
ATOM   7573  C CG    . MET F 6 31  ? 116.357 89.683  111.868 1.00 18.52  ? 59  MET D CG    1 
ATOM   7574  S SD    . MET F 6 31  ? 116.296 91.452  111.900 1.00 25.36  ? 59  MET D SD    1 
ATOM   7575  C CE    . MET F 6 31  ? 117.624 91.864  110.767 1.00 24.42  ? 59  MET D CE    1 
ATOM   7576  N N     . ASN F 6 32  ? 114.657 87.976  107.857 1.00 21.31  ? 60  ASN D N     1 
ATOM   7577  C CA    . ASN F 6 32  ? 114.700 87.639  106.447 1.00 22.67  ? 60  ASN D CA    1 
ATOM   7578  C C     . ASN F 6 32  ? 113.612 88.433  105.686 1.00 22.16  ? 60  ASN D C     1 
ATOM   7579  O O     . ASN F 6 32  ? 113.852 88.873  104.562 1.00 24.27  ? 60  ASN D O     1 
ATOM   7580  C CB    . ASN F 6 32  ? 114.520 86.122  106.246 1.00 26.60  ? 60  ASN D CB    1 
ATOM   7581  C CG    . ASN F 6 32  ? 114.865 85.692  104.820 1.00 35.43  ? 60  ASN D CG    1 
ATOM   7582  O OD1   . ASN F 6 32  ? 115.964 85.969  104.339 1.00 34.44  ? 60  ASN D OD1   1 
ATOM   7583  N ND2   . ASN F 6 32  ? 113.916 85.041  104.132 1.00 30.67  ? 60  ASN D ND2   1 
ATOM   7584  N N     . SER F 6 33  ? 112.426 88.604  106.292 1.00 24.71  ? 61  SER D N     1 
ATOM   7585  C CA    . SER F 6 33  ? 111.318 89.395  105.668 1.00 25.61  ? 61  SER D CA    1 
ATOM   7586  C C     . SER F 6 33  ? 111.775 90.849  105.520 1.00 24.77  ? 61  SER D C     1 
ATOM   7587  O O     . SER F 6 33  ? 111.499 91.505  104.521 1.00 24.41  ? 61  SER D O     1 
ATOM   7588  C CB    . SER F 6 33  ? 110.081 89.417  106.573 1.00 23.25  ? 61  SER D CB    1 
ATOM   7589  O OG    . SER F 6 33  ? 109.362 88.201  106.508 1.00 23.16  ? 61  SER D OG    1 
ATOM   7590  N N     . PHE F 6 34  ? 112.471 91.346  106.549 1.00 23.74  ? 62  PHE D N     1 
ATOM   7591  C CA    . PHE F 6 34  ? 112.933 92.732  106.548 1.00 22.78  ? 62  PHE D CA    1 
ATOM   7592  C C     . PHE F 6 34  ? 113.905 92.927  105.405 1.00 21.87  ? 62  PHE D C     1 
ATOM   7593  O O     . PHE F 6 34  ? 113.717 93.797  104.572 1.00 23.31  ? 62  PHE D O     1 
ATOM   7594  C CB    . PHE F 6 34  ? 113.605 93.062  107.899 1.00 26.02  ? 62  PHE D CB    1 
ATOM   7595  C CG    . PHE F 6 34  ? 114.329 94.381  107.914 1.00 26.23  ? 62  PHE D CG    1 
ATOM   7596  C CD1   . PHE F 6 34  ? 113.627 95.576  107.841 1.00 25.04  ? 62  PHE D CD1   1 
ATOM   7597  C CD2   . PHE F 6 34  ? 115.731 94.412  108.020 1.00 29.29  ? 62  PHE D CD2   1 
ATOM   7598  C CE1   . PHE F 6 34  ? 114.301 96.810  107.865 1.00 31.34  ? 62  PHE D CE1   1 
ATOM   7599  C CE2   . PHE F 6 34  ? 116.421 95.636  108.050 1.00 31.52  ? 62  PHE D CE2   1 
ATOM   7600  C CZ    . PHE F 6 34  ? 115.697 96.845  107.968 1.00 27.66  ? 62  PHE D CZ    1 
ATOM   7601  N N     . VAL F 6 35  ? 114.933 92.092  105.328 1.00 21.76  ? 63  VAL D N     1 
ATOM   7602  C CA    . VAL F 6 35  ? 115.881 92.279  104.246 1.00 20.80  ? 63  VAL D CA    1 
ATOM   7603  C C     . VAL F 6 35  ? 115.202 92.210  102.860 1.00 22.62  ? 63  VAL D C     1 
ATOM   7604  O O     . VAL F 6 35  ? 115.442 93.057  102.032 1.00 21.86  ? 63  VAL D O     1 
ATOM   7605  C CB    . VAL F 6 35  ? 117.038 91.273  104.331 1.00 20.57  ? 63  VAL D CB    1 
ATOM   7606  C CG1   . VAL F 6 35  ? 117.971 91.495  103.146 1.00 20.14  ? 63  VAL D CG1   1 
ATOM   7607  C CG2   . VAL F 6 35  ? 117.828 91.502  105.659 1.00 18.87  ? 63  VAL D CG2   1 
ATOM   7608  N N     . ASN F 6 36  ? 114.353 91.214  102.619 1.00 23.01  ? 64  ASN D N     1 
ATOM   7609  C CA    . ASN F 6 36  ? 113.646 91.106  101.340 1.00 22.74  ? 64  ASN D CA    1 
ATOM   7610  C C     . ASN F 6 36  ? 112.769 92.307  101.069 1.00 19.01  ? 64  ASN D C     1 
ATOM   7611  O O     . ASN F 6 36  ? 112.667 92.776  99.935  1.00 22.29  ? 64  ASN D O     1 
ATOM   7612  C CB    . ASN F 6 36  ? 112.755 89.860  101.317 1.00 25.29  ? 64  ASN D CB    1 
ATOM   7613  C CG    . ASN F 6 36  ? 113.559 88.587  101.144 1.00 31.28  ? 64  ASN D CG    1 
ATOM   7614  O OD1   . ASN F 6 36  ? 114.471 88.542  100.322 1.00 32.91  ? 64  ASN D OD1   1 
ATOM   7615  N ND2   . ASN F 6 36  ? 113.220 87.537  101.900 1.00 35.41  ? 64  ASN D ND2   1 
ATOM   7616  N N     . ASP F 6 37  ? 112.114 92.787  102.119 1.00 21.91  ? 65  ASP D N     1 
ATOM   7617  C CA    . ASP F 6 37  ? 111.227 93.934  102.009 1.00 24.25  ? 65  ASP D CA    1 
ATOM   7618  C C     . ASP F 6 37  ? 112.012 95.181  101.542 1.00 26.03  ? 65  ASP D C     1 
ATOM   7619  O O     . ASP F 6 37  ? 111.648 95.826  100.535 1.00 23.29  ? 65  ASP D O     1 
ATOM   7620  C CB    . ASP F 6 37  ? 110.561 94.171  103.369 1.00 24.78  ? 65  ASP D CB    1 
ATOM   7621  C CG    . ASP F 6 37  ? 109.525 95.291  103.322 1.00 26.79  ? 65  ASP D CG    1 
ATOM   7622  O OD1   . ASP F 6 37  ? 108.984 95.508  102.228 1.00 33.94  ? 65  ASP D OD1   1 
ATOM   7623  O OD2   . ASP F 6 37  ? 109.229 95.935  104.359 1.00 24.63  ? 65  ASP D OD2   1 
ATOM   7624  N N     . VAL F 6 38  ? 113.111 95.497  102.248 1.00 22.25  ? 66  VAL D N     1 
ATOM   7625  C CA    . VAL F 6 38  ? 113.917 96.664  101.897 1.00 20.53  ? 66  VAL D CA    1 
ATOM   7626  C C     . VAL F 6 38  ? 114.571 96.448  100.533 1.00 20.81  ? 66  VAL D C     1 
ATOM   7627  O O     . VAL F 6 38  ? 114.672 97.366  99.741  1.00 22.68  ? 66  VAL D O     1 
ATOM   7628  C CB    . VAL F 6 38  ? 114.998 96.932  102.996 1.00 24.40  ? 66  VAL D CB    1 
ATOM   7629  C CG1   . VAL F 6 38  ? 115.876 98.078  102.582 1.00 25.56  ? 66  VAL D CG1   1 
ATOM   7630  C CG2   . VAL F 6 38  ? 114.285 97.220  104.370 1.00 23.01  ? 66  VAL D CG2   1 
ATOM   7631  N N     . PHE F 6 39  ? 115.028 95.231  100.245 1.00 19.96  ? 67  PHE D N     1 
ATOM   7632  C CA    . PHE F 6 39  ? 115.608 94.987  98.924  1.00 21.97  ? 67  PHE D CA    1 
ATOM   7633  C C     . PHE F 6 39  ? 114.555 95.388  97.855  1.00 23.56  ? 67  PHE D C     1 
ATOM   7634  O O     . PHE F 6 39  ? 114.827 96.185  96.938  1.00 23.68  ? 67  PHE D O     1 
ATOM   7635  C CB    . PHE F 6 39  ? 115.933 93.489  98.788  1.00 23.17  ? 67  PHE D CB    1 
ATOM   7636  C CG    . PHE F 6 39  ? 116.346 93.070  97.394  1.00 27.93  ? 67  PHE D CG    1 
ATOM   7637  C CD1   . PHE F 6 39  ? 115.384 92.787  96.425  1.00 32.96  ? 67  PHE D CD1   1 
ATOM   7638  C CD2   . PHE F 6 39  ? 117.683 92.984  97.045  1.00 32.39  ? 67  PHE D CD2   1 
ATOM   7639  C CE1   . PHE F 6 39  ? 115.748 92.433  95.131  1.00 35.88  ? 67  PHE D CE1   1 
ATOM   7640  C CE2   . PHE F 6 39  ? 118.070 92.630  95.749  1.00 32.74  ? 67  PHE D CE2   1 
ATOM   7641  C CZ    . PHE F 6 39  ? 117.105 92.355  94.788  1.00 33.09  ? 67  PHE D CZ    1 
ATOM   7642  N N     . GLU F 6 40  ? 113.352 94.836  97.965  1.00 24.21  ? 68  GLU D N     1 
ATOM   7643  C CA    . GLU F 6 40  ? 112.295 95.136  96.973  1.00 26.46  ? 68  GLU D CA    1 
ATOM   7644  C C     . GLU F 6 40  ? 111.976 96.621  96.922  1.00 25.16  ? 68  GLU D C     1 
ATOM   7645  O O     . GLU F 6 40  ? 111.794 97.186  95.856  1.00 26.48  ? 68  GLU D O     1 
ATOM   7646  C CB    . GLU F 6 40  ? 110.984 94.409  97.314  1.00 29.46  ? 68  GLU D CB    1 
ATOM   7647  C CG    . GLU F 6 40  ? 111.036 92.902  97.473  1.00 42.85  ? 68  GLU D CG    1 
ATOM   7648  C CD    . GLU F 6 40  ? 109.775 92.391  98.182  1.00 49.38  ? 68  GLU D CD    1 
ATOM   7649  O OE1   . GLU F 6 40  ? 108.664 92.703  97.711  1.00 55.15  ? 68  GLU D OE1   1 
ATOM   7650  O OE2   . GLU F 6 40  ? 109.886 91.706  99.216  1.00 54.50  ? 68  GLU D OE2   1 
ATOM   7651  N N     . ARG F 6 41  ? 111.885 97.257  98.085  1.00 24.70  ? 69  ARG D N     1 
ATOM   7652  C CA    . ARG F 6 41  ? 111.557 98.670  98.091  1.00 23.62  ? 69  ARG D CA    1 
ATOM   7653  C C     . ARG F 6 41  ? 112.631 99.483  97.399  1.00 26.73  ? 69  ARG D C     1 
ATOM   7654  O O     . ARG F 6 41  ? 112.337 100.309 96.518  1.00 23.28  ? 69  ARG D O     1 
ATOM   7655  C CB    . ARG F 6 41  ? 111.361 99.176  99.513  1.00 25.42  ? 69  ARG D CB    1 
ATOM   7656  C CG    . ARG F 6 41  ? 110.107 98.693  100.181 1.00 28.28  ? 69  ARG D CG    1 
ATOM   7657  C CD    . ARG F 6 41  ? 109.855 99.617  101.394 1.00 33.34  ? 69  ARG D CD    1 
ATOM   7658  N NE    . ARG F 6 41  ? 109.571 98.886  102.594 1.00 29.49  ? 69  ARG D NE    1 
ATOM   7659  C CZ    . ARG F 6 41  ? 109.355 99.461  103.771 1.00 27.95  ? 69  ARG D CZ    1 
ATOM   7660  N NH1   . ARG F 6 41  ? 109.408 100.781 103.890 1.00 24.23  ? 69  ARG D NH1   1 
ATOM   7661  N NH2   . ARG F 6 41  ? 108.997 98.713  104.811 1.00 30.46  ? 69  ARG D NH2   1 
ATOM   7662  N N     . ILE F 6 42  ? 113.886 99.235  97.770  1.00 22.77  ? 70  ILE D N     1 
ATOM   7663  C CA    . ILE F 6 42  ? 114.959 99.981  97.135  1.00 21.89  ? 70  ILE D CA    1 
ATOM   7664  C C     . ILE F 6 42  ? 115.031 99.646  95.630  1.00 25.17  ? 70  ILE D C     1 
ATOM   7665  O O     . ILE F 6 42  ? 115.181 100.544 94.813  1.00 26.96  ? 70  ILE D O     1 
ATOM   7666  C CB    . ILE F 6 42  ? 116.335 99.659  97.792  1.00 23.13  ? 70  ILE D CB    1 
ATOM   7667  C CG1   . ILE F 6 42  ? 116.390 100.222 99.228  1.00 21.87  ? 70  ILE D CG1   1 
ATOM   7668  C CG2   . ILE F 6 42  ? 117.452 100.229 96.910  1.00 25.06  ? 70  ILE D CG2   1 
ATOM   7669  C CD1   . ILE F 6 42  ? 117.615 99.702  100.061 1.00 26.68  ? 70  ILE D CD1   1 
ATOM   7670  N N     . ALA F 6 43  ? 114.916 98.361  95.283  1.00 25.88  ? 71  ALA D N     1 
ATOM   7671  C CA    . ALA F 6 43  ? 115.015 97.941  93.873  1.00 26.10  ? 71  ALA D CA    1 
ATOM   7672  C C     . ALA F 6 43  ? 113.891 98.544  93.047  1.00 24.44  ? 71  ALA D C     1 
ATOM   7673  O O     . ALA F 6 43  ? 114.123 98.998  91.953  1.00 24.92  ? 71  ALA D O     1 
ATOM   7674  C CB    . ALA F 6 43  ? 115.017 96.419  93.746  1.00 22.05  ? 71  ALA D CB    1 
ATOM   7675  N N     . GLY F 6 44  ? 112.689 98.574  93.597  1.00 25.37  ? 72  GLY D N     1 
ATOM   7676  C CA    . GLY F 6 44  ? 111.555 99.159  92.895  1.00 26.66  ? 72  GLY D CA    1 
ATOM   7677  C C     . GLY F 6 44  ? 111.722 100.663 92.695  1.00 29.31  ? 72  GLY D C     1 
ATOM   7678  O O     . GLY F 6 44  ? 111.411 101.183 91.621  1.00 28.41  ? 72  GLY D O     1 
ATOM   7679  N N     . GLU F 6 45  ? 112.176 101.373 93.732  1.00 28.36  ? 73  GLU D N     1 
ATOM   7680  C CA    . GLU F 6 45  ? 112.425 102.806 93.616  1.00 29.58  ? 73  GLU D CA    1 
ATOM   7681  C C     . GLU F 6 45  ? 113.507 103.007 92.536  1.00 26.02  ? 73  GLU D C     1 
ATOM   7682  O O     . GLU F 6 45  ? 113.416 103.934 91.744  1.00 28.77  ? 73  GLU D O     1 
ATOM   7683  C CB    . GLU F 6 45  ? 112.959 103.394 94.935  1.00 30.16  ? 73  GLU D CB    1 
ATOM   7684  C CG    . GLU F 6 45  ? 112.001 103.420 96.093  1.00 36.47  ? 73  GLU D CG    1 
ATOM   7685  C CD    . GLU F 6 45  ? 110.987 104.543 96.018  1.00 37.35  ? 73  GLU D CD    1 
ATOM   7686  O OE1   . GLU F 6 45  ? 111.116 105.446 95.160  1.00 37.68  ? 73  GLU D OE1   1 
ATOM   7687  O OE2   . GLU F 6 45  ? 110.048 104.518 96.830  1.00 38.18  ? 73  GLU D OE2   1 
ATOM   7688  N N     . ALA F 6 46  ? 114.527 102.140 92.515  1.00 25.20  ? 74  ALA D N     1 
ATOM   7689  C CA    . ALA F 6 46  ? 115.631 102.252 91.519  1.00 25.71  ? 74  ALA D CA    1 
ATOM   7690  C C     . ALA F 6 46  ? 115.099 102.042 90.106  1.00 25.33  ? 74  ALA D C     1 
ATOM   7691  O O     . ALA F 6 46  ? 115.481 102.754 89.170  1.00 26.31  ? 74  ALA D O     1 
ATOM   7692  C CB    . ALA F 6 46  ? 116.743 101.195 91.810  1.00 26.12  ? 74  ALA D CB    1 
ATOM   7693  N N     . SER F 6 47  ? 114.238 101.035 89.955  1.00 26.00  ? 75  SER D N     1 
ATOM   7694  C CA    . SER F 6 47  ? 113.613 100.721 88.661  1.00 28.20  ? 75  SER D CA    1 
ATOM   7695  C C     . SER F 6 47  ? 112.828 101.898 88.073  1.00 30.26  ? 75  SER D C     1 
ATOM   7696  O O     . SER F 6 47  ? 112.986 102.247 86.893  1.00 28.06  ? 75  SER D O     1 
ATOM   7697  C CB    . SER F 6 47  ? 112.653 99.555  88.826  1.00 28.50  ? 75  SER D CB    1 
ATOM   7698  O OG    . SER F 6 47  ? 112.056 99.247  87.587  1.00 32.98  ? 75  SER D OG    1 
ATOM   7699  N N     . ARG F 6 48  ? 111.974 102.489 88.909  1.00 29.67  ? 76  ARG D N     1 
ATOM   7700  C CA    . ARG F 6 48  ? 111.136 103.617 88.512  1.00 31.71  ? 76  ARG D CA    1 
ATOM   7701  C C     . ARG F 6 48  ? 112.051 104.760 88.156  1.00 33.42  ? 76  ARG D C     1 
ATOM   7702  O O     . ARG F 6 48  ? 111.898 105.399 87.106  1.00 33.52  ? 76  ARG D O     1 
ATOM   7703  C CB    . ARG F 6 48  ? 110.203 104.049 89.663  1.00 32.82  ? 76  ARG D CB    1 
ATOM   7704  C CG    . ARG F 6 48  ? 109.000 103.124 89.920  1.00 33.38  ? 76  ARG D CG    1 
ATOM   7705  C CD    . ARG F 6 48  ? 108.258 103.454 91.278  1.00 38.04  ? 76  ARG D CD    1 
ATOM   7706  N NE    . ARG F 6 48  ? 107.978 102.174 91.912  1.00 46.26  ? 76  ARG D NE    1 
ATOM   7707  C CZ    . ARG F 6 48  ? 108.336 101.814 93.134  1.00 43.68  ? 76  ARG D CZ    1 
ATOM   7708  N NH1   . ARG F 6 48  ? 108.989 102.640 93.931  1.00 48.26  ? 76  ARG D NH1   1 
ATOM   7709  N NH2   . ARG F 6 48  ? 108.099 100.575 93.524  1.00 51.89  ? 76  ARG D NH2   1 
ATOM   7710  N N     . LEU F 6 49  ? 113.018 105.010 89.035  1.00 30.75  ? 77  LEU D N     1 
ATOM   7711  C CA    . LEU F 6 49  ? 113.975 106.083 88.803  1.00 32.57  ? 77  LEU D CA    1 
ATOM   7712  C C     . LEU F 6 49  ? 114.623 105.958 87.410  1.00 32.90  ? 77  LEU D C     1 
ATOM   7713  O O     . LEU F 6 49  ? 114.641 106.904 86.636  1.00 34.48  ? 77  LEU D O     1 
ATOM   7714  C CB    . LEU F 6 49  ? 115.060 106.051 89.878  1.00 31.63  ? 77  LEU D CB    1 
ATOM   7715  C CG    . LEU F 6 49  ? 116.008 107.240 89.774  1.00 38.87  ? 77  LEU D CG    1 
ATOM   7716  C CD1   . LEU F 6 49  ? 115.271 108.539 90.136  1.00 36.23  ? 77  LEU D CD1   1 
ATOM   7717  C CD2   . LEU F 6 49  ? 117.185 107.018 90.705  1.00 40.45  ? 77  LEU D CD2   1 
ATOM   7718  N N     . ALA F 6 50  ? 115.155 104.785 87.103  1.00 31.70  ? 78  ALA D N     1 
ATOM   7719  C CA    . ALA F 6 50  ? 115.781 104.555 85.819  1.00 34.03  ? 78  ALA D CA    1 
ATOM   7720  C C     . ALA F 6 50  ? 114.752 104.760 84.698  1.00 34.69  ? 78  ALA D C     1 
ATOM   7721  O O     . ALA F 6 50  ? 115.062 105.345 83.669  1.00 36.28  ? 78  ALA D O     1 
ATOM   7722  C CB    . ALA F 6 50  ? 116.346 103.116 85.754  1.00 29.81  ? 78  ALA D CB    1 
ATOM   7723  N N     . HIS F 6 51  ? 113.539 104.263 84.885  1.00 34.09  ? 79  HIS D N     1 
ATOM   7724  C CA    . HIS F 6 51  ? 112.543 104.409 83.829  1.00 36.47  ? 79  HIS D CA    1 
ATOM   7725  C C     . HIS F 6 51  ? 112.225 105.869 83.619  1.00 35.37  ? 79  HIS D C     1 
ATOM   7726  O O     . HIS F 6 51  ? 112.239 106.338 82.490  1.00 38.98  ? 79  HIS D O     1 
ATOM   7727  C CB    . HIS F 6 51  ? 111.274 103.597 84.135  1.00 38.51  ? 79  HIS D CB    1 
ATOM   7728  C CG    . HIS F 6 51  ? 111.405 102.139 83.818  1.00 45.37  ? 79  HIS D CG    1 
ATOM   7729  N ND1   . HIS F 6 51  ? 111.625 101.674 82.537  1.00 54.67  ? 79  HIS D ND1   1 
ATOM   7730  C CD2   . HIS F 6 51  ? 111.384 101.042 84.613  1.00 49.06  ? 79  HIS D CD2   1 
ATOM   7731  C CE1   . HIS F 6 51  ? 111.736 100.356 82.559  1.00 52.24  ? 79  HIS D CE1   1 
ATOM   7732  N NE2   . HIS F 6 51  ? 111.596 99.947  83.807  1.00 50.31  ? 79  HIS D NE2   1 
ATOM   7733  N N     . TYR F 6 52  ? 111.973 106.596 84.706  1.00 33.74  ? 80  TYR D N     1 
ATOM   7734  C CA    . TYR F 6 52  ? 111.680 108.025 84.631  1.00 36.11  ? 80  TYR D CA    1 
ATOM   7735  C C     . TYR F 6 52  ? 112.761 108.762 83.828  1.00 37.83  ? 80  TYR D C     1 
ATOM   7736  O O     . TYR F 6 52  ? 112.476 109.747 83.146  1.00 38.44  ? 80  TYR D O     1 
ATOM   7737  C CB    . TYR F 6 52  ? 111.624 108.653 86.045  1.00 36.02  ? 80  TYR D CB    1 
ATOM   7738  C CG    . TYR F 6 52  ? 110.535 108.124 86.967  1.00 40.69  ? 80  TYR D CG    1 
ATOM   7739  C CD1   . TYR F 6 52  ? 109.485 107.334 86.486  1.00 40.97  ? 80  TYR D CD1   1 
ATOM   7740  C CD2   . TYR F 6 52  ? 110.545 108.443 88.324  1.00 40.98  ? 80  TYR D CD2   1 
ATOM   7741  C CE1   . TYR F 6 52  ? 108.468 106.879 87.342  1.00 45.11  ? 80  TYR D CE1   1 
ATOM   7742  C CE2   . TYR F 6 52  ? 109.543 107.998 89.180  1.00 43.64  ? 80  TYR D CE2   1 
ATOM   7743  C CZ    . TYR F 6 52  ? 108.511 107.221 88.693  1.00 46.73  ? 80  TYR D CZ    1 
ATOM   7744  O OH    . TYR F 6 52  ? 107.516 106.808 89.561  1.00 48.89  ? 80  TYR D OH    1 
ATOM   7745  N N     . ASN F 6 53  ? 114.007 108.310 83.931  1.00 37.33  ? 81  ASN D N     1 
ATOM   7746  C CA    . ASN F 6 53  ? 115.111 108.953 83.211  1.00 38.45  ? 81  ASN D CA    1 
ATOM   7747  C C     . ASN F 6 53  ? 115.493 108.250 81.918  1.00 37.32  ? 81  ASN D C     1 
ATOM   7748  O O     . ASN F 6 53  ? 116.580 108.470 81.366  1.00 38.36  ? 81  ASN D O     1 
ATOM   7749  C CB    . ASN F 6 53  ? 116.321 109.058 84.126  1.00 35.51  ? 81  ASN D CB    1 
ATOM   7750  C CG    . ASN F 6 53  ? 116.129 110.105 85.178  1.00 38.83  ? 81  ASN D CG    1 
ATOM   7751  O OD1   . ASN F 6 53  ? 116.130 111.291 84.872  1.00 37.40  ? 81  ASN D OD1   1 
ATOM   7752  N ND2   . ASN F 6 53  ? 115.928 109.683 86.427  1.00 37.22  ? 81  ASN D ND2   1 
ATOM   7753  N N     . LYS F 6 54  ? 114.602 107.394 81.438  1.00 37.68  ? 82  LYS D N     1 
ATOM   7754  C CA    . LYS F 6 54  ? 114.846 106.676 80.194  1.00 41.31  ? 82  LYS D CA    1 
ATOM   7755  C C     . LYS F 6 54  ? 116.198 105.974 80.141  1.00 41.63  ? 82  LYS D C     1 
ATOM   7756  O O     . LYS F 6 54  ? 116.876 106.017 79.130  1.00 41.30  ? 82  LYS D O     1 
ATOM   7757  C CB    . LYS F 6 54  ? 114.707 107.643 79.019  1.00 42.03  ? 82  LYS D CB    1 
ATOM   7758  C CG    . LYS F 6 54  ? 113.266 108.075 78.800  1.00 48.68  ? 82  LYS D CG    1 
ATOM   7759  C CD    . LYS F 6 54  ? 113.160 109.255 77.863  1.00 56.10  ? 82  LYS D CD    1 
ATOM   7760  C CE    . LYS F 6 54  ? 111.756 109.830 77.899  1.00 57.21  ? 82  LYS D CE    1 
ATOM   7761  N NZ    . LYS F 6 54  ? 111.684 111.109 77.141  1.00 65.01  ? 82  LYS D NZ    1 
ATOM   7762  N N     . ARG F 6 55  ? 116.574 105.329 81.240  1.00 41.52  ? 83  ARG D N     1 
ATOM   7763  C CA    . ARG F 6 55  ? 117.825 104.592 81.336  1.00 41.59  ? 83  ARG D CA    1 
ATOM   7764  C C     . ARG F 6 55  ? 117.493 103.124 81.452  1.00 41.63  ? 83  ARG D C     1 
ATOM   7765  O O     . ARG F 6 55  ? 116.615 102.745 82.222  1.00 41.66  ? 83  ARG D O     1 
ATOM   7766  C CB    . ARG F 6 55  ? 118.613 105.014 82.580  1.00 43.64  ? 83  ARG D CB    1 
ATOM   7767  C CG    . ARG F 6 55  ? 119.239 106.391 82.470  1.00 51.71  ? 83  ARG D CG    1 
ATOM   7768  C CD    . ARG F 6 55  ? 120.381 106.397 81.472  1.00 56.97  ? 83  ARG D CD    1 
ATOM   7769  N NE    . ARG F 6 55  ? 120.884 107.745 81.241  1.00 62.82  ? 83  ARG D NE    1 
ATOM   7770  C CZ    . ARG F 6 55  ? 120.246 108.657 80.520  1.00 65.84  ? 83  ARG D CZ    1 
ATOM   7771  N NH1   . ARG F 6 55  ? 119.085 108.354 79.958  1.00 70.99  ? 83  ARG D NH1   1 
ATOM   7772  N NH2   . ARG F 6 55  ? 120.758 109.871 80.372  1.00 69.25  ? 83  ARG D NH2   1 
ATOM   7773  N N     . SER F 6 56  ? 118.198 102.287 80.712  1.00 37.27  ? 84  SER D N     1 
ATOM   7774  C CA    . SER F 6 56  ? 117.942 100.865 80.786  1.00 36.68  ? 84  SER D CA    1 
ATOM   7775  C C     . SER F 6 56  ? 118.862 100.190 81.822  1.00 34.20  ? 84  SER D C     1 
ATOM   7776  O O     . SER F 6 56  ? 118.798 98.976  82.011  1.00 33.19  ? 84  SER D O     1 
ATOM   7777  C CB    . SER F 6 56  ? 118.174 100.246 79.409  1.00 40.47  ? 84  SER D CB    1 
ATOM   7778  O OG    . SER F 6 56  ? 119.492 100.516 78.984  1.00 40.97  ? 84  SER D OG    1 
ATOM   7779  N N     . THR F 6 57  ? 119.708 100.976 82.487  1.00 32.46  ? 85  THR D N     1 
ATOM   7780  C CA    . THR F 6 57  ? 120.632 100.409 83.475  1.00 31.84  ? 85  THR D CA    1 
ATOM   7781  C C     . THR F 6 57  ? 120.455 100.884 84.918  1.00 30.94  ? 85  THR D C     1 
ATOM   7782  O O     . THR F 6 57  ? 120.361 102.078 85.191  1.00 31.27  ? 85  THR D O     1 
ATOM   7783  C CB    . THR F 6 57  ? 122.117 100.714 83.123  1.00 34.00  ? 85  THR D CB    1 
ATOM   7784  O OG1   . THR F 6 57  ? 122.328 100.528 81.723  1.00 37.99  ? 85  THR D OG1   1 
ATOM   7785  C CG2   . THR F 6 57  ? 123.053 99.731  83.871  1.00 34.48  ? 85  THR D CG2   1 
ATOM   7786  N N     . ILE F 6 58  ? 120.414 99.950  85.850  1.00 30.27  ? 86  ILE D N     1 
ATOM   7787  C CA    . ILE F 6 58  ? 120.344 100.358 87.243  1.00 28.22  ? 86  ILE D CA    1 
ATOM   7788  C C     . ILE F 6 58  ? 121.790 100.270 87.721  1.00 28.62  ? 86  ILE D C     1 
ATOM   7789  O O     . ILE F 6 58  ? 122.357 99.178  87.786  1.00 29.84  ? 86  ILE D O     1 
ATOM   7790  C CB    . ILE F 6 58  ? 119.469 99.413  88.088  1.00 28.26  ? 86  ILE D CB    1 
ATOM   7791  C CG1   . ILE F 6 58  ? 117.976 99.736  87.828  1.00 30.27  ? 86  ILE D CG1   1 
ATOM   7792  C CG2   . ILE F 6 58  ? 119.789 99.605  89.579  1.00 27.21  ? 86  ILE D CG2   1 
ATOM   7793  C CD1   . ILE F 6 58  ? 116.991 98.798  88.558  1.00 28.79  ? 86  ILE D CD1   1 
ATOM   7794  N N     . THR F 6 59  ? 122.383 101.414 88.015  1.00 26.22  ? 87  THR D N     1 
ATOM   7795  C CA    . THR F 6 59  ? 123.758 101.455 88.517  1.00 28.81  ? 87  THR D CA    1 
ATOM   7796  C C     . THR F 6 59  ? 123.719 101.834 89.997  1.00 30.64  ? 87  THR D C     1 
ATOM   7797  O O     . THR F 6 59  ? 122.653 102.094 90.559  1.00 30.18  ? 87  THR D O     1 
ATOM   7798  C CB    . THR F 6 59  ? 124.580 102.514 87.801  1.00 30.56  ? 87  THR D CB    1 
ATOM   7799  O OG1   . THR F 6 59  ? 124.109 103.807 88.197  1.00 28.32  ? 87  THR D OG1   1 
ATOM   7800  C CG2   . THR F 6 59  ? 124.438 102.369 86.275  1.00 29.51  ? 87  THR D CG2   1 
ATOM   7801  N N     . SER F 6 60  ? 124.884 101.885 90.629  1.00 28.53  ? 88  SER D N     1 
ATOM   7802  C CA    . SER F 6 60  ? 124.926 102.213 92.033  1.00 28.31  ? 88  SER D CA    1 
ATOM   7803  C C     . SER F 6 60  ? 124.361 103.593 92.259  1.00 29.47  ? 88  SER D C     1 
ATOM   7804  O O     . SER F 6 60  ? 123.887 103.909 93.361  1.00 30.96  ? 88  SER D O     1 
ATOM   7805  C CB    . SER F 6 60  ? 126.362 102.107 92.567  1.00 29.46  ? 88  SER D CB    1 
ATOM   7806  O OG    . SER F 6 60  ? 127.163 103.037 91.914  1.00 30.30  ? 88  SER D OG    1 
ATOM   7807  N N     . ARG F 6 61  ? 124.385 104.425 91.225  1.00 28.50  ? 89  ARG D N     1 
ATOM   7808  C CA    . ARG F 6 61  ? 123.824 105.768 91.358  1.00 28.95  ? 89  ARG D CA    1 
ATOM   7809  C C     . ARG F 6 61  ? 122.281 105.734 91.548  1.00 30.12  ? 89  ARG D C     1 
ATOM   7810  O O     . ARG F 6 61  ? 121.725 106.570 92.262  1.00 28.46  ? 89  ARG D O     1 
ATOM   7811  C CB    . ARG F 6 61  ? 124.177 106.598 90.139  1.00 33.68  ? 89  ARG D CB    1 
ATOM   7812  C CG    . ARG F 6 61  ? 123.892 108.076 90.338  1.00 39.79  ? 89  ARG D CG    1 
ATOM   7813  C CD    . ARG F 6 61  ? 124.657 108.951 89.314  1.00 47.90  ? 89  ARG D CD    1 
ATOM   7814  N NE    . ARG F 6 61  ? 124.393 110.362 89.588  1.00 44.75  ? 89  ARG D NE    1 
ATOM   7815  C CZ    . ARG F 6 61  ? 123.304 111.002 89.182  1.00 44.02  ? 89  ARG D CZ    1 
ATOM   7816  N NH1   . ARG F 6 61  ? 122.400 110.359 88.466  1.00 39.88  ? 89  ARG D NH1   1 
ATOM   7817  N NH2   . ARG F 6 61  ? 123.100 112.267 89.530  1.00 44.88  ? 89  ARG D NH2   1 
ATOM   7818  N N     . GLU F 6 62  ? 121.592 104.797 90.898  1.00 29.27  ? 90  GLU D N     1 
ATOM   7819  C CA    . GLU F 6 62  ? 120.146 104.686 91.076  1.00 30.36  ? 90  GLU D CA    1 
ATOM   7820  C C     . GLU F 6 62  ? 119.888 104.086 92.463  1.00 28.53  ? 90  GLU D C     1 
ATOM   7821  O O     . GLU F 6 62  ? 118.920 104.460 93.134  1.00 28.10  ? 90  GLU D O     1 
ATOM   7822  C CB    . GLU F 6 62  ? 119.495 103.782 90.008  1.00 28.96  ? 90  GLU D CB    1 
ATOM   7823  C CG    . GLU F 6 62  ? 119.266 104.455 88.654  1.00 33.07  ? 90  GLU D CG    1 
ATOM   7824  C CD    . GLU F 6 62  ? 120.560 104.851 87.970  1.00 33.28  ? 90  GLU D CD    1 
ATOM   7825  O OE1   . GLU F 6 62  ? 120.620 105.971 87.424  1.00 34.33  ? 90  GLU D OE1   1 
ATOM   7826  O OE2   . GLU F 6 62  ? 121.508 104.037 87.976  1.00 35.06  ? 90  GLU D OE2   1 
ATOM   7827  N N     . ILE F 6 63  ? 120.739 103.153 92.893  1.00 28.60  ? 91  ILE D N     1 
ATOM   7828  C CA    . ILE F 6 63  ? 120.527 102.562 94.212  1.00 25.83  ? 91  ILE D CA    1 
ATOM   7829  C C     . ILE F 6 63  ? 120.704 103.664 95.252  1.00 28.31  ? 91  ILE D C     1 
ATOM   7830  O O     . ILE F 6 63  ? 119.932 103.758 96.215  1.00 28.88  ? 91  ILE D O     1 
ATOM   7831  C CB    . ILE F 6 63  ? 121.542 101.405 94.542  1.00 27.20  ? 91  ILE D CB    1 
ATOM   7832  C CG1   . ILE F 6 63  ? 121.416 100.228 93.539  1.00 29.21  ? 91  ILE D CG1   1 
ATOM   7833  C CG2   . ILE F 6 63  ? 121.317 100.948 95.993  1.00 19.20  ? 91  ILE D CG2   1 
ATOM   7834  C CD1   . ILE F 6 63  ? 120.017 99.513  93.473  1.00 28.44  ? 91  ILE D CD1   1 
ATOM   7835  N N     . GLN F 6 64  ? 121.686 104.542 95.040  1.00 26.73  ? 92  GLN D N     1 
ATOM   7836  C CA    . GLN F 6 64  ? 121.924 105.605 96.020  1.00 26.82  ? 92  GLN D CA    1 
ATOM   7837  C C     . GLN F 6 64  ? 120.741 106.555 96.098  1.00 23.18  ? 92  GLN D C     1 
ATOM   7838  O O     . GLN F 6 64  ? 120.306 106.919 97.183  1.00 25.40  ? 92  GLN D O     1 
ATOM   7839  C CB    . GLN F 6 64  ? 123.220 106.371 95.688  1.00 27.97  ? 92  GLN D CB    1 
ATOM   7840  C CG    . GLN F 6 64  ? 123.450 107.622 96.524  1.00 29.86  ? 92  GLN D CG    1 
ATOM   7841  C CD    . GLN F 6 64  ? 124.863 108.164 96.313  1.00 32.56  ? 92  GLN D CD    1 
ATOM   7842  O OE1   . GLN F 6 64  ? 125.079 109.078 95.531  1.00 35.89  ? 92  GLN D OE1   1 
ATOM   7843  N NE2   . GLN F 6 64  ? 125.817 107.571 96.979  1.00 22.59  ? 92  GLN D NE2   1 
ATOM   7844  N N     . THR F 6 65  ? 120.208 106.960 94.958  1.00 24.43  ? 93  THR D N     1 
ATOM   7845  C CA    . THR F 6 65  ? 119.058 107.862 94.980  1.00 25.80  ? 93  THR D CA    1 
ATOM   7846  C C     . THR F 6 65  ? 117.831 107.157 95.578  1.00 24.20  ? 93  THR D C     1 
ATOM   7847  O O     . THR F 6 65  ? 117.088 107.755 96.350  1.00 24.41  ? 93  THR D O     1 
ATOM   7848  C CB    . THR F 6 65  ? 118.736 108.383 93.573  1.00 28.18  ? 93  THR D CB    1 
ATOM   7849  O OG1   . THR F 6 65  ? 119.876 109.104 93.084  1.00 28.10  ? 93  THR D OG1   1 
ATOM   7850  C CG2   . THR F 6 65  ? 117.518 109.311 93.611  1.00 23.35  ? 93  THR D CG2   1 
ATOM   7851  N N     . ALA F 6 66  ? 117.651 105.877 95.258  1.00 24.61  ? 94  ALA D N     1 
ATOM   7852  C CA    . ALA F 6 66  ? 116.518 105.129 95.800  1.00 25.62  ? 94  ALA D CA    1 
ATOM   7853  C C     . ALA F 6 66  ? 116.640 105.106 97.328  1.00 27.99  ? 94  ALA D C     1 
ATOM   7854  O O     . ALA F 6 66  ? 115.647 105.272 98.070  1.00 27.68  ? 94  ALA D O     1 
ATOM   7855  C CB    . ALA F 6 66  ? 116.516 103.702 95.240  1.00 23.12  ? 94  ALA D CB    1 
ATOM   7856  N N     . VAL F 6 67  ? 117.867 104.902 97.804  1.00 27.20  ? 95  VAL D N     1 
ATOM   7857  C CA    . VAL F 6 67  ? 118.115 104.868 99.231  1.00 26.22  ? 95  VAL D CA    1 
ATOM   7858  C C     . VAL F 6 67  ? 117.761 106.193 99.891  1.00 26.03  ? 95  VAL D C     1 
ATOM   7859  O O     . VAL F 6 67  ? 117.175 106.222 100.981 1.00 25.22  ? 95  VAL D O     1 
ATOM   7860  C CB    . VAL F 6 67  ? 119.594 104.499 99.545  1.00 28.41  ? 95  VAL D CB    1 
ATOM   7861  C CG1   . VAL F 6 67  ? 119.882 104.750 101.003 1.00 26.57  ? 95  VAL D CG1   1 
ATOM   7862  C CG2   . VAL F 6 67  ? 119.835 102.982 99.207  1.00 23.85  ? 95  VAL D CG2   1 
ATOM   7863  N N     . ARG F 6 68  ? 118.083 107.292 99.231  1.00 26.02  ? 96  ARG D N     1 
ATOM   7864  C CA    . ARG F 6 68  ? 117.786 108.609 99.774  1.00 26.77  ? 96  ARG D CA    1 
ATOM   7865  C C     . ARG F 6 68  ? 116.289 108.857 99.808  1.00 29.31  ? 96  ARG D C     1 
ATOM   7866  O O     . ARG F 6 68  ? 115.789 109.482 100.734 1.00 29.21  ? 96  ARG D O     1 
ATOM   7867  C CB    . ARG F 6 68  ? 118.478 109.705 98.939  1.00 29.01  ? 96  ARG D CB    1 
ATOM   7868  C CG    . ARG F 6 68  ? 119.923 109.952 99.405  1.00 35.74  ? 96  ARG D CG    1 
ATOM   7869  C CD    . ARG F 6 68  ? 120.743 110.630 98.315  1.00 45.47  ? 96  ARG D CD    1 
ATOM   7870  N NE    . ARG F 6 68  ? 122.128 110.919 98.710  1.00 49.89  ? 96  ARG D NE    1 
ATOM   7871  C CZ    . ARG F 6 68  ? 123.077 111.306 97.853  1.00 52.08  ? 96  ARG D CZ    1 
ATOM   7872  N NH1   . ARG F 6 68  ? 122.801 111.445 96.560  1.00 47.25  ? 96  ARG D NH1   1 
ATOM   7873  N NH2   . ARG F 6 68  ? 124.308 111.565 98.288  1.00 55.42  ? 96  ARG D NH2   1 
ATOM   7874  N N     . LEU F 6 69  ? 115.590 108.417 98.767  1.00 24.90  ? 97  LEU D N     1 
ATOM   7875  C CA    . LEU F 6 69  ? 114.132 108.550 98.709  1.00 27.54  ? 97  LEU D CA    1 
ATOM   7876  C C     . LEU F 6 69  ? 113.437 107.682 99.754  1.00 29.39  ? 97  LEU D C     1 
ATOM   7877  O O     . LEU F 6 69  ? 112.445 108.099 100.374 1.00 28.49  ? 97  LEU D O     1 
ATOM   7878  C CB    . LEU F 6 69  ? 113.621 108.101 97.357  1.00 26.55  ? 97  LEU D CB    1 
ATOM   7879  C CG    . LEU F 6 69  ? 114.029 108.982 96.160  1.00 28.36  ? 97  LEU D CG    1 
ATOM   7880  C CD1   . LEU F 6 69  ? 113.724 108.229 94.893  1.00 28.72  ? 97  LEU D CD1   1 
ATOM   7881  C CD2   . LEU F 6 69  ? 113.300 110.309 96.211  1.00 26.86  ? 97  LEU D CD2   1 
ATOM   7882  N N     . LEU F 6 70  ? 113.962 106.476 99.956  1.00 28.68  ? 98  LEU D N     1 
ATOM   7883  C CA    . LEU F 6 70  ? 113.319 105.539 100.871 1.00 27.36  ? 98  LEU D CA    1 
ATOM   7884  C C     . LEU F 6 70  ? 113.625 105.672 102.346 1.00 29.78  ? 98  LEU D C     1 
ATOM   7885  O O     . LEU F 6 70  ? 112.729 105.532 103.156 1.00 29.54  ? 98  LEU D O     1 
ATOM   7886  C CB    . LEU F 6 70  ? 113.632 104.106 100.451 1.00 29.23  ? 98  LEU D CB    1 
ATOM   7887  C CG    . LEU F 6 70  ? 113.032 102.940 101.271 1.00 36.11  ? 98  LEU D CG    1 
ATOM   7888  C CD1   . LEU F 6 70  ? 111.554 102.826 100.934 1.00 39.34  ? 98  LEU D CD1   1 
ATOM   7889  C CD2   . LEU F 6 70  ? 113.711 101.598 100.948 1.00 34.51  ? 98  LEU D CD2   1 
ATOM   7890  N N     . LEU F 6 71  ? 114.875 105.948 102.701 1.00 27.27  ? 99  LEU D N     1 
ATOM   7891  C CA    . LEU F 6 71  ? 115.245 105.969 104.103 1.00 28.84  ? 99  LEU D CA    1 
ATOM   7892  C C     . LEU F 6 71  ? 115.146 107.277 104.853 1.00 30.82  ? 99  LEU D C     1 
ATOM   7893  O O     . LEU F 6 71  ? 115.486 108.338 104.328 1.00 33.92  ? 99  LEU D O     1 
ATOM   7894  C CB    . LEU F 6 71  ? 116.672 105.421 104.288 1.00 25.90  ? 99  LEU D CB    1 
ATOM   7895  C CG    . LEU F 6 71  ? 117.065 104.043 103.762 1.00 33.90  ? 99  LEU D CG    1 
ATOM   7896  C CD1   . LEU F 6 71  ? 118.407 103.623 104.417 1.00 26.74  ? 99  LEU D CD1   1 
ATOM   7897  C CD2   . LEU F 6 71  ? 116.015 103.013 104.094 1.00 29.17  ? 99  LEU D CD2   1 
ATOM   7898  N N     . PRO F 6 72  ? 114.696 107.217 106.116 1.00 31.22  ? 100 PRO D N     1 
ATOM   7899  C CA    . PRO F 6 72  ? 114.583 108.443 106.918 1.00 35.77  ? 100 PRO D CA    1 
ATOM   7900  C C     . PRO F 6 72  ? 115.995 108.996 107.108 1.00 33.95  ? 100 PRO D C     1 
ATOM   7901  O O     . PRO F 6 72  ? 116.977 108.257 107.050 1.00 36.68  ? 100 PRO D O     1 
ATOM   7902  C CB    . PRO F 6 72  ? 114.014 107.951 108.251 1.00 33.60  ? 100 PRO D CB    1 
ATOM   7903  C CG    . PRO F 6 72  ? 113.416 106.609 107.944 1.00 34.83  ? 100 PRO D CG    1 
ATOM   7904  C CD    . PRO F 6 72  ? 114.327 106.032 106.910 1.00 32.26  ? 100 PRO D CD    1 
ATOM   7905  N N     . GLY F 6 73  ? 116.058 110.289 107.372 1.00 36.36  ? 101 GLY D N     1 
ATOM   7906  C CA    . GLY F 6 73  ? 117.294 111.029 107.586 1.00 35.04  ? 101 GLY D CA    1 
ATOM   7907  C C     . GLY F 6 73  ? 118.627 110.392 107.893 1.00 34.95  ? 101 GLY D C     1 
