data_6JOD
# 
_entry.id   6JOD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6JOD         
WWPDB D_1300011452 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'Heavy and light chain of 4A03Fab' 
_pdbx_database_related.db_id          5XLI 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6JOD 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Asada, H.'     1 0000-0001-6255-4728 
'Iwata, S.'     2 0000-0003-1735-2937 
'Hirata, K.'    3 0000-0002-1491-6509 
'Shimamura, T.' 4 0000-0002-1158-9485 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            28 
_citation.language                  ? 
_citation.page_first                418 
_citation.page_last                 ? 
_citation.title                     'The Crystal Structure of Angiotensin II Type 2 Receptor with Endogenous Peptide Hormone.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2019.12.003 
_citation.pdbx_database_id_PubMed   31899086 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Asada, H.'         1  ? 
primary 'Inoue, A.'         2  ? 
primary 'Ngako Kadji, F.M.' 3  ? 
primary 'Hirata, K.'        4  ? 
primary 'Shiimura, Y.'      5  ? 
primary 'Im, D.'            6  ? 
primary 'Shimamura, T.'     7  ? 
primary 'Nomura, N.'        8  ? 
primary 'Iwanari, H.'       9  ? 
primary 'Hamakubo, T.'      10 ? 
primary 'Kusano-Arai, O.'   11 ? 
primary 'Hisano, H.'        12 ? 
primary 'Uemura, T.'        13 ? 
primary 'Suno, C.'          14 ? 
primary 'Aoki, J.'          15 ? 
primary 'Iwata, S.'         16 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6JOD 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     102.550 
_cell.length_a_esd                 ? 
_cell.length_b                     426.430 
_cell.length_b_esd                 ? 
_cell.length_c                     52.700 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6JOD 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Type-2 angiotensin II receptor'                  35733.621 1 ? S208A                       ? 
'1-34 and 347-363 deleted.'                 
2 polymer syn 'Angiotensin II'                                  1048.195  1 ? ?                           ? 
'Endogenous ligand of Angiotensin receptor' 
3 polymer man 'Soluble cytochrome b562,Soluble cytochrome b562' 9156.169  1 ? M1007W,R1098I,H1102I,R1106G ? ? 
4 polymer nat 'Heavy chain of 4A03Fab'                          23371.201 1 ? ?                           ? ? 
5 polymer nat 'Light chain of 4A03Fab'                          23262.699 1 ? ?                           ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Angiotensin II type-2 receptor,AT2' 
3 'Cytochrome b-562,Cytochrome b-562'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGP
VMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNA
CIMAFPPEKYAQWAAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHV
LTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRES
;
;CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGP
VMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNA
CIMAFPPEKYAQWAAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHV
LTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRES
;
A ? 
2 'polypeptide(L)' no no DRVYIHPF DRVYIHPF B ? 
3 'polypeptide(L)' no no 
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAGSGSGDILVGQIDDALKLANEGKVKEAQAAAEQLKTTINA
YIQKYG
;
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAGSGSGDILVGQIDDALKLANEGKVKEAQAAAEQLKTTINA
YIQKYG
;
C ? 
4 'polypeptide(L)' no no 
;DVQLVESGGGLVQPGGSRKLSCAASGFTFSGFGMHWVRQAPEKGLEWVAYISSGSSLIYYADTVKGRFTISRDNPKNTLF
LQMTSLRSEDTAMYFCATSLYYGTPWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVT
WNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
;
;DVQLVESGGGLVQPGGSRKLSCAASGFTFSGFGMHWVRQAPEKGLEWVAYISSGSSLIYYADTVKGRFTISRDNPKNTLF
LQMTSLRSEDTAMYFCATSLYYGTPWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVT
WNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
;
H ? 
5 'polypeptide(L)' no no 
;DIVLTQSPAIMSASPGEKVTMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTSYSLTISRMEAE
DAATFYCQQWSSYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLN
SWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
;
;DIVLTQSPAIMSASPGEKVTMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTSYSLTISRMEAE
DAATFYCQQWSSYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLN
SWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   SER n 
1 3   GLN n 
1 4   LYS n 
1 5   PRO n 
1 6   SER n 
1 7   ASP n 
1 8   LYS n 
1 9   HIS n 
1 10  LEU n 
1 11  ASP n 
1 12  ALA n 
1 13  ILE n 
1 14  PRO n 
1 15  ILE n 
1 16  LEU n 
1 17  TYR n 
1 18  TYR n 
1 19  ILE n 
1 20  ILE n 
1 21  PHE n 
1 22  VAL n 
1 23  ILE n 
1 24  GLY n 
1 25  PHE n 
1 26  LEU n 
1 27  VAL n 
1 28  ASN n 
1 29  ILE n 
1 30  VAL n 
1 31  VAL n 
1 32  VAL n 
1 33  THR n 
1 34  LEU n 
1 35  PHE n 
1 36  CYS n 
1 37  CYS n 
1 38  GLN n 
1 39  LYS n 
1 40  GLY n 
1 41  PRO n 
1 42  LYS n 
1 43  LYS n 
1 44  VAL n 
1 45  SER n 
1 46  SER n 
1 47  ILE n 
1 48  TYR n 
1 49  ILE n 
1 50  PHE n 
1 51  ASN n 
1 52  LEU n 
1 53  ALA n 
1 54  VAL n 
1 55  ALA n 
1 56  ASP n 
1 57  LEU n 
1 58  LEU n 
1 59  LEU n 
1 60  LEU n 
1 61  ALA n 
1 62  THR n 
1 63  LEU n 
1 64  PRO n 
1 65  LEU n 
1 66  TRP n 
1 67  ALA n 
1 68  THR n 
1 69  TYR n 
1 70  TYR n 
1 71  SER n 
1 72  TYR n 
1 73  ARG n 
1 74  TYR n 
1 75  ASP n 
1 76  TRP n 
1 77  LEU n 
1 78  PHE n 
1 79  GLY n 
1 80  PRO n 
1 81  VAL n 
1 82  MET n 
1 83  CYS n 
1 84  LYS n 
1 85  VAL n 
1 86  PHE n 
1 87  GLY n 
1 88  SER n 
1 89  PHE n 
1 90  LEU n 
1 91  THR n 
1 92  LEU n 
1 93  ASN n 
1 94  MET n 
1 95  PHE n 
1 96  ALA n 
1 97  SER n 
1 98  ILE n 
1 99  PHE n 
1 100 PHE n 
1 101 ILE n 
1 102 THR n 
1 103 CYS n 
1 104 MET n 
1 105 SER n 
1 106 VAL n 
1 107 ASP n 
1 108 ARG n 
1 109 TYR n 
1 110 GLN n 
1 111 SER n 
1 112 VAL n 
1 113 ILE n 
1 114 TYR n 
1 115 PRO n 
1 116 PHE n 
1 117 LEU n 
1 118 SER n 
1 119 GLN n 
1 120 ARG n 
1 121 ARG n 
1 122 ASN n 
1 123 PRO n 
1 124 TRP n 
1 125 GLN n 
1 126 ALA n 
1 127 SER n 
1 128 TYR n 
1 129 ILE n 
1 130 VAL n 
1 131 PRO n 
1 132 LEU n 
1 133 VAL n 
1 134 TRP n 
1 135 CYS n 
1 136 MET n 
1 137 ALA n 
1 138 CYS n 
1 139 LEU n 
1 140 SER n 
1 141 SER n 
1 142 LEU n 
1 143 PRO n 
1 144 THR n 
1 145 PHE n 
1 146 TYR n 
1 147 PHE n 
1 148 ARG n 
1 149 ASP n 
1 150 VAL n 
1 151 ARG n 
1 152 THR n 
1 153 ILE n 
1 154 GLU n 
1 155 TYR n 
1 156 LEU n 
1 157 GLY n 
1 158 VAL n 
1 159 ASN n 
1 160 ALA n 
1 161 CYS n 
1 162 ILE n 
1 163 MET n 
1 164 ALA n 
1 165 PHE n 
1 166 PRO n 
1 167 PRO n 
1 168 GLU n 
1 169 LYS n 
1 170 TYR n 
1 171 ALA n 
1 172 GLN n 
1 173 TRP n 
1 174 ALA n 
1 175 ALA n 
1 176 GLY n 
1 177 ILE n 
1 178 ALA n 
1 179 LEU n 
1 180 MET n 
1 181 LYS n 
1 182 ASN n 
1 183 ILE n 
1 184 LEU n 
1 185 GLY n 
1 186 PHE n 
1 187 ILE n 
1 188 ILE n 
1 189 PRO n 
1 190 LEU n 
1 191 ILE n 
1 192 PHE n 
1 193 ILE n 
1 194 ALA n 
1 195 THR n 
1 196 CYS n 
1 197 TYR n 
1 198 PHE n 
1 199 GLY n 
1 200 ILE n 
1 201 ARG n 
1 202 LYS n 
1 203 HIS n 
1 204 LEU n 
1 205 LEU n 
1 206 LYS n 
1 207 THR n 
1 208 ASN n 
1 209 SER n 
1 210 TYR n 
1 211 GLY n 
1 212 LYS n 
1 213 ASN n 
1 214 ARG n 
1 215 ILE n 
1 216 THR n 
1 217 ARG n 
1 218 ASP n 
1 219 GLN n 
1 220 VAL n 
1 221 LEU n 
1 222 LYS n 
1 223 MET n 
1 224 ALA n 
1 225 ALA n 
1 226 ALA n 
1 227 VAL n 
1 228 VAL n 
1 229 LEU n 
1 230 ALA n 
1 231 PHE n 
1 232 ILE n 
1 233 ILE n 
1 234 CYS n 
1 235 TRP n 
1 236 LEU n 
1 237 PRO n 
1 238 PHE n 
1 239 HIS n 
1 240 VAL n 
1 241 LEU n 
1 242 THR n 
1 243 PHE n 
1 244 LEU n 
1 245 ASP n 
1 246 ALA n 
1 247 LEU n 
1 248 ALA n 
1 249 TRP n 
1 250 MET n 
1 251 GLY n 
1 252 VAL n 
1 253 ILE n 
1 254 ASN n 
1 255 SER n 
1 256 CYS n 
1 257 GLU n 
1 258 VAL n 
1 259 ILE n 
1 260 ALA n 
1 261 VAL n 
1 262 ILE n 
1 263 ASP n 
1 264 LEU n 
1 265 ALA n 
1 266 LEU n 
1 267 PRO n 
1 268 PHE n 
1 269 ALA n 
1 270 ILE n 
1 271 LEU n 
1 272 LEU n 
1 273 GLY n 
1 274 PHE n 
1 275 THR n 
1 276 ASN n 
1 277 SER n 
1 278 CYS n 
1 279 VAL n 
1 280 ASN n 
1 281 PRO n 
1 282 PHE n 
1 283 LEU n 
1 284 TYR n 
1 285 CYS n 
1 286 PHE n 
1 287 VAL n 
1 288 GLY n 
1 289 ASN n 
1 290 ARG n 
1 291 PHE n 
1 292 GLN n 
1 293 GLN n 
1 294 LYS n 
1 295 LEU n 
1 296 ARG n 
1 297 SER n 
1 298 VAL n 
1 299 PHE n 
1 300 ARG n 
1 301 VAL n 
1 302 PRO n 
1 303 ILE n 
1 304 THR n 
1 305 TRP n 
1 306 LEU n 
1 307 GLN n 
1 308 GLY n 
1 309 LYS n 
1 310 ARG n 
1 311 GLU n 
1 312 SER n 
2 1   ASP n 
2 2   ARG n 
2 3   VAL n 
2 4   TYR n 
2 5   ILE n 
2 6   HIS n 
2 7   PRO n 
2 8   PHE n 
3 1   ALA n 
3 2   ASP n 
3 3   LEU n 
3 4   GLU n 
3 5   ASP n 
3 6   ASN n 
3 7   TRP n 
3 8   GLU n 
3 9   THR n 
3 10  LEU n 
3 11  ASN n 
3 12  ASP n 
3 13  ASN n 
3 14  LEU n 
3 15  LYS n 
3 16  VAL n 
3 17  ILE n 
3 18  GLU n 
3 19  LYS n 
3 20  ALA n 
3 21  ASP n 
3 22  ASN n 
3 23  ALA n 
3 24  ALA n 
3 25  GLN n 
3 26  VAL n 
3 27  LYS n 
3 28  ASP n 
3 29  ALA n 
3 30  LEU n 
3 31  THR n 
3 32  LYS n 
3 33  MET n 
3 34  ARG n 
3 35  ALA n 
3 36  ALA n 
3 37  ALA n 
3 38  LEU n 
3 39  ASP n 
3 40  ALA n 
3 41  GLY n 
3 42  SER n 
3 43  GLY n 
3 44  SER n 
3 45  GLY n 
3 46  ASP n 
3 47  ILE n 
3 48  LEU n 
3 49  VAL n 
3 50  GLY n 
3 51  GLN n 
3 52  ILE n 
3 53  ASP n 
3 54  ASP n 
3 55  ALA n 
3 56  LEU n 
3 57  LYS n 
3 58  LEU n 
3 59  ALA n 
3 60  ASN n 
3 61  GLU n 
3 62  GLY n 
3 63  LYS n 
3 64  VAL n 
3 65  LYS n 
3 66  GLU n 
3 67  ALA n 
3 68  GLN n 
3 69  ALA n 
3 70  ALA n 
3 71  ALA n 
3 72  GLU n 
3 73  GLN n 
3 74  LEU n 
3 75  LYS n 
3 76  THR n 
3 77  THR n 
3 78  ILE n 
3 79  ASN n 
3 80  ALA n 
3 81  TYR n 
3 82  ILE n 
3 83  GLN n 
3 84  LYS n 
3 85  TYR n 
3 86  GLY n 
4 1   ASP n 
4 2   VAL n 
4 3   GLN n 
4 4   LEU n 
4 5   VAL n 
4 6   GLU n 
4 7   SER n 
4 8   GLY n 
4 9   GLY n 
4 10  GLY n 
4 11  LEU n 
4 12  VAL n 
4 13  GLN n 
4 14  PRO n 
4 15  GLY n 
4 16  GLY n 
4 17  SER n 
4 18  ARG n 
4 19  LYS n 
4 20  LEU n 
4 21  SER n 
4 22  CYS n 
4 23  ALA n 
4 24  ALA n 
4 25  SER n 
4 26  GLY n 
4 27  PHE n 
4 28  THR n 
4 29  PHE n 
4 30  SER n 
4 31  GLY n 
4 32  PHE n 
4 33  GLY n 
4 34  MET n 
4 35  HIS n 
4 36  TRP n 
4 37  VAL n 
4 38  ARG n 
4 39  GLN n 
4 40  ALA n 
4 41  PRO n 
4 42  GLU n 
4 43  LYS n 
4 44  GLY n 
4 45  LEU n 
4 46  GLU n 
4 47  TRP n 
4 48  VAL n 
4 49  ALA n 
4 50  TYR n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  GLY n 
4 55  SER n 
4 56  SER n 
4 57  LEU n 
4 58  ILE n 
4 59  TYR n 
4 60  TYR n 
4 61  ALA n 
4 62  ASP n 
4 63  THR n 
4 64  VAL n 
4 65  LYS n 
4 66  GLY n 
4 67  ARG n 
4 68  PHE n 
4 69  THR n 
4 70  ILE n 
4 71  SER n 
4 72  ARG n 
4 73  ASP n 
4 74  ASN n 
4 75  PRO n 
4 76  LYS n 
4 77  ASN n 
4 78  THR n 
4 79  LEU n 
4 80  PHE n 
4 81  LEU n 
4 82  GLN n 
4 83  MET n 
4 84  THR n 
4 85  SER n 
4 86  LEU n 
4 87  ARG n 
4 88  SER n 
4 89  GLU n 
4 90  ASP n 
4 91  THR n 
4 92  ALA n 
4 93  MET n 
4 94  TYR n 
4 95  PHE n 
4 96  CYS n 
4 97  ALA n 
4 98  THR n 
4 99  SER n 
4 100 LEU n 
4 101 TYR n 
4 102 TYR n 
4 103 GLY n 
4 104 THR n 
4 105 PRO n 
4 106 TRP n 
4 107 PHE n 
4 108 ALA n 
4 109 TYR n 
4 110 TRP n 
4 111 GLY n 
4 112 GLN n 
4 113 GLY n 
4 114 THR n 
4 115 LEU n 
4 116 VAL n 
4 117 THR n 
4 118 VAL n 
4 119 SER n 
4 120 ALA n 
4 121 ALA n 
4 122 LYS n 
4 123 THR n 
4 124 THR n 
4 125 PRO n 
4 126 PRO n 
4 127 SER n 
4 128 VAL n 
4 129 TYR n 
4 130 PRO n 
4 131 LEU n 
4 132 ALA n 
4 133 PRO n 
4 134 GLY n 
4 135 CYS n 
4 136 GLY n 
4 137 ASP n 
4 138 THR n 
4 139 THR n 
4 140 GLY n 
4 141 SER n 
4 142 SER n 
4 143 VAL n 
4 144 THR n 
4 145 LEU n 
4 146 GLY n 
4 147 CYS n 
4 148 LEU n 
4 149 VAL n 
4 150 LYS n 
4 151 GLY n 
4 152 TYR n 
4 153 PHE n 
4 154 PRO n 
4 155 GLU n 
4 156 SER n 
4 157 VAL n 
4 158 THR n 
4 159 VAL n 
4 160 THR n 
4 161 TRP n 
4 162 ASN n 
4 163 SER n 
4 164 GLY n 
4 165 SER n 
4 166 LEU n 
4 167 SER n 
4 168 SER n 
4 169 SER n 
4 170 VAL n 
4 171 HIS n 
4 172 THR n 
4 173 PHE n 
4 174 PRO n 
4 175 ALA n 
4 176 LEU n 
4 177 LEU n 
4 178 GLN n 
4 179 SER n 
4 180 GLY n 
4 181 LEU n 
4 182 TYR n 
4 183 THR n 
4 184 MET n 
4 185 SER n 
4 186 SER n 
4 187 SER n 
4 188 VAL n 
4 189 THR n 
4 190 VAL n 
4 191 PRO n 
4 192 SER n 
4 193 SER n 
4 194 THR n 
4 195 TRP n 
4 196 PRO n 
4 197 SER n 
4 198 GLN n 
4 199 THR n 
4 200 VAL n 
4 201 THR n 
4 202 CYS n 
4 203 SER n 
4 204 VAL n 
4 205 ALA n 
4 206 HIS n 
4 207 PRO n 
4 208 ALA n 
4 209 SER n 
4 210 SER n 
4 211 THR n 
4 212 THR n 
4 213 VAL n 
4 214 ASP n 
4 215 LYS n 
4 216 LYS n 
4 217 LEU n 
4 218 GLU n 
4 219 PRO n 
4 220 SER n 
5 1   ASP n 
5 2   ILE n 
5 3   VAL n 
5 4   LEU n 
5 5   THR n 
5 6   GLN n 
5 7   SER n 
5 8   PRO n 
5 9   ALA n 
5 10  ILE n 
5 11  MET n 
5 12  SER n 
5 13  ALA n 
5 14  SER n 
5 15  PRO n 
5 16  GLY n 
5 17  GLU n 
5 18  LYS n 
5 19  VAL n 
5 20  THR n 
5 21  MET n 
5 22  THR n 
5 23  CYS n 
5 24  SER n 
5 25  ALA n 
5 26  SER n 
5 27  SER n 
5 28  SER n 
5 29  VAL n 
5 30  THR n 
5 31  TYR n 
5 32  MET n 
5 33  TYR n 
5 34  TRP n 
5 35  TYR n 
5 36  GLN n 
5 37  GLN n 
5 38  LYS n 
5 39  PRO n 
5 40  GLY n 
5 41  SER n 
5 42  SER n 
5 43  PRO n 
5 44  ARG n 
5 45  LEU n 
5 46  LEU n 
5 47  ILE n 
5 48  TYR n 
5 49  ASP n 
5 50  THR n 
5 51  SER n 
5 52  ASN n 
5 53  LEU n 
5 54  ALA n 
5 55  SER n 
5 56  GLY n 
5 57  VAL n 
5 58  PRO n 
5 59  VAL n 
5 60  ARG n 
5 61  PHE n 
5 62  SER n 
5 63  GLY n 
5 64  SER n 
5 65  GLY n 
5 66  SER n 
5 67  GLY n 
5 68  THR n 
5 69  SER n 
5 70  TYR n 
5 71  SER n 
5 72  LEU n 
5 73  THR n 
5 74  ILE n 
5 75  SER n 
5 76  ARG n 
5 77  MET n 
5 78  GLU n 
5 79  ALA n 
5 80  GLU n 
5 81  ASP n 
5 82  ALA n 
5 83  ALA n 
5 84  THR n 
5 85  PHE n 
5 86  TYR n 
5 87  CYS n 
5 88  GLN n 
5 89  GLN n 
5 90  TRP n 
5 91  SER n 
5 92  SER n 
5 93  TYR n 
5 94  PRO n 
5 95  LEU n 
5 96  THR n 
5 97  PHE n 
5 98  GLY n 
5 99  ALA n 
5 100 GLY n 
5 101 THR n 
5 102 LYS n 
5 103 LEU n 
5 104 GLU n 
5 105 LEU n 
5 106 LYS n 
5 107 ARG n 
5 108 ALA n 
5 109 ASP n 
5 110 ALA n 
5 111 ALA n 
5 112 PRO n 
5 113 THR n 
5 114 VAL n 
5 115 SER n 
5 116 ILE n 
5 117 PHE n 
5 118 PRO n 
5 119 PRO n 
5 120 SER n 
5 121 SER n 
5 122 GLU n 
5 123 GLN n 
5 124 LEU n 
5 125 THR n 
5 126 SER n 
5 127 GLY n 
5 128 GLY n 
5 129 ALA n 
5 130 SER n 
5 131 VAL n 
5 132 VAL n 
5 133 CYS n 
5 134 PHE n 
5 135 LEU n 
5 136 ASN n 
5 137 ASN n 
5 138 PHE n 
5 139 TYR n 
5 140 PRO n 
5 141 LYS n 
5 142 ASP n 
5 143 ILE n 
5 144 ASN n 
5 145 VAL n 
5 146 LYS n 
5 147 TRP n 
5 148 LYS n 
5 149 ILE n 
5 150 ASP n 
5 151 GLY n 
5 152 SER n 
5 153 GLU n 
5 154 ARG n 
5 155 GLN n 
5 156 ASN n 
5 157 GLY n 
5 158 VAL n 
5 159 LEU n 
5 160 ASN n 
5 161 SER n 
5 162 TRP n 
5 163 THR n 
5 164 ASP n 
5 165 GLN n 
5 166 ASP n 
5 167 SER n 
5 168 LYS n 
5 169 ASP n 
5 170 SER n 
5 171 THR n 
5 172 TYR n 
5 173 SER n 
5 174 MET n 
5 175 SER n 
5 176 SER n 
5 177 THR n 
5 178 LEU n 
5 179 THR n 
5 180 LEU n 
5 181 THR n 
5 182 LYS n 
5 183 ASP n 
5 184 GLU n 
5 185 TYR n 
5 186 GLU n 
5 187 ARG n 
5 188 HIS n 
5 189 ASN n 
5 190 SER n 
5 191 TYR n 
5 192 THR n 
5 193 CYS n 
5 194 GLU n 
5 195 ALA n 
5 196 THR n 
5 197 HIS n 
5 198 LYS n 
5 199 THR n 
5 200 SER n 
5 201 THR n 
5 202 SER n 
5 203 PRO n 
5 204 ILE n 
5 205 VAL n 
5 206 LYS n 
5 207 SER n 
5 208 PHE n 
5 209 ASN n 
5 210 ARG n 
5 211 ASN n 
5 212 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  312 Human ? AGTR2 ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 
7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1  40  ?     ? cybC  ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 
7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 2 sample 'Biological sequence' 41 86  ?     ? cybC  ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 
7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4 1 sample 1 220 ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 1 212 ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       8 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP AGTR2_HUMAN P50052 ? 1 
;CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGP
VMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNA
CIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHV
LTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRES
;
35 
2 PDB 6JOD        6JOD   ? 2 ? 1  
3 UNP C562_ECOLX  P0ABE7 ? 3 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDA 23 
4 UNP C562_ECOLX  P0ABE7 ? 3 ILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR 89 
5 PDB 6JOD        6JOD   ? 4 ? 1  
6 PDB 6JOD        6JOD   ? 5 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6JOD A 1  ? 312 ? P50052 35 ? 346 ? 35   346  
2 2 6JOD B 1  ? 8   ? 6JOD   1  ? 8   ? 1    8    
3 3 6JOD C 1  ? 40  ? P0ABE7 23 ? 62  ? 1001 1060 
4 4 6JOD C 47 ? 86  ? P0ABE7 89 ? 128 ? 1067 1106 
5 5 6JOD H 1  ? 220 ? 6JOD   1  ? 220 ? 1    220  
6 6 6JOD L 1  ? 212 ? 6JOD   1  ? 212 ? 1    212  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6JOD ALA A 174 ? UNP P50052 SER 208 'engineered mutation' 208  1  
3 6JOD TRP C 7   ? UNP P0ABE7 MET 29  'engineered mutation' 1007 2  
3 6JOD GLY C 41  ? UNP P0ABE7 ?   ?   linker                1061 3  
3 6JOD SER C 42  ? UNP P0ABE7 ?   ?   linker                1062 4  
3 6JOD GLY C 43  ? UNP P0ABE7 ?   ?   linker                1063 5  
3 6JOD SER C 44  ? UNP P0ABE7 ?   ?   linker                1064 6  
3 6JOD GLY C 45  ? UNP P0ABE7 ?   ?   linker                1065 7  
3 6JOD ASP C 46  ? UNP P0ABE7 ?   ?   linker                1066 8  
4 6JOD ILE C 78  ? UNP P0ABE7 ARG 120 'engineered mutation' 1098 9  
4 6JOD ILE C 82  ? UNP P0ABE7 HIS 124 'engineered mutation' 1102 10 
4 6JOD GLY C 86  ? UNP P0ABE7 ARG 128 'engineered mutation' 1106 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6JOD 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.77 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;30% (v/v) PEG 300
0.1 M HEPES (pH 7.0)
100 mM Sodium phosphate dibasic dihydrate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX225-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-05-22 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL32XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL32XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            114.160 
_reflns.entry_id                         6JOD 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.20 
_reflns.d_resolution_low                 49.854 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19767 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.89 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  82.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.47 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.0498 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.2 
_reflns_shell.d_res_low                   3.31 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1933 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.551 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                374.930 
_refine.B_iso_mean                               141.9422 
_refine.B_iso_min                                60.510 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6JOD 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.2000 
_refine.ls_d_res_low                             49.8540 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     19767 
_refine.ls_number_reflns_R_free                  940 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8900 
_refine.ls_percent_reflns_R_free                 4.7600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2375 
_refine.ls_R_factor_R_free                       0.2869 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2350 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '5xjm, 1M6T' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 34.7900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.6000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.2000 
_refine_hist.d_res_low                        49.8540 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6257 
_refine_hist.pdbx_number_residues_total       805 
_refine_hist.pdbx_number_atoms_protein        6257 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 6425 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.609  ? 8754 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.041  ? 999  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 1088 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.015 ? 3798 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2001 3.3688  2758 . 133 2625 100.0000 . . . 0.4455 0.0000 0.3812 . . . . . . 7 . . . 
'X-RAY DIFFRACTION' 3.3688 3.5798  2769 . 133 2636 100.0000 . . . 0.3426 0.0000 0.3123 . . . . . . 7 . . . 
'X-RAY DIFFRACTION' 3.5798 3.8561  2774 . 136 2638 100.0000 . . . 0.3392 0.0000 0.2790 . . . . . . 7 . . . 
'X-RAY DIFFRACTION' 3.8561 4.2440  2788 . 137 2651 100.0000 . . . 0.2769 0.0000 0.2266 . . . . . . 7 . . . 
'X-RAY DIFFRACTION' 4.2440 4.8576  2826 . 122 2704 100.0000 . . . 0.2393 0.0000 0.1849 . . . . . . 7 . . . 
'X-RAY DIFFRACTION' 4.8576 6.1183  2851 . 133 2718 100.0000 . . . 0.2534 0.0000 0.2216 . . . . . . 7 . . . 
'X-RAY DIFFRACTION' 6.1183 49.8597 3001 . 146 2855 100.0000 . . . 0.2873 0.0000 0.2278 . . . . . . 7 . . . 
# 
_struct.entry_id                     6JOD 
_struct.title                        'Angiotensin II type 2 receptor with ligand' 
_struct.pdbx_descriptor              
;Type-2 angiotensin II receptor, Angiotensin II, Soluble cytochrome b562,Soluble cytochrome b562, Heavy chain of 4A03Fab, Light chain of 4A03Fab
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6JOD 
_struct_keywords.text            'G protein-coupled receptor, regulator of blood pressure, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 7   ? ASP A 11  ? ASP A 41   ASP A 45   5 ? 5  
HELX_P HELX_P2  AA2 ALA A 12  ? CYS A 37  ? ALA A 46   CYS A 71   1 ? 26 
HELX_P HELX_P3  AA3 LYS A 43  ? ALA A 61  ? LYS A 77   ALA A 95   1 ? 19 
HELX_P HELX_P4  AA4 THR A 62  ? TYR A 72  ? THR A 96   TYR A 106  1 ? 11 
HELX_P HELX_P5  AA5 GLY A 79  ? TYR A 114 ? GLY A 113  TYR A 148  1 ? 36 
HELX_P HELX_P6  AA6 ASN A 122 ? SER A 141 ? ASN A 156  SER A 175  1 ? 20 
HELX_P HELX_P7  AA7 SER A 141 ? PHE A 147 ? SER A 175  PHE A 181  1 ? 7  
HELX_P HELX_P8  AA8 PRO A 166 ? GLU A 168 ? PRO A 200  GLU A 202  5 ? 3  
HELX_P HELX_P9  AA9 LYS A 169 ? PHE A 186 ? LYS A 203  PHE A 220  1 ? 18 
HELX_P HELX_P10 AB1 PHE A 186 ? ASN A 208 ? PHE A 220  ASN A 242  1 ? 23 
HELX_P HELX_P11 AB2 GLY A 211 ? GLY A 251 ? GLY A 245  GLY A 285  1 ? 41 
HELX_P HELX_P12 AB3 SER A 255 ? CYS A 285 ? SER A 289  CYS A 319  1 ? 31 
HELX_P HELX_P13 AB4 GLY A 288 ? ARG A 300 ? GLY A 322  ARG A 334  1 ? 13 
HELX_P HELX_P14 AB5 ARG A 300 ? LEU A 306 ? ARG A 334  LEU A 340  1 ? 7  
HELX_P HELX_P15 AB6 THR C 9   ? LYS C 19  ? THR C 1009 LYS C 1019 1 ? 11 
HELX_P HELX_P16 AB7 ASN C 22  ? ASP C 39  ? ASN C 1022 ASP C 1039 1 ? 18 
HELX_P HELX_P17 AB8 LEU C 48  ? GLY C 62  ? LEU C 1068 GLY C 1082 1 ? 15 
HELX_P HELX_P18 AB9 LYS C 63  ? GLN C 73  ? LYS C 1083 GLN C 1093 1 ? 11 
HELX_P HELX_P19 AC1 ARG D 87  ? THR D 91  ? ARG H 87   THR H 91   5 ? 5  
HELX_P HELX_P20 AC2 GLU E 78  ? ALA E 82  ? GLU L 78   ALA L 82   5 ? 5  
HELX_P HELX_P21 AC3 SER E 120 ? GLY E 127 ? SER L 120  GLY L 127  1 ? 8  
HELX_P HELX_P22 AC4 LYS E 182 ? GLU E 186 ? LYS L 182  GLU L 186  1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 1   SG ? ? ? 1_555 A CYS 256 SG ? ? A CYS 35  A CYS 290 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 83  SG ? ? ? 1_555 A CYS 161 SG ? ? A CYS 117 A CYS 195 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? D CYS 22  SG ? ? ? 1_555 D CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4 disulf ? ? D CYS 147 SG ? ? ? 1_555 D CYS 202 SG ? ? H CYS 147 H CYS 202 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf5 disulf ? ? E CYS 23  SG ? ? ? 1_555 E CYS 87  SG ? ? L CYS 23  L CYS 87  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf6 disulf ? ? E CYS 133 SG ? ? ? 1_555 E CYS 193 SG ? ? L CYS 133 L CYS 193 1_555 ? ? ? ? ? ? ? 2.028 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 153 D . ? PHE 153 H PRO 154 D ? PRO 154 H 1 -3.40 
2 TRP 195 D . ? TRP 195 H PRO 196 D ? PRO 196 H 1 -1.80 
3 SER 7   E . ? SER 7   L PRO 8   E ? PRO 8   L 1 -5.38 
4 TYR 93  E . ? TYR 93  L PRO 94  E ? PRO 94  L 1 5.36  
5 TYR 139 E . ? TYR 139 L PRO 140 E ? PRO 140 L 1 1.76  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 6 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 3 ? 