ATOM   7908  O O     . GLY F 6 73  ? 119.446 110.150 107.003 1.00 36.95  ? 101 GLY D O     1 
ATOM   7909  N N     . GLU F 6 74  ? 118.870 110.149 109.164 1.00 35.45  ? 102 GLU D N     1 
ATOM   7910  C CA    . GLU F 6 74  ? 120.124 109.591 109.614 1.00 35.67  ? 102 GLU D CA    1 
ATOM   7911  C C     . GLU F 6 74  ? 120.424 108.212 109.027 1.00 38.59  ? 102 GLU D C     1 
ATOM   7912  O O     . GLU F 6 74  ? 121.597 107.894 108.771 1.00 36.97  ? 102 GLU D O     1 
ATOM   7913  C CB    . GLU F 6 74  ? 120.117 109.576 111.140 1.00 39.40  ? 102 GLU D CB    1 
ATOM   7914  C CG    . GLU F 6 74  ? 121.436 109.988 111.797 1.00 51.51  ? 102 GLU D CG    1 
ATOM   7915  C CD    . GLU F 6 74  ? 122.114 111.172 111.103 1.00 50.78  ? 102 GLU D CD    1 
ATOM   7916  O OE1   . GLU F 6 74  ? 121.540 112.279 111.033 1.00 54.04  ? 102 GLU D OE1   1 
ATOM   7917  O OE2   . GLU F 6 74  ? 123.232 110.980 110.611 1.00 54.79  ? 102 GLU D OE2   1 
ATOM   7918  N N     . LEU F 6 75  ? 119.397 107.380 108.789 1.00 31.64  ? 103 LEU D N     1 
ATOM   7919  C CA    . LEU F 6 75  ? 119.662 106.062 108.206 1.00 27.62  ? 103 LEU D CA    1 
ATOM   7920  C C     . LEU F 6 75  ? 120.119 106.232 106.762 1.00 25.37  ? 103 LEU D C     1 
ATOM   7921  O O     . LEU F 6 75  ? 120.990 105.512 106.279 1.00 28.67  ? 103 LEU D O     1 
ATOM   7922  C CB    . LEU F 6 75  ? 118.394 105.165 108.234 1.00 27.68  ? 103 LEU D CB    1 
ATOM   7923  C CG    . LEU F 6 75  ? 117.996 104.590 109.594 1.00 28.45  ? 103 LEU D CG    1 
ATOM   7924  C CD1   . LEU F 6 75  ? 116.590 103.848 109.464 1.00 25.91  ? 103 LEU D CD1   1 
ATOM   7925  C CD2   . LEU F 6 75  ? 119.087 103.590 110.039 1.00 25.28  ? 103 LEU D CD2   1 
ATOM   7926  N N     . ALA F 6 76  ? 119.513 107.158 106.040 1.00 26.29  ? 104 ALA D N     1 
ATOM   7927  C CA    . ALA F 6 76  ? 119.933 107.339 104.661 1.00 26.61  ? 104 ALA D CA    1 
ATOM   7928  C C     . ALA F 6 76  ? 121.414 107.766 104.605 1.00 30.79  ? 104 ALA D C     1 
ATOM   7929  O O     . ALA F 6 76  ? 122.198 107.240 103.795 1.00 31.16  ? 104 ALA D O     1 
ATOM   7930  C CB    . ALA F 6 76  ? 119.061 108.353 103.990 1.00 27.47  ? 104 ALA D CB    1 
ATOM   7931  N N     . LYS F 6 77  ? 121.799 108.683 105.489 1.00 33.55  ? 105 LYS D N     1 
ATOM   7932  C CA    . LYS F 6 77  ? 123.177 109.200 105.550 1.00 34.36  ? 105 LYS D CA    1 
ATOM   7933  C C     . LYS F 6 77  ? 124.190 108.104 105.728 1.00 36.18  ? 105 LYS D C     1 
ATOM   7934  O O     . LYS F 6 77  ? 125.183 108.010 104.963 1.00 35.06  ? 105 LYS D O     1 
ATOM   7935  C CB    . LYS F 6 77  ? 123.306 110.187 106.693 1.00 40.50  ? 105 LYS D CB    1 
ATOM   7936  C CG    . LYS F 6 77  ? 124.718 110.759 106.929 1.00 50.57  ? 105 LYS D CG    1 
ATOM   7937  C CD    . LYS F 6 77  ? 124.698 111.772 108.093 1.00 52.15  ? 105 LYS D CD    1 
ATOM   7938  C CE    . LYS F 6 77  ? 123.554 112.782 107.907 1.00 57.75  ? 105 LYS D CE    1 
ATOM   7939  N NZ    . LYS F 6 77  ? 123.324 113.656 109.110 1.00 64.78  ? 105 LYS D NZ    1 
ATOM   7940  N N     . HIS F 6 78  ? 123.939 107.254 106.721 1.00 30.21  ? 106 HIS D N     1 
ATOM   7941  C CA    . HIS F 6 78  ? 124.837 106.162 107.014 1.00 32.35  ? 106 HIS D CA    1 
ATOM   7942  C C     . HIS F 6 78  ? 124.811 105.071 105.944 1.00 32.91  ? 106 HIS D C     1 
ATOM   7943  O O     . HIS F 6 78  ? 125.852 104.489 105.633 1.00 30.36  ? 106 HIS D O     1 
ATOM   7944  C CB    . HIS F 6 78  ? 124.523 105.574 108.390 1.00 35.76  ? 106 HIS D CB    1 
ATOM   7945  C CG    . HIS F 6 78  ? 125.003 106.412 109.530 1.00 44.17  ? 106 HIS D CG    1 
ATOM   7946  N ND1   . HIS F 6 78  ? 124.427 106.367 110.783 1.00 50.90  ? 106 HIS D ND1   1 
ATOM   7947  C CD2   . HIS F 6 78  ? 126.017 107.304 109.613 1.00 45.53  ? 106 HIS D CD2   1 
ATOM   7948  C CE1   . HIS F 6 78  ? 125.065 107.201 111.586 1.00 48.20  ? 106 HIS D CE1   1 
ATOM   7949  N NE2   . HIS F 6 78  ? 126.034 107.779 110.900 1.00 47.78  ? 106 HIS D NE2   1 
ATOM   7950  N N     . ALA F 6 79  ? 123.626 104.778 105.396 1.00 31.16  ? 107 ALA D N     1 
ATOM   7951  C CA    . ALA F 6 79  ? 123.518 103.762 104.336 1.00 28.41  ? 107 ALA D CA    1 
ATOM   7952  C C     . ALA F 6 79  ? 124.330 104.269 103.152 1.00 28.98  ? 107 ALA D C     1 
ATOM   7953  O O     . ALA F 6 79  ? 125.088 103.515 102.556 1.00 29.37  ? 107 ALA D O     1 
ATOM   7954  C CB    . ALA F 6 79  ? 122.021 103.538 103.893 1.00 24.92  ? 107 ALA D CB    1 
ATOM   7955  N N     . VAL F 6 80  ? 124.133 105.534 102.794 1.00 29.23  ? 108 VAL D N     1 
ATOM   7956  C CA    . VAL F 6 80  ? 124.872 106.134 101.678 1.00 32.08  ? 108 VAL D CA    1 
ATOM   7957  C C     . VAL F 6 80  ? 126.397 105.992 101.856 1.00 34.91  ? 108 VAL D C     1 
ATOM   7958  O O     . VAL F 6 80  ? 127.089 105.555 100.926 1.00 31.04  ? 108 VAL D O     1 
ATOM   7959  C CB    . VAL F 6 80  ? 124.471 107.624 101.480 1.00 32.97  ? 108 VAL D CB    1 
ATOM   7960  C CG1   . VAL F 6 80  ? 125.445 108.334 100.522 1.00 36.46  ? 108 VAL D CG1   1 
ATOM   7961  C CG2   . VAL F 6 80  ? 123.082 107.681 100.870 1.00 31.68  ? 108 VAL D CG2   1 
ATOM   7962  N N     . SER F 6 81  ? 126.920 106.308 103.039 1.00 34.27  ? 109 SER D N     1 
ATOM   7963  C CA    . SER F 6 81  ? 128.371 106.178 103.287 1.00 35.72  ? 109 SER D CA    1 
ATOM   7964  C C     . SER F 6 81  ? 128.844 104.747 103.134 1.00 36.39  ? 109 SER D C     1 
ATOM   7965  O O     . SER F 6 81  ? 129.869 104.480 102.498 1.00 34.86  ? 109 SER D O     1 
ATOM   7966  C CB    . SER F 6 81  ? 128.745 106.656 104.702 1.00 32.84  ? 109 SER D CB    1 
ATOM   7967  O OG    . SER F 6 81  ? 128.318 107.992 104.861 1.00 46.99  ? 109 SER D OG    1 
ATOM   7968  N N     . GLU F 6 82  ? 128.113 103.824 103.737 1.00 33.16  ? 110 GLU D N     1 
ATOM   7969  C CA    . GLU F 6 82  ? 128.470 102.418 103.645 1.00 33.32  ? 110 GLU D CA    1 
ATOM   7970  C C     . GLU F 6 82  ? 128.435 101.895 102.196 1.00 34.16  ? 110 GLU D C     1 
ATOM   7971  O O     . GLU F 6 82  ? 129.317 101.128 101.773 1.00 32.69  ? 110 GLU D O     1 
ATOM   7972  C CB    . GLU F 6 82  ? 127.530 101.592 104.511 1.00 35.51  ? 110 GLU D CB    1 
ATOM   7973  C CG    . GLU F 6 82  ? 127.686 101.821 105.991 1.00 42.68  ? 110 GLU D CG    1 
ATOM   7974  C CD    . GLU F 6 82  ? 128.419 100.678 106.660 1.00 51.13  ? 110 GLU D CD    1 
ATOM   7975  O OE1   . GLU F 6 82  ? 129.669 100.660 106.608 1.00 51.35  ? 110 GLU D OE1   1 
ATOM   7976  O OE2   . GLU F 6 82  ? 127.739 99.784  107.222 1.00 52.24  ? 110 GLU D OE2   1 
ATOM   7977  N N     . GLY F 6 83  ? 127.419 102.277 101.433 1.00 30.13  ? 111 GLY D N     1 
ATOM   7978  C CA    . GLY F 6 83  ? 127.368 101.796 100.055 1.00 31.76  ? 111 GLY D CA    1 
ATOM   7979  C C     . GLY F 6 83  ? 128.467 102.425 99.203  1.00 29.36  ? 111 GLY D C     1 
ATOM   7980  O O     . GLY F 6 83  ? 129.128 101.756 98.407  1.00 31.11  ? 111 GLY D O     1 
ATOM   7981  N N     . THR F 6 84  ? 128.654 103.723 99.357  1.00 29.33  ? 112 THR D N     1 
ATOM   7982  C CA    . THR F 6 84  ? 129.698 104.421 98.609  1.00 34.86  ? 112 THR D CA    1 
ATOM   7983  C C     . THR F 6 84  ? 131.055 103.767 98.934  1.00 33.72  ? 112 THR D C     1 
ATOM   7984  O O     . THR F 6 84  ? 131.847 103.432 98.059  1.00 34.77  ? 112 THR D O     1 
ATOM   7985  C CB    . THR F 6 84  ? 129.770 105.876 99.023  1.00 32.17  ? 112 THR D CB    1 
ATOM   7986  O OG1   . THR F 6 84  ? 128.491 106.479 98.839  1.00 36.34  ? 112 THR D OG1   1 
ATOM   7987  C CG2   . THR F 6 84  ? 130.787 106.609 98.193  1.00 32.55  ? 112 THR D CG2   1 
ATOM   7988  N N     . LYS F 6 85  ? 131.302 103.570 100.212 1.00 32.40  ? 113 LYS D N     1 
ATOM   7989  C CA    . LYS F 6 85  ? 132.543 102.975 100.619 1.00 35.96  ? 113 LYS D CA    1 
ATOM   7990  C C     . LYS F 6 85  ? 132.708 101.584 100.014 1.00 35.41  ? 113 LYS D C     1 
ATOM   7991  O O     . LYS F 6 85  ? 133.792 101.242 99.529  1.00 33.95  ? 113 LYS D O     1 
ATOM   7992  C CB    . LYS F 6 85  ? 132.603 102.925 102.154 1.00 40.02  ? 113 LYS D CB    1 
ATOM   7993  C CG    . LYS F 6 85  ? 133.802 102.232 102.737 1.00 45.42  ? 113 LYS D CG    1 
ATOM   7994  C CD    . LYS F 6 85  ? 133.920 102.598 104.213 1.00 56.10  ? 113 LYS D CD    1 
ATOM   7995  C CE    . LYS F 6 85  ? 135.056 101.848 104.883 1.00 62.74  ? 113 LYS D CE    1 
ATOM   7996  N NZ    . LYS F 6 85  ? 134.786 100.383 104.942 1.00 67.45  ? 113 LYS D NZ    1 
ATOM   7997  N N     . ALA F 6 86  ? 131.639 100.792 100.015 1.00 30.43  ? 114 ALA D N     1 
ATOM   7998  C CA    . ALA F 6 86  ? 131.712 99.434  99.502  1.00 30.55  ? 114 ALA D CA    1 
ATOM   7999  C C     . ALA F 6 86  ? 132.038 99.422  98.004  1.00 32.81  ? 114 ALA D C     1 
ATOM   8000  O O     . ALA F 6 86  ? 132.794 98.559  97.536  1.00 32.18  ? 114 ALA D O     1 
ATOM   8001  C CB    . ALA F 6 86  ? 130.394 98.686  99.775  1.00 27.37  ? 114 ALA D CB    1 
ATOM   8002  N N     . VAL F 6 87  ? 131.480 100.381 97.263  1.00 32.30  ? 115 VAL D N     1 
ATOM   8003  C CA    . VAL F 6 87  ? 131.728 100.450 95.823  1.00 32.81  ? 115 VAL D CA    1 
ATOM   8004  C C     . VAL F 6 87  ? 133.140 100.958 95.542  1.00 32.42  ? 115 VAL D C     1 
ATOM   8005  O O     . VAL F 6 87  ? 133.827 100.396 94.729  1.00 31.78  ? 115 VAL D O     1 
ATOM   8006  C CB    . VAL F 6 87  ? 130.690 101.355 95.067  1.00 33.60  ? 115 VAL D CB    1 
ATOM   8007  C CG1   . VAL F 6 87  ? 131.058 101.433 93.584  1.00 29.16  ? 115 VAL D CG1   1 
ATOM   8008  C CG2   . VAL F 6 87  ? 129.256 100.766 95.205  1.00 28.36  ? 115 VAL D CG2   1 
ATOM   8009  N N     . THR F 6 88  ? 133.558 102.028 96.204  1.00 34.32  ? 116 THR D N     1 
ATOM   8010  C CA    . THR F 6 88  ? 134.908 102.527 96.017  1.00 37.04  ? 116 THR D CA    1 
ATOM   8011  C C     . THR F 6 88  ? 135.916 101.409 96.311  1.00 38.18  ? 116 THR D C     1 
ATOM   8012  O O     . THR F 6 88  ? 136.877 101.232 95.569  1.00 40.23  ? 116 THR D O     1 
ATOM   8013  C CB    . THR F 6 88  ? 135.186 103.694 96.938  1.00 36.15  ? 116 THR D CB    1 
ATOM   8014  O OG1   . THR F 6 88  ? 134.214 104.713 96.685  1.00 38.10  ? 116 THR D OG1   1 
ATOM   8015  C CG2   . THR F 6 88  ? 136.578 104.266 96.679  1.00 40.09  ? 116 THR D CG2   1 
ATOM   8016  N N     . LYS F 6 89  ? 135.692 100.642 97.378  1.00 36.05  ? 117 LYS D N     1 
ATOM   8017  C CA    . LYS F 6 89  ? 136.589 99.554  97.707  1.00 35.96  ? 117 LYS D CA    1 
ATOM   8018  C C     . LYS F 6 89  ? 136.538 98.471  96.651  1.00 38.51  ? 117 LYS D C     1 
ATOM   8019  O O     . LYS F 6 89  ? 137.575 97.942  96.207  1.00 39.60  ? 117 LYS D O     1 
ATOM   8020  C CB    . LYS F 6 89  ? 136.243 98.937  99.065  1.00 37.78  ? 117 LYS D CB    1 
ATOM   8021  C CG    . LYS F 6 89  ? 137.068 97.699  99.336  1.00 41.93  ? 117 LYS D CG    1 
ATOM   8022  C CD    . LYS F 6 89  ? 136.890 97.137  100.734 1.00 49.03  ? 117 LYS D CD    1 
ATOM   8023  C CE    . LYS F 6 89  ? 137.830 95.945  100.894 1.00 52.71  ? 117 LYS D CE    1 
ATOM   8024  N NZ    . LYS F 6 89  ? 137.625 95.220  102.166 1.00 62.79  ? 117 LYS D NZ    1 
ATOM   8025  N N     . TYR F 6 90  ? 135.325 98.122  96.246  1.00 35.02  ? 118 TYR D N     1 
ATOM   8026  C CA    . TYR F 6 90  ? 135.124 97.081  95.249  1.00 34.95  ? 118 TYR D CA    1 
ATOM   8027  C C     . TYR F 6 90  ? 135.876 97.360  93.952  1.00 40.07  ? 118 TYR D C     1 
ATOM   8028  O O     . TYR F 6 90  ? 136.479 96.464  93.347  1.00 37.74  ? 118 TYR D O     1 
ATOM   8029  C CB    . TYR F 6 90  ? 133.650 96.979  94.904  1.00 36.76  ? 118 TYR D CB    1 
ATOM   8030  C CG    . TYR F 6 90  ? 133.383 95.941  93.869  1.00 34.37  ? 118 TYR D CG    1 
ATOM   8031  C CD1   . TYR F 6 90  ? 133.424 94.593  94.202  1.00 34.48  ? 118 TYR D CD1   1 
ATOM   8032  C CD2   . TYR F 6 90  ? 133.101 96.297  92.540  1.00 34.23  ? 118 TYR D CD2   1 
ATOM   8033  C CE1   . TYR F 6 90  ? 133.190 93.623  93.253  1.00 38.04  ? 118 TYR D CE1   1 
ATOM   8034  C CE2   . TYR F 6 90  ? 132.867 95.328  91.580  1.00 33.81  ? 118 TYR D CE2   1 
ATOM   8035  C CZ    . TYR F 6 90  ? 132.907 93.997  91.950  1.00 36.40  ? 118 TYR D CZ    1 
ATOM   8036  O OH    . TYR F 6 90  ? 132.596 93.011  91.060  1.00 45.40  ? 118 TYR D OH    1 
ATOM   8037  N N     . THR F 6 91  ? 135.789 98.614  93.525  1.00 39.58  ? 119 THR D N     1 
ATOM   8038  C CA    . THR F 6 91  ? 136.399 99.060  92.300  1.00 47.46  ? 119 THR D CA    1 
ATOM   8039  C C     . THR F 6 91  ? 137.911 99.218  92.417  1.00 50.46  ? 119 THR D C     1 
ATOM   8040  O O     . THR F 6 91  ? 138.602 99.309  91.408  1.00 50.39  ? 119 THR D O     1 
ATOM   8041  C CB    . THR F 6 91  ? 135.770 100.392 91.865  1.00 48.38  ? 119 THR D CB    1 
ATOM   8042  O OG1   . THR F 6 91  ? 134.365 100.201 91.660  1.00 53.10  ? 119 THR D OG1   1 
ATOM   8043  C CG2   . THR F 6 91  ? 136.374 100.863 90.566  1.00 53.15  ? 119 THR D CG2   1 
ATOM   8044  N N     . SER F 6 92  ? 138.416 99.242  93.646  1.00 51.92  ? 120 SER D N     1 
ATOM   8045  C CA    . SER F 6 92  ? 139.845 99.386  93.863  1.00 54.61  ? 120 SER D CA    1 
ATOM   8046  C C     . SER F 6 92  ? 140.480 98.008  93.873  1.00 57.38  ? 120 SER D C     1 
ATOM   8047  O O     . SER F 6 92  ? 141.689 97.874  93.723  1.00 58.39  ? 120 SER D O     1 
ATOM   8048  C CB    . SER F 6 92  ? 140.120 100.069 95.202  1.00 52.96  ? 120 SER D CB    1 
ATOM   8049  O OG    . SER F 6 92  ? 140.045 99.120  96.258  1.00 49.36  ? 120 SER D OG    1 
ATOM   8050  N N     . ALA F 6 93  ? 139.656 96.981  94.036  1.00 60.91  ? 121 ALA D N     1 
ATOM   8051  C CA    . ALA F 6 93  ? 140.157 95.625  94.117  1.00 64.10  ? 121 ALA D CA    1 
ATOM   8052  C C     . ALA F 6 93  ? 140.160 94.781  92.846  1.00 69.63  ? 121 ALA D C     1 
ATOM   8053  O O     . ALA F 6 93  ? 139.652 93.654  92.853  1.00 70.29  ? 121 ALA D O     1 
ATOM   8054  C CB    . ALA F 6 93  ? 139.417 94.893  95.207  1.00 65.21  ? 121 ALA D CB    1 
ATOM   8055  N N     . LYS F 6 94  ? 140.735 95.304  91.763  1.00 72.63  ? 122 LYS D N     1 
ATOM   8056  C CA    . LYS F 6 94  ? 140.824 94.539  90.514  1.00 76.70  ? 122 LYS D CA    1 
ATOM   8057  C C     . LYS F 6 94  ? 141.395 95.333  89.343  1.00 78.69  ? 122 LYS D C     1 
ATOM   8058  O O     . LYS F 6 94  ? 142.546 95.035  88.956  1.00 79.38  ? 122 LYS D O     1 
ATOM   8059  C CB    . LYS F 6 94  ? 139.457 93.978  90.119  1.00 77.06  ? 122 LYS D CB    1 
ATOM   8060  C CG    . LYS F 6 94  ? 139.542 92.804  89.162  1.00 78.37  ? 122 LYS D CG    1 
ATOM   8061  C CD    . LYS F 6 94  ? 138.230 92.041  89.110  1.00 80.54  ? 122 LYS D CD    1 
ATOM   8062  C CE    . LYS F 6 94  ? 138.415 90.664  88.488  1.00 81.00  ? 122 LYS D CE    1 
ATOM   8063  N NZ    . LYS F 6 94  ? 137.168 89.847  88.569  1.00 81.09  ? 122 LYS D NZ    1 
ATOM   8064  O OXT   . LYS F 6 94  ? 140.693 96.238  88.833  1.00 80.44  ? 122 LYS D OXT   1 
ATOM   8065  N N     . PRO G 3 1   ? 84.708  91.458  152.412 1.00 57.69  ? 38  PRO E N     1 
ATOM   8066  C CA    . PRO G 3 1   ? 85.384  90.974  151.191 1.00 57.20  ? 38  PRO E CA    1 
ATOM   8067  C C     . PRO G 3 1   ? 86.047  92.117  150.417 1.00 55.98  ? 38  PRO E C     1 
ATOM   8068  O O     . PRO G 3 1   ? 85.417  93.127  150.105 1.00 56.83  ? 38  PRO E O     1 
ATOM   8069  C CB    . PRO G 3 1   ? 84.321  90.275  150.352 1.00 57.74  ? 38  PRO E CB    1 
ATOM   8070  C CG    . PRO G 3 1   ? 83.055  90.949  150.837 1.00 57.57  ? 38  PRO E CG    1 
ATOM   8071  C CD    . PRO G 3 1   ? 83.270  91.150  152.338 1.00 58.13  ? 38  PRO E CD    1 
ATOM   8072  N N     . HIS G 3 2   ? 87.329  91.940  150.122 1.00 54.89  ? 39  HIS E N     1 
ATOM   8073  C CA    . HIS G 3 2   ? 88.121  92.932  149.403 1.00 52.32  ? 39  HIS E CA    1 
ATOM   8074  C C     . HIS G 3 2   ? 87.653  93.161  147.963 1.00 48.64  ? 39  HIS E C     1 
ATOM   8075  O O     . HIS G 3 2   ? 87.212  92.235  147.283 1.00 47.38  ? 39  HIS E O     1 
ATOM   8076  C CB    . HIS G 3 2   ? 89.590  92.501  149.415 1.00 55.83  ? 39  HIS E CB    1 
ATOM   8077  C CG    . HIS G 3 2   ? 90.499  93.412  148.655 1.00 60.85  ? 39  HIS E CG    1 
ATOM   8078  N ND1   . HIS G 3 2   ? 90.501  93.484  147.278 1.00 60.99  ? 39  HIS E ND1   1 
ATOM   8079  C CD2   . HIS G 3 2   ? 91.444  94.285  149.080 1.00 61.23  ? 39  HIS E CD2   1 
ATOM   8080  C CE1   . HIS G 3 2   ? 91.409  94.362  146.888 1.00 61.56  ? 39  HIS E CE1   1 
ATOM   8081  N NE2   . HIS G 3 2   ? 91.995  94.861  147.961 1.00 61.76  ? 39  HIS E NE2   1 
ATOM   8082  N N     . ARG G 3 3   ? 87.746  94.410  147.516 1.00 44.53  ? 40  ARG E N     1 
ATOM   8083  C CA    . ARG G 3 3   ? 87.358  94.777  146.158 1.00 42.19  ? 40  ARG E CA    1 
ATOM   8084  C C     . ARG G 3 3   ? 88.222  95.903  145.589 1.00 40.27  ? 40  ARG E C     1 
ATOM   8085  O O     . ARG G 3 3   ? 88.349  96.960  146.204 1.00 36.80  ? 40  ARG E O     1 
ATOM   8086  C CB    . ARG G 3 3   ? 85.896  95.241  146.099 1.00 40.96  ? 40  ARG E CB    1 
ATOM   8087  C CG    . ARG G 3 3   ? 84.832  94.147  146.052 1.00 44.45  ? 40  ARG E CG    1 
ATOM   8088  C CD    . ARG G 3 3   ? 83.487  94.727  145.569 1.00 47.68  ? 40  ARG E CD    1 
ATOM   8089  N NE    . ARG G 3 3   ? 82.855  93.878  144.553 1.00 54.97  ? 40  ARG E NE    1 
ATOM   8090  C CZ    . ARG G 3 3   ? 82.761  94.189  143.267 1.00 55.09  ? 40  ARG E CZ    1 
ATOM   8091  N NH1   . ARG G 3 3   ? 83.251  95.329  142.819 1.00 63.33  ? 40  ARG E NH1   1 
ATOM   8092  N NH2   . ARG G 3 3   ? 82.176  93.367  142.423 1.00 54.19  ? 40  ARG E NH2   1 
ATOM   8093  N N     . TYR G 3 4   ? 88.821  95.687  144.422 1.00 36.03  ? 41  TYR E N     1 
ATOM   8094  C CA    . TYR G 3 4   ? 89.582  96.776  143.816 1.00 32.91  ? 41  TYR E CA    1 
ATOM   8095  C C     . TYR G 3 4   ? 88.505  97.664  143.257 1.00 29.50  ? 41  TYR E C     1 
ATOM   8096  O O     . TYR G 3 4   ? 87.427  97.192  142.945 1.00 31.32  ? 41  TYR E O     1 
ATOM   8097  C CB    . TYR G 3 4   ? 90.518  96.270  142.699 1.00 30.68  ? 41  TYR E CB    1 
ATOM   8098  C CG    . TYR G 3 4   ? 91.718  95.536  143.253 1.00 31.10  ? 41  TYR E CG    1 
ATOM   8099  C CD1   . TYR G 3 4   ? 92.774  96.233  143.840 1.00 32.34  ? 41  TYR E CD1   1 
ATOM   8100  C CD2   . TYR G 3 4   ? 91.766  94.155  143.268 1.00 32.18  ? 41  TYR E CD2   1 
ATOM   8101  C CE1   . TYR G 3 4   ? 93.839  95.564  144.441 1.00 32.69  ? 41  TYR E CE1   1 
ATOM   8102  C CE2   . TYR G 3 4   ? 92.841  93.478  143.854 1.00 33.11  ? 41  TYR E CE2   1 
ATOM   8103  C CZ    . TYR G 3 4   ? 93.865  94.191  144.438 1.00 30.43  ? 41  TYR E CZ    1 
ATOM   8104  O OH    . TYR G 3 4   ? 94.912  93.511  145.030 1.00 39.46  ? 41  TYR E OH    1 
ATOM   8105  N N     . ARG G 3 5   ? 88.775  98.954  143.158 1.00 30.02  ? 42  ARG E N     1 
ATOM   8106  C CA    . ARG G 3 5   ? 87.797  99.889  142.631 1.00 29.30  ? 42  ARG E CA    1 
ATOM   8107  C C     . ARG G 3 5   ? 87.679  99.732  141.099 1.00 34.55  ? 42  ARG E C     1 
ATOM   8108  O O     . ARG G 3 5   ? 88.617  99.299  140.429 1.00 31.70  ? 42  ARG E O     1 
ATOM   8109  C CB    . ARG G 3 5   ? 88.234  101.307 142.978 1.00 35.28  ? 42  ARG E CB    1 
ATOM   8110  C CG    . ARG G 3 5   ? 88.491  101.502 144.480 1.00 39.03  ? 42  ARG E CG    1 
ATOM   8111  C CD    . ARG G 3 5   ? 89.029  102.887 144.763 1.00 46.45  ? 42  ARG E CD    1 
ATOM   8112  N NE    . ARG G 3 5   ? 88.079  103.935 144.390 1.00 53.67  ? 42  ARG E NE    1 
ATOM   8113  C CZ    . ARG G 3 5   ? 88.372  105.230 144.397 1.00 59.92  ? 42  ARG E CZ    1 
ATOM   8114  N NH1   . ARG G 3 5   ? 89.588  105.637 144.750 1.00 61.16  ? 42  ARG E NH1   1 
ATOM   8115  N NH2   . ARG G 3 5   ? 87.447  106.124 144.070 1.00 62.73  ? 42  ARG E NH2   1 
ATOM   8116  N N     . PRO G 3 6   ? 86.519  100.080 140.530 1.00 33.84  ? 43  PRO E N     1 
ATOM   8117  C CA    . PRO G 3 6   ? 86.429  99.923  139.077 1.00 32.86  ? 43  PRO E CA    1 
ATOM   8118  C C     . PRO G 3 6   ? 87.487  100.756 138.359 1.00 31.74  ? 43  PRO E C     1 
ATOM   8119  O O     . PRO G 3 6   ? 87.627  101.958 138.615 1.00 32.90  ? 43  PRO E O     1 
ATOM   8120  C CB    . PRO G 3 6   ? 85.001  100.368 138.750 1.00 33.13  ? 43  PRO E CB    1 
ATOM   8121  C CG    . PRO G 3 6   ? 84.544  101.128 139.936 1.00 36.45  ? 43  PRO E CG    1 
ATOM   8122  C CD    . PRO G 3 6   ? 85.243  100.517 141.116 1.00 34.92  ? 43  PRO E CD    1 
ATOM   8123  N N     . GLY G 3 7   ? 88.240  100.101 137.482 1.00 29.31  ? 44  GLY E N     1 
ATOM   8124  C CA    . GLY G 3 7   ? 89.276  100.788 136.728 1.00 27.31  ? 44  GLY E CA    1 
ATOM   8125  C C     . GLY G 3 7   ? 90.655  100.292 137.112 1.00 29.05  ? 44  GLY E C     1 
ATOM   8126  O O     . GLY G 3 7   ? 91.577  100.260 136.290 1.00 31.47  ? 44  GLY E O     1 
ATOM   8127  N N     . THR G 3 8   ? 90.790  99.885  138.367 1.00 27.48  ? 45  THR E N     1 
ATOM   8128  C CA    . THR G 3 8   ? 92.048  99.384  138.891 1.00 27.40  ? 45  THR E CA    1 
ATOM   8129  C C     . THR G 3 8   ? 92.485  98.119  138.193 1.00 26.33  ? 45  THR E C     1 
ATOM   8130  O O     . THR G 3 8   ? 93.622  98.010  137.758 1.00 26.43  ? 45  THR E O     1 
ATOM   8131  C CB    . THR G 3 8   ? 91.942  99.118  140.412 1.00 28.36  ? 45  THR E CB    1 
ATOM   8132  O OG1   . THR G 3 8   ? 91.807  100.371 141.088 1.00 29.49  ? 45  THR E OG1   1 
ATOM   8133  C CG2   . THR G 3 8   ? 93.196  98.422  140.936 1.00 27.44  ? 45  THR E CG2   1 
ATOM   8134  N N     . VAL G 3 9   ? 91.587  97.148  138.087 1.00 27.17  ? 46  VAL E N     1 
ATOM   8135  C CA    . VAL G 3 9   ? 91.931  95.911  137.425 1.00 25.81  ? 46  VAL E CA    1 
ATOM   8136  C C     . VAL G 3 9   ? 92.083  96.167  135.911 1.00 26.57  ? 46  VAL E C     1 
ATOM   8137  O O     . VAL G 3 9   ? 92.955  95.591  135.268 1.00 26.99  ? 46  VAL E O     1 
ATOM   8138  C CB    . VAL G 3 9   ? 90.865  94.854  137.665 1.00 27.72  ? 46  VAL E CB    1 
ATOM   8139  C CG1   . VAL G 3 9   ? 91.279  93.522  136.964 1.00 27.98  ? 46  VAL E CG1   1 
ATOM   8140  C CG2   . VAL G 3 9   ? 90.704  94.625  139.198 1.00 30.66  ? 46  VAL E CG2   1 
ATOM   8141  N N     . ALA G 3 10  ? 91.237  97.034  135.356 1.00 25.48  ? 47  ALA E N     1 
ATOM   8142  C CA    . ALA G 3 10  ? 91.341  97.375  133.937 1.00 25.81  ? 47  ALA E CA    1 
ATOM   8143  C C     . ALA G 3 10  ? 92.771  97.876  133.650 1.00 27.85  ? 47  ALA E C     1 
ATOM   8144  O O     . ALA G 3 10  ? 93.391  97.471  132.671 1.00 23.16  ? 47  ALA E O     1 
ATOM   8145  C CB    . ALA G 3 10  ? 90.344  98.461  133.567 1.00 24.40  ? 47  ALA E CB    1 
ATOM   8146  N N     . LEU G 3 11  ? 93.279  98.775  134.492 1.00 28.66  ? 48  LEU E N     1 
ATOM   8147  C CA    . LEU G 3 11  ? 94.639  99.303  134.292 1.00 26.55  ? 48  LEU E CA    1 
ATOM   8148  C C     . LEU G 3 11  ? 95.628  98.169  134.443 1.00 26.86  ? 48  LEU E C     1 
ATOM   8149  O O     . LEU G 3 11  ? 96.585  98.080  133.685 1.00 27.90  ? 48  LEU E O     1 
ATOM   8150  C CB    . LEU G 3 11  ? 94.936  100.439 135.273 1.00 22.98  ? 48  LEU E CB    1 
ATOM   8151  C CG    . LEU G 3 11  ? 94.245  101.742 134.888 1.00 27.16  ? 48  LEU E CG    1 
ATOM   8152  C CD1   . LEU G 3 11  ? 94.197  102.688 136.091 1.00 26.68  ? 48  LEU E CD1   1 
ATOM   8153  C CD2   . LEU G 3 11  ? 94.981  102.371 133.682 1.00 26.18  ? 48  LEU E CD2   1 
ATOM   8154  N N     . ARG G 3 12  ? 95.414  97.291  135.412 1.00 25.35  ? 49  ARG E N     1 
ATOM   8155  C CA    . ARG G 3 12  ? 96.314  96.161  135.562 1.00 25.47  ? 49  ARG E CA    1 
ATOM   8156  C C     . ARG G 3 12  ? 96.333  95.301  134.285 1.00 26.03  ? 49  ARG E C     1 
ATOM   8157  O O     . ARG G 3 12  ? 97.373  94.782  133.865 1.00 22.15  ? 49  ARG E O     1 
ATOM   8158  C CB    . ARG G 3 12  ? 95.869  95.260  136.714 1.00 31.56  ? 49  ARG E CB    1 
ATOM   8159  C CG    . ARG G 3 12  ? 96.991  94.359  137.160 1.00 38.74  ? 49  ARG E CG    1 
ATOM   8160  C CD    . ARG G 3 12  ? 96.612  92.902  137.321 1.00 45.72  ? 49  ARG E CD    1 
ATOM   8161  N NE    . ARG G 3 12  ? 95.541  92.682  138.284 1.00 48.24  ? 49  ARG E NE    1 
ATOM   8162  C CZ    . ARG G 3 12  ? 95.368  93.380  139.398 1.00 44.39  ? 49  ARG E CZ    1 
ATOM   8163  N NH1   . ARG G 3 12  ? 96.200  94.363  139.700 1.00 46.99  ? 49  ARG E NH1   1 
ATOM   8164  N NH2   . ARG G 3 12  ? 94.352  93.086  140.211 1.00 39.79  ? 49  ARG E NH2   1 
ATOM   8165  N N     . GLU G 3 13  ? 95.163  95.110  133.683 1.00 19.46  ? 50  GLU E N     1 
ATOM   8166  C CA    . GLU G 3 13  ? 95.081  94.312  132.476 1.00 20.38  ? 50  GLU E CA    1 
ATOM   8167  C C     . GLU G 3 13  ? 95.824  94.997  131.328 1.00 20.62  ? 50  GLU E C     1 
ATOM   8168  O O     . GLU G 3 13  ? 96.499  94.356  130.531 1.00 23.11  ? 50  GLU E O     1 
ATOM   8169  C CB    . GLU G 3 13  ? 93.591  94.074  132.121 1.00 19.44  ? 50  GLU E CB    1 
ATOM   8170  C CG    . GLU G 3 13  ? 92.897  93.146  133.119 1.00 23.54  ? 50  GLU E CG    1 
ATOM   8171  C CD    . GLU G 3 13  ? 91.442  92.887  132.757 1.00 31.04  ? 50  GLU E CD    1 
ATOM   8172  O OE1   . GLU G 3 13  ? 90.798  92.122  133.486 1.00 30.26  ? 50  GLU E OE1   1 
ATOM   8173  O OE2   . GLU G 3 13  ? 90.943  93.451  131.748 1.00 28.46  ? 50  GLU E OE2   1 
ATOM   8174  N N     . ILE G 3 14  ? 95.700  96.307  131.235 1.00 21.36  ? 51  ILE E N     1 
ATOM   8175  C CA    . ILE G 3 14  ? 96.404  97.011  130.175 1.00 22.63  ? 51  ILE E CA    1 
ATOM   8176  C C     . ILE G 3 14  ? 97.917  96.735  130.300 1.00 25.24  ? 51  ILE E C     1 
ATOM   8177  O O     . ILE G 3 14  ? 98.567  96.331  129.327 1.00 24.88  ? 51  ILE E O     1 
ATOM   8178  C CB    . ILE G 3 14  ? 96.153  98.513  130.276 1.00 22.08  ? 51  ILE E CB    1 
ATOM   8179  C CG1   . ILE G 3 14  ? 94.689  98.817  129.900 1.00 21.79  ? 51  ILE E CG1   1 
ATOM   8180  C CG2   . ILE G 3 14  ? 97.085  99.260  129.331 1.00 21.13  ? 51  ILE E CG2   1 
ATOM   8181  C CD1   . ILE G 3 14  ? 94.307  100.274 130.153 1.00 20.17  ? 51  ILE E CD1   1 
ATOM   8182  N N     . ARG G 3 15  ? 98.468  96.891  131.509 1.00 23.53  ? 52  ARG E N     1 
ATOM   8183  C CA    . ARG G 3 15  ? 99.909  96.677  131.691 1.00 26.03  ? 52  ARG E CA    1 
ATOM   8184  C C     . ARG G 3 15  ? 100.329 95.238  131.376 1.00 26.70  ? 52  ARG E C     1 
ATOM   8185  O O     . ARG G 3 15  ? 101.391 94.964  130.784 1.00 24.64  ? 52  ARG E O     1 
ATOM   8186  C CB    . ARG G 3 15  ? 100.320 97.053  133.128 1.00 26.87  ? 52  ARG E CB    1 
ATOM   8187  C CG    . ARG G 3 15  ? 100.079 98.529  133.476 1.00 33.32  ? 52  ARG E CG    1 
ATOM   8188  C CD    . ARG G 3 15  ? 100.569 98.865  134.897 1.00 38.52  ? 52  ARG E CD    1 
ATOM   8189  N NE    . ARG G 3 15  ? 99.693  99.822  135.567 1.00 44.09  ? 52  ARG E NE    1 
ATOM   8190  C CZ    . ARG G 3 15  ? 99.770  101.135 135.419 1.00 48.10  ? 52  ARG E CZ    1 
ATOM   8191  N NH1   . ARG G 3 15  ? 100.690 101.652 134.619 1.00 55.67  ? 52  ARG E NH1   1 
ATOM   8192  N NH2   . ARG G 3 15  ? 98.933  101.936 136.068 1.00 43.27  ? 52  ARG E NH2   1 
ATOM   8193  N N     . ARG G 3 16  ? 99.482  94.301  131.765 1.00 23.22  ? 53  ARG E N     1 
ATOM   8194  C CA    . ARG G 3 16  ? 99.794  92.927  131.514 1.00 22.43  ? 53  ARG E CA    1 
ATOM   8195  C C     . ARG G 3 16  ? 99.859  92.629  130.006 1.00 23.70  ? 53  ARG E C     1 
ATOM   8196  O O     . ARG G 3 16  ? 100.839 92.046  129.506 1.00 21.94  ? 53  ARG E O     1 
ATOM   8197  C CB    . ARG G 3 16  ? 98.711  92.037  132.138 1.00 23.70  ? 53  ARG E CB    1 
ATOM   8198  C CG    . ARG G 3 16  ? 98.773  90.629  131.594 1.00 23.95  ? 53  ARG E CG    1 
ATOM   8199  C CD    . ARG G 3 16  ? 97.656  89.722  132.140 1.00 34.52  ? 53  ARG E CD    1 
ATOM   8200  N NE    . ARG G 3 16  ? 97.746  88.391  131.526 1.00 43.04  ? 53  ARG E NE    1 
ATOM   8201  C CZ    . ARG G 3 16  ? 96.959  87.358  131.826 1.00 44.46  ? 53  ARG E CZ    1 
ATOM   8202  N NH1   . ARG G 3 16  ? 96.006  87.482  132.734 1.00 44.70  ? 53  ARG E NH1   1 
ATOM   8203  N NH2   . ARG G 3 16  ? 97.146  86.193  131.229 1.00 45.39  ? 53  ARG E NH2   1 
ATOM   8204  N N     . TYR G 3 17  ? 98.805  93.017  129.276 1.00 22.48  ? 54  TYR E N     1 
ATOM   8205  C CA    . TYR G 3 17  ? 98.774  92.697  127.850 1.00 23.21  ? 54  TYR E CA    1 
ATOM   8206  C C     . TYR G 3 17  ? 99.731  93.524  127.025 1.00 22.35  ? 54  TYR E C     1 
ATOM   8207  O O     . TYR G 3 17  ? 100.185 93.065  125.982 1.00 22.50  ? 54  TYR E O     1 
ATOM   8208  C CB    . TYR G 3 17  ? 97.313  92.780  127.304 1.00 23.21  ? 54  TYR E CB    1 
ATOM   8209  C CG    . TYR G 3 17  ? 96.455  91.681  127.915 1.00 24.41  ? 54  TYR E CG    1 
ATOM   8210  C CD1   . TYR G 3 17  ? 96.774  90.345  127.710 1.00 23.16  ? 54  TYR E CD1   1 
ATOM   8211  C CD2   . TYR G 3 17  ? 95.367  91.983  128.735 1.00 22.55  ? 54  TYR E CD2   1 
ATOM   8212  C CE1   . TYR G 3 17  ? 96.044  89.326  128.305 1.00 27.42  ? 54  TYR E CE1   1 
ATOM   8213  C CE2   . TYR G 3 17  ? 94.616  90.962  129.336 1.00 24.56  ? 54  TYR E CE2   1 
ATOM   8214  C CZ    . TYR G 3 17  ? 94.978  89.643  129.108 1.00 22.99  ? 54  TYR E CZ    1 
ATOM   8215  O OH    . TYR G 3 17  ? 94.298  88.624  129.705 1.00 26.24  ? 54  TYR E OH    1 
ATOM   8216  N N     . GLN G 3 18  ? 100.068 94.728  127.474 1.00 22.23  ? 55  GLN E N     1 
ATOM   8217  C CA    . GLN G 3 18  ? 101.016 95.507  126.672 1.00 22.08  ? 55  GLN E CA    1 
ATOM   8218  C C     . GLN G 3 18  ? 102.434 94.988  126.891 1.00 25.55  ? 55  GLN E C     1 
ATOM   8219  O O     . GLN G 3 18  ? 103.356 95.375  126.208 1.00 26.75  ? 55  GLN E O     1 
ATOM   8220  C CB    . GLN G 3 18  ? 100.953 96.983  127.029 1.00 22.58  ? 55  GLN E CB    1 
ATOM   8221  C CG    . GLN G 3 18  ? 99.651  97.619  126.613 1.00 23.09  ? 55  GLN E CG    1 
ATOM   8222  C CD    . GLN G 3 18  ? 99.711  99.113  126.681 1.00 24.97  ? 55  GLN E CD    1 
ATOM   8223  O OE1   . GLN G 3 18  ? 100.430 99.690  127.511 1.00 24.03  ? 55  GLN E OE1   1 
ATOM   8224  N NE2   . GLN G 3 18  ? 98.948  99.764  125.823 1.00 28.38  ? 55  GLN E NE2   1 
ATOM   8225  N N     . LYS G 3 19  ? 102.582 94.084  127.840 1.00 28.95  ? 56  LYS E N     1 
ATOM   8226  C CA    . LYS G 3 19  ? 103.887 93.510  128.160 1.00 27.91  ? 56  LYS E CA    1 
ATOM   8227  C C     . LYS G 3 19  ? 104.076 92.225  127.398 1.00 28.38  ? 56  LYS E C     1 
ATOM   8228  O O     . LYS G 3 19  ? 105.200 91.821  127.142 1.00 27.33  ? 56  LYS E O     1 
ATOM   8229  C CB    . LYS G 3 19  ? 103.929 93.221  129.657 1.00 36.00  ? 56  LYS E CB    1 
ATOM   8230  C CG    . LYS G 3 19  ? 105.287 92.932  130.255 1.00 46.58  ? 56  LYS E CG    1 
ATOM   8231  C CD    . LYS G 3 19  ? 105.217 93.024  131.803 1.00 48.96  ? 56  LYS E CD    1 
ATOM   8232  C CE    . LYS G 3 19  ? 106.540 92.590  132.425 1.00 60.66  ? 56  LYS E CE    1 
ATOM   8233  N NZ    . LYS G 3 19  ? 106.646 92.904  133.894 1.00 63.48  ? 56  LYS E NZ    1 
ATOM   8234  N N     . SER G 3 20  ? 102.980 91.592  126.977 1.00 24.17  ? 57  SER E N     1 
ATOM   8235  C CA    . SER G 3 20  ? 103.117 90.302  126.314 1.00 23.74  ? 57  SER E CA    1 
ATOM   8236  C C     . SER G 3 20  ? 102.830 90.345  124.835 1.00 23.24  ? 57  SER E C     1 
ATOM   8237  O O     . SER G 3 20  ? 102.434 91.383  124.292 1.00 23.34  ? 57  SER E O     1 
ATOM   8238  C CB    . SER G 3 20  ? 102.186 89.284  127.005 1.00 25.54  ? 57  SER E CB    1 
ATOM   8239  O OG    . SER G 3 20  ? 100.828 89.722  126.901 1.00 27.42  ? 57  SER E OG    1 
ATOM   8240  N N     . THR G 3 21  ? 103.037 89.224  124.165 1.00 23.17  ? 58  THR E N     1 
ATOM   8241  C CA    . THR G 3 21  ? 102.803 89.203  122.744 1.00 25.84  ? 58  THR E CA    1 