AA7 ? 4 ? 
AA8 ? 6 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 148 ? ILE A 153 ? ARG A 182 ILE A 187 
AA1 2 VAL A 158 ? MET A 163 ? VAL A 192 MET A 197 
AA2 1 GLN D 3   ? SER D 7   ? GLN H 3   SER H 7   
AA2 2 SER D 17  ? SER D 25  ? SER H 17  SER H 25  
AA2 3 THR D 78  ? THR D 84  ? THR H 78  THR H 84  
AA2 4 PHE D 68  ? ASP D 73  ? PHE H 68  ASP H 73  
AA3 1 GLY D 10  ? VAL D 12  ? GLY H 10  VAL H 12  
AA3 2 THR D 114 ? VAL D 118 ? THR H 114 VAL H 118 
AA3 3 ALA D 92  ? THR D 98  ? ALA H 92  THR H 98  
AA3 4 MET D 34  ? GLN D 39  ? MET H 34  GLN H 39  
AA3 5 LEU D 45  ? ILE D 51  ? LEU H 45  ILE H 51  
AA3 6 ILE D 58  ? TYR D 60  ? ILE H 58  TYR H 60  
AA4 1 GLY D 10  ? VAL D 12  ? GLY H 10  VAL H 12  
AA4 2 THR D 114 ? VAL D 118 ? THR H 114 VAL H 118 
AA4 3 ALA D 92  ? THR D 98  ? ALA H 92  THR H 98  
AA4 4 TYR D 109 ? TRP D 110 ? TYR H 109 TRP H 110 
AA5 1 SER D 127 ? LEU D 131 ? SER H 127 LEU H 131 
AA5 2 SER D 142 ? TYR D 152 ? SER H 142 TYR H 152 
AA5 3 LEU D 181 ? PRO D 191 ? LEU H 181 PRO H 191 
AA5 4 VAL D 170 ? GLN D 178 ? VAL H 170 GLN H 178 
AA6 1 THR D 158 ? SER D 163 ? THR H 158 SER H 163 
AA6 2 THR D 201 ? HIS D 206 ? THR H 201 HIS H 206 
AA6 3 THR D 211 ? LYS D 215 ? THR H 211 LYS H 215 
AA7 1 LEU E 4   ? SER E 7   ? LEU L 4   SER L 7   
AA7 2 VAL E 19  ? ALA E 25  ? VAL L 19  ALA L 25  
AA7 3 SER E 69  ? ILE E 74  ? SER L 69  ILE L 74  
AA7 4 PHE E 61  ? SER E 66  ? PHE L 61  SER L 66  
AA8 1 ILE E 10  ? ALA E 13  ? ILE L 10  ALA L 13  
AA8 2 THR E 101 ? LEU E 105 ? THR L 101 LEU L 105 
AA8 3 THR E 84  ? TRP E 90  ? THR L 84  TRP L 90  
AA8 4 TYR E 31  ? GLN E 37  ? TYR L 31  GLN L 37  
AA8 5 ARG E 44  ? TYR E 48  ? ARG L 44  TYR L 48  
AA8 6 ASN E 52  ? LEU E 53  ? ASN L 52  LEU L 53  
AA9 1 ILE E 10  ? ALA E 13  ? ILE L 10  ALA L 13  
AA9 2 THR E 101 ? LEU E 105 ? THR L 101 LEU L 105 
AA9 3 THR E 84  ? TRP E 90  ? THR L 84  TRP L 90  
AA9 4 THR E 96  ? PHE E 97  ? THR L 96  PHE L 97  
AB1 1 THR E 113 ? PHE E 117 ? THR L 113 PHE L 117 
AB1 2 GLY E 128 ? PHE E 138 ? GLY L 128 PHE L 138 
AB1 3 TYR E 172 ? THR E 181 ? TYR L 172 THR L 181 
AB1 4 VAL E 158 ? TRP E 162 ? VAL L 158 TRP L 162 
AB2 1 SER E 152 ? ARG E 154 ? SER L 152 ARG L 154 
AB2 2 ILE E 143 ? ILE E 149 ? ILE L 143 ILE L 149 
AB2 3 SER E 190 ? HIS E 197 ? SER L 190 HIS L 197 
AB2 4 ILE E 204 ? ASN E 209 ? ILE L 204 ASN L 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 153 ? N ILE A 187 O VAL A 158 ? O VAL A 192 
AA2 1 2 N GLN D 3   ? N GLN H 3   O SER D 25  ? O SER H 25  
AA2 2 3 N LEU D 20  ? N LEU H 20  O LEU D 81  ? O LEU H 81  
AA2 3 4 O THR D 78  ? O THR H 78  N ASP D 73  ? N ASP H 73  
AA3 1 2 N VAL D 12  ? N VAL H 12  O THR D 117 ? O THR H 117 
AA3 2 3 O THR D 114 ? O THR H 114 N TYR D 94  ? N TYR H 94  
AA3 3 4 O PHE D 95  ? O PHE H 95  N VAL D 37  ? N VAL H 37  
AA3 4 5 N MET D 34  ? N MET H 34  O ILE D 51  ? O ILE H 51  
AA3 5 6 N TYR D 50  ? N TYR H 50  O TYR D 59  ? O TYR H 59  
AA4 1 2 N VAL D 12  ? N VAL H 12  O THR D 117 ? O THR H 117 
AA4 2 3 O THR D 114 ? O THR H 114 N TYR D 94  ? N TYR H 94  
AA4 3 4 N THR D 98  ? N THR H 98  O TYR D 109 ? O TYR H 109 
AA5 1 2 N TYR D 129 ? N TYR H 129 O LEU D 148 ? O LEU H 148 
AA5 2 3 N TYR D 152 ? N TYR H 152 O TYR D 182 ? O TYR H 182 
AA5 3 4 O LEU D 181 ? O LEU H 181 N GLN D 178 ? N GLN H 178 
AA6 1 2 N THR D 160 ? N THR H 160 O SER D 203 ? O SER H 203 
AA6 2 3 N HIS D 206 ? N HIS H 206 O THR D 211 ? O THR H 211 
AA7 1 2 N SER E 7   ? N SER L 7   O THR E 22  ? O THR L 22  
AA7 2 3 N MET E 21  ? N MET L 21  O LEU E 72  ? O LEU L 72  
AA7 3 4 O SER E 69  ? O SER L 69  N SER E 66  ? N SER L 66  
AA8 1 2 N MET E 11  ? N MET L 11  O GLU E 104 ? O GLU L 104 
AA8 2 3 O THR E 101 ? O THR L 101 N PHE E 85  ? N PHE L 85  
AA8 3 4 O THR E 84  ? O THR L 84  N GLN E 37  ? N GLN L 37  
AA8 4 5 N TRP E 34  ? N TRP L 34  O LEU E 46  ? O LEU L 46  
AA8 5 6 N TYR E 48  ? N TYR L 48  O ASN E 52  ? O ASN L 52  
AA9 1 2 N MET E 11  ? N MET L 11  O GLU E 104 ? O GLU L 104 
AA9 2 3 O THR E 101 ? O THR L 101 N PHE E 85  ? N PHE L 85  
AA9 3 4 N GLN E 89  ? N GLN L 89  O THR E 96  ? O THR L 96  
AB1 1 2 N PHE E 117 ? N PHE L 117 O VAL E 132 ? O VAL L 132 
AB1 2 3 N PHE E 138 ? N PHE L 138 O TYR E 172 ? O TYR L 172 
AB1 3 4 O THR E 177 ? O THR L 177 N LEU E 159 ? N LEU L 159 
AB2 1 2 O SER E 152 ? O SER L 152 N ILE E 149 ? N ILE L 149 
AB2 2 3 N LYS E 146 ? N LYS L 146 O GLU E 194 ? O GLU L 194 
AB2 3 4 N TYR E 191 ? N TYR L 191 O PHE E 208 ? O PHE L 208 
# 
_atom_sites.entry_id                    6JOD 
_atom_sites.fract_transf_matrix[1][1]   0.009751 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002345 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018975 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . CYS A 1 1   ? 35.604 55.962  15.842  1.00 232.27 ? 35   CYS A N   1 
ATOM 2    C CA  . CYS A 1 1   ? 34.566 54.959  16.052  1.00 223.46 ? 35   CYS A CA  1 
ATOM 3    C C   . CYS A 1 1   ? 33.198 55.512  15.679  1.00 215.75 ? 35   CYS A C   1 
ATOM 4    O O   . CYS A 1 1   ? 32.538 55.004  14.772  1.00 205.98 ? 35   CYS A O   1 
ATOM 5    C CB  . CYS A 1 1   ? 34.553 54.489  17.509  1.00 236.37 ? 35   CYS A CB  1 
ATOM 6    S SG  . CYS A 1 1   ? 34.155 52.733  17.747  1.00 237.40 ? 35   CYS A SG  1 
ATOM 7    N N   . SER A 1 2   ? 32.785 56.569  16.382  1.00 227.29 ? 36   SER A N   1 
ATOM 8    C CA  . SER A 1 2   ? 31.458 57.150  16.205  1.00 226.93 ? 36   SER A CA  1 
ATOM 9    C C   . SER A 1 2   ? 31.178 57.583  14.770  1.00 225.34 ? 36   SER A C   1 
ATOM 10   O O   . SER A 1 2   ? 30.024 57.889  14.449  1.00 217.59 ? 36   SER A O   1 
ATOM 11   C CB  . SER A 1 2   ? 31.291 58.339  17.153  1.00 237.98 ? 36   SER A CB  1 
ATOM 12   O OG  . SER A 1 2   ? 29.979 58.870  17.086  1.00 236.00 ? 36   SER A OG  1 
ATOM 13   N N   . GLN A 1 3   ? 32.194 57.615  13.908  1.00 227.26 ? 37   GLN A N   1 
ATOM 14   C CA  . GLN A 1 3   ? 32.009 57.915  12.496  1.00 223.63 ? 37   GLN A CA  1 
ATOM 15   C C   . GLN A 1 3   ? 31.072 56.893  11.850  1.00 215.16 ? 37   GLN A C   1 
ATOM 16   O O   . GLN A 1 3   ? 30.927 55.760  12.318  1.00 213.95 ? 37   GLN A O   1 
ATOM 17   C CB  . GLN A 1 3   ? 33.364 57.918  11.786  1.00 218.84 ? 37   GLN A CB  1 
ATOM 18   C CG  . GLN A 1 3   ? 33.382 58.609  10.437  1.00 214.98 ? 37   GLN A CG  1 
ATOM 19   C CD  . GLN A 1 3   ? 34.011 59.991  10.489  1.00 220.49 ? 37   GLN A CD  1 
ATOM 20   O OE1 . GLN A 1 3   ? 34.242 60.617  9.455   1.00 214.29 ? 37   GLN A OE1 1 
ATOM 21   N NE2 . GLN A 1 3   ? 34.292 60.471  11.695  1.00 219.27 ? 37   GLN A NE2 1 
ATOM 22   N N   . LYS A 1 4   ? 30.430 57.305  10.758  1.00 216.19 ? 38   LYS A N   1 
ATOM 23   C CA  . LYS A 1 4   ? 29.465 56.441  10.091  1.00 208.81 ? 38   LYS A CA  1 
ATOM 24   C C   . LYS A 1 4   ? 30.163 55.257  9.416   1.00 208.03 ? 38   LYS A C   1 
ATOM 25   O O   . LYS A 1 4   ? 31.302 55.376  8.957   1.00 217.59 ? 38   LYS A O   1 
ATOM 26   C CB  . LYS A 1 4   ? 28.662 57.233  9.065   1.00 206.48 ? 38   LYS A CB  1 
ATOM 27   C CG  . LYS A 1 4   ? 27.607 58.123  9.691   1.00 212.15 ? 38   LYS A CG  1 
ATOM 28   C CD  . LYS A 1 4   ? 26.631 57.314  10.535  1.00 205.07 ? 38   LYS A CD  1 
ATOM 29   C CE  . LYS A 1 4   ? 25.727 58.224  11.353  1.00 209.57 ? 38   LYS A CE  1 
ATOM 30   N NZ  . LYS A 1 4   ? 24.709 57.474  12.139  1.00 202.97 ? 38   LYS A NZ  1 
ATOM 31   N N   . PRO A 1 5   ? 29.494 54.108  9.334   1.00 189.63 ? 39   PRO A N   1 
ATOM 32   C CA  . PRO A 1 5   ? 30.145 52.879  8.865   1.00 175.36 ? 39   PRO A CA  1 
ATOM 33   C C   . PRO A 1 5   ? 30.322 52.861  7.348   1.00 168.45 ? 39   PRO A C   1 
ATOM 34   O O   . PRO A 1 5   ? 29.963 53.797  6.636   1.00 170.80 ? 39   PRO A O   1 
ATOM 35   C CB  . PRO A 1 5   ? 29.178 51.785  9.323   1.00 173.40 ? 39   PRO A CB  1 
ATOM 36   C CG  . PRO A 1 5   ? 27.848 52.446  9.281   1.00 175.09 ? 39   PRO A CG  1 
ATOM 37   C CD  . PRO A 1 5   ? 28.095 53.864  9.731   1.00 183.47 ? 39   PRO A CD  1 
ATOM 38   N N   . SER A 1 6   ? 30.884 51.754  6.865   1.00 161.43 ? 40   SER A N   1 
ATOM 39   C CA  . SER A 1 6   ? 31.189 51.557  5.456   1.00 156.25 ? 40   SER A CA  1 
ATOM 40   C C   . SER A 1 6   ? 29.984 51.000  4.705   1.00 144.61 ? 40   SER A C   1 
ATOM 41   O O   . SER A 1 6   ? 29.068 50.410  5.283   1.00 140.82 ? 40   SER A O   1 
ATOM 42   C CB  . SER A 1 6   ? 32.377 50.609  5.285   1.00 151.63 ? 40   SER A CB  1 
ATOM 43   O OG  . SER A 1 6   ? 33.456 50.981  6.122   1.00 160.71 ? 40   SER A OG  1 
ATOM 44   N N   . ASP A 1 7   ? 30.002 51.194  3.385   1.00 167.14 ? 41   ASP A N   1 
ATOM 45   C CA  . ASP A 1 7   ? 28.978 50.646  2.506   1.00 165.16 ? 41   ASP A CA  1 
ATOM 46   C C   . ASP A 1 7   ? 29.597 49.920  1.317   1.00 170.13 ? 41   ASP A C   1 
ATOM 47   O O   . ASP A 1 7   ? 28.908 49.662  0.323   1.00 131.06 ? 41   ASP A O   1 
ATOM 48   C CB  . ASP A 1 7   ? 28.017 51.747  2.035   1.00 154.22 ? 41   ASP A CB  1 
ATOM 49   C CG  . ASP A 1 7   ? 28.678 52.782  1.127   1.00 165.47 ? 41   ASP A CG  1 
ATOM 50   O OD1 . ASP A 1 7   ? 29.850 53.158  1.353   1.00 147.82 ? 41   ASP A OD1 1 
ATOM 51   O OD2 . ASP A 1 7   ? 27.998 53.236  0.182   1.00 141.47 ? 41   ASP A OD2 1 
ATOM 52   N N   . LYS A 1 8   ? 30.882 49.565  1.414   1.00 168.75 ? 42   LYS A N   1 
ATOM 53   C CA  . LYS A 1 8   ? 31.589 48.987  0.276   1.00 169.22 ? 42   LYS A CA  1 
ATOM 54   C C   . LYS A 1 8   ? 31.040 47.616  -0.092  1.00 166.09 ? 42   LYS A C   1 
ATOM 55   O O   . LYS A 1 8   ? 31.027 47.246  -1.271  1.00 173.15 ? 42   LYS A O   1 
ATOM 56   C CB  . LYS A 1 8   ? 33.084 48.878  0.589   1.00 174.32 ? 42   LYS A CB  1 
ATOM 57   C CG  . LYS A 1 8   ? 33.571 49.749  1.743   1.00 182.26 ? 42   LYS A CG  1 
ATOM 58   C CD  . LYS A 1 8   ? 33.804 51.190  1.310   1.00 192.68 ? 42   LYS A CD  1 
ATOM 59   C CE  . LYS A 1 8   ? 34.419 52.017  2.430   1.00 204.57 ? 42   LYS A CE  1 
ATOM 60   N NZ  . LYS A 1 8   ? 34.672 53.430  2.021   1.00 213.51 ? 42   LYS A NZ  1 
ATOM 61   N N   . HIS A 1 9   ? 30.579 46.858  0.903   1.00 158.14 ? 43   HIS A N   1 
ATOM 62   C CA  . HIS A 1 9   ? 30.231 45.460  0.685   1.00 136.05 ? 43   HIS A CA  1 
ATOM 63   C C   . HIS A 1 9   ? 28.987 45.297  -0.179  1.00 127.40 ? 43   HIS A C   1 
ATOM 64   O O   . HIS A 1 9   ? 28.889 44.323  -0.933  1.00 133.72 ? 43   HIS A O   1 
ATOM 65   C CB  . HIS A 1 9   ? 30.032 44.771  2.032   1.00 132.29 ? 43   HIS A CB  1 
ATOM 66   C CG  . HIS A 1 9   ? 29.102 45.502  2.951   1.00 137.16 ? 43   HIS A CG  1 
ATOM 67   N ND1 . HIS A 1 9   ? 29.441 46.689  3.566   1.00 140.43 ? 43   HIS A ND1 1 
ATOM 68   C CD2 . HIS A 1 9   ? 27.846 45.211  3.364   1.00 134.02 ? 43   HIS A CD2 1 
ATOM 69   C CE1 . HIS A 1 9   ? 28.433 47.096  4.317   1.00 141.10 ? 43   HIS A CE1 1 
ATOM 70   N NE2 . HIS A 1 9   ? 27.452 46.218  4.211   1.00 134.25 ? 43   HIS A NE2 1 
ATOM 71   N N   . LEU A 1 10  ? 28.039 46.234  -0.104  1.00 127.31 ? 44   LEU A N   1 
ATOM 72   C CA  . LEU A 1 10  ? 26.753 46.071  -0.777  1.00 132.43 ? 44   LEU A CA  1 
ATOM 73   C C   . LEU A 1 10  ? 26.872 45.912  -2.287  1.00 138.38 ? 44   LEU A C   1 
ATOM 74   O O   . LEU A 1 10  ? 25.882 45.539  -2.928  1.00 132.32 ? 44   LEU A O   1 
ATOM 75   C CB  . LEU A 1 10  ? 25.840 47.258  -0.477  1.00 140.00 ? 44   LEU A CB  1 
ATOM 76   C CG  . LEU A 1 10  ? 25.457 47.473  0.985   1.00 146.09 ? 44   LEU A CG  1 
ATOM 77   C CD1 . LEU A 1 10  ? 24.376 48.535  1.084   1.00 149.84 ? 44   LEU A CD1 1 
ATOM 78   C CD2 . LEU A 1 10  ? 25.003 46.169  1.622   1.00 135.71 ? 44   LEU A CD2 1 
ATOM 79   N N   . ASP A 1 11  ? 28.034 46.197  -2.877  1.00 154.70 ? 45   ASP A N   1 
ATOM 80   C CA  . ASP A 1 11  ? 28.191 45.987  -4.312  1.00 166.30 ? 45   ASP A CA  1 
ATOM 81   C C   . ASP A 1 11  ? 28.223 44.508  -4.665  1.00 165.43 ? 45   ASP A C   1 
ATOM 82   O O   . ASP A 1 11  ? 27.742 44.116  -5.733  1.00 161.91 ? 45   ASP A O   1 
ATOM 83   C CB  . ASP A 1 11  ? 29.464 46.672  -4.807  1.00 176.00 ? 45   ASP A CB  1 
ATOM 84   C CG  . ASP A 1 11  ? 29.404 48.174  -4.674  1.00 181.13 ? 45   ASP A CG  1 
ATOM 85   O OD1 . ASP A 1 11  ? 29.458 48.666  -3.525  1.00 184.06 ? 45   ASP A OD1 1 
ATOM 86   O OD2 . ASP A 1 11  ? 29.302 48.864  -5.712  1.00 182.88 ? 45   ASP A OD2 1 
ATOM 87   N N   . ALA A 1 12  ? 28.780 43.678  -3.785  1.00 168.01 ? 46   ALA A N   1 
ATOM 88   C CA  . ALA A 1 12  ? 28.952 42.260  -4.062  1.00 163.32 ? 46   ALA A CA  1 
ATOM 89   C C   . ALA A 1 12  ? 27.789 41.403  -3.585  1.00 160.12 ? 46   ALA A C   1 
ATOM 90   O O   . ALA A 1 12  ? 27.628 40.281  -4.077  1.00 164.43 ? 46   ALA A O   1 
ATOM 91   C CB  . ALA A 1 12  ? 30.251 41.759  -3.421  1.00 169.42 ? 46   ALA A CB  1 
ATOM 92   N N   . ILE A 1 13  ? 26.974 41.904  -2.655  1.00 151.62 ? 47   ILE A N   1 
ATOM 93   C CA  . ILE A 1 13  ? 25.925 41.075  -2.052  1.00 139.95 ? 47   ILE A CA  1 
ATOM 94   C C   . ILE A 1 13  ? 24.905 40.572  -3.073  1.00 137.70 ? 47   ILE A C   1 
ATOM 95   O O   . ILE A 1 13  ? 24.655 39.354  -3.115  1.00 141.20 ? 47   ILE A O   1 
ATOM 96   C CB  . ILE A 1 13  ? 25.272 41.828  -0.882  1.00 124.08 ? 47   ILE A CB  1 
ATOM 97   C CG1 . ILE A 1 13  ? 26.235 41.872  0.307   1.00 123.09 ? 47   ILE A CG1 1 
ATOM 98   C CG2 . ILE A 1 13  ? 23.935 41.206  -0.502  1.00 117.22 ? 47   ILE A CG2 1 
ATOM 99   C CD1 . ILE A 1 13  ? 25.693 42.586  1.519   1.00 121.77 ? 47   ILE A CD1 1 
ATOM 100  N N   . PRO A 1 14  ? 24.289 41.420  -3.907  1.00 136.60 ? 48   PRO A N   1 
ATOM 101  C CA  . PRO A 1 14  ? 23.248 40.899  -4.816  1.00 133.19 ? 48   PRO A CA  1 
ATOM 102  C C   . PRO A 1 14  ? 23.755 39.847  -5.788  1.00 137.70 ? 48   PRO A C   1 
ATOM 103  O O   . PRO A 1 14  ? 23.054 38.860  -6.052  1.00 142.50 ? 48   PRO A O   1 
ATOM 104  C CB  . PRO A 1 14  ? 22.764 42.159  -5.540  1.00 131.34 ? 48   PRO A CB  1 
ATOM 105  C CG  . PRO A 1 14  ? 23.915 43.099  -5.471  1.00 137.18 ? 48   PRO A CG  1 
ATOM 106  C CD  . PRO A 1 14  ? 24.523 42.859  -4.128  1.00 139.27 ? 48   PRO A CD  1 
ATOM 107  N N   . ILE A 1 15  ? 24.952 40.041  -6.349  1.00 135.05 ? 49   ILE A N   1 
ATOM 108  C CA  . ILE A 1 15  ? 25.506 39.060  -7.281  1.00 131.60 ? 49   ILE A CA  1 
ATOM 109  C C   . ILE A 1 15  ? 25.627 37.698  -6.610  1.00 130.88 ? 49   ILE A C   1 
ATOM 110  O O   . ILE A 1 15  ? 25.198 36.673  -7.156  1.00 140.98 ? 49   ILE A O   1 
ATOM 111  C CB  . ILE A 1 15  ? 26.861 39.541  -7.828  1.00 132.29 ? 49   ILE A CB  1 
ATOM 112  C CG1 . ILE A 1 15  ? 26.661 40.724  -8.781  1.00 143.05 ? 49   ILE A CG1 1 
ATOM 113  C CG2 . ILE A 1 15  ? 27.587 38.398  -8.524  1.00 126.93 ? 49   ILE A CG2 1 
ATOM 114  C CD1 . ILE A 1 15  ? 25.761 40.420  -9.972  1.00 143.03 ? 49   ILE A CD1 1 
ATOM 115  N N   . LEU A 1 16  ? 26.221 37.666  -5.414  1.00 127.24 ? 50   LEU A N   1 
ATOM 116  C CA  . LEU A 1 16  ? 26.313 36.417  -4.663  1.00 126.38 ? 50   LEU A CA  1 
ATOM 117  C C   . LEU A 1 16  ? 24.935 35.803  -4.443  1.00 122.40 ? 50   LEU A C   1 
ATOM 118  O O   . LEU A 1 16  ? 24.746 34.589  -4.610  1.00 124.73 ? 50   LEU A O   1 
ATOM 119  C CB  . LEU A 1 16  ? 27.012 36.662  -3.326  1.00 116.22 ? 50   LEU A CB  1 
ATOM 120  C CG  . LEU A 1 16  ? 28.421 37.245  -3.375  1.00 120.90 ? 50   LEU A CG  1 
ATOM 121  C CD1 . LEU A 1 16  ? 29.022 37.251  -1.985  1.00 133.13 ? 50   LEU A CD1 1 
ATOM 122  C CD2 . LEU A 1 16  ? 29.290 36.458  -4.334  1.00 120.91 ? 50   LEU A CD2 1 
ATOM 123  N N   . TYR A 1 17  ? 23.956 36.631  -4.067  1.00 92.61  ? 51   TYR A N   1 
ATOM 124  C CA  . TYR A 1 17  ? 22.596 36.122  -3.913  1.00 104.66 ? 51   TYR A CA  1 
ATOM 125  C C   . TYR A 1 17  ? 22.119 35.432  -5.183  1.00 111.59 ? 51   TYR A C   1 
ATOM 126  O O   . TYR A 1 17  ? 21.499 34.365  -5.126  1.00 119.11 ? 51   TYR A O   1 
ATOM 127  C CB  . TYR A 1 17  ? 21.641 37.251  -3.530  1.00 106.34 ? 51   TYR A CB  1 
ATOM 128  C CG  . TYR A 1 17  ? 21.508 37.464  -2.041  1.00 107.46 ? 51   TYR A CG  1 
ATOM 129  C CD1 . TYR A 1 17  ? 22.626 37.709  -1.260  1.00 117.80 ? 51   TYR A CD1 1 
ATOM 130  C CD2 . TYR A 1 17  ? 20.264 37.432  -1.417  1.00 96.27  ? 51   TYR A CD2 1 
ATOM 131  C CE1 . TYR A 1 17  ? 22.518 37.908  0.102   1.00 120.37 ? 51   TYR A CE1 1 
ATOM 132  C CE2 . TYR A 1 17  ? 20.147 37.634  -0.051  1.00 104.11 ? 51   TYR A CE2 1 
ATOM 133  C CZ  . TYR A 1 17  ? 21.280 37.872  0.702   1.00 116.09 ? 51   TYR A CZ  1 
ATOM 134  O OH  . TYR A 1 17  ? 21.186 38.076  2.061   1.00 118.03 ? 51   TYR A OH  1 
ATOM 135  N N   . TYR A 1 18  ? 22.387 36.036  -6.345  1.00 112.44 ? 52   TYR A N   1 
ATOM 136  C CA  . TYR A 1 18  ? 21.926 35.439  -7.598  1.00 118.36 ? 52   TYR A CA  1 
ATOM 137  C C   . TYR A 1 18  ? 22.647 34.127  -7.887  1.00 118.41 ? 52   TYR A C   1 
ATOM 138  O O   . TYR A 1 18  ? 22.041 33.175  -8.395  1.00 125.49 ? 52   TYR A O   1 
ATOM 139  C CB  . TYR A 1 18  ? 22.113 36.419  -8.757  1.00 132.36 ? 52   TYR A CB  1 
ATOM 140  C CG  . TYR A 1 18  ? 20.835 37.115  -9.189  1.00 147.24 ? 52   TYR A CG  1 
ATOM 141  C CD1 . TYR A 1 18  ? 20.232 38.062  -8.377  1.00 153.16 ? 52   TYR A CD1 1 
ATOM 142  C CD2 . TYR A 1 18  ? 20.241 36.834  -10.417 1.00 153.77 ? 52   TYR A CD2 1 
ATOM 143  C CE1 . TYR A 1 18  ? 19.069 38.707  -8.763  1.00 157.78 ? 52   TYR A CE1 1 
ATOM 144  C CE2 . TYR A 1 18  ? 19.075 37.477  -10.813 1.00 156.01 ? 52   TYR A CE2 1 
ATOM 145  C CZ  . TYR A 1 18  ? 18.496 38.413  -9.979  1.00 158.59 ? 52   TYR A CZ  1 
ATOM 146  O OH  . TYR A 1 18  ? 17.341 39.061  -10.353 1.00 160.74 ? 52   TYR A OH  1 
ATOM 147  N N   . ILE A 1 19  ? 23.947 34.073  -7.593  1.00 117.70 ? 53   ILE A N   1 
ATOM 148  C CA  . ILE A 1 19  ? 24.723 32.844  -7.765  1.00 115.07 ? 53   ILE A CA  1 
ATOM 149  C C   . ILE A 1 19  ? 24.093 31.710  -6.968  1.00 113.76 ? 53   ILE A C   1 
ATOM 150  O O   . ILE A 1 19  ? 23.736 30.652  -7.508  1.00 118.50 ? 53   ILE A O   1 
ATOM 151  C CB  . ILE A 1 19  ? 26.182 33.077  -7.337  1.00 110.32 ? 53   ILE A CB  1 
ATOM 152  C CG1 . ILE A 1 19  ? 26.854 34.086  -8.269  1.00 98.20  ? 53   ILE A CG1 1 
ATOM 153  C CG2 . ILE A 1 19  ? 26.941 31.760  -7.268  1.00 110.37 ? 53   ILE A CG2 1 
ATOM 154  C CD1 . ILE A 1 19  ? 28.215 34.530  -7.792  1.00 101.24 ? 53   ILE A CD1 1 
ATOM 155  N N   . ILE A 1 20  ? 23.949 31.925  -5.660  1.00 116.47 ? 54   ILE A N   1 
ATOM 156  C CA  . ILE A 1 20  ? 23.313 30.928  -4.803  1.00 126.22 ? 54   ILE A CA  1 
ATOM 157  C C   . ILE A 1 20  ? 21.934 30.561  -5.337  1.00 133.14 ? 54   ILE A C   1 
ATOM 158  O O   . ILE A 1 20  ? 21.549 29.384  -5.350  1.00 144.42 ? 54   ILE A O   1 
ATOM 159  C CB  . ILE A 1 20  ? 23.245 31.443  -3.354  1.00 121.01 ? 54   ILE A CB  1 
ATOM 160  C CG1 . ILE A 1 20  ? 24.651 31.728  -2.823  1.00 123.51 ? 54   ILE A CG1 1 
ATOM 161  C CG2 . ILE A 1 20  ? 22.504 30.465  -2.461  1.00 118.36 ? 54   ILE A CG2 1 