ATOM   8242  C C     . THR G 3 21  ? 101.895 88.069  122.261 1.00 23.21  ? 58  THR E C     1 
ATOM   8243  O O     . THR G 3 21  ? 101.666 87.958  121.087 1.00 22.95  ? 58  THR E O     1 
ATOM   8244  C CB    . THR G 3 21  ? 104.131 89.067  121.979 1.00 25.34  ? 58  THR E CB    1 
ATOM   8245  O OG1   . THR G 3 21  ? 104.693 87.788  122.263 1.00 25.96  ? 58  THR E OG1   1 
ATOM   8246  C CG2   . THR G 3 21  ? 105.138 90.148  122.438 1.00 30.11  ? 58  THR E CG2   1 
ATOM   8247  N N     . GLU G 3 22  ? 101.452 87.180  123.137 1.00 24.23  ? 59  GLU E N     1 
ATOM   8248  C CA    . GLU G 3 22  ? 100.619 86.095  122.643 1.00 24.94  ? 59  GLU E CA    1 
ATOM   8249  C C     . GLU G 3 22  ? 99.298  86.584  122.052 1.00 22.39  ? 59  GLU E C     1 
ATOM   8250  O O     . GLU G 3 22  ? 98.749  87.604  122.449 1.00 20.31  ? 59  GLU E O     1 
ATOM   8251  C CB    . GLU G 3 22  ? 100.332 85.088  123.746 1.00 28.75  ? 59  GLU E CB    1 
ATOM   8252  C CG    . GLU G 3 22  ? 100.383 85.664  125.118 1.00 44.60  ? 59  GLU E CG    1 
ATOM   8253  C CD    . GLU G 3 22  ? 99.077  86.214  125.548 1.00 43.18  ? 59  GLU E CD    1 
ATOM   8254  O OE1   . GLU G 3 22  ? 98.079  85.699  125.021 1.00 51.51  ? 59  GLU E OE1   1 
ATOM   8255  O OE2   . GLU G 3 22  ? 99.040  87.122  126.408 1.00 38.20  ? 59  GLU E OE2   1 
ATOM   8256  N N     . LEU G 3 23  ? 98.802  85.849  121.080 1.00 20.90  ? 60  LEU E N     1 
ATOM   8257  C CA    . LEU G 3 23  ? 97.525  86.209  120.470 1.00 23.43  ? 60  LEU E CA    1 
ATOM   8258  C C     . LEU G 3 23  ? 96.432  86.146  121.554 1.00 23.65  ? 60  LEU E C     1 
ATOM   8259  O O     . LEU G 3 23  ? 96.506  85.336  122.508 1.00 23.66  ? 60  LEU E O     1 
ATOM   8260  C CB    . LEU G 3 23  ? 97.283  85.263  119.300 1.00 21.97  ? 60  LEU E CB    1 
ATOM   8261  C CG    . LEU G 3 23  ? 98.407  85.525  118.268 1.00 25.03  ? 60  LEU E CG    1 
ATOM   8262  C CD1   . LEU G 3 23  ? 98.223  84.615  117.055 1.00 25.98  ? 60  LEU E CD1   1 
ATOM   8263  C CD2   . LEU G 3 23  ? 98.318  86.971  117.791 1.00 22.93  ? 60  LEU E CD2   1 
ATOM   8264  N N     . LEU G 3 24  ? 95.431  87.007  121.414 1.00 22.12  ? 61  LEU E N     1 
ATOM   8265  C CA    . LEU G 3 24  ? 94.365  87.160  122.397 1.00 19.33  ? 61  LEU E CA    1 
ATOM   8266  C C     . LEU G 3 24  ? 93.004  86.551  122.022 1.00 21.70  ? 61  LEU E C     1 
ATOM   8267  O O     . LEU G 3 24  ? 92.144  86.404  122.887 1.00 20.82  ? 61  LEU E O     1 
ATOM   8268  C CB    . LEU G 3 24  ? 94.232  88.649  122.696 1.00 19.48  ? 61  LEU E CB    1 
ATOM   8269  C CG    . LEU G 3 24  ? 95.584  89.275  123.151 1.00 20.46  ? 61  LEU E CG    1 
ATOM   8270  C CD1   . LEU G 3 24  ? 95.434  90.827  123.223 1.00 21.86  ? 61  LEU E CD1   1 
ATOM   8271  C CD2   . LEU G 3 24  ? 95.986  88.708  124.535 1.00 22.80  ? 61  LEU E CD2   1 
ATOM   8272  N N     . ILE G 3 25  ? 92.813  86.219  120.742 1.00 21.21  ? 62  ILE E N     1 
ATOM   8273  C CA    . ILE G 3 25  ? 91.569  85.575  120.299 1.00 23.05  ? 62  ILE E CA    1 
ATOM   8274  C C     . ILE G 3 25  ? 91.884  84.064  120.350 1.00 21.71  ? 62  ILE E C     1 
ATOM   8275  O O     . ILE G 3 25  ? 92.978  83.660  120.002 1.00 17.96  ? 62  ILE E O     1 
ATOM   8276  C CB    . ILE G 3 25  ? 91.215  85.943  118.827 1.00 21.37  ? 62  ILE E CB    1 
ATOM   8277  C CG1   . ILE G 3 25  ? 90.917  87.461  118.719 1.00 17.17  ? 62  ILE E CG1   1 
ATOM   8278  C CG2   . ILE G 3 25  ? 89.904  85.160  118.374 1.00 19.97  ? 62  ILE E CG2   1 
ATOM   8279  C CD1   . ILE G 3 25  ? 90.829  87.957  117.284 1.00 18.46  ? 62  ILE E CD1   1 
ATOM   8280  N N     . ARG G 3 26  ? 90.930  83.243  120.774 1.00 24.09  ? 63  ARG E N     1 
ATOM   8281  C CA    . ARG G 3 26  ? 91.130  81.792  120.821 1.00 25.76  ? 63  ARG E CA    1 
ATOM   8282  C C     . ARG G 3 26  ? 91.412  81.316  119.411 1.00 24.99  ? 63  ARG E C     1 
ATOM   8283  O O     . ARG G 3 26  ? 90.749  81.738  118.455 1.00 23.37  ? 63  ARG E O     1 
ATOM   8284  C CB    . ARG G 3 26  ? 89.869  81.105  121.348 1.00 27.41  ? 63  ARG E CB    1 
ATOM   8285  C CG    . ARG G 3 26  ? 89.487  81.514  122.763 1.00 34.30  ? 63  ARG E CG    1 
ATOM   8286  C CD    . ARG G 3 26  ? 90.355  80.782  123.743 1.00 41.20  ? 63  ARG E CD    1 
ATOM   8287  N NE    . ARG G 3 26  ? 91.660  81.408  123.826 1.00 51.41  ? 63  ARG E NE    1 
ATOM   8288  C CZ    . ARG G 3 26  ? 92.797  80.763  124.037 1.00 55.83  ? 63  ARG E CZ    1 
ATOM   8289  N NH1   . ARG G 3 26  ? 92.786  79.447  124.171 1.00 60.26  ? 63  ARG E NH1   1 
ATOM   8290  N NH2   . ARG G 3 26  ? 93.936  81.447  124.146 1.00 57.49  ? 63  ARG E NH2   1 
ATOM   8291  N N     . LYS G 3 27  ? 92.356  80.397  119.288 1.00 22.79  ? 64  LYS E N     1 
ATOM   8292  C CA    . LYS G 3 27  ? 92.775  79.910  117.985 1.00 26.71  ? 64  LYS E CA    1 
ATOM   8293  C C     . LYS G 3 27  ? 91.775  79.131  117.132 1.00 28.24  ? 64  LYS E C     1 
ATOM   8294  O O     . LYS G 3 27  ? 91.605  79.411  115.959 1.00 25.31  ? 64  LYS E O     1 
ATOM   8295  C CB    . LYS G 3 27  ? 94.055  79.082  118.156 1.00 32.48  ? 64  LYS E CB    1 
ATOM   8296  C CG    . LYS G 3 27  ? 95.263  79.922  118.635 1.00 47.00  ? 64  LYS E CG    1 
ATOM   8297  C CD    . LYS G 3 27  ? 96.555  79.073  118.609 1.00 52.12  ? 64  LYS E CD    1 
ATOM   8298  C CE    . LYS G 3 27  ? 97.686  79.694  119.406 1.00 55.52  ? 64  LYS E CE    1 
ATOM   8299  N NZ    . LYS G 3 27  ? 98.183  80.958  118.830 1.00 58.02  ? 64  LYS E NZ    1 
ATOM   8300  N N     . LEU G 3 28  ? 91.152  78.104  117.679 1.00 27.29  ? 65  LEU E N     1 
ATOM   8301  C CA    . LEU G 3 28  ? 90.200  77.346  116.858 1.00 25.45  ? 65  LEU E CA    1 
ATOM   8302  C C     . LEU G 3 28  ? 89.025  78.238  116.432 1.00 23.11  ? 65  LEU E C     1 
ATOM   8303  O O     . LEU G 3 28  ? 88.636  78.227  115.285 1.00 25.35  ? 65  LEU E O     1 
ATOM   8304  C CB    . LEU G 3 28  ? 89.699  76.114  117.630 1.00 28.89  ? 65  LEU E CB    1 
ATOM   8305  C CG    . LEU G 3 28  ? 88.616  75.226  116.977 1.00 28.66  ? 65  LEU E CG    1 
ATOM   8306  C CD1   . LEU G 3 28  ? 89.109  74.734  115.640 1.00 31.26  ? 65  LEU E CD1   1 
ATOM   8307  C CD2   . LEU G 3 28  ? 88.314  74.032  117.906 1.00 28.94  ? 65  LEU E CD2   1 
ATOM   8308  N N     . PRO G 3 29  ? 88.431  79.004  117.362 1.00 23.36  ? 66  PRO E N     1 
ATOM   8309  C CA    . PRO G 3 29  ? 87.314  79.846  116.938 1.00 23.54  ? 66  PRO E CA    1 
ATOM   8310  C C     . PRO G 3 29  ? 87.733  80.789  115.814 1.00 26.95  ? 66  PRO E C     1 
ATOM   8311  O O     . PRO G 3 29  ? 86.968  81.016  114.888 1.00 21.69  ? 66  PRO E O     1 
ATOM   8312  C CB    . PRO G 3 29  ? 86.928  80.591  118.203 1.00 23.23  ? 66  PRO E CB    1 
ATOM   8313  C CG    . PRO G 3 29  ? 87.230  79.579  119.289 1.00 24.37  ? 66  PRO E CG    1 
ATOM   8314  C CD    . PRO G 3 29  ? 88.581  79.027  118.826 1.00 25.36  ? 66  PRO E CD    1 
ATOM   8315  N N     . PHE G 3 30  ? 88.942  81.352  115.891 1.00 25.54  ? 67  PHE E N     1 
ATOM   8316  C CA    . PHE G 3 30  ? 89.371  82.225  114.820 1.00 25.61  ? 67  PHE E CA    1 
ATOM   8317  C C     . PHE G 3 30  ? 89.545  81.404  113.523 1.00 23.75  ? 67  PHE E C     1 
ATOM   8318  O O     . PHE G 3 30  ? 89.172  81.844  112.446 1.00 20.02  ? 67  PHE E O     1 
ATOM   8319  C CB    . PHE G 3 30  ? 90.692  82.912  115.151 1.00 22.85  ? 67  PHE E CB    1 
ATOM   8320  C CG    . PHE G 3 30  ? 91.120  83.917  114.093 1.00 22.25  ? 67  PHE E CG    1 
ATOM   8321  C CD1   . PHE G 3 30  ? 90.641  85.223  114.113 1.00 22.64  ? 67  PHE E CD1   1 
ATOM   8322  C CD2   . PHE G 3 30  ? 92.030  83.554  113.111 1.00 22.98  ? 67  PHE E CD2   1 
ATOM   8323  C CE1   . PHE G 3 30  ? 91.094  86.181  113.145 1.00 19.78  ? 67  PHE E CE1   1 
ATOM   8324  C CE2   . PHE G 3 30  ? 92.480  84.478  112.154 1.00 18.14  ? 67  PHE E CE2   1 
ATOM   8325  C CZ    . PHE G 3 30  ? 92.006  85.802  112.179 1.00 16.55  ? 67  PHE E CZ    1 
ATOM   8326  N N     . GLN G 3 31  ? 90.113  80.211  113.618 1.00 19.85  ? 68  GLN E N     1 
ATOM   8327  C CA    . GLN G 3 31  ? 90.262  79.391  112.428 1.00 23.80  ? 68  GLN E CA    1 
ATOM   8328  C C     . GLN G 3 31  ? 88.887  79.080  111.743 1.00 24.39  ? 68  GLN E C     1 
ATOM   8329  O O     . GLN G 3 31  ? 88.785  79.035  110.503 1.00 21.76  ? 68  GLN E O     1 
ATOM   8330  C CB    . GLN G 3 31  ? 90.959  78.074  112.784 1.00 28.33  ? 68  GLN E CB    1 
ATOM   8331  C CG    . GLN G 3 31  ? 91.131  77.223  111.571 1.00 40.68  ? 68  GLN E CG    1 
ATOM   8332  C CD    . GLN G 3 31  ? 92.073  76.087  111.801 1.00 49.09  ? 68  GLN E CD    1 
ATOM   8333  O OE1   . GLN G 3 31  ? 91.742  75.124  112.492 1.00 52.69  ? 68  GLN E OE1   1 
ATOM   8334  N NE2   . GLN G 3 31  ? 93.274  76.195  111.236 1.00 52.90  ? 68  GLN E NE2   1 
ATOM   8335  N N     . ARG G 3 32  ? 87.847  78.865  112.542 1.00 23.60  ? 69  ARG E N     1 
ATOM   8336  C CA    . ARG G 3 32  ? 86.513  78.576  111.989 1.00 25.78  ? 69  ARG E CA    1 
ATOM   8337  C C     . ARG G 3 32  ? 85.961  79.819  111.293 1.00 25.42  ? 69  ARG E C     1 
ATOM   8338  O O     . ARG G 3 32  ? 85.305  79.734  110.249 1.00 24.52  ? 69  ARG E O     1 
ATOM   8339  C CB    . ARG G 3 32  ? 85.513  78.189  113.083 1.00 24.66  ? 69  ARG E CB    1 
ATOM   8340  C CG    . ARG G 3 32  ? 85.665  76.805  113.727 1.00 27.83  ? 69  ARG E CG    1 
ATOM   8341  C CD    . ARG G 3 32  ? 84.440  76.643  114.712 1.00 33.53  ? 69  ARG E CD    1 
ATOM   8342  N NE    . ARG G 3 32  ? 84.819  75.954  115.937 1.00 44.99  ? 69  ARG E NE    1 
ATOM   8343  C CZ    . ARG G 3 32  ? 84.695  76.471  117.154 1.00 40.64  ? 69  ARG E CZ    1 
ATOM   8344  N NH1   . ARG G 3 32  ? 84.211  77.684  117.348 1.00 35.09  ? 69  ARG E NH1   1 
ATOM   8345  N NH2   . ARG G 3 32  ? 85.040  75.753  118.186 1.00 47.43  ? 69  ARG E NH2   1 
ATOM   8346  N N     . LEU G 3 33  ? 86.180  80.976  111.899 1.00 21.56  ? 70  LEU E N     1 
ATOM   8347  C CA    . LEU G 3 33  ? 85.701  82.197  111.262 1.00 22.14  ? 70  LEU E CA    1 
ATOM   8348  C C     . LEU G 3 33  ? 86.393  82.358  109.900 1.00 21.81  ? 70  LEU E C     1 
ATOM   8349  O O     . LEU G 3 33  ? 85.744  82.676  108.900 1.00 21.44  ? 70  LEU E O     1 
ATOM   8350  C CB    . LEU G 3 33  ? 85.971  83.410  112.158 1.00 23.31  ? 70  LEU E CB    1 
ATOM   8351  C CG    . LEU G 3 33  ? 85.599  84.742  111.529 1.00 24.17  ? 70  LEU E CG    1 
ATOM   8352  C CD1   . LEU G 3 33  ? 84.076  84.710  111.177 1.00 20.95  ? 70  LEU E CD1   1 
ATOM   8353  C CD2   . LEU G 3 33  ? 85.924  85.882  112.505 1.00 24.23  ? 70  LEU E CD2   1 
ATOM   8354  N N     . VAL G 3 34  ? 87.710  82.132  109.855 1.00 21.17  ? 71  VAL E N     1 
ATOM   8355  C CA    . VAL G 3 34  ? 88.452  82.238  108.610 1.00 21.44  ? 71  VAL E CA    1 
ATOM   8356  C C     . VAL G 3 34  ? 87.863  81.256  107.575 1.00 24.07  ? 71  VAL E C     1 
ATOM   8357  O O     . VAL G 3 34  ? 87.607  81.638  106.460 1.00 21.23  ? 71  VAL E O     1 
ATOM   8358  C CB    . VAL G 3 34  ? 89.953  81.918  108.806 1.00 23.20  ? 71  VAL E CB    1 
ATOM   8359  C CG1   . VAL G 3 34  ? 90.627  81.649  107.468 1.00 18.65  ? 71  VAL E CG1   1 
ATOM   8360  C CG2   . VAL G 3 34  ? 90.634  83.126  109.495 1.00 21.25  ? 71  VAL E CG2   1 
ATOM   8361  N N     . ARG G 3 35  ? 87.675  79.997  107.966 1.00 24.48  ? 72  ARG E N     1 
ATOM   8362  C CA    . ARG G 3 35  ? 87.111  78.999  107.068 1.00 26.21  ? 72  ARG E CA    1 
ATOM   8363  C C     . ARG G 3 35  ? 85.680  79.322  106.597 1.00 23.01  ? 72  ARG E C     1 
ATOM   8364  O O     . ARG G 3 35  ? 85.334  79.098  105.437 1.00 29.24  ? 72  ARG E O     1 
ATOM   8365  C CB    . ARG G 3 35  ? 87.161  77.621  107.731 1.00 25.55  ? 72  ARG E CB    1 
ATOM   8366  C CG    . ARG G 3 35  ? 88.573  77.024  107.720 1.00 30.82  ? 72  ARG E CG    1 
ATOM   8367  C CD    . ARG G 3 35  ? 88.628  75.674  108.431 1.00 34.46  ? 72  ARG E CD    1 
ATOM   8368  N NE    . ARG G 3 35  ? 89.994  75.294  108.763 1.00 37.82  ? 72  ARG E NE    1 
ATOM   8369  C CZ    . ARG G 3 35  ? 90.871  74.780  107.904 1.00 40.49  ? 72  ARG E CZ    1 
ATOM   8370  N NH1   . ARG G 3 35  ? 90.541  74.566  106.628 1.00 30.28  ? 72  ARG E NH1   1 
ATOM   8371  N NH2   . ARG G 3 35  ? 92.095  74.490  108.332 1.00 42.97  ? 72  ARG E NH2   1 
ATOM   8372  N N     . GLU G 3 36  ? 84.862  79.847  107.489 1.00 24.15  ? 73  GLU E N     1 
ATOM   8373  C CA    . GLU G 3 36  ? 83.500  80.207  107.137 1.00 24.23  ? 73  GLU E CA    1 
ATOM   8374  C C     . GLU G 3 36  ? 83.522  81.294  106.079 1.00 25.98  ? 73  GLU E C     1 
ATOM   8375  O O     . GLU G 3 36  ? 82.857  81.223  105.035 1.00 26.23  ? 73  GLU E O     1 
ATOM   8376  C CB    . GLU G 3 36  ? 82.770  80.736  108.346 1.00 24.43  ? 73  GLU E CB    1 
ATOM   8377  C CG    . GLU G 3 36  ? 81.343  81.206  108.057 1.00 20.82  ? 73  GLU E CG    1 
ATOM   8378  C CD    . GLU G 3 36  ? 80.665  81.675  109.308 1.00 24.61  ? 73  GLU E CD    1 
ATOM   8379  O OE1   . GLU G 3 36  ? 80.685  80.908  110.295 1.00 23.58  ? 73  GLU E OE1   1 
ATOM   8380  O OE2   . GLU G 3 36  ? 80.087  82.772  109.323 1.00 23.16  ? 73  GLU E OE2   1 
ATOM   8381  N N     . ILE G 3 37  ? 84.269  82.338  106.365 1.00 25.19  ? 74  ILE E N     1 
ATOM   8382  C CA    . ILE G 3 37  ? 84.355  83.435  105.414 1.00 21.89  ? 74  ILE E CA    1 
ATOM   8383  C C     . ILE G 3 37  ? 84.922  82.983  104.098 1.00 21.08  ? 74  ILE E C     1 
ATOM   8384  O O     . ILE G 3 37  ? 84.365  83.313  103.049 1.00 23.30  ? 74  ILE E O     1 
ATOM   8385  C CB    . ILE G 3 37  ? 85.228  84.596  105.979 1.00 23.83  ? 74  ILE E CB    1 
ATOM   8386  C CG1   . ILE G 3 37  ? 84.471  85.272  107.119 1.00 24.16  ? 74  ILE E CG1   1 
ATOM   8387  C CG2   . ILE G 3 37  ? 85.583  85.602  104.843 1.00 19.66  ? 74  ILE E CG2   1 
ATOM   8388  C CD1   . ILE G 3 37  ? 85.340  86.186  108.051 1.00 26.00  ? 74  ILE E CD1   1 
ATOM   8389  N N     . ALA G 3 38  ? 86.038  82.256  104.128 1.00 21.38  ? 75  ALA E N     1 
ATOM   8390  C CA    . ALA G 3 38  ? 86.663  81.796  102.889 1.00 21.50  ? 75  ALA E CA    1 
ATOM   8391  C C     . ALA G 3 38  ? 85.710  80.914  102.081 1.00 26.03  ? 75  ALA E C     1 
ATOM   8392  O O     . ALA G 3 38  ? 85.649  81.017  100.861 1.00 24.28  ? 75  ALA E O     1 
ATOM   8393  C CB    . ALA G 3 38  ? 87.904  81.002  103.180 1.00 20.04  ? 75  ALA E CB    1 
ATOM   8394  N N     . GLN G 3 39  ? 84.998  80.046  102.781 1.00 23.83  ? 76  GLN E N     1 
ATOM   8395  C CA    . GLN G 3 39  ? 84.057  79.129  102.149 1.00 27.95  ? 76  GLN E CA    1 
ATOM   8396  C C     . GLN G 3 39  ? 82.968  79.876  101.384 1.00 27.19  ? 76  GLN E C     1 
ATOM   8397  O O     . GLN G 3 39  ? 82.574  79.438  100.295 1.00 27.18  ? 76  GLN E O     1 
ATOM   8398  C CB    . GLN G 3 39  ? 83.458  78.223  103.216 1.00 29.37  ? 76  GLN E CB    1 
ATOM   8399  C CG    . GLN G 3 39  ? 82.325  77.287  102.765 1.00 33.22  ? 76  GLN E CG    1 
ATOM   8400  C CD    . GLN G 3 39  ? 81.934  76.400  103.924 1.00 30.18  ? 76  GLN E CD    1 
ATOM   8401  O OE1   . GLN G 3 39  ? 81.410  76.873  104.902 1.00 28.76  ? 76  GLN E OE1   1 
ATOM   8402  N NE2   . GLN G 3 39  ? 82.244  75.121  103.831 1.00 33.00  ? 76  GLN E NE2   1 
ATOM   8403  N N     . ASP G 3 40  ? 82.487  80.990  101.930 1.00 26.14  ? 77  ASP E N     1 
ATOM   8404  C CA    . ASP G 3 40  ? 81.478  81.771  101.212 1.00 27.95  ? 77  ASP E CA    1 
ATOM   8405  C C     . ASP G 3 40  ? 82.066  82.425  99.951  1.00 32.51  ? 77  ASP E C     1 
ATOM   8406  O O     . ASP G 3 40  ? 81.325  82.833  99.043  1.00 30.90  ? 77  ASP E O     1 
ATOM   8407  C CB    . ASP G 3 40  ? 80.863  82.855  102.103 1.00 26.85  ? 77  ASP E CB    1 
ATOM   8408  C CG    . ASP G 3 40  ? 79.969  82.277  103.221 1.00 29.25  ? 77  ASP E CG    1 
ATOM   8409  O OD1   . ASP G 3 40  ? 79.369  81.186  103.040 1.00 25.46  ? 77  ASP E OD1   1 
ATOM   8410  O OD2   . ASP G 3 40  ? 79.879  82.966  104.256 1.00 28.80  ? 77  ASP E OD2   1 
ATOM   8411  N N     . PHE G 3 41  ? 83.390  82.570  99.901  1.00 28.76  ? 78  PHE E N     1 
ATOM   8412  C CA    . PHE G 3 41  ? 84.027  83.144  98.725  1.00 33.67  ? 78  PHE E CA    1 
ATOM   8413  C C     . PHE G 3 41  ? 84.258  82.053  97.702  1.00 32.62  ? 78  PHE E C     1 
ATOM   8414  O O     . PHE G 3 41  ? 84.011  82.250  96.515  1.00 31.17  ? 78  PHE E O     1 
ATOM   8415  C CB    . PHE G 3 41  ? 85.401  83.742  99.051  1.00 38.06  ? 78  PHE E CB    1 
ATOM   8416  C CG    . PHE G 3 41  ? 85.344  85.127  99.594  1.00 42.81  ? 78  PHE E CG    1 
ATOM   8417  C CD1   . PHE G 3 41  ? 84.541  86.090  98.998  1.00 41.86  ? 78  PHE E CD1   1 
ATOM   8418  C CD2   . PHE G 3 41  ? 86.112  85.480  100.696 1.00 38.64  ? 78  PHE E CD2   1 
ATOM   8419  C CE1   . PHE G 3 41  ? 84.515  87.396  99.509  1.00 47.26  ? 78  PHE E CE1   1 
ATOM   8420  C CE2   . PHE G 3 41  ? 86.086  86.778  101.200 1.00 38.70  ? 78  PHE E CE2   1 
ATOM   8421  C CZ    . PHE G 3 41  ? 85.303  87.728  100.624 1.00 38.29  ? 78  PHE E CZ    1 
ATOM   8422  N N     . LYS G 3 42  ? 84.722  80.901  98.173  1.00 29.75  ? 79  LYS E N     1 
ATOM   8423  C CA    . LYS G 3 42  ? 85.053  79.797  97.281  1.00 33.26  ? 79  LYS E CA    1 
ATOM   8424  C C     . LYS G 3 42  ? 84.968  78.488  98.043  1.00 33.83  ? 79  LYS E C     1 
ATOM   8425  O O     . LYS G 3 42  ? 85.576  78.343  99.104  1.00 32.86  ? 79  LYS E O     1 
ATOM   8426  C CB    . LYS G 3 42  ? 86.485  79.993  96.768  1.00 36.72  ? 79  LYS E CB    1 
ATOM   8427  C CG    . LYS G 3 42  ? 86.759  79.390  95.417  1.00 45.75  ? 79  LYS E CG    1 
ATOM   8428  C CD    . LYS G 3 42  ? 86.758  77.904  95.465  1.00 51.11  ? 79  LYS E CD    1 
ATOM   8429  C CE    . LYS G 3 42  ? 86.907  77.321  94.063  1.00 50.21  ? 79  LYS E CE    1 
ATOM   8430  N NZ    . LYS G 3 42  ? 86.542  75.891  94.148  1.00 53.49  ? 79  LYS E NZ    1 
ATOM   8431  N N     . THR G 3 43  ? 84.246  77.513  97.500  1.00 32.95  ? 80  THR E N     1 
ATOM   8432  C CA    . THR G 3 43  ? 84.085  76.238  98.201  1.00 32.12  ? 80  THR E CA    1 
ATOM   8433  C C     . THR G 3 43  ? 85.286  75.336  98.037  1.00 31.49  ? 80  THR E C     1 
ATOM   8434  O O     . THR G 3 43  ? 86.087  75.522  97.137  1.00 38.41  ? 80  THR E O     1 
ATOM   8435  C CB    . THR G 3 43  ? 82.848  75.435  97.672  1.00 37.97  ? 80  THR E CB    1 
ATOM   8436  O OG1   . THR G 3 43  ? 83.035  75.152  96.282  1.00 35.26  ? 80  THR E OG1   1 
ATOM   8437  C CG2   . THR G 3 43  ? 81.561  76.235  97.838  1.00 39.07  ? 80  THR E CG2   1 
ATOM   8438  N N     . ASP G 3 44  ? 85.409  74.366  98.930  1.00 32.57  ? 81  ASP E N     1 
ATOM   8439  C CA    . ASP G 3 44  ? 86.457  73.369  98.876  1.00 37.16  ? 81  ASP E CA    1 
ATOM   8440  C C     . ASP G 3 44  ? 87.900  73.843  98.989  1.00 38.74  ? 81  ASP E C     1 
ATOM   8441  O O     . ASP G 3 44  ? 88.817  73.245  98.404  1.00 38.83  ? 81  ASP E O     1 
ATOM   8442  C CB    . ASP G 3 44  ? 86.269  72.544  97.597  1.00 44.59  ? 81  ASP E CB    1 
ATOM   8443  C CG    . ASP G 3 44  ? 84.826  72.117  97.406  1.00 51.73  ? 81  ASP E CG    1 
ATOM   8444  O OD1   . ASP G 3 44  ? 84.330  71.340  98.257  1.00 53.40  ? 81  ASP E OD1   1 
ATOM   8445  O OD2   . ASP G 3 44  ? 84.184  72.580  96.427  1.00 55.57  ? 81  ASP E OD2   1 
ATOM   8446  N N     . LEU G 3 45  ? 88.130  74.898  99.757  1.00 35.16  ? 82  LEU E N     1 
ATOM   8447  C CA    . LEU G 3 45  ? 89.498  75.368  99.912  1.00 34.79  ? 82  LEU E CA    1 
ATOM   8448  C C     . LEU G 3 45  ? 90.144  74.678  101.090 1.00 31.04  ? 82  LEU E C     1 
ATOM   8449  O O     . LEU G 3 45  ? 89.474  74.303  102.044 1.00 33.04  ? 82  LEU E O     1 
ATOM   8450  C CB    . LEU G 3 45  ? 89.526  76.862  100.187 1.00 29.91  ? 82  LEU E CB    1 
ATOM   8451  C CG    . LEU G 3 45  ? 89.173  77.845  99.074  1.00 29.11  ? 82  LEU E CG    1 
ATOM   8452  C CD1   . LEU G 3 45  ? 88.972  79.209  99.731  1.00 30.14  ? 82  LEU E CD1   1 
ATOM   8453  C CD2   . LEU G 3 45  ? 90.271  77.900  98.024  1.00 26.87  ? 82  LEU E CD2   1 
ATOM   8454  N N     . ARG G 3 46  ? 91.450  74.517  101.019 1.00 30.55  ? 83  ARG E N     1 
ATOM   8455  C CA    . ARG G 3 46  ? 92.202  73.978  102.148 1.00 31.66  ? 83  ARG E CA    1 
ATOM   8456  C C     . ARG G 3 46  ? 93.100  75.175  102.600 1.00 29.97  ? 83  ARG E C     1 
ATOM   8457  O O     . ARG G 3 46  ? 93.247  76.136  101.846 1.00 26.96  ? 83  ARG E O     1 
ATOM   8458  C CB    . ARG G 3 46  ? 93.072  72.805  101.699 1.00 33.11  ? 83  ARG E CB    1 
ATOM   8459  C CG    . ARG G 3 46  ? 92.284  71.511  101.465 1.00 41.18  ? 83  ARG E CG    1 
ATOM   8460  C CD    . ARG G 3 46  ? 93.247  70.362  101.193 1.00 45.44  ? 83  ARG E CD    1 
ATOM   8461  N NE    . ARG G 3 46  ? 92.585  69.087  101.416 1.00 58.45  ? 83  ARG E NE    1 
ATOM   8462  C CZ    . ARG G 3 46  ? 93.155  68.037  101.999 1.00 58.63  ? 83  ARG E CZ    1 
ATOM   8463  N NH1   . ARG G 3 46  ? 94.410  68.103  102.423 1.00 59.51  ? 83  ARG E NH1   1 
ATOM   8464  N NH2   . ARG G 3 46  ? 92.461  66.922  102.156 1.00 65.03  ? 83  ARG E NH2   1 
ATOM   8465  N N     . PHE G 3 47  ? 93.678  75.102  103.799 1.00 26.87  ? 84  PHE E N     1 
ATOM   8466  C CA    . PHE G 3 47  ? 94.531  76.172  104.346 1.00 30.29  ? 84  PHE E CA    1 
ATOM   8467  C C     . PHE G 3 47  ? 95.777  75.607  104.994 1.00 28.29  ? 84  PHE E C     1 
ATOM   8468  O O     . PHE G 3 47  ? 95.694  74.633  105.751 1.00 30.67  ? 84  PHE E O     1 
ATOM   8469  C CB    . PHE G 3 47  ? 93.827  76.981  105.483 1.00 26.09  ? 84  PHE E CB    1 
ATOM   8470  C CG    . PHE G 3 47  ? 92.916  78.080  104.999 1.00 24.22  ? 84  PHE E CG    1 
ATOM   8471  C CD1   . PHE G 3 47  ? 91.605  77.795  104.574 1.00 26.78  ? 84  PHE E CD1   1 
ATOM   8472  C CD2   . PHE G 3 47  ? 93.363  79.396  104.952 1.00 24.10  ? 84  PHE E CD2   1 
ATOM   8473  C CE1   . PHE G 3 47  ? 90.762  78.794  104.111 1.00 25.01  ? 84  PHE E CE1   1 
ATOM   8474  C CE2   . PHE G 3 47  ? 92.527  80.434  104.483 1.00 24.54  ? 84  PHE E CE2   1 
ATOM   8475  C CZ    . PHE G 3 47  ? 91.221  80.129  104.059 1.00 27.17  ? 84  PHE E CZ    1 
ATOM   8476  N N     . GLN G 3 48  ? 96.925  76.206  104.699 1.00 27.11  ? 85  GLN E N     1 
ATOM   8477  C CA    . GLN G 3 48  ? 98.166  75.798  105.372 1.00 28.71  ? 85  GLN E CA    1 
ATOM   8478  C C     . GLN G 3 48  ? 97.956  76.350  106.760 1.00 27.46  ? 85  GLN E C     1 
ATOM   8479  O O     . GLN G 3 48  ? 97.373  77.422  106.890 1.00 24.81  ? 85  GLN E O     1 
ATOM   8480  C CB    . GLN G 3 48  ? 99.383  76.503  104.753 1.00 27.88  ? 85  GLN E CB    1 
ATOM   8481  C CG    . GLN G 3 48  ? 99.738  76.024  103.357 1.00 30.68  ? 85  GLN E CG    1 
ATOM   8482  C CD    . GLN G 3 48  ? 101.076 76.570  102.896 1.00 33.71  ? 85  GLN E CD    1 
ATOM   8483  O OE1   . GLN G 3 48  ? 101.474 77.681  103.286 1.00 31.00  ? 85  GLN E OE1   1 
ATOM   8484  N NE2   . GLN G 3 48  ? 101.773 75.806  102.037 1.00 33.51  ? 85  GLN E NE2   1 
ATOM   8485  N N     . SER G 3 49  ? 98.420  75.663  107.794 1.00 27.25  ? 86  SER E N     1 
ATOM   8486  C CA    . SER G 3 49  ? 98.221  76.168  109.150 1.00 27.56  ? 86  SER E CA    1 
ATOM   8487  C C     . SER G 3 49  ? 98.877  77.554  109.326 1.00 25.85  ? 86  SER E C     1 
ATOM   8488  O O     . SER G 3 49  ? 98.326  78.403  109.997 1.00 25.87  ? 86  SER E O     1 
ATOM   8489  C CB    . SER G 3 49  ? 98.796  75.200  110.187 1.00 27.56  ? 86  SER E CB    1 
ATOM   8490  O OG    . SER G 3 49  ? 100.204 75.183  110.048 1.00 38.16  ? 86  SER E OG    1 
ATOM   8491  N N     . SER G 3 50  ? 100.049 77.776  108.752 1.00 24.80  ? 87  SER E N     1 
ATOM   8492  C CA    . SER G 3 50  ? 100.675 79.097  108.872 1.00 26.64  ? 87  SER E CA    1 
ATOM   8493  C C     . SER G 3 50  ? 99.863  80.192  108.157 1.00 23.93  ? 87  SER E C     1 
ATOM   8494  O O     . SER G 3 50  ? 100.025 81.360  108.481 1.00 23.47  ? 87  SER E O     1 
ATOM   8495  C CB    . SER G 3 50  ? 102.100 79.098  108.302 1.00 24.11  ? 87  SER E CB    1 
ATOM   8496  O OG    . SER G 3 50  ? 102.056 78.764  106.937 1.00 35.09  ? 87  SER E OG    1 
ATOM   8497  N N     . ALA G 3 51  ? 99.013  79.831  107.186 1.00 22.95  ? 88  ALA E N     1 
ATOM   8498  C CA    . ALA G 3 51  ? 98.191  80.845  106.512 1.00 22.40  ? 88  ALA E CA    1 
ATOM   8499  C C     . ALA G 3 51  ? 97.149  81.343  107.501 1.00 23.47  ? 88  ALA E C     1 
ATOM   8500  O O     . ALA G 3 51  ? 96.831  82.538  107.547 1.00 19.96  ? 88  ALA E O     1 
ATOM   8501  C CB    . ALA G 3 51  ? 97.486  80.273  105.250 1.00 23.25  ? 88  ALA E CB    1 
ATOM   8502  N N     . VAL G 3 52  ? 96.614  80.443  108.314 1.00 19.39  ? 89  VAL E N     1 
ATOM   8503  C CA    . VAL G 3 52  ? 95.623  80.877  109.296 1.00 21.32  ? 89  VAL E CA    1 
ATOM   8504  C C     . VAL G 3 52  ? 96.295  81.694  110.403 1.00 20.73  ? 89  VAL E C     1 
ATOM   8505  O O     . VAL G 3 52  ? 95.689  82.617  110.917 1.00 21.90  ? 89  VAL E O     1 
ATOM   8506  C CB    . VAL G 3 52  ? 94.876  79.687  109.957 1.00 20.74  ? 89  VAL E CB    1 
ATOM   8507  C CG1   . VAL G 3 52  ? 93.889  80.184  111.000 1.00 19.25  ? 89  VAL E CG1   1 
ATOM   8508  C CG2   . VAL G 3 52  ? 94.156  78.880  108.903 1.00 26.29  ? 89  VAL E CG2   1 
ATOM   8509  N N     . MET G 3 53  ? 97.508  81.310  110.817 1.00 20.76  ? 90  MET E N     1 
ATOM   8510  C CA    . MET G 3 53  ? 98.223  82.056  111.862 1.00 22.29  ? 90  MET E CA    1 
ATOM   8511  C C     . MET G 3 53  ? 98.606  83.446  111.340 1.00 20.97  ? 90  MET E C     1 
ATOM   8512  O O     . MET G 3 53  ? 98.565  84.427  112.072 1.00 21.86  ? 90  MET E O     1 
ATOM   8513  C CB    . MET G 3 53  ? 99.487  81.303  112.280 1.00 23.17  ? 90  MET E CB    1 
ATOM   8514  C CG    . MET G 3 53  ? 99.200  79.968  112.985 1.00 32.25  ? 90  MET E CG    1 
ATOM   8515  S SD    . MET G 3 53  ? 97.796  80.037  114.181 1.00 44.17  ? 90  MET E SD    1 
ATOM   8516  C CE    . MET G 3 53  ? 98.398  81.318  115.335 1.00 37.09  ? 90  MET E CE    1 
ATOM   8517  N N     . ALA G 3 54  ? 98.989  83.520  110.065 1.00 21.13  ? 91  ALA E N     1 
ATOM   8518  C CA    . ALA G 3 54  ? 99.329  84.807  109.461 1.00 21.33  ? 91  ALA E CA    1 
ATOM   8519  C C     . ALA G 3 54  ? 98.099  85.725  109.498 1.00 22.10  ? 91  ALA E C     1 
ATOM   8520  O O     . ALA G 3 54  ? 98.197  86.903  109.836 1.00 20.91  ? 91  ALA E O     1 
ATOM   8521  C CB    . ALA G 3 54  ? 99.808  84.609  108.020 1.00 18.99  ? 91  ALA E CB    1 
ATOM   8522  N N     . LEU G 3 55  ? 96.936  85.191  109.150 1.00 19.20  ? 92  LEU E N     1 
ATOM   8523  C CA    . LEU G 3 55  ? 95.714  85.990  109.178 1.00 19.34  ? 92  LEU E CA    1 
ATOM   8524  C C     . LEU G 3 55  ? 95.436  86.405  110.607 1.00 19.25  ? 92  LEU E C     1 
ATOM   8525  O O     . LEU G 3 55  ? 95.018  87.547  110.864 1.00 17.15  ? 92  LEU E O     1 
ATOM   8526  C CB    . LEU G 3 55  ? 94.505  85.185  108.632 1.00 19.25  ? 92  LEU E CB    1 
ATOM   8527  C CG    . LEU G 3 55  ? 94.482  84.988  107.104 1.00 20.70  ? 92  LEU E CG    1 
ATOM   8528  C CD1   . LEU G 3 55  ? 93.490  83.885  106.694 1.00 21.68  ? 92  LEU E CD1   1 
ATOM   8529  C CD2   . LEU G 3 55  ? 94.035  86.319  106.475 1.00 18.18  ? 92  LEU E CD2   1 
ATOM   8530  N N     . GLN G 3 56  ? 95.710  85.526  111.568 1.00 15.58  ? 93  GLN E N     1 
ATOM   8531  C CA    . GLN G 3 56  ? 95.423  85.914  112.942 1.00 17.68  ? 93  GLN E CA    1 
ATOM   8532  C C     . GLN G 3 56  ? 96.369  86.996  113.465 1.00 17.18  ? 93  GLN E C     1 
ATOM   8533  O O     . GLN G 3 56  ? 95.927  87.915  114.141 1.00 19.20  ? 93  GLN E O     1 
ATOM   8534  C CB    . GLN G 3 56  ? 95.479  84.720  113.925 1.00 19.72  ? 93  GLN E CB    1 
ATOM   8535  C CG    . GLN G 3 56  ? 94.738  85.112  115.189 1.00 18.44  ? 93  GLN E CG    1 
ATOM   8536  C CD    . GLN G 3 56  ? 94.527  83.984  116.174 1.00 25.51  ? 93  GLN E CD    1 
ATOM   8537  O OE1   . GLN G 3 56  ? 94.620  82.785  115.824 1.00 21.68  ? 93  GLN E OE1   1 
ATOM   8538  N NE2   . GLN G 3 56  ? 94.226  84.357  117.433 1.00 20.65  ? 93  GLN E NE2   1 
ATOM   8539  N N     . GLU G 3 57  ? 97.663  86.866  113.177 1.00 20.83  ? 94  GLU E N     1 
ATOM   8540  C CA    . GLU G 3 57  ? 98.640  87.884  113.604 1.00 19.80  ? 94  GLU E CA    1 
ATOM   8541  C C     . GLU G 3 57  ? 98.259  89.212  112.980 1.00 19.28  ? 94  GLU E C     1 
ATOM   8542  O O     . GLU G 3 57  ? 98.197  90.242  113.675 1.00 17.87  ? 94  GLU E O     1 
ATOM   8543  C CB    . GLU G 3 57  ? 100.045 87.496  113.156 1.00 18.65  ? 94  GLU E CB    1 
ATOM   8544  C CG    . GLU G 3 57  ? 100.602 86.332  113.953 1.00 18.31  ? 94  GLU E CG    1 
ATOM   8545  C CD    . GLU G 3 57  ? 101.167 86.764  115.277 1.00 27.03  ? 94  GLU E CD    1 
ATOM   8546  O OE1   . GLU G 3 57  ? 101.339 87.998  115.495 1.00 24.46  ? 94  GLU E OE1   1 
ATOM   8547  O OE2   . GLU G 3 57  ? 101.455 85.860  116.105 1.00 28.18  ? 94  GLU E OE2   1 
ATOM   8548  N N     . ALA G 3 58  ? 97.950  89.196  111.687 1.00 17.36  ? 95  ALA E N     1 
ATOM   8549  C CA    . ALA G 3 58  ? 97.539  90.456  111.045 1.00 18.03  ? 95  ALA E CA    1 
ATOM   8550  C C     . ALA G 3 58  ? 96.227  91.022  111.570 1.00 19.20  ? 95  ALA E C     1 
ATOM   8551  O O     . ALA G 3 58  ? 96.107  92.238  111.732 1.00 17.77  ? 95  ALA E O     1 
ATOM   8552  C CB    . ALA G 3 58  ? 97.448  90.276  109.551 1.00 16.81  ? 95  ALA E CB    1 
ATOM   8553  N N     . SER G 3 59  ? 95.229  90.160  111.837 1.00 19.93  ? 96  SER E N     1 
ATOM   8554  C CA    . SER G 3 59  ? 93.934  90.650  112.327 1.00 18.13  ? 96  SER E CA    1 
ATOM   8555  C C     . SER G 3 59  ? 94.070  91.231  113.718 1.00 16.34  ? 96  SER E C     1 
ATOM   8556  O O     . SER G 3 59  ? 93.491  92.274  114.025 1.00 17.02  ? 96  SER E O     1 
ATOM   8557  C CB    . SER G 3 59  ? 92.852  89.526  112.327 1.00 19.35  ? 96  SER E CB    1 
ATOM   8558  O OG    . SER G 3 59  ? 92.659  88.976  111.013 1.00 22.53  ? 96  SER E OG    1 
ATOM   8559  N N     . GLU G 3 60  ? 94.824  90.566  114.595 1.00 16.73  ? 97  GLU E N     1 
ATOM   8560  C CA    . GLU G 3 60  ? 94.986  91.129  115.926 1.00 15.95  ? 97  GLU E CA    1 
ATOM   8561  C C     . GLU G 3 60  ? 95.799  92.438  115.906 1.00 16.05  ? 97  GLU E C     1 
ATOM   8562  O O     . GLU G 3 60  ? 95.462  93.361  116.635 1.00 17.00  ? 97  GLU E O     1 
ATOM   8563  C CB    . GLU G 3 60  ? 95.620  90.088  116.888 1.00 17.06  ? 97  GLU E CB    1 
ATOM   8564  C CG    . GLU G 3 60  ? 94.633  88.891  117.116 1.00 17.18  ? 97  GLU E CG    1 
ATOM   8565  C CD    . GLU G 3 60  ? 94.899  88.121  118.404 1.00 24.93  ? 97  GLU E CD    1 
ATOM   8566  O OE1   . GLU G 3 60  ? 95.577  88.662  119.328 1.00 19.62  ? 97  GLU E OE1   1 
ATOM   8567  O OE2   . GLU G 3 60  ? 94.392  86.988  118.489 1.00 24.13  ? 97  GLU E OE2   1 
ATOM   8568  N N     . ALA G 3 61  ? 96.841  92.531  115.082 1.00 16.33  ? 98  ALA E N     1 
ATOM   8569  C CA    . ALA G 3 61  ? 97.616  93.773  115.066 1.00 17.42  ? 98  ALA E CA    1 
ATOM   8570  C C     . ALA G 3 61  ? 96.718  94.870  114.586 1.00 19.60  ? 98  ALA E C     1 
ATOM   8571  O O     . ALA G 3 61  ? 96.774  95.984  115.089 1.00 19.84  ? 98  ALA E O     1 
ATOM   8572  C CB    . ALA G 3 61  ? 98.838  93.660  114.121 1.00 16.77  ? 98  ALA E CB    1 
ATOM   8573  N N     . TYR G 3 62  ? 95.880  94.555  113.595 1.00 19.16  ? 99  TYR E N     1 
ATOM   8574  C CA    . TYR G 3 62  ? 94.976  95.545  113.050 1.00 16.74  ? 99  TYR E CA    1 
ATOM   8575  C C     . TYR G 3 62  ? 94.018  96.005  114.139 1.00 16.61  ? 99  TYR E C     1 
ATOM   8576  O O     . TYR G 3 62  ? 93.864  97.207  114.370 1.00 18.04  ? 99  TYR E O     1 