ATOM 162  C CD1 . ILE A 1 20  ? 25.701 30.697  -3.238  1.00 119.40 ? 54   ILE A CD1 1 
ATOM 163  N N   . PHE A 1 21  ? 21.177 31.559  -5.798  1.00 121.09 ? 55   PHE A N   1 
ATOM 164  C CA  . PHE A 1 21  ? 19.833 31.312  -6.312  1.00 120.63 ? 55   PHE A CA  1 
ATOM 165  C C   . PHE A 1 21  ? 19.836 30.359  -7.497  1.00 123.55 ? 55   PHE A C   1 
ATOM 166  O O   . PHE A 1 21  ? 19.025 29.431  -7.558  1.00 128.31 ? 55   PHE A O   1 
ATOM 167  C CB  . PHE A 1 21  ? 19.165 32.621  -6.720  1.00 121.25 ? 55   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 21  ? 18.032 32.432  -7.697  1.00 123.50 ? 55   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 21  ? 16.780 32.026  -7.258  1.00 123.33 ? 55   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 21  ? 18.219 32.646  -9.056  1.00 122.86 ? 55   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 21  ? 15.738 31.846  -8.152  1.00 123.52 ? 55   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 21  ? 17.179 32.463  -9.953  1.00 123.85 ? 55   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 21  ? 15.940 32.064  -9.500  1.00 124.60 ? 55   PHE A CZ  1 
ATOM 174  N N   . VAL A 1 22  ? 20.685 30.619  -8.492  1.00 126.41 ? 56   VAL A N   1 
ATOM 175  C CA  . VAL A 1 22  ? 20.667 29.766  -9.675  1.00 131.75 ? 56   VAL A CA  1 
ATOM 176  C C   . VAL A 1 22  ? 21.162 28.369  -9.322  1.00 127.89 ? 56   VAL A C   1 
ATOM 177  O O   . VAL A 1 22  ? 20.581 27.367  -9.761  1.00 128.12 ? 56   VAL A O   1 
ATOM 178  C CB  . VAL A 1 22  ? 21.461 30.398  -10.837 1.00 141.42 ? 56   VAL A CB  1 
ATOM 179  C CG1 . VAL A 1 22  ? 22.951 30.475  -10.531 1.00 143.27 ? 56   VAL A CG1 1 
ATOM 180  C CG2 . VAL A 1 22  ? 21.219 29.625  -12.125 1.00 144.05 ? 56   VAL A CG2 1 
ATOM 181  N N   . ILE A 1 23  ? 22.200 28.271  -8.481  1.00 126.19 ? 57   ILE A N   1 
ATOM 182  C CA  . ILE A 1 23  ? 22.725 26.952  -8.123  1.00 126.06 ? 57   ILE A CA  1 
ATOM 183  C C   . ILE A 1 23  ? 21.653 26.133  -7.411  1.00 120.10 ? 57   ILE A C   1 
ATOM 184  O O   . ILE A 1 23  ? 21.286 25.034  -7.848  1.00 128.60 ? 57   ILE A O   1 
ATOM 185  C CB  . ILE A 1 23  ? 24.003 27.078  -7.272  1.00 118.77 ? 57   ILE A CB  1 
ATOM 186  C CG1 . ILE A 1 23  ? 25.118 27.760  -8.062  1.00 120.65 ? 57   ILE A CG1 1 
ATOM 187  C CG2 . ILE A 1 23  ? 24.497 25.704  -6.826  1.00 105.48 ? 57   ILE A CG2 1 
ATOM 188  C CD1 . ILE A 1 23  ? 26.448 27.797  -7.330  1.00 119.90 ? 57   ILE A CD1 1 
ATOM 189  N N   . GLY A 1 24  ? 21.121 26.670  -6.314  1.00 106.46 ? 58   GLY A N   1 
ATOM 190  C CA  . GLY A 1 24  ? 20.129 25.932  -5.550  1.00 120.75 ? 58   GLY A CA  1 
ATOM 191  C C   . GLY A 1 24  ? 18.841 25.700  -6.317  1.00 124.60 ? 58   GLY A C   1 
ATOM 192  O O   . GLY A 1 24  ? 18.199 24.658  -6.169  1.00 130.44 ? 58   GLY A O   1 
ATOM 193  N N   . PHE A 1 25  ? 18.438 26.673  -7.132  1.00 129.43 ? 59   PHE A N   1 
ATOM 194  C CA  . PHE A 1 25  ? 17.223 26.532  -7.921  1.00 139.90 ? 59   PHE A CA  1 
ATOM 195  C C   . PHE A 1 25  ? 17.373 25.493  -9.019  1.00 147.19 ? 59   PHE A C   1 
ATOM 196  O O   . PHE A 1 25  ? 16.364 24.974  -9.504  1.00 153.05 ? 59   PHE A O   1 
ATOM 197  C CB  . PHE A 1 25  ? 16.830 27.883  -8.525  1.00 142.73 ? 59   PHE A CB  1 
ATOM 198  C CG  . PHE A 1 25  ? 15.366 27.997  -8.847  1.00 138.36 ? 59   PHE A CG  1 
ATOM 199  C CD1 . PHE A 1 25  ? 14.442 28.224  -7.843  1.00 134.33 ? 59   PHE A CD1 1 
ATOM 200  C CD2 . PHE A 1 25  ? 14.913 27.878  -10.153 1.00 141.15 ? 59   PHE A CD2 1 
ATOM 201  C CE1 . PHE A 1 25  ? 13.095 28.329  -8.126  1.00 140.27 ? 59   PHE A CE1 1 
ATOM 202  C CE2 . PHE A 1 25  ? 13.565 27.983  -10.445 1.00 142.31 ? 59   PHE A CE2 1 
ATOM 203  C CZ  . PHE A 1 25  ? 12.654 28.209  -9.429  1.00 144.90 ? 59   PHE A CZ  1 
ATOM 204  N N   . LEU A 1 26  ? 18.602 25.196  -9.443  1.00 143.61 ? 60   LEU A N   1 
ATOM 205  C CA  . LEU A 1 26  ? 18.802 24.047  -10.320 1.00 145.88 ? 60   LEU A CA  1 
ATOM 206  C C   . LEU A 1 26  ? 18.800 22.743  -9.528  1.00 147.70 ? 60   LEU A C   1 
ATOM 207  O O   . LEU A 1 26  ? 18.015 21.834  -9.816  1.00 153.41 ? 60   LEU A O   1 
ATOM 208  C CB  . LEU A 1 26  ? 20.107 24.195  -11.106 1.00 137.12 ? 60   LEU A CB  1 
ATOM 209  C CG  . LEU A 1 26  ? 20.143 25.327  -12.131 1.00 128.39 ? 60   LEU A CG  1 
ATOM 210  C CD1 . LEU A 1 26  ? 21.384 25.226  -13.006 1.00 122.22 ? 60   LEU A CD1 1 
ATOM 211  C CD2 . LEU A 1 26  ? 18.871 25.339  -12.973 1.00 128.70 ? 60   LEU A CD2 1 
ATOM 212  N N   . VAL A 1 27  ? 19.665 22.645  -8.513  1.00 144.86 ? 61   VAL A N   1 
ATOM 213  C CA  . VAL A 1 27  ? 19.835 21.389  -7.777  1.00 150.93 ? 61   VAL A CA  1 
ATOM 214  C C   . VAL A 1 27  ? 18.514 20.940  -7.155  1.00 156.28 ? 61   VAL A C   1 
ATOM 215  O O   . VAL A 1 27  ? 18.038 19.817  -7.388  1.00 175.23 ? 61   VAL A O   1 
ATOM 216  C CB  . VAL A 1 27  ? 20.935 21.541  -6.711  1.00 150.25 ? 61   VAL A CB  1 
ATOM 217  C CG1 . VAL A 1 27  ? 21.151 20.239  -5.986  1.00 157.80 ? 61   VAL A CG1 1 
ATOM 218  C CG2 . VAL A 1 27  ? 22.232 22.001  -7.352  1.00 151.72 ? 61   VAL A CG2 1 
ATOM 219  N N   . ASN A 1 28  ? 17.911 21.806  -6.336  1.00 138.15 ? 62   ASN A N   1 
ATOM 220  C CA  . ASN A 1 28  ? 16.635 21.473  -5.709  1.00 136.63 ? 62   ASN A CA  1 
ATOM 221  C C   . ASN A 1 28  ? 15.584 21.102  -6.744  1.00 136.65 ? 62   ASN A C   1 
ATOM 222  O O   . ASN A 1 28  ? 14.786 20.183  -6.525  1.00 136.27 ? 62   ASN A O   1 
ATOM 223  C CB  . ASN A 1 28  ? 16.142 22.633  -4.847  1.00 141.65 ? 62   ASN A CB  1 
ATOM 224  C CG  . ASN A 1 28  ? 16.877 22.727  -3.529  1.00 143.68 ? 62   ASN A CG  1 
ATOM 225  O OD1 . ASN A 1 28  ? 16.552 22.024  -2.571  1.00 142.36 ? 62   ASN A OD1 1 
ATOM 226  N ND2 . ASN A 1 28  ? 17.877 23.598  -3.472  1.00 144.57 ? 62   ASN A ND2 1 
ATOM 227  N N   . ILE A 1 29  ? 15.561 21.805  -7.878  1.00 132.89 ? 63   ILE A N   1 
ATOM 228  C CA  . ILE A 1 29  ? 14.631 21.437  -8.943  1.00 138.38 ? 63   ILE A CA  1 
ATOM 229  C C   . ILE A 1 29  ? 14.880 20.002  -9.389  1.00 153.29 ? 63   ILE A C   1 
ATOM 230  O O   . ILE A 1 29  ? 13.940 19.224  -9.574  1.00 155.18 ? 63   ILE A O   1 
ATOM 231  C CB  . ILE A 1 29  ? 14.720 22.429  -10.117 1.00 120.06 ? 63   ILE A CB  1 
ATOM 232  C CG1 . ILE A 1 29  ? 13.652 23.508  -9.963  1.00 122.35 ? 63   ILE A CG1 1 
ATOM 233  C CG2 . ILE A 1 29  ? 14.537 21.724  -11.454 1.00 106.18 ? 63   ILE A CG2 1 
ATOM 234  C CD1 . ILE A 1 29  ? 13.579 24.452  -11.131 1.00 122.05 ? 63   ILE A CD1 1 
ATOM 235  N N   . VAL A 1 30  ? 16.152 19.624  -9.549  1.00 161.92 ? 64   VAL A N   1 
ATOM 236  C CA  . VAL A 1 30  ? 16.480 18.255  -9.950  1.00 165.97 ? 64   VAL A CA  1 
ATOM 237  C C   . VAL A 1 30  ? 15.905 17.257  -8.953  1.00 166.27 ? 64   VAL A C   1 
ATOM 238  O O   . VAL A 1 30  ? 15.239 16.282  -9.332  1.00 175.93 ? 64   VAL A O   1 
ATOM 239  C CB  . VAL A 1 30  ? 18.002 18.087  -10.100 1.00 170.39 ? 64   VAL A CB  1 
ATOM 240  C CG1 . VAL A 1 30  ? 18.340 16.636  -10.393 1.00 179.56 ? 64   VAL A CG1 1 
ATOM 241  C CG2 . VAL A 1 30  ? 18.528 18.997  -11.201 1.00 168.57 ? 64   VAL A CG2 1 
ATOM 242  N N   . VAL A 1 31  ? 16.152 17.492  -7.661  1.00 153.87 ? 65   VAL A N   1 
ATOM 243  C CA  . VAL A 1 31  ? 15.636 16.600  -6.618  1.00 154.85 ? 65   VAL A CA  1 
ATOM 244  C C   . VAL A 1 31  ? 14.118 16.469  -6.729  1.00 162.62 ? 65   VAL A C   1 
ATOM 245  O O   . VAL A 1 31  ? 13.565 15.364  -6.856  1.00 174.21 ? 65   VAL A O   1 
ATOM 246  C CB  . VAL A 1 31  ? 16.048 17.114  -5.228  1.00 142.42 ? 65   VAL A CB  1 
ATOM 247  C CG1 . VAL A 1 31  ? 15.487 16.213  -4.137  1.00 144.52 ? 65   VAL A CG1 1 
ATOM 248  C CG2 . VAL A 1 31  ? 17.560 17.214  -5.135  1.00 141.04 ? 65   VAL A CG2 1 
ATOM 249  N N   . VAL A 1 32  ? 13.430 17.612  -6.697  1.00 156.90 ? 66   VAL A N   1 
ATOM 250  C CA  . VAL A 1 32  ? 11.971 17.625  -6.670  1.00 160.94 ? 66   VAL A CA  1 
ATOM 251  C C   . VAL A 1 32  ? 11.396 16.973  -7.920  1.00 161.66 ? 66   VAL A C   1 
ATOM 252  O O   . VAL A 1 32  ? 10.323 16.363  -7.878  1.00 164.73 ? 66   VAL A O   1 
ATOM 253  C CB  . VAL A 1 32  ? 11.461 19.067  -6.493  1.00 155.91 ? 66   VAL A CB  1 
ATOM 254  C CG1 . VAL A 1 32  ? 9.945  19.113  -6.538  1.00 157.57 ? 66   VAL A CG1 1 
ATOM 255  C CG2 . VAL A 1 32  ? 11.965 19.648  -5.184  1.00 156.47 ? 66   VAL A CG2 1 
ATOM 256  N N   . THR A 1 33  ? 12.079 17.111  -9.057  1.00 161.88 ? 67   THR A N   1 
ATOM 257  C CA  . THR A 1 33  ? 11.613 16.450  -10.272 1.00 169.51 ? 67   THR A CA  1 
ATOM 258  C C   . THR A 1 33  ? 11.752 14.939  -10.159 1.00 178.63 ? 67   THR A C   1 
ATOM 259  O O   . THR A 1 33  ? 10.813 14.196  -10.472 1.00 181.60 ? 67   THR A O   1 
ATOM 260  C CB  . THR A 1 33  ? 12.376 16.959  -11.494 1.00 172.29 ? 67   THR A CB  1 
ATOM 261  O OG1 . THR A 1 33  ? 13.785 16.853  -11.262 1.00 173.68 ? 67   THR A OG1 1 
ATOM 262  C CG2 . THR A 1 33  ? 12.001 18.404  -11.805 1.00 166.63 ? 67   THR A CG2 1 
ATOM 263  N N   . LEU A 1 34  ? 12.926 14.465  -9.725  1.00 182.24 ? 68   LEU A N   1 
ATOM 264  C CA  . LEU A 1 34  ? 13.109 13.032  -9.515  1.00 183.14 ? 68   LEU A CA  1 
ATOM 265  C C   . LEU A 1 34  ? 12.054 12.459  -8.579  1.00 178.01 ? 68   LEU A C   1 
ATOM 266  O O   . LEU A 1 34  ? 11.691 11.284  -8.696  1.00 190.26 ? 68   LEU A O   1 
ATOM 267  C CB  . LEU A 1 34  ? 14.505 12.747  -8.955  1.00 180.68 ? 68   LEU A CB  1 
ATOM 268  C CG  . LEU A 1 34  ? 15.713 12.950  -9.869  1.00 178.55 ? 68   LEU A CG  1 
ATOM 269  C CD1 . LEU A 1 34  ? 16.997 12.571  -9.147  1.00 179.98 ? 68   LEU A CD1 1 
ATOM 270  C CD2 . LEU A 1 34  ? 15.560 12.136  -11.137 1.00 183.63 ? 68   LEU A CD2 1 
ATOM 271  N N   . PHE A 1 35  ? 11.548 13.264  -7.649  1.00 173.52 ? 69   PHE A N   1 
ATOM 272  C CA  . PHE A 1 35  ? 10.594 12.735  -6.683  1.00 186.80 ? 69   PHE A CA  1 
ATOM 273  C C   . PHE A 1 35  ? 9.138  12.900  -7.101  1.00 209.71 ? 69   PHE A C   1 
ATOM 274  O O   . PHE A 1 35  ? 8.305  12.050  -6.764  1.00 213.28 ? 69   PHE A O   1 
ATOM 275  C CB  . PHE A 1 35  ? 10.797 13.417  -5.331  1.00 176.25 ? 69   PHE A CB  1 
ATOM 276  C CG  . PHE A 1 35  ? 10.267 12.633  -4.179  1.00 174.30 ? 69   PHE A CG  1 
ATOM 277  C CD1 . PHE A 1 35  ? 8.938  12.731  -3.802  1.00 169.07 ? 69   PHE A CD1 1 
ATOM 278  C CD2 . PHE A 1 35  ? 11.099 11.790  -3.474  1.00 177.77 ? 69   PHE A CD2 1 
ATOM 279  C CE1 . PHE A 1 35  ? 8.454  12.007  -2.738  1.00 173.68 ? 69   PHE A CE1 1 
ATOM 280  C CE2 . PHE A 1 35  ? 10.620 11.064  -2.417  1.00 183.18 ? 69   PHE A CE2 1 
ATOM 281  C CZ  . PHE A 1 35  ? 9.298  11.171  -2.043  1.00 182.59 ? 69   PHE A CZ  1 
ATOM 282  N N   . CYS A 1 36  ? 8.812  13.965  -7.831  1.00 230.74 ? 70   CYS A N   1 
ATOM 283  C CA  . CYS A 1 36  ? 7.432  14.433  -7.917  1.00 239.36 ? 70   CYS A CA  1 
ATOM 284  C C   . CYS A 1 36  ? 6.582  13.564  -8.836  1.00 254.47 ? 70   CYS A C   1 
ATOM 285  O O   . CYS A 1 36  ? 5.607  12.945  -8.397  1.00 264.11 ? 70   CYS A O   1 
ATOM 286  C CB  . CYS A 1 36  ? 7.408  15.888  -8.393  1.00 230.97 ? 70   CYS A CB  1 
ATOM 287  S SG  . CYS A 1 36  ? 5.752  16.563  -8.661  1.00 229.79 ? 70   CYS A SG  1 
ATOM 288  N N   . CYS A 1 37  ? 6.924  13.523  -10.121 1.00 205.81 ? 71   CYS A N   1 
ATOM 289  C CA  . CYS A 1 37  ? 6.178  12.714  -11.075 1.00 205.79 ? 71   CYS A CA  1 
ATOM 290  C C   . CYS A 1 37  ? 6.877  11.409  -11.411 1.00 199.59 ? 71   CYS A C   1 
ATOM 291  O O   . CYS A 1 37  ? 6.204  10.405  -11.667 1.00 203.21 ? 71   CYS A O   1 
ATOM 292  C CB  . CYS A 1 37  ? 5.929  13.500  -12.366 1.00 201.54 ? 71   CYS A CB  1 
ATOM 293  S SG  . CYS A 1 37  ? 4.824  12.672  -13.528 1.00 198.08 ? 71   CYS A SG  1 
ATOM 294  N N   . GLN A 1 38  ? 8.207  11.400  -11.414 1.00 194.50 ? 72   GLN A N   1 
ATOM 295  C CA  . GLN A 1 38  ? 8.943  10.168  -11.648 1.00 191.88 ? 72   GLN A CA  1 
ATOM 296  C C   . GLN A 1 38  ? 8.846  9.287   -10.411 1.00 198.64 ? 72   GLN A C   1 
ATOM 297  O O   . GLN A 1 38  ? 8.994  9.769   -9.283  1.00 199.63 ? 72   GLN A O   1 
ATOM 298  C CB  . GLN A 1 38  ? 10.405 10.468  -11.981 1.00 187.04 ? 72   GLN A CB  1 
ATOM 299  C CG  . GLN A 1 38  ? 10.640 11.820  -12.648 1.00 176.55 ? 72   GLN A CG  1 
ATOM 300  C CD  . GLN A 1 38  ? 9.787  12.033  -13.886 1.00 171.90 ? 72   GLN A CD  1 
ATOM 301  O OE1 . GLN A 1 38  ? 9.056  13.020  -13.986 1.00 169.22 ? 72   GLN A OE1 1 
ATOM 302  N NE2 . GLN A 1 38  ? 9.877  11.109  -14.835 1.00 171.22 ? 72   GLN A NE2 1 
ATOM 303  N N   . LYS A 1 39  ? 8.582  8.000   -10.620 1.00 209.07 ? 73   LYS A N   1 
ATOM 304  C CA  . LYS A 1 39  ? 8.384  7.094   -9.498  1.00 223.98 ? 73   LYS A CA  1 
ATOM 305  C C   . LYS A 1 39  ? 9.618  7.084   -8.603  1.00 245.12 ? 73   LYS A C   1 
ATOM 306  O O   . LYS A 1 39  ? 10.733 7.390   -9.034  1.00 239.21 ? 73   LYS A O   1 
ATOM 307  C CB  . LYS A 1 39  ? 8.064  5.685   -9.999  1.00 212.49 ? 73   LYS A CB  1 
ATOM 308  C CG  . LYS A 1 39  ? 6.882  5.614   -10.957 1.00 201.27 ? 73   LYS A CG  1 
ATOM 309  C CD  . LYS A 1 39  ? 5.584  6.039   -10.288 1.00 192.62 ? 73   LYS A CD  1 
ATOM 310  C CE  . LYS A 1 39  ? 4.408  5.923   -11.246 1.00 185.13 ? 73   LYS A CE  1 
ATOM 311  N NZ  . LYS A 1 39  ? 3.116  6.230   -10.573 1.00 180.67 ? 73   LYS A NZ  1 
ATOM 312  N N   . GLY A 1 40  ? 9.408  6.730   -7.340  1.00 272.30 ? 74   GLY A N   1 
ATOM 313  C CA  . GLY A 1 40  ? 10.373 7.009   -6.304  1.00 277.11 ? 74   GLY A CA  1 
ATOM 314  C C   . GLY A 1 40  ? 9.789  7.392   -4.951  1.00 279.45 ? 74   GLY A C   1 
ATOM 315  O O   . GLY A 1 40  ? 10.482 7.316   -3.932  1.00 287.82 ? 74   GLY A O   1 
ATOM 316  N N   . PRO A 1 41  ? 8.505  7.826   -4.895  1.00 218.26 ? 75   PRO A N   1 
ATOM 317  C CA  . PRO A 1 41  ? 7.858  7.993   -3.582  1.00 202.48 ? 75   PRO A CA  1 
ATOM 318  C C   . PRO A 1 41  ? 7.552  6.680   -2.871  1.00 211.05 ? 75   PRO A C   1 
ATOM 319  O O   . PRO A 1 41  ? 8.047  5.617   -3.263  1.00 213.68 ? 75   PRO A O   1 
ATOM 320  C CB  . PRO A 1 41  ? 6.567  8.747   -3.921  1.00 194.49 ? 75   PRO A CB  1 
ATOM 321  C CG  . PRO A 1 41  ? 6.890  9.500   -5.137  1.00 191.67 ? 75   PRO A CG  1 
ATOM 322  C CD  . PRO A 1 41  ? 7.795  8.610   -5.928  1.00 192.05 ? 75   PRO A CD  1 
ATOM 323  N N   . LYS A 1 42  ? 6.761  6.774   -1.795  1.00 216.95 ? 76   LYS A N   1 
ATOM 324  C CA  . LYS A 1 42  ? 6.303  5.698   -0.895  1.00 215.20 ? 76   LYS A CA  1 
ATOM 325  C C   . LYS A 1 42  ? 7.298  5.332   0.201   1.00 204.89 ? 76   LYS A C   1 
ATOM 326  O O   . LYS A 1 42  ? 7.103  4.298   0.863   1.00 219.65 ? 76   LYS A O   1 
ATOM 327  C CB  . LYS A 1 42  ? 5.927  4.405   -1.635  1.00 212.87 ? 76   LYS A CB  1 
ATOM 328  C CG  . LYS A 1 42  ? 4.549  4.407   -2.288  1.00 202.97 ? 76   LYS A CG  1 
ATOM 329  C CD  . LYS A 1 42  ? 4.595  4.931   -3.714  1.00 192.13 ? 76   LYS A CD  1 
ATOM 330  C CE  . LYS A 1 42  ? 5.367  3.992   -4.627  1.00 184.37 ? 76   LYS A CE  1 
ATOM 331  N NZ  . LYS A 1 42  ? 5.388  4.488   -6.032  1.00 170.62 ? 76   LYS A NZ  1 
ATOM 332  N N   . LYS A 1 43  ? 8.346  6.122   0.429   1.00 194.62 ? 77   LYS A N   1 
ATOM 333  C CA  . LYS A 1 43  ? 9.251  5.905   1.550   1.00 200.87 ? 77   LYS A CA  1 
ATOM 334  C C   . LYS A 1 43  ? 9.232  7.121   2.467   1.00 204.72 ? 77   LYS A C   1 
ATOM 335  O O   . LYS A 1 43  ? 9.168  8.262   2.000   1.00 202.53 ? 77   LYS A O   1 
ATOM 336  C CB  . LYS A 1 43  ? 10.682 5.625   1.078   1.00 157.93 ? 77   LYS A CB  1 
ATOM 337  C CG  . LYS A 1 43  ? 11.595 5.109   2.184   1.00 165.63 ? 77   LYS A CG  1 
ATOM 338  C CD  . LYS A 1 43  ? 12.989 4.790   1.671   1.00 167.33 ? 77   LYS A CD  1 
ATOM 339  C CE  . LYS A 1 43  ? 13.894 4.315   2.798   1.00 175.56 ? 77   LYS A CE  1 
ATOM 340  N NZ  . LYS A 1 43  ? 15.279 4.059   2.317   1.00 177.63 ? 77   LYS A NZ  1 
ATOM 341  N N   . VAL A 1 44  ? 9.298  6.868   3.777   1.00 205.66 ? 78   VAL A N   1 
ATOM 342  C CA  . VAL A 1 44  ? 9.192  7.948   4.756   1.00 200.67 ? 78   VAL A CA  1 
ATOM 343  C C   . VAL A 1 44  ? 10.371 8.906   4.630   1.00 185.15 ? 78   VAL A C   1 
ATOM 344  O O   . VAL A 1 44  ? 10.192 10.123  4.490   1.00 180.36 ? 78   VAL A O   1 
ATOM 345  C CB  . VAL A 1 44  ? 9.083  7.375   6.179   1.00 212.51 ? 78   VAL A CB  1 
ATOM 346  C CG1 . VAL A 1 44  ? 9.048  8.504   7.196   1.00 214.69 ? 78   VAL A CG1 1 
ATOM 347  C CG2 . VAL A 1 44  ? 7.849  6.502   6.301   1.00 221.38 ? 78   VAL A CG2 1 
ATOM 348  N N   . SER A 1 45  ? 11.594 8.374   4.694   1.00 176.01 ? 79   SER A N   1 
ATOM 349  C CA  . SER A 1 45  ? 12.769 9.218   4.506   1.00 174.26 ? 79   SER A CA  1 
ATOM 350  C C   . SER A 1 45  ? 12.740 9.916   3.155   1.00 169.75 ? 79   SER A C   1 
ATOM 351  O O   . SER A 1 45  ? 13.201 11.056  3.035   1.00 165.38 ? 79   SER A O   1 
ATOM 352  C CB  . SER A 1 45  ? 14.039 8.381   4.637   1.00 175.18 ? 79   SER A CB  1 
ATOM 353  O OG  . SER A 1 45  ? 14.194 7.530   3.518   1.00 169.40 ? 79   SER A OG  1 
ATOM 354  N N   . SER A 1 46  ? 12.188 9.258   2.135   1.00 164.05 ? 80   SER A N   1 
ATOM 355  C CA  . SER A 1 46  ? 12.065 9.895   0.831   1.00 157.34 ? 80   SER A CA  1 
ATOM 356  C C   . SER A 1 46  ? 11.073 11.052  0.871   1.00 156.69 ? 80   SER A C   1 
ATOM 357  O O   . SER A 1 46  ? 11.350 12.126  0.327   1.00 159.46 ? 80   SER A O   1 
ATOM 358  C CB  . SER A 1 46  ? 11.657 8.862   -0.215  1.00 162.88 ? 80   SER A CB  1 
ATOM 359  O OG  . SER A 1 46  ? 12.784 8.141   -0.677  1.00 172.15 ? 80   SER A OG  1 
ATOM 360  N N   . ILE A 1 47  ? 9.915  10.854  1.509   1.00 154.53 ? 81   ILE A N   1 
ATOM 361  C CA  . ILE A 1 47  ? 8.963  11.952  1.678   1.00 150.95 ? 81   ILE A CA  1 
ATOM 362  C C   . ILE A 1 47  ? 9.623  13.123  2.395   1.00 140.50 ? 81   ILE A C   1 
ATOM 363  O O   . ILE A 1 47  ? 9.423  14.291  2.031   1.00 134.66 ? 81   ILE A O   1 
ATOM 364  C CB  . ILE A 1 47  ? 7.713  11.463  2.433   1.00 151.97 ? 81   ILE A CB  1 
ATOM 365  C CG1 . ILE A 1 47  ? 6.934  10.461  1.583   1.00 143.85 ? 81   ILE A CG1 1 
ATOM 366  C CG2 . ILE A 1 47  ? 6.827  12.636  2.830   1.00 148.05 ? 81   ILE A CG2 1 
ATOM 367  C CD1 . ILE A 1 47  ? 5.804  9.796   2.325   1.00 152.37 ? 81   ILE A CD1 1 
ATOM 368  N N   . TYR A 1 48  ? 10.432 12.828  3.414   1.00 136.64 ? 82   TYR A N   1 
ATOM 369  C CA  . TYR A 1 48  ? 11.145 13.888  4.117   1.00 132.28 ? 82   TYR A CA  1 
ATOM 370  C C   . TYR A 1 48  ? 12.121 14.608  3.193   1.00 126.77 ? 82   TYR A C   1 
ATOM 371  O O   . TYR A 1 48  ? 12.223 15.840  3.229   1.00 124.77 ? 82   TYR A O   1 
ATOM 372  C CB  . TYR A 1 48  ? 11.871 13.312  5.328   1.00 138.65 ? 82   TYR A CB  1 
ATOM 373  C CG  . TYR A 1 48  ? 10.950 12.918  6.457   1.00 148.60 ? 82   TYR A CG  1 
ATOM 374  C CD1 . TYR A 1 48  ? 9.713  13.532  6.616   1.00 152.63 ? 82   TYR A CD1 1 
ATOM 375  C CD2 . TYR A 1 48  ? 11.315 11.933  7.362   1.00 159.89 ? 82   TYR A CD2 1 
ATOM 376  C CE1 . TYR A 1 48  ? 8.868  13.175  7.649   1.00 161.28 ? 82   TYR A CE1 1 
ATOM 377  C CE2 . TYR A 1 48  ? 10.477 11.569  8.396   1.00 166.23 ? 82   TYR A CE2 1 
ATOM 378  C CZ  . TYR A 1 48  ? 9.256  12.190  8.535   1.00 167.74 ? 82   TYR A CZ  1 
ATOM 379  O OH  . TYR A 1 48  ? 8.426  11.821  9.568   1.00 175.43 ? 82   TYR A OH  1 
ATOM 380  N N   . ILE A 1 49  ? 12.847 13.858  2.360   1.00 126.49 ? 83   ILE A N   1 
ATOM 381  C CA  . ILE A 1 49  ? 13.752 14.485  1.398   1.00 131.05 ? 83   ILE A CA  1 
ATOM 382  C C   . ILE A 1 49  ? 12.981 15.411  0.467   1.00 127.53 ? 83   ILE A C   1 
ATOM 383  O O   . ILE A 1 49  ? 13.429 16.524  0.161   1.00 123.26 ? 83   ILE A O   1 
ATOM 384  C CB  . ILE A 1 49  ? 14.527 13.415  0.608   1.00 143.00 ? 83   ILE A CB  1 
ATOM 385  C CG1 . ILE A 1 49  ? 15.465 12.639  1.527   1.00 154.15 ? 83   ILE A CG1 1 
ATOM 386  C CG2 . ILE A 1 49  ? 15.323 14.057  -0.515  1.00 138.68 ? 83   ILE A CG2 1 
ATOM 387  C CD1 . ILE A 1 49  ? 16.215 11.542  0.823   1.00 165.47 ? 83   ILE A CD1 1 
ATOM 388  N N   . PHE A 1 50  ? 11.810 14.969  0.005   1.00 133.97 ? 84   PHE A N   1 
ATOM 389  C CA  . PHE A 1 50  ? 11.014 15.782  -0.908  1.00 127.62 ? 84   PHE A CA  1 
ATOM 390  C C   . PHE A 1 50  ? 10.556 17.067  -0.240  1.00 125.09 ? 84   PHE A C   1 
ATOM 391  O O   . PHE A 1 50  ? 10.644 18.151  -0.826  1.00 129.90 ? 84   PHE A O   1 
ATOM 392  C CB  . PHE A 1 50  ? 9.813  14.981  -1.403  1.00 141.46 ? 84   PHE A CB  1 
ATOM 393  C CG  . PHE A 1 50  ? 8.784  15.805  -2.128  1.00 138.66 ? 84   PHE A CG  1 
ATOM 394  C CD1 . PHE A 1 50  ? 8.973  16.167  -3.452  1.00 143.45 ? 84   PHE A CD1 1 
ATOM 395  C CD2 . PHE A 1 50  ? 7.619  16.199  -1.490  1.00 137.76 ? 84   PHE A CD2 1 
ATOM 396  C CE1 . PHE A 1 50  ? 8.024  16.916  -4.122  1.00 142.37 ? 84   PHE A CE1 1 
ATOM 397  C CE2 . PHE A 1 50  ? 6.667  16.948  -2.154  1.00 140.37 ? 84   PHE A CE2 1 
ATOM 398  C CZ  . PHE A 1 50  ? 6.870  17.307  -3.471  1.00 139.11 ? 84   PHE A CZ  1 
ATOM 399  N N   . ASN A 1 51  ? 10.050 16.963  0.990   1.00 125.50 ? 85   ASN A N   1 
ATOM 400  C CA  . ASN A 1 51  ? 9.565  18.154  1.677   1.00 132.22 ? 85   ASN A CA  1 
ATOM 401  C C   . ASN A 1 51  ? 10.703 19.132  1.960   1.00 127.42 ? 85   ASN A C   1 
ATOM 402  O O   . ASN A 1 51  ? 10.547 20.347  1.777   1.00 113.71 ? 85   ASN A O   1 
ATOM 403  C CB  . ASN A 1 51  ? 8.846  17.749  2.962   1.00 134.18 ? 85   ASN A CB  1 
ATOM 404  C CG  . ASN A 1 51  ? 7.608  16.919  2.695   1.00 147.60 ? 85   ASN A CG  1 
ATOM 405  O OD1 . ASN A 1 51  ? 6.816  17.230  1.806   1.00 153.46 ? 85   ASN A OD1 1 
ATOM 406  N ND2 . ASN A 1 51  ? 7.441  15.849  3.459   1.00 157.89 ? 85   ASN A ND2 1 
ATOM 407  N N   . LEU A 1 52  ? 11.860 18.619  2.384   1.00 134.45 ? 86   LEU A N   1 
ATOM 408  C CA  . LEU A 1 52  ? 13.022 19.479  2.580   1.00 126.91 ? 86   LEU A CA  1 
ATOM 409  C C   . LEU A 1 52  ? 13.420 20.173  1.282   1.00 137.94 ? 86   LEU A C   1 
ATOM 410  O O   . LEU A 1 52  ? 13.717 21.376  1.277   1.00 145.12 ? 86   LEU A O   1 
ATOM 411  C CB  . LEU A 1 52  ? 14.185 18.658  3.133   1.00 120.48 ? 86   LEU A CB  1 
ATOM 412  C CG  . LEU A 1 52  ? 15.515 19.378  3.327   1.00 122.16 ? 86   LEU A CG  1 
ATOM 413  C CD1 . LEU A 1 52  ? 15.381 20.455  4.386   1.00 125.50 ? 86   LEU A CD1 1 
ATOM 414  C CD2 . LEU A 1 52  ? 16.587 18.378  3.705   1.00 129.00 ? 86   LEU A CD2 1 
ATOM 415  N N   . ALA A 1 53  ? 13.418 19.436  0.166   1.00 146.91 ? 87   ALA A N   1 
ATOM 416  C CA  . ALA A 1 53  ? 13.784 20.028  -1.117  1.00 148.95 ? 87   ALA A CA  1 
ATOM 417  C C   . ALA A 1 53  ? 12.776 21.077  -1.572  1.00 151.67 ? 87   ALA A C   1 
ATOM 418  O O   . ALA A 1 53  ? 13.156 22.054  -2.226  1.00 148.10 ? 87   ALA A O   1 
ATOM 419  C CB  . ALA A 1 53  ? 13.922 18.932  -2.172  1.00 157.39 ? 87   ALA A CB  1 
ATOM 420  N N   . VAL A 1 54  ? 11.495 20.892  -1.246  1.00 157.55 ? 88   VAL A N   1 
ATOM 421  C CA  . VAL A 1 54  ? 10.494 21.901  -1.581  1.00 158.45 ? 88   VAL A CA  1 
ATOM 422  C C   . VAL A 1 54  ? 10.689 23.146  -0.725  1.00 153.95 ? 88   VAL A C   1 
ATOM 423  O O   . VAL A 1 54  ? 10.604 24.277  -1.221  1.00 157.78 ? 88   VAL A O   1 
ATOM 424  C CB  . VAL A 1 54  ? 9.074  21.324  -1.428  1.00 158.10 ? 88   VAL A CB  1 
ATOM 425  C CG1 . VAL A 1 54  ? 8.021  22.430  -1.518  1.00 154.59 ? 88   VAL A CG1 1 
ATOM 426  C CG2 . VAL A 1 54  ? 8.816  20.255  -2.479  1.00 163.33 ? 88   VAL A CG2 1 
ATOM 427  N N   . ALA A 1 55  ? 10.950 22.960  0.571   1.00 150.28 ? 89   ALA A N   1 
ATOM 428  C CA  . ALA A 1 55  ? 11.218 24.098  1.444   1.00 138.07 ? 89   ALA A CA  1 
ATOM 429  C C   . ALA A 1 55  ? 12.416 24.898  0.950   1.00 127.85 ? 89   ALA A C   1 
ATOM 430  O O   . ALA A 1 55  ? 12.370 26.131  0.891   1.00 128.95 ? 89   ALA A O   1 
ATOM 431  C CB  . ALA A 1 55  ? 11.439 23.619  2.878   1.00 136.89 ? 89   ALA A CB  1 
ATOM 432  N N   . ASP A 1 56  ? 13.501 24.211  0.580   1.00 134.37 ? 90   ASP A N   1 
ATOM 433  C CA  . ASP A 1 56  ? 14.663 24.918  0.050   1.00 135.59 ? 90   ASP A CA  1 
ATOM 434  C C   . ASP A 1 56  ? 14.378 25.546  -1.307  1.00 135.02 ? 90   ASP A C   1 
ATOM 435  O O   . ASP A 1 56  ? 14.927 26.608  -1.625  1.00 135.56 ? 90   ASP A O   1 
ATOM 436  C CB  . ASP A 1 56  ? 15.860 23.978  -0.053  1.00 148.63 ? 90   ASP A CB  1 
ATOM 437  C CG  . ASP A 1 56  ? 16.321 23.482  1.294   1.00 158.81 ? 90   ASP A CG  1 
ATOM 438  O OD1 . ASP A 1 56  ? 15.923 24.083  2.313   1.00 157.48 ? 90   ASP A OD1 1 
ATOM 439  O OD2 . ASP A 1 56  ? 17.085 22.494  1.335   1.00 162.86 ? 90   ASP A OD2 1 
ATOM 440  N N   . LEU A 1 57  ? 13.531 24.914  -2.118  1.00 133.92 ? 91   LEU A N   1 
ATOM 441  C CA  . LEU A 1 57  ? 13.235 25.454  -3.441  1.00 128.89 ? 91   LEU A CA  1 
ATOM 442  C C   . LEU A 1 57  ? 12.451 26.756  -3.330  1.00 114.14 ? 91   LEU A C   1 
ATOM 443  O O   . LEU A 1 57  ? 12.886 27.803  -3.824  1.00 113.07 ? 91   LEU A O   1 
ATOM 444  C CB  . LEU A 1 57  ? 12.471 24.419  -4.270  1.00 137.39 ? 91   LEU A CB  1 
ATOM 445  C CG  . LEU A 1 57  ? 12.185 24.799  -5.724  1.00 139.82 ? 91   LEU A CG  1 
ATOM 446  C CD1 . LEU A 1 57  ? 13.477 24.935  -6.521  1.00 138.56 ? 91   LEU A CD1 1 
ATOM 447  C CD2 . LEU A 1 57  ? 11.247 23.793  -6.373  1.00 138.33 ? 91   LEU A CD2 1 
ATOM 448  N N   . LEU A 1 58  ? 11.291 26.711  -2.666  1.00 103.16 ? 92   LEU A N   1 
ATOM 449  C CA  . LEU A 1 58  ? 10.521 27.929  -2.428  1.00 111.90 ? 92   LEU A CA  1 
ATOM 450  C C   . LEU A 1 58  ? 11.301 28.947  -1.609  1.00 118.31 ? 92   LEU A C   1 
ATOM 451  O O   . LEU A 1 58  ? 11.034 30.151  -1.703  1.00 111.60 ? 92   LEU A O   1 
ATOM 452  C CB  . LEU A 1 58  ? 9.213  27.598  -1.712  1.00 106.70 ? 92   LEU A CB  1 
ATOM 453  C CG  . LEU A 1 58  ? 8.278  26.619  -2.408  1.00 114.96 ? 92   LEU A CG  1 
ATOM 454  C CD1 . LEU A 1 58  ? 7.004  26.461  -1.592  1.00 117.50 ? 92   LEU A CD1 1 
ATOM 455  C CD2 . LEU A 1 58  ? 7.975  27.077  -3.831  1.00 115.92 ? 92   LEU A CD2 1 
ATOM 456  N N   . LEU A 1 59  ? 12.260 28.484  -0.811  1.00 120.78 ? 93   LEU A N   1 
ATOM 457  C CA  . LEU A 1 59  ? 13.092 29.381  -0.023  1.00 111.39 ? 93   LEU A CA  1 
ATOM 458  C C   . LEU A 1 59  ? 14.010 30.199  -0.918  1.00 117.94 ? 93   LEU A C   1 
ATOM 459  O O   . LEU A 1 59  ? 14.027 31.434  -0.854  1.00 136.06 ? 93   LEU A O   1 
ATOM 460  C CB  . LEU A 1 59  ? 13.899 28.558  0.973   1.00 112.24 ? 93   LEU A CB  1 
ATOM 461  C CG  . LEU A 1 59  ? 14.857 29.276  1.901   1.00 120.47 ? 93   LEU A CG  1 
ATOM 462  C CD1 . LEU A 1 59  ? 14.095 30.319  2.678   1.00 134.20 ? 93   LEU A CD1 1 
ATOM 463  C CD2 . LEU A 1 59  ? 15.458 28.246  2.823   1.00 121.49 ? 93   LEU A CD2 1 
ATOM 464  N N   . LEU A 1 60  ? 14.786 29.522  -1.765  1.00 118.79 ? 94   LEU A N   1 
ATOM 465  C CA  . LEU A 1 60  ? 15.686 30.229  -2.665  1.00 115.99 ? 94   LEU A CA  1 
ATOM 466  C C   . LEU A 1 60  ? 14.940 30.943  -3.783  1.00 109.46 ? 94   LEU A C   1 
ATOM 467  O O   . LEU A 1 60  ? 15.525 31.806  -4.447  1.00 106.77 ? 94   LEU A O   1 
ATOM 468  C CB  . LEU A 1 60  ? 16.709 29.253  -3.246  1.00 123.08 ? 94   LEU A CB  1 
ATOM 469  C CG  . LEU A 1 60  ? 17.427 28.384  -2.209  1.00 123.78 ? 94   LEU A CG  1 
ATOM 470  C CD1 . LEU A 1 60  ? 18.385 27.425  -2.883  1.00 118.40 ? 94   LEU A CD1 1 
ATOM 471  C CD2 . LEU A 1 60  ? 18.150 29.231  -1.172  1.00 127.62 ? 94   LEU A CD2 1 
ATOM 472  N N   . ALA A 1 61  ? 13.666 30.609  -4.008  1.00 99.98  ? 95   ALA A N   1 
ATOM 473  C CA  . ALA A 1 61  ? 12.877 31.345  -4.987  1.00 115.39 ? 95   ALA A CA  1 
ATOM 474  C C   . ALA A 1 61  ? 12.716 32.810  -4.604  1.00 133.77 ? 95   ALA A C   1 
ATOM 475  O O   . ALA A 1 61  ? 12.436 33.642  -5.475  1.00 137.30 ? 95   ALA A O   1 
ATOM 476  C CB  . ALA A 1 61  ? 11.503 30.698  -5.158  1.00 111.96 ? 95   ALA A CB  1 
ATOM 477  N N   . THR A 1 62  ? 12.888 33.140  -3.326  1.00 131.14 ? 96   THR A N   1 
ATOM 478  C CA  . THR A 1 62  ? 12.824 34.516  -2.859  1.00 116.77 ? 96   THR A CA  1 
ATOM 479  C C   . THR A 1 62  ? 14.172 35.220  -2.895  1.00 113.60 ? 96   THR A C   1 
ATOM 480  O O   . THR A 1 62  ? 14.227 36.423  -2.625  1.00 119.42 ? 96   THR A O   1 
ATOM 481  C CB  . THR A 1 62  ? 12.276 34.569  -1.428  1.00 106.11 ? 96   THR A CB  1 
ATOM 482  O OG1 . THR A 1 62  ? 13.075 33.738  -0.580  1.00 86.74  ? 96   THR A OG1 1 
ATOM 483  C CG2 . THR A 1 62  ? 10.829 34.094  -1.386  1.00 113.54 ? 96   THR A CG2 1 
ATOM 484  N N   . LEU A 1 63  ? 15.253 34.510  -3.215  1.00 110.80 ? 97   LEU A N   1 
ATOM 485  C CA  . LEU A 1 63  ? 16.561 35.156  -3.284  1.00 115.87 ? 97   LEU A CA  1 
ATOM 486  C C   . LEU A 1 63  ? 16.644 36.282  -4.311  1.00 129.09 ? 97   LEU A C   1 
ATOM 487  O O   . LEU A 1 63  ? 17.359 37.264  -4.040  1.00 140.16 ? 97   LEU A O   1 
ATOM 488  C CB  . LEU A 1 63  ? 17.645 34.108  -3.554  1.00 117.19 ? 97   LEU A CB  1 
ATOM 489  C CG  . LEU A 1 63  ? 17.985 33.175  -2.394  1.00 119.16 ? 97   LEU A CG  1 
ATOM 490  C CD1 . LEU A 1 63  ? 19.206 32.350  -2.751  1.00 124.07 ? 97   LEU A CD1 1 
ATOM 491  C CD2 . LEU A 1 63  ? 18.217 33.960  -1.110  1.00 116.64 ? 97   LEU A CD2 1 
ATOM 492  N N   . PRO A 1 64  ? 15.994 36.216  -5.484  1.00 125.57 ? 98   PRO A N   1 
ATOM 493  C CA  . PRO A 1 64  ? 16.034 37.385  -6.382  1.00 125.87 ? 98   PRO A CA  1 
ATOM 494  C C   . PRO A 1 64  ? 15.466 38.643  -5.753  1.00 115.11 ? 98   PRO A C   1 
ATOM 495  O O   . PRO A 1 64  ? 15.981 39.745  -5.990  1.00 104.61 ? 98   PRO A O   1 
ATOM 496  C CB  . PRO A 1 64  ? 15.199 36.929  -7.586  1.00 129.20 ? 98   PRO A CB  1 
ATOM 497  C CG  . PRO A 1 64  ? 15.318 35.457  -7.583  1.00 128.24 ? 98   PRO A CG  1 
ATOM 498  C CD  . PRO A 1 64  ? 15.354 35.059  -6.139  1.00 126.01 ? 98   PRO A CD  1 
ATOM 499  N N   . LEU A 1 65  ? 14.410 38.503  -4.950  1.00 125.23 ? 99   LEU A N   1 
ATOM 500  C CA  . LEU A 1 65  ? 13.827 39.658  -4.280  1.00 128.13 ? 99   LEU A CA  1 
ATOM 501  C C   . LEU A 1 65  ? 14.819 40.301  -3.322  1.00 118.85 ? 99   LEU A C   1 
ATOM 502  O O   . LEU A 1 65  ? 14.944 41.529  -3.281  1.00 131.36 ? 99   LEU A O   1 
ATOM 503  C CB  . LEU A 1 65  ? 12.558 39.247  -3.540  1.00 136.82 ? 99   LEU A CB  1 
ATOM 504  C CG  . LEU A 1 65  ? 11.466 38.662  -4.432  1.00 148.11 ? 99   LEU A CG  1 
ATOM 505  C CD1 . LEU A 1 65  ? 10.423 37.958  -3.588  1.00 160.50 ? 99   LEU A CD1 1 
ATOM 506  C CD2 . LEU A 1 65  ? 10.830 39.752  -5.279  1.00 147.56 ? 99   LEU A CD2 1 
ATOM 507  N N   . TRP A 1 66  ? 15.532 39.490  -2.539  1.00 106.79 ? 100  TRP A N   1 
ATOM 508  C CA  . TRP A 1 66  ? 16.502 40.060  -1.613  1.00 111.18 ? 100  TRP A CA  1 
ATOM 509  C C   . TRP A 1 66  ? 17.710 40.625  -2.345  1.00 105.57 ? 100  TRP A C   1 
ATOM 510  O O   . TRP A 1 66  ? 18.321 41.587  -1.870  1.00 90.53  ? 100  TRP A O   1 
ATOM 511  C CB  . TRP A 1 66  ? 16.942 39.015  -0.585  1.00 122.55 ? 100  TRP A CB  1 
ATOM 512  C CG  . TRP A 1 66  ? 15.806 38.286  0.057   1.00 126.51 ? 100  TRP A CG  1 
ATOM 513  C CD1 . TRP A 1 66  ? 15.642 36.935  0.129   1.00 130.77 ? 100  TRP A CD1 1 
ATOM 514  C CD2 . TRP A 1 66  ? 14.663 38.866  0.700   1.00 128.82 ? 100  TRP A CD2 1 
ATOM 515  N NE1 . TRP A 1 66  ? 14.473 36.636  0.784   1.00 133.65 ? 100  TRP A NE1 1 
ATOM 516  C CE2 . TRP A 1 66  ? 13.854 37.804  1.144   1.00 130.74 ? 100  TRP A CE2 1 
ATOM 517  C CE3 . TRP A 1 66  ? 14.249 40.179  0.946   1.00 129.23 ? 100  TRP A CE3 1 
ATOM 518  C CZ2 . TRP A 1 66  ? 12.654 38.012  1.820   1.00 134.47 ? 100  TRP A CZ2 1 
ATOM 519  C CZ3 . TRP A 1 66  ? 13.057 40.384  1.617   1.00 130.22 ? 100  TRP A CZ3 1 
ATOM 520  C CH2 . TRP A 1 66  ? 12.274 39.307  2.047   1.00 132.33 ? 100  TRP A CH2 1 
ATOM 521  N N   . ALA A 1 67  ? 18.074 40.044  -3.492  1.00 123.27 ? 101  ALA A N   1 
ATOM 522  C CA  . ALA A 1 67  ? 19.184 40.589  -4.268  1.00 124.89 ? 101  ALA A CA  1 
ATOM 523  C C   . ALA A 1 67  ? 18.826 41.946  -4.853  1.00 123.52 ? 101  ALA A C   1 
ATOM 524  O O   . ALA A 1 67  ? 19.664 42.857  -4.893  1.00 131.10 ? 101  ALA A O   1 
ATOM 525  C CB  . ALA A 1 67  ? 19.576 39.615  -5.373  1.00 129.77 ? 101  ALA A CB  1 
ATOM 526  N N   . THR A 1 68  ? 17.584 42.097  -5.315  1.00 118.88 ? 102  THR A N   1 
ATOM 527  C CA  . THR A 1 68  ? 17.103 43.408  -5.734  1.00 120.31 ? 102  THR A CA  1 
ATOM 528  C C   . THR A 1 68  ? 17.044 44.374  -4.554  1.00 116.96 ? 102  THR A C   1 
ATOM 529  O O   . THR A 1 68  ? 17.397 45.551  -4.686  1.00 118.66 ? 102  THR A O   1 
ATOM 530  C CB  . THR A 1 68  ? 15.732 43.259  -6.396  1.00 119.41 ? 102  THR A CB  1 
ATOM 531  O OG1 . THR A 1 68  ? 15.872 42.505  -7.607  1.00 122.21 ? 102  THR A OG1 1 
ATOM 532  C CG2 . THR A 1 68  ? 15.126 44.616  -6.712  1.00 126.21 ? 102  THR A CG2 1 
ATOM 533  N N   . TYR A 1 69  ? 16.619 43.884  -3.389  1.00 121.06 ? 103  TYR A N   1 
ATOM 534  C CA  . TYR A 1 69  ? 16.522 44.731  -2.205  1.00 127.44 ? 103  TYR A CA  1 
ATOM 535  C C   . TYR A 1 69  ? 17.884 45.274  -1.790  1.00 118.94 ? 103  TYR A C   1 
ATOM 536  O O   . TYR A 1 69  ? 18.004 46.447  -1.423  1.00 119.79 ? 103  TYR A O   1 
ATOM 537  C CB  . TYR A 1 69  ? 15.882 43.935  -1.072  1.00 136.84 ? 103  TYR A CB  1 
ATOM 538  C CG  . TYR A 1 69  ? 15.781 44.644  0.254   1.00 137.19 ? 103  TYR A CG  1 
ATOM 539  C CD1 . TYR A 1 69  ? 14.850 45.652  0.458   1.00 136.20 ? 103  TYR A CD1 1 
ATOM 540  C CD2 . TYR A 1 69  ? 16.592 44.273  1.315   1.00 130.82 ? 103  TYR A CD2 1 
ATOM 541  C CE1 . TYR A 1 69  ? 14.744 46.282  1.678   1.00 136.37 ? 103  TYR A CE1 1 
ATOM 542  C CE2 . TYR A 1 69  ? 16.494 44.896  2.534   1.00 127.03 ? 103  TYR A CE2 1 
ATOM 543  C CZ  . TYR A 1 69  ? 15.571 45.899  2.712   1.00 128.98 ? 103  TYR A CZ  1 
ATOM 544  O OH  . TYR A 1 69  ? 15.481 46.514  3.935   1.00 128.20 ? 103  TYR A OH  1 
ATOM 545  N N   . TYR A 1 70  ? 18.921 44.437  -1.835  1.00 110.13 ? 104  TYR A N   1 
ATOM 546  C CA  . TYR A 1 70  ? 20.271 44.897  -1.533  1.00 100.23 ? 104  TYR A CA  1 
ATOM 547  C C   . TYR A 1 70  ? 20.884 45.690  -2.677  1.00 96.68  ? 104  TYR A C   1 
ATOM 548  O O   . TYR A 1 70  ? 21.835 46.445  -2.446  1.00 82.04  ? 104  TYR A O   1 
ATOM 549  C CB  . TYR A 1 70  ? 21.179 43.712  -1.201  1.00 107.91 ? 104  TYR A CB  1 
ATOM 550  C CG  . TYR A 1 70  ? 21.024 43.163  0.200   1.00 110.24 ? 104  TYR A CG  1 
ATOM 551  C CD1 . TYR A 1 70  ? 21.795 43.647  1.248   1.00 110.60 ? 104  TYR A CD1 1 
ATOM 552  C CD2 . TYR A 1 70  ? 20.113 42.152  0.473   1.00 116.81 ? 104  TYR A CD2 1 
ATOM 553  C CE1 . TYR A 1 70  ? 21.657 43.143  2.533   1.00 116.83 ? 104  TYR A CE1 1 
ATOM 554  C CE2 . TYR A 1 70  ? 19.968 41.642  1.752   1.00 120.47 ? 104  TYR A CE2 1 
ATOM 555  C CZ  . TYR A 1 70  ? 20.742 42.140  2.778   1.00 119.12 ? 104  TYR A CZ  1 
ATOM 556  O OH  . TYR A 1 70  ? 20.600 41.635  4.050   1.00 115.01 ? 104  TYR A OH  1 
ATOM 557  N N   . SER A 1 71  ? 20.378 45.516  -3.902  1.00 118.44 ? 105  SER A N   1 
ATOM 558  C CA  . SER A 1 71  ? 20.882 46.287  -5.036  1.00 128.97 ? 105  SER A CA  1 
ATOM 559  C C   . SER A 1 71  ? 20.477 47.751  -4.923  1.00 124.83 ? 105  SER A C   1 
ATOM 560  O O   . SER A 1 71  ? 21.295 48.656  -5.133  1.00 123.57 ? 105  SER A O   1 
ATOM 561  C CB  . SER A 1 71  ? 20.364 45.696  -6.348  1.00 143.82 ? 105  SER A CB  1 
ATOM 562  O OG  . SER A 1 71  ? 20.672 44.319  -6.451  1.00 152.33 ? 105  SER A OG  1 
ATOM 563  N N   . TYR A 1 72  ? 19.211 47.999  -4.603  1.00 115.94 ? 106  TYR A N   1 
ATOM 564  C CA  . TYR A 1 72  ? 18.696 49.336  -4.365  1.00 105.09 ? 106  TYR A CA  1 
ATOM 565  C C   . TYR A 1 72  ? 18.992 49.841  -2.959  1.00 100.74 ? 106  TYR A C   1 
ATOM 566  O O   . TYR A 1 72  ? 18.389 50.831  -2.533  1.00 112.04 ? 106  TYR A O   1 
ATOM 567  C CB  . TYR A 1 72  ? 17.190 49.365  -4.629  1.00 105.03 ? 106  TYR A CB  1 
ATOM 568  C CG  . TYR A 1 72  ? 16.833 49.294  -6.098  1.00 115.29 ? 106  TYR A CG  1 
ATOM 569  C CD1 . TYR A 1 72  ? 17.515 50.058  -7.033  1.00 123.34 ? 106  TYR A CD1 1 
ATOM 570  C CD2 . TYR A 1 72  ? 15.823 48.459  -6.551  1.00 126.02 ? 106  TYR A CD2 1 
ATOM 571  C CE1 . TYR A 1 72  ? 17.197 50.002  -8.378  1.00 131.21 ? 106  TYR A CE1 1 
ATOM 572  C CE2 . TYR A 1 72  ? 15.500 48.393  -7.894  1.00 133.49 ? 106  TYR A CE2 1 
ATOM 573  C CZ  . TYR A 1 72  ? 16.186 49.167  -8.802  1.00 138.20 ? 106  TYR A CZ  1 
ATOM 574  O OH  . TYR A 1 72  ? 15.857 49.098  -10.138 1.00 147.24 ? 106  TYR A OH  1 
ATOM 575  N N   . ARG A 1 73  ? 19.891 49.177  -2.237  1.00 95.49  ? 107  ARG A N   1 
ATOM 576  C CA  . ARG A 1 73  ? 20.367 49.624  -0.933  1.00 91.80  ? 107  ARG A CA  1 
ATOM 577  C C   . ARG A 1 73  ? 19.203 49.949  0.005   1.00 102.87 ? 107  ARG A C   1 
ATOM 578  O O   . ARG A 1 73  ? 19.021 51.079  0.461   1.00 119.86 ? 107  ARG A O   1 
ATOM 579  C CB  . ARG A 1 73  ? 21.319 50.809  -1.094  1.00 94.22  ? 107  ARG A CB  1 
ATOM 580  C CG  . ARG A 1 73  ? 22.440 50.542  -2.089  1.00 96.84  ? 107  ARG A CG  1 
ATOM 581  C CD  . ARG A 1 73  ? 23.725 51.239  -1.684  1.00 106.60 ? 107  ARG A CD  1 
ATOM 582  N NE  . ARG A 1 73  ? 24.865 50.779  -2.472  1.00 116.61 ? 107  ARG A NE  1 
ATOM 583  C CZ  . ARG A 1 73  ? 26.135 51.018  -2.158  1.00 118.29 ? 107  ARG A CZ  1 
ATOM 584  N NH1 . ARG A 1 73  ? 27.107 50.558  -2.935  1.00 114.69 ? 107  ARG A NH1 1 
ATOM 585  N NH2 . ARG A 1 73  ? 26.435 51.714  -1.068  1.00 118.69 ? 107  ARG A NH2 1 
ATOM 586  N N   . TYR A 1 74  ? 18.392 48.922  0.254   1.00 108.65 ? 108  TYR A N   1 
ATOM 587  C CA  . TYR A 1 74  ? 17.320 48.830  1.245   1.00 106.13 ? 108  TYR A CA  1 
ATOM 588  C C   . TYR A 1 74  ? 16.051 49.563  0.827   1.00 110.81 ? 108  TYR A C   1 
ATOM 589  O O   . TYR A 1 74  ? 15.067 49.533  1.582   1.00 115.29 ? 108  TYR A O   1 
ATOM 590  C CB  . TYR A 1 74  ? 17.757 49.321  2.634   1.00 103.42 ? 108  TYR A CB  1 
ATOM 591  C CG  . TYR A 1 74  ? 18.937 48.551  3.173   1.00 107.35 ? 108  TYR A CG  1 