ATOM   8577  C CB    . TYR G 3 62  ? 94.198  94.954  111.847 1.00 19.82  ? 99  TYR E CB    1 
ATOM   8578  C CG    . TYR G 3 62  ? 92.998  95.784  111.425 1.00 19.99  ? 99  TYR E CG    1 
ATOM   8579  C CD1   . TYR G 3 62  ? 93.154  96.945  110.659 1.00 21.20  ? 99  TYR E CD1   1 
ATOM   8580  C CD2   . TYR G 3 62  ? 91.692  95.425  111.847 1.00 24.56  ? 99  TYR E CD2   1 
ATOM   8581  C CE1   . TYR G 3 62  ? 92.018  97.772  110.330 1.00 21.23  ? 99  TYR E CE1   1 
ATOM   8582  C CE2   . TYR G 3 62  ? 90.579  96.206  111.521 1.00 19.83  ? 99  TYR E CE2   1 
ATOM   8583  C CZ    . TYR G 3 62  ? 90.747  97.383  110.775 1.00 25.75  ? 99  TYR E CZ    1 
ATOM   8584  O OH    . TYR G 3 62  ? 89.634  98.142  110.483 1.00 23.69  ? 99  TYR E OH    1 
ATOM   8585  N N     . LEU G 3 63  ? 93.413  95.071  114.869 1.00 16.08  ? 100 LEU E N     1 
ATOM   8586  C CA    . LEU G 3 63  ? 92.447  95.480  115.900 1.00 17.19  ? 100 LEU E CA    1 
ATOM   8587  C C     . LEU G 3 63  ? 93.069  96.250  117.082 1.00 15.72  ? 100 LEU E C     1 
ATOM   8588  O O     . LEU G 3 63  ? 92.476  97.206  117.611 1.00 18.67  ? 100 LEU E O     1 
ATOM   8589  C CB    . LEU G 3 63  ? 91.683  94.242  116.419 1.00 18.28  ? 100 LEU E CB    1 
ATOM   8590  C CG    . LEU G 3 63  ? 90.685  93.595  115.399 1.00 22.64  ? 100 LEU E CG    1 
ATOM   8591  C CD1   . LEU G 3 63  ? 89.920  92.412  116.080 1.00 17.85  ? 100 LEU E CD1   1 
ATOM   8592  C CD2   . LEU G 3 63  ? 89.624  94.677  114.944 1.00 17.44  ? 100 LEU E CD2   1 
ATOM   8593  N N     . VAL G 3 64  ? 94.232  95.811  117.528 1.00 17.75  ? 101 VAL E N     1 
ATOM   8594  C CA    . VAL G 3 64  ? 94.891  96.512  118.642 1.00 17.67  ? 101 VAL E CA    1 
ATOM   8595  C C     . VAL G 3 64  ? 95.168  97.959  118.252 1.00 14.79  ? 101 VAL E C     1 
ATOM   8596  O O     . VAL G 3 64  ? 94.884  98.906  119.020 1.00 16.66  ? 101 VAL E O     1 
ATOM   8597  C CB    . VAL G 3 64  ? 96.211  95.788  119.021 1.00 15.29  ? 101 VAL E CB    1 
ATOM   8598  C CG1   . VAL G 3 64  ? 97.073  96.656  119.953 1.00 15.18  ? 101 VAL E CG1   1 
ATOM   8599  C CG2   . VAL G 3 64  ? 95.846  94.492  119.732 1.00 18.40  ? 101 VAL E CG2   1 
ATOM   8600  N N     . GLY G 3 65  ? 95.726  98.145  117.053 1.00 18.40  ? 102 GLY E N     1 
ATOM   8601  C CA    . GLY G 3 65  ? 96.039  99.505  116.548 1.00 19.60  ? 102 GLY E CA    1 
ATOM   8602  C C     . GLY G 3 65  ? 94.751  100.313 116.340 1.00 20.28  ? 102 GLY E C     1 
ATOM   8603  O O     . GLY G 3 65  ? 94.731  101.534 116.566 1.00 20.29  ? 102 GLY E O     1 
ATOM   8604  N N     . LEU G 3 66  ? 93.660  99.661  115.916 1.00 19.03  ? 103 LEU E N     1 
ATOM   8605  C CA    . LEU G 3 66  ? 92.402  100.403 115.765 1.00 15.42  ? 103 LEU E CA    1 
ATOM   8606  C C     . LEU G 3 66  ? 91.888  100.807 117.179 1.00 15.09  ? 103 LEU E C     1 
ATOM   8607  O O     . LEU G 3 66  ? 91.379  101.887 117.381 1.00 17.00  ? 103 LEU E O     1 
ATOM   8608  C CB    . LEU G 3 66  ? 91.343  99.533  115.044 1.00 16.03  ? 103 LEU E CB    1 
ATOM   8609  C CG    . LEU G 3 66  ? 89.957  100.128 114.979 1.00 18.40  ? 103 LEU E CG    1 
ATOM   8610  C CD1   . LEU G 3 66  ? 90.021  101.362 114.101 1.00 19.62  ? 103 LEU E CD1   1 
ATOM   8611  C CD2   . LEU G 3 66  ? 88.961  99.068  114.359 1.00 17.41  ? 103 LEU E CD2   1 
ATOM   8612  N N     . PHE G 3 67  ? 92.030  99.939  118.178 1.00 17.40  ? 104 PHE E N     1 
ATOM   8613  C CA    . PHE G 3 67  ? 91.557  100.320 119.531 1.00 17.36  ? 104 PHE E CA    1 
ATOM   8614  C C     . PHE G 3 67  ? 92.390  101.470 120.078 1.00 18.85  ? 104 PHE E C     1 
ATOM   8615  O O     . PHE G 3 67  ? 91.879  102.302 120.851 1.00 22.59  ? 104 PHE E O     1 
ATOM   8616  C CB    . PHE G 3 67  ? 91.629  99.133  120.517 1.00 15.91  ? 104 PHE E CB    1 
ATOM   8617  C CG    . PHE G 3 67  ? 90.468  98.182  120.391 1.00 17.91  ? 104 PHE E CG    1 
ATOM   8618  C CD1   . PHE G 3 67  ? 89.172  98.662  120.462 1.00 18.58  ? 104 PHE E CD1   1 
ATOM   8619  C CD2   . PHE G 3 67  ? 90.670  96.811  120.175 1.00 17.26  ? 104 PHE E CD2   1 
ATOM   8620  C CE1   . PHE G 3 67  ? 88.054  97.795  120.306 1.00 18.10  ? 104 PHE E CE1   1 
ATOM   8621  C CE2   . PHE G 3 67  ? 89.577  95.952  120.020 1.00 17.41  ? 104 PHE E CE2   1 
ATOM   8622  C CZ    . PHE G 3 67  ? 88.271  96.450  120.085 1.00 18.14  ? 104 PHE E CZ    1 
ATOM   8623  N N     . GLU G 3 68  ? 93.662  101.547 119.692 1.00 17.24  ? 105 GLU E N     1 
ATOM   8624  C CA    . GLU G 3 68  ? 94.490  102.675 120.169 1.00 18.05  ? 105 GLU E CA    1 
ATOM   8625  C C     . GLU G 3 68  ? 93.878  103.954 119.596 1.00 19.00  ? 105 GLU E C     1 
ATOM   8626  O O     . GLU G 3 68  ? 93.661  104.925 120.320 1.00 19.36  ? 105 GLU E O     1 
ATOM   8627  C CB    . GLU G 3 68  ? 95.948  102.562 119.682 1.00 18.46  ? 105 GLU E CB    1 
ATOM   8628  C CG    . GLU G 3 68  ? 96.766  101.418 120.324 1.00 27.88  ? 105 GLU E CG    1 
ATOM   8629  C CD    . GLU G 3 68  ? 98.053  101.077 119.531 1.00 32.39  ? 105 GLU E CD    1 
ATOM   8630  O OE1   . GLU G 3 68  ? 98.339  101.751 118.512 1.00 30.45  ? 105 GLU E OE1   1 
ATOM   8631  O OE2   . GLU G 3 68  ? 98.760  100.133 119.925 1.00 32.44  ? 105 GLU E OE2   1 
ATOM   8632  N N     . ASP G 3 69  ? 93.575  103.955 118.298 1.00 18.67  ? 106 ASP E N     1 
ATOM   8633  C CA    . ASP G 3 69  ? 93.004  105.156 117.652 1.00 18.55  ? 106 ASP E CA    1 
ATOM   8634  C C     . ASP G 3 69  ? 91.612  105.485 118.246 1.00 18.56  ? 106 ASP E C     1 
ATOM   8635  O O     . ASP G 3 69  ? 91.275  106.633 118.490 1.00 20.01  ? 106 ASP E O     1 
ATOM   8636  C CB    . ASP G 3 69  ? 92.895  104.922 116.137 1.00 18.28  ? 106 ASP E CB    1 
ATOM   8637  C CG    . ASP G 3 69  ? 94.251  104.854 115.451 1.00 23.10  ? 106 ASP E CG    1 
ATOM   8638  O OD1   . ASP G 3 69  ? 95.262  105.183 116.093 1.00 24.53  ? 106 ASP E OD1   1 
ATOM   8639  O OD2   . ASP G 3 69  ? 94.311  104.487 114.270 1.00 24.63  ? 106 ASP E OD2   1 
ATOM   8640  N N     . THR G 3 70  ? 90.818  104.433 118.474 1.00 20.26  ? 107 THR E N     1 
ATOM   8641  C CA    . THR G 3 70  ? 89.481  104.556 119.039 1.00 16.56  ? 107 THR E CA    1 
ATOM   8642  C C     . THR G 3 70  ? 89.596  105.219 120.405 1.00 17.45  ? 107 THR E C     1 
ATOM   8643  O O     . THR G 3 70  ? 88.819  106.098 120.772 1.00 19.73  ? 107 THR E O     1 
ATOM   8644  C CB    . THR G 3 70  ? 88.878  103.110 119.178 1.00 20.15  ? 107 THR E CB    1 
ATOM   8645  O OG1   . THR G 3 70  ? 88.766  102.542 117.867 1.00 18.12  ? 107 THR E OG1   1 
ATOM   8646  C CG2   . THR G 3 70  ? 87.517  103.123 119.834 1.00 21.66  ? 107 THR E CG2   1 
ATOM   8647  N N     . ASN G 3 71  ? 90.557  104.756 121.193 1.00 18.50  ? 108 ASN E N     1 
ATOM   8648  C CA    . ASN G 3 71  ? 90.774  105.300 122.523 1.00 18.45  ? 108 ASN E CA    1 
ATOM   8649  C C     . ASN G 3 71  ? 91.075  106.800 122.435 1.00 24.42  ? 108 ASN E C     1 
ATOM   8650  O O     . ASN G 3 71  ? 90.572  107.616 123.241 1.00 21.11  ? 108 ASN E O     1 
ATOM   8651  C CB    . ASN G 3 71  ? 91.983  104.583 123.169 1.00 20.58  ? 108 ASN E CB    1 
ATOM   8652  C CG    . ASN G 3 71  ? 91.944  104.632 124.688 1.00 23.01  ? 108 ASN E CG    1 
ATOM   8653  O OD1   . ASN G 3 71  ? 90.859  104.708 125.295 1.00 26.09  ? 108 ASN E OD1   1 
ATOM   8654  N ND2   . ASN G 3 71  ? 93.108  104.547 125.306 1.00 24.76  ? 108 ASN E ND2   1 
ATOM   8655  N N     . LEU G 3 72  ? 91.926  107.163 121.476 1.00 20.90  ? 109 LEU E N     1 
ATOM   8656  C CA    . LEU G 3 72  ? 92.261  108.565 121.333 1.00 20.46  ? 109 LEU E CA    1 
ATOM   8657  C C     . LEU G 3 72  ? 90.985  109.351 121.000 1.00 22.50  ? 109 LEU E C     1 
ATOM   8658  O O     . LEU G 3 72  ? 90.830  110.483 121.449 1.00 20.32  ? 109 LEU E O     1 
ATOM   8659  C CB    . LEU G 3 72  ? 93.320  108.732 120.236 1.00 20.29  ? 109 LEU E CB    1 
ATOM   8660  C CG    . LEU G 3 72  ? 94.716  108.231 120.598 1.00 23.88  ? 109 LEU E CG    1 
ATOM   8661  C CD1   . LEU G 3 72  ? 95.649  108.499 119.384 1.00 26.96  ? 109 LEU E CD1   1 
ATOM   8662  C CD2   . LEU G 3 72  ? 95.229  108.960 121.858 1.00 24.98  ? 109 LEU E CD2   1 
ATOM   8663  N N     . CYS G 3 73  ? 90.084  108.759 120.208 1.00 19.80  ? 110 CYS E N     1 
ATOM   8664  C CA    . CYS G 3 73  ? 88.836  109.438 119.860 1.00 22.52  ? 110 CYS E CA    1 
ATOM   8665  C C     . CYS G 3 73  ? 87.909  109.625 121.068 1.00 22.57  ? 110 CYS E C     1 
ATOM   8666  O O     . CYS G 3 73  ? 87.271  110.644 121.194 1.00 21.92  ? 110 CYS E O     1 
ATOM   8667  C CB    . CYS G 3 73  ? 88.104  108.701 118.742 1.00 16.17  ? 110 CYS E CB    1 
ATOM   8668  S SG    . CYS G 3 73  ? 89.039  108.818 117.177 1.00 21.92  ? 110 CYS E SG    1 
ATOM   8669  N N     . ALA G 3 74  ? 87.845  108.640 121.941 1.00 23.67  ? 111 ALA E N     1 
ATOM   8670  C CA    . ALA G 3 74  ? 87.017  108.760 123.141 1.00 23.11  ? 111 ALA E CA    1 
ATOM   8671  C C     . ALA G 3 74  ? 87.601  109.853 124.038 1.00 22.70  ? 111 ALA E C     1 
ATOM   8672  O O     . ALA G 3 74  ? 86.884  110.714 124.527 1.00 25.99  ? 111 ALA E O     1 
ATOM   8673  C CB    . ALA G 3 74  ? 87.006  107.433 123.879 1.00 25.01  ? 111 ALA E CB    1 
ATOM   8674  N N     . ILE G 3 75  ? 88.908  109.811 124.257 1.00 22.19  ? 112 ILE E N     1 
ATOM   8675  C CA    . ILE G 3 75  ? 89.589  110.791 125.102 1.00 24.24  ? 112 ILE E CA    1 
ATOM   8676  C C     . ILE G 3 75  ? 89.421  112.187 124.532 1.00 26.54  ? 112 ILE E C     1 
ATOM   8677  O O     . ILE G 3 75  ? 89.280  113.152 125.262 1.00 27.91  ? 112 ILE E O     1 
ATOM   8678  C CB    . ILE G 3 75  ? 91.083  110.452 125.228 1.00 25.04  ? 112 ILE E CB    1 
ATOM   8679  C CG1   . ILE G 3 75  ? 91.240  109.216 126.128 1.00 21.98  ? 112 ILE E CG1   1 
ATOM   8680  C CG2   . ILE G 3 75  ? 91.859  111.628 125.843 1.00 24.41  ? 112 ILE E CG2   1 
ATOM   8681  C CD1   . ILE G 3 75  ? 92.669  108.581 125.994 1.00 24.79  ? 112 ILE E CD1   1 
ATOM   8682  N N     . HIS G 3 76  ? 89.402  112.276 123.215 1.00 23.16  ? 113 HIS E N     1 
ATOM   8683  C CA    . HIS G 3 76  ? 89.220  113.549 122.543 1.00 25.97  ? 113 HIS E CA    1 
ATOM   8684  C C     . HIS G 3 76  ? 87.852  114.111 122.953 1.00 28.83  ? 113 HIS E C     1 
ATOM   8685  O O     . HIS G 3 76  ? 87.684  115.318 123.085 1.00 31.62  ? 113 HIS E O     1 
ATOM   8686  C CB    . HIS G 3 76  ? 89.261  113.352 121.024 1.00 23.24  ? 113 HIS E CB    1 
ATOM   8687  C CG    . HIS G 3 76  ? 89.249  114.634 120.253 1.00 22.97  ? 113 HIS E CG    1 
ATOM   8688  N ND1   . HIS G 3 76  ? 90.301  115.524 120.282 1.00 21.63  ? 113 HIS E ND1   1 
ATOM   8689  C CD2   . HIS G 3 76  ? 88.294  115.205 119.478 1.00 23.51  ? 113 HIS E CD2   1 
ATOM   8690  C CE1   . HIS G 3 76  ? 89.993  116.595 119.567 1.00 22.25  ? 113 HIS E CE1   1 
ATOM   8691  N NE2   . HIS G 3 76  ? 88.779  116.426 119.070 1.00 23.20  ? 113 HIS E NE2   1 
ATOM   8692  N N     . ALA G 3 77  ? 86.875  113.226 123.146 1.00 26.97  ? 114 ALA E N     1 
ATOM   8693  C CA    . ALA G 3 77  ? 85.544  113.667 123.517 1.00 28.91  ? 114 ALA E CA    1 
ATOM   8694  C C     . ALA G 3 77  ? 85.385  113.765 125.042 1.00 29.12  ? 114 ALA E C     1 
ATOM   8695  O O     . ALA G 3 77  ? 84.267  113.825 125.544 1.00 29.44  ? 114 ALA E O     1 
ATOM   8696  C CB    . ALA G 3 77  ? 84.502  112.707 122.940 1.00 27.75  ? 114 ALA E CB    1 
ATOM   8697  N N     . LYS G 3 78  ? 86.496  113.770 125.770 1.00 30.64  ? 115 LYS E N     1 
ATOM   8698  C CA    . LYS G 3 78  ? 86.454  113.858 127.225 1.00 32.74  ? 115 LYS E CA    1 
ATOM   8699  C C     . LYS G 3 78  ? 85.852  112.634 127.902 1.00 32.05  ? 115 LYS E C     1 
ATOM   8700  O O     . LYS G 3 78  ? 85.332  112.696 129.028 1.00 33.27  ? 115 LYS E O     1 
ATOM   8701  C CB    . LYS G 3 78  ? 85.728  115.139 127.640 1.00 32.98  ? 115 LYS E CB    1 
ATOM   8702  C CG    . LYS G 3 78  ? 86.474  116.377 127.156 1.00 43.23  ? 115 LYS E CG    1 
ATOM   8703  C CD    . LYS G 3 78  ? 85.697  117.648 127.446 1.00 50.88  ? 115 LYS E CD    1 
ATOM   8704  C CE    . LYS G 3 78  ? 86.497  118.897 127.122 1.00 54.47  ? 115 LYS E CE    1 
ATOM   8705  N NZ    . LYS G 3 78  ? 85.687  120.115 127.463 1.00 60.55  ? 115 LYS E NZ    1 
ATOM   8706  N N     . ARG G 3 79  ? 85.962  111.497 127.234 1.00 29.41  ? 116 ARG E N     1 
ATOM   8707  C CA    . ARG G 3 79  ? 85.467  110.248 127.790 1.00 27.59  ? 116 ARG E CA    1 
ATOM   8708  C C     . ARG G 3 79  ? 86.662  109.319 128.002 1.00 28.98  ? 116 ARG E C     1 
ATOM   8709  O O     . ARG G 3 79  ? 87.762  109.584 127.511 1.00 30.09  ? 116 ARG E O     1 
ATOM   8710  C CB    . ARG G 3 79  ? 84.461  109.588 126.827 1.00 25.20  ? 116 ARG E CB    1 
ATOM   8711  C CG    . ARG G 3 79  ? 83.071  110.279 126.789 1.00 27.80  ? 116 ARG E CG    1 
ATOM   8712  C CD    . ARG G 3 79  ? 82.084  109.567 125.827 1.00 28.17  ? 116 ARG E CD    1 
ATOM   8713  N NE    . ARG G 3 79  ? 82.285  109.875 124.406 1.00 26.34  ? 116 ARG E NE    1 
ATOM   8714  C CZ    . ARG G 3 79  ? 82.925  109.101 123.523 1.00 29.05  ? 116 ARG E CZ    1 
ATOM   8715  N NH1   . ARG G 3 79  ? 83.471  107.933 123.886 1.00 22.28  ? 116 ARG E NH1   1 
ATOM   8716  N NH2   . ARG G 3 79  ? 82.939  109.456 122.247 1.00 24.17  ? 116 ARG E NH2   1 
ATOM   8717  N N     . VAL G 3 80  ? 86.446  108.240 128.734 1.00 25.21  ? 117 VAL E N     1 
ATOM   8718  C CA    . VAL G 3 80  ? 87.475  107.247 128.955 1.00 25.76  ? 117 VAL E CA    1 
ATOM   8719  C C     . VAL G 3 80  ? 86.866  105.922 128.480 1.00 23.86  ? 117 VAL E C     1 
ATOM   8720  O O     . VAL G 3 80  ? 87.513  104.883 128.488 1.00 28.42  ? 117 VAL E O     1 
ATOM   8721  C CB    . VAL G 3 80  ? 87.875  107.163 130.459 1.00 26.64  ? 117 VAL E CB    1 
ATOM   8722  C CG1   . VAL G 3 80  ? 88.404  108.523 130.928 1.00 27.72  ? 117 VAL E CG1   1 
ATOM   8723  C CG2   . VAL G 3 80  ? 86.667  106.753 131.310 1.00 26.60  ? 117 VAL E CG2   1 
ATOM   8724  N N     . THR G 3 81  ? 85.610  105.973 128.061 1.00 23.46  ? 118 THR E N     1 
ATOM   8725  C CA    . THR G 3 81  ? 84.902  104.782 127.582 1.00 26.15  ? 118 THR E CA    1 
ATOM   8726  C C     . THR G 3 81  ? 84.823  104.781 126.046 1.00 24.22  ? 118 THR E C     1 
ATOM   8727  O O     . THR G 3 81  ? 84.282  105.720 125.457 1.00 25.34  ? 118 THR E O     1 
ATOM   8728  C CB    . THR G 3 81  ? 83.451  104.757 128.137 1.00 27.80  ? 118 THR E CB    1 
ATOM   8729  O OG1   . THR G 3 81  ? 83.481  104.951 129.563 1.00 27.68  ? 118 THR E OG1   1 
ATOM   8730  C CG2   . THR G 3 81  ? 82.760  103.433 127.802 1.00 24.03  ? 118 THR E CG2   1 
ATOM   8731  N N     . ILE G 3 82  ? 85.357  103.756 125.390 1.00 22.89  ? 119 ILE E N     1 
ATOM   8732  C CA    . ILE G 3 82  ? 85.257  103.760 123.944 1.00 21.60  ? 119 ILE E CA    1 
ATOM   8733  C C     . ILE G 3 82  ? 83.837  103.344 123.526 1.00 24.34  ? 119 ILE E C     1 
ATOM   8734  O O     . ILE G 3 82  ? 83.194  102.493 124.156 1.00 22.14  ? 119 ILE E O     1 
ATOM   8735  C CB    . ILE G 3 82  ? 86.290  102.838 123.274 1.00 21.90  ? 119 ILE E CB    1 
ATOM   8736  C CG1   . ILE G 3 82  ? 86.134  101.397 123.758 1.00 22.58  ? 119 ILE E CG1   1 
ATOM   8737  C CG2   . ILE G 3 82  ? 87.729  103.380 123.561 1.00 19.26  ? 119 ILE E CG2   1 
ATOM   8738  C CD1   . ILE G 3 82  ? 86.981  100.386 122.953 1.00 22.59  ? 119 ILE E CD1   1 
ATOM   8739  N N     . MET G 3 83  ? 83.361  103.946 122.449 1.00 22.15  ? 120 MET E N     1 
ATOM   8740  C CA    . MET G 3 83  ? 82.019  103.670 121.969 1.00 24.29  ? 120 MET E CA    1 
ATOM   8741  C C     . MET G 3 83  ? 82.032  103.466 120.465 1.00 25.46  ? 120 MET E C     1 
ATOM   8742  O O     . MET G 3 83  ? 83.006  103.836 119.795 1.00 23.68  ? 120 MET E O     1 
ATOM   8743  C CB    . MET G 3 83  ? 81.116  104.851 122.315 1.00 27.77  ? 120 MET E CB    1 
ATOM   8744  C CG    . MET G 3 83  ? 81.094  105.228 123.788 1.00 25.55  ? 120 MET E CG    1 
ATOM   8745  S SD    . MET G 3 83  ? 80.062  106.695 124.039 1.00 34.13  ? 120 MET E SD    1 
ATOM   8746  C CE    . MET G 3 83  ? 80.550  107.699 122.733 1.00 41.63  ? 120 MET E CE    1 
ATOM   8747  N N     . PRO G 3 84  ? 80.962  102.856 119.907 1.00 25.76  ? 121 PRO E N     1 
ATOM   8748  C CA    . PRO G 3 84  ? 80.947  102.650 118.450 1.00 25.83  ? 121 PRO E CA    1 
ATOM   8749  C C     . PRO G 3 84  ? 81.292  103.918 117.653 1.00 23.36  ? 121 PRO E C     1 
ATOM   8750  O O     . PRO G 3 84  ? 82.004  103.839 116.654 1.00 26.76  ? 121 PRO E O     1 
ATOM   8751  C CB    . PRO G 3 84  ? 79.517  102.137 118.174 1.00 26.41  ? 121 PRO E CB    1 
ATOM   8752  C CG    . PRO G 3 84  ? 79.298  101.222 119.404 1.00 23.85  ? 121 PRO E CG    1 
ATOM   8753  C CD    . PRO G 3 84  ? 79.864  102.110 120.561 1.00 24.97  ? 121 PRO E CD    1 
ATOM   8754  N N     . LYS G 3 85  ? 80.832  105.080 118.080 1.00 23.02  ? 122 LYS E N     1 
ATOM   8755  C CA    . LYS G 3 85  ? 81.153  106.288 117.309 1.00 25.90  ? 122 LYS E CA    1 
ATOM   8756  C C     . LYS G 3 85  ? 82.669  106.586 117.278 1.00 23.44  ? 122 LYS E C     1 
ATOM   8757  O O     . LYS G 3 85  ? 83.140  107.248 116.363 1.00 23.25  ? 122 LYS E O     1 
ATOM   8758  C CB    . LYS G 3 85  ? 80.413  107.511 117.868 1.00 27.49  ? 122 LYS E CB    1 
ATOM   8759  C CG    . LYS G 3 85  ? 80.760  107.819 119.320 1.00 32.70  ? 122 LYS E CG    1 
ATOM   8760  C CD    . LYS G 3 85  ? 79.645  108.579 120.027 1.00 40.34  ? 122 LYS E CD    1 
ATOM   8761  C CE    . LYS G 3 85  ? 79.749  110.046 119.831 1.00 46.68  ? 122 LYS E CE    1 
ATOM   8762  N NZ    . LYS G 3 85  ? 78.534  110.753 120.338 1.00 49.94  ? 122 LYS E NZ    1 
ATOM   8763  N N     . ASP G 3 86  ? 83.424  106.131 118.276 1.00 21.54  ? 123 ASP E N     1 
ATOM   8764  C CA    . ASP G 3 86  ? 84.877  106.365 118.275 1.00 18.56  ? 123 ASP E CA    1 
ATOM   8765  C C     . ASP G 3 86  ? 85.553  105.465 117.232 1.00 22.09  ? 123 ASP E C     1 
ATOM   8766  O O     . ASP G 3 86  ? 86.464  105.870 116.551 1.00 20.49  ? 123 ASP E O     1 
ATOM   8767  C CB    . ASP G 3 86  ? 85.471  106.049 119.661 1.00 20.13  ? 123 ASP E CB    1 
ATOM   8768  C CG    . ASP G 3 86  ? 84.886  106.930 120.746 1.00 19.78  ? 123 ASP E CG    1 
ATOM   8769  O OD1   . ASP G 3 86  ? 84.800  108.163 120.534 1.00 21.74  ? 123 ASP E OD1   1 
ATOM   8770  O OD2   . ASP G 3 86  ? 84.512  106.406 121.799 1.00 23.70  ? 123 ASP E OD2   1 
ATOM   8771  N N     . ILE G 3 87  ? 85.121  104.211 117.151 1.00 20.88  ? 124 ILE E N     1 
ATOM   8772  C CA    . ILE G 3 87  ? 85.686  103.290 116.176 1.00 21.88  ? 124 ILE E CA    1 
ATOM   8773  C C     . ILE G 3 87  ? 85.375  103.826 114.771 1.00 23.50  ? 124 ILE E C     1 
ATOM   8774  O O     . ILE G 3 87  ? 86.227  103.813 113.879 1.00 25.09  ? 124 ILE E O     1 
ATOM   8775  C CB    . ILE G 3 87  ? 85.034  101.879 116.299 1.00 23.00  ? 124 ILE E CB    1 
ATOM   8776  C CG1   . ILE G 3 87  ? 85.427  101.232 117.636 1.00 24.62  ? 124 ILE E CG1   1 
ATOM   8777  C CG2   . ILE G 3 87  ? 85.405  101.014 115.084 1.00 22.66  ? 124 ILE E CG2   1 
ATOM   8778  C CD1   . ILE G 3 87  ? 84.979  99.753  117.744 1.00 19.50  ? 124 ILE E CD1   1 
ATOM   8779  N N     . GLN G 3 88  ? 84.144  104.290 114.591 1.00 24.36  ? 125 GLN E N     1 
ATOM   8780  C CA    . GLN G 3 88  ? 83.678  104.829 113.291 1.00 24.48  ? 125 GLN E CA    1 
ATOM   8781  C C     . GLN G 3 88  ? 84.461  106.087 112.904 1.00 21.69  ? 125 GLN E C     1 
ATOM   8782  O O     . GLN G 3 88  ? 84.854  106.247 111.769 1.00 23.50  ? 125 GLN E O     1 
ATOM   8783  C CB    . GLN G 3 88  ? 82.150  105.111 113.354 1.00 22.31  ? 125 GLN E CB    1 
ATOM   8784  C CG    . GLN G 3 88  ? 81.257  103.829 113.450 1.00 28.10  ? 125 GLN E CG    1 
ATOM   8785  C CD    . GLN G 3 88  ? 79.842  104.067 114.054 1.00 33.14  ? 125 GLN E CD    1 
ATOM   8786  O OE1   . GLN G 3 88  ? 79.366  105.193 114.163 1.00 38.69  ? 125 GLN E OE1   1 
ATOM   8787  N NE2   . GLN G 3 88  ? 79.179  102.994 114.435 1.00 32.20  ? 125 GLN E NE2   1 
ATOM   8788  N N     . LEU G 3 89  ? 84.693  106.990 113.838 1.00 19.01  ? 126 LEU E N     1 
ATOM   8789  C CA    . LEU G 3 89  ? 85.471  108.169 113.502 1.00 19.44  ? 126 LEU E CA    1 
ATOM   8790  C C     . LEU G 3 89  ? 86.899  107.730 113.136 1.00 21.49  ? 126 LEU E C     1 
ATOM   8791  O O     . LEU G 3 89  ? 87.463  108.203 112.144 1.00 21.75  ? 126 LEU E O     1 
ATOM   8792  C CB    . LEU G 3 89  ? 85.530  109.146 114.679 1.00 22.44  ? 126 LEU E CB    1 
ATOM   8793  C CG    . LEU G 3 89  ? 86.441  110.373 114.511 1.00 26.38  ? 126 LEU E CG    1 
ATOM   8794  C CD1   . LEU G 3 89  ? 85.868  111.229 113.407 1.00 26.38  ? 126 LEU E CD1   1 
ATOM   8795  C CD2   . LEU G 3 89  ? 86.539  111.169 115.832 1.00 24.65  ? 126 LEU E CD2   1 
ATOM   8796  N N     . ALA G 3 90  ? 87.480  106.829 113.930 1.00 19.83  ? 127 ALA E N     1 
ATOM   8797  C CA    . ALA G 3 90  ? 88.837  106.352 113.655 1.00 20.54  ? 127 ALA E CA    1 
ATOM   8798  C C     . ALA G 3 90  ? 88.914  105.728 112.251 1.00 23.98  ? 127 ALA E C     1 
ATOM   8799  O O     . ALA G 3 90  ? 89.833  106.043 111.490 1.00 23.72  ? 127 ALA E O     1 
ATOM   8800  C CB    . ALA G 3 90  ? 89.283  105.312 114.739 1.00 20.07  ? 127 ALA E CB    1 
ATOM   8801  N N     . ARG G 3 91  ? 87.947  104.876 111.891 1.00 21.03  ? 128 ARG E N     1 
ATOM   8802  C CA    . ARG G 3 91  ? 87.994  104.253 110.572 1.00 22.42  ? 128 ARG E CA    1 
ATOM   8803  C C     . ARG G 3 91  ? 87.740  105.285 109.473 1.00 25.01  ? 128 ARG E C     1 
ATOM   8804  O O     . ARG G 3 91  ? 88.323  105.214 108.377 1.00 22.89  ? 128 ARG E O     1 
ATOM   8805  C CB    . ARG G 3 91  ? 86.987  103.114 110.488 1.00 25.16  ? 128 ARG E CB    1 
ATOM   8806  C CG    . ARG G 3 91  ? 87.357  101.973 111.431 1.00 26.13  ? 128 ARG E CG    1 
ATOM   8807  C CD    . ARG G 3 91  ? 87.108  100.635 110.750 1.00 36.57  ? 128 ARG E CD    1 
ATOM   8808  N NE    . ARG G 3 91  ? 85.745  100.596 110.341 1.00 47.06  ? 128 ARG E NE    1 
ATOM   8809  C CZ    . ARG G 3 91  ? 85.284  100.023 109.246 1.00 43.59  ? 128 ARG E CZ    1 
ATOM   8810  N NH1   . ARG G 3 91  ? 86.080  99.395  108.387 1.00 42.24  ? 128 ARG E NH1   1 
ATOM   8811  N NH2   . ARG G 3 91  ? 83.999  100.115 109.028 1.00 44.06  ? 128 ARG E NH2   1 
ATOM   8812  N N     . ARG G 3 92  ? 86.862  106.233 109.742 1.00 21.11  ? 129 ARG E N     1 
ATOM   8813  C CA    . ARG G 3 92  ? 86.635  107.258 108.736 1.00 27.21  ? 129 ARG E CA    1 
ATOM   8814  C C     . ARG G 3 92  ? 87.917  108.102 108.482 1.00 26.95  ? 129 ARG E C     1 
ATOM   8815  O O     . ARG G 3 92  ? 88.266  108.370 107.323 1.00 26.86  ? 129 ARG E O     1 
ATOM   8816  C CB    . ARG G 3 92  ? 85.470  108.163 109.141 1.00 32.28  ? 129 ARG E CB    1 
ATOM   8817  C CG    . ARG G 3 92  ? 85.161  109.235 108.100 1.00 41.48  ? 129 ARG E CG    1 
ATOM   8818  C CD    . ARG G 3 92  ? 83.674  109.599 108.095 1.00 52.17  ? 129 ARG E CD    1 
ATOM   8819  N NE    . ARG G 3 92  ? 83.379  110.628 107.097 1.00 58.19  ? 129 ARG E NE    1 
ATOM   8820  C CZ    . ARG G 3 92  ? 82.306  111.416 107.126 1.00 59.07  ? 129 ARG E CZ    1 
ATOM   8821  N NH1   . ARG G 3 92  ? 81.410  111.295 108.107 1.00 57.97  ? 129 ARG E NH1   1 
ATOM   8822  N NH2   . ARG G 3 92  ? 82.142  112.347 106.195 1.00 58.12  ? 129 ARG E NH2   1 
ATOM   8823  N N     . ILE G 3 93  ? 88.627  108.513 109.537 1.00 26.40  ? 130 ILE E N     1 
ATOM   8824  C CA    . ILE G 3 93  ? 89.828  109.324 109.320 1.00 28.82  ? 130 ILE E CA    1 
ATOM   8825  C C     . ILE G 3 93  ? 90.912  108.509 108.620 1.00 30.86  ? 130 ILE E C     1 
ATOM   8826  O O     . ILE G 3 93  ? 91.622  109.034 107.751 1.00 28.35  ? 130 ILE E O     1 
ATOM   8827  C CB    . ILE G 3 93  ? 90.328  109.916 110.630 1.00 28.40  ? 130 ILE E CB    1 
ATOM   8828  C CG1   . ILE G 3 93  ? 89.280  110.912 111.132 1.00 30.03  ? 130 ILE E CG1   1 
ATOM   8829  C CG2   . ILE G 3 93  ? 91.644  110.663 110.432 1.00 24.86  ? 130 ILE E CG2   1 
ATOM   8830  C CD1   . ILE G 3 93  ? 89.619  111.506 112.472 1.00 34.92  ? 130 ILE E CD1   1 
ATOM   8831  N N     . ARG G 3 94  ? 90.997  107.218 108.960 1.00 27.19  ? 131 ARG E N     1 
ATOM   8832  C CA    . ARG G 3 94  ? 91.961  106.312 108.332 1.00 30.50  ? 131 ARG E CA    1 
ATOM   8833  C C     . ARG G 3 94  ? 91.665  106.047 106.866 1.00 31.11  ? 131 ARG E C     1 
ATOM   8834  O O     . ARG G 3 94  ? 92.483  105.463 106.177 1.00 32.04  ? 131 ARG E O     1 
ATOM   8835  C CB    . ARG G 3 94  ? 91.938  104.947 109.004 1.00 30.77  ? 131 ARG E CB    1 
ATOM   8836  C CG    . ARG G 3 94  ? 92.394  104.927 110.434 1.00 28.49  ? 131 ARG E CG    1 
ATOM   8837  C CD    . ARG G 3 94  ? 92.128  103.535 110.937 1.00 27.15  ? 131 ARG E CD    1 
ATOM   8838  N NE    . ARG G 3 94  ? 92.994  103.227 112.055 1.00 25.70  ? 131 ARG E NE    1 
ATOM   8839  C CZ    . ARG G 3 94  ? 93.473  102.012 112.294 1.00 25.97  ? 131 ARG E CZ    1 
ATOM   8840  N NH1   . ARG G 3 94  ? 93.143  100.998 111.493 1.00 22.78  ? 131 ARG E NH1   1 
ATOM   8841  N NH2   . ARG G 3 94  ? 94.323  101.831 113.290 1.00 22.06  ? 131 ARG E NH2   1 
ATOM   8842  N N     . GLY G 3 95  ? 90.480  106.419 106.393 1.00 30.23  ? 132 GLY E N     1 
ATOM   8843  C CA    . GLY G 3 95  ? 90.181  106.135 105.009 1.00 32.27  ? 132 GLY E CA    1 
ATOM   8844  C C     . GLY G 3 95  ? 89.651  104.720 104.835 1.00 35.68  ? 132 GLY E C     1 
ATOM   8845  O O     . GLY G 3 95  ? 89.651  104.206 103.732 1.00 35.29  ? 132 GLY E O     1 
ATOM   8846  N N     . GLU G 3 96  ? 89.198  104.079 105.912 1.00 35.33  ? 133 GLU E N     1 
ATOM   8847  C CA    . GLU G 3 96  ? 88.644  102.726 105.805 1.00 38.17  ? 133 GLU E CA    1 
ATOM   8848  C C     . GLU G 3 96  ? 87.168  102.816 105.428 1.00 44.26  ? 133 GLU E C     1 
ATOM   8849  O O     . GLU G 3 96  ? 86.560  101.835 104.986 1.00 47.98  ? 133 GLU E O     1 
ATOM   8850  C CB    . GLU G 3 96  ? 88.815  101.951 107.124 1.00 30.66  ? 133 GLU E CB    1 
ATOM   8851  C CG    . GLU G 3 96  ? 90.256  101.434 107.303 1.00 32.73  ? 133 GLU E CG    1 
ATOM   8852  C CD    . GLU G 3 96  ? 90.516  100.751 108.628 1.00 28.13  ? 133 GLU E CD    1 
ATOM   8853  O OE1   . GLU G 3 96  ? 89.607  100.065 109.163 1.00 27.49  ? 133 GLU E OE1   1 
ATOM   8854  O OE2   . GLU G 3 96  ? 91.672  100.884 109.116 1.00 30.58  ? 133 GLU E OE2   1 
ATOM   8855  N N     . ARG G 3 97  ? 86.598  103.998 105.611 1.00 47.63  ? 134 ARG E N     1 
ATOM   8856  C CA    . ARG G 3 97  ? 85.201  104.231 105.280 1.00 54.56  ? 134 ARG E CA    1 
ATOM   8857  C C     . ARG G 3 97  ? 85.028  105.656 104.736 1.00 55.59  ? 134 ARG E C     1 
ATOM   8858  O O     . ARG G 3 97  ? 84.056  105.941 104.046 1.00 59.05  ? 134 ARG E O     1 
ATOM   8859  C CB    . ARG G 3 97  ? 84.306  104.009 106.520 1.00 55.25  ? 134 ARG E CB    1 
ATOM   8860  C CG    . ARG G 3 97  ? 84.422  105.076 107.601 1.00 56.59  ? 134 ARG E CG    1 
ATOM   8861  C CD    . ARG G 3 97  ? 83.368  104.897 108.704 1.00 58.60  ? 134 ARG E CD    1 
ATOM   8862  N NE    . ARG G 3 97  ? 83.716  103.834 109.636 1.00 60.79  ? 134 ARG E NE    1 
ATOM   8863  C CZ    . ARG G 3 97  ? 82.843  102.993 110.189 1.00 58.84  ? 134 ARG E CZ    1 
ATOM   8864  N NH1   . ARG G 3 97  ? 81.551  103.087 109.901 1.00 59.32  ? 134 ARG E NH1   1 
ATOM   8865  N NH2   . ARG G 3 97  ? 83.268  102.058 111.029 1.00 49.09  ? 134 ARG E NH2   1 
ATOM   8866  N N     . ALA G 3 98  ? 86.005  106.512 105.042 1.00 56.39  ? 135 ALA E N     1 
ATOM   8867  C CA    . ALA G 3 98  ? 86.078  107.935 104.656 1.00 58.71  ? 135 ALA E CA    1 
ATOM   8868  C C     . ALA G 3 98  ? 84.980  108.605 103.808 1.00 61.43  ? 135 ALA E C     1 
ATOM   8869  O O     . ALA G 3 98  ? 85.276  109.709 103.282 1.00 60.72  ? 135 ALA E O     1 
ATOM   8870  C CB    . ALA G 3 98  ? 87.423  108.203 104.009 1.00 56.71  ? 135 ALA E CB    1 
ATOM   8871  O OXT   . ALA G 3 98  ? 83.848  108.077 103.691 1.00 61.56  ? 135 ALA E OXT   1 
ATOM   8872  N N     . LYS H 4 1   ? 84.323  61.348  99.806  1.00 103.78 ? 16  LYS F N     1 
ATOM   8873  C CA    . LYS H 4 1   ? 84.257  62.171  101.048 1.00 103.39 ? 16  LYS F CA    1 
ATOM   8874  C C     . LYS H 4 1   ? 82.813  62.361  101.486 1.00 102.39 ? 16  LYS F C     1 
ATOM   8875  O O     . LYS H 4 1   ? 81.998  62.910  100.743 1.00 102.93 ? 16  LYS F O     1 
ATOM   8876  C CB    . LYS H 4 1   ? 84.912  63.536  100.811 1.00 104.63 ? 16  LYS F CB    1 
ATOM   8877  C CG    . LYS H 4 1   ? 84.304  64.335  99.669  1.00 104.86 ? 16  LYS F CG    1 
ATOM   8878  C CD    . LYS H 4 1   ? 85.051  65.641  99.464  1.00 106.12 ? 16  LYS F CD    1 
ATOM   8879  C CE    . LYS H 4 1   ? 84.496  66.418  98.280  1.00 106.73 ? 16  LYS F CE    1 
ATOM   8880  N NZ    . LYS H 4 1   ? 85.247  67.683  98.043  1.00 107.04 ? 16  LYS F NZ    1 
ATOM   8881  N N     . ARG H 4 2   ? 82.496  61.907  102.694 1.00 100.86 ? 17  ARG F N     1 
ATOM   8882  C CA    . ARG H 4 2   ? 81.138  62.028  103.213 1.00 98.88  ? 17  ARG F CA    1 
ATOM   8883  C C     . ARG H 4 2   ? 80.942  63.182  104.183 1.00 95.82  ? 17  ARG F C     1 
ATOM   8884  O O     . ARG H 4 2   ? 81.672  63.318  105.164 1.00 96.26  ? 17  ARG F O     1 
ATOM   8885  C CB    . ARG H 4 2   ? 80.705  60.744  103.924 1.00 100.67 ? 17  ARG F CB    1 
ATOM   8886  C CG    . ARG H 4 2   ? 80.523  59.518  103.052 1.00 103.43 ? 17  ARG F CG    1 
ATOM   8887  C CD    . ARG H 4 2   ? 79.599  58.539  103.766 1.00 105.89 ? 17  ARG F CD    1 
ATOM   8888  N NE    . ARG H 4 2   ? 79.710  57.169  103.276 1.00 107.81 ? 17  ARG F NE    1 
ATOM   8889  C CZ    . ARG H 4 2   ? 78.935  56.171  103.691 1.00 108.47 ? 17  ARG F CZ    1 
ATOM   8890  N NH1   . ARG H 4 2   ? 77.992  56.395  104.598 1.00 108.59 ? 17  ARG F NH1   1 
ATOM   8891  N NH2   . ARG H 4 2   ? 79.108  54.946  103.212 1.00 109.18 ? 17  ARG F NH2   1 
ATOM   8892  N N     . HIS H 4 3   ? 79.939  64.006  103.901 1.00 92.16  ? 18  HIS F N     1 
ATOM   8893  C CA    . HIS H 4 3   ? 79.583  65.122  104.765 1.00 88.59  ? 18  HIS F CA    1 
ATOM   8894  C C     . HIS H 4 3   ? 80.735  66.075  105.077 1.00 84.54  ? 18  HIS F C     1 
ATOM   8895  O O     . HIS H 4 3   ? 81.868  65.853  104.661 1.00 85.34  ? 18  HIS F O     1 
ATOM   8896  C CB    . HIS H 4 3   ? 79.006  64.568  106.070 1.00 89.72  ? 18  HIS F CB    1 
ATOM   8897  C CG    . HIS H 4 3   ? 78.208  63.314  105.884 1.00 90.64  ? 18  HIS F CG    1 
ATOM   8898  N ND1   . HIS H 4 3   ? 76.943  63.307  105.337 1.00 91.06  ? 18  HIS F ND1   1 
ATOM   8899  C CD2   . HIS H 4 3   ? 78.517  62.018  106.131 1.00 91.70  ? 18  HIS F CD2   1 
ATOM   8900  C CE1   . HIS H 4 3   ? 76.508  62.063  105.254 1.00 91.22  ? 18  HIS F CE1   1 
ATOM   8901  N NE2   . HIS H 4 3   ? 77.443  61.261  105.729 1.00 91.53  ? 18  HIS F NE2   1 
ATOM   8902  N N     . ARG H 4 4   ? 80.409  67.130  105.817 1.00 79.82  ? 19  ARG F N     1 
ATOM   8903  C CA    . ARG H 4 4   ? 81.351  68.164  106.243 1.00 74.53  ? 19  ARG F CA    1 
ATOM   8904  C C     . ARG H 4 4   ? 80.512  69.277  106.871 1.00 68.81  ? 19  ARG F C     1 
ATOM   8905  O O     . ARG H 4 4   ? 79.995  70.153  106.181 1.00 67.77  ? 19  ARG F O     1 
ATOM   8906  C CB    . ARG H 4 4   ? 82.151  68.702  105.052 1.00 77.77  ? 19  ARG F CB    1 
ATOM   8907  C CG    . ARG H 4 4   ? 83.378  69.518  105.463 1.00 80.81  ? 19  ARG F CG    1 
ATOM   8908  C CD    . ARG H 4 4   ? 83.067  71.005  105.547 1.00 84.59  ? 19  ARG F CD    1 
ATOM   8909  N NE    . ARG H 4 4   ? 84.055  71.728  106.343 1.00 86.78  ? 19  ARG F NE    1 
ATOM   8910  C CZ    . ARG H 4 4   ? 84.289  73.030  106.237 1.00 86.16  ? 19  ARG F CZ    1 
ATOM   8911  N NH1   . ARG H 4 4   ? 83.611  73.755  105.364 1.00 87.44  ? 19  ARG F NH1   1 