ATOM 592  C CD1 . TYR A 1 74  ? 18.794 47.236  3.598   1.00 115.34 ? 108  TYR A CD1 1 
ATOM 593  C CD2 . TYR A 1 74  ? 20.196 49.129  3.245   1.00 106.90 ? 108  TYR A CD2 1 
ATOM 594  C CE1 . TYR A 1 74  ? 19.873 46.519  4.088   1.00 114.61 ? 108  TYR A CE1 1 
ATOM 595  C CE2 . TYR A 1 74  ? 21.281 48.421  3.734   1.00 111.44 ? 108  TYR A CE2 1 
ATOM 596  C CZ  . TYR A 1 74  ? 21.114 47.117  4.154   1.00 113.55 ? 108  TYR A CZ  1 
ATOM 597  O OH  . TYR A 1 74  ? 22.190 46.410  4.642   1.00 109.43 ? 108  TYR A OH  1 
ATOM 598  N N   . ASP A 1 75  ? 16.020 50.204  -0.334  1.00 110.90 ? 109  ASP A N   1 
ATOM 599  C CA  . ASP A 1 75  ? 14.775 50.770  -0.832  1.00 115.02 ? 109  ASP A CA  1 
ATOM 600  C C   . ASP A 1 75  ? 13.916 49.642  -1.397  1.00 114.97 ? 109  ASP A C   1 
ATOM 601  O O   . ASP A 1 75  ? 14.307 48.977  -2.362  1.00 120.32 ? 109  ASP A O   1 
ATOM 602  C CB  . ASP A 1 75  ? 15.051 51.837  -1.886  1.00 110.08 ? 109  ASP A CB  1 
ATOM 603  C CG  . ASP A 1 75  ? 13.811 52.601  -2.270  1.00 111.08 ? 109  ASP A CG  1 
ATOM 604  O OD1 . ASP A 1 75  ? 13.379 53.464  -1.477  1.00 103.69 ? 109  ASP A OD1 1 
ATOM 605  O OD2 . ASP A 1 75  ? 13.267 52.331  -3.362  1.00 131.37 ? 109  ASP A OD2 1 
ATOM 606  N N   . TRP A 1 76  ? 12.755 49.426  -0.790  1.00 104.58 ? 110  TRP A N   1 
ATOM 607  C CA  . TRP A 1 76  ? 11.863 48.330  -1.139  1.00 107.10 ? 110  TRP A CA  1 
ATOM 608  C C   . TRP A 1 76  ? 10.794 48.847  -2.095  1.00 125.14 ? 110  TRP A C   1 
ATOM 609  O O   . TRP A 1 76  ? 10.024 49.750  -1.743  1.00 130.81 ? 110  TRP A O   1 
ATOM 610  C CB  . TRP A 1 76  ? 11.243 47.742  0.129   1.00 99.40  ? 110  TRP A CB  1 
ATOM 611  C CG  . TRP A 1 76  ? 10.269 46.633  -0.087  1.00 101.96 ? 110  TRP A CG  1 
ATOM 612  C CD1 . TRP A 1 76  ? 8.914  46.740  -0.169  1.00 113.90 ? 110  TRP A CD1 1 
ATOM 613  C CD2 . TRP A 1 76  ? 10.571 45.240  -0.225  1.00 103.14 ? 110  TRP A CD2 1 
ATOM 614  N NE1 . TRP A 1 76  ? 8.351  45.501  -0.358  1.00 119.52 ? 110  TRP A NE1 1 
ATOM 615  C CE2 . TRP A 1 76  ? 9.349  44.563  -0.397  1.00 110.51 ? 110  TRP A CE2 1 
ATOM 616  C CE3 . TRP A 1 76  ? 11.757 44.501  -0.227  1.00 102.06 ? 110  TRP A CE3 1 
ATOM 617  C CZ2 . TRP A 1 76  ? 9.278  43.184  -0.569  1.00 110.67 ? 110  TRP A CZ2 1 
ATOM 618  C CZ3 . TRP A 1 76  ? 11.686 43.133  -0.397  1.00 101.55 ? 110  TRP A CZ3 1 
ATOM 619  C CH2 . TRP A 1 76  ? 10.454 42.488  -0.565  1.00 109.85 ? 110  TRP A CH2 1 
ATOM 620  N N   . LEU A 1 77  ? 10.756 48.284  -3.306  1.00 127.85 ? 111  LEU A N   1 
ATOM 621  C CA  . LEU A 1 77  ? 9.829  48.739  -4.338  1.00 127.00 ? 111  LEU A CA  1 
ATOM 622  C C   . LEU A 1 77  ? 8.478  48.035  -4.292  1.00 127.59 ? 111  LEU A C   1 
ATOM 623  O O   . LEU A 1 77  ? 7.455  48.653  -4.609  1.00 136.67 ? 111  LEU A O   1 
ATOM 624  C CB  . LEU A 1 77  ? 10.427 48.527  -5.734  1.00 120.31 ? 111  LEU A CB  1 
ATOM 625  C CG  . LEU A 1 77  ? 11.935 48.385  -5.931  1.00 111.94 ? 111  LEU A CG  1 
ATOM 626  C CD1 . LEU A 1 77  ? 12.212 47.913  -7.345  1.00 111.04 ? 111  LEU A CD1 1 
ATOM 627  C CD2 . LEU A 1 77  ? 12.640 49.698  -5.663  1.00 118.46 ? 111  LEU A CD2 1 
ATOM 628  N N   . PHE A 1 78  ? 8.450  46.762  -3.905  1.00 123.13 ? 112  PHE A N   1 
ATOM 629  C CA  . PHE A 1 78  ? 7.287  45.912  -4.133  1.00 127.52 ? 112  PHE A CA  1 
ATOM 630  C C   . PHE A 1 78  ? 6.120  46.199  -3.191  1.00 136.14 ? 112  PHE A C   1 
ATOM 631  O O   . PHE A 1 78  ? 5.011  45.719  -3.448  1.00 134.64 ? 112  PHE A O   1 
ATOM 632  C CB  . PHE A 1 78  ? 7.717  44.445  -4.034  1.00 116.32 ? 112  PHE A CB  1 
ATOM 633  C CG  . PHE A 1 78  ? 8.988  44.141  -4.791  1.00 111.86 ? 112  PHE A CG  1 
ATOM 634  C CD1 . PHE A 1 78  ? 9.000  44.137  -6.177  1.00 112.92 ? 112  PHE A CD1 1 
ATOM 635  C CD2 . PHE A 1 78  ? 10.172 43.878  -4.118  1.00 106.90 ? 112  PHE A CD2 1 
ATOM 636  C CE1 . PHE A 1 78  ? 10.164 43.869  -6.879  1.00 109.32 ? 112  PHE A CE1 1 
ATOM 637  C CE2 . PHE A 1 78  ? 11.342 43.606  -4.816  1.00 101.10 ? 112  PHE A CE2 1 
ATOM 638  C CZ  . PHE A 1 78  ? 11.337 43.603  -6.197  1.00 103.57 ? 112  PHE A CZ  1 
ATOM 639  N N   . GLY A 1 79  ? 6.327  46.968  -2.125  1.00 151.64 ? 113  GLY A N   1 
ATOM 640  C CA  . GLY A 1 79  ? 5.233  47.377  -1.275  1.00 164.35 ? 113  GLY A CA  1 
ATOM 641  C C   . GLY A 1 79  ? 5.250  46.732  0.095   1.00 168.71 ? 113  GLY A C   1 
ATOM 642  O O   . GLY A 1 79  ? 6.046  45.831  0.378   1.00 169.37 ? 113  GLY A O   1 
ATOM 643  N N   . PRO A 1 80  ? 4.360  47.190  0.980   1.00 174.22 ? 114  PRO A N   1 
ATOM 644  C CA  . PRO A 1 80  ? 4.335  46.623  2.337   1.00 173.20 ? 114  PRO A CA  1 
ATOM 645  C C   . PRO A 1 80  ? 3.772  45.216  2.382   1.00 172.65 ? 114  PRO A C   1 
ATOM 646  O O   . PRO A 1 80  ? 4.289  44.368  3.123   1.00 172.06 ? 114  PRO A O   1 
ATOM 647  C CB  . PRO A 1 80  ? 3.458  47.616  3.108   1.00 179.08 ? 114  PRO A CB  1 
ATOM 648  C CG  . PRO A 1 80  ? 2.540  48.171  2.070   1.00 185.37 ? 114  PRO A CG  1 
ATOM 649  C CD  . PRO A 1 80  ? 3.341  48.237  0.795   1.00 179.97 ? 114  PRO A CD  1 
ATOM 650  N N   . VAL A 1 81  ? 2.721  44.944  1.606   1.00 166.99 ? 115  VAL A N   1 
ATOM 651  C CA  . VAL A 1 81  ? 2.147  43.603  1.576   1.00 155.18 ? 115  VAL A CA  1 
ATOM 652  C C   . VAL A 1 81  ? 3.177  42.590  1.086   1.00 146.99 ? 115  VAL A C   1 
ATOM 653  O O   . VAL A 1 81  ? 3.278  41.478  1.619   1.00 151.08 ? 115  VAL A O   1 
ATOM 654  C CB  . VAL A 1 81  ? 0.869  43.592  0.716   1.00 148.22 ? 115  VAL A CB  1 
ATOM 655  C CG1 . VAL A 1 81  ? -0.297 44.145  1.509   1.00 148.52 ? 115  VAL A CG1 1 
ATOM 656  C CG2 . VAL A 1 81  ? 1.073  44.411  -0.549  1.00 151.95 ? 115  VAL A CG2 1 
ATOM 657  N N   . MET A 1 82  ? 3.972  42.961  0.079   1.00 136.99 ? 116  MET A N   1 
ATOM 658  C CA  . MET A 1 82  ? 4.998  42.049  -0.415  1.00 127.50 ? 116  MET A CA  1 
ATOM 659  C C   . MET A 1 82  ? 6.091  41.834  0.622   1.00 126.07 ? 116  MET A C   1 
ATOM 660  O O   . MET A 1 82  ? 6.637  40.730  0.738   1.00 132.79 ? 116  MET A O   1 
ATOM 661  C CB  . MET A 1 82  ? 5.590  42.578  -1.718  1.00 129.08 ? 116  MET A CB  1 
ATOM 662  C CG  . MET A 1 82  ? 4.625  42.546  -2.889  1.00 133.83 ? 116  MET A CG  1 
ATOM 663  S SD  . MET A 1 82  ? 3.912  40.913  -3.172  1.00 127.72 ? 116  MET A SD  1 
ATOM 664  C CE  . MET A 1 82  ? 3.005  41.207  -4.686  1.00 133.61 ? 116  MET A CE  1 
ATOM 665  N N   . CYS A 1 83  ? 6.434  42.879  1.376   1.00 126.89 ? 117  CYS A N   1 
ATOM 666  C CA  . CYS A 1 83  ? 7.420  42.733  2.442   1.00 127.75 ? 117  CYS A CA  1 
ATOM 667  C C   . CYS A 1 83  ? 6.922  41.764  3.513   1.00 116.96 ? 117  CYS A C   1 
ATOM 668  O O   . CYS A 1 83  ? 7.661  40.871  3.954   1.00 98.52  ? 117  CYS A O   1 
ATOM 669  C CB  . CYS A 1 83  ? 7.744  44.112  3.027   1.00 136.10 ? 117  CYS A CB  1 
ATOM 670  S SG  . CYS A 1 83  ? 8.756  44.153  4.527   1.00 139.00 ? 117  CYS A SG  1 
ATOM 671  N N   . LYS A 1 84  ? 5.663  41.920  3.934   1.00 117.98 ? 118  LYS A N   1 
ATOM 672  C CA  . LYS A 1 84  ? 5.038  40.958  4.837   1.00 121.11 ? 118  LYS A CA  1 
ATOM 673  C C   . LYS A 1 84  ? 5.149  39.542  4.289   1.00 124.53 ? 118  LYS A C   1 
ATOM 674  O O   . LYS A 1 84  ? 5.728  38.648  4.922   1.00 135.29 ? 118  LYS A O   1 
ATOM 675  C CB  . LYS A 1 84  ? 3.563  41.315  5.049   1.00 126.42 ? 118  LYS A CB  1 
ATOM 676  C CG  . LYS A 1 84  ? 3.293  42.352  6.115   1.00 133.36 ? 118  LYS A CG  1 
ATOM 677  C CD  . LYS A 1 84  ? 3.230  41.729  7.491   1.00 136.03 ? 118  LYS A CD  1 
ATOM 678  C CE  . LYS A 1 84  ? 3.133  42.810  8.545   1.00 148.99 ? 118  LYS A CE  1 
ATOM 679  N NZ  . LYS A 1 84  ? 3.441  42.285  9.891   1.00 154.22 ? 118  LYS A NZ  1 
ATOM 680  N N   . VAL A 1 85  ? 4.599  39.335  3.090   1.00 118.68 ? 119  VAL A N   1 
ATOM 681  C CA  . VAL A 1 85  ? 4.426  37.991  2.549   1.00 108.05 ? 119  VAL A CA  1 
ATOM 682  C C   . VAL A 1 85  ? 5.769  37.300  2.366   1.00 101.84 ? 119  VAL A C   1 
ATOM 683  O O   . VAL A 1 85  ? 5.942  36.136  2.740   1.00 112.55 ? 119  VAL A O   1 
ATOM 684  C CB  . VAL A 1 85  ? 3.641  38.048  1.227   1.00 108.29 ? 119  VAL A CB  1 
ATOM 685  C CG1 . VAL A 1 85  ? 3.731  36.714  0.504   1.00 111.03 ? 119  VAL A CG1 1 
ATOM 686  C CG2 . VAL A 1 85  ? 2.194  38.433  1.487   1.00 102.55 ? 119  VAL A CG2 1 
ATOM 687  N N   . PHE A 1 86  ? 6.737  37.999  1.784   1.00 98.39  ? 120  PHE A N   1 
ATOM 688  C CA  . PHE A 1 86  ? 8.006  37.356  1.472   1.00 112.93 ? 120  PHE A CA  1 
ATOM 689  C C   . PHE A 1 86  ? 8.927  37.259  2.682   1.00 129.46 ? 120  PHE A C   1 
ATOM 690  O O   . PHE A 1 86  ? 9.768  36.356  2.737   1.00 133.01 ? 120  PHE A O   1 
ATOM 691  C CB  . PHE A 1 86  ? 8.691  38.096  0.329   1.00 123.03 ? 120  PHE A CB  1 
ATOM 692  C CG  . PHE A 1 86  ? 7.956  37.987  -0.973  1.00 133.59 ? 120  PHE A CG  1 
ATOM 693  C CD1 . PHE A 1 86  ? 7.492  36.761  -1.415  1.00 134.12 ? 120  PHE A CD1 1 
ATOM 694  C CD2 . PHE A 1 86  ? 7.701  39.113  -1.740  1.00 140.46 ? 120  PHE A CD2 1 
ATOM 695  C CE1 . PHE A 1 86  ? 6.805  36.652  -2.609  1.00 139.89 ? 120  PHE A CE1 1 
ATOM 696  C CE2 . PHE A 1 86  ? 7.014  39.011  -2.934  1.00 144.72 ? 120  PHE A CE2 1 
ATOM 697  C CZ  . PHE A 1 86  ? 6.565  37.778  -3.369  1.00 145.36 ? 120  PHE A CZ  1 
ATOM 698  N N   . GLY A 1 87  ? 8.801  38.166  3.651   1.00 147.19 ? 121  GLY A N   1 
ATOM 699  C CA  . GLY A 1 87  ? 9.549  37.997  4.889   1.00 147.59 ? 121  GLY A CA  1 
ATOM 700  C C   . GLY A 1 87  ? 9.057  36.807  5.691   1.00 149.34 ? 121  GLY A C   1 
ATOM 701  O O   . GLY A 1 87  ? 9.841  35.937  6.091   1.00 152.46 ? 121  GLY A O   1 
ATOM 702  N N   . SER A 1 88  ? 7.743  36.745  5.924   1.00 152.80 ? 122  SER A N   1 
ATOM 703  C CA  . SER A 1 88  ? 7.182  35.612  6.650   1.00 147.53 ? 122  SER A CA  1 
ATOM 704  C C   . SER A 1 88  ? 7.346  34.315  5.870   1.00 141.85 ? 122  SER A C   1 
ATOM 705  O O   . SER A 1 88  ? 7.503  33.246  6.467   1.00 145.30 ? 122  SER A O   1 
ATOM 706  C CB  . SER A 1 88  ? 5.708  35.874  6.961   1.00 140.15 ? 122  SER A CB  1 
ATOM 707  O OG  . SER A 1 88  ? 4.995  36.200  5.783   1.00 147.21 ? 122  SER A OG  1 
ATOM 708  N N   . PHE A 1 89  ? 7.303  34.390  4.540   1.00 129.85 ? 123  PHE A N   1 
ATOM 709  C CA  . PHE A 1 89  ? 7.537  33.218  3.704   1.00 117.25 ? 123  PHE A CA  1 
ATOM 710  C C   . PHE A 1 89  ? 8.974  32.738  3.835   1.00 102.64 ? 123  PHE A C   1 
ATOM 711  O O   . PHE A 1 89  ? 9.230  31.534  3.968   1.00 107.71 ? 123  PHE A O   1 
ATOM 712  C CB  . PHE A 1 89  ? 7.210  33.567  2.253   1.00 120.72 ? 123  PHE A CB  1 
ATOM 713  C CG  . PHE A 1 89  ? 7.140  32.386  1.333   1.00 121.52 ? 123  PHE A CG  1 
ATOM 714  C CD1 . PHE A 1 89  ? 5.970  31.654  1.216   1.00 121.93 ? 123  PHE A CD1 1 
ATOM 715  C CD2 . PHE A 1 89  ? 8.230  32.030  0.558   1.00 120.26 ? 123  PHE A CD2 1 
ATOM 716  C CE1 . PHE A 1 89  ? 5.896  30.577  0.360   1.00 123.88 ? 123  PHE A CE1 1 
ATOM 717  C CE2 . PHE A 1 89  ? 8.161  30.951  -0.303  1.00 120.38 ? 123  PHE A CE2 1 
ATOM 718  C CZ  . PHE A 1 89  ? 6.993  30.224  -0.401  1.00 123.71 ? 123  PHE A CZ  1 
ATOM 719  N N   . LEU A 1 90  ? 9.921  33.672  3.801   1.00 102.08 ? 124  LEU A N   1 
ATOM 720  C CA  . LEU A 1 90  ? 11.321 33.333  4.004   1.00 110.73 ? 124  LEU A CA  1 
ATOM 721  C C   . LEU A 1 90  ? 11.524 32.642  5.343   1.00 114.29 ? 124  LEU A C   1 
ATOM 722  O O   . LEU A 1 90  ? 12.116 31.559  5.413   1.00 116.38 ? 124  LEU A O   1 
ATOM 723  C CB  . LEU A 1 90  ? 12.170 34.597  3.929   1.00 118.59 ? 124  LEU A CB  1 
ATOM 724  C CG  . LEU A 1 90  ? 13.661 34.355  3.783   1.00 117.09 ? 124  LEU A CG  1 
ATOM 725  C CD1 . LEU A 1 90  ? 13.903 33.836  2.394   1.00 126.36 ? 124  LEU A CD1 1 
ATOM 726  C CD2 . LEU A 1 90  ? 14.417 35.638  4.023   1.00 104.56 ? 124  LEU A CD2 1 
ATOM 727  N N   . THR A 1 91  ? 11.034 33.258  6.421   1.00 118.86 ? 125  THR A N   1 
ATOM 728  C CA  . THR A 1 91  ? 11.222 32.678  7.748   1.00 119.66 ? 125  THR A CA  1 
ATOM 729  C C   . THR A 1 91  ? 10.540 31.319  7.856   1.00 115.64 ? 125  THR A C   1 
ATOM 730  O O   . THR A 1 91  ? 11.103 30.372  8.422   1.00 117.26 ? 125  THR A O   1 
ATOM 731  C CB  . THR A 1 91  ? 10.698 33.645  8.809   1.00 126.28 ? 125  THR A CB  1 
ATOM 732  O OG1 . THR A 1 91  ? 11.560 34.790  8.874   1.00 133.48 ? 125  THR A OG1 1 
ATOM 733  C CG2 . THR A 1 91  ? 10.642 32.984  10.171  1.00 120.82 ? 125  THR A CG2 1 
ATOM 734  N N   . LEU A 1 92  ? 9.339  31.201  7.290   1.00 111.67 ? 126  LEU A N   1 
ATOM 735  C CA  . LEU A 1 92  ? 8.615  29.935  7.307   1.00 111.00 ? 126  LEU A CA  1 
ATOM 736  C C   . LEU A 1 92  ? 9.400  28.831  6.609   1.00 116.79 ? 126  LEU A C   1 
ATOM 737  O O   . LEU A 1 92  ? 9.439  27.694  7.090   1.00 126.81 ? 126  LEU A O   1 
ATOM 738  C CB  . LEU A 1 92  ? 7.245  30.118  6.658   1.00 110.29 ? 126  LEU A CB  1 
ATOM 739  C CG  . LEU A 1 92  ? 6.501  28.860  6.212   1.00 113.11 ? 126  LEU A CG  1 
ATOM 740  C CD1 . LEU A 1 92  ? 6.157  27.979  7.398   1.00 115.90 ? 126  LEU A CD1 1 
ATOM 741  C CD2 . LEU A 1 92  ? 5.250  29.249  5.450   1.00 114.63 ? 126  LEU A CD2 1 
ATOM 742  N N   . ASN A 1 93  ? 10.036 29.139  5.478   1.00 116.93 ? 127  ASN A N   1 
ATOM 743  C CA  . ASN A 1 93  ? 10.802 28.102  4.794   1.00 118.79 ? 127  ASN A CA  1 
ATOM 744  C C   . ASN A 1 93  ? 12.134 27.819  5.471   1.00 126.86 ? 127  ASN A C   1 
ATOM 745  O O   . ASN A 1 93  ? 12.645 26.699  5.366   1.00 134.26 ? 127  ASN A O   1 
ATOM 746  C CB  . ASN A 1 93  ? 11.029 28.476  3.336   1.00 121.50 ? 127  ASN A CB  1 
ATOM 747  C CG  . ASN A 1 93  ? 9.893  28.036  2.452   1.00 126.99 ? 127  ASN A CG  1 
ATOM 748  O OD1 . ASN A 1 93  ? 10.052 27.898  1.241   1.00 134.16 ? 127  ASN A OD1 1 
ATOM 749  N ND2 . ASN A 1 93  ? 8.737  27.795  3.055   1.00 123.21 ? 127  ASN A ND2 1 
ATOM 750  N N   . MET A 1 94  ? 12.727 28.809  6.140   1.00 131.27 ? 128  MET A N   1 
ATOM 751  C CA  . MET A 1 94  ? 13.892 28.521  6.969   1.00 135.66 ? 128  MET A CA  1 
ATOM 752  C C   . MET A 1 94  ? 13.534 27.516  8.051   1.00 131.43 ? 128  MET A C   1 
ATOM 753  O O   . MET A 1 94  ? 14.210 26.493  8.222   1.00 134.53 ? 128  MET A O   1 
ATOM 754  C CB  . MET A 1 94  ? 14.430 29.806  7.597   1.00 150.98 ? 128  MET A CB  1 
ATOM 755  C CG  . MET A 1 94  ? 14.918 30.840  6.603   1.00 160.37 ? 128  MET A CG  1 
ATOM 756  S SD  . MET A 1 94  ? 16.244 30.213  5.556   1.00 166.08 ? 128  MET A SD  1 
ATOM 757  C CE  . MET A 1 94  ? 17.557 31.370  5.929   1.00 166.82 ? 128  MET A CE  1 
ATOM 758  N N   . PHE A 1 95  ? 12.449 27.784  8.779   1.00 120.15 ? 129  PHE A N   1 
ATOM 759  C CA  . PHE A 1 95  ? 12.044 26.895  9.860   1.00 118.47 ? 129  PHE A CA  1 
ATOM 760  C C   . PHE A 1 95  ? 11.611 25.535  9.330   1.00 122.29 ? 129  PHE A C   1 
ATOM 761  O O   . PHE A 1 95  ? 11.855 24.509  9.974   1.00 123.48 ? 129  PHE A O   1 
ATOM 762  C CB  . PHE A 1 95  ? 10.927 27.546  10.672  1.00 124.91 ? 129  PHE A CB  1 
ATOM 763  C CG  . PHE A 1 95  ? 11.397 28.669  11.551  1.00 127.19 ? 129  PHE A CG  1 
ATOM 764  C CD1 . PHE A 1 95  ? 12.693 28.689  12.043  1.00 117.74 ? 129  PHE A CD1 1 
ATOM 765  C CD2 . PHE A 1 95  ? 10.547 29.710  11.882  1.00 127.48 ? 129  PHE A CD2 1 
ATOM 766  C CE1 . PHE A 1 95  ? 13.126 29.722  12.855  1.00 107.30 ? 129  PHE A CE1 1 
ATOM 767  C CE2 . PHE A 1 95  ? 10.974 30.740  12.698  1.00 119.57 ? 129  PHE A CE2 1 
ATOM 768  C CZ  . PHE A 1 95  ? 12.265 30.747  13.181  1.00 109.81 ? 129  PHE A CZ  1 
ATOM 769  N N   . ALA A 1 96  ? 10.972 25.500  8.158   1.00 117.57 ? 130  ALA A N   1 
ATOM 770  C CA  . ALA A 1 96  ? 10.597 24.218  7.570   1.00 111.22 ? 130  ALA A CA  1 
ATOM 771  C C   . ALA A 1 96  ? 11.828 23.413  7.172   1.00 108.04 ? 130  ALA A C   1 
ATOM 772  O O   . ALA A 1 96  ? 11.895 22.206  7.426   1.00 115.28 ? 130  ALA A O   1 
ATOM 773  C CB  . ALA A 1 96  ? 9.680  24.437  6.366   1.00 98.87  ? 130  ALA A CB  1 
ATOM 774  N N   . SER A 1 97  ? 12.818 24.066  6.562   1.00 107.31 ? 131  SER A N   1 
ATOM 775  C CA  . SER A 1 97  ? 14.045 23.367  6.199   1.00 111.51 ? 131  SER A CA  1 
ATOM 776  C C   . SER A 1 97  ? 14.756 22.827  7.436   1.00 113.75 ? 131  SER A C   1 
ATOM 777  O O   . SER A 1 97  ? 15.119 21.646  7.489   1.00 117.61 ? 131  SER A O   1 
ATOM 778  C CB  . SER A 1 97  ? 14.963 24.297  5.402   1.00 116.64 ? 131  SER A CB  1 
ATOM 779  O OG  . SER A 1 97  ? 16.161 23.639  5.018   1.00 123.34 ? 131  SER A OG  1 
ATOM 780  N N   . ILE A 1 98  ? 14.948 23.672  8.453   1.00 109.40 ? 132  ILE A N   1 
ATOM 781  C CA  . ILE A 1 98  ? 15.709 23.249  9.627   1.00 114.52 ? 132  ILE A CA  1 
ATOM 782  C C   . ILE A 1 98  ? 14.961 22.159  10.387  1.00 125.10 ? 132  ILE A C   1 
ATOM 783  O O   . ILE A 1 98  ? 15.540 21.133  10.776  1.00 126.92 ? 132  ILE A O   1 
ATOM 784  C CB  . ILE A 1 98  ? 16.021 24.460  10.523  1.00 104.89 ? 132  ILE A CB  1 
ATOM 785  C CG1 . ILE A 1 98  ? 16.919 25.444  9.770   1.00 104.24 ? 132  ILE A CG1 1 
ATOM 786  C CG2 . ILE A 1 98  ? 16.671 24.009  11.824  1.00 104.02 ? 132  ILE A CG2 1 
ATOM 787  C CD1 . ILE A 1 98  ? 17.246 26.694  10.547  1.00 111.63 ? 132  ILE A CD1 1 
ATOM 788  N N   . PHE A 1 99  ? 13.660 22.366  10.603  1.00 138.56 ? 133  PHE A N   1 
ATOM 789  C CA  . PHE A 1 99  ? 12.836 21.360  11.263  1.00 151.62 ? 133  PHE A CA  1 
ATOM 790  C C   . PHE A 1 99  ? 12.803 20.051  10.482  1.00 153.02 ? 133  PHE A C   1 
ATOM 791  O O   . PHE A 1 99  ? 12.669 18.977  11.080  1.00 160.27 ? 133  PHE A O   1 
ATOM 792  C CB  . PHE A 1 99  ? 11.414 21.890  11.453  1.00 155.56 ? 133  PHE A CB  1 
ATOM 793  C CG  . PHE A 1 99  ? 11.304 23.001  12.457  1.00 151.80 ? 133  PHE A CG  1 
ATOM 794  C CD1 . PHE A 1 99  ? 12.327 23.255  13.356  1.00 151.43 ? 133  PHE A CD1 1 
ATOM 795  C CD2 . PHE A 1 99  ? 10.166 23.787  12.506  1.00 147.03 ? 133  PHE A CD2 1 
ATOM 796  C CE1 . PHE A 1 99  ? 12.216 24.275  14.279  1.00 148.87 ? 133  PHE A CE1 1 
ATOM 797  C CE2 . PHE A 1 99  ? 10.048 24.805  13.425  1.00 146.33 ? 133  PHE A CE2 1 
ATOM 798  C CZ  . PHE A 1 99  ? 11.074 25.051  14.314  1.00 146.98 ? 133  PHE A CZ  1 
ATOM 799  N N   . PHE A 1 100 ? 12.915 20.114  9.154   1.00 139.50 ? 134  PHE A N   1 
ATOM 800  C CA  . PHE A 1 100 ? 12.942 18.887  8.367   1.00 135.55 ? 134  PHE A CA  1 
ATOM 801  C C   . PHE A 1 100 ? 14.294 18.192  8.462   1.00 139.52 ? 134  PHE A C   1 
ATOM 802  O O   . PHE A 1 100 ? 14.356 16.960  8.437   1.00 147.96 ? 134  PHE A O   1 
ATOM 803  C CB  . PHE A 1 100 ? 12.586 19.174  6.908   1.00 135.26 ? 134  PHE A CB  1 
ATOM 804  C CG  . PHE A 1 100 ? 11.110 19.120  6.626   1.00 140.79 ? 134  PHE A CG  1 
ATOM 805  C CD1 . PHE A 1 100 ? 10.311 18.161  7.226   1.00 146.23 ? 134  PHE A CD1 1 
ATOM 806  C CD2 . PHE A 1 100 ? 10.520 20.036  5.770   1.00 143.81 ? 134  PHE A CD2 1 
ATOM 807  C CE1 . PHE A 1 100 ? 8.953  18.111  6.974   1.00 147.64 ? 134  PHE A CE1 1 