ATOM   8912  N NH2   . ARG H 4 4   ? 85.199  73.607  107.008 1.00 86.68  ? 19  ARG F NH2   1 
ATOM   8913  N N     . LYS H 4 5   ? 80.378  69.212  108.190 1.00 62.38  ? 20  LYS F N     1 
ATOM   8914  C CA    . LYS H 4 5   ? 79.587  70.150  108.973 1.00 57.42  ? 20  LYS F CA    1 
ATOM   8915  C C     . LYS H 4 5   ? 79.480  71.585  108.434 1.00 51.84  ? 20  LYS F C     1 
ATOM   8916  O O     . LYS H 4 5   ? 80.441  72.165  107.927 1.00 51.47  ? 20  LYS F O     1 
ATOM   8917  C CB    . LYS H 4 5   ? 80.098  70.161  110.413 1.00 60.49  ? 20  LYS F CB    1 
ATOM   8918  C CG    . LYS H 4 5   ? 79.326  71.068  111.334 1.00 64.90  ? 20  LYS F CG    1 
ATOM   8919  C CD    . LYS H 4 5   ? 77.884  70.646  111.508 1.00 65.26  ? 20  LYS F CD    1 
ATOM   8920  C CE    . LYS H 4 5   ? 77.178  71.673  112.372 1.00 68.01  ? 20  LYS F CE    1 
ATOM   8921  N NZ    . LYS H 4 5   ? 75.919  71.185  113.002 1.00 73.05  ? 20  LYS F NZ    1 
ATOM   8922  N N     . VAL H 4 6   ? 78.285  72.137  108.555 1.00 42.51  ? 21  VAL F N     1 
ATOM   8923  C CA    . VAL H 4 6   ? 77.991  73.474  108.081 1.00 38.88  ? 21  VAL F CA    1 
ATOM   8924  C C     . VAL H 4 6   ? 78.568  74.519  109.024 1.00 35.05  ? 21  VAL F C     1 
ATOM   8925  O O     . VAL H 4 6   ? 78.379  74.441  110.241 1.00 29.56  ? 21  VAL F O     1 
ATOM   8926  C CB    . VAL H 4 6   ? 76.463  73.656  107.946 1.00 36.37  ? 21  VAL F CB    1 
ATOM   8927  C CG1   . VAL H 4 6   ? 76.133  75.051  107.576 1.00 37.51  ? 21  VAL F CG1   1 
ATOM   8928  C CG2   . VAL H 4 6   ? 75.949  72.718  106.877 1.00 40.74  ? 21  VAL F CG2   1 
ATOM   8929  N N     . LEU H 4 7   ? 79.297  75.479  108.464 1.00 32.56  ? 22  LEU F N     1 
ATOM   8930  C CA    . LEU H 4 7   ? 79.889  76.549  109.282 1.00 31.11  ? 22  LEU F CA    1 
ATOM   8931  C C     . LEU H 4 7   ? 78.955  77.741  109.304 1.00 30.98  ? 22  LEU F C     1 
ATOM   8932  O O     . LEU H 4 7   ? 78.601  78.262  108.254 1.00 32.21  ? 22  LEU F O     1 
ATOM   8933  C CB    . LEU H 4 7   ? 81.250  76.946  108.705 1.00 31.42  ? 22  LEU F CB    1 
ATOM   8934  C CG    . LEU H 4 7   ? 82.301  75.828  108.671 1.00 33.45  ? 22  LEU F CG    1 
ATOM   8935  C CD1   . LEU H 4 7   ? 83.579  76.250  107.898 1.00 32.94  ? 22  LEU F CD1   1 
ATOM   8936  C CD2   . LEU H 4 7   ? 82.635  75.462  110.091 1.00 34.10  ? 22  LEU F CD2   1 
ATOM   8937  N N     . ARG H 4 8   ? 78.539  78.165  110.492 1.00 29.12  ? 23  ARG F N     1 
ATOM   8938  C CA    . ARG H 4 8   ? 77.666  79.321  110.635 1.00 30.93  ? 23  ARG F CA    1 
ATOM   8939  C C     . ARG H 4 8   ? 77.893  80.060  111.963 1.00 27.10  ? 23  ARG F C     1 
ATOM   8940  O O     . ARG H 4 8   ? 78.249  79.458  112.951 1.00 28.25  ? 23  ARG F O     1 
ATOM   8941  C CB    . ARG H 4 8   ? 76.178  78.871  110.543 1.00 34.48  ? 23  ARG F CB    1 
ATOM   8942  C CG    . ARG H 4 8   ? 75.933  77.532  111.216 1.00 39.61  ? 23  ARG F CG    1 
ATOM   8943  C CD    . ARG H 4 8   ? 74.569  76.833  110.842 1.00 40.77  ? 23  ARG F CD    1 
ATOM   8944  N NE    . ARG H 4 8   ? 73.477  77.631  111.320 1.00 36.82  ? 23  ARG F NE    1 
ATOM   8945  C CZ    . ARG H 4 8   ? 72.734  77.366  112.392 1.00 30.69  ? 23  ARG F CZ    1 
ATOM   8946  N NH1   . ARG H 4 8   ? 72.925  76.284  113.129 1.00 33.82  ? 23  ARG F NH1   1 
ATOM   8947  N NH2   . ARG H 4 8   ? 71.829  78.242  112.753 1.00 27.56  ? 23  ARG F NH2   1 
ATOM   8948  N N     . ASP H 4 9   ? 77.715  81.376  111.946 1.00 26.18  ? 24  ASP F N     1 
ATOM   8949  C CA    . ASP H 4 9   ? 77.797  82.213  113.137 1.00 27.69  ? 24  ASP F CA    1 
ATOM   8950  C C     . ASP H 4 9   ? 79.120  82.197  113.903 1.00 23.51  ? 24  ASP F C     1 
ATOM   8951  O O     . ASP H 4 9   ? 79.169  82.606  115.073 1.00 22.93  ? 24  ASP F O     1 
ATOM   8952  C CB    . ASP H 4 9   ? 76.645  81.823  114.087 1.00 30.25  ? 24  ASP F CB    1 
ATOM   8953  C CG    . ASP H 4 9   ? 76.187  82.967  114.955 1.00 32.87  ? 24  ASP F CG    1 
ATOM   8954  O OD1   . ASP H 4 9   ? 76.313  84.161  114.554 1.00 35.68  ? 24  ASP F OD1   1 
ATOM   8955  O OD2   . ASP H 4 9   ? 75.651  82.677  116.039 1.00 35.14  ? 24  ASP F OD2   1 
ATOM   8956  N N     . ASN H 4 10  ? 80.182  81.781  113.237 1.00 20.44  ? 25  ASN F N     1 
ATOM   8957  C CA    . ASN H 4 10  ? 81.480  81.747  113.899 1.00 25.25  ? 25  ASN F CA    1 
ATOM   8958  C C     . ASN H 4 10  ? 82.041  83.104  114.263 1.00 22.63  ? 25  ASN F C     1 
ATOM   8959  O O     . ASN H 4 10  ? 83.044  83.187  114.965 1.00 28.71  ? 25  ASN F O     1 
ATOM   8960  C CB    . ASN H 4 10  ? 82.471  80.944  113.077 1.00 23.64  ? 25  ASN F CB    1 
ATOM   8961  C CG    . ASN H 4 10  ? 82.101  79.489  113.072 1.00 30.87  ? 25  ASN F CG    1 
ATOM   8962  O OD1   . ASN H 4 10  ? 82.231  78.825  114.102 1.00 26.72  ? 25  ASN F OD1   1 
ATOM   8963  N ND2   . ASN H 4 10  ? 81.583  78.993  111.942 1.00 25.32  ? 25  ASN F ND2   1 
ATOM   8964  N N     . ILE H 4 11  ? 81.396  84.169  113.836 1.00 23.17  ? 26  ILE F N     1 
ATOM   8965  C CA    . ILE H 4 11  ? 81.880  85.492  114.224 1.00 25.80  ? 26  ILE F CA    1 
ATOM   8966  C C     . ILE H 4 11  ? 81.703  85.588  115.763 1.00 30.06  ? 26  ILE F C     1 
ATOM   8967  O O     . ILE H 4 11  ? 82.417  86.349  116.449 1.00 26.36  ? 26  ILE F O     1 
ATOM   8968  C CB    . ILE H 4 11  ? 81.077  86.629  113.499 1.00 26.66  ? 26  ILE F CB    1 
ATOM   8969  C CG1   . ILE H 4 11  ? 81.706  87.991  113.807 1.00 28.31  ? 26  ILE F CG1   1 
ATOM   8970  C CG2   . ILE H 4 11  ? 79.603  86.621  113.939 1.00 24.70  ? 26  ILE F CG2   1 
ATOM   8971  C CD1   . ILE H 4 11  ? 83.136  88.104  113.335 1.00 24.08  ? 26  ILE F CD1   1 
ATOM   8972  N N     . GLN H 4 12  ? 80.779  84.792  116.313 1.00 24.43  ? 27  GLN F N     1 
ATOM   8973  C CA    . GLN H 4 12  ? 80.536  84.821  117.761 1.00 30.30  ? 27  GLN F CA    1 
ATOM   8974  C C     . GLN H 4 12  ? 81.647  84.137  118.540 1.00 30.97  ? 27  GLN F C     1 
ATOM   8975  O O     . GLN H 4 12  ? 81.682  84.198  119.772 1.00 36.82  ? 27  GLN F O     1 
ATOM   8976  C CB    . GLN H 4 12  ? 79.172  84.216  118.113 1.00 32.75  ? 27  GLN F CB    1 
ATOM   8977  C CG    . GLN H 4 12  ? 78.020  85.106  117.663 1.00 32.60  ? 27  GLN F CG    1 
ATOM   8978  C CD    . GLN H 4 12  ? 78.065  86.468  118.335 1.00 35.95  ? 27  GLN F CD    1 
ATOM   8979  O OE1   . GLN H 4 12  ? 78.304  86.555  119.536 1.00 44.51  ? 27  GLN F OE1   1 
ATOM   8980  N NE2   . GLN H 4 12  ? 77.825  87.534  117.575 1.00 36.93  ? 27  GLN F NE2   1 
ATOM   8981  N N     . GLY H 4 13  ? 82.557  83.501  117.822 1.00 30.13  ? 28  GLY F N     1 
ATOM   8982  C CA    . GLY H 4 13  ? 83.709  82.881  118.465 1.00 32.13  ? 28  GLY F CA    1 
ATOM   8983  C C     . GLY H 4 13  ? 84.682  83.993  118.880 1.00 32.38  ? 28  GLY F C     1 
ATOM   8984  O O     . GLY H 4 13  ? 85.621  83.773  119.635 1.00 36.91  ? 28  GLY F O     1 
ATOM   8985  N N     . ILE H 4 14  ? 84.489  85.191  118.338 1.00 30.00  ? 29  ILE F N     1 
ATOM   8986  C CA    . ILE H 4 14  ? 85.309  86.343  118.723 1.00 30.33  ? 29  ILE F CA    1 
ATOM   8987  C C     . ILE H 4 14  ? 84.513  86.876  119.931 1.00 24.23  ? 29  ILE F C     1 
ATOM   8988  O O     . ILE H 4 14  ? 83.641  87.729  119.805 1.00 26.34  ? 29  ILE F O     1 
ATOM   8989  C CB    . ILE H 4 14  ? 85.357  87.427  117.615 1.00 27.98  ? 29  ILE F CB    1 
ATOM   8990  C CG1   . ILE H 4 14  ? 85.682  86.779  116.262 1.00 31.22  ? 29  ILE F CG1   1 
ATOM   8991  C CG2   . ILE H 4 14  ? 86.398  88.472  117.963 1.00 27.12  ? 29  ILE F CG2   1 
ATOM   8992  C CD1   . ILE H 4 14  ? 86.978  85.973  116.209 1.00 29.14  ? 29  ILE F CD1   1 
ATOM   8993  N N     . THR H 4 15  ? 84.823  86.346  121.098 1.00 23.58  ? 30  THR F N     1 
ATOM   8994  C CA    . THR H 4 15  ? 84.093  86.669  122.330 1.00 23.34  ? 30  THR F CA    1 
ATOM   8995  C C     . THR H 4 15  ? 84.355  88.002  122.984 1.00 26.40  ? 30  THR F C     1 
ATOM   8996  O O     . THR H 4 15  ? 85.370  88.648  122.741 1.00 24.05  ? 30  THR F O     1 
ATOM   8997  C CB    . THR H 4 15  ? 84.392  85.632  123.389 1.00 24.48  ? 30  THR F CB    1 
ATOM   8998  O OG1   . THR H 4 15  ? 85.771  85.758  123.766 1.00 27.16  ? 30  THR F OG1   1 
ATOM   8999  C CG2   . THR H 4 15  ? 84.191  84.216  122.834 1.00 23.52  ? 30  THR F CG2   1 
ATOM   9000  N N     . LYS H 4 16  ? 83.430  88.386  123.856 1.00 21.82  ? 31  LYS F N     1 
ATOM   9001  C CA    . LYS H 4 16  ? 83.554  89.608  124.610 1.00 25.18  ? 31  LYS F CA    1 
ATOM   9002  C C     . LYS H 4 16  ? 84.924  89.688  125.346 1.00 24.27  ? 31  LYS F C     1 
ATOM   9003  O O     . LYS H 4 16  ? 85.615  90.712  125.289 1.00 23.40  ? 31  LYS F O     1 
ATOM   9004  C CB    . LYS H 4 16  ? 82.383  89.704  125.599 1.00 26.36  ? 31  LYS F CB    1 
ATOM   9005  C CG    . LYS H 4 16  ? 82.498  90.841  126.620 1.00 33.47  ? 31  LYS F CG    1 
ATOM   9006  C CD    . LYS H 4 16  ? 81.204  91.002  127.456 1.00 33.50  ? 31  LYS F CD    1 
ATOM   9007  C CE    . LYS H 4 16  ? 81.494  91.861  128.676 1.00 40.56  ? 31  LYS F CE    1 
ATOM   9008  N NZ    . LYS H 4 16  ? 80.297  92.265  129.490 1.00 45.28  ? 31  LYS F NZ    1 
ATOM   9009  N N     . PRO H 4 17  ? 85.332  88.618  126.033 1.00 24.36  ? 32  PRO F N     1 
ATOM   9010  C CA    . PRO H 4 17  ? 86.638  88.720  126.722 1.00 25.89  ? 32  PRO F CA    1 
ATOM   9011  C C     . PRO H 4 17  ? 87.809  88.851  125.741 1.00 24.61  ? 32  PRO F C     1 
ATOM   9012  O O     . PRO H 4 17  ? 88.798  89.543  126.042 1.00 25.09  ? 32  PRO F O     1 
ATOM   9013  C CB    . PRO H 4 17  ? 86.735  87.417  127.544 1.00 28.87  ? 32  PRO F CB    1 
ATOM   9014  C CG    . PRO H 4 17  ? 85.264  86.887  127.571 1.00 29.79  ? 32  PRO F CG    1 
ATOM   9015  C CD    . PRO H 4 17  ? 84.710  87.294  126.243 1.00 29.10  ? 32  PRO F CD    1 
ATOM   9016  N N     . ALA H 4 18  ? 87.740  88.191  124.588 1.00 24.03  ? 33  ALA F N     1 
ATOM   9017  C CA    . ALA H 4 18  ? 88.847  88.329  123.646 1.00 22.06  ? 33  ALA F CA    1 
ATOM   9018  C C     . ALA H 4 18  ? 88.914  89.765  123.130 1.00 24.36  ? 33  ALA F C     1 
ATOM   9019  O O     . ALA H 4 18  ? 89.995  90.339  122.970 1.00 22.61  ? 33  ALA F O     1 
ATOM   9020  C CB    . ALA H 4 18  ? 88.705  87.363  122.473 1.00 20.98  ? 33  ALA F CB    1 
ATOM   9021  N N     . ILE H 4 19  ? 87.757  90.354  122.876 1.00 19.42  ? 34  ILE F N     1 
ATOM   9022  C CA    . ILE H 4 19  ? 87.753  91.711  122.386 1.00 22.33  ? 34  ILE F CA    1 
ATOM   9023  C C     . ILE H 4 19  ? 88.250  92.646  123.494 1.00 24.06  ? 34  ILE F C     1 
ATOM   9024  O O     . ILE H 4 19  ? 88.982  93.589  123.221 1.00 21.53  ? 34  ILE F O     1 
ATOM   9025  C CB    . ILE H 4 19  ? 86.337  92.107  121.895 1.00 19.57  ? 34  ILE F CB    1 
ATOM   9026  C CG1   . ILE H 4 19  ? 85.987  91.266  120.636 1.00 22.85  ? 34  ILE F CG1   1 
ATOM   9027  C CG2   . ILE H 4 19  ? 86.272  93.596  121.630 1.00 21.13  ? 34  ILE F CG2   1 
ATOM   9028  C CD1   . ILE H 4 19  ? 84.471  91.400  120.216 1.00 21.80  ? 34  ILE F CD1   1 
ATOM   9029  N N     . ARG H 4 20  ? 87.862  92.377  124.739 1.00 23.20  ? 35  ARG F N     1 
ATOM   9030  C CA    . ARG H 4 20  ? 88.295  93.195  125.861 1.00 21.66  ? 35  ARG F CA    1 
ATOM   9031  C C     . ARG H 4 20  ? 89.831  93.134  125.941 1.00 21.39  ? 35  ARG F C     1 
ATOM   9032  O O     . ARG H 4 20  ? 90.474  94.152  126.123 1.00 23.74  ? 35  ARG F O     1 
ATOM   9033  C CB    . ARG H 4 20  ? 87.718  92.686  127.194 1.00 25.39  ? 35  ARG F CB    1 
ATOM   9034  C CG    . ARG H 4 20  ? 88.177  93.541  128.403 1.00 33.31  ? 35  ARG F CG    1 
ATOM   9035  C CD    . ARG H 4 20  ? 87.724  92.954  129.751 1.00 39.42  ? 35  ARG F CD    1 
ATOM   9036  N NE    . ARG H 4 20  ? 86.333  92.543  129.675 1.00 47.74  ? 35  ARG F NE    1 
ATOM   9037  C CZ    . ARG H 4 20  ? 85.318  93.367  129.441 1.00 57.15  ? 35  ARG F CZ    1 
ATOM   9038  N NH1   . ARG H 4 20  ? 85.521  94.670  129.272 1.00 55.43  ? 35  ARG F NH1   1 
ATOM   9039  N NH2   . ARG H 4 20  ? 84.091  92.876  129.345 1.00 62.35  ? 35  ARG F NH2   1 
ATOM   9040  N N     . ARG H 4 21  ? 90.401  91.944  125.784 1.00 18.03  ? 36  ARG F N     1 
ATOM   9041  C CA    . ARG H 4 21  ? 91.846  91.772  125.847 1.00 20.82  ? 36  ARG F CA    1 
ATOM   9042  C C     . ARG H 4 21  ? 92.535  92.563  124.746 1.00 21.99  ? 36  ARG F C     1 
ATOM   9043  O O     . ARG H 4 21  ? 93.538  93.236  124.990 1.00 23.35  ? 36  ARG F O     1 
ATOM   9044  C CB    . ARG H 4 21  ? 92.232  90.284  125.704 1.00 21.95  ? 36  ARG F CB    1 
ATOM   9045  C CG    . ARG H 4 21  ? 91.920  89.406  126.944 1.00 21.38  ? 36  ARG F CG    1 
ATOM   9046  C CD    . ARG H 4 21  ? 92.554  88.048  126.772 1.00 24.97  ? 36  ARG F CD    1 
ATOM   9047  N NE    . ARG H 4 21  ? 91.938  87.183  125.751 1.00 25.08  ? 36  ARG F NE    1 
ATOM   9048  C CZ    . ARG H 4 21  ? 90.908  86.340  125.991 1.00 30.79  ? 36  ARG F CZ    1 
ATOM   9049  N NH1   . ARG H 4 21  ? 90.374  86.274  127.219 1.00 21.01  ? 36  ARG F NH1   1 
ATOM   9050  N NH2   . ARG H 4 21  ? 90.457  85.523  125.019 1.00 24.54  ? 36  ARG F NH2   1 
ATOM   9051  N N     . LEU H 4 22  ? 92.029  92.448  123.529 1.00 18.65  ? 37  LEU F N     1 
ATOM   9052  C CA    . LEU H 4 22  ? 92.604  93.199  122.420 1.00 19.28  ? 37  LEU F CA    1 
ATOM   9053  C C     . LEU H 4 22  ? 92.536  94.712  122.741 1.00 20.85  ? 37  LEU F C     1 
ATOM   9054  O O     . LEU H 4 22  ? 93.482  95.461  122.452 1.00 17.97  ? 37  LEU F O     1 
ATOM   9055  C CB    . LEU H 4 22  ? 91.821  92.913  121.128 1.00 19.54  ? 37  LEU F CB    1 
ATOM   9056  C CG    . LEU H 4 22  ? 92.036  91.512  120.602 1.00 16.60  ? 37  LEU F CG    1 
ATOM   9057  C CD1   . LEU H 4 22  ? 90.884  91.111  119.651 1.00 17.82  ? 37  LEU F CD1   1 
ATOM   9058  C CD2   . LEU H 4 22  ? 93.409  91.508  119.829 1.00 19.21  ? 37  LEU F CD2   1 
ATOM   9059  N N     . ALA H 4 23  ? 91.420  95.184  123.299 1.00 16.31  ? 38  ALA F N     1 
ATOM   9060  C CA    . ALA H 4 23  ? 91.328  96.612  123.608 1.00 18.26  ? 38  ALA F CA    1 
ATOM   9061  C C     . ALA H 4 23  ? 92.331  96.967  124.734 1.00 20.49  ? 38  ALA F C     1 
ATOM   9062  O O     . ALA H 4 23  ? 92.884  98.079  124.747 1.00 19.35  ? 38  ALA F O     1 
ATOM   9063  C CB    . ALA H 4 23  ? 89.908  97.018  124.024 1.00 20.08  ? 38  ALA F CB    1 
ATOM   9064  N N     . ARG H 4 24  ? 92.562  96.044  125.669 1.00 17.87  ? 39  ARG F N     1 
ATOM   9065  C CA    . ARG H 4 24  ? 93.517  96.341  126.739 1.00 20.58  ? 39  ARG F CA    1 
ATOM   9066  C C     . ARG H 4 24  ? 94.908  96.488  126.122 1.00 21.23  ? 39  ARG F C     1 
ATOM   9067  O O     . ARG H 4 24  ? 95.640  97.402  126.475 1.00 23.67  ? 39  ARG F O     1 
ATOM   9068  C CB    . ARG H 4 24  ? 93.524  95.216  127.787 1.00 19.78  ? 39  ARG F CB    1 
ATOM   9069  C CG    . ARG H 4 24  ? 92.203  95.095  128.561 1.00 15.84  ? 39  ARG F CG    1 
ATOM   9070  C CD    . ARG H 4 24  ? 92.054  96.167  129.620 1.00 20.10  ? 39  ARG F CD    1 
ATOM   9071  N NE    . ARG H 4 24  ? 90.923  95.850  130.493 1.00 21.98  ? 39  ARG F NE    1 
ATOM   9072  C CZ    . ARG H 4 24  ? 89.741  96.422  130.384 1.00 25.84  ? 39  ARG F CZ    1 
ATOM   9073  N NH1   . ARG H 4 24  ? 89.557  97.349  129.449 1.00 20.82  ? 39  ARG F NH1   1 
ATOM   9074  N NH2   . ARG H 4 24  ? 88.736  96.027  131.162 1.00 25.10  ? 39  ARG F NH2   1 
ATOM   9075  N N     . ARG H 4 25  ? 95.299  95.590  125.217 1.00 20.28  ? 40  ARG F N     1 
ATOM   9076  C CA    . ARG H 4 25  ? 96.615  95.748  124.584 1.00 20.27  ? 40  ARG F CA    1 
ATOM   9077  C C     . ARG H 4 25  ? 96.682  97.108  123.863 1.00 21.42  ? 40  ARG F C     1 
ATOM   9078  O O     . ARG H 4 25  ? 97.765  97.729  123.759 1.00 20.84  ? 40  ARG F O     1 
ATOM   9079  C CB    . ARG H 4 25  ? 96.886  94.615  123.604 1.00 21.59  ? 40  ARG F CB    1 
ATOM   9080  C CG    . ARG H 4 25  ? 98.279  94.645  122.944 1.00 17.78  ? 40  ARG F CG    1 
ATOM   9081  C CD    . ARG H 4 25  ? 98.661  93.266  122.401 1.00 21.87  ? 40  ARG F CD    1 
ATOM   9082  N NE    . ARG H 4 25  ? 99.060  92.328  123.470 1.00 21.48  ? 40  ARG F NE    1 
ATOM   9083  C CZ    . ARG H 4 25  ? 99.127  91.005  123.333 1.00 22.73  ? 40  ARG F CZ    1 
ATOM   9084  N NH1   . ARG H 4 25  ? 98.805  90.428  122.189 1.00 17.94  ? 40  ARG F NH1   1 
ATOM   9085  N NH2   . ARG H 4 25  ? 99.581  90.245  124.330 1.00 21.26  ? 40  ARG F NH2   1 
ATOM   9086  N N     . GLY H 4 26  ? 95.524  97.567  123.387 1.00 18.10  ? 41  GLY F N     1 
ATOM   9087  C CA    . GLY H 4 26  ? 95.438  98.857  122.692 1.00 18.19  ? 41  GLY F CA    1 
ATOM   9088  C C     . GLY H 4 26  ? 95.314  100.028 123.646 1.00 17.97  ? 41  GLY F C     1 
ATOM   9089  O O     . GLY H 4 26  ? 95.047  101.163 123.231 1.00 19.13  ? 41  GLY F O     1 
ATOM   9090  N N     . GLY H 4 27  ? 95.472  99.736  124.931 1.00 20.42  ? 42  GLY F N     1 
ATOM   9091  C CA    . GLY H 4 27  ? 95.445  100.760 125.975 1.00 19.71  ? 42  GLY F CA    1 
ATOM   9092  C C     . GLY H 4 27  ? 94.094  101.218 126.460 1.00 23.92  ? 42  GLY F C     1 
ATOM   9093  O O     . GLY H 4 27  ? 94.014  102.256 127.121 1.00 21.94  ? 42  GLY F O     1 
ATOM   9094  N N     . VAL H 4 28  ? 93.035  100.450 126.167 1.00 20.01  ? 43  VAL F N     1 
ATOM   9095  C CA    . VAL H 4 28  ? 91.677  100.863 126.540 1.00 20.56  ? 43  VAL F CA    1 
ATOM   9096  C C     . VAL H 4 28  ? 91.284  100.460 127.928 1.00 17.28  ? 43  VAL F C     1 
ATOM   9097  O O     . VAL H 4 28  ? 91.405  99.326  128.286 1.00 19.74  ? 43  VAL F O     1 
ATOM   9098  C CB    . VAL H 4 28  ? 90.612  100.299 125.543 1.00 23.42  ? 43  VAL F CB    1 
ATOM   9099  C CG1   . VAL H 4 28  ? 89.188  100.620 126.056 1.00 18.30  ? 43  VAL F CG1   1 
ATOM   9100  C CG2   . VAL H 4 28  ? 90.833  100.924 124.142 1.00 16.28  ? 43  VAL F CG2   1 
ATOM   9101  N N     . LYS H 4 29  ? 90.748  101.405 128.678 1.00 20.55  ? 44  LYS F N     1 
ATOM   9102  C CA    . LYS H 4 29  ? 90.359  101.158 130.060 1.00 22.36  ? 44  LYS F CA    1 
ATOM   9103  C C     . LYS H 4 29  ? 88.869  100.881 130.323 1.00 25.83  ? 44  LYS F C     1 
ATOM   9104  O O     . LYS H 4 29  ? 88.528  100.156 131.269 1.00 26.05  ? 44  LYS F O     1 
ATOM   9105  C CB    . LYS H 4 29  ? 90.797  102.352 130.915 1.00 22.94  ? 44  LYS F CB    1 
ATOM   9106  C CG    . LYS H 4 29  ? 90.568  102.169 132.422 1.00 25.22  ? 44  LYS F CG    1 
ATOM   9107  C CD    . LYS H 4 29  ? 90.826  103.479 133.162 1.00 29.00  ? 44  LYS F CD    1 
ATOM   9108  C CE    . LYS H 4 29  ? 90.803  103.309 134.689 1.00 30.45  ? 44  LYS F CE    1 
ATOM   9109  N NZ    . LYS H 4 29  ? 90.832  104.665 135.311 1.00 31.08  ? 44  LYS F NZ    1 
ATOM   9110  N N     . ARG H 4 30  ? 87.980  101.432 129.503 1.00 23.92  ? 45  ARG F N     1 
ATOM   9111  C CA    . ARG H 4 30  ? 86.541  101.242 129.725 1.00 25.36  ? 45  ARG F CA    1 
ATOM   9112  C C     . ARG H 4 30  ? 85.911  101.069 128.369 1.00 27.44  ? 45  ARG F C     1 
ATOM   9113  O O     . ARG H 4 30  ? 86.310  101.743 127.409 1.00 23.62  ? 45  ARG F O     1 
ATOM   9114  C CB    . ARG H 4 30  ? 85.975  102.450 130.456 1.00 29.49  ? 45  ARG F CB    1 
ATOM   9115  C CG    . ARG H 4 30  ? 84.676  102.192 131.176 1.00 31.53  ? 45  ARG F CG    1 
ATOM   9116  C CD    . ARG H 4 30  ? 84.435  103.264 132.240 1.00 31.40  ? 45  ARG F CD    1 
ATOM   9117  N NE    . ARG H 4 30  ? 83.236  102.993 133.021 1.00 32.11  ? 45  ARG F NE    1 
ATOM   9118  C CZ    . ARG H 4 30  ? 81.996  103.257 132.623 1.00 36.99  ? 45  ARG F CZ    1 
ATOM   9119  N NH1   . ARG H 4 30  ? 81.760  103.813 131.432 1.00 26.53  ? 45  ARG F NH1   1 
ATOM   9120  N NH2   . ARG H 4 30  ? 80.979  102.960 133.432 1.00 37.87  ? 45  ARG F NH2   1 
ATOM   9121  N N     . ILE H 4 31  ? 84.921  100.184 128.303 1.00 23.33  ? 46  ILE F N     1 
ATOM   9122  C CA    . ILE H 4 31  ? 84.301  99.771  127.046 1.00 25.82  ? 46  ILE F CA    1 
ATOM   9123  C C     . ILE H 4 31  ? 82.755  99.713  127.086 1.00 28.81  ? 46  ILE F C     1 
ATOM   9124  O O     . ILE H 4 31  ? 82.163  99.026  127.949 1.00 25.83  ? 46  ILE F O     1 
ATOM   9125  C CB    . ILE H 4 31  ? 84.834  98.342  126.714 1.00 23.81  ? 46  ILE F CB    1 
ATOM   9126  C CG1   . ILE H 4 31  ? 86.373  98.361  126.686 1.00 24.41  ? 46  ILE F CG1   1 
ATOM   9127  C CG2   . ILE H 4 31  ? 84.208  97.808  125.448 1.00 21.83  ? 46  ILE F CG2   1 
ATOM   9128  C CD1   . ILE H 4 31  ? 87.015  96.988  126.486 1.00 23.35  ? 46  ILE F CD1   1 
ATOM   9129  N N     . SER H 4 32  ? 82.122  100.441 126.166 1.00 26.80  ? 47  SER F N     1 
ATOM   9130  C CA    . SER H 4 32  ? 80.660  100.449 126.059 1.00 27.17  ? 47  SER F CA    1 
ATOM   9131  C C     . SER H 4 32  ? 80.168  99.062  125.604 1.00 28.51  ? 47  SER F C     1 
ATOM   9132  O O     . SER H 4 32  ? 80.833  98.378  124.806 1.00 25.02  ? 47  SER F O     1 
ATOM   9133  C CB    . SER H 4 32  ? 80.226  101.491 125.015 1.00 28.53  ? 47  SER F CB    1 
ATOM   9134  O OG    . SER H 4 32  ? 79.033  101.067 124.366 1.00 38.64  ? 47  SER F OG    1 
ATOM   9135  N N     . GLY H 4 33  ? 79.003  98.647  126.098 1.00 27.39  ? 48  GLY F N     1 
ATOM   9136  C CA    . GLY H 4 33  ? 78.467  97.351  125.707 1.00 24.05  ? 48  GLY F CA    1 
ATOM   9137  C C     . GLY H 4 33  ? 78.264  97.137  124.208 1.00 23.91  ? 48  GLY F C     1 
ATOM   9138  O O     . GLY H 4 33  ? 78.263  96.001  123.734 1.00 26.41  ? 48  GLY F O     1 
ATOM   9139  N N     . LEU H 4 34  ? 78.104  98.213  123.455 1.00 23.99  ? 49  LEU F N     1 
ATOM   9140  C CA    . LEU H 4 34  ? 77.907  98.094  122.009 1.00 26.64  ? 49  LEU F CA    1 
ATOM   9141  C C     . LEU H 4 34  ? 79.204  97.828  121.212 1.00 28.12  ? 49  LEU F C     1 
ATOM   9142  O O     . LEU H 4 34  ? 79.174  97.485  120.015 1.00 23.30  ? 49  LEU F O     1 
ATOM   9143  C CB    . LEU H 4 34  ? 77.239  99.360  121.486 1.00 28.52  ? 49  LEU F CB    1 
ATOM   9144  C CG    . LEU H 4 34  ? 75.828  99.565  122.077 1.00 36.13  ? 49  LEU F CG    1 
ATOM   9145  C CD1   . LEU H 4 34  ? 75.284  100.899 121.615 1.00 38.76  ? 49  LEU F CD1   1 
ATOM   9146  C CD2   . LEU H 4 34  ? 74.907  98.427  121.633 1.00 37.74  ? 49  LEU F CD2   1 
ATOM   9147  N N     . ILE H 4 35  ? 80.344  97.949  121.885 1.00 25.04  ? 50  ILE F N     1 
ATOM   9148  C CA    . ILE H 4 35  ? 81.614  97.777  121.199 1.00 21.14  ? 50  ILE F CA    1 
ATOM   9149  C C     . ILE H 4 35  ? 81.826  96.373  120.670 1.00 21.54  ? 50  ILE F C     1 
ATOM   9150  O O     . ILE H 4 35  ? 82.393  96.183  119.592 1.00 23.21  ? 50  ILE F O     1 
ATOM   9151  C CB    . ILE H 4 35  ? 82.791  98.166  122.169 1.00 20.63  ? 50  ILE F CB    1 
ATOM   9152  C CG1   . ILE H 4 35  ? 82.870  99.701  122.306 1.00 21.14  ? 50  ILE F CG1   1 
ATOM   9153  C CG2   . ILE H 4 35  ? 84.108  97.580  121.681 1.00 21.34  ? 50  ILE F CG2   1 
ATOM   9154  C CD1   . ILE H 4 35  ? 83.520  100.423 121.120 1.00 20.55  ? 50  ILE F CD1   1 
ATOM   9155  N N     . TYR H 4 36  ? 81.368  95.360  121.405 1.00 21.68  ? 51  TYR F N     1 
ATOM   9156  C CA    . TYR H 4 36  ? 81.645  94.002  120.949 1.00 20.08  ? 51  TYR F CA    1 
ATOM   9157  C C     . TYR H 4 36  ? 81.095  93.680  119.577 1.00 24.09  ? 51  TYR F C     1 
ATOM   9158  O O     . TYR H 4 36  ? 81.820  93.142  118.734 1.00 21.59  ? 51  TYR F O     1 
ATOM   9159  C CB    . TYR H 4 36  ? 81.170  92.984  121.994 1.00 19.04  ? 51  TYR F CB    1 
ATOM   9160  C CG    . TYR H 4 36  ? 81.740  93.372  123.334 1.00 22.66  ? 51  TYR F CG    1 
ATOM   9161  C CD1   . TYR H 4 36  ? 83.107  93.321  123.553 1.00 23.21  ? 51  TYR F CD1   1 
ATOM   9162  C CD2   . TYR H 4 36  ? 80.939  93.920  124.323 1.00 23.41  ? 51  TYR F CD2   1 
ATOM   9163  C CE1   . TYR H 4 36  ? 83.664  93.810  124.731 1.00 28.12  ? 51  TYR F CE1   1 
ATOM   9164  C CE2   . TYR H 4 36  ? 81.486  94.428  125.504 1.00 23.60  ? 51  TYR F CE2   1 
ATOM   9165  C CZ    . TYR H 4 36  ? 82.852  94.359  125.690 1.00 26.49  ? 51  TYR F CZ    1 
ATOM   9166  O OH    . TYR H 4 36  ? 83.424  94.837  126.849 1.00 26.75  ? 51  TYR F OH    1 
ATOM   9167  N N     . GLU H 4 37  ? 79.829  94.006  119.340 1.00 24.37  ? 52  GLU F N     1 
ATOM   9168  C CA    . GLU H 4 37  ? 79.249  93.720  118.032 1.00 24.74  ? 52  GLU F CA    1 
ATOM   9169  C C     . GLU H 4 37  ? 79.892  94.592  116.958 1.00 20.80  ? 52  GLU F C     1 
ATOM   9170  O O     . GLU H 4 37  ? 80.086  94.149  115.842 1.00 23.74  ? 52  GLU F O     1 
ATOM   9171  C CB    . GLU H 4 37  ? 77.728  93.949  118.024 1.00 25.89  ? 52  GLU F CB    1 
ATOM   9172  C CG    . GLU H 4 37  ? 76.948  92.733  118.476 1.00 39.73  ? 52  GLU F CG    1 
ATOM   9173  C CD    . GLU H 4 37  ? 77.278  91.484  117.667 1.00 39.52  ? 52  GLU F CD    1 
ATOM   9174  O OE1   . GLU H 4 37  ? 77.211  91.538  116.414 1.00 50.31  ? 52  GLU F OE1   1 
ATOM   9175  O OE2   . GLU H 4 37  ? 77.601  90.448  118.281 1.00 40.85  ? 52  GLU F OE2   1 
ATOM   9176  N N     . GLU H 4 38  ? 80.187  95.836  117.293 1.00 20.36  ? 53  GLU F N     1 
ATOM   9177  C CA    . GLU H 4 38  ? 80.827  96.731  116.345 1.00 22.31  ? 53  GLU F CA    1 
ATOM   9178  C C     . GLU H 4 38  ? 82.192  96.158  115.933 1.00 21.09  ? 53  GLU F C     1 
ATOM   9179  O O     . GLU H 4 38  ? 82.569  96.173  114.755 1.00 20.15  ? 53  GLU F O     1 
ATOM   9180  C CB    . GLU H 4 38  ? 81.032  98.097  116.994 1.00 23.29  ? 53  GLU F CB    1 
ATOM   9181  C CG    . GLU H 4 38  ? 81.457  99.141  116.024 1.00 24.94  ? 53  GLU F CG    1 
ATOM   9182  C CD    . GLU H 4 38  ? 80.277  99.635  115.230 1.00 34.59  ? 53  GLU F CD    1 
ATOM   9183  O OE1   . GLU H 4 38  ? 79.151  99.188  115.519 1.00 32.61  ? 53  GLU F OE1   1 
ATOM   9184  O OE2   . GLU H 4 38  ? 80.475  100.469 114.340 1.00 34.12  ? 53  GLU F OE2   1 
ATOM   9185  N N     . THR H 4 39  ? 82.928  95.623  116.895 1.00 17.06  ? 54  THR F N     1 
ATOM   9186  C CA    . THR H 4 39  ? 84.248  95.086  116.593 1.00 18.06  ? 54  THR F CA    1 
ATOM   9187  C C     . THR H 4 39  ? 84.159  93.838  115.732 1.00 21.66  ? 54  THR F C     1 
ATOM   9188  O O     . THR H 4 39  ? 84.973  93.623  114.839 1.00 19.15  ? 54  THR F O     1 
ATOM   9189  C CB    . THR H 4 39  ? 85.027  94.755  117.902 1.00 18.48  ? 54  THR F CB    1 
ATOM   9190  O OG1   . THR H 4 39  ? 85.178  95.942  118.694 1.00 19.78  ? 54  THR F OG1   1 
ATOM   9191  C CG2   . THR H 4 39  ? 86.411  94.153  117.569 1.00 16.83  ? 54  THR F CG2   1 
ATOM   9192  N N     . ARG H 4 40  ? 83.165  92.985  115.999 1.00 25.47  ? 55  ARG F N     1 
ATOM   9193  C CA    . ARG H 4 40  ? 83.006  91.797  115.182 1.00 20.30  ? 55  ARG F CA    1 
ATOM   9194  C C     . ARG H 4 40  ? 82.766  92.219  113.731 1.00 20.48  ? 55  ARG F C     1 
ATOM   9195  O O     . ARG H 4 40  ? 83.339  91.628  112.811 1.00 23.73  ? 55  ARG F O     1 
ATOM   9196  C CB    . ARG H 4 40  ? 81.808  90.970  115.695 1.00 23.47  ? 55  ARG F CB    1 
ATOM   9197  C CG    . ARG H 4 40  ? 82.127  90.224  116.990 1.00 22.88  ? 55  ARG F CG    1 
ATOM   9198  C CD    . ARG H 4 40  ? 80.889  89.515  117.606 1.00 30.34  ? 55  ARG F CD    1 
ATOM   9199  N NE    . ARG H 4 40  ? 81.274  89.042  118.922 1.00 27.65  ? 55  ARG F NE    1 
ATOM   9200  C CZ    . ARG H 4 40  ? 80.682  89.396  120.052 1.00 27.12  ? 55  ARG F CZ    1 
ATOM   9201  N NH1   . ARG H 4 40  ? 79.642  90.203  120.038 1.00 22.75  ? 55  ARG F NH1   1 
ATOM   9202  N NH2   . ARG H 4 40  ? 81.209  89.015  121.202 1.00 27.89  ? 55  ARG F NH2   1 
ATOM   9203  N N     . GLY H 4 41  ? 81.906  93.218  113.541 1.00 22.03  ? 56  GLY F N     1 
ATOM   9204  C CA    . GLY H 4 41  ? 81.581  93.688  112.200 1.00 23.77  ? 56  GLY F CA    1 
ATOM   9205  C C     . GLY H 4 41  ? 82.832  94.217  111.503 1.00 26.23  ? 56  GLY F C     1 
ATOM   9206  O O     . GLY H 4 41  ? 83.051  93.973  110.320 1.00 22.34  ? 56  GLY F O     1 
ATOM   9207  N N     . VAL H 4 42  ? 83.656  94.960  112.240 1.00 24.22  ? 57  VAL F N     1 
ATOM   9208  C CA    . VAL H 4 42  ? 84.899  95.481  111.662 1.00 21.69  ? 57  VAL F CA    1 
ATOM   9209  C C     . VAL H 4 42  ? 85.874  94.350  111.363 1.00 19.41  ? 57  VAL F C     1 
ATOM   9210  O O     . VAL H 4 42  ? 86.559  94.373  110.341 1.00 20.79  ? 57  VAL F O     1 
ATOM   9211  C CB    . VAL H 4 42  ? 85.558  96.505  112.630 1.00 25.56  ? 57  VAL F CB    1 
ATOM   9212  C CG1   . VAL H 4 42  ? 86.998  96.819  112.175 1.00 26.25  ? 57  VAL F CG1   1 
ATOM   9213  C CG2   . VAL H 4 42  ? 84.700  97.779  112.664 1.00 22.49  ? 57  VAL F CG2   1 
ATOM   9214  N N     . LEU H 4 43  ? 85.940  93.335  112.225 1.00 21.12  ? 58  LEU F N     1 
ATOM   9215  C CA    . LEU H 4 43  ? 86.870  92.254  111.963 1.00 20.29  ? 58  LEU F CA    1 
ATOM   9216  C C     . LEU H 4 43  ? 86.412  91.450  110.755 1.00 22.21  ? 58  LEU F C     1 
ATOM   9217  O O     . LEU H 4 43  ? 87.220  90.955  109.981 1.00 21.52  ? 58  LEU F O     1 
ATOM   9218  C CB    . LEU H 4 43  ? 87.010  91.327  113.196 1.00 19.85  ? 58  LEU F CB    1 
ATOM   9219  C CG    . LEU H 4 43  ? 87.773  90.026  112.968 1.00 20.64  ? 58  LEU F CG    1 
ATOM   9220  C CD1   . LEU H 4 43  ? 89.242  90.311  112.511 1.00 21.78  ? 58  LEU F CD1   1 
ATOM   9221  C CD2   . LEU H 4 43  ? 87.786  89.180  114.260 1.00 27.88  ? 58  LEU F CD2   1 
ATOM   9222  N N     . LYS H 4 44  ? 85.104  91.301  110.595 1.00 22.72  ? 59  LYS F N     1 
ATOM   9223  C CA    . LYS H 4 44  ? 84.607  90.540  109.460 1.00 22.47  ? 59  LYS F CA    1 
ATOM   9224  C C     . LYS H 4 44  ? 84.974  91.201  108.144 1.00 17.58  ? 59  LYS F C     1 
ATOM   9225  O O     . LYS H 4 44  ? 85.329  90.522  107.206 1.00 21.60  ? 59  LYS F O     1 
ATOM   9226  C CB    . LYS H 4 44  ? 83.076  90.358  109.568 1.00 26.15  ? 59  LYS F CB    1 
ATOM   9227  C CG    . LYS H 4 44  ? 82.443  89.639  108.403 1.00 29.49  ? 59  LYS F CG    1 
ATOM   9228  C CD    . LYS H 4 44  ? 80.935  89.426  108.661 1.00 35.78  ? 59  LYS F CD    1 
ATOM   9229  C CE    . LYS H 4 44  ? 80.169  89.009  107.366 1.00 39.81  ? 59  LYS F CE    1 
ATOM   9230  N NZ    . LYS H 4 44  ? 80.121  90.089  106.301 1.00 35.96  ? 59  LYS F NZ    1 
ATOM   9231  N N     . VAL H 4 45  ? 84.877  92.519  108.075 1.00 21.91  ? 60  VAL F N     1 
ATOM   9232  C CA    . VAL H 4 45  ? 85.230  93.249  106.860 1.00 22.06  ? 60  VAL F CA    1 
ATOM   9233  C C     . VAL H 4 45  ? 86.708  93.091  106.598 1.00 22.59  ? 60  VAL F C     1 
ATOM   9234  O O     . VAL H 4 45  ? 87.131  92.791  105.487 1.00 22.11  ? 60  VAL F O     1 
ATOM   9235  C CB    . VAL H 4 45  ? 84.883  94.746  106.992 1.00 25.59  ? 60  VAL F CB    1 
ATOM   9236  C CG1   . VAL H 4 45  ? 85.510  95.553  105.829 1.00 25.29  ? 60  VAL F CG1   1 
ATOM   9237  C CG2   . VAL H 4 45  ? 83.331  94.923  106.970 1.00 28.38  ? 60  VAL F CG2   1 
ATOM   9238  N N     . PHE H 4 46  ? 87.513  93.256  107.644 1.00 24.00  ? 61  PHE F N     1 
ATOM   9239  C CA    . PHE H 4 46  ? 88.944  93.122  107.479 1.00 19.69  ? 61  PHE F CA    1 
ATOM   9240  C C     . PHE H 4 46  ? 89.270  91.733  106.920 1.00 21.06  ? 61  PHE F C     1 
ATOM   9241  O O     . PHE H 4 46  ? 90.025  91.576  105.951 1.00 19.85  ? 61  PHE F O     1 
ATOM   9242  C CB    . PHE H 4 46  ? 89.636  93.314  108.841 1.00 20.70  ? 61  PHE F CB    1 
ATOM   9243  C CG    . PHE H 4 46  ? 91.126  93.144  108.772 1.00 21.85  ? 61  PHE F CG    1 
ATOM   9244  C CD1   . PHE H 4 46  ? 91.947  94.228  108.440 1.00 22.49  ? 61  PHE F CD1   1 
ATOM   9245  C CD2   . PHE H 4 46  ? 91.693  91.898  108.999 1.00 19.36  ? 61  PHE F CD2   1 
ATOM   9246  C CE1   . PHE H 4 46  ? 93.324  94.066  108.347 1.00 22.62  ? 61  PHE F CE1   1 