ATOM 808  C CE2 . PHE A 1 100 ? 9.162  19.996  5.519   1.00 145.67 ? 134  PHE A CE2 1 
ATOM 809  C CZ  . PHE A 1 100 ? 8.377  19.031  6.121   1.00 148.46 ? 134  PHE A CZ  1 
ATOM 810  N N   . ILE A 1 101 ? 15.387 18.953  8.563   1.00 135.21 ? 135  ILE A N   1 
ATOM 811  C CA  . ILE A 1 101 ? 16.687 18.336  8.823   1.00 133.03 ? 135  ILE A CA  1 
ATOM 812  C C   . ILE A 1 101 ? 16.650 17.590  10.151  1.00 135.02 ? 135  ILE A C   1 
ATOM 813  O O   . ILE A 1 101 ? 17.074 16.429  10.251  1.00 137.04 ? 135  ILE A O   1 
ATOM 814  C CB  . ILE A 1 101 ? 17.804 19.396  8.804   1.00 124.79 ? 135  ILE A CB  1 
ATOM 815  C CG1 . ILE A 1 101 ? 17.883 20.076  7.439   1.00 119.53 ? 135  ILE A CG1 1 
ATOM 816  C CG2 . ILE A 1 101 ? 19.144 18.768  9.145   1.00 127.21 ? 135  ILE A CG2 1 
ATOM 817  C CD1 . ILE A 1 101 ? 18.804 21.277  7.428   1.00 123.65 ? 135  ILE A CD1 1 
ATOM 818  N N   . THR A 1 102 ? 16.123 18.248  11.189  1.00 129.88 ? 136  THR A N   1 
ATOM 819  C CA  . THR A 1 102 ? 15.982 17.602  12.491  1.00 135.13 ? 136  THR A CA  1 
ATOM 820  C C   . THR A 1 102 ? 15.097 16.362  12.406  1.00 132.34 ? 136  THR A C   1 
ATOM 821  O O   . THR A 1 102 ? 15.414 15.317  12.990  1.00 128.12 ? 136  THR A O   1 
ATOM 822  C CB  . THR A 1 102 ? 15.409 18.601  13.497  1.00 129.80 ? 136  THR A CB  1 
ATOM 823  O OG1 . THR A 1 102 ? 16.392 19.604  13.786  1.00 111.45 ? 136  THR A OG1 1 
ATOM 824  C CG2 . THR A 1 102 ? 14.993 17.901  14.785  1.00 140.58 ? 136  THR A CG2 1 
ATOM 825  N N   . CYS A 1 103 ? 13.986 16.458  11.673  1.00 135.38 ? 137  CYS A N   1 
ATOM 826  C CA  . CYS A 1 103 ? 13.061 15.337  11.555  1.00 144.99 ? 137  CYS A CA  1 
ATOM 827  C C   . CYS A 1 103 ? 13.682 14.163  10.803  1.00 157.45 ? 137  CYS A C   1 
ATOM 828  O O   . CYS A 1 103 ? 13.383 13.003  11.112  1.00 162.29 ? 137  CYS A O   1 
ATOM 829  C CB  . CYS A 1 103 ? 11.778 15.808  10.869  1.00 142.58 ? 137  CYS A CB  1 
ATOM 830  S SG  . CYS A 1 103 ? 10.521 14.543  10.647  1.00 166.00 ? 137  CYS A SG  1 
ATOM 831  N N   . MET A 1 104 ? 14.544 14.437  9.821   1.00 161.42 ? 138  MET A N   1 
ATOM 832  C CA  . MET A 1 104 ? 15.224 13.359  9.114   1.00 168.33 ? 138  MET A CA  1 
ATOM 833  C C   . MET A 1 104 ? 16.312 12.724  9.964   1.00 167.73 ? 138  MET A C   1 
ATOM 834  O O   . MET A 1 104 ? 16.548 11.517  9.857   1.00 176.88 ? 138  MET A O   1 
ATOM 835  C CB  . MET A 1 104 ? 15.825 13.881  7.813   1.00 177.05 ? 138  MET A CB  1 
ATOM 836  C CG  . MET A 1 104 ? 14.806 14.435  6.849   1.00 180.11 ? 138  MET A CG  1 
ATOM 837  S SD  . MET A 1 104 ? 15.527 14.749  5.237   1.00 182.89 ? 138  MET A SD  1 
ATOM 838  C CE  . MET A 1 104 ? 16.194 13.123  4.898   1.00 195.16 ? 138  MET A CE  1 
ATOM 839  N N   . SER A 1 105 ? 16.992 13.513  10.800  1.00 152.89 ? 139  SER A N   1 
ATOM 840  C CA  . SER A 1 105 ? 17.949 12.919  11.728  1.00 151.07 ? 139  SER A CA  1 
ATOM 841  C C   . SER A 1 105 ? 17.242 12.052  12.759  1.00 150.43 ? 139  SER A C   1 
ATOM 842  O O   . SER A 1 105 ? 17.737 10.976  13.119  1.00 153.41 ? 139  SER A O   1 
ATOM 843  C CB  . SER A 1 105 ? 18.764 14.009  12.421  1.00 152.29 ? 139  SER A CB  1 
ATOM 844  O OG  . SER A 1 105 ? 19.519 14.758  11.487  1.00 145.25 ? 139  SER A OG  1 
ATOM 845  N N   . VAL A 1 106 ? 16.088 12.506  13.252  1.00 155.95 ? 140  VAL A N   1 
ATOM 846  C CA  . VAL A 1 106 ? 15.306 11.691  14.176  1.00 161.38 ? 140  VAL A CA  1 
ATOM 847  C C   . VAL A 1 106 ? 14.826 10.426  13.483  1.00 170.23 ? 140  VAL A C   1 
ATOM 848  O O   . VAL A 1 106 ? 14.821 9.338   14.072  1.00 186.89 ? 140  VAL A O   1 
ATOM 849  C CB  . VAL A 1 106 ? 14.133 12.507  14.749  1.00 158.06 ? 140  VAL A CB  1 
ATOM 850  C CG1 . VAL A 1 106 ? 13.166 11.608  15.492  1.00 160.93 ? 140  VAL A CG1 1 
ATOM 851  C CG2 . VAL A 1 106 ? 14.655 13.586  15.673  1.00 158.74 ? 140  VAL A CG2 1 
ATOM 852  N N   . ASP A 1 107 ? 14.428 10.545  12.215  1.00 165.92 ? 141  ASP A N   1 
ATOM 853  C CA  . ASP A 1 107 ? 13.973 9.378   11.470  1.00 170.68 ? 141  ASP A CA  1 
ATOM 854  C C   . ASP A 1 107 ? 15.103 8.374   11.275  1.00 166.32 ? 141  ASP A C   1 
ATOM 855  O O   . ASP A 1 107 ? 14.896 7.161   11.403  1.00 173.61 ? 141  ASP A O   1 
ATOM 856  C CB  . ASP A 1 107 ? 13.395 9.815   10.125  1.00 168.87 ? 141  ASP A CB  1 
ATOM 857  C CG  . ASP A 1 107 ? 12.865 8.655   9.316   1.00 169.46 ? 141  ASP A CG  1 
ATOM 858  O OD1 . ASP A 1 107 ? 11.854 8.054   9.732   1.00 170.94 ? 141  ASP A OD1 1 
ATOM 859  O OD2 . ASP A 1 107 ? 13.461 8.344   8.265   1.00 170.28 ? 141  ASP A OD2 1 
ATOM 860  N N   . ARG A 1 108 ? 16.309 8.860   10.974  1.00 161.81 ? 142  ARG A N   1 
ATOM 861  C CA  . ARG A 1 108 ? 17.453 7.964   10.846  1.00 171.91 ? 142  ARG A CA  1 
ATOM 862  C C   . ARG A 1 108 ? 17.786 7.296   12.174  1.00 186.63 ? 142  ARG A C   1 
ATOM 863  O O   . ARG A 1 108 ? 18.123 6.107   12.210  1.00 190.96 ? 142  ARG A O   1 
ATOM 864  C CB  . ARG A 1 108 ? 18.664 8.728   10.316  1.00 165.47 ? 142  ARG A CB  1 
ATOM 865  C CG  . ARG A 1 108 ? 18.546 9.165   8.873   1.00 164.89 ? 142  ARG A CG  1 
ATOM 866  C CD  . ARG A 1 108 ? 19.773 9.955   8.470   1.00 172.68 ? 142  ARG A CD  1 
ATOM 867  N NE  . ARG A 1 108 ? 19.761 10.306  7.055   1.00 172.29 ? 142  ARG A NE  1 
ATOM 868  C CZ  . ARG A 1 108 ? 20.760 10.922  6.434   1.00 166.05 ? 142  ARG A CZ  1 
ATOM 869  N NH1 . ARG A 1 108 ? 20.665 11.201  5.143   1.00 164.07 ? 142  ARG A NH1 1 
ATOM 870  N NH2 . ARG A 1 108 ? 21.855 11.257  7.103   1.00 163.27 ? 142  ARG A NH2 1 
ATOM 871  N N   . TYR A 1 109 ? 17.702 8.044   13.277  1.00 193.52 ? 143  TYR A N   1 
ATOM 872  C CA  . TYR A 1 109 ? 17.996 7.468   14.588  1.00 203.95 ? 143  TYR A CA  1 
ATOM 873  C C   . TYR A 1 109 ? 17.001 6.370   14.943  1.00 208.76 ? 143  TYR A C   1 
ATOM 874  O O   . TYR A 1 109 ? 17.388 5.256   15.323  1.00 222.42 ? 143  TYR A O   1 
ATOM 875  C CB  . TYR A 1 109 ? 17.986 8.569   15.646  1.00 201.24 ? 143  TYR A CB  1 
ATOM 876  C CG  . TYR A 1 109 ? 18.183 8.100   17.071  1.00 204.50 ? 143  TYR A CG  1 
ATOM 877  C CD1 . TYR A 1 109 ? 19.446 7.776   17.547  1.00 205.05 ? 143  TYR A CD1 1 
ATOM 878  C CD2 . TYR A 1 109 ? 17.109 8.016   17.951  1.00 205.17 ? 143  TYR A CD2 1 
ATOM 879  C CE1 . TYR A 1 109 ? 19.633 7.364   18.852  1.00 210.67 ? 143  TYR A CE1 1 
ATOM 880  C CE2 . TYR A 1 109 ? 17.287 7.606   19.257  1.00 211.11 ? 143  TYR A CE2 1 
ATOM 881  C CZ  . TYR A 1 109 ? 18.552 7.287   19.704  1.00 215.34 ? 143  TYR A CZ  1 
ATOM 882  O OH  . TYR A 1 109 ? 18.736 6.874   21.004  1.00 223.86 ? 143  TYR A OH  1 
ATOM 883  N N   . GLN A 1 110 ? 15.707 6.669   14.818  1.00 201.56 ? 144  GLN A N   1 
ATOM 884  C CA  . GLN A 1 110 ? 14.676 5.699   15.157  1.00 203.27 ? 144  GLN A CA  1 
ATOM 885  C C   . GLN A 1 110 ? 14.575 4.566   14.145  1.00 195.52 ? 144  GLN A C   1 
ATOM 886  O O   . GLN A 1 110 ? 13.938 3.553   14.446  1.00 196.66 ? 144  GLN A O   1 
ATOM 887  C CB  . GLN A 1 110 ? 13.325 6.400   15.299  1.00 205.22 ? 144  GLN A CB  1 
ATOM 888  C CG  . GLN A 1 110 ? 13.265 7.366   16.469  1.00 206.71 ? 144  GLN A CG  1 
ATOM 889  C CD  . GLN A 1 110 ? 11.853 7.810   16.783  1.00 210.85 ? 144  GLN A CD  1 
ATOM 890  O OE1 . GLN A 1 110 ? 10.920 7.526   16.032  1.00 212.43 ? 144  GLN A OE1 1 
ATOM 891  N NE2 . GLN A 1 110 ? 11.687 8.507   17.902  1.00 213.07 ? 144  GLN A NE2 1 
ATOM 892  N N   . SER A 1 111 ? 15.173 4.707   12.963  1.00 193.86 ? 145  SER A N   1 
ATOM 893  C CA  . SER A 1 111 ? 15.272 3.584   12.039  1.00 188.80 ? 145  SER A CA  1 
ATOM 894  C C   . SER A 1 111 ? 16.512 2.739   12.289  1.00 207.50 ? 145  SER A C   1 
ATOM 895  O O   . SER A 1 111 ? 16.520 1.549   11.953  1.00 221.48 ? 145  SER A O   1 
ATOM 896  C CB  . SER A 1 111 ? 15.278 4.078   10.592  1.00 190.29 ? 145  SER A CB  1 
ATOM 897  O OG  . SER A 1 111 ? 16.450 4.826   10.314  1.00 187.49 ? 145  SER A OG  1 
ATOM 898  N N   . VAL A 1 112 ? 17.560 3.327   12.870  1.00 202.62 ? 146  VAL A N   1 
ATOM 899  C CA  . VAL A 1 112 ? 18.743 2.549   13.223  1.00 208.67 ? 146  VAL A CA  1 
ATOM 900  C C   . VAL A 1 112 ? 18.499 1.740   14.492  1.00 215.98 ? 146  VAL A C   1 
ATOM 901  O O   . VAL A 1 112 ? 18.890 0.570   14.576  1.00 218.20 ? 146  VAL A O   1 
ATOM 902  C CB  . VAL A 1 112 ? 19.971 3.468   13.361  1.00 205.94 ? 146  VAL A CB  1 
ATOM 903  C CG1 . VAL A 1 112 ? 21.123 2.725   14.017  1.00 209.86 ? 146  VAL A CG1 1 
ATOM 904  C CG2 . VAL A 1 112 ? 20.396 3.994   11.998  1.00 205.00 ? 146  VAL A CG2 1 
ATOM 905  N N   . ILE A 1 113 ? 17.843 2.337   15.493  1.00 218.31 ? 147  ILE A N   1 
ATOM 906  C CA  . ILE A 1 113 ? 17.563 1.593   16.720  1.00 225.20 ? 147  ILE A CA  1 
ATOM 907  C C   . ILE A 1 113 ? 16.572 0.466   16.452  1.00 221.26 ? 147  ILE A C   1 
ATOM 908  O O   . ILE A 1 113 ? 16.689 -0.626  17.019  1.00 230.93 ? 147  ILE A O   1 
ATOM 909  C CB  . ILE A 1 113 ? 17.062 2.535   17.831  1.00 216.46 ? 147  ILE A CB  1 
ATOM 910  C CG1 . ILE A 1 113 ? 18.169 3.496   18.263  1.00 206.71 ? 147  ILE A CG1 1 
ATOM 911  C CG2 . ILE A 1 113 ? 16.571 1.737   19.032  1.00 219.78 ? 147  ILE A CG2 1 
ATOM 912  C CD1 . ILE A 1 113 ? 17.958 4.069   19.648  1.00 206.98 ? 147  ILE A CD1 1 
ATOM 913  N N   . TYR A 1 114 ? 15.589 0.704   15.584  1.00 173.95 ? 148  TYR A N   1 
ATOM 914  C CA  . TYR A 1 114 ? 14.579 -0.300  15.257  1.00 180.11 ? 148  TYR A CA  1 
ATOM 915  C C   . TYR A 1 114 ? 14.863 -0.873  13.873  1.00 187.58 ? 148  TYR A C   1 
ATOM 916  O O   . TYR A 1 114 ? 14.465 -0.275  12.861  1.00 195.29 ? 148  TYR A O   1 
ATOM 917  C CB  . TYR A 1 114 ? 13.169 0.303   15.305  1.00 187.45 ? 148  TYR A CB  1 
ATOM 918  C CG  . TYR A 1 114 ? 12.668 0.678   16.688  1.00 196.92 ? 148  TYR A CG  1 
ATOM 919  C CD1 . TYR A 1 114 ? 13.515 0.675   17.788  1.00 198.87 ? 148  TYR A CD1 1 
ATOM 920  C CD2 . TYR A 1 114 ? 11.337 1.024   16.892  1.00 203.95 ? 148  TYR A CD2 1 
ATOM 921  C CE1 . TYR A 1 114 ? 13.059 1.018   19.048  1.00 200.33 ? 148  TYR A CE1 1 
ATOM 922  C CE2 . TYR A 1 114 ? 10.870 1.366   18.151  1.00 205.28 ? 148  TYR A CE2 1 
ATOM 923  C CZ  . TYR A 1 114 ? 11.735 1.360   19.225  1.00 203.69 ? 148  TYR A CZ  1 
ATOM 924  O OH  . TYR A 1 114 ? 11.275 1.699   20.477  1.00 205.81 ? 148  TYR A OH  1 
ATOM 925  N N   . PRO A 1 115 ? 15.534 -2.025  13.767  1.00 187.85 ? 149  PRO A N   1 
ATOM 926  C CA  . PRO A 1 115 ? 15.857 -2.569  12.440  1.00 194.31 ? 149  PRO A CA  1 
ATOM 927  C C   . PRO A 1 115 ? 14.686 -3.227  11.731  1.00 195.45 ? 149  PRO A C   1 
ATOM 928  O O   . PRO A 1 115 ? 14.783 -3.470  10.520  1.00 197.14 ? 149  PRO A O   1 
ATOM 929  C CB  . PRO A 1 115 ? 16.957 -3.605  12.743  1.00 167.62 ? 149  PRO A CB  1 
ATOM 930  C CG  . PRO A 1 115 ? 17.357 -3.375  14.180  1.00 165.27 ? 149  PRO A CG  1 
ATOM 931  C CD  . PRO A 1 115 ? 16.139 -2.825  14.842  1.00 181.74 ? 149  PRO A CD  1 
ATOM 932  N N   . PHE A 1 116 ? 13.587 -3.519  12.430  1.00 200.69 ? 150  PHE A N   1 
ATOM 933  C CA  . PHE A 1 116 ? 12.484 -4.283  11.859  1.00 209.84 ? 150  PHE A CA  1 
ATOM 934  C C   . PHE A 1 116 ? 11.334 -3.401  11.379  1.00 215.39 ? 150  PHE A C   1 
ATOM 935  O O   . PHE A 1 116 ? 10.222 -3.899  11.180  1.00 213.25 ? 150  PHE A O   1 
ATOM 936  C CB  . PHE A 1 116 ? 11.978 -5.321  12.868  1.00 211.89 ? 150  PHE A CB  1 
ATOM 937  C CG  . PHE A 1 116 ? 10.978 -4.784  13.865  1.00 210.75 ? 150  PHE A CG  1 
ATOM 938  C CD1 . PHE A 1 116 ? 11.255 -3.655  14.621  1.00 206.77 ? 150  PHE A CD1 1 
ATOM 939  C CD2 . PHE A 1 116 ? 9.756  -5.417  14.041  1.00 209.56 ? 150  PHE A CD2 1 
ATOM 940  C CE1 . PHE A 1 116 ? 10.332 -3.169  15.532  1.00 205.88 ? 150  PHE A CE1 1 
ATOM 941  C CE2 . PHE A 1 116 ? 8.830  -4.935  14.951  1.00 207.85 ? 150  PHE A CE2 1 
ATOM 942  C CZ  . PHE A 1 116 ? 9.119  -3.810  15.696  1.00 206.78 ? 150  PHE A CZ  1 
ATOM 943  N N   . LEU A 1 117 ? 11.577 -2.109  11.173  1.00 220.98 ? 151  LEU A N   1 
ATOM 944  C CA  . LEU A 1 117 ? 10.544 -1.197  10.695  1.00 220.97 ? 151  LEU A CA  1 
ATOM 945  C C   . LEU A 1 117 ? 10.617 -1.098  9.174   1.00 229.94 ? 151  LEU A C   1 
ATOM 946  O O   . LEU A 1 117 ? 11.650 -0.704  8.622   1.00 228.37 ? 151  LEU A O   1 
ATOM 947  C CB  . LEU A 1 117 ? 10.694 0.180   11.341  1.00 213.92 ? 151  LEU A CB  1 
ATOM 948  C CG  . LEU A 1 117 ? 10.331 0.237   12.827  1.00 207.81 ? 151  LEU A CG  1 
ATOM 949  C CD1 . LEU A 1 117 ? 10.376 1.665   13.340  1.00 209.15 ? 151  LEU A CD1 1 
ATOM 950  C CD2 . LEU A 1 117 ? 8.960  -0.374  13.067  1.00 204.76 ? 151  LEU A CD2 1 
ATOM 951  N N   . SER A 1 118 ? 9.521  -1.456  8.506   1.00 248.63 ? 152  SER A N   1 
ATOM 952  C CA  . SER A 1 118 ? 9.477  -1.489  7.053   1.00 262.96 ? 152  SER A CA  1 
ATOM 953  C C   . SER A 1 118 ? 9.561  -0.075  6.477   1.00 282.92 ? 152  SER A C   1 
ATOM 954  O O   . SER A 1 118 ? 9.491  0.928   7.191   1.00 277.49 ? 152  SER A O   1 
ATOM 955  C CB  . SER A 1 118 ? 8.205  -2.188  6.568   1.00 254.39 ? 152  SER A CB  1 
ATOM 956  O OG  . SER A 1 118 ? 8.144  -3.529  7.027   1.00 250.23 ? 152  SER A OG  1 
ATOM 957  N N   . GLN A 1 119 ? 9.710  -0.005  5.152   1.00 311.14 ? 153  GLN A N   1 
ATOM 958  C CA  . GLN A 1 119 ? 9.895  1.289   4.504   1.00 313.68 ? 153  GLN A CA  1 
ATOM 959  C C   . GLN A 1 119 ? 8.589  2.067   4.416   1.00 316.65 ? 153  GLN A C   1 
ATOM 960  O O   . GLN A 1 119 ? 8.606  3.304   4.422   1.00 320.98 ? 153  GLN A O   1 
ATOM 961  C CB  . GLN A 1 119 ? 10.509 1.101   3.118   1.00 314.45 ? 153  GLN A CB  1 
ATOM 962  C CG  . GLN A 1 119 ? 11.809 0.319   3.128   1.00 306.90 ? 153  GLN A CG  1 
ATOM 963  C CD  . GLN A 1 119 ? 12.478 0.301   1.770   1.00 303.32 ? 153  GLN A CD  1 
ATOM 964  O OE1 . GLN A 1 119 ? 12.158 1.113   0.904   1.00 305.94 ? 153  GLN A OE1 1 
ATOM 965  N NE2 . GLN A 1 119 ? 13.408 -0.628  1.575   1.00 300.38 ? 153  GLN A NE2 1 
ATOM 966  N N   . ARG A 1 120 ? 7.455  1.370   4.312   1.00 316.86 ? 154  ARG A N   1 
ATOM 967  C CA  . ARG A 1 120 ? 6.164  2.046   4.390   1.00 314.28 ? 154  ARG A CA  1 
ATOM 968  C C   . ARG A 1 120 ? 6.020  2.775   5.720   1.00 307.11 ? 154  ARG A C   1 
ATOM 969  O O   . ARG A 1 120 ? 5.705  3.971   5.757   1.00 312.05 ? 154  ARG A O   1 
ATOM 970  C CB  . ARG A 1 120 ? 5.031  1.038   4.193   1.00 316.52 ? 154  ARG A CB  1 
ATOM 971  C CG  . ARG A 1 120 ? 5.040  0.354   2.834   1.00 318.14 ? 154  ARG A CG  1 
ATOM 972  C CD  . ARG A 1 120 ? 3.935  -0.686  2.737   1.00 320.33 ? 154  ARG A CD  1 
ATOM 973  N NE  . ARG A 1 120 ? 2.609  -0.089  2.865   1.00 324.87 ? 154  ARG A NE  1 
ATOM 974  C CZ  . ARG A 1 120 ? 1.475  -0.783  2.885   1.00 324.52 ? 154  ARG A CZ  1 
ATOM 975  N NH1 . ARG A 1 120 ? 0.314  -0.155  3.003   1.00 328.01 ? 154  ARG A NH1 1 
ATOM 976  N NH2 . ARG A 1 120 ? 1.503  -2.105  2.790   1.00 320.69 ? 154  ARG A NH2 1 
ATOM 977  N N   . ARG A 1 121 ? 6.264  2.064   6.823   1.00 299.71 ? 155  ARG A N   1 
ATOM 978  C CA  . ARG A 1 121 ? 6.333  2.641   8.168   1.00 298.29 ? 155  ARG A CA  1 
ATOM 979  C C   . ARG A 1 121 ? 5.097  3.486   8.472   1.00 304.60 ? 155  ARG A C   1 
ATOM 980  O O   . ARG A 1 121 ? 5.185  4.610   8.975   1.00 308.43 ? 155  ARG A O   1 
ATOM 981  C CB  . ARG A 1 121 ? 7.620  3.452   8.343   1.00 288.90 ? 155  ARG A CB  1 
ATOM 982  C CG  . ARG A 1 121 ? 7.987  3.765   9.788   1.00 279.46 ? 155  ARG A CG  1 
ATOM 983  C CD  . ARG A 1 121 ? 9.254  4.598   9.868   1.00 272.35 ? 155  ARG A CD  1 
ATOM 984  N NE  . ARG A 1 121 ? 9.444  5.170   11.197  1.00 268.35 ? 155  ARG A NE  1 
ATOM 985  C CZ  . ARG A 1 121 ? 10.532 5.828   11.581  1.00 268.10 ? 155  ARG A CZ  1 
ATOM 986  N NH1 . ARG A 1 121 ? 10.614 6.315   12.812  1.00 267.78 ? 155  ARG A NH1 1 
ATOM 987  N NH2 . ARG A 1 121 ? 11.542 5.994   10.738  1.00 268.73 ? 155  ARG A NH2 1 
ATOM 988  N N   . ASN A 1 122 ? 3.927  2.919   8.163   1.00 306.38 ? 156  ASN A N   1 
ATOM 989  C CA  . ASN A 1 122 ? 2.651  3.605   8.313   1.00 314.34 ? 156  ASN A CA  1 
ATOM 990  C C   . ASN A 1 122 ? 2.718  4.942   7.586   1.00 324.52 ? 156  ASN A C   1 
ATOM 991  O O   . ASN A 1 122 ? 2.795  5.993   8.233   1.00 325.85 ? 156  ASN A O   1 
ATOM 992  C CB  . ASN A 1 122 ? 2.311  3.800   9.793   1.00 311.59 ? 156  ASN A CB  1 
ATOM 993  C CG  . ASN A 1 122 ? 0.910  4.328   10.006  1.00 314.64 ? 156  ASN A CG  1 
ATOM 994  O OD1 . ASN A 1 122 ? 0.052  4.218   9.130   1.00 316.76 ? 156  ASN A OD1 1 
ATOM 995  N ND2 . ASN A 1 122 ? 0.667  4.903   11.178  1.00 315.61 ? 156  ASN A ND2 1 
ATOM 996  N N   . PRO A 1 123 ? 2.710  4.943   6.250   1.00 244.09 ? 157  PRO A N   1 
ATOM 997  C CA  . PRO A 1 123 ? 2.943  6.200   5.517   1.00 242.86 ? 157  PRO A CA  1 
ATOM 998  C C   . PRO A 1 123 ? 1.961  7.299   5.869   1.00 250.20 ? 157  PRO A C   1 
ATOM 999  O O   . PRO A 1 123 ? 2.287  8.485   5.715   1.00 251.27 ? 157  PRO A O   1 
ATOM 1000 C CB  . PRO A 1 123 ? 2.816  5.778   4.047   1.00 235.71 ? 157  PRO A CB  1 
ATOM 1001 C CG  . PRO A 1 123 ? 1.982  4.536   4.080   1.00 237.46 ? 157  PRO A CG  1 
ATOM 1002 C CD  . PRO A 1 123 ? 2.365  3.832   5.349   1.00 242.23 ? 157  PRO A CD  1 
ATOM 1003 N N   . TRP A 1 124 ? 0.763  6.949   6.345   1.00 253.57 ? 158  TRP A N   1 
ATOM 1004 C CA  . TRP A 1 124 ? -0.178 7.983   6.761   1.00 255.75 ? 158  TRP A CA  1 
ATOM 1005 C C   . TRP A 1 124 ? 0.307  8.706   8.010   1.00 257.54 ? 158  TRP A C   1 
ATOM 1006 O O   . TRP A 1 124 ? -0.062 9.864   8.237   1.00 260.54 ? 158  TRP A O   1 
ATOM 1007 C CB  . TRP A 1 124 ? -1.565 7.388   6.972   1.00 259.52 ? 158  TRP A CB  1 
ATOM 1008 C CG  . TRP A 1 124 ? -2.266 7.100   5.678   1.00 256.76 ? 158  TRP A CG  1 
ATOM 1009 C CD1 . TRP A 1 124 ? -2.363 5.893   5.048   1.00 253.30 ? 158  TRP A CD1 1 
ATOM 1010 C CD2 . TRP A 1 124 ? -2.961 8.043   4.849   1.00 255.17 ? 158  TRP A CD2 1 
ATOM 1011 N NE1 . TRP A 1 124 ? -3.080 6.024   3.882   1.00 252.38 ? 158  TRP A NE1 1 
ATOM 1012 C CE2 . TRP A 1 124 ? -3.459 7.333   3.737   1.00 253.49 ? 158  TRP A CE2 1 
ATOM 1013 C CE3 . TRP A 1 124 ? -3.214 9.416   4.940   1.00 252.56 ? 158  TRP A CE3 1 
ATOM 1014 C CZ2 . TRP A 1 124 ? -4.193 7.950   2.724   1.00 251.98 ? 158  TRP A CZ2 1 
ATOM 1015 C CZ3 . TRP A 1 124 ? -3.944 10.026  3.934   1.00 249.64 ? 158  TRP A CZ3 1 
ATOM 1016 C CH2 . TRP A 1 124 ? -4.424 9.293   2.841   1.00 249.93 ? 158  TRP A CH2 1 
ATOM 1017 N N   . GLN A 1 125 ? 1.133  8.048   8.830   1.00 241.30 ? 159  GLN A N   1 
ATOM 1018 C CA  . GLN A 1 125 ? 1.732  8.739   9.968   1.00 220.24 ? 159  GLN A CA  1 
ATOM 1019 C C   . GLN A 1 125 ? 2.671  9.846   9.500   1.00 200.11 ? 159  GLN A C   1 
ATOM 1020 O O   . GLN A 1 125 ? 2.763  10.901  10.139  1.00 202.12 ? 159  GLN A O   1 
ATOM 1021 C CB  . GLN A 1 125 ? 2.463  7.743   10.874  1.00 220.16 ? 159  GLN A CB  1 
ATOM 1022 C CG  . GLN A 1 125 ? 3.966  7.646   10.660  1.00 218.52 ? 159  GLN A CG  1 
ATOM 1023 C CD  . GLN A 1 125 ? 4.605  6.555   11.495  1.00 224.85 ? 159  GLN A CD  1 