ATOM   9247  C CE2   . PHE H 4 46  ? 93.093  91.700  108.907 1.00 23.69  ? 61  PHE F CE2   1 
ATOM   9248  C CZ    . PHE H 4 46  ? 93.917  92.805  108.579 1.00 23.36  ? 61  PHE F CZ    1 
ATOM   9249  N N     . LEU H 4 47  ? 88.737  90.702  107.555 1.00 20.07  ? 62  LEU F N     1 
ATOM   9250  C CA    . LEU H 4 47  ? 88.992  89.351  107.092 1.00 20.68  ? 62  LEU F CA    1 
ATOM   9251  C C     . LEU H 4 47  ? 88.454  89.060  105.695 1.00 18.87  ? 62  LEU F C     1 
ATOM   9252  O O     . LEU H 4 47  ? 89.144  88.448  104.903 1.00 21.03  ? 62  LEU F O     1 
ATOM   9253  C CB    . LEU H 4 47  ? 88.423  88.336  108.090 1.00 22.67  ? 62  LEU F CB    1 
ATOM   9254  C CG    . LEU H 4 47  ? 89.285  88.097  109.332 1.00 26.19  ? 62  LEU F CG    1 
ATOM   9255  C CD1   . LEU H 4 47  ? 88.464  87.195  110.273 1.00 24.37  ? 62  LEU F CD1   1 
ATOM   9256  C CD2   . LEU H 4 47  ? 90.638  87.443  108.969 1.00 17.09  ? 62  LEU F CD2   1 
ATOM   9257  N N     . GLU H 4 48  ? 87.235  89.504  105.384 1.00 22.12  ? 63  GLU F N     1 
ATOM   9258  C CA    . GLU H 4 48  ? 86.689  89.276  104.028 1.00 22.93  ? 63  GLU F CA    1 
ATOM   9259  C C     . GLU H 4 48  ? 87.632  89.868  102.993 1.00 22.23  ? 63  GLU F C     1 
ATOM   9260  O O     . GLU H 4 48  ? 87.948  89.231  102.000 1.00 21.15  ? 63  GLU F O     1 
ATOM   9261  C CB    . GLU H 4 48  ? 85.309  89.954  103.857 1.00 25.95  ? 63  GLU F CB    1 
ATOM   9262  C CG    . GLU H 4 48  ? 84.258  89.306  104.749 1.00 29.92  ? 63  GLU F CG    1 
ATOM   9263  C CD    . GLU H 4 48  ? 82.917  90.026  104.748 1.00 29.57  ? 63  GLU F CD    1 
ATOM   9264  O OE1   . GLU H 4 48  ? 82.894  91.252  104.577 1.00 30.92  ? 63  GLU F OE1   1 
ATOM   9265  O OE2   . GLU H 4 48  ? 81.891  89.345  104.972 1.00 36.01  ? 63  GLU F OE2   1 
ATOM   9266  N N     . ASN H 4 49  ? 88.095  91.094  103.240 1.00 22.24  ? 64  ASN F N     1 
ATOM   9267  C CA    . ASN H 4 49  ? 88.980  91.757  102.275 1.00 21.55  ? 64  ASN F CA    1 
ATOM   9268  C C     . ASN H 4 49  ? 90.299  91.035  102.100 1.00 20.93  ? 64  ASN F C     1 
ATOM   9269  O O     . ASN H 4 49  ? 90.740  90.778  100.978 1.00 20.00  ? 64  ASN F O     1 
ATOM   9270  C CB    . ASN H 4 49  ? 89.228  93.225  102.684 1.00 21.20  ? 64  ASN F CB    1 
ATOM   9271  C CG    . ASN H 4 49  ? 87.967  94.080  102.563 1.00 28.98  ? 64  ASN F CG    1 
ATOM   9272  O OD1   . ASN H 4 49  ? 87.036  93.698  101.861 1.00 36.11  ? 64  ASN F OD1   1 
ATOM   9273  N ND2   . ASN H 4 49  ? 87.932  95.226  103.238 1.00 30.14  ? 64  ASN F ND2   1 
ATOM   9274  N N     . VAL H 4 50  ? 90.957  90.695  103.199 1.00 21.68  ? 65  VAL F N     1 
ATOM   9275  C CA    . VAL H 4 50  ? 92.248  90.009  103.035 1.00 20.67  ? 65  VAL F CA    1 
ATOM   9276  C C     . VAL H 4 50  ? 92.050  88.598  102.444 1.00 18.88  ? 65  VAL F C     1 
ATOM   9277  O O     . VAL H 4 50  ? 92.814  88.168  101.564 1.00 18.32  ? 65  VAL F O     1 
ATOM   9278  C CB    . VAL H 4 50  ? 93.004  89.889  104.401 1.00 19.15  ? 65  VAL F CB    1 
ATOM   9279  C CG1   . VAL H 4 50  ? 94.333  89.173  104.190 1.00 21.50  ? 65  VAL F CG1   1 
ATOM   9280  C CG2   . VAL H 4 50  ? 93.246  91.321  105.000 1.00 25.18  ? 65  VAL F CG2   1 
ATOM   9281  N N     . ILE H 4 51  ? 91.050  87.870  102.945 1.00 20.76  ? 66  ILE F N     1 
ATOM   9282  C CA    . ILE H 4 51  ? 90.809  86.508  102.450 1.00 19.78  ? 66  ILE F CA    1 
ATOM   9283  C C     . ILE H 4 51  ? 90.412  86.520  100.972 1.00 23.33  ? 66  ILE F C     1 
ATOM   9284  O O     . ILE H 4 51  ? 90.867  85.673  100.203 1.00 22.15  ? 66  ILE F O     1 
ATOM   9285  C CB    . ILE H 4 51  ? 89.712  85.772  103.297 1.00 24.40  ? 66  ILE F CB    1 
ATOM   9286  C CG1   . ILE H 4 51  ? 90.288  85.396  104.673 1.00 21.56  ? 66  ILE F CG1   1 
ATOM   9287  C CG2   . ILE H 4 51  ? 89.270  84.465  102.576 1.00 22.22  ? 66  ILE F CG2   1 
ATOM   9288  C CD1   . ILE H 4 51  ? 89.223  85.147  105.775 1.00 20.62  ? 66  ILE F CD1   1 
ATOM   9289  N N     . ARG H 4 52  ? 89.581  87.485  100.562 1.00 21.67  ? 67  ARG F N     1 
ATOM   9290  C CA    . ARG H 4 52  ? 89.223  87.557  99.138  1.00 22.15  ? 67  ARG F CA    1 
ATOM   9291  C C     . ARG H 4 52  ? 90.479  87.604  98.248  1.00 23.61  ? 67  ARG F C     1 
ATOM   9292  O O     . ARG H 4 52  ? 90.616  86.840  97.272  1.00 21.15  ? 67  ARG F O     1 
ATOM   9293  C CB    . ARG H 4 52  ? 88.356  88.807  98.882  1.00 21.46  ? 67  ARG F CB    1 
ATOM   9294  C CG    . ARG H 4 52  ? 87.903  88.978  97.413  1.00 31.67  ? 67  ARG F CG    1 
ATOM   9295  C CD    . ARG H 4 52  ? 87.148  90.312  97.213  1.00 35.94  ? 67  ARG F CD    1 
ATOM   9296  N NE    . ARG H 4 52  ? 86.068  90.452  98.192  1.00 50.44  ? 67  ARG F NE    1 
ATOM   9297  C CZ    . ARG H 4 52  ? 85.987  91.421  99.105  1.00 50.40  ? 67  ARG F CZ    1 
ATOM   9298  N NH1   . ARG H 4 52  ? 86.928  92.363  99.180  1.00 49.86  ? 67  ARG F NH1   1 
ATOM   9299  N NH2   . ARG H 4 52  ? 84.953  91.454  99.939  1.00 51.42  ? 67  ARG F NH2   1 
ATOM   9300  N N     . ASP H 4 53  ? 91.399  88.517  98.560  1.00 24.21  ? 68  ASP F N     1 
ATOM   9301  C CA    . ASP H 4 53  ? 92.625  88.650  97.766  1.00 22.72  ? 68  ASP F CA    1 
ATOM   9302  C C     . ASP H 4 53  ? 93.502  87.418  97.906  1.00 20.21  ? 68  ASP F C     1 
ATOM   9303  O O     . ASP H 4 53  ? 94.086  86.927  96.940  1.00 23.51  ? 68  ASP F O     1 
ATOM   9304  C CB    . ASP H 4 53  ? 93.431  89.868  98.229  1.00 20.69  ? 68  ASP F CB    1 
ATOM   9305  C CG    . ASP H 4 53  ? 92.825  91.177  97.766  1.00 28.53  ? 68  ASP F CG    1 
ATOM   9306  O OD1   . ASP H 4 53  ? 91.758  91.160  97.098  1.00 24.88  ? 68  ASP F OD1   1 
ATOM   9307  O OD2   . ASP H 4 53  ? 93.414  92.226  98.070  1.00 22.76  ? 68  ASP F OD2   1 
ATOM   9308  N N     . ALA H 4 54  ? 93.615  86.907  99.118  1.00 20.99  ? 69  ALA F N     1 
ATOM   9309  C CA    . ALA H 4 54  ? 94.482  85.738  99.296  1.00 22.53  ? 69  ALA F CA    1 
ATOM   9310  C C     . ALA H 4 54  ? 93.970  84.585  98.406  1.00 23.33  ? 69  ALA F C     1 
ATOM   9311  O O     . ALA H 4 54  ? 94.736  83.961  97.676  1.00 23.52  ? 69  ALA F O     1 
ATOM   9312  C CB    . ALA H 4 54  ? 94.496  85.329  100.732 1.00 20.52  ? 69  ALA F CB    1 
ATOM   9313  N N     . VAL H 4 55  ? 92.662  84.336  98.458  1.00 25.19  ? 70  VAL F N     1 
ATOM   9314  C CA    . VAL H 4 55  ? 92.075  83.262  97.649  1.00 24.95  ? 70  VAL F CA    1 
ATOM   9315  C C     . VAL H 4 55  ? 92.204  83.576  96.163  1.00 25.33  ? 70  VAL F C     1 
ATOM   9316  O O     . VAL H 4 55  ? 92.315  82.664  95.334  1.00 30.27  ? 70  VAL F O     1 
ATOM   9317  C CB    . VAL H 4 55  ? 90.587  83.048  98.035  1.00 27.88  ? 70  VAL F CB    1 
ATOM   9318  C CG1   . VAL H 4 55  ? 89.888  82.114  97.029  1.00 25.80  ? 70  VAL F CG1   1 
ATOM   9319  C CG2   . VAL H 4 55  ? 90.534  82.481  99.432  1.00 23.43  ? 70  VAL F CG2   1 
ATOM   9320  N N     . THR H 4 56  ? 92.211  84.851  95.812  1.00 24.38  ? 71  THR F N     1 
ATOM   9321  C CA    . THR H 4 56  ? 92.376  85.199  94.404  1.00 25.80  ? 71  THR F CA    1 
ATOM   9322  C C     . THR H 4 56  ? 93.762  84.756  93.951  1.00 29.58  ? 71  THR F C     1 
ATOM   9323  O O     . THR H 4 56  ? 93.900  84.215  92.832  1.00 26.38  ? 71  THR F O     1 
ATOM   9324  C CB    . THR H 4 56  ? 92.168  86.678  94.174  1.00 24.68  ? 71  THR F CB    1 
ATOM   9325  O OG1   . THR H 4 56  ? 90.817  86.968  94.507  1.00 22.46  ? 71  THR F OG1   1 
ATOM   9326  C CG2   . THR H 4 56  ? 92.375  87.050  92.706  1.00 24.79  ? 71  THR F CG2   1 
ATOM   9327  N N     . TYR H 4 57  ? 94.779  84.942  94.813  1.00 25.15  ? 72  TYR F N     1 
ATOM   9328  C CA    . TYR H 4 57  ? 96.121  84.493  94.480  1.00 23.25  ? 72  TYR F CA    1 
ATOM   9329  C C     . TYR H 4 57  ? 96.110  82.942  94.408  1.00 27.36  ? 72  TYR F C     1 
ATOM   9330  O O     . TYR H 4 57  ? 96.730  82.364  93.520  1.00 25.26  ? 72  TYR F O     1 
ATOM   9331  C CB    . TYR H 4 57  ? 97.167  84.942  95.526  1.00 21.96  ? 72  TYR F CB    1 
ATOM   9332  C CG    . TYR H 4 57  ? 97.585  86.405  95.420  1.00 25.45  ? 72  TYR F CG    1 
ATOM   9333  C CD1   . TYR H 4 57  ? 98.276  86.866  94.304  1.00 23.84  ? 72  TYR F CD1   1 
ATOM   9334  C CD2   . TYR H 4 57  ? 97.268  87.327  96.427  1.00 24.08  ? 72  TYR F CD2   1 
ATOM   9335  C CE1   . TYR H 4 57  ? 98.642  88.173  94.187  1.00 27.33  ? 72  TYR F CE1   1 
ATOM   9336  C CE2   . TYR H 4 57  ? 97.625  88.670  96.311  1.00 24.82  ? 72  TYR F CE2   1 
ATOM   9337  C CZ    . TYR H 4 57  ? 98.316  89.078  95.187  1.00 27.13  ? 72  TYR F CZ    1 
ATOM   9338  O OH    . TYR H 4 57  ? 98.697  90.385  95.036  1.00 30.10  ? 72  TYR F OH    1 
ATOM   9339  N N     . THR H 4 58  ? 95.421  82.291  95.354  1.00 23.80  ? 73  THR F N     1 
ATOM   9340  C CA    . THR H 4 58  ? 95.328  80.813  95.378  1.00 28.27  ? 73  THR F CA    1 
ATOM   9341  C C     . THR H 4 58  ? 94.746  80.269  94.045  1.00 30.90  ? 73  THR F C     1 
ATOM   9342  O O     . THR H 4 58  ? 95.302  79.363  93.418  1.00 28.71  ? 73  THR F O     1 
ATOM   9343  C CB    . THR H 4 58  ? 94.407  80.327  96.549  1.00 29.07  ? 73  THR F CB    1 
ATOM   9344  O OG1   . THR H 4 58  ? 94.896  80.851  97.794  1.00 29.43  ? 73  THR F OG1   1 
ATOM   9345  C CG2   . THR H 4 58  ? 94.395  78.782  96.652  1.00 23.34  ? 73  THR F CG2   1 
ATOM   9346  N N     . GLU H 4 59  ? 93.637  80.844  93.602  1.00 30.49  ? 74  GLU F N     1 
ATOM   9347  C CA    . GLU H 4 59  ? 93.008  80.408  92.354  1.00 31.98  ? 74  GLU F CA    1 
ATOM   9348  C C     . GLU H 4 59  ? 93.894  80.673  91.141  1.00 34.22  ? 74  GLU F C     1 
ATOM   9349  O O     . GLU H 4 59  ? 93.998  79.837  90.244  1.00 31.87  ? 74  GLU F O     1 
ATOM   9350  C CB    . GLU H 4 59  ? 91.673  81.126  92.173  1.00 34.22  ? 74  GLU F CB    1 
ATOM   9351  C CG    . GLU H 4 59  ? 90.615  80.719  93.194  1.00 47.02  ? 74  GLU F CG    1 
ATOM   9352  C CD    . GLU H 4 59  ? 89.344  81.564  93.099  1.00 52.53  ? 74  GLU F CD    1 
ATOM   9353  O OE1   . GLU H 4 59  ? 89.258  82.441  92.214  1.00 59.38  ? 74  GLU F OE1   1 
ATOM   9354  O OE2   . GLU H 4 59  ? 88.427  81.354  93.915  1.00 57.92  ? 74  GLU F OE2   1 
ATOM   9355  N N     . HIS H 4 60  ? 94.538  81.839  91.109  1.00 30.76  ? 75  HIS F N     1 
ATOM   9356  C CA    . HIS H 4 60  ? 95.385  82.168  89.996  1.00 30.10  ? 75  HIS F CA    1 
ATOM   9357  C C     . HIS H 4 60  ? 96.497  81.131  89.829  1.00 34.34  ? 75  HIS F C     1 
ATOM   9358  O O     . HIS H 4 60  ? 96.906  80.811  88.711  1.00 31.25  ? 75  HIS F O     1 
ATOM   9359  C CB    . HIS H 4 60  ? 96.038  83.523  90.186  1.00 31.26  ? 75  HIS F CB    1 
ATOM   9360  C CG    . HIS H 4 60  ? 96.833  83.945  88.999  1.00 32.73  ? 75  HIS F CG    1 
ATOM   9361  N ND1   . HIS H 4 60  ? 96.246  84.457  87.863  1.00 32.25  ? 75  HIS F ND1   1 
ATOM   9362  C CD2   . HIS H 4 60  ? 98.143  83.798  88.714  1.00 32.78  ? 75  HIS F CD2   1 
ATOM   9363  C CE1   . HIS H 4 60  ? 97.164  84.597  86.928  1.00 35.45  ? 75  HIS F CE1   1 
ATOM   9364  N NE2   . HIS H 4 60  ? 98.323  84.204  87.420  1.00 32.28  ? 75  HIS F NE2   1 
ATOM   9365  N N     . ALA H 4 61  ? 97.013  80.640  90.952  1.00 32.73  ? 76  ALA F N     1 
ATOM   9366  C CA    . ALA H 4 61  ? 98.079  79.662  90.893  1.00 36.25  ? 76  ALA F CA    1 
ATOM   9367  C C     . ALA H 4 61  ? 97.486  78.282  90.652  1.00 35.71  ? 76  ALA F C     1 
ATOM   9368  O O     . ALA H 4 61  ? 98.213  77.292  90.627  1.00 37.65  ? 76  ALA F O     1 
ATOM   9369  C CB    . ALA H 4 61  ? 98.852  79.676  92.181  1.00 32.27  ? 76  ALA F CB    1 
ATOM   9370  N N     . LYS H 4 62  ? 96.166  78.225  90.512  1.00 36.15  ? 77  LYS F N     1 
ATOM   9371  C CA    . LYS H 4 62  ? 95.455  76.964  90.297  1.00 36.89  ? 77  LYS F CA    1 
ATOM   9372  C C     . LYS H 4 62  ? 95.654  75.973  91.440  1.00 37.37  ? 77  LYS F C     1 
ATOM   9373  O O     . LYS H 4 62  ? 95.777  74.769  91.216  1.00 36.06  ? 77  LYS F O     1 
ATOM   9374  C CB    . LYS H 4 62  ? 95.893  76.310  88.981  1.00 38.19  ? 77  LYS F CB    1 
ATOM   9375  C CG    . LYS H 4 62  ? 95.285  76.943  87.754  1.00 42.61  ? 77  LYS F CG    1 
ATOM   9376  C CD    . LYS H 4 62  ? 95.943  76.408  86.495  1.00 48.98  ? 77  LYS F CD    1 
ATOM   9377  C CE    . LYS H 4 62  ? 95.561  77.225  85.273  1.00 53.62  ? 77  LYS F CE    1 
ATOM   9378  N NZ    . LYS H 4 62  ? 96.624  77.084  84.220  1.00 57.91  ? 77  LYS F NZ    1 
ATOM   9379  N N     . ARG H 4 63  ? 95.688  76.474  92.668  1.00 33.95  ? 78  ARG F N     1 
ATOM   9380  C CA    . ARG H 4 63  ? 95.854  75.603  93.821  1.00 30.45  ? 78  ARG F CA    1 
ATOM   9381  C C     . ARG H 4 63  ? 94.517  75.549  94.517  1.00 29.45  ? 78  ARG F C     1 
ATOM   9382  O O     . ARG H 4 63  ? 93.641  76.339  94.222  1.00 28.26  ? 78  ARG F O     1 
ATOM   9383  C CB    . ARG H 4 63  ? 96.922  76.163  94.780  1.00 28.99  ? 78  ARG F CB    1 
ATOM   9384  C CG    . ARG H 4 63  ? 98.359  75.867  94.349  1.00 29.79  ? 78  ARG F CG    1 
ATOM   9385  C CD    . ARG H 4 63  ? 99.430  76.419  95.334  1.00 32.47  ? 78  ARG F CD    1 
ATOM   9386  N NE    . ARG H 4 63  ? 99.796  77.830  95.139  1.00 31.23  ? 78  ARG F NE    1 
ATOM   9387  C CZ    . ARG H 4 63  ? 99.271  78.850  95.831  1.00 28.08  ? 78  ARG F CZ    1 
ATOM   9388  N NH1   . ARG H 4 63  ? 98.341  78.631  96.763  1.00 23.22  ? 78  ARG F NH1   1 
ATOM   9389  N NH2   . ARG H 4 63  ? 99.710  80.098  95.621  1.00 27.71  ? 78  ARG F NH2   1 
ATOM   9390  N N     . LYS H 4 64  ? 94.353  74.616  95.441  1.00 28.62  ? 79  LYS F N     1 
ATOM   9391  C CA    . LYS H 4 64  ? 93.124  74.523  96.197  1.00 33.31  ? 79  LYS F CA    1 
ATOM   9392  C C     . LYS H 4 64  ? 93.457  74.856  97.656  1.00 31.27  ? 79  LYS F C     1 
ATOM   9393  O O     . LYS H 4 64  ? 92.585  74.935  98.499  1.00 33.50  ? 79  LYS F O     1 
ATOM   9394  C CB    . LYS H 4 64  ? 92.560  73.101  96.104  1.00 39.33  ? 79  LYS F CB    1 
ATOM   9395  C CG    . LYS H 4 64  ? 91.976  72.753  94.737  1.00 47.15  ? 79  LYS F CG    1 
ATOM   9396  C CD    . LYS H 4 64  ? 91.785  71.250  94.637  1.00 57.31  ? 79  LYS F CD    1 
ATOM   9397  C CE    . LYS H 4 64  ? 90.845  70.853  93.509  1.00 61.00  ? 79  LYS F CE    1 
ATOM   9398  N NZ    . LYS H 4 64  ? 90.342  69.457  93.740  1.00 63.23  ? 79  LYS F NZ    1 
ATOM   9399  N N     . THR H 4 65  ? 94.739  75.020  97.936  1.00 28.71  ? 80  THR F N     1 
ATOM   9400  C CA    . THR H 4 65  ? 95.223  75.318  99.281  1.00 30.54  ? 80  THR F CA    1 
ATOM   9401  C C     . THR H 4 65  ? 95.693  76.781  99.417  1.00 28.41  ? 80  THR F C     1 
ATOM   9402  O O     . THR H 4 65  ? 96.528  77.238  98.659  1.00 27.52  ? 80  THR F O     1 
ATOM   9403  C CB    . THR H 4 65  ? 96.393  74.361  99.614  1.00 33.18  ? 80  THR F CB    1 
ATOM   9404  O OG1   . THR H 4 65  ? 95.954  73.013  99.391  1.00 37.09  ? 80  THR F OG1   1 
ATOM   9405  C CG2   . THR H 4 65  ? 96.842  74.512  101.082 1.00 35.18  ? 80  THR F CG2   1 
ATOM   9406  N N     . VAL H 4 66  ? 95.123  77.519  100.354 1.00 29.58  ? 81  VAL F N     1 
ATOM   9407  C CA    . VAL H 4 66  ? 95.526  78.911  100.564 1.00 25.82  ? 81  VAL F CA    1 
ATOM   9408  C C     . VAL H 4 66  ? 96.846  78.820  101.341 1.00 27.38  ? 81  VAL F C     1 
ATOM   9409  O O     . VAL H 4 66  ? 96.890  78.193  102.411 1.00 25.50  ? 81  VAL F O     1 
ATOM   9410  C CB    . VAL H 4 66  ? 94.499  79.653  101.402 1.00 24.45  ? 81  VAL F CB    1 
ATOM   9411  C CG1   . VAL H 4 66  ? 94.936  81.156  101.542 1.00 24.41  ? 81  VAL F CG1   1 
ATOM   9412  C CG2   . VAL H 4 66  ? 93.090  79.586  100.710 1.00 26.18  ? 81  VAL F CG2   1 
ATOM   9413  N N     . THR H 4 67  ? 97.908  79.399  100.796 1.00 23.30  ? 82  THR F N     1 
ATOM   9414  C CA    . THR H 4 67  ? 99.215  79.332  101.457 1.00 26.12  ? 82  THR F CA    1 
ATOM   9415  C C     . THR H 4 67  ? 99.491  80.549  102.341 1.00 25.92  ? 82  THR F C     1 
ATOM   9416  O O     . THR H 4 67  ? 98.790  81.557  102.251 1.00 21.75  ? 82  THR F O     1 
ATOM   9417  C CB    . THR H 4 67  ? 100.385 79.224  100.413 1.00 26.98  ? 82  THR F CB    1 
ATOM   9418  O OG1   . THR H 4 67  ? 100.320 80.318  99.487  1.00 27.76  ? 82  THR F OG1   1 
ATOM   9419  C CG2   . THR H 4 67  ? 100.319 77.920  99.634  1.00 27.64  ? 82  THR F CG2   1 
ATOM   9420  N N     . ALA H 4 68  ? 100.502 80.446  103.210 1.00 24.45  ? 83  ALA F N     1 
ATOM   9421  C CA    . ALA H 4 68  ? 100.879 81.583  104.040 1.00 23.11  ? 83  ALA F CA    1 
ATOM   9422  C C     . ALA H 4 68  ? 101.287 82.704  103.064 1.00 21.12  ? 83  ALA F C     1 
ATOM   9423  O O     . ALA H 4 68  ? 100.971 83.870  103.286 1.00 23.48  ? 83  ALA F O     1 
ATOM   9424  C CB    . ALA H 4 68  ? 102.050 81.213  104.969 1.00 20.75  ? 83  ALA F CB    1 
ATOM   9425  N N     . MET H 4 69  ? 101.955 82.350  101.971 1.00 21.86  ? 84  MET F N     1 
ATOM   9426  C CA    . MET H 4 69  ? 102.371 83.360  100.992 1.00 22.12  ? 84  MET F CA    1 
ATOM   9427  C C     . MET H 4 69  ? 101.153 84.023  100.317 1.00 23.50  ? 84  MET F C     1 
ATOM   9428  O O     . MET H 4 69  ? 101.183 85.225  100.031 1.00 22.99  ? 84  MET F O     1 
ATOM   9429  C CB    . MET H 4 69  ? 103.302 82.768  99.917  1.00 21.05  ? 84  MET F CB    1 
ATOM   9430  C CG    . MET H 4 69  ? 104.755 82.504  100.420 1.00 36.83  ? 84  MET F CG    1 
ATOM   9431  S SD    . MET H 4 69  ? 105.448 83.874  101.453 1.00 41.42  ? 84  MET F SD    1 
ATOM   9432  C CE    . MET H 4 69  ? 105.406 85.275  100.308 1.00 36.34  ? 84  MET F CE    1 
ATOM   9433  N N     . ASP H 4 70  ? 100.088 83.269  100.032 1.00 22.69  ? 85  ASP F N     1 
ATOM   9434  C CA    . ASP H 4 70  ? 98.898  83.938  99.448  1.00 21.86  ? 85  ASP F CA    1 
ATOM   9435  C C     . ASP H 4 70  ? 98.423  85.021  100.441 1.00 19.63  ? 85  ASP F C     1 
ATOM   9436  O O     . ASP H 4 70  ? 97.998  86.095  100.054 1.00 21.01  ? 85  ASP F O     1 
ATOM   9437  C CB    . ASP H 4 70  ? 97.724  82.950  99.221  1.00 23.63  ? 85  ASP F CB    1 
ATOM   9438  C CG    . ASP H 4 70  ? 98.030  81.890  98.170  1.00 26.36  ? 85  ASP F CG    1 
ATOM   9439  O OD1   . ASP H 4 70  ? 98.827  82.195  97.263  1.00 24.03  ? 85  ASP F OD1   1 
ATOM   9440  O OD2   . ASP H 4 70  ? 97.443  80.767  98.237  1.00 27.71  ? 85  ASP F OD2   1 
ATOM   9441  N N     . VAL H 4 71  ? 98.470  84.729  101.733 1.00 16.91  ? 86  VAL F N     1 
ATOM   9442  C CA    . VAL H 4 71  ? 98.013  85.720  102.749 1.00 17.00  ? 86  VAL F CA    1 
ATOM   9443  C C     . VAL H 4 71  ? 98.995  86.922  102.852 1.00 17.83  ? 86  VAL F C     1 
ATOM   9444  O O     . VAL H 4 71  ? 98.578  88.076  102.913 1.00 20.64  ? 86  VAL F O     1 
ATOM   9445  C CB    . VAL H 4 71  ? 97.856  85.049  104.109 1.00 18.37  ? 86  VAL F CB    1 
ATOM   9446  C CG1   . VAL H 4 71  ? 97.655  86.118  105.232 1.00 17.83  ? 86  VAL F CG1   1 
ATOM   9447  C CG2   . VAL H 4 71  ? 96.621  84.073  104.060 1.00 20.06  ? 86  VAL F CG2   1 
ATOM   9448  N N     . VAL H 4 72  ? 100.290 86.622  102.889 1.00 21.26  ? 87  VAL F N     1 
ATOM   9449  C CA    . VAL H 4 72  ? 101.337 87.650  102.948 1.00 19.58  ? 87  VAL F CA    1 
ATOM   9450  C C     . VAL H 4 72  ? 101.198 88.589  101.766 1.00 18.76  ? 87  VAL F C     1 
ATOM   9451  O O     . VAL H 4 72  ? 101.215 89.806  101.932 1.00 18.87  ? 87  VAL F O     1 
ATOM   9452  C CB    . VAL H 4 72  ? 102.763 86.965  102.969 1.00 20.69  ? 87  VAL F CB    1 
ATOM   9453  C CG1   . VAL H 4 72  ? 103.901 88.026  102.786 1.00 22.83  ? 87  VAL F CG1   1 
ATOM   9454  C CG2   . VAL H 4 72  ? 102.929 86.275  104.306 1.00 19.99  ? 87  VAL F CG2   1 
ATOM   9455  N N     . TYR H 4 73  ? 101.023 88.044  100.563 1.00 21.96  ? 88  TYR F N     1 
ATOM   9456  C CA    . TYR H 4 73  ? 100.865 88.888  99.387  1.00 21.87  ? 88  TYR F CA    1 
ATOM   9457  C C     . TYR H 4 73  ? 99.588  89.685  99.471  1.00 21.81  ? 88  TYR F C     1 
ATOM   9458  O O     . TYR H 4 73  ? 99.562  90.862  99.103  1.00 22.94  ? 88  TYR F O     1 
ATOM   9459  C CB    . TYR H 4 73  ? 100.860 88.048  98.101  1.00 26.17  ? 88  TYR F CB    1 
ATOM   9460  C CG    . TYR H 4 73  ? 102.155 87.311  97.859  1.00 29.38  ? 88  TYR F CG    1 
ATOM   9461  C CD1   . TYR H 4 73  ? 103.375 87.897  98.169  1.00 35.18  ? 88  TYR F CD1   1 
ATOM   9462  C CD2   . TYR H 4 73  ? 102.156 86.049  97.283  1.00 34.89  ? 88  TYR F CD2   1 
ATOM   9463  C CE1   . TYR H 4 73  ? 104.566 87.245  97.905  1.00 39.56  ? 88  TYR F CE1   1 
ATOM   9464  C CE2   . TYR H 4 73  ? 103.336 85.382  97.012  1.00 35.49  ? 88  TYR F CE2   1 
ATOM   9465  C CZ    . TYR H 4 73  ? 104.532 85.982  97.317  1.00 38.82  ? 88  TYR F CZ    1 
ATOM   9466  O OH    . TYR H 4 73  ? 105.696 85.336  97.012  1.00 42.43  ? 88  TYR F OH    1 
ATOM   9467  N N     . ALA H 4 74  ? 98.522  89.065  99.958  1.00 21.08  ? 89  ALA F N     1 
ATOM   9468  C CA    . ALA H 4 74  ? 97.242  89.790  100.085 1.00 19.96  ? 89  ALA F CA    1 
ATOM   9469  C C     . ALA H 4 74  ? 97.424  90.932  101.099 1.00 22.38  ? 89  ALA F C     1 
ATOM   9470  O O     . ALA H 4 74  ? 96.997  92.078  100.869 1.00 21.15  ? 89  ALA F O     1 
ATOM   9471  C CB    . ALA H 4 74  ? 96.135  88.835  100.558 1.00 19.33  ? 89  ALA F CB    1 
ATOM   9472  N N     . LEU H 4 75  ? 98.069  90.629  102.221 1.00 18.52  ? 90  LEU F N     1 
ATOM   9473  C CA    . LEU H 4 75  ? 98.286  91.685  103.216 1.00 22.75  ? 90  LEU F CA    1 
ATOM   9474  C C     . LEU H 4 75  ? 99.142  92.820  102.651 1.00 22.14  ? 90  LEU F C     1 
ATOM   9475  O O     . LEU H 4 75  ? 98.851  94.001  102.871 1.00 22.67  ? 90  LEU F O     1 
ATOM   9476  C CB    . LEU H 4 75  ? 98.960  91.099  104.449 1.00 21.86  ? 90  LEU F CB    1 
ATOM   9477  C CG    . LEU H 4 75  ? 98.053  90.224  105.321 1.00 22.49  ? 90  LEU F CG    1 
ATOM   9478  C CD1   . LEU H 4 75  ? 98.942  89.452  106.307 1.00 19.03  ? 90  LEU F CD1   1 
ATOM   9479  C CD2   . LEU H 4 75  ? 97.033  91.151  106.077 1.00 20.43  ? 90  LEU F CD2   1 
ATOM   9480  N N     . LYS H 4 76  ? 100.197 92.460  101.927 1.00 22.22  ? 91  LYS F N     1 
ATOM   9481  C CA    . LYS H 4 76  ? 101.068 93.466  101.348 1.00 24.29  ? 91  LYS F CA    1 
ATOM   9482  C C     . LYS H 4 76  ? 100.273 94.378  100.410 1.00 26.32  ? 91  LYS F C     1 
ATOM   9483  O O     . LYS H 4 76  ? 100.411 95.594  100.496 1.00 26.57  ? 91  LYS F O     1 
ATOM   9484  C CB    . LYS H 4 76  ? 102.254 92.829  100.572 1.00 27.65  ? 91  LYS F CB    1 
ATOM   9485  C CG    . LYS H 4 76  ? 103.247 93.911  100.130 1.00 28.50  ? 91  LYS F CG    1 
ATOM   9486  C CD    . LYS H 4 76  ? 104.381 93.378  99.290  1.00 42.55  ? 91  LYS F CD    1 
ATOM   9487  C CE    . LYS H 4 76  ? 105.272 92.394  100.040 1.00 46.29  ? 91  LYS F CE    1 
ATOM   9488  N NZ    . LYS H 4 76  ? 106.402 91.873  99.180  1.00 44.82  ? 91  LYS F NZ    1 
ATOM   9489  N N     . ARG H 4 77  ? 99.440  93.792  99.537  1.00 24.75  ? 92  ARG F N     1 
ATOM   9490  C CA    . ARG H 4 77  ? 98.604  94.540  98.566  1.00 28.11  ? 92  ARG F CA    1 
ATOM   9491  C C     . ARG H 4 77  ? 97.740  95.557  99.271  1.00 26.72  ? 92  ARG F C     1 
ATOM   9492  O O     . ARG H 4 77  ? 97.403  96.569  98.731  1.00 27.78  ? 92  ARG F O     1 
ATOM   9493  C CB    . ARG H 4 77  ? 97.535  93.676  97.869  1.00 31.91  ? 92  ARG F CB    1 
ATOM   9494  C CG    . ARG H 4 77  ? 97.880  92.718  96.842  1.00 40.30  ? 92  ARG F CG    1 
ATOM   9495  C CD    . ARG H 4 77  ? 96.567  92.458  96.045  1.00 31.27  ? 92  ARG F CD    1 
ATOM   9496  N NE    . ARG H 4 77  ? 96.242  93.650  95.270  1.00 26.59  ? 92  ARG F NE    1 
ATOM   9497  C CZ    . ARG H 4 77  ? 95.194  94.453  95.460  1.00 29.97  ? 92  ARG F CZ    1 
ATOM   9498  N NH1   . ARG H 4 77  ? 94.280  94.242  96.406  1.00 25.42  ? 92  ARG F NH1   1 
ATOM   9499  N NH2   . ARG H 4 77  ? 95.089  95.532  94.710  1.00 35.49  ? 92  ARG F NH2   1 
ATOM   9500  N N     . GLN H 4 78  ? 97.264  95.184  100.437 1.00 28.32  ? 93  GLN F N     1 
ATOM   9501  C CA    . GLN H 4 78  ? 96.440  96.047  101.229 1.00 28.52  ? 93  GLN F CA    1 
ATOM   9502  C C     . GLN H 4 78  ? 97.209  97.017  102.109 1.00 28.45  ? 93  GLN F C     1 
ATOM   9503  O O     . GLN H 4 78  ? 96.615  97.693  102.901 1.00 26.72  ? 93  GLN F O     1 
ATOM   9504  C CB    . GLN H 4 78  ? 95.526  95.192  102.085 1.00 30.74  ? 93  GLN F CB    1 
ATOM   9505  C CG    . GLN H 4 78  ? 94.311  94.784  101.278 1.00 45.46  ? 93  GLN F CG    1 
ATOM   9506  C CD    . GLN H 4 78  ? 93.727  93.482  101.699 1.00 47.26  ? 93  GLN F CD    1 
ATOM   9507  O OE1   . GLN H 4 78  ? 93.284  93.325  102.841 1.00 48.58  ? 93  GLN F OE1   1 
ATOM   9508  N NE2   . GLN H 4 78  ? 93.711  92.520  100.775 1.00 47.19  ? 93  GLN F NE2   1 
ATOM   9509  N N     . GLY H 4 79  ? 98.525  97.082  101.983 1.00 29.56  ? 94  GLY F N     1 
ATOM   9510  C CA    . GLY H 4 79  ? 99.255  98.031  102.820 1.00 27.97  ? 94  GLY F CA    1 
ATOM   9511  C C     . GLY H 4 79  ? 99.345  97.608  104.285 1.00 29.08  ? 94  GLY F C     1 
ATOM   9512  O O     . GLY H 4 79  ? 99.417  98.460  105.176 1.00 27.50  ? 94  GLY F O     1 
ATOM   9513  N N     . ARG H 4 80  ? 99.328  96.294  104.527 1.00 25.58  ? 95  ARG F N     1 
ATOM   9514  C CA    . ARG H 4 80  ? 99.418  95.717  105.882 1.00 27.21  ? 95  ARG F CA    1 
ATOM   9515  C C     . ARG H 4 80  ? 100.564 94.671  105.889 1.00 25.40  ? 95  ARG F C     1 
ATOM   9516  O O     . ARG H 4 80  ? 100.417 93.570  106.484 1.00 23.83  ? 95  ARG F O     1 
ATOM   9517  C CB    . ARG H 4 80  ? 98.126  94.977  106.276 1.00 28.23  ? 95  ARG F CB    1 
ATOM   9518  C CG    . ARG H 4 80  ? 96.794  95.712  106.176 1.00 34.64  ? 95  ARG F CG    1 
ATOM   9519  C CD    . ARG H 4 80  ? 96.583  96.716  107.244 1.00 39.23  ? 95  ARG F CD    1 
ATOM   9520  N NE    . ARG H 4 80  ? 97.069  96.265  108.547 1.00 46.13  ? 95  ARG F NE    1 
ATOM   9521  C CZ    . ARG H 4 80  ? 97.057  97.020  109.640 1.00 41.37  ? 95  ARG F CZ    1 
ATOM   9522  N NH1   . ARG H 4 80  ? 96.570  98.257  109.568 1.00 40.72  ? 95  ARG F NH1   1 
ATOM   9523  N NH2   . ARG H 4 80  ? 97.537  96.544  110.788 1.00 36.34  ? 95  ARG F NH2   1 
ATOM   9524  N N     . THR H 4 81  ? 101.681 95.008  105.239 1.00 21.38  ? 96  THR F N     1 
ATOM   9525  C CA    . THR H 4 81  ? 102.836 94.103  105.161 1.00 22.14  ? 96  THR F CA    1 
ATOM   9526  C C     . THR H 4 81  ? 103.078 93.375  106.482 1.00 19.37  ? 96  THR F C     1 
ATOM   9527  O O     . THR H 4 81  ? 103.079 93.984  107.539 1.00 20.90  ? 96  THR F O     1 
ATOM   9528  C CB    . THR H 4 81  ? 104.102 94.855  104.776 1.00 23.14  ? 96  THR F CB    1 
ATOM   9529  O OG1   . THR H 4 81  ? 103.932 95.443  103.486 1.00 23.52  ? 96  THR F OG1   1 
ATOM   9530  C CG2   . THR H 4 81  ? 105.302 93.870  104.707 1.00 23.28  ? 96  THR F CG2   1 
ATOM   9531  N N     . LEU H 4 82  ? 103.241 92.067  106.401 1.00 18.24  ? 97  LEU F N     1 
ATOM   9532  C CA    . LEU H 4 82  ? 103.427 91.237  107.577 1.00 20.89  ? 97  LEU F CA    1 
ATOM   9533  C C     . LEU H 4 82  ? 104.776 90.525  107.459 1.00 20.05  ? 97  LEU F C     1 
ATOM   9534  O O     . LEU H 4 82  ? 105.096 89.966  106.406 1.00 21.66  ? 97  LEU F O     1 
ATOM   9535  C CB    . LEU H 4 82  ? 102.287 90.171  107.659 1.00 20.69  ? 97  LEU F CB    1 
ATOM   9536  C CG    . LEU H 4 82  ? 102.463 89.152  108.799 1.00 23.40  ? 97  LEU F CG    1 
ATOM   9537  C CD1   . LEU H 4 82  ? 102.321 89.924  110.117 1.00 21.59  ? 97  LEU F CD1   1 
ATOM   9538  C CD2   . LEU H 4 82  ? 101.441 88.004  108.754 1.00 24.72  ? 97  LEU F CD2   1 
ATOM   9539  N N     . TYR H 4 83  ? 105.584 90.589  108.515 1.00 20.22  ? 98  TYR F N     1 
ATOM   9540  C CA    . TYR H 4 83  ? 106.865 89.891  108.512 1.00 19.90  ? 98  TYR F CA    1 
ATOM   9541  C C     . TYR H 4 83  ? 106.714 88.648  109.386 1.00 20.41  ? 98  TYR F C     1 
ATOM   9542  O O     . TYR H 4 83  ? 106.012 88.674  110.383 1.00 17.43  ? 98  TYR F O     1 
ATOM   9543  C CB    . TYR H 4 83  ? 107.959 90.729  109.202 1.00 19.34  ? 98  TYR F CB    1 
ATOM   9544  C CG    . TYR H 4 83  ? 108.516 91.900  108.447 1.00 20.61  ? 98  TYR F CG    1 
ATOM   9545  C CD1   . TYR H 4 83  ? 108.113 92.204  107.154 1.00 20.15  ? 98  TYR F CD1   1 
ATOM   9546  C CD2   . TYR H 4 83  ? 109.503 92.697  109.043 1.00 20.16  ? 98  TYR F CD2   1 
ATOM   9547  C CE1   . TYR H 4 83  ? 108.688 93.294  106.461 1.00 25.36  ? 98  TYR F CE1   1 
ATOM   9548  C CE2   . TYR H 4 83  ? 110.069 93.752  108.389 1.00 24.53  ? 98  TYR F CE2   1 
ATOM   9549  C CZ    . TYR H 4 83  ? 109.670 94.062  107.106 1.00 26.55  ? 98  TYR F CZ    1 
ATOM   9550  O OH    . TYR H 4 83  ? 110.247 95.153  106.499 1.00 26.51  ? 98  TYR F OH    1 
ATOM   9551  N N     . GLY H 4 84  ? 107.449 87.601  109.054 1.00 22.35  ? 99  GLY F N     1 
ATOM   9552  C CA    . GLY H 4 84  ? 107.442 86.421  109.888 1.00 23.02  ? 99  GLY F CA    1 
ATOM   9553  C C     . GLY H 4 84  ? 106.865 85.191  109.246 1.00 24.88  ? 99  GLY F C     1 
ATOM   9554  O O     . GLY H 4 84  ? 106.961 84.135  109.811 1.00 26.11  ? 99  GLY F O     1 
ATOM   9555  N N     . PHE H 4 85  ? 106.264 85.309  108.075 1.00 25.93  ? 100 PHE F N     1 
ATOM   9556  C CA    . PHE H 4 85  ? 105.678 84.130  107.477 1.00 27.22  ? 100 PHE F CA    1 
ATOM   9557  C C     . PHE H 4 85  ? 106.149 83.819  106.075 1.00 27.56  ? 100 PHE F C     1 
ATOM   9558  O O     . PHE H 4 85  ? 105.435 83.143  105.324 1.00 33.00  ? 100 PHE F O     1 
ATOM   9559  C CB    . PHE H 4 85  ? 104.154 84.238  107.504 1.00 23.57  ? 100 PHE F CB    1 
ATOM   9560  C CG    . PHE H 4 85  ? 103.568 84.181  108.890 1.00 22.49  ? 100 PHE F CG    1 
ATOM   9561  C CD1   . PHE H 4 85  ? 103.494 85.320  109.674 1.00 17.27  ? 100 PHE F CD1   1 
ATOM   9562  C CD2   . PHE H 4 85  ? 103.135 82.957  109.428 1.00 23.06  ? 100 PHE F CD2   1 
ATOM   9563  C CE1   . PHE H 4 85  ? 103.006 85.257  110.973 1.00 22.27  ? 100 PHE F CE1   1 
ATOM   9564  C CE2   . PHE H 4 85  ? 102.644 82.874  110.734 1.00 23.46  ? 100 PHE F CE2   1 
ATOM   9565  C CZ    . PHE H 4 85  ? 102.579 84.024  111.510 1.00 26.06  ? 100 PHE F CZ    1 
ATOM   9566  N N     . GLY H 4 86  ? 107.343 84.294  105.738 1.00 27.19  ? 101 GLY F N     1 
ATOM   9567  C CA    . GLY H 4 86  ? 107.917 84.054  104.424 1.00 30.01  ? 101 GLY F CA    1 
ATOM   9568  C C     . GLY H 4 86  ? 107.799 85.315  103.602 1.00 36.38  ? 101 GLY F C     1 
ATOM   9569  O O     . GLY H 4 86  ? 108.301 85.410  102.472 1.00 39.59  ? 101 GLY F O     1 
ATOM   9570  N N     . GLY H 4 87  ? 107.139 86.306  104.188 1.00 36.23  ? 102 GLY F N     1 
ATOM   9571  C CA    . GLY H 4 87  ? 106.950 87.554  103.496 1.00 45.12  ? 102 GLY F CA    1 
ATOM   9572  C C     . GLY H 4 87  ? 107.760 88.641  104.135 1.00 45.29  ? 102 GLY F C     1 
ATOM   9573  O O     . GLY H 4 87  ? 108.983 88.537  104.055 1.00 51.12  ? 102 GLY F O     1 
ATOM   9574  O OXT   . GLY H 4 87  ? 107.176 89.574  104.713 1.00 49.86  ? 102 GLY F OXT   1 
ATOM   9575  N N     . ALA I 5 1   ? 97.055  95.136  55.749  1.00 74.08  ? 14  ALA G N     1 
ATOM   9576  C CA    . ALA I 5 1   ? 97.247  94.821  57.198  1.00 73.13  ? 14  ALA G CA    1 
ATOM   9577  C C     . ALA I 5 1   ? 96.195  95.516  58.052  1.00 72.08  ? 14  ALA G C     1 
ATOM   9578  O O     . ALA I 5 1   ? 95.896  96.693  57.850  1.00 71.12  ? 14  ALA G O     1 
ATOM   9579  C CB    . ALA I 5 1   ? 98.637  95.251  57.648  1.00 72.79  ? 14  ALA G CB    1 
ATOM   9580  N N     . LYS I 5 2   ? 95.637  94.779  59.004  1.00 71.59  ? 15  LYS G N     1 
ATOM   9581  C CA    . LYS I 5 2   ? 94.626  95.325  59.902  1.00 70.12  ? 15  LYS G CA    1 
ATOM   9582  C C     . LYS I 5 2   ? 95.263  95.525  61.278  1.00 66.90  ? 15  LYS G C     1 
ATOM   9583  O O     . LYS I 5 2   ? 95.954  94.636  61.782  1.00 67.84  ? 15  LYS G O     1 
ATOM   9584  C CB    . LYS I 5 2   ? 93.446  94.355  60.009  1.00 73.42  ? 15  LYS G CB    1 
ATOM   9585  C CG    . LYS I 5 2   ? 92.163  94.979  60.538  1.00 77.56  ? 15  LYS G CG    1 
ATOM   9586  C CD    . LYS I 5 2   ? 91.574  95.966  59.534  1.00 81.02  ? 15  LYS G CD    1 
ATOM   9587  C CE    . LYS I 5 2   ? 90.325  96.659  60.080  1.00 83.38  ? 15  LYS G CE    1 
ATOM   9588  N NZ    . LYS I 5 2   ? 89.263  95.698  60.509  1.00 84.45  ? 15  LYS G NZ    1 
ATOM   9589  N N     . THR I 5 3   ? 95.044  96.691  61.881  1.00 62.34  ? 16  THR G N     1 
ATOM   9590  C CA    . THR I 5 3   ? 95.609  96.964  63.201  1.00 57.17  ? 16  THR G CA    1 
ATOM   9591  C C     . THR I 5 3   ? 95.068  95.978  64.223  1.00 53.59  ? 16  THR G C     1 
ATOM   9592  O O     . THR I 5 3   ? 93.929  95.515  64.126  1.00 52.67  ? 16  THR G O     1 
ATOM   9593  C CB    . THR I 5 3   ? 95.241  98.354  63.712  1.00 55.87  ? 16  THR G CB    1 
ATOM   9594  O OG1   . THR I 5 3   ? 93.839  98.386  63.995  1.00 55.99  ? 16  THR G OG1   1 
ATOM   9595  C CG2   . THR I 5 3   ? 95.583  99.415  62.689  1.00 55.78  ? 16  THR G CG2   1 
ATOM   9596  N N     . ARG I 5 4   ? 95.891  95.654  65.210  1.00 50.31  ? 17  ARG G N     1 
ATOM   9597  C CA    . ARG I 5 4   ? 95.453  94.746  66.245  1.00 48.11  ? 17  ARG G CA    1 
ATOM   9598  C C     . ARG I 5 4   ? 94.228  95.339  66.961  1.00 45.66  ? 17  ARG G C     1 
ATOM   9599  O O     . ARG I 5 4   ? 93.329  94.614  67.382  1.00 45.76  ? 17  ARG G O     1 
ATOM   9600  C CB    . ARG I 5 4   ? 96.610  94.475  67.217  1.00 50.85  ? 17  ARG G CB    1 
ATOM   9601  C CG    . ARG I 5 4   ? 97.646  93.497  66.668  1.00 50.03  ? 17  ARG G CG    1 
ATOM   9602  C CD    . ARG I 5 4   ? 98.671  93.089  67.722  1.00 49.28  ? 17  ARG G CD    1 
ATOM   9603  N NE    . ARG I 5 4   ? 99.733  94.075  67.858  1.00 50.50  ? 17  ARG G NE    1 
ATOM   9604  C CZ    . ARG I 5 4   ? 100.700 94.016  68.770  1.00 51.70  ? 17  ARG G CZ    1 
ATOM   9605  N NH1   . ARG I 5 4   ? 100.737 93.010  69.639  1.00 45.35  ? 17  ARG G NH1   1 
ATOM   9606  N NH2   . ARG I 5 4   ? 101.638 94.950  68.795  1.00 49.33  ? 17  ARG G NH2   1 
ATOM   9607  N N     . SER I 5 5   ? 94.178  96.659  67.079  1.00 43.99  ? 18  SER G N     1 
ATOM   9608  C CA    . SER I 5 5   ? 93.035  97.291  67.719  1.00 46.14  ? 18  SER G CA    1 
ATOM   9609  C C     . SER I 5 5   ? 91.741  96.964  66.965  1.00 47.11  ? 18  SER G C     1 
ATOM   9610  O O     . SER I 5 5   ? 90.745  96.571  67.569  1.00 45.85  ? 18  SER G O     1 
ATOM   9611  C CB    . SER I 5 5   ? 93.219  98.817  67.785  1.00 47.80  ? 18  SER G CB    1 
ATOM   9612  O OG    . SER I 5 5   ? 94.304  99.187  68.633  1.00 47.19  ? 18  SER G OG    1 
ATOM   9613  N N     . SER I 5 6   ? 91.756  97.130  65.643  1.00 48.21  ? 19  SER G N     1 
ATOM   9614  C CA    . SER I 5 6   ? 90.563  96.855  64.841  1.00 49.84  ? 19  SER G CA    1 
ATOM   9615  C C     . SER I 5 6   ? 90.139  95.395  64.950  1.00 47.26  ? 19  SER G C     1 
ATOM   9616  O O     . SER I 5 6   ? 88.954  95.098  65.069  1.00 47.93  ? 19  SER G O     1 
ATOM   9617  C CB    . SER I 5 6   ? 90.789  97.261  63.372  1.00 52.89  ? 19  SER G CB    1 
ATOM   9618  O OG    . SER I 5 6   ? 91.971  96.699  62.832  1.00 56.93  ? 19  SER G OG    1 
ATOM   9619  N N     . ARG I 5 7   ? 91.108  94.492  64.930  1.00 47.32  ? 20  ARG G N     1 
ATOM   9620  C CA    . ARG I 5 7   ? 90.818  93.065  65.064  1.00 50.35  ? 20  ARG G CA    1 
ATOM   9621  C C     . ARG I 5 7   ? 90.137  92.773  66.401  1.00 50.56  ? 20  ARG G C     1 
ATOM   9622  O O     . ARG I 5 7   ? 89.313  91.863  66.510  1.00 51.10  ? 20  ARG G O     1 
ATOM   9623  C CB    . ARG I 5 7   ? 92.107  92.239  65.014  1.00 54.79  ? 20  ARG G CB    1 
ATOM   9624  C CG    . ARG I 5 7   ? 92.860  92.212  63.693  1.00 60.84  ? 20  ARG G CG    1 
ATOM   9625  C CD    . ARG I 5 7   ? 94.088  91.330  63.852  1.00 65.16  ? 20  ARG G CD    1 
ATOM   9626  N NE    . ARG I 5 7   ? 94.994  91.380  62.709  1.00 70.65  ? 20  ARG G NE    1 
ATOM   9627  C CZ    . ARG I 5 7   ? 94.745  90.805  61.539  1.00 71.65  ? 20  ARG G CZ    1 
ATOM   9628  N NH1   . ARG I 5 7   ? 93.613  90.136  61.357  1.00 71.43  ? 20  ARG G NH1   1 
ATOM   9629  N NH2   . ARG I 5 7   ? 95.636  90.876  60.558  1.00 71.32  ? 20  ARG G NH2   1 
ATOM   9630  N N     . ALA I 5 8   ? 90.507  93.531  67.431  1.00 48.93  ? 21  ALA G N     1 
ATOM   9631  C CA    . ALA I 5 8   ? 89.950  93.319  68.762  1.00 45.66  ? 21  ALA G CA    1 
ATOM   9632  C C     . ALA I 5 8   ? 88.682  94.105  68.942  1.00 45.75  ? 21  ALA G C     1 
ATOM   9633  O O     . ALA I 5 8   ? 87.981  93.945  69.945  1.00 46.22  ? 21  ALA G O     1 
ATOM   9634  C CB    . ALA I 5 8   ? 90.970  93.723  69.827  1.00 43.87  ? 21  ALA G CB    1 
ATOM   9635  N N     . GLY I 5 9   ? 88.401  94.975  67.981  1.00 44.32  ? 22  GLY G N     1 
ATOM   9636  C CA    . GLY I 5 9   ? 87.203  95.792  68.054  1.00 45.30  ? 22  GLY G CA    1 
ATOM   9637  C C     . GLY I 5 9   ? 87.355  96.883  69.092  1.00 44.49  ? 22  GLY G C     1 
ATOM   9638  O O     . GLY I 5 9   ? 86.383  97.302  69.722  1.00 44.52  ? 22  GLY G O     1 
ATOM   9639  N N     . LEU I 5 10  ? 88.580  97.371  69.246  1.00 43.07  ? 23  LEU G N     1 
ATOM   9640  C CA    . LEU I 5 10  ? 88.867  98.396  70.234  1.00 40.15  ? 23  LEU G CA    1 
ATOM   9641  C C     . LEU I 5 10  ? 89.301  99.715  69.639  1.00 40.20  ? 23  LEU G C     1 
ATOM   9642  O O     . LEU I 5 10  ? 89.815  99.769  68.520  1.00 41.47  ? 23  LEU G O     1 
ATOM   9643  C CB    . LEU I 5 10  ? 89.982  97.901  71.161  1.00 39.71  ? 23  LEU G CB    1 
ATOM   9644  C CG    . LEU I 5 10  ? 89.709  96.595  71.906  1.00 39.38  ? 23  LEU G CG    1 
ATOM   9645  C CD1   . LEU I 5 10  ? 90.939  96.176  72.712  1.00 41.10  ? 23  LEU G CD1   1 
ATOM   9646  C CD2   . LEU I 5 10  ? 88.500  96.793  72.793  1.00 35.72  ? 23  LEU G CD2   1 
ATOM   9647  N N     . GLN I 5 11  ? 89.096  100.777 70.405  1.00 39.70  ? 24  GLN G N     1 
ATOM   9648  C CA    . GLN I 5 11  ? 89.525  102.113 70.030  1.00 39.83  ? 24  GLN G CA    1 
ATOM   9649  C C     . GLN I 5 11  ? 90.948  102.311 70.593  1.00 42.55  ? 24  GLN G C     1 
ATOM   9650  O O     . GLN I 5 11  ? 91.787  102.965 69.974  1.00 44.40  ? 24  GLN G O     1 
ATOM   9651  C CB    . GLN I 5 11  ? 88.595  103.153 70.637  1.00 41.61  ? 24  GLN G CB    1 
ATOM   9652  C CG    . GLN I 5 11  ? 87.174  103.068 70.123  1.00 50.99  ? 24  GLN G CG    1 
ATOM   9653  C CD    . GLN I 5 11  ? 87.141  103.015 68.613  1.00 52.55  ? 24  GLN G CD    1 
ATOM   9654  O OE1   . GLN I 5 11  ? 87.784  103.818 67.940  1.00 54.23  ? 24  GLN G OE1   1 
ATOM   9655  N NE2   . GLN I 5 11  ? 86.399  102.060 68.070  1.00 53.47  ? 24  GLN G NE2   1 
ATOM   9656  N N     . PHE I 5 12  ? 91.219  101.761 71.778  1.00 38.03  ? 25  PHE G N     1 
ATOM   9657  C CA    . PHE I 5 12  ? 92.550  101.900 72.365  1.00 36.83  ? 25  PHE G CA    1 
ATOM   9658  C C     . PHE I 5 12  ? 93.593  101.106 71.585  1.00 36.95  ? 25  PHE G C     1 
ATOM   9659  O O     . PHE I 5 12  ? 93.309  100.027 71.079  1.00 37.91  ? 25  PHE G O     1 
ATOM   9660  C CB    . PHE I 5 12  ? 92.512  101.497 73.845  1.00 34.01  ? 25  PHE G CB    1 
ATOM   9661  C CG    . PHE I 5 12  ? 92.167  102.639 74.757  1.00 33.24  ? 25  PHE G CG    1 
ATOM   9662  C CD1   . PHE I 5 12  ? 91.126  103.509 74.436  1.00 33.21  ? 25  PHE G CD1   1 
ATOM   9663  C CD2   . PHE I 5 12  ? 92.931  102.897 75.903  1.00 34.27  ? 25  PHE G CD2   1 
ATOM   9664  C CE1   . PHE I 5 12  ? 90.854  104.626 75.231  1.00 31.89  ? 25  PHE G CE1   1 
ATOM   9665  C CE2   . PHE I 5 12  ? 92.675  104.002 76.708  1.00 33.70  ? 25  PHE G CE2   1 
ATOM   9666  C CZ    . PHE I 5 12  ? 91.629  104.878 76.369  1.00 39.85  ? 25  PHE G CZ    1 
ATOM   9667  N N     . PRO I 5 13  ? 94.832  101.624 71.502  1.00 37.84  ? 26  PRO G N     1 
ATOM   9668  C CA    . PRO I 5 13  ? 95.952  101.010 70.775  1.00 34.47  ? 26  PRO G CA    1 
ATOM   9669  C C     . PRO I 5 13  ? 96.624  99.764  71.353  1.00 38.20  ? 26  PRO G C     1 
ATOM   9670  O O     . PRO I 5 13  ? 97.527  99.852  72.185  1.00 36.85  ? 26  PRO G O     1 
ATOM   9671  C CB    . PRO I 5 13  ? 96.934  102.164 70.646  1.00 37.14  ? 26  PRO G CB    1 
ATOM   9672  C CG    . PRO I 5 13  ? 96.784  102.844 72.021  1.00 37.81  ? 26  PRO G CG    1 
ATOM   9673  C CD    . PRO I 5 13  ? 95.268  102.832 72.235  1.00 38.58  ? 26  PRO G CD    1 
ATOM   9674  N N     . VAL I 5 14  ? 96.205  98.606  70.875  1.00 36.61  ? 27  VAL G N     1 
ATOM   9675  C CA    . VAL I 5 14  ? 96.790  97.359  71.303  1.00 35.66  ? 27  VAL G CA    1 
ATOM   9676  C C     . VAL I 5 14  ? 98.295  97.400  71.078  1.00 39.39  ? 27  VAL G C     1 
ATOM   9677  O O     . VAL I 5 14  ? 99.069  97.116  71.990  1.00 37.93  ? 27  VAL G O     1 
ATOM   9678  C CB    . VAL I 5 14  ? 96.196  96.199  70.511  1.00 35.94  ? 27  VAL G CB    1 
ATOM   9679  C CG1   . VAL I 5 14  ? 97.018  94.970  70.694  1.00 33.37  ? 27  VAL G CG1   1 
ATOM   9680  C CG2   . VAL I 5 14  ? 94.777  95.965  70.950  1.00 38.09  ? 27  VAL G CG2   1 
ATOM   9681  N N     . GLY I 5 15  ? 98.720  97.764  69.866  1.00 38.19  ? 28  GLY G N     1 
ATOM   9682  C CA    . GLY I 5 15  ? 100.142 97.806  69.572  1.00 36.87  ? 28  GLY G CA    1 
ATOM   9683  C C     . GLY I 5 15  ? 100.958 98.614  70.575  1.00 37.33  ? 28  GLY G C     1 
ATOM   9684  O O     . GLY I 5 15  ? 102.020 98.177  71.027  1.00 38.02  ? 28  GLY G O     1 
ATOM   9685  N N     . ARG I 5 16  ? 100.476 99.801  70.905  1.00 34.33  ? 29  ARG G N     1 
ATOM   9686  C CA    . ARG I 5 16  ? 101.158 100.651 71.869  1.00 38.19  ? 29  ARG G CA    1 
ATOM   9687  C C     . ARG I 5 16  ? 101.163 100.017 73.269  1.00 37.44  ? 29  ARG G C     1 
ATOM   9688  O O     . ARG I 5 16  ? 102.171 100.080 73.983  1.00 35.37  ? 29  ARG G O     1 
ATOM   9689  C CB    . ARG I 5 16  ? 100.484 102.015 71.957  1.00 35.39  ? 29  ARG G CB    1 
ATOM   9690  C CG    . ARG I 5 16  ? 101.112 102.922 72.998  1.00 37.52  ? 29  ARG G CG    1 
ATOM   9691  C CD    . ARG I 5 16  ? 100.441 104.284 73.026  1.00 42.66  ? 29  ARG G CD    1 
ATOM   9692  N NE    . ARG I 5 16  ? 100.678 105.022 71.791  1.00 41.07  ? 29  ARG G NE    1 
ATOM   9693  C CZ    . ARG I 5 16  ? 100.337 106.284 71.586  1.00 43.87  ? 29  ARG G CZ    1 
ATOM   9694  N NH1   . ARG I 5 16  ? 99.726  106.979 72.537  1.00 41.19  ? 29  ARG G NH1   1 
ATOM   9695  N NH2   . ARG I 5 16  ? 100.634 106.863 70.421  1.00 40.08  ? 29  ARG G NH2   1 
ATOM   9696  N N     . VAL I 5 17  ? 100.047 99.393  73.649  1.00 36.65  ? 30  VAL G N     1 
ATOM   9697  C CA    . VAL I 5 17  ? 99.945  98.782  74.972  1.00 35.33  ? 30  VAL G CA    1 
ATOM   9698  C C     . VAL I 5 17  ? 100.930 97.617  75.072  1.00 35.97  ? 30  VAL G C     1 
ATOM   9699  O O     . VAL I 5 17  ? 101.562 97.408  76.112  1.00 33.74  ? 30  VAL G O     1 
ATOM   9700  C CB    . VAL I 5 17  ? 98.463  98.377  75.264  1.00 34.02  ? 30  VAL G CB    1 
ATOM   9701  C CG1   . VAL I 5 17  ? 98.330  97.607  76.562  1.00 27.88  ? 30  VAL G CG1   1 
ATOM   9702  C CG2   . VAL I 5 17  ? 97.621  99.637  75.383  1.00 29.40  ? 30  VAL G CG2   1 
ATOM   9703  N N     . HIS I 5 18  ? 101.100 96.878  73.976  1.00 36.03  ? 31  HIS G N     1 
ATOM   9704  C CA    . HIS I 5 18  ? 102.048 95.762  73.960  1.00 36.39  ? 31  HIS G CA    1 
ATOM   9705  C C     . HIS I 5 18  ? 103.456 96.322  74.183  1.00 37.46  ? 31  HIS G C     1 
ATOM   9706  O O     . HIS I 5 18  ? 104.223 95.831  75.018  1.00 36.88  ? 31  HIS G O     1 
ATOM   9707  C CB    . HIS I 5 18  ? 102.003 95.046  72.611  1.00 41.14  ? 31  HIS G CB    1 
ATOM   9708  C CG    . HIS I 5 18  ? 102.520 93.640  72.649  1.00 44.69  ? 31  HIS G CG    1 
ATOM   9709  N ND1   . HIS I 5 18  ? 103.280 93.147  73.690  1.00 48.49  ? 31  HIS G ND1   1 
ATOM   9710  C CD2   . HIS I 5 18  ? 102.387 92.619  71.771  1.00 43.72  ? 31  HIS G CD2   1 
ATOM   9711  C CE1   . HIS I 5 18  ? 103.589 91.884  73.449  1.00 47.88  ? 31  HIS G CE1   1 
ATOM   9712  N NE2   . HIS I 5 18  ? 103.057 91.541  72.290  1.00 45.66  ? 31  HIS G NE2   1 
ATOM   9713  N N     . ARG I 5 19  ? 103.772 97.370  73.436  1.00 36.37  ? 32  ARG G N     1 
ATOM   9714  C CA    . ARG I 5 19  ? 105.073 98.022  73.501  1.00 38.39  ? 32  ARG G CA    1 
ATOM   9715  C C     . ARG I 5 19  ? 105.337 98.549  74.908  1.00 39.66  ? 32  ARG G C     1 
ATOM   9716  O O     . ARG I 5 19  ? 106.413 98.330  75.474  1.00 40.82  ? 32  ARG G O     1 
ATOM   9717  C CB    . ARG I 5 19  ? 105.099 99.180  72.495  1.00 40.45  ? 32  ARG G CB    1 
ATOM   9718  C CG    . ARG I 5 19  ? 106.443 99.856  72.295  1.00 45.09  ? 32  ARG G CG    1 
ATOM   9719  C CD    . ARG I 5 19  ? 106.227 101.212 71.624  1.00 51.66  ? 32  ARG G CD    1 
ATOM   9720  N NE    . ARG I 5 19  ? 106.093 102.273 72.619  1.00 55.55  ? 32  ARG G NE    1 
ATOM   9721  C CZ    . ARG I 5 19  ? 105.342 103.359 72.486  1.00 55.85  ? 32  ARG G CZ    1 
ATOM   9722  N NH1   . ARG I 5 19  ? 104.620 103.557 71.390  1.00 57.86  ? 32  ARG G NH1   1 
ATOM   9723  N NH2   . ARG I 5 19  ? 105.323 104.259 73.462  1.00 60.36  ? 32  ARG G NH2   1 
ATOM   9724  N N     . LEU I 5 20  ? 104.365 99.266  75.464  1.00 36.31  ? 33  LEU G N     1 
ATOM   9725  C CA    . LEU I 5 20  ? 104.519 99.803  76.814  1.00 37.27  ? 33  LEU G CA    1 
ATOM   9726  C C     . LEU I 5 20  ? 104.714 98.660  77.828  1.00 37.91  ? 33  LEU G C     1 
ATOM   9727  O O     . LEU I 5 20  ? 105.504 98.793  78.756  1.00 40.94  ? 33  LEU G O     1 
ATOM   9728  C CB    . LEU I 5 20  ? 103.307 100.662 77.192  1.00 37.50  ? 33  LEU G CB    1 
ATOM   9729  C CG    . LEU I 5 20  ? 103.103 101.932 76.350  1.00 37.02  ? 33  LEU G CG    1 
ATOM   9730  C CD1   . LEU I 5 20  ? 101.813 102.624 76.743  1.00 35.49  ? 33  LEU G CD1   1 
ATOM   9731  C CD2   . LEU I 5 20  ? 104.278 102.861 76.539  1.00 37.35  ? 33  LEU G CD2   1 
ATOM   9732  N N     . LEU I 5 21  ? 104.019 97.545  77.655  1.00 33.77  ? 34  LEU G N     1 
ATOM   9733  C CA    . LEU I 5 21  ? 104.195 96.431  78.581  1.00 36.65  ? 34  LEU G CA    1 
ATOM   9734  C C     . LEU I 5 21  ? 105.612 95.858  78.505  1.00 40.33  ? 34  LEU G C     1 
ATOM   9735  O O     . LEU I 5 21  ? 106.226 95.596  79.536  1.00 41.72  ? 34  LEU G O     1 
ATOM   9736  C CB    . LEU I 5 21  ? 103.184 95.313  78.315  1.00 30.65  ? 34  LEU G CB    1 
ATOM   9737  C CG    . LEU I 5 21  ? 101.759 95.585  78.814  1.00 33.44  ? 34  LEU G CG    1 
ATOM   9738  C CD1   . LEU I 5 21  ? 100.803 94.524  78.266  1.00 28.07  ? 34  LEU G CD1   1 
ATOM   9739  C CD2   . LEU I 5 21  ? 101.757 95.608  80.373  1.00 31.24  ? 34  LEU G CD2   1 
ATOM   9740  N N     . ARG I 5 22  ? 106.124 95.676  77.289  1.00 41.20  ? 35  ARG G N     1 
ATOM   9741  C CA    . ARG I 5 22  ? 107.463 95.125  77.079  1.00 45.74  ? 35  ARG G CA    1 
ATOM   9742  C C     . ARG I 5 22  ? 108.563 95.965  77.670  1.00 46.50  ? 35  ARG G C     1 
ATOM   9743  O O     . ARG I 5 22  ? 109.474 95.447  78.302  1.00 51.38  ? 35  ARG G O     1 
ATOM   9744  C CB    . ARG I 5 22  ? 107.770 94.979  75.580  1.00 48.89  ? 35  ARG G CB    1 
ATOM   9745  C CG    . ARG I 5 22  ? 107.020 93.885  74.879  1.00 53.09  ? 35  ARG G CG    1 
ATOM   9746  C CD    . ARG I 5 22  ? 107.488 93.755  73.443  1.00 60.49  ? 35  ARG G CD    1 
ATOM   9747  N NE    . ARG I 5 22  ? 106.824 92.643  72.766  1.00 63.31  ? 35  ARG G NE    1 
ATOM   9748  C CZ    . ARG I 5 22  ? 106.895 91.380  73.170  1.00 64.86  ? 35  ARG G CZ    1 
ATOM   9749  N NH1   . ARG I 5 22  ? 107.605 91.059  74.244  1.00 66.93  ? 35  ARG G NH1   1 
ATOM   9750  N NH2   . ARG I 5 22  ? 106.245 90.438  72.508  1.00 68.07  ? 35  ARG G NH2   1 
ATOM   9751  N N     . LYS I 5 23  ? 108.490 97.268  77.446  1.00 46.32  ? 36  LYS G N     1 
ATOM   9752  C CA    . LYS I 5 23  ? 109.523 98.159  77.926  1.00 47.49  ? 36  LYS G CA    1 
ATOM   9753  C C     . LYS I 5 23  ? 109.343 98.617  79.357  1.00 48.14  ? 36  LYS G C     1 
ATOM   9754  O O     . LYS I 5 23  ? 110.212 99.311  79.900  1.00 46.05  ? 36  LYS G O     1 
ATOM   9755  C CB    . LYS I 5 23  ? 109.622 99.376  77.015  1.00 52.06  ? 36  LYS G CB    1 
ATOM   9756  C CG    . LYS I 5 23  ? 110.127 99.060  75.605  1.00 55.12  ? 36  LYS G CG    1 
ATOM   9757  C CD    . LYS I 5 23  ? 110.262 100.338 74.779  1.00 61.67  ? 36  LYS G CD    1 
ATOM   9758  C CE    . LYS I 5 23  ? 110.676 100.037 73.343  1.00 65.44  ? 36  LYS G CE    1 
ATOM   9759  N NZ    . LYS I 5 23  ? 110.588 101.240 72.467  1.00 69.17  ? 36  LYS G NZ    1 
ATOM   9760  N N     . GLY I 5 24  ? 108.222 98.237  79.972  1.00 43.54  ? 37  GLY G N     1 
ATOM   9761  C CA    . GLY I 5 24  ? 108.001 98.635  81.341  1.00 40.75  ? 37  GLY G CA    1 
ATOM   9762  C C     . GLY I 5 24  ? 108.721 97.686  82.297  1.00 39.87  ? 37  GLY G C     1 
ATOM   9763  O O     . GLY I 5 24  ? 108.647 97.856  83.509  1.00 40.86  ? 37  GLY G O     1 
ATOM   9764  N N     . ASN I 5 25  ? 109.423 96.700  81.762  1.00 38.13  ? 38  ASN G N     1 
ATOM   9765  C CA    . ASN I 5 25  ? 110.115 95.726  82.614  1.00 41.56  ? 38  ASN G CA    1 
ATOM   9766  C C     . ASN I 5 25  ? 109.181 95.021  83.582  1.00 40.10  ? 38  ASN G C     1 
ATOM   9767  O O     . ASN I 5 25  ? 109.524 94.851  84.750  1.00 41.07  ? 38  ASN G O     1 
ATOM   9768  C CB    . ASN I 5 25  ? 111.224 96.384  83.435  1.00 42.44  ? 38  ASN G CB    1 
ATOM   9769  C CG    . ASN I 5 25  ? 112.436 96.702  82.608  1.00 45.17  ? 38  ASN G CG    1 
ATOM   9770  O OD1   . ASN I 5 25  ? 112.720 97.864  82.320  1.00 44.67  ? 38  ASN G OD1   1 
ATOM   9771  N ND2   . ASN I 5 25  ? 113.166 95.663  82.214  1.00 47.34  ? 38  ASN G ND2   1 
ATOM   9772  N N     . TYR I 5 26  ? 108.009 94.620  83.111  1.00 34.41  ? 39  TYR G N     1 
ATOM   9773  C CA    . TYR I 5 26  ? 107.059 93.925  83.962  1.00 31.99  ? 39  TYR G CA    1 
ATOM   9774  C C     . TYR I 5 26  ? 107.316 92.425  84.003  1.00 32.52  ? 39  TYR G C     1 
ATOM   9775  O O     . TYR I 5 26  ? 107.055 91.774  85.020  1.00 29.57  ? 39  TYR G O     1 
ATOM   9776  C CB    . TYR I 5 26  ? 105.633 94.201  83.477  1.00 29.17  ? 39  TYR G CB    1 
ATOM   9777  C CG    . TYR I 5 26  ? 105.290 95.659  83.568  1.00 32.85  ? 39  TYR G CG    1 
ATOM   9778  C CD1   . TYR I 5 26  ? 105.111 96.266  84.808  1.00 33.56  ? 39  TYR G CD1   1 
ATOM   9779  C CD2   . TYR I 5 26  ? 105.178 96.441  82.423  1.00 32.31  ? 39  TYR G CD2   1 
ATOM   9780  C CE1   . TYR I 5 26  ? 104.819 97.610  84.909  1.00 34.36  ? 39  TYR G CE1   1 
ATOM   9781  C CE2   . TYR I 5 26  ? 104.895 97.784  82.510  1.00 37.05  ? 39  TYR G CE2   1 
ATOM   9782  C CZ    . TYR I 5 26  ? 104.711 98.364  83.752  1.00 37.41  ? 39  TYR G CZ    1 
ATOM   9783  O OH    . TYR I 5 26  ? 104.386 99.686  83.831  1.00 35.14  ? 39  TYR G OH    1 
ATOM   9784  N N     . ALA I 5 27  ? 107.824 91.883  82.897  1.00 28.51  ? 40  ALA G N     1 
ATOM   9785  C CA    . ALA I 5 27  ? 108.136 90.458  82.795  1.00 34.37  ? 40  ALA G CA    1 
ATOM   9786  C C     . ALA I 5 27  ? 109.099 90.269  81.620  1.00 34.22  ? 40  ALA G C     1 
ATOM   9787  O O     . ALA I 5 27  ? 109.220 91.156  80.787  1.00 36.80  ? 40  ALA G O     1 
ATOM   9788  C CB    . ALA I 5 27  ? 106.857 89.647  82.548  1.00 30.91  ? 40  ALA G CB    1 
ATOM   9789  N N     . GLU I 5 28  ? 109.779 89.133  81.554  1.00 36.11  ? 41  GLU G N     1 
ATOM   9790  C CA    . GLU I 5 28  ? 110.697 88.885  80.442  1.00 41.53  ? 41  GLU G CA    1 
ATOM   9791  C C     . GLU I 5 28  ? 109.895 88.770  79.139  1.00 41.37  ? 41  GLU G C     1 
ATOM   9792  O O     . GLU I 5 28  ? 110.332 89.225  78.085  1.00 43.18  ? 41  GLU G O     1 
ATOM   9793  C CB    . GLU I 5 28  ? 111.479 87.584  80.654  1.00 46.11  ? 41  GLU G CB    1 
ATOM   9794  C CG    . GLU I 5 28  ? 112.322 87.508  81.931  1.00 59.91  ? 41  GLU G CG    1 
ATOM   9795  C CD    . GLU I 5 28  ? 113.463 88.517  81.962  1.00 66.55  ? 41  GLU G CD    1 
ATOM   9796  O OE1   . GLU I 5 28  ? 114.058 88.770  80.893  1.00 69.29  ? 41  GLU G OE1   1 
ATOM   9797  O OE2   . GLU I 5 28  ? 113.776 89.042  83.058  1.00 71.06  ? 41  GLU G OE2   1 
ATOM   9798  N N     . ARG I 5 29  ? 108.716 88.170  79.216  1.00 39.33  ? 42  ARG G N     1 
ATOM   9799  C CA    . ARG I 5 29  ? 107.887 88.003  78.036  1.00 40.76  ? 42  ARG G CA    1 
ATOM   9800  C C     . ARG I 5 29  ? 106.474 88.523  78.248  1.00 39.11  ? 42  ARG G C     1 
ATOM   9801  O O     . ARG I 5 29  ? 106.011 88.611  79.374  1.00 39.76  ? 42  ARG G O     1 
ATOM   9802  C CB    . ARG I 5 29  ? 107.804 86.529  77.659  1.00 44.47  ? 42  ARG G CB    1 
ATOM   9803  C CG    . ARG I 5 29  ? 109.135 85.877  77.366  1.00 46.49  ? 42  ARG G CG    1 
ATOM   9804  C CD    . ARG I 5 29  ? 108.910 84.477  76.875  1.00 50.93  ? 42  ARG G CD    1 
ATOM   9805  N NE    . ARG I 5 29  ? 110.016 84.049  76.015  1.00 58.03  ? 42  ARG G NE    1 
ATOM   9806  C CZ    . ARG I 5 29  ? 109.999 82.950  75.275  1.00 53.11  ? 42  ARG G CZ    1 
ATOM   9807  N NH1   . ARG I 5 29  ? 108.932 82.159  75.279  1.00 54.11  ? 42  ARG G NH1   1 
ATOM   9808  N NH2   . ARG I 5 29  ? 111.053 82.637  74.546  1.00 56.99  ? 42  ARG G NH2   1 
ATOM   9809  N N     . VAL I 5 30  ? 105.798 88.849  77.153  1.00 38.32  ? 43  VAL G N     1 
ATOM   9810  C CA    . VAL I 5 30  ? 104.427 89.338  77.180  1.00 40.12  ? 43  VAL G CA    1 
ATOM   9811  C C     . VAL I 5 30  ? 103.637 88.617  76.105  1.00 39.24  ? 43  VAL G C     1 
ATOM   9812  O O     . VAL I 5 30  ? 103.924 88.767  74.928  1.00 38.89  ? 43  VAL G O     1 
ATOM   9813  C CB    . VAL I 5 30  ? 104.348 90.858  76.882  1.00 40.64  ? 43  VAL G CB    1 
ATOM   9814  C CG1   . VAL I 5 30  ? 102.868 91.310  76.885  1.00 37.33  ? 43  VAL G CG1   1 
ATOM   9815  C CG2   . VAL I 5 30  ? 105.162 91.630  77.904  1.00 39.56  ? 43  VAL G CG2   1 
ATOM   9816  N N     . GLY I 5 31  ? 102.662 87.823  76.512  1.00 38.89  ? 44  GLY G N     1 
ATOM   9817  C CA    . GLY I 5 31  ? 101.850 87.100  75.555  1.00 39.02  ? 44  GLY G CA    1 
ATOM   9818  C C     . GLY I 5 31  ? 101.018 88.019  74.673  1.00 40.06  ? 44  GLY G C     1 
ATOM   9819  O O     . GLY I 5 31  ? 100.786 89.186  74.999  1.00 37.08  ? 44  GLY G O     1 
ATOM   9820  N N     . ALA I 5 32  ? 100.545 87.469  73.555  1.00 39.58  ? 45  ALA G N     1 
ATOM   9821  C CA    . ALA I 5 32  ? 99.747  88.202  72.575  1.00 37.52  ? 45  ALA G CA    1 
ATOM   9822  C C     . ALA I 5 32  ? 98.416  88.749  73.059  1.00 35.19  ? 45  ALA G C     1 
ATOM   9823  O O     . ALA I 5 32  ? 98.027  89.849  72.680  1.00 36.66  ? 45  ALA G O     1 
ATOM   9824  C CB    . ALA I 5 32  ? 99.520  87.310  71.316  1.00 39.75  ? 45  ALA G CB    1 
ATOM   9825  N N     . GLY I 5 33  ? 97.707  87.999  73.884  1.00 32.91  ? 46  GLY G N     1 
ATOM   9826  C CA    . GLY I 5 33  ? 96.424  88.486  74.368  1.00 33.17  ? 46  GLY G CA    1 
ATOM   9827  C C     . GLY I 5 33  ? 96.484  89.549  75.474  1.00 35.44  ? 46  GLY G C     1 
ATOM   9828  O O     . GLY I 5 33  ? 95.546  90.338  75.632  1.00 34.28  ? 46  GLY G O     1 
ATOM   9829  N N     . ALA I 5 34  ? 97.596  89.596  76.219  1.00 35.99  ? 47  ALA G N     1 
ATOM   9830  C CA    . ALA I 5 34  ? 97.745  90.550  77.329  1.00 32.73  ? 47  ALA G CA    1 
ATOM   9831  C C     . ALA I 5 34  ? 97.480  91.986  76.941  1.00 31.98  ? 47  ALA G C     1 
ATOM   9832  O O     . ALA I 5 34  ? 96.668  92.660  77.581  1.00 34.95  ? 47  ALA G O     1 
ATOM   9833  C CB    . ALA I 5 34  ? 99.132  90.419  77.953  1.00 33.89  ? 47  ALA G CB    1 
ATOM   9834  N N     . PRO I 5 35  ? 98.176  92.501  75.911  1.00 32.97  ? 48  PRO G N     1 
ATOM   9835  C CA    . PRO I 5 35  ? 97.931  93.891  75.505  1.00 32.64  ? 48  PRO G CA    1 
ATOM   9836  C C     . PRO I 5 35  ? 96.516  94.102  74.983  1.00 32.00  ? 48  PRO G C     1 
ATOM   9837  O O     . PRO I 5 35  ? 95.993  95.201  75.065  1.00 30.77  ? 48  PRO G O     1 
ATOM   9838  C CB    . PRO I 5 35  ? 98.990  94.136  74.419  1.00 33.07  ? 48  PRO G CB    1 
ATOM   9839  C CG    . PRO I 5 35  ? 99.223  92.787  73.872  1.00 33.21  ? 48  PRO G CG    1 
ATOM   9840  C CD    . PRO I 5 35  ? 99.264  91.919  75.106  1.00 32.72  ? 48  PRO G CD    1 
ATOM   9841  N N     . VAL I 5 36  ? 95.893  93.055  74.440  1.00 33.75  ? 49  VAL G N     1 
ATOM   9842  C CA    . VAL I 5 36  ? 94.519  93.214  73.940  1.00 34.02  ? 49  VAL G CA    1 
ATOM   9843  C C     . VAL I 5 36  ? 93.576  93.341  75.129  1.00 32.82  ? 49  VAL G C     1 
ATOM   9844  O O     . VAL I 5 36  ? 92.751  94.243  75.190  1.00 31.36  ? 49  VAL G O     1 
ATOM   9845  C CB    . VAL I 5 36  ? 94.037  92.005  73.069  1.00 33.51  ? 49  VAL G CB    1 
ATOM   9846  C CG1   . VAL I 5 36  ? 92.577  92.227  72.633  1.00 32.09  ? 49  VAL G CG1   1 
ATOM   9847  C CG2   . VAL I 5 36  ? 94.918  91.862  71.816  1.00 33.95  ? 49  VAL G CG2   1 
ATOM   9848  N N     . TYR I 5 37  ? 93.691  92.402  76.065  1.00 33.41  ? 50  TYR G N     1 
ATOM   9849  C CA    . TYR I 5 37  ? 92.857  92.412  77.270  1.00 32.63  ? 50  TYR G CA    1 
ATOM   9850  C C     . TYR I 5 37  ? 93.024  93.746  78.021  1.00 32.18  ? 50  TYR G C     1 
ATOM   9851  O O     . TYR I 5 37  ? 92.047  94.403  78.391  1.00 30.44  ? 50  TYR G O     1 
ATOM   9852  C CB    . TYR I 5 37  ? 93.293  91.272  78.182  1.00 29.84  ? 50  TYR G CB    1 
ATOM   9853  C CG    . TYR I 5 37  ? 92.282  90.888  79.236  1.00 32.70  ? 50  TYR G CG    1 
ATOM   9854  C CD1   . TYR I 5 37  ? 91.992  91.747  80.289  1.00 31.06  ? 50  TYR G CD1   1 
ATOM   9855  C CD2   . TYR I 5 37  ? 91.628  89.650  79.182  1.00 30.31  ? 50  TYR G CD2   1 
ATOM   9856  C CE1   . TYR I 5 37  ? 91.085  91.399  81.269  1.00 32.29  ? 50  TYR G CE1   1 
ATOM   9857  C CE2   . TYR I 5 37  ? 90.717  89.281  80.149  1.00 30.44  ? 50  TYR G CE2   1 
ATOM   9858  C CZ    . TYR I 5 37  ? 90.447  90.160  81.200  1.00 33.92  ? 50  TYR G CZ    1 
ATOM   9859  O OH    . TYR I 5 37  ? 89.582  89.802  82.200  1.00 27.26  ? 50  TYR G OH    1 
ATOM   9860  N N     . LEU I 5 38  ? 94.279  94.135  78.249  1.00 32.23  ? 51  LEU G N     1 
ATOM   9861  C CA    . LEU I 5 38  ? 94.566  95.359  78.981  1.00 29.81  ? 51  LEU G CA    1 
ATOM   9862  C C     . LEU I 5 38  ? 94.029  96.594  78.273  1.00 30.03  ? 51  LEU G C     1 
ATOM   9863  O O     . LEU I 5 38  ? 93.452  97.473  78.909  1.00 28.46  ? 51  LEU G O     1 
ATOM   9864  C CB    . LEU I 5 38  ? 96.069  95.492  79.209  1.00 29.63  ? 51  LEU G CB    1 
ATOM   9865  C CG    . LEU I 5 38  ? 96.527  96.752  79.947  1.00 27.08  ? 51  LEU G CG    1 
ATOM   9866  C CD1   . LEU I 5 38  ? 95.692  96.964  81.209  1.00 23.22  ? 51  LEU G CD1   1 
ATOM   9867  C CD2   . LEU I 5 38  ? 98.013  96.601  80.284  1.00 26.71  ? 51  LEU G CD2   1 
ATOM   9868  N N     . ALA I 5 39  ? 94.207  96.668  76.964  1.00 28.04  ? 52  ALA G N     1 
ATOM   9869  C CA    . ALA I 5 39  ? 93.689  97.826  76.216  1.00 27.34  ? 52  ALA G CA    1 
ATOM   9870  C C     . ALA I 5 39  ? 92.177  97.916  76.391  1.00 26.33  ? 52  ALA G C     1 
ATOM   9871  O O     . ALA I 5 39  ? 91.623  98.984  76.611  1.00 28.87  ? 52  ALA G O     1 
ATOM   9872  C CB    . ALA I 5 39  ? 94.046  97.679  74.721  1.00 28.96  ? 52  ALA G CB    1 
ATOM   9873  N N     . ALA I 5 40  ? 91.508  96.774  76.327  1.00 30.68  ? 53  ALA G N     1 
ATOM   9874  C CA    . ALA I 5 40  ? 90.056  96.735  76.449  1.00 31.21  ? 53  ALA G CA    1 
ATOM   9875  C C     . ALA I 5 40  ? 89.628  97.216  77.820  1.00 31.20  ? 53  ALA G C     1 
ATOM   9876  O O     . ALA I 5 40  ? 88.614  97.894  77.961  1.00 29.45  ? 53  ALA G O     1 
ATOM   9877  C CB    . ALA I 5 40  ? 89.552  95.317  76.209  1.00 31.14  ? 53  ALA G CB    1 
ATOM   9878  N N     . VAL I 5 41  ? 90.403  96.850  78.840  1.00 29.64  ? 54  VAL G N     1 
ATOM   9879  C CA    . VAL I 5 41  ? 90.086  97.277  80.205  1.00 28.62  ? 54  VAL G CA    1 
ATOM   9880  C C     . VAL I 5 41  ? 90.264  98.782  80.332  1.00 28.50  ? 54  VAL G C     1 
ATOM   9881  O O     . VAL I 5 41  ? 89.447  99.450  80.969  1.00 32.14  ? 54  VAL G O     1 
ATOM   9882  C CB    . VAL I 5 41  ? 90.981  96.528  81.243  1.00 27.26  ? 54  VAL G CB    1 
ATOM   9883  C CG1   . VAL I 5 41  ? 90.927  97.215  82.662  1.00 24.71  ? 54  VAL G CG1   1 
ATOM   9884  C CG2   . VAL I 5 41  ? 90.499  95.075  81.339  1.00 24.45  ? 54  VAL G CG2   1 
ATOM   9885  N N     . LEU I 5 42  ? 91.323  99.319  79.729  1.00 28.56  ? 55  LEU G N     1 
ATOM   9886  C CA    . LEU I 5 42  ? 91.579  100.743 79.815  1.00 29.71  ? 55  LEU G CA    1 
ATOM   9887  C C     . LEU I 5 42  ? 90.511  101.530 79.076  1.00 32.43  ? 55  LEU G C     1 
ATOM   9888  O O     . LEU I 5 42  ? 90.137  102.632 79.497  1.00 31.55  ? 55  LEU G O     1 
ATOM   9889  C CB    . LEU I 5 42  ? 92.950  101.075 79.232  1.00 30.02  ? 55  LEU G CB    1 
ATOM   9890  C CG    . LEU I 5 42  ? 94.121  100.458 80.012  1.00 30.77  ? 55  LEU G CG    1 
ATOM   9891  C CD1   . LEU I 5 42  ? 95.427  100.673 79.255  1.00 30.28  ? 55  LEU G CD1   1 
ATOM   9892  C CD2   . LEU I 5 42  ? 94.161  101.069 81.409  1.00 27.36  ? 55  LEU G CD2   1 
ATOM   9893  N N     . GLU I 5 43  ? 90.045  100.965 77.959  1.00 31.75  ? 56  GLU G N     1 
ATOM   9894  C CA    . GLU I 5 43  ? 89.012  101.611 77.149  1.00 31.20  ? 56  GLU G CA    1 
ATOM   9895  C C     . GLU I 5 43  ? 87.725  101.665 77.942  1.00 29.59  ? 56  GLU G C     1 
ATOM   9896  O O     . GLU I 5 43  ? 87.089  102.717 78.055  1.00 33.23  ? 56  GLU G O     1 
ATOM   9897  C CB    . GLU I 5 43  ? 88.780  100.834 75.845  1.00 31.89  ? 56  GLU G CB    1 
ATOM   9898  C CG    . GLU I 5 43  ? 87.898  101.588 74.864  1.00 33.95  ? 56  GLU G CG    1 
ATOM   9899  C CD    . GLU I 5 43  ? 87.923  101.003 73.452  1.00 37.66  ? 56  GLU G CD    1 
ATOM   9900  O OE1   . GLU I 5 43  ? 89.004  100.688 72.922  1.00 37.59  ? 56  GLU G OE1   1 
ATOM   9901  O OE2   . GLU I 5 43  ? 86.838  100.875 72.863  1.00 46.57  ? 56  GLU G OE2   1 
ATOM   9902  N N     . TYR I 5 44  ? 87.343  100.519 78.490  1.00 29.94  ? 57  TYR G N     1 
ATOM   9903  C CA    . TYR I 5 44  ? 86.123  100.425 79.291  1.00 31.37  ? 57  TYR G CA    1 
ATOM   9904  C C     . TYR I 5 44  ? 86.113  101.408 80.472  1.00 31.75  ? 57  TYR G C     1 
ATOM   9905  O O     . TYR I 5 44  ? 85.127  102.118 80.687  1.00 32.72  ? 57  TYR G O     1 
ATOM   9906  C CB    . TYR I 5 44  ? 85.962  98.992  79.819  1.00 32.73  ? 57  TYR G CB    1 
ATOM   9907  C CG    . TYR I 5 44  ? 84.957  98.901  80.928  1.00 35.52  ? 57  TYR G CG    1 
ATOM   9908  C CD1   . TYR I 5 44  ? 83.588  99.120  80.687  1.00 34.54  ? 57  TYR G CD1   1 
ATOM   9909  C CD2   . TYR I 5 44  ? 85.375  98.699  82.235  1.00 34.64  ? 57  TYR G CD2   1 
ATOM   9910  C CE1   . TYR I 5 44  ? 82.685  99.149  81.730  1.00 32.69  ? 57  TYR G CE1   1 
ATOM   9911  C CE2   . TYR I 5 44  ? 84.488  98.722  83.277  1.00 33.86  ? 57  TYR G CE2   1 
ATOM   9912  C CZ    . TYR I 5 44  ? 83.150  98.954  83.025  1.00 34.98  ? 57  TYR G CZ    1 
ATOM   9913  O OH    . TYR I 5 44  ? 82.307  99.026  84.097  1.00 36.24  ? 57  TYR G OH    1 
ATOM   9914  N N     . LEU I 5 45  ? 87.207  101.468 81.235  1.00 29.11  ? 58  LEU G N     1 
ATOM   9915  C CA    . LEU I 5 45  ? 87.246  102.370 82.370  1.00 27.70  ? 58  LEU G CA    1 