ATOM 1024 O OE1 . GLN A 1 125 ? 3.967  5.979   12.377  1.00 232.61 ? 159  GLN A OE1 1 
ATOM 1025 N NE2 . GLN A 1 125 ? 5.870  6.262   11.220  1.00 221.20 ? 159  GLN A NE2 1 
ATOM 1026 N N   . ALA A 1 126 ? 3.358  9.632   8.375   1.00 178.19 ? 160  ALA A N   1 
ATOM 1027 C CA  . ALA A 1 126 ? 4.107  10.717  7.755   1.00 154.48 ? 160  ALA A CA  1 
ATOM 1028 C C   . ALA A 1 126 ? 3.168  11.737  7.129   1.00 150.94 ? 160  ALA A C   1 
ATOM 1029 O O   . ALA A 1 126 ? 3.448  12.941  7.165   1.00 162.37 ? 160  ALA A O   1 
ATOM 1030 C CB  . ALA A 1 126 ? 5.077  10.164  6.710   1.00 137.90 ? 160  ALA A CB  1 
ATOM 1031 N N   . SER A 1 127 ? 2.041  11.281  6.574   1.00 143.55 ? 161  SER A N   1 
ATOM 1032 C CA  . SER A 1 127 ? 1.025  12.205  6.080   1.00 139.22 ? 161  SER A CA  1 
ATOM 1033 C C   . SER A 1 127 ? 0.414  13.045  7.197   1.00 142.01 ? 161  SER A C   1 
ATOM 1034 O O   . SER A 1 127 ? -0.281 14.026  6.908   1.00 146.36 ? 161  SER A O   1 
ATOM 1035 C CB  . SER A 1 127 ? -0.073 11.433  5.345   1.00 141.28 ? 161  SER A CB  1 
ATOM 1036 O OG  . SER A 1 127 ? -1.097 12.296  4.879   1.00 144.39 ? 161  SER A OG  1 
ATOM 1037 N N   . TYR A 1 128 ? 0.631  12.670  8.459   1.00 140.94 ? 162  TYR A N   1 
ATOM 1038 C CA  . TYR A 1 128 ? 0.279  13.527  9.586   1.00 151.95 ? 162  TYR A CA  1 
ATOM 1039 C C   . TYR A 1 128 ? 1.466  14.334  10.093  1.00 157.25 ? 162  TYR A C   1 
ATOM 1040 O O   . TYR A 1 128 ? 1.284  15.463  10.566  1.00 158.21 ? 162  TYR A O   1 
ATOM 1041 C CB  . TYR A 1 128 ? -0.294 12.696  10.741  1.00 154.00 ? 162  TYR A CB  1 
ATOM 1042 C CG  . TYR A 1 128 ? -1.674 12.126  10.481  1.00 158.09 ? 162  TYR A CG  1 
ATOM 1043 C CD1 . TYR A 1 128 ? -2.767 12.960  10.282  1.00 162.81 ? 162  TYR A CD1 1 
ATOM 1044 C CD2 . TYR A 1 128 ? -1.886 10.754  10.455  1.00 154.63 ? 162  TYR A CD2 1 
ATOM 1045 C CE1 . TYR A 1 128 ? -4.032 12.439  10.049  1.00 164.04 ? 162  TYR A CE1 1 
ATOM 1046 C CE2 . TYR A 1 128 ? -3.142 10.227  10.221  1.00 154.67 ? 162  TYR A CE2 1 
ATOM 1047 C CZ  . TYR A 1 128 ? -4.211 11.071  10.020  1.00 157.11 ? 162  TYR A CZ  1 
ATOM 1048 O OH  . TYR A 1 128 ? -5.459 10.539  9.790   1.00 159.00 ? 162  TYR A OH  1 
ATOM 1049 N N   . ILE A 1 129 ? 2.679  13.784  9.995   1.00 158.43 ? 163  ILE A N   1 
ATOM 1050 C CA  . ILE A 1 129 ? 3.862  14.487  10.484  1.00 154.97 ? 163  ILE A CA  1 
ATOM 1051 C C   . ILE A 1 129 ? 4.174  15.694  9.610   1.00 146.03 ? 163  ILE A C   1 
ATOM 1052 O O   . ILE A 1 129 ? 4.482  16.778  10.120  1.00 152.08 ? 163  ILE A O   1 
ATOM 1053 C CB  . ILE A 1 129 ? 5.061  13.528  10.569  1.00 155.46 ? 163  ILE A CB  1 
ATOM 1054 C CG1 . ILE A 1 129 ? 4.901  12.573  11.749  1.00 160.31 ? 163  ILE A CG1 1 
ATOM 1055 C CG2 . ILE A 1 129 ? 6.360  14.303  10.708  1.00 148.59 ? 163  ILE A CG2 1 
ATOM 1056 C CD1 . ILE A 1 129 ? 5.977  11.527  11.807  1.00 157.70 ? 163  ILE A CD1 1 
ATOM 1057 N N   . VAL A 1 130 ? 4.116  15.532  8.285   1.00 131.95 ? 164  VAL A N   1 
ATOM 1058 C CA  . VAL A 1 130 ? 4.439  16.647  7.392   1.00 129.24 ? 164  VAL A CA  1 
ATOM 1059 C C   . VAL A 1 130 ? 3.590  17.882  7.692   1.00 134.03 ? 164  VAL A C   1 
ATOM 1060 O O   . VAL A 1 130 ? 4.163  18.965  7.885   1.00 140.12 ? 164  VAL A O   1 
ATOM 1061 C CB  . VAL A 1 130 ? 4.352  16.197  5.927   1.00 125.40 ? 164  VAL A CB  1 
ATOM 1062 C CG1 . VAL A 1 130 ? 4.701  17.348  4.995   1.00 125.30 ? 164  VAL A CG1 1 
ATOM 1063 C CG2 . VAL A 1 130 ? 5.277  15.018  5.690   1.00 135.19 ? 164  VAL A CG2 1 
ATOM 1064 N N   . PRO A 1 131 ? 2.254  17.795  7.777   1.00 130.54 ? 165  PRO A N   1 
ATOM 1065 C CA  . PRO A 1 131 ? 1.487  18.980  8.194   1.00 135.36 ? 165  PRO A CA  1 
ATOM 1066 C C   . PRO A 1 131 ? 1.856  19.477  9.582   1.00 139.59 ? 165  PRO A C   1 
ATOM 1067 O O   . PRO A 1 131 ? 1.781  20.686  9.835   1.00 145.05 ? 165  PRO A O   1 
ATOM 1068 C CB  . PRO A 1 131 ? 0.031  18.493  8.133   1.00 131.66 ? 165  PRO A CB  1 
ATOM 1069 C CG  . PRO A 1 131 ? 0.056  17.354  7.175   1.00 128.74 ? 165  PRO A CG  1 
ATOM 1070 C CD  . PRO A 1 131 ? 1.361  16.674  7.431   1.00 127.54 ? 165  PRO A CD  1 
ATOM 1071 N N   . LEU A 1 132 ? 2.254  18.581  10.489  1.00 141.22 ? 166  LEU A N   1 
ATOM 1072 C CA  . LEU A 1 132 ? 2.669  19.012  11.820  1.00 149.32 ? 166  LEU A CA  1 
ATOM 1073 C C   . LEU A 1 132 ? 3.936  19.858  11.753  1.00 156.45 ? 166  LEU A C   1 
ATOM 1074 O O   . LEU A 1 132 ? 4.032  20.904  12.410  1.00 169.36 ? 166  LEU A O   1 
ATOM 1075 C CB  . LEU A 1 132 ? 2.873  17.794  12.722  1.00 151.23 ? 166  LEU A CB  1 
ATOM 1076 C CG  . LEU A 1 132 ? 3.268  18.054  14.177  1.00 154.10 ? 166  LEU A CG  1 
ATOM 1077 C CD1 . LEU A 1 132 ? 2.176  18.826  14.889  1.00 156.17 ? 166  LEU A CD1 1 
ATOM 1078 C CD2 . LEU A 1 132 ? 3.559  16.751  14.908  1.00 162.68 ? 166  LEU A CD2 1 
ATOM 1079 N N   . VAL A 1 133 ? 4.914  19.431  10.951  1.00 154.53 ? 167  VAL A N   1 
ATOM 1080 C CA  . VAL A 1 133 ? 6.143  20.205  10.802  1.00 157.11 ? 167  VAL A CA  1 
ATOM 1081 C C   . VAL A 1 133 ? 5.859  21.548  10.136  1.00 149.87 ? 167  VAL A C   1 
ATOM 1082 O O   . VAL A 1 133 ? 6.373  22.590  10.567  1.00 145.22 ? 167  VAL A O   1 
ATOM 1083 C CB  . VAL A 1 133 ? 7.195  19.396  10.021  1.00 158.43 ? 167  VAL A CB  1 
ATOM 1084 C CG1 . VAL A 1 133 ? 8.503  20.173  9.930   1.00 159.19 ? 167  VAL A CG1 1 
ATOM 1085 C CG2 . VAL A 1 133 ? 7.417  18.048  10.678  1.00 164.57 ? 167  VAL A CG2 1 
ATOM 1086 N N   . TRP A 1 134 ? 5.032  21.553  9.084   1.00 151.96 ? 168  TRP A N   1 
ATOM 1087 C CA  . TRP A 1 134 ? 4.709  22.818  8.428   1.00 146.95 ? 168  TRP A CA  1 
ATOM 1088 C C   . TRP A 1 134 ? 3.982  23.764  9.379   1.00 149.21 ? 168  TRP A C   1 
ATOM 1089 O O   . TRP A 1 134 ? 4.217  24.979  9.358   1.00 163.34 ? 168  TRP A O   1 
ATOM 1090 C CB  . TRP A 1 134 ? 3.879  22.566  7.167   1.00 148.64 ? 168  TRP A CB  1 
ATOM 1091 C CG  . TRP A 1 134 ? 4.702  22.123  5.989   1.00 151.74 ? 168  TRP A CG  1 
ATOM 1092 C CD1 . TRP A 1 134 ? 4.804  20.856  5.487   1.00 156.47 ? 168  TRP A CD1 1 
ATOM 1093 C CD2 . TRP A 1 134 ? 5.548  22.946  5.174   1.00 151.73 ? 168  TRP A CD2 1 
ATOM 1094 N NE1 . TRP A 1 134 ? 5.658  20.841  4.408   1.00 153.69 ? 168  TRP A NE1 1 
ATOM 1095 C CE2 . TRP A 1 134 ? 6.128  22.111  4.196   1.00 151.83 ? 168  TRP A CE2 1 
ATOM 1096 C CE3 . TRP A 1 134 ? 5.870  24.307  5.174   1.00 145.08 ? 168  TRP A CE3 1 
ATOM 1097 C CZ2 . TRP A 1 134 ? 7.011  22.594  3.229   1.00 143.13 ? 168  TRP A CZ2 1 
ATOM 1098 C CZ3 . TRP A 1 134 ? 6.746  24.782  4.214   1.00 138.92 ? 168  TRP A CZ3 1 
ATOM 1099 C CH2 . TRP A 1 134 ? 7.306  23.929  3.257   1.00 135.93 ? 168  TRP A CH2 1 
ATOM 1100 N N   . CYS A 1 135 ? 3.111  23.226  10.235  1.00 146.35 ? 169  CYS A N   1 
ATOM 1101 C CA  . CYS A 1 135 ? 2.381  24.080  11.167  1.00 155.75 ? 169  CYS A CA  1 
ATOM 1102 C C   . CYS A 1 135 ? 3.300  24.618  12.257  1.00 157.32 ? 169  CYS A C   1 
ATOM 1103 O O   . CYS A 1 135 ? 3.134  25.757  12.713  1.00 158.90 ? 169  CYS A O   1 
ATOM 1104 C CB  . CYS A 1 135 ? 1.203  23.320  11.775  1.00 158.58 ? 169  CYS A CB  1 
ATOM 1105 S SG  . CYS A 1 135 ? -0.214 23.167  10.665  1.00 160.34 ? 169  CYS A SG  1 
ATOM 1106 N N   . MET A 1 136 ? 4.270  23.812  12.697  1.00 156.32 ? 170  MET A N   1 
ATOM 1107 C CA  . MET A 1 136 ? 5.253  24.311  13.653  1.00 164.40 ? 170  MET A CA  1 
ATOM 1108 C C   . MET A 1 136 ? 6.106  25.416  13.046  1.00 158.64 ? 170  MET A C   1 
ATOM 1109 O O   . MET A 1 136 ? 6.420  26.410  13.714  1.00 163.87 ? 170  MET A O   1 
ATOM 1110 C CB  . MET A 1 136 ? 6.137  23.171  14.145  1.00 174.22 ? 170  MET A CB  1 
ATOM 1111 C CG  . MET A 1 136 ? 5.539  22.398  15.293  1.00 189.50 ? 170  MET A CG  1 
ATOM 1112 S SD  . MET A 1 136 ? 6.806  21.480  16.180  1.00 201.29 ? 170  MET A SD  1 
ATOM 1113 C CE  . MET A 1 136 ? 7.891  22.809  16.702  1.00 204.35 ? 170  MET A CE  1 
ATOM 1114 N N   . ALA A 1 137 ? 6.495  25.258  11.779  1.00 148.14 ? 171  ALA A N   1 
ATOM 1115 C CA  . ALA A 1 137 ? 7.254  26.309  11.112  1.00 134.75 ? 171  ALA A CA  1 
ATOM 1116 C C   . ALA A 1 137 ? 6.429  27.581  10.981  1.00 125.13 ? 171  ALA A C   1 
ATOM 1117 O O   . ALA A 1 137 ? 6.945  28.685  11.187  1.00 123.29 ? 171  ALA A O   1 
ATOM 1118 C CB  . ALA A 1 137 ? 7.728  25.829  9.741   1.00 131.00 ? 171  ALA A CB  1 
ATOM 1119 N N   . CYS A 1 138 ? 5.141  27.447  10.654  1.00 118.92 ? 172  CYS A N   1 
ATOM 1120 C CA  . CYS A 1 138 ? 4.270  28.618  10.586  1.00 122.66 ? 172  CYS A CA  1 
ATOM 1121 C C   . CYS A 1 138 ? 4.189  29.321  11.934  1.00 132.09 ? 172  CYS A C   1 
ATOM 1122 O O   . CYS A 1 138 ? 4.386  30.540  12.026  1.00 148.70 ? 172  CYS A O   1 
ATOM 1123 C CB  . CYS A 1 138 ? 2.877  28.209  10.116  1.00 129.68 ? 172  CYS A CB  1 
ATOM 1124 S SG  . CYS A 1 138 ? 2.825  27.672  8.407   1.00 136.87 ? 172  CYS A SG  1 
ATOM 1125 N N   . LEU A 1 139 ? 3.905  28.563  12.996  1.00 128.68 ? 173  LEU A N   1 
ATOM 1126 C CA  . LEU A 1 139 ? 3.808  29.159  14.324  1.00 135.41 ? 173  LEU A CA  1 
ATOM 1127 C C   . LEU A 1 139 ? 5.116  29.827  14.728  1.00 140.91 ? 173  LEU A C   1 
ATOM 1128 O O   . LEU A 1 139 ? 5.110  30.863  15.404  1.00 146.82 ? 173  LEU A O   1 
ATOM 1129 C CB  . LEU A 1 139 ? 3.406  28.104  15.353  1.00 132.19 ? 173  LEU A CB  1 
ATOM 1130 C CG  . LEU A 1 139 ? 2.004  27.509  15.225  1.00 144.42 ? 173  LEU A CG  1 
ATOM 1131 C CD1 . LEU A 1 139 ? 1.741  26.521  16.348  1.00 146.30 ? 173  LEU A CD1 1 
ATOM 1132 C CD2 . LEU A 1 139 ? 0.953  28.606  15.219  1.00 136.77 ? 173  LEU A CD2 1 
ATOM 1133 N N   . SER A 1 140 ? 6.251  29.258  14.318  1.00 138.14 ? 174  SER A N   1 
ATOM 1134 C CA  . SER A 1 140 ? 7.524  29.889  14.642  1.00 142.14 ? 174  SER A CA  1 
ATOM 1135 C C   . SER A 1 140 ? 7.766  31.132  13.792  1.00 137.87 ? 174  SER A C   1 
ATOM 1136 O O   . SER A 1 140 ? 8.472  32.049  14.227  1.00 137.56 ? 174  SER A O   1 
ATOM 1137 C CB  . SER A 1 140 ? 8.665  28.886  14.483  1.00 134.72 ? 174  SER A CB  1 
ATOM 1138 O OG  . SER A 1 140 ? 8.597  27.881  15.477  1.00 136.47 ? 174  SER A OG  1 
ATOM 1139 N N   . SER A 1 141 ? 7.188  31.190  12.595  1.00 133.79 ? 175  SER A N   1 
ATOM 1140 C CA  . SER A 1 141 ? 7.275  32.372  11.749  1.00 126.46 ? 175  SER A CA  1 
ATOM 1141 C C   . SER A 1 141 ? 6.195  33.401  12.057  1.00 124.18 ? 175  SER A C   1 
ATOM 1142 O O   . SER A 1 141 ? 6.131  34.429  11.377  1.00 122.29 ? 175  SER A O   1 
ATOM 1143 C CB  . SER A 1 141 ? 7.195  31.979  10.268  1.00 125.51 ? 175  SER A CB  1 
ATOM 1144 O OG  . SER A 1 141 ? 5.867  31.646  9.897   1.00 126.88 ? 175  SER A OG  1 
ATOM 1145 N N   . LEU A 1 142 ? 5.339  33.148  13.048  1.00 132.58 ? 176  LEU A N   1 
ATOM 1146 C CA  . LEU A 1 142 ? 4.355  34.157  13.436  1.00 135.64 ? 176  LEU A CA  1 
ATOM 1147 C C   . LEU A 1 142 ? 4.970  35.485  13.862  1.00 139.06 ? 176  LEU A C   1 
ATOM 1148 O O   . LEU A 1 142 ? 4.376  36.529  13.540  1.00 146.89 ? 176  LEU A O   1 
ATOM 1149 C CB  . LEU A 1 142 ? 3.447  33.622  14.549  1.00 142.37 ? 176  LEU A CB  1 
ATOM 1150 C CG  . LEU A 1 142 ? 2.464  32.529  14.141  1.00 143.76 ? 176  LEU A CG  1 
ATOM 1151 C CD1 . LEU A 1 142 ? 1.423  32.333  15.230  1.00 148.23 ? 176  LEU A CD1 1 
ATOM 1152 C CD2 . LEU A 1 142 ? 1.814  32.845  12.797  1.00 142.74 ? 176  LEU A CD2 1 
ATOM 1153 N N   . PRO A 1 143 ? 6.095  35.540  14.590  1.00 133.26 ? 177  PRO A N   1 
ATOM 1154 C CA  . PRO A 1 143 ? 6.698  36.860  14.849  1.00 134.94 ? 177  PRO A CA  1 
ATOM 1155 C C   . PRO A 1 143 ? 7.080  37.584  13.573  1.00 122.35 ? 177  PRO A C   1 
ATOM 1156 O O   . PRO A 1 143 ? 6.737  38.762  13.398  1.00 122.91 ? 177  PRO A O   1 
ATOM 1157 C CB  . PRO A 1 143 ? 7.919  36.522  15.714  1.00 127.05 ? 177  PRO A CB  1 
ATOM 1158 C CG  . PRO A 1 143 ? 7.556  35.270  16.388  1.00 133.75 ? 177  PRO A CG  1 
ATOM 1159 C CD  . PRO A 1 143 ? 6.765  34.488  15.375  1.00 134.82 ? 177  PRO A CD  1 
ATOM 1160 N N   . THR A 1 144 ? 7.778  36.900  12.664  1.00 118.40 ? 178  THR A N   1 
ATOM 1161 C CA  . THR A 1 144 ? 8.092  37.501  11.374  1.00 114.62 ? 178  THR A CA  1 
ATOM 1162 C C   . THR A 1 144 ? 6.826  37.832  10.598  1.00 121.50 ? 178  THR A C   1 
ATOM 1163 O O   . THR A 1 144 ? 6.815  38.771  9.796   1.00 112.77 ? 178  THR A O   1 
ATOM 1164 C CB  . THR A 1 144 ? 8.986  36.565  10.565  1.00 130.48 ? 178  THR A CB  1 
ATOM 1165 O OG1 . THR A 1 144 ? 10.073 36.121  11.387  1.00 126.40 ? 178  THR A OG1 1 
ATOM 1166 C CG2 . THR A 1 144 ? 9.539  37.276  9.334   1.00 107.03 ? 178  THR A CG2 1 
ATOM 1167 N N   . PHE A 1 145 ? 5.748  37.085  10.824  1.00 132.80 ? 179  PHE A N   1 
ATOM 1168 C CA  . PHE A 1 145 ? 4.496  37.407  10.154  1.00 134.47 ? 179  PHE A CA  1 
ATOM 1169 C C   . PHE A 1 145 ? 3.855  38.658  10.736  1.00 128.25 ? 179  PHE A C   1 
ATOM 1170 O O   . PHE A 1 145 ? 3.110  39.354  10.037  1.00 122.92 ? 179  PHE A O   1 
ATOM 1171 C CB  . PHE A 1 145 ? 3.536  36.226  10.244  1.00 141.79 ? 179  PHE A CB  1 
ATOM 1172 C CG  . PHE A 1 145 ? 2.187  36.500  9.657   1.00 139.82 ? 179  PHE A CG  1 
ATOM 1173 C CD1 . PHE A 1 145 ? 2.028  36.637  8.288   1.00 138.55 ? 179  PHE A CD1 1 
ATOM 1174 C CD2 . PHE A 1 145 ? 1.075  36.615  10.472  1.00 141.89 ? 179  PHE A CD2 1 
ATOM 1175 C CE1 . PHE A 1 145 ? 0.785  36.886  7.744   1.00 143.19 ? 179  PHE A CE1 1 
ATOM 1176 C CE2 . PHE A 1 145 ? -0.170 36.863  9.935   1.00 146.61 ? 179  PHE A CE2 1 
ATOM 1177 C CZ  . PHE A 1 145 ? -0.316 36.999  8.569   1.00 147.46 ? 179  PHE A CZ  1 
ATOM 1178 N N   . TYR A 1 146 ? 4.130  38.967  11.999  1.00 122.96 ? 180  TYR A N   1 
ATOM 1179 C CA  . TYR A 1 146 ? 3.482  40.103  12.637  1.00 134.46 ? 180  TYR A CA  1 
ATOM 1180 C C   . TYR A 1 146 ? 4.303  41.381  12.582  1.00 135.11 ? 180  TYR A C   1 
ATOM 1181 O O   . TYR A 1 146 ? 3.723  42.468  12.662  1.00 137.16 ? 180  TYR A O   1 
ATOM 1182 C CB  . TYR A 1 146 ? 3.155  39.780  14.099  1.00 130.95 ? 180  TYR A CB  1 
ATOM 1183 C CG  . TYR A 1 146 ? 2.382  40.867  14.813  1.00 134.84 ? 180  TYR A CG  1 
ATOM 1184 C CD1 . TYR A 1 146 ? 1.007  40.992  14.655  1.00 136.74 ? 180  TYR A CD1 1 
ATOM 1185 C CD2 . TYR A 1 146 ? 3.028  41.766  15.650  1.00 140.78 ? 180  TYR A CD2 1 
ATOM 1186 C CE1 . TYR A 1 146 ? 0.297  41.986  15.310  1.00 153.65 ? 180  TYR A CE1 1 
ATOM 1187 C CE2 . TYR A 1 146 ? 2.328  42.764  16.310  1.00 145.96 ? 180  TYR A CE2 1 
ATOM 1188 C CZ  . TYR A 1 146 ? 0.964  42.870  16.137  1.00 154.17 ? 180  TYR A CZ  1 
ATOM 1189 O OH  . TYR A 1 146 ? 0.272  43.863  16.796  1.00 145.91 ? 180  TYR A OH  1 
ATOM 1190 N N   . PHE A 1 147 ? 5.624  41.293  12.427  1.00 135.88 ? 181  PHE A N   1 
ATOM 1191 C CA  . PHE A 1 147 ? 6.457  42.481  12.497  1.00 132.72 ? 181  PHE A CA  1 
ATOM 1192 C C   . PHE A 1 147 ? 7.180  42.844  11.208  1.00 133.74 ? 181  PHE A C   1 
ATOM 1193 O O   . PHE A 1 147 ? 7.660  43.976  11.102  1.00 142.61 ? 181  PHE A O   1 
ATOM 1194 C CB  . PHE A 1 147 ? 7.497  42.339  13.621  1.00 133.41 ? 181  PHE A CB  1 
ATOM 1195 C CG  . PHE A 1 147 ? 6.910  42.432  15.001  1.00 145.08 ? 181  PHE A CG  1 
ATOM 1196 C CD1 . PHE A 1 147 ? 6.391  43.631  15.464  1.00 151.56 ? 181  PHE A CD1 1 
ATOM 1197 C CD2 . PHE A 1 147 ? 6.880  41.328  15.835  1.00 149.71 ? 181  PHE A CD2 1 
ATOM 1198 C CE1 . PHE A 1 147 ? 5.850  43.727  16.730  1.00 156.21 ? 181  PHE A CE1 1 
ATOM 1199 C CE2 . PHE A 1 147 ? 6.339  41.418  17.106  1.00 155.19 ? 181  PHE A CE2 1 
ATOM 1200 C CZ  . PHE A 1 147 ? 5.824  42.620  17.554  1.00 157.05 ? 181  PHE A CZ  1 
ATOM 1201 N N   . ARG A 1 148 ? 7.275  41.945  10.234  1.00 115.23 ? 182  ARG A N   1 
ATOM 1202 C CA  . ARG A 1 148 ? 7.993  42.248  8.997   1.00 111.25 ? 182  ARG A CA  1 
ATOM 1203 C C   . ARG A 1 148 ? 7.121  43.155  8.140   1.00 110.79 ? 182  ARG A C   1 
ATOM 1204 O O   . ARG A 1 148 ? 6.228  42.688  7.430   1.00 111.88 ? 182  ARG A O   1 
ATOM 1205 C CB  . ARG A 1 148 ? 8.365  40.967  8.260   1.00 107.99 ? 182  ARG A CB  1 
ATOM 1206 C CG  . ARG A 1 148 ? 9.061  41.179  6.924   1.00 103.92 ? 182  ARG A CG  1 
ATOM 1207 C CD  . ARG A 1 148 ? 10.486 41.677  7.097   1.00 103.08 ? 182  ARG A CD  1 
ATOM 1208 N NE  . ARG A 1 148 ? 11.276 40.817  7.975   1.00 103.76 ? 182  ARG A NE  1 
ATOM 1209 C CZ  . ARG A 1 148 ? 12.590 40.934  8.140   1.00 120.31 ? 182  ARG A CZ  1 
ATOM 1210 N NH1 . ARG A 1 148 ? 13.240 40.117  8.960   1.00 120.30 ? 182  ARG A NH1 1 
ATOM 1211 N NH2 . ARG A 1 148 ? 13.256 41.869  7.476   1.00 101.39 ? 182  ARG A NH2 1 
ATOM 1212 N N   . ASP A 1 149 ? 7.377  44.462  8.200   1.00 125.34 ? 183  ASP A N   1 
ATOM 1213 C CA  . ASP A 1 149 ? 6.611  45.444  7.440   1.00 117.94 ? 183  ASP A CA  1 
ATOM 1214 C C   . ASP A 1 149 ? 7.557  46.493  6.872   1.00 113.93 ? 183  ASP A C   1 
ATOM 1215 O O   . ASP A 1 149 ? 8.737  46.564  7.229   1.00 112.64 ? 183  ASP A O   1 
ATOM 1216 C CB  . ASP A 1 149 ? 5.531  46.114  8.304   1.00 117.89 ? 183  ASP A CB  1 
ATOM 1217 C CG  . ASP A 1 149 ? 4.321  46.562  7.493   1.00 119.13 ? 183  ASP A CG  1 
ATOM 1218 O OD1 . ASP A 1 149 ? 4.301  46.324  6.268   1.00 116.30 ? 183  ASP A OD1 1 
ATOM 1219 O OD2 . ASP A 1 149 ? 3.386  47.144  8.083   1.00 123.19 ? 183  ASP A OD2 1 
ATOM 1220 N N   . VAL A 1 150 ? 7.022  47.317  5.978   1.00 122.15 ? 184  VAL A N   1 
ATOM 1221 C CA  . VAL A 1 150 ? 7.767  48.424  5.389   1.00 121.41 ? 184  VAL A CA  1 
ATOM 1222 C C   . VAL A 1 150 ? 7.613  49.652  6.273   1.00 124.54 ? 184  VAL A C   1 
ATOM 1223 O O   . VAL A 1 150 ? 6.491  50.057  6.603   1.00 113.81 ? 184  VAL A O   1 
ATOM 1224 C CB  . VAL A 1 150 ? 7.286  48.716  3.959   1.00 118.62 ? 184  VAL A CB  1 
ATOM 1225 C CG1 . VAL A 1 150 ? 7.769  50.087  3.509   1.00 112.08 ? 184  VAL A CG1 1 
ATOM 1226 C CG2 . VAL A 1 150 ? 7.791  47.649  3.014   1.00 118.08 ? 184  VAL A CG2 1 
ATOM 1227 N N   . ARG A 1 151 ? 8.742  50.243  6.656   1.00 127.52 ? 185  ARG A N   1 
ATOM 1228 C CA  . ARG A 1 151 ? 8.768  51.463  7.443   1.00 128.26 ? 185  ARG A CA  1 
ATOM 1229 C C   . ARG A 1 151 ? 9.682  52.480  6.778   1.00 140.62 ? 185  ARG A C   1 
ATOM 1230 O O   . ARG A 1 151 ? 10.696 52.128  6.165   1.00 144.40 ? 185  ARG A O   1 
ATOM 1231 C CB  . ARG A 1 151 ? 9.239  51.202  8.874   1.00 118.06 ? 185  ARG A CB  1 
ATOM 1232 C CG  . ARG A 1 151 ? 8.312  50.315  9.655   1.00 119.94 ? 185  ARG A CG  1 
ATOM 1233 C CD  . ARG A 1 151 ? 6.919  50.894  9.709   1.00 122.11 ? 185  ARG A CD  1 
ATOM 1234 N NE  . ARG A 1 151 ? 6.006  49.975  10.374  1.00 123.90 ? 185  ARG A NE  1 
ATOM 1235 C CZ  . ARG A 1 151 ? 4.714  50.204  10.563  1.00 144.67 ? 185  ARG A CZ  1 
ATOM 1236 N NH1 . ARG A 1 151 ? 4.173  51.336  10.137  1.00 153.74 ? 185  ARG A NH1 1 
ATOM 1237 N NH2 . ARG A 1 151 ? 3.966  49.301  11.180  1.00 127.88 ? 185  ARG A NH2 1 
ATOM 1238 N N   . THR A 1 152 ? 9.306  53.749  6.910   1.00 139.13 ? 186  THR A N   1 