ATOM   9916  C C     . LEU I 5 45  ? 87.126  103.803 81.890  1.00 26.54  ? 58  LEU G C     1 
ATOM   9917  O O     . LEU I 5 45  ? 86.454  104.617 82.511  1.00 25.59  ? 58  LEU G O     1 
ATOM   9918  C CB    . LEU I 5 45  ? 88.542  102.203 83.189  1.00 28.18  ? 58  LEU G CB    1 
ATOM   9919  C CG    . LEU I 5 45  ? 88.534  100.912 84.016  1.00 30.24  ? 58  LEU G CG    1 
ATOM   9920  C CD1   . LEU I 5 45  ? 89.938  100.622 84.647  1.00 25.79  ? 58  LEU G CD1   1 
ATOM   9921  C CD2   . LEU I 5 45  ? 87.417  101.036 85.057  1.00 25.80  ? 58  LEU G CD2   1 
ATOM   9922  N N     . THR I 5 46  ? 87.794  104.094 80.790  1.00 25.92  ? 59  THR G N     1 
ATOM   9923  C CA    . THR I 5 46  ? 87.747  105.437 80.200  1.00 30.15  ? 59  THR G CA    1 
ATOM   9924  C C     . THR I 5 46  ? 86.291  105.802 79.834  1.00 28.81  ? 59  THR G C     1 
ATOM   9925  O O     . THR I 5 46  ? 85.800  106.881 80.167  1.00 30.91  ? 59  THR G O     1 
ATOM   9926  C CB    . THR I 5 46  ? 88.654  105.503 78.934  1.00 29.39  ? 59  THR G CB    1 
ATOM   9927  O OG1   . THR I 5 46  ? 90.028  105.329 79.324  1.00 33.03  ? 59  THR G OG1   1 
ATOM   9928  C CG2   . THR I 5 46  ? 88.511  106.868 78.231  1.00 28.37  ? 59  THR G CG2   1 
ATOM   9929  N N     . ALA I 5 47  ? 85.612  104.890 79.161  1.00 31.67  ? 60  ALA G N     1 
ATOM   9930  C CA    . ALA I 5 47  ? 84.203  105.095 78.776  1.00 33.61  ? 60  ALA G CA    1 
ATOM   9931  C C     . ALA I 5 47  ? 83.354  105.324 80.013  1.00 32.80  ? 60  ALA G C     1 
ATOM   9932  O O     . ALA I 5 47  ? 82.485  106.193 80.021  1.00 36.00  ? 60  ALA G O     1 
ATOM   9933  C CB    . ALA I 5 47  ? 83.658  103.850 78.001  1.00 33.50  ? 60  ALA G CB    1 
ATOM   9934  N N     . GLU I 5 48  ? 83.591  104.540 81.065  1.00 31.52  ? 61  GLU G N     1 
ATOM   9935  C CA    . GLU I 5 48  ? 82.811  104.698 82.301  1.00 33.43  ? 61  GLU G CA    1 
ATOM   9936  C C     . GLU I 5 48  ? 82.921  106.112 82.887  1.00 35.12  ? 61  GLU G C     1 
ATOM   9937  O O     . GLU I 5 48  ? 81.914  106.753 83.208  1.00 35.58  ? 61  GLU G O     1 
ATOM   9938  C CB    . GLU I 5 48  ? 83.284  103.680 83.345  1.00 38.43  ? 61  GLU G CB    1 
ATOM   9939  C CG    . GLU I 5 48  ? 82.424  103.551 84.554  1.00 44.32  ? 61  GLU G CG    1 
ATOM   9940  C CD    . GLU I 5 48  ? 81.006  103.094 84.226  1.00 51.05  ? 61  GLU G CD    1 
ATOM   9941  O OE1   . GLU I 5 48  ? 80.801  102.431 83.181  1.00 48.82  ? 61  GLU G OE1   1 
ATOM   9942  O OE2   . GLU I 5 48  ? 80.107  103.398 85.037  1.00 52.74  ? 61  GLU G OE2   1 
ATOM   9943  N N     . ILE I 5 49  ? 84.146  106.614 83.037  1.00 31.13  ? 62  ILE G N     1 
ATOM   9944  C CA    . ILE I 5 49  ? 84.319  107.936 83.603  1.00 28.18  ? 62  ILE G CA    1 
ATOM   9945  C C     . ILE I 5 49  ? 83.791  109.049 82.685  1.00 28.02  ? 62  ILE G C     1 
ATOM   9946  O O     . ILE I 5 49  ? 83.173  110.022 83.154  1.00 28.96  ? 62  ILE G O     1 
ATOM   9947  C CB    . ILE I 5 49  ? 85.801  108.227 83.877  1.00 29.46  ? 62  ILE G CB    1 
ATOM   9948  C CG1   . ILE I 5 49  ? 86.330  107.293 84.947  1.00 32.24  ? 62  ILE G CG1   1 
ATOM   9949  C CG2   . ILE I 5 49  ? 85.968  109.656 84.363  1.00 32.04  ? 62  ILE G CG2   1 
ATOM   9950  C CD1   . ILE I 5 49  ? 87.755  107.624 85.353  1.00 35.07  ? 62  ILE G CD1   1 
ATOM   9951  N N     . LEU I 5 50  ? 84.069  108.936 81.387  1.00 26.92  ? 63  LEU G N     1 
ATOM   9952  C CA    . LEU I 5 50  ? 83.604  109.951 80.424  1.00 29.92  ? 63  LEU G CA    1 
ATOM   9953  C C     . LEU I 5 50  ? 82.067  109.912 80.388  1.00 30.41  ? 63  LEU G C     1 
ATOM   9954  O O     . LEU I 5 50  ? 81.412  110.957 80.308  1.00 33.29  ? 63  LEU G O     1 
ATOM   9955  C CB    . LEU I 5 50  ? 84.176  109.679 79.029  1.00 28.14  ? 63  LEU G CB    1 
ATOM   9956  C CG    . LEU I 5 50  ? 85.672  109.873 78.827  1.00 25.32  ? 63  LEU G CG    1 
ATOM   9957  C CD1   . LEU I 5 50  ? 86.056  109.413 77.428  1.00 29.22  ? 63  LEU G CD1   1 
ATOM   9958  C CD2   . LEU I 5 50  ? 86.047  111.306 79.042  1.00 29.12  ? 63  LEU G CD2   1 
ATOM   9959  N N     . GLU I 5 51  ? 81.495  108.719 80.481  1.00 30.58  ? 64  GLU G N     1 
ATOM   9960  C CA    . GLU I 5 51  ? 80.035  108.598 80.505  1.00 34.89  ? 64  GLU G CA    1 
ATOM   9961  C C     . GLU I 5 51  ? 79.462  109.412 81.677  1.00 37.63  ? 64  GLU G C     1 
ATOM   9962  O O     . GLU I 5 51  ? 78.604  110.284 81.490  1.00 36.14  ? 64  GLU G O     1 
ATOM   9963  C CB    . GLU I 5 51  ? 79.630  107.134 80.669  1.00 40.35  ? 64  GLU G CB    1 
ATOM   9964  C CG    . GLU I 5 51  ? 78.156  106.955 80.913  1.00 48.30  ? 64  GLU G CG    1 
ATOM   9965  C CD    . GLU I 5 51  ? 77.330  107.520 79.784  1.00 55.44  ? 64  GLU G CD    1 
ATOM   9966  O OE1   . GLU I 5 51  ? 77.315  106.914 78.689  1.00 55.61  ? 64  GLU G OE1   1 
ATOM   9967  O OE2   . GLU I 5 51  ? 76.713  108.586 79.994  1.00 62.38  ? 64  GLU G OE2   1 
ATOM   9968  N N     . LEU I 5 52  ? 79.942  109.144 82.893  1.00 36.25  ? 65  LEU G N     1 
ATOM   9969  C CA    . LEU I 5 52  ? 79.459  109.877 84.064  1.00 34.85  ? 65  LEU G CA    1 
ATOM   9970  C C     . LEU I 5 52  ? 79.909  111.347 84.037  1.00 37.03  ? 65  LEU G C     1 
ATOM   9971  O O     . LEU I 5 52  ? 79.172  112.239 84.478  1.00 35.88  ? 65  LEU G O     1 
ATOM   9972  C CB    . LEU I 5 52  ? 79.962  109.209 85.347  1.00 38.15  ? 65  LEU G CB    1 
ATOM   9973  C CG    . LEU I 5 52  ? 79.566  107.735 85.486  1.00 39.14  ? 65  LEU G CG    1 
ATOM   9974  C CD1   . LEU I 5 52  ? 80.282  107.113 86.678  1.00 38.48  ? 65  LEU G CD1   1 
ATOM   9975  C CD2   . LEU I 5 52  ? 78.057  107.623 85.673  1.00 35.91  ? 65  LEU G CD2   1 
ATOM   9976  N N     . ALA I 5 53  ? 81.108  111.611 83.527  1.00 33.18  ? 66  ALA G N     1 
ATOM   9977  C CA    . ALA I 5 53  ? 81.578  112.995 83.486  1.00 36.87  ? 66  ALA G CA    1 
ATOM   9978  C C     . ALA I 5 53  ? 80.691  113.801 82.529  1.00 34.37  ? 66  ALA G C     1 
ATOM   9979  O O     . ALA I 5 53  ? 80.248  114.900 82.848  1.00 34.92  ? 66  ALA G O     1 
ATOM   9980  C CB    . ALA I 5 53  ? 83.054  113.057 83.018  1.00 33.95  ? 66  ALA G CB    1 
ATOM   9981  N N     . GLY I 5 54  ? 80.459  113.246 81.347  1.00 36.09  ? 67  GLY G N     1 
ATOM   9982  C CA    . GLY I 5 54  ? 79.614  113.917 80.378  1.00 36.40  ? 67  GLY G CA    1 
ATOM   9983  C C     . GLY I 5 54  ? 78.256  114.220 80.978  1.00 37.70  ? 67  GLY G C     1 
ATOM   9984  O O     . GLY I 5 54  ? 77.725  115.312 80.741  1.00 37.52  ? 67  GLY G O     1 
ATOM   9985  N N     . ASN I 5 55  ? 77.702  113.273 81.755  1.00 36.99  ? 68  ASN G N     1 
ATOM   9986  C CA    . ASN I 5 55  ? 76.397  113.472 82.405  1.00 40.43  ? 68  ASN G CA    1 
ATOM   9987  C C     . ASN I 5 55  ? 76.455  114.647 83.368  1.00 40.28  ? 68  ASN G C     1 
ATOM   9988  O O     . ASN I 5 55  ? 75.474  115.387 83.520  1.00 38.43  ? 68  ASN G O     1 
ATOM   9989  C CB    . ASN I 5 55  ? 75.953  112.232 83.216  1.00 39.21  ? 68  ASN G CB    1 
ATOM   9990  C CG    . ASN I 5 55  ? 75.546  111.073 82.341  1.00 43.17  ? 68  ASN G CG    1 
ATOM   9991  O OD1   . ASN I 5 55  ? 75.452  111.198 81.116  1.00 43.78  ? 68  ASN G OD1   1 
ATOM   9992  N ND2   . ASN I 5 55  ? 75.293  109.928 82.965  1.00 42.77  ? 68  ASN G ND2   1 
ATOM   9993  N N     . ALA I 5 56  ? 77.592  114.794 84.045  1.00 37.87  ? 69  ALA G N     1 
ATOM   9994  C CA    . ALA I 5 56  ? 77.771  115.886 85.004  1.00 38.31  ? 69  ALA G CA    1 
ATOM   9995  C C     . ALA I 5 56  ? 77.872  117.204 84.267  1.00 39.99  ? 69  ALA G C     1 
ATOM   9996  O O     . ALA I 5 56  ? 77.406  118.220 84.762  1.00 41.07  ? 69  ALA G O     1 
ATOM   9997  C CB    . ALA I 5 56  ? 79.030  115.669 85.864  1.00 35.74  ? 69  ALA G CB    1 
ATOM   9998  N N     . ALA I 5 57  ? 78.504  117.198 83.096  1.00 42.06  ? 70  ALA G N     1 
ATOM   9999  C CA    . ALA I 5 57  ? 78.617  118.430 82.315  1.00 44.43  ? 70  ALA G CA    1 
ATOM   10000 C C     . ALA I 5 57  ? 77.180  118.805 81.928  1.00 45.36  ? 70  ALA G C     1 
ATOM   10001 O O     . ALA I 5 57  ? 76.772  119.952 82.065  1.00 43.89  ? 70  ALA G O     1 
ATOM   10002 C CB    . ALA I 5 57  ? 79.467  118.208 81.058  1.00 40.53  ? 70  ALA G CB    1 
ATOM   10003 N N     . ARG I 5 58  ? 76.414  117.811 81.488  1.00 49.26  ? 71  ARG G N     1 
ATOM   10004 C CA    . ARG I 5 58  ? 75.024  118.036 81.099  1.00 54.73  ? 71  ARG G CA    1 
ATOM   10005 C C     . ARG I 5 58  ? 74.212  118.642 82.242  1.00 55.14  ? 71  ARG G C     1 
ATOM   10006 O O     . ARG I 5 58  ? 73.553  119.670 82.056  1.00 56.36  ? 71  ARG G O     1 
ATOM   10007 C CB    . ARG I 5 58  ? 74.366  116.729 80.644  1.00 58.37  ? 71  ARG G CB    1 
ATOM   10008 C CG    . ARG I 5 58  ? 72.901  116.901 80.222  1.00 64.73  ? 71  ARG G CG    1 
ATOM   10009 C CD    . ARG I 5 58  ? 72.198  115.560 80.005  1.00 70.66  ? 71  ARG G CD    1 
ATOM   10010 N NE    . ARG I 5 58  ? 70.743  115.710 79.952  1.00 76.72  ? 71  ARG G NE    1 
ATOM   10011 C CZ    . ARG I 5 58  ? 69.871  114.740 80.219  1.00 78.18  ? 71  ARG G CZ    1 
ATOM   10012 N NH1   . ARG I 5 58  ? 70.293  113.532 80.562  1.00 79.95  ? 71  ARG G NH1   1 
ATOM   10013 N NH2   . ARG I 5 58  ? 68.566  114.976 80.141  1.00 81.86  ? 71  ARG G NH2   1 
ATOM   10014 N N     . ASP I 5 59  ? 74.258  118.022 83.419  1.00 54.87  ? 72  ASP G N     1 
ATOM   10015 C CA    . ASP I 5 59  ? 73.511  118.527 84.571  1.00 55.43  ? 72  ASP G CA    1 
ATOM   10016 C C     . ASP I 5 59  ? 73.913  119.954 84.879  1.00 56.47  ? 72  ASP G C     1 
ATOM   10017 O O     . ASP I 5 59  ? 73.135  120.724 85.434  1.00 58.22  ? 72  ASP G O     1 
ATOM   10018 C CB    . ASP I 5 59  ? 73.777  117.700 85.826  1.00 58.24  ? 72  ASP G CB    1 
ATOM   10019 C CG    . ASP I 5 59  ? 73.538  116.232 85.622  1.00 64.13  ? 72  ASP G CG    1 
ATOM   10020 O OD1   . ASP I 5 59  ? 72.708  115.869 84.751  1.00 65.82  ? 72  ASP G OD1   1 
ATOM   10021 O OD2   . ASP I 5 59  ? 74.177  115.439 86.351  1.00 67.42  ? 72  ASP G OD2   1 
ATOM   10022 N N     . ASN I 5 60  ? 75.145  120.299 84.538  1.00 57.13  ? 73  ASN G N     1 
ATOM   10023 C CA    . ASN I 5 60  ? 75.645  121.636 84.806  1.00 58.58  ? 73  ASN G CA    1 
ATOM   10024 C C     . ASN I 5 60  ? 75.386  122.565 83.621  1.00 57.79  ? 73  ASN G C     1 
ATOM   10025 O O     . ASN I 5 60  ? 75.821  123.718 83.616  1.00 57.14  ? 73  ASN G O     1 
ATOM   10026 C CB    . ASN I 5 60  ? 77.141  121.564 85.138  1.00 61.98  ? 73  ASN G CB    1 
ATOM   10027 C CG    . ASN I 5 60  ? 77.404  120.963 86.518  1.00 68.45  ? 73  ASN G CG    1 
ATOM   10028 O OD1   . ASN I 5 60  ? 77.751  121.680 87.466  1.00 70.84  ? 73  ASN G OD1   1 
ATOM   10029 N ND2   . ASN I 5 60  ? 77.223  119.644 86.642  1.00 66.49  ? 73  ASN G ND2   1 
ATOM   10030 N N     . LYS I 5 61  ? 74.677  122.049 82.622  1.00 55.38  ? 74  LYS G N     1 
ATOM   10031 C CA    . LYS I 5 61  ? 74.345  122.819 81.428  1.00 57.33  ? 74  LYS G CA    1 
ATOM   10032 C C     . LYS I 5 61  ? 75.587  123.150 80.612  1.00 54.55  ? 74  LYS G C     1 
ATOM   10033 O O     . LYS I 5 61  ? 75.708  124.240 80.058  1.00 53.30  ? 74  LYS G O     1 
ATOM   10034 C CB    . LYS I 5 61  ? 73.622  124.118 81.820  1.00 60.80  ? 74  LYS G CB    1 
ATOM   10035 C CG    . LYS I 5 61  ? 72.486  123.919 82.828  1.00 67.73  ? 74  LYS G CG    1 
ATOM   10036 C CD    . LYS I 5 61  ? 71.519  122.832 82.359  1.00 72.40  ? 74  LYS G CD    1 
ATOM   10037 C CE    . LYS I 5 61  ? 70.521  122.446 83.447  1.00 74.81  ? 74  LYS G CE    1 
ATOM   10038 N NZ    . LYS I 5 61  ? 69.773  121.204 83.070  1.00 76.82  ? 74  LYS G NZ    1 
ATOM   10039 N N     . LYS I 5 62  ? 76.508  122.195 80.538  1.00 52.89  ? 75  LYS G N     1 
ATOM   10040 C CA    . LYS I 5 62  ? 77.739  122.382 79.789  1.00 49.44  ? 75  LYS G CA    1 
ATOM   10041 C C     . LYS I 5 62  ? 77.945  121.253 78.813  1.00 46.63  ? 75  LYS G C     1 
ATOM   10042 O O     . LYS I 5 62  ? 77.567  120.120 79.077  1.00 48.83  ? 75  LYS G O     1 
ATOM   10043 C CB    . LYS I 5 62  ? 78.920  122.487 80.749  1.00 51.14  ? 75  LYS G CB    1 
ATOM   10044 C CG    . LYS I 5 62  ? 78.897  123.781 81.557  1.00 55.01  ? 75  LYS G CG    1 
ATOM   10045 C CD    . LYS I 5 62  ? 80.107  123.892 82.448  1.00 61.28  ? 75  LYS G CD    1 
ATOM   10046 C CE    . LYS I 5 62  ? 80.050  125.154 83.283  1.00 63.68  ? 75  LYS G CE    1 
ATOM   10047 N NZ    . LYS I 5 62  ? 81.139  125.145 84.316  1.00 68.62  ? 75  LYS G NZ    1 
ATOM   10048 N N     . THR I 5 63  ? 78.529  121.568 77.669  1.00 45.30  ? 76  THR G N     1 
ATOM   10049 C CA    . THR I 5 63  ? 78.785  120.569 76.641  1.00 44.36  ? 76  THR G CA    1 
ATOM   10050 C C     . THR I 5 63  ? 80.249  120.117 76.642  1.00 43.51  ? 76  THR G C     1 
ATOM   10051 O O     . THR I 5 63  ? 80.616  119.131 75.985  1.00 45.07  ? 76  THR G O     1 
ATOM   10052 C CB    . THR I 5 63  ? 78.438  121.140 75.275  1.00 47.30  ? 76  THR G CB    1 
ATOM   10053 O OG1   . THR I 5 63  ? 79.315  122.235 74.993  1.00 48.61  ? 76  THR G OG1   1 
ATOM   10054 C CG2   . THR I 5 63  ? 76.998  121.645 75.283  1.00 48.90  ? 76  THR G CG2   1 
ATOM   10055 N N     . ARG I 5 64  ? 81.093  120.850 77.357  1.00 39.92  ? 77  ARG G N     1 
ATOM   10056 C CA    . ARG I 5 64  ? 82.495  120.470 77.444  1.00 40.30  ? 77  ARG G CA    1 
ATOM   10057 C C     . ARG I 5 64  ? 82.879  119.996 78.860  1.00 34.37  ? 77  ARG G C     1 
ATOM   10058 O O     . ARG I 5 64  ? 82.702  120.704 79.842  1.00 32.28  ? 77  ARG G O     1 
ATOM   10059 C CB    . ARG I 5 64  ? 83.408  121.631 77.053  1.00 38.93  ? 77  ARG G CB    1 
ATOM   10060 C CG    . ARG I 5 64  ? 84.888  121.270 77.115  1.00 42.60  ? 77  ARG G CG    1 
ATOM   10061 C CD    . ARG I 5 64  ? 85.763  122.477 76.814  1.00 44.97  ? 77  ARG G CD    1 
ATOM   10062 N NE    . ARG I 5 64  ? 85.518  122.969 75.466  1.00 45.09  ? 77  ARG G NE    1 
ATOM   10063 C CZ    . ARG I 5 64  ? 85.419  124.255 75.144  1.00 50.52  ? 77  ARG G CZ    1 
ATOM   10064 N NH1   . ARG I 5 64  ? 85.541  125.194 76.079  1.00 47.95  ? 77  ARG G NH1   1 
ATOM   10065 N NH2   . ARG I 5 64  ? 85.201  124.600 73.881  1.00 48.13  ? 77  ARG G NH2   1 
ATOM   10066 N N     . ILE I 5 65  ? 83.412  118.789 78.926  1.00 34.47  ? 78  ILE G N     1 
ATOM   10067 C CA    . ILE I 5 65  ? 83.856  118.189 80.183  1.00 32.96  ? 78  ILE G CA    1 
ATOM   10068 C C     . ILE I 5 65  ? 85.110  118.908 80.694  1.00 32.09  ? 78  ILE G C     1 
ATOM   10069 O O     . ILE I 5 65  ? 86.070  119.065 79.955  1.00 32.11  ? 78  ILE G O     1 
ATOM   10070 C CB    . ILE I 5 65  ? 84.182  116.703 79.945  1.00 33.27  ? 78  ILE G CB    1 
ATOM   10071 C CG1   . ILE I 5 65  ? 82.877  115.942 79.685  1.00 29.64  ? 78  ILE G CG1   1 
ATOM   10072 C CG2   . ILE I 5 65  ? 84.992  116.137 81.125  1.00 30.12  ? 78  ILE G CG2   1 
ATOM   10073 C CD1   . ILE I 5 65  ? 83.053  114.451 79.342  1.00 29.86  ? 78  ILE G CD1   1 
ATOM   10074 N N     . ILE I 5 66  ? 85.087  119.393 81.932  1.00 31.68  ? 79  ILE G N     1 
ATOM   10075 C CA    . ILE I 5 66  ? 86.268  120.055 82.507  1.00 33.28  ? 79  ILE G CA    1 
ATOM   10076 C C     . ILE I 5 66  ? 86.651  119.230 83.751  1.00 31.19  ? 79  ILE G C     1 
ATOM   10077 O O     . ILE I 5 66  ? 85.937  118.305 84.090  1.00 32.96  ? 79  ILE G O     1 
ATOM   10078 C CB    . ILE I 5 66  ? 85.989  121.528 82.909  1.00 31.45  ? 79  ILE G CB    1 
ATOM   10079 C CG1   . ILE I 5 66  ? 84.846  121.596 83.927  1.00 29.19  ? 79  ILE G CG1   1 
ATOM   10080 C CG2   . ILE I 5 66  ? 85.675  122.375 81.626  1.00 32.40  ? 79  ILE G CG2   1 
ATOM   10081 C CD1   . ILE I 5 66  ? 84.675  122.987 84.561  1.00 31.74  ? 79  ILE G CD1   1 
ATOM   10082 N N     . PRO I 5 67  ? 87.776  119.538 84.426  1.00 30.71  ? 80  PRO G N     1 
ATOM   10083 C CA    . PRO I 5 67  ? 88.135  118.732 85.611  1.00 27.97  ? 80  PRO G CA    1 
ATOM   10084 C C     . PRO I 5 67  ? 87.048  118.562 86.660  1.00 27.75  ? 80  PRO G C     1 
ATOM   10085 O O     . PRO I 5 67  ? 86.882  117.482 87.210  1.00 31.14  ? 80  PRO G O     1 
ATOM   10086 C CB    . PRO I 5 67  ? 89.379  119.447 86.157  1.00 31.15  ? 80  PRO G CB    1 
ATOM   10087 C CG    . PRO I 5 67  ? 90.053  119.923 84.854  1.00 30.78  ? 80  PRO G CG    1 
ATOM   10088 C CD    . PRO I 5 67  ? 88.858  120.476 84.073  1.00 28.99  ? 80  PRO G CD    1 
ATOM   10089 N N     . ARG I 5 68  ? 86.325  119.634 86.956  1.00 31.01  ? 81  ARG G N     1 
ATOM   10090 C CA    . ARG I 5 68  ? 85.247  119.594 87.921  1.00 30.69  ? 81  ARG G CA    1 
ATOM   10091 C C     . ARG I 5 68  ? 84.300  118.441 87.638  1.00 33.61  ? 81  ARG G C     1 
ATOM   10092 O O     . ARG I 5 68  ? 83.915  117.701 88.566  1.00 34.78  ? 81  ARG G O     1 
ATOM   10093 C CB    . ARG I 5 68  ? 84.471  120.920 87.898  1.00 33.63  ? 81  ARG G CB    1 
ATOM   10094 C CG    . ARG I 5 68  ? 83.203  120.956 88.756  1.00 34.44  ? 81  ARG G CG    1 
ATOM   10095 C CD    . ARG I 5 68  ? 83.510  120.649 90.212  1.00 30.52  ? 81  ARG G CD    1 
ATOM   10096 N NE    . ARG I 5 68  ? 82.384  120.914 91.105  1.00 29.62  ? 81  ARG G NE    1 
ATOM   10097 C CZ    . ARG I 5 68  ? 82.462  120.776 92.432  1.00 35.04  ? 81  ARG G CZ    1 
ATOM   10098 N NH1   . ARG I 5 68  ? 83.615  120.363 92.985  1.00 25.93  ? 81  ARG G NH1   1 
ATOM   10099 N NH2   . ARG I 5 68  ? 81.423  121.090 93.211  1.00 27.53  ? 81  ARG G NH2   1 
ATOM   10100 N N     . HIS I 5 69  ? 83.931  118.266 86.369  1.00 31.11  ? 82  HIS G N     1 
ATOM   10101 C CA    . HIS I 5 69  ? 83.005  117.206 86.012  1.00 31.77  ? 82  HIS G CA    1 
ATOM   10102 C C     . HIS I 5 69  ? 83.582  115.813 86.250  1.00 30.36  ? 82  HIS G C     1 
ATOM   10103 O O     . HIS I 5 69  ? 82.845  114.888 86.615  1.00 28.01  ? 82  HIS G O     1 
ATOM   10104 C CB    . HIS I 5 69  ? 82.572  117.340 84.550  1.00 32.26  ? 82  HIS G CB    1 
ATOM   10105 C CG    . HIS I 5 69  ? 82.024  118.693 84.213  1.00 35.23  ? 82  HIS G CG    1 
ATOM   10106 N ND1   . HIS I 5 69  ? 82.011  119.185 82.926  1.00 35.59  ? 82  HIS G ND1   1 
ATOM   10107 C CD2   . HIS I 5 69  ? 81.479  119.660 84.992  1.00 37.41  ? 82  HIS G CD2   1 
ATOM   10108 C CE1   . HIS I 5 69  ? 81.484  120.399 82.926  1.00 35.58  ? 82  HIS G CE1   1 
ATOM   10109 N NE2   . HIS I 5 69  ? 81.151  120.711 84.165  1.00 35.23  ? 82  HIS G NE2   1 
ATOM   10110 N N     . LEU I 5 70  ? 84.882  115.657 86.010  1.00 27.04  ? 83  LEU G N     1 
ATOM   10111 C CA    . LEU I 5 70  ? 85.513  114.363 86.242  1.00 28.86  ? 83  LEU G CA    1 
ATOM   10112 C C     . LEU I 5 70  ? 85.464  114.111 87.736  1.00 24.94  ? 83  LEU G C     1 
ATOM   10113 O O     . LEU I 5 70  ? 85.151  113.002 88.140  1.00 28.15  ? 83  LEU G O     1 
ATOM   10114 C CB    . LEU I 5 70  ? 86.965  114.339 85.744  1.00 31.48  ? 83  LEU G CB    1 
ATOM   10115 C CG    . LEU I 5 70  ? 87.142  114.427 84.217  1.00 29.69  ? 83  LEU G CG    1 
ATOM   10116 C CD1   . LEU I 5 70  ? 88.598  114.664 83.900  1.00 26.90  ? 83  LEU G CD1   1 
ATOM   10117 C CD2   . LEU I 5 70  ? 86.646  113.158 83.565  1.00 26.96  ? 83  LEU G CD2   1 
ATOM   10118 N N     . GLN I 5 71  ? 85.753  115.128 88.545  1.00 25.73  ? 84  GLN G N     1 
ATOM   10119 C CA    . GLN I 5 71  ? 85.704  114.979 90.018  1.00 26.91  ? 84  GLN G CA    1 
ATOM   10120 C C     . GLN I 5 71  ? 84.284  114.640 90.494  1.00 30.86  ? 84  GLN G C     1 
ATOM   10121 O O     . GLN I 5 71  ? 84.091  113.709 91.281  1.00 28.97  ? 84  GLN G O     1 
ATOM   10122 C CB    . GLN I 5 71  ? 86.191  116.264 90.722  1.00 24.95  ? 84  GLN G CB    1 
ATOM   10123 C CG    . GLN I 5 71  ? 85.995  116.299 92.262  1.00 26.75  ? 84  GLN G CG    1 
ATOM   10124 C CD    . GLN I 5 71  ? 87.002  115.421 93.050  1.00 28.34  ? 84  GLN G CD    1 
ATOM   10125 O OE1   . GLN I 5 71  ? 87.603  114.499 92.503  1.00 26.60  ? 84  GLN G OE1   1 
ATOM   10126 N NE2   . GLN I 5 71  ? 87.159  115.713 94.336  1.00 23.01  ? 84  GLN G NE2   1 
ATOM   10127 N N     . LEU I 5 72  ? 83.280  115.380 90.024  1.00 27.00  ? 85  LEU G N     1 
ATOM   10128 C CA    . LEU I 5 72  ? 81.908  115.075 90.415  1.00 27.63  ? 85  LEU G CA    1 
ATOM   10129 C C     . LEU I 5 72  ? 81.531  113.659 90.009  1.00 26.89  ? 85  LEU G C     1 
ATOM   10130 O O     . LEU I 5 72  ? 80.890  112.963 90.780  1.00 29.88  ? 85  LEU G O     1 
ATOM   10131 C CB    . LEU I 5 72  ? 80.894  116.047 89.766  1.00 29.89  ? 85  LEU G CB    1 
ATOM   10132 C CG    . LEU I 5 72  ? 80.926  117.520 90.199  1.00 34.34  ? 85  LEU G CG    1 
ATOM   10133 C CD1   . LEU I 5 72  ? 79.970  118.366 89.313  1.00 32.94  ? 85  LEU G CD1   1 
ATOM   10134 C CD2   . LEU I 5 72  ? 80.527  117.627 91.644  1.00 33.20  ? 85  LEU G CD2   1 
ATOM   10135 N N     . ALA I 5 73  ? 81.929  113.221 88.813  1.00 26.81  ? 86  ALA G N     1 
ATOM   10136 C CA    . ALA I 5 73  ? 81.582  111.877 88.358  1.00 22.44  ? 86  ALA G CA    1 
ATOM   10137 C C     . ALA I 5 73  ? 82.237  110.801 89.214  1.00 28.49  ? 86  ALA G C     1 
ATOM   10138 O O     . ALA I 5 73  ? 81.610  109.779 89.562  1.00 25.59  ? 86  ALA G O     1 
ATOM   10139 C CB    . ALA I 5 73  ? 82.014  111.678 86.907  1.00 26.77  ? 86  ALA G CB    1 
ATOM   10140 N N     . VAL I 5 74  ? 83.517  111.016 89.520  1.00 25.60  ? 87  VAL G N     1 
ATOM   10141 C CA    . VAL I 5 74  ? 84.273  110.061 90.332  1.00 25.20  ? 87  VAL G CA    1 
ATOM   10142 C C     . VAL I 5 74  ? 83.799  110.045 91.792  1.00 29.09  ? 87  VAL G C     1 
ATOM   10143 O O     . VAL I 5 74  ? 83.467  108.977 92.337  1.00 28.37  ? 87  VAL G O     1 
ATOM   10144 C CB    . VAL I 5 74  ? 85.812  110.387 90.297  1.00 21.50  ? 87  VAL G CB    1 
ATOM   10145 C CG1   . VAL I 5 74  ? 86.563  109.589 91.420  1.00 21.72  ? 87  VAL G CG1   1 
ATOM   10146 C CG2   . VAL I 5 74  ? 86.392  110.048 88.889  1.00 18.88  ? 87  VAL G CG2   1 
ATOM   10147 N N     . ARG I 5 75  ? 83.735  111.210 92.434  1.00 29.20  ? 88  ARG G N     1 
ATOM   10148 C CA    . ARG I 5 75  ? 83.362  111.198 93.849  1.00 31.28  ? 88  ARG G CA    1 
ATOM   10149 C C     . ARG I 5 75  ? 81.904  110.810 94.132  1.00 32.00  ? 88  ARG G C     1 
ATOM   10150 O O     . ARG I 5 75  ? 81.583  110.362 95.223  1.00 28.73  ? 88  ARG G O     1 
ATOM   10151 C CB    . ARG I 5 75  ? 83.747  112.527 94.510  1.00 28.93  ? 88  ARG G CB    1 
ATOM   10152 C CG    . ARG I 5 75  ? 85.027  113.138 93.908  1.00 29.93  ? 88  ARG G CG    1 
ATOM   10153 C CD    . ARG I 5 75  ? 86.434  112.882 94.522  1.00 41.07  ? 88  ARG G CD    1 
ATOM   10154 N NE    . ARG I 5 75  ? 86.816  111.500 94.677  1.00 37.70  ? 88  ARG G NE    1 
ATOM   10155 C CZ    . ARG I 5 75  ? 88.027  110.969 94.461  1.00 35.97  ? 88  ARG G CZ    1 
ATOM   10156 N NH1   . ARG I 5 75  ? 89.066  111.664 94.034  1.00 32.68  ? 88  ARG G NH1   1 
ATOM   10157 N NH2   . ARG I 5 75  ? 88.199  109.694 94.754  1.00 26.75  ? 88  ARG G NH2   1 
ATOM   10158 N N     . ASN I 5 76  ? 81.029  110.952 93.144  1.00 31.91  ? 89  ASN G N     1 
ATOM   10159 C CA    . ASN I 5 76  ? 79.629  110.562 93.337  1.00 31.63  ? 89  ASN G CA    1 
ATOM   10160 C C     . ASN I 5 76  ? 79.402  109.120 92.977  1.00 30.77  ? 89  ASN G C     1 
ATOM   10161 O O     . ASN I 5 76  ? 78.313  108.633 93.107  1.00 31.22  ? 89  ASN G O     1 
ATOM   10162 C CB    . ASN I 5 76  ? 78.685  111.409 92.491  1.00 29.93  ? 89  ASN G CB    1 
ATOM   10163 C CG    . ASN I 5 76  ? 78.404  112.743 93.123  1.00 33.02  ? 89  ASN G CG    1 
ATOM   10164 O OD1   . ASN I 5 76  ? 78.010  112.817 94.284  1.00 33.96  ? 89  ASN G OD1   1 
ATOM   10165 N ND2   . ASN I 5 76  ? 78.607  113.807 92.367  1.00 33.81  ? 89  ASN G ND2   1 
ATOM   10166 N N     . ASP I 5 77  ? 80.419  108.453 92.469  1.00 30.83  ? 90  ASP G N     1 
ATOM   10167 C CA    . ASP I 5 77  ? 80.279  107.061 92.098  1.00 29.31  ? 90  ASP G CA    1 
ATOM   10168 C C     . ASP I 5 77  ? 81.061  106.244 93.123  1.00 32.04  ? 90  ASP G C     1 
ATOM   10169 O O     . ASP I 5 77  ? 82.281  106.369 93.239  1.00 27.25  ? 90  ASP G O     1 
ATOM   10170 C CB    . ASP I 5 77  ? 80.855  106.807 90.711  1.00 30.49  ? 90  ASP G CB    1 
ATOM   10171 C CG    . ASP I 5 77  ? 80.653  105.382 90.269  1.00 33.77  ? 90  ASP G CG    1 
ATOM   10172 O OD1   . ASP I 5 77  ? 79.512  105.050 89.879  1.00 36.95  ? 90  ASP G OD1   1 
ATOM   10173 O OD2   . ASP I 5 77  ? 81.615  104.593 90.336  1.00 37.17  ? 90  ASP G OD2   1 
ATOM   10174 N N     . GLU I 5 78  ? 80.361  105.404 93.873  1.00 32.45  ? 91  GLU G N     1 
ATOM   10175 C CA    . GLU I 5 78  ? 81.018  104.612 94.903  1.00 32.12  ? 91  GLU G CA    1 
ATOM   10176 C C     . GLU I 5 78  ? 82.278  103.875 94.433  1.00 31.64  ? 91  GLU G C     1 
ATOM   10177 O O     . GLU I 5 78  ? 83.326  103.969 95.064  1.00 30.65  ? 91  GLU G O     1 
ATOM   10178 C CB    . GLU I 5 78  ? 80.017  103.608 95.487  1.00 36.96  ? 91  GLU G CB    1 
ATOM   10179 C CG    . GLU I 5 78  ? 80.599  102.717 96.572  1.00 51.51  ? 91  GLU G CG    1 
ATOM   10180 C CD    . GLU I 5 78  ? 79.588  101.726 97.116  1.00 60.57  ? 91  GLU G CD    1 
ATOM   10181 O OE1   . GLU I 5 78  ? 79.255  100.746 96.405  1.00 65.29  ? 91  GLU G OE1   1 
ATOM   10182 O OE2   . GLU I 5 78  ? 79.118  101.937 98.258  1.00 66.13  ? 91  GLU G OE2   1 
ATOM   10183 N N     . GLU I 5 79  ? 82.188  103.158 93.317  1.00 30.42  ? 92  GLU G N     1 
ATOM   10184 C CA    . GLU I 5 79  ? 83.331  102.375 92.851  1.00 33.21  ? 92  GLU G CA    1 
ATOM   10185 C C     . GLU I 5 79  ? 84.496  103.177 92.303  1.00 31.48  ? 92  GLU G C     1 
ATOM   10186 O O     . GLU I 5 79  ? 85.643  102.910 92.648  1.00 31.66  ? 92  GLU G O     1 
ATOM   10187 C CB    . GLU I 5 79  ? 82.874  101.332 91.847  1.00 33.43  ? 92  GLU G CB    1 
ATOM   10188 C CG    . GLU I 5 79  ? 81.864  100.374 92.461  1.00 37.62  ? 92  GLU G CG    1 
ATOM   10189 C CD    . GLU I 5 79  ? 81.742  99.071  91.692  1.00 41.70  ? 92  GLU G CD    1 
ATOM   10190 O OE1   . GLU I 5 79  ? 82.069  99.046  90.492  1.00 41.65  ? 92  GLU G OE1   1 
ATOM   10191 O OE2   . GLU I 5 79  ? 81.312  98.062  92.293  1.00 46.02  ? 92  GLU G OE2   1 
ATOM   10192 N N     . LEU I 5 80  ? 84.209  104.158 91.464  1.00 29.81  ? 93  LEU G N     1 
ATOM   10193 C CA    . LEU I 5 80  ? 85.268  104.991 90.915  1.00 29.89  ? 93  LEU G CA    1 
ATOM   10194 C C     . LEU I 5 80  ? 85.955  105.752 92.058  1.00 25.87  ? 93  LEU G C     1 
ATOM   10195 O O     . LEU I 5 80  ? 87.164  105.894 92.058  1.00 27.01  ? 93  LEU G O     1 
ATOM   10196 C CB    . LEU I 5 80  ? 84.708  105.966 89.894  1.00 26.53  ? 93  LEU G CB    1 
ATOM   10197 C CG    . LEU I 5 80  ? 84.350  105.298 88.553  1.00 31.14  ? 93  LEU G CG    1 
ATOM   10198 C CD1   . LEU I 5 80  ? 83.619  106.296 87.672  1.00 34.00  ? 93  LEU G CD1   1 
ATOM   10199 C CD2   . LEU I 5 80  ? 85.598  104.826 87.854  1.00 30.33  ? 93  LEU G CD2   1 
ATOM   10200 N N     . ASN I 5 81  ? 85.175  106.199 93.044  1.00 25.59  ? 94  ASN G N     1 
ATOM   10201 C CA    . ASN I 5 81  ? 85.719  106.925 94.166  1.00 25.29  ? 94  ASN G CA    1 
ATOM   10202 C C     . ASN I 5 81  ? 86.744  106.077 94.930  1.00 28.75  ? 94  ASN G C     1 
ATOM   10203 O O     . ASN I 5 81  ? 87.782  106.590 95.356  1.00 26.91  ? 94  ASN G O     1 
ATOM   10204 C CB    . ASN I 5 81  ? 84.620  107.367 95.116  1.00 26.38  ? 94  ASN G CB    1 
ATOM   10205 C CG    . ASN I 5 81  ? 85.180  108.112 96.316  1.00 30.46  ? 94  ASN G CG    1 
ATOM   10206 O OD1   . ASN I 5 81  ? 85.845  109.132 96.150  1.00 25.38  ? 94  ASN G OD1   1 
ATOM   10207 N ND2   . ASN I 5 81  ? 84.937  107.590 97.528  1.00 27.62  ? 94  ASN G ND2   1 
ATOM   10208 N N     . LYS I 5 82  ? 86.447  104.790 95.108  1.00 27.78  ? 95  LYS G N     1 
ATOM   10209 C CA    . LYS I 5 82  ? 87.369  103.882 95.799  1.00 30.38  ? 95  LYS G CA    1 
ATOM   10210 C C     . LYS I 5 82  ? 88.591  103.611 94.895  1.00 28.68  ? 95  LYS G C     1 
ATOM   10211 O O     . LYS I 5 82  ? 89.731  103.654 95.341  1.00 27.55  ? 95  LYS G O     1 
ATOM   10212 C CB    . LYS I 5 82  ? 86.647  102.567 96.137  1.00 35.68  ? 95  LYS G CB    1 
ATOM   10213 C CG    . LYS I 5 82  ? 87.500  101.539 96.904  1.00 40.82  ? 95  LYS G CG    1 
ATOM   10214 C CD    . LYS I 5 82  ? 86.666  100.283 97.119  1.00 52.74  ? 95  LYS G CD    1 
ATOM   10215 C CE    . LYS I 5 82  ? 87.212  99.375  98.200  1.00 55.90  ? 95  LYS G CE    1 
ATOM   10216 N NZ    . LYS I 5 82  ? 86.362  98.143  98.326  1.00 60.41  ? 95  LYS G NZ    1 
ATOM   10217 N N     . LEU I 5 83  ? 88.362  103.329 93.613  1.00 28.15  ? 96  LEU G N     1 
ATOM   10218 C CA    . LEU I 5 83  ? 89.506  103.099 92.717  1.00 27.88  ? 96  LEU G CA    1 
ATOM   10219 C C     . LEU I 5 83  ? 90.468  104.289 92.781  1.00 27.28  ? 96  LEU G C     1 
ATOM   10220 O O     . LEU I 5 83  ? 91.688  104.123 92.798  1.00 30.54  ? 96  LEU G O     1 
ATOM   10221 C CB    . LEU I 5 83  ? 89.047  102.942 91.272  1.00 29.49  ? 96  LEU G CB    1 
ATOM   10222 C CG    . LEU I 5 83  ? 90.124  102.699 90.221  1.00 28.37  ? 96  LEU G CG    1 
ATOM   10223 C CD1   . LEU I 5 83  ? 90.829  101.381 90.526  1.00 26.06  ? 96  LEU G CD1   1 
ATOM   10224 C CD2   . LEU I 5 83  ? 89.463  102.644 88.843  1.00 29.59  ? 96  LEU G CD2   1 
ATOM   10225 N N     . LEU I 5 84  ? 89.909  105.487 92.812  1.00 25.05  ? 97  LEU G N     1 
ATOM   10226 C CA    . LEU I 5 84  ? 90.702  106.709 92.845  1.00 26.81  ? 97  LEU G CA    1 
ATOM   10227 C C     . LEU I 5 84  ? 90.721  107.314 94.257  1.00 23.74  ? 97  LEU G C     1 
ATOM   10228 O O     . LEU I 5 84  ? 90.807  108.523 94.439  1.00 22.88  ? 97  LEU G O     1 
ATOM   10229 C CB    . LEU I 5 84  ? 90.117  107.700 91.810  1.00 23.35  ? 97  LEU G CB    1 
ATOM   10230 C CG    . LEU I 5 84  ? 90.036  107.125 90.372  1.00 25.29  ? 97  LEU G CG    1 
ATOM   10231 C CD1   . LEU I 5 84  ? 89.592  108.250 89.413  1.00 30.04  ? 97  LEU G CD1   1 
ATOM   10232 C CD2   . LEU I 5 84  ? 91.360  106.551 89.921  1.00 27.59  ? 97  LEU G CD2   1 
ATOM   10233 N N     . GLY I 5 85  ? 90.662  106.450 95.259  1.00 24.22  ? 98  GLY G N     1 
ATOM   10234 C CA    . GLY I 5 85  ? 90.656  106.927 96.644  1.00 25.32  ? 98  GLY G CA    1 
ATOM   10235 C C     . GLY I 5 85  ? 91.914  107.675 97.077  1.00 26.82  ? 98  GLY G C     1 
ATOM   10236 O O     . GLY I 5 85  ? 91.867  108.471 98.004  1.00 25.66  ? 98  GLY G O     1 
ATOM   10237 N N     . ARG I 5 86  ? 93.043  107.421 96.425  1.00 27.31  ? 99  ARG G N     1 
ATOM   10238 C CA    . ARG I 5 86  ? 94.280  108.131 96.798  1.00 28.24  ? 99  ARG G CA    1 
ATOM   10239 C C     . ARG I 5 86  ? 94.785  109.014 95.651  1.00 28.24  ? 99  ARG G C     1 
ATOM   10240 O O     . ARG I 5 86  ? 95.974  109.294 95.525  1.00 30.56  ? 99  ARG G O     1 
ATOM   10241 C CB    . ARG I 5 86  ? 95.335  107.107 97.230  1.00 31.63  ? 99  ARG G CB    1 
ATOM   10242 C CG    . ARG I 5 86  ? 94.824  106.349 98.469  1.00 37.98  ? 99  ARG G CG    1 
ATOM   10243 C CD    . ARG I 5 86  ? 95.640  105.125 98.838  1.00 53.94  ? 99  ARG G CD    1 
ATOM   10244 N NE    . ARG I 5 86  ? 94.809  104.153 99.559  1.00 64.45  ? 99  ARG G NE    1 
ATOM   10245 C CZ    . ARG I 5 86  ? 95.284  103.187 100.342 1.00 68.43  ? 99  ARG G CZ    1 
ATOM   10246 N NH1   . ARG I 5 86  ? 96.597  103.061 100.515 1.00 69.50  ? 99  ARG G NH1   1 
ATOM   10247 N NH2   . ARG I 5 86  ? 94.445  102.349 100.949 1.00 69.83  ? 99  ARG G NH2   1 
ATOM   10248 N N     . VAL I 5 87  ? 93.861  109.458 94.818  1.00 24.70  ? 100 VAL G N     1 
ATOM   10249 C CA    . VAL I 5 87  ? 94.216  110.290 93.674  1.00 23.49  ? 100 VAL G CA    1 
ATOM   10250 C C     . VAL I 5 87  ? 93.594  111.661 93.807  1.00 25.