ATOM 1239 C CA  . THR A 1 152 ? 10.091 54.846  6.362   1.00 140.49 ? 186  THR A CA  1 
ATOM 1240 C C   . THR A 1 152 ? 11.224 55.183  7.323   1.00 141.86 ? 186  THR A C   1 
ATOM 1241 O O   . THR A 1 152 ? 10.980 55.593  8.462   1.00 149.30 ? 186  THR A O   1 
ATOM 1242 C CB  . THR A 1 152 ? 9.206  56.068  6.119   1.00 151.65 ? 186  THR A CB  1 
ATOM 1243 O OG1 . THR A 1 152 ? 8.220  55.759  5.127   1.00 156.34 ? 186  THR A OG1 1 
ATOM 1244 C CG2 . THR A 1 152 ? 10.038 57.250  5.641   1.00 156.70 ? 186  THR A CG2 1 
ATOM 1245 N N   . ILE A 1 153 ? 12.456 54.986  6.873   1.00 115.71 ? 187  ILE A N   1 
ATOM 1246 C CA  . ILE A 1 153 ? 13.642 55.388  7.615   1.00 117.51 ? 187  ILE A CA  1 
ATOM 1247 C C   . ILE A 1 153 ? 14.097 56.721  7.044   1.00 171.06 ? 187  ILE A C   1 
ATOM 1248 O O   . ILE A 1 153 ? 14.651 56.779  5.939   1.00 149.84 ? 187  ILE A O   1 
ATOM 1249 C CB  . ILE A 1 153 ? 14.750 54.336  7.530   1.00 115.24 ? 187  ILE A CB  1 
ATOM 1250 C CG1 . ILE A 1 153 ? 14.252 53.016  8.113   1.00 134.36 ? 187  ILE A CG1 1 
ATOM 1251 C CG2 . ILE A 1 153 ? 15.978 54.820  8.279   1.00 142.71 ? 187  ILE A CG2 1 
ATOM 1252 C CD1 . ILE A 1 153 ? 15.249 51.903  8.018   1.00 131.02 ? 187  ILE A CD1 1 
ATOM 1253 N N   . GLU A 1 154 ? 13.854 57.796  7.796   1.00 117.86 ? 188  GLU A N   1 
ATOM 1254 C CA  . GLU A 1 154 ? 14.142 59.127  7.279   1.00 109.26 ? 188  GLU A CA  1 
ATOM 1255 C C   . GLU A 1 154 ? 15.639 59.357  7.148   1.00 103.87 ? 188  GLU A C   1 
ATOM 1256 O O   . GLU A 1 154 ? 16.088 59.984  6.183   1.00 108.49 ? 188  GLU A O   1 
ATOM 1257 C CB  . GLU A 1 154 ? 13.513 60.193  8.174   1.00 121.26 ? 188  GLU A CB  1 
ATOM 1258 C CG  . GLU A 1 154 ? 12.017 60.393  7.958   1.00 137.53 ? 188  GLU A CG  1 
ATOM 1259 C CD  . GLU A 1 154 ? 11.579 61.822  8.236   1.00 148.24 ? 188  GLU A CD  1 
ATOM 1260 O OE1 . GLU A 1 154 ? 12.464 62.689  8.396   1.00 144.81 ? 188  GLU A OE1 1 
ATOM 1261 O OE2 . GLU A 1 154 ? 10.357 62.081  8.289   1.00 150.43 ? 188  GLU A OE2 1 
ATOM 1262 N N   . TYR A 1 155 ? 16.433 58.864  8.104   1.00 89.92  ? 189  TYR A N   1 
ATOM 1263 C CA  . TYR A 1 155 ? 17.865 59.139  8.049   1.00 90.18  ? 189  TYR A CA  1 
ATOM 1264 C C   . TYR A 1 155 ? 18.500 58.491  6.830   1.00 99.08  ? 189  TYR A C   1 
ATOM 1265 O O   . TYR A 1 155 ? 19.467 59.016  6.263   1.00 105.01 ? 189  TYR A O   1 
ATOM 1266 C CB  . TYR A 1 155 ? 18.569 58.669  9.313   1.00 78.37  ? 189  TYR A CB  1 
ATOM 1267 C CG  . TYR A 1 155 ? 20.043 59.000  9.278   1.00 74.26  ? 189  TYR A CG  1 
ATOM 1268 C CD1 . TYR A 1 155 ? 20.498 60.261  9.635   1.00 76.56  ? 189  TYR A CD1 1 
ATOM 1269 C CD2 . TYR A 1 155 ? 20.979 58.058  8.871   1.00 72.72  ? 189  TYR A CD2 1 
ATOM 1270 C CE1 . TYR A 1 155 ? 21.845 60.572  9.602   1.00 89.46  ? 189  TYR A CE1 1 
ATOM 1271 C CE2 . TYR A 1 155 ? 22.327 58.358  8.833   1.00 73.36  ? 189  TYR A CE2 1 
ATOM 1272 C CZ  . TYR A 1 155 ? 22.755 59.614  9.200   1.00 92.33  ? 189  TYR A CZ  1 
ATOM 1273 O OH  . TYR A 1 155 ? 24.097 59.911  9.163   1.00 98.03  ? 189  TYR A OH  1 
ATOM 1274 N N   . LEU A 1 156 ? 17.994 57.338  6.429   1.00 109.41 ? 190  LEU A N   1 
ATOM 1275 C CA  . LEU A 1 156 ? 18.397 56.768  5.155   1.00 115.79 ? 190  LEU A CA  1 
ATOM 1276 C C   . LEU A 1 156 ? 17.552 57.278  3.996   1.00 117.29 ? 190  LEU A C   1 
ATOM 1277 O O   . LEU A 1 156 ? 17.928 57.070  2.837   1.00 114.16 ? 190  LEU A O   1 
ATOM 1278 C CB  . LEU A 1 156 ? 18.333 55.242  5.216   1.00 115.44 ? 190  LEU A CB  1 
ATOM 1279 C CG  . LEU A 1 156 ? 19.169 54.632  6.339   1.00 109.68 ? 190  LEU A CG  1 
ATOM 1280 C CD1 . LEU A 1 156 ? 19.089 53.120  6.279   1.00 114.55 ? 190  LEU A CD1 1 
ATOM 1281 C CD2 . LEU A 1 156 ? 20.610 55.107  6.246   1.00 101.56 ? 190  LEU A CD2 1 
ATOM 1282 N N   . GLY A 1 157 ? 16.444 57.960  4.278   1.00 117.35 ? 191  GLY A N   1 
ATOM 1283 C CA  . GLY A 1 157 ? 15.542 58.389  3.230   1.00 125.07 ? 191  GLY A CA  1 
ATOM 1284 C C   . GLY A 1 157 ? 15.119 57.206  2.387   1.00 120.58 ? 191  GLY A C   1 
ATOM 1285 O O   . GLY A 1 157 ? 15.199 57.236  1.155   1.00 115.39 ? 191  GLY A O   1 
ATOM 1286 N N   . VAL A 1 158 ? 14.677 56.142  3.050   1.00 121.42 ? 192  VAL A N   1 
ATOM 1287 C CA  . VAL A 1 158 ? 14.474 54.858  2.391   1.00 111.64 ? 192  VAL A CA  1 
ATOM 1288 C C   . VAL A 1 158 ? 13.266 54.165  3.004   1.00 106.01 ? 192  VAL A C   1 
ATOM 1289 O O   . VAL A 1 158 ? 13.162 54.058  4.230   1.00 112.30 ? 192  VAL A O   1 
ATOM 1290 C CB  . VAL A 1 158 ? 15.733 53.975  2.510   1.00 103.33 ? 192  VAL A CB  1 
ATOM 1291 C CG1 . VAL A 1 158 ? 15.375 52.528  2.370   1.00 110.06 ? 192  VAL A CG1 1 
ATOM 1292 C CG2 . VAL A 1 158 ? 16.759 54.367  1.458   1.00 102.52 ? 192  VAL A CG2 1 
ATOM 1293 N N   . ASN A 1 159 ? 12.353 53.695  2.157   1.00 93.21  ? 193  ASN A N   1 
ATOM 1294 C CA  . ASN A 1 159 ? 11.266 52.830  2.614   1.00 108.28 ? 193  ASN A CA  1 
ATOM 1295 C C   . ASN A 1 159 ? 11.803 51.407  2.702   1.00 105.88 ? 193  ASN A C   1 
ATOM 1296 O O   . ASN A 1 159 ? 11.853 50.684  1.704   1.00 106.74 ? 193  ASN A O   1 
ATOM 1297 C CB  . ASN A 1 159 ? 10.067 52.918  1.677   1.00 114.79 ? 193  ASN A CB  1 
ATOM 1298 C CG  . ASN A 1 159 ? 9.265  54.189  1.874   1.00 119.18 ? 193  ASN A CG  1 
ATOM 1299 O OD1 . ASN A 1 159 ? 9.243  54.758  2.966   1.00 124.72 ? 193  ASN A OD1 1 
ATOM 1300 N ND2 . ASN A 1 159 ? 8.600  54.642  0.815   1.00 118.48 ? 193  ASN A ND2 1 
ATOM 1301 N N   . ALA A 1 160 ? 12.209 50.997  3.901   1.00 101.70 ? 194  ALA A N   1 
ATOM 1302 C CA  . ALA A 1 160 ? 12.891 49.727  4.086   1.00 101.05 ? 194  ALA A CA  1 
ATOM 1303 C C   . ALA A 1 160 ? 11.944 48.664  4.625   1.00 116.39 ? 194  ALA A C   1 
ATOM 1304 O O   . ALA A 1 160 ? 11.008 48.949  5.377   1.00 120.92 ? 194  ALA A O   1 
ATOM 1305 C CB  . ALA A 1 160 ? 14.086 49.872  5.026   1.00 73.89  ? 194  ALA A CB  1 
ATOM 1306 N N   . CYS A 1 161 ? 12.210 47.427  4.223   1.00 122.29 ? 195  CYS A N   1 
ATOM 1307 C CA  . CYS A 1 161 ? 11.441 46.264  4.653   1.00 122.61 ? 195  CYS A CA  1 
ATOM 1308 C C   . CYS A 1 161 ? 12.106 45.716  5.911   1.00 125.47 ? 195  CYS A C   1 
ATOM 1309 O O   . CYS A 1 161 ? 13.059 44.937  5.841   1.00 129.80 ? 195  CYS A O   1 
ATOM 1310 C CB  . CYS A 1 161 ? 11.381 45.241  3.525   1.00 116.58 ? 195  CYS A CB  1 
ATOM 1311 S SG  . CYS A 1 161 ? 10.635 43.668  3.935   1.00 113.80 ? 195  CYS A SG  1 
ATOM 1312 N N   . ILE A 1 162 ? 11.609 46.139  7.073   1.00 122.37 ? 196  ILE A N   1 
ATOM 1313 C CA  . ILE A 1 162 ? 12.256 45.834  8.345   1.00 117.63 ? 196  ILE A CA  1 
ATOM 1314 C C   . ILE A 1 162 ? 11.304 45.089  9.264   1.00 117.71 ? 196  ILE A C   1 
ATOM 1315 O O   . ILE A 1 162 ? 10.159 44.805  8.898   1.00 109.72 ? 196  ILE A O   1 
ATOM 1316 C CB  . ILE A 1 162 ? 12.744 47.113  9.046   1.00 116.30 ? 196  ILE A CB  1 
ATOM 1317 C CG1 . ILE A 1 162 ? 11.539 47.907  9.553   1.00 113.16 ? 196  ILE A CG1 1 
ATOM 1318 C CG2 . ILE A 1 162 ? 13.588 47.953  8.112   1.00 121.44 ? 196  ILE A CG2 1 
ATOM 1319 C CD1 . ILE A 1 162 ? 11.902 49.123  10.354  1.00 119.13 ? 196  ILE A CD1 1 
ATOM 1320 N N   . MET A 1 163 ? 11.777 44.778  10.468  1.00 123.87 ? 197  MET A N   1 
ATOM 1321 C CA  . MET A 1 163 ? 10.929 44.284  11.547  1.00 126.03 ? 197  MET A CA  1 
ATOM 1322 C C   . MET A 1 163 ? 10.406 45.495  12.318  1.00 122.88 ? 197  MET A C   1 
ATOM 1323 O O   . MET A 1 163 ? 11.178 46.210  12.966  1.00 105.94 ? 197  MET A O   1 
ATOM 1324 C CB  . MET A 1 163 ? 11.710 43.329  12.447  1.00 123.93 ? 197  MET A CB  1 
ATOM 1325 C CG  . MET A 1 163 ? 12.182 42.057  11.750  1.00 118.84 ? 197  MET A CG  1 
ATOM 1326 S SD  . MET A 1 163 ? 10.857 40.866  11.428  1.00 121.13 ? 197  MET A SD  1 
ATOM 1327 C CE  . MET A 1 163 ? 10.463 40.332  13.092  1.00 119.90 ? 197  MET A CE  1 
ATOM 1328 N N   . ALA A 1 164 ? 9.094  45.726  12.240  1.00 136.34 ? 198  ALA A N   1 
ATOM 1329 C CA  . ALA A 1 164 ? 8.481  46.953  12.756  1.00 138.88 ? 198  ALA A CA  1 
ATOM 1330 C C   . ALA A 1 164 ? 7.983  46.738  14.186  1.00 140.04 ? 198  ALA A C   1 
ATOM 1331 O O   . ALA A 1 164 ? 6.787  46.763  14.483  1.00 143.96 ? 198  ALA A O   1 
ATOM 1332 C CB  . ALA A 1 164 ? 7.355  47.406  11.836  1.00 143.82 ? 198  ALA A CB  1 
ATOM 1333 N N   . PHE A 1 165 ? 8.943  46.535  15.087  1.00 133.96 ? 199  PHE A N   1 
ATOM 1334 C CA  . PHE A 1 165 ? 8.628  46.441  16.501  1.00 134.63 ? 199  PHE A CA  1 
ATOM 1335 C C   . PHE A 1 165 ? 8.131  47.795  17.006  1.00 135.36 ? 199  PHE A C   1 
ATOM 1336 O O   . PHE A 1 165 ? 8.374  48.829  16.377  1.00 138.07 ? 199  PHE A O   1 
ATOM 1337 C CB  . PHE A 1 165 ? 9.856  45.997  17.297  1.00 135.17 ? 199  PHE A CB  1 
ATOM 1338 C CG  . PHE A 1 165 ? 10.466 44.703  16.821  1.00 138.20 ? 199  PHE A CG  1 
ATOM 1339 C CD1 . PHE A 1 165 ? 9.668  43.619  16.492  1.00 142.09 ? 199  PHE A CD1 1 
ATOM 1340 C CD2 . PHE A 1 165 ? 11.841 44.570  16.706  1.00 129.95 ? 199  PHE A CD2 1 
ATOM 1341 C CE1 . PHE A 1 165 ? 10.229 42.429  16.056  1.00 137.59 ? 199  PHE A CE1 1 
ATOM 1342 C CE2 . PHE A 1 165 ? 12.406 43.382  16.269  1.00 127.89 ? 199  PHE A CE2 1 
ATOM 1343 C CZ  . PHE A 1 165 ? 11.600 42.312  15.946  1.00 132.65 ? 199  PHE A CZ  1 
ATOM 1344 N N   . PRO A 1 166 ? 7.410  47.814  18.126  1.00 127.02 ? 200  PRO A N   1 
ATOM 1345 C CA  . PRO A 1 166 ? 7.018  49.093  18.735  1.00 129.40 ? 200  PRO A CA  1 
ATOM 1346 C C   . PRO A 1 166 ? 8.238  49.931  19.071  1.00 128.00 ? 200  PRO A C   1 
ATOM 1347 O O   . PRO A 1 166 ? 9.057  49.536  19.915  1.00 130.73 ? 200  PRO A O   1 
ATOM 1348 C CB  . PRO A 1 166 ? 6.268  48.662  20.002  1.00 132.83 ? 200  PRO A CB  1 
ATOM 1349 C CG  . PRO A 1 166 ? 5.732  47.310  19.665  1.00 132.22 ? 200  PRO A CG  1 
ATOM 1350 C CD  . PRO A 1 166 ? 6.782  46.667  18.804  1.00 125.06 ? 200  PRO A CD  1 
ATOM 1351 N N   . PRO A 1 167 ? 8.388  51.101  18.438  1.00 118.11 ? 201  PRO A N   1 
ATOM 1352 C CA  . PRO A 1 167 ? 9.631  51.879  18.598  1.00 107.81 ? 201  PRO A CA  1 
ATOM 1353 C C   . PRO A 1 167 ? 9.936  52.290  20.028  1.00 112.77 ? 201  PRO A C   1 
ATOM 1354 O O   . PRO A 1 167 ? 11.104 52.558  20.338  1.00 103.98 ? 201  PRO A O   1 
ATOM 1355 C CB  . PRO A 1 167 ? 9.394  53.108  17.709  1.00 101.86 ? 201  PRO A CB  1 
ATOM 1356 C CG  . PRO A 1 167 ? 8.319  52.700  16.759  1.00 105.01 ? 201  PRO A CG  1 
ATOM 1357 C CD  . PRO A 1 167 ? 7.446  51.744  17.508  1.00 113.96 ? 201  PRO A CD  1 
ATOM 1358 N N   . GLU A 1 168 ? 8.931  52.374  20.903  1.00 120.31 ? 202  GLU A N   1 
ATOM 1359 C CA  . GLU A 1 168 ? 9.205  52.654  22.308  1.00 133.16 ? 202  GLU A CA  1 
ATOM 1360 C C   . GLU A 1 168 ? 10.069 51.558  22.913  1.00 141.51 ? 202  GLU A C   1 
ATOM 1361 O O   . GLU A 1 168 ? 11.130 51.828  23.490  1.00 141.55 ? 202  GLU A O   1 
ATOM 1362 C CB  . GLU A 1 168 ? 7.896  52.797  23.086  1.00 152.13 ? 202  GLU A CB  1 
ATOM 1363 C CG  . GLU A 1 168 ? 7.027  53.980  22.675  1.00 171.56 ? 202  GLU A CG  1 
ATOM 1364 C CD  . GLU A 1 168 ? 6.181  53.693  21.449  1.00 180.68 ? 202  GLU A CD  1 
ATOM 1365 O OE1 . GLU A 1 168 ? 6.218  52.545  20.958  1.00 178.73 ? 202  GLU A OE1 1 
ATOM 1366 O OE2 . GLU A 1 168 ? 5.479  54.613  20.978  1.00 185.33 ? 202  GLU A OE2 1 
ATOM 1367 N N   . LYS A 1 169 ? 9.634  50.309  22.773  1.00 149.99 ? 203  LYS A N   1 
ATOM 1368 C CA  . LYS A 1 169 ? 10.346 49.136  23.264  1.00 143.95 ? 203  LYS A CA  1 
ATOM 1369 C C   . LYS A 1 169 ? 10.911 48.320  22.108  1.00 136.12 ? 203  LYS A C   1 
ATOM 1370 O O   . LYS A 1 169 ? 10.850 47.090  22.109  1.00 139.71 ? 203  LYS A O   1 
ATOM 1371 C CB  . LYS A 1 169 ? 9.434  48.269  24.125  1.00 156.74 ? 203  LYS A CB  1 
ATOM 1372 C CG  . LYS A 1 169 ? 8.906  48.960  25.369  1.00 171.75 ? 203  LYS A CG  1 
ATOM 1373 C CD  . LYS A 1 169 ? 8.028  48.018  26.184  1.00 187.89 ? 203  LYS A CD  1 
ATOM 1374 C CE  . LYS A 1 169 ? 7.528  48.676  27.464  1.00 199.44 ? 203  LYS A CE  1 
ATOM 1375 N NZ  . LYS A 1 169 ? 6.698  47.750  28.291  1.00 204.42 ? 203  LYS A NZ  1 
ATOM 1376 N N   . TYR A 1 170 ? 11.444 49.002  21.094  1.00 121.90 ? 204  TYR A N   1 
ATOM 1377 C CA  . TYR A 1 170 ? 11.969 48.296  19.932  1.00 117.48 ? 204  TYR A CA  1 
ATOM 1378 C C   . TYR A 1 170 ? 13.117 47.381  20.329  1.00 123.50 ? 204  TYR A C   1 
ATOM 1379 O O   . TYR A 1 170 ? 13.029 46.157  20.181  1.00 132.23 ? 204  TYR A O   1 
ATOM 1380 C CB  . TYR A 1 170 ? 12.417 49.295  18.866  1.00 108.33 ? 204  TYR A CB  1 
ATOM 1381 C CG  . TYR A 1 170 ? 12.749 48.664  17.530  1.00 102.94 ? 204  TYR A CG  1 
ATOM 1382 C CD1 . TYR A 1 170 ? 14.011 48.139  17.273  1.00 96.45  ? 204  TYR A CD1 1 
ATOM 1383 C CD2 . TYR A 1 170 ? 11.801 48.605  16.521  1.00 103.92 ? 204  TYR A CD2 1 
ATOM 1384 C CE1 . TYR A 1 170 ? 14.312 47.568  16.048  1.00 95.12  ? 204  TYR A CE1 1 
ATOM 1385 C CE2 . TYR A 1 170 ? 12.090 48.034  15.298  1.00 104.79 ? 204  TYR A CE2 1 
ATOM 1386 C CZ  . TYR A 1 170 ? 13.345 47.518  15.062  1.00 99.09  ? 204  TYR A CZ  1 
ATOM 1387 O OH  . TYR A 1 170 ? 13.623 46.951  13.835  1.00 88.38  ? 204  TYR A OH  1 
ATOM 1388 N N   . ALA A 1 171 ? 14.191 47.964  20.874  1.00 120.95 ? 205  ALA A N   1 
ATOM 1389 C CA  . ALA A 1 171 ? 15.408 47.210  21.159  1.00 117.76 ? 205  ALA A CA  1 
ATOM 1390 C C   . ALA A 1 171 ? 15.105 45.933  21.922  1.00 115.00 ? 205  ALA A C   1 
ATOM 1391 O O   . ALA A 1 171 ? 15.484 44.838  21.493  1.00 126.90 ? 205  ALA A O   1 
ATOM 1392 C CB  . ALA A 1 171 ? 16.387 48.073  21.949  1.00 127.07 ? 205  ALA A CB  1 
ATOM 1393 N N   . GLN A 1 172 ? 14.389 46.057  23.041  1.00 113.78 ? 206  GLN A N   1 
ATOM 1394 C CA  . GLN A 1 172 ? 13.970 44.890  23.808  1.00 115.11 ? 206  GLN A CA  1 
ATOM 1395 C C   . GLN A 1 172 ? 13.412 43.815  22.890  1.00 117.83 ? 206  GLN A C   1 
ATOM 1396 O O   . GLN A 1 172 ? 13.976 42.719  22.780  1.00 122.73 ? 206  GLN A O   1 
ATOM 1397 C CB  . GLN A 1 172 ? 12.927 45.291  24.846  1.00 125.72 ? 206  GLN A CB  1 
ATOM 1398 C CG  . GLN A 1 172 ? 13.419 46.287  25.885  1.00 140.35 ? 206  GLN A CG  1 
ATOM 1399 C CD  . GLN A 1 172 ? 13.383 47.730  25.403  1.00 149.99 ? 206  GLN A CD  1 
ATOM 1400 O OE1 . GLN A 1 172 ? 13.268 48.004  24.206  1.00 151.82 ? 206  GLN A OE1 1 
ATOM 1401 N NE2 . GLN A 1 172 ? 13.480 48.662  26.342  1.00 156.94 ? 206  GLN A NE2 1 
ATOM 1402 N N   . TRP A 1 173 ? 12.332 44.144  22.176  1.00 112.19 ? 207  TRP A N   1 
ATOM 1403 C CA  . TRP A 1 173 ? 11.741 43.197  21.236  1.00 111.68 ? 207  TRP A CA  1 
ATOM 1404 C C   . TRP A 1 173 ? 12.803 42.566  20.349  1.00 107.74 ? 207  TRP A C   1 
ATOM 1405 O O   . TRP A 1 173 ? 12.912 41.337  20.282  1.00 114.10 ? 207  TRP A O   1 
ATOM 1406 C CB  . TRP A 1 173 ? 10.673 43.884  20.388  1.00 115.79 ? 207  TRP A CB  1 
ATOM 1407 C CG  . TRP A 1 173 ? 9.335  43.916  21.046  1.00 128.14 ? 207  TRP A CG  1 
ATOM 1408 C CD1 . TRP A 1 173 ? 8.839  44.902  21.848  1.00 136.28 ? 207  TRP A CD1 1 
ATOM 1409 C CD2 . TRP A 1 173 ? 8.316  42.908  20.971  1.00 135.47 ? 207  TRP A CD2 1 
ATOM 1410 N NE1 . TRP A 1 173 ? 7.571  44.573  22.274  1.00 143.42 ? 207  TRP A NE1 1 
ATOM 1411 C CE2 . TRP A 1 173 ? 7.228  43.354  21.749  1.00 142.96 ? 207  TRP A CE2 1 
ATOM 1412 C CE3 . TRP A 1 173 ? 8.218  41.673  20.320  1.00 128.98 ? 207  TRP A CE3 1 
ATOM 1413 C CZ2 . TRP A 1 173 ? 6.056  42.609  21.893  1.00 145.57 ? 207  TRP A CZ2 1 
ATOM 1414 C CZ3 . TRP A 1 173 ? 7.053  40.936  20.465  1.00 129.82 ? 207  TRP A CZ3 1 
ATOM 1415 C CH2 . TRP A 1 173 ? 5.989  41.406  21.244  1.00 136.23 ? 207  TRP A CH2 1 
ATOM 1416 N N   . ALA A 1 174 ? 13.631 43.392  19.702  1.00 115.51 ? 208  ALA A N   1 
ATOM 1417 C CA  . ALA A 1 174 ? 14.694 42.848  18.865  1.00 113.39 ? 208  ALA A CA  1 
ATOM 1418 C C   . ALA A 1 174 ? 15.466 41.774  19.614  1.00 120.45 ? 208  ALA A C   1 
ATOM 1419 O O   . ALA A 1 174 ? 15.472 40.608  19.204  1.00 131.55 ? 208  ALA A O   1 
ATOM 1420 C CB  . ALA A 1 174 ? 15.637 43.948  18.394  1.00 114.68 ? 208  ALA A CB  1 
ATOM 1421 N N   . ALA A 1 175 ? 16.055 42.138  20.760  1.00 117.60 ? 209  ALA A N   1 
ATOM 1422 C CA  . ALA A 1 175 ? 16.788 41.165  21.565  1.00 114.76 ? 209  ALA A CA  1 
ATOM 1423 C C   . ALA A 1 175 ? 15.988 39.877  21.714  1.00 118.80 ? 209  ALA A C   1 
ATOM 1424 O O   . ALA A 1 175 ? 16.439 38.804  21.291  1.00 118.91 ? 209  ALA A O   1 
ATOM 1425 C CB  . ALA A 1 175 ? 17.136 41.747  22.934  1.00 99.71  ? 209  ALA A CB  1 
ATOM 1426 N N   . GLY A 1 176 ? 14.755 39.985  22.225  1.00 115.13 ? 210  GLY A N   1 
ATOM 1427 C CA  . GLY A 1 176 ? 13.905 38.824  22.399  1.00 109.08 ? 210  GLY A CA  1 
ATOM 1428 C C   . GLY A 1 176 ? 13.860 37.974  21.150  1.00 111.04 ? 210  GLY A C   1 
ATOM 1429 O O   . GLY A 1 176 ? 14.273 36.810  21.169  1.00 124.29 ? 210  GLY A O   1 
ATOM 1430 N N   . ILE A 1 177 ? 13.445 38.567  20.028  1.00 102.56 ? 211  ILE A N   1 
ATOM 1431 C CA  . ILE A 1 177 ? 13.286 37.767  18.819  1.00 122.17 ? 211  ILE A CA  1 
ATOM 1432 C C   . ILE A 1 177 ? 14.616 37.147  18.417  1.00 127.06 ? 211  ILE A C   1 
ATOM 1433 O O   . ILE A 1 177 ? 14.679 35.961  18.071  1.00 138.51 ? 211  ILE A O   1 
ATOM 1434 C CB  . ILE A 1 177 ? 12.683 38.619  17.698  1.00 99.71  ? 211  ILE A CB  1 
ATOM 1435 C CG1 . ILE A 1 177 ? 11.273 39.042  18.106  1.00 103.31 ? 211  ILE A CG1 1 
ATOM 1436 C CG2 . ILE A 1 177 ? 12.695 37.857  16.390  1.00 100.02 ? 211  ILE A CG2 1 
ATOM 1437 C CD1 . ILE A 1 177 ? 10.330 37.880  18.368  1.00 107.27 ? 211  ILE A CD1 1 
ATOM 1438 N N   . ALA A 1 178 ? 15.710 37.909  18.533  1.00 126.28 ? 212  ALA A N   1 
ATOM 1439 C CA  . ALA A 1 178 ? 17.020 37.336  18.244  1.00 125.98 ? 212  ALA A CA  1 
ATOM 1440 C C   . ALA A 1 178 ? 17.240 36.067  19.053  1.00 139.72 ? 212  ALA A C   1 
ATOM 1441 O O   . ALA A 1 178 ? 17.516 35.002  18.490  1.00 145.60 ? 212  ALA A O   1 
ATOM 1442 C CB  . ALA A 1 178 ? 18.122 38.351  18.525  1.00 114.69 ? 212  ALA A CB  1 
ATOM 1443 N N   . LEU A 1 179 ? 17.052 36.145  20.373  1.00 139.29 ? 213  LEU A N   1 
ATOM 1444 C CA  . LEU A 1 179 ? 17.183 34.943  21.192  1.00 131.01 ? 213  LEU A CA  1 
ATOM 1445 C C   . LEU A 1 179 ? 16.239 33.841  20.725  1.00 136.81 ? 213  LEU A C   1 
ATOM 1446 O O   . LEU A 1 179 ? 16.651 32.684  20.600  1.00 148.05 ? 213  LEU A O   1 
ATOM 1447 C CB  . LEU A 1 179 ? 16.943 35.272  22.660  1.00 129.17 ? 213  LEU A CB  1 
ATOM 1448 C CG  . LEU A 1 179 ? 17.964 36.239  23.264  1.00 122.62 ? 213  LEU A CG  1 
ATOM 1449 C CD1 . LEU A 1 179 ? 17.702 36.466  24.743  1.00 125.43 ? 213  LEU A CD1 1 
ATOM 1450 C CD2 . LEU A 1 179 ? 19.400 35.764  23.040  1.00 118.20 ? 213  LEU A CD2 1 
ATOM 1451 N N   . MET A 1 180 ? 14.982 34.177  20.420  1.00 135.30 ? 214  MET A N   1 
ATOM 1452 C CA  . MET A 1 180 ? 14.089 33.161  19.870  1.00 138.12 ? 214  MET A CA  1 
ATOM 1453 C C   . MET A 1 180 ? 14.675 32.550  18.601  1.00 133.04 ? 214  MET A C   1 
ATOM 1454 O O   . MET A 1 180 ? 14.733 31.322  18.468  1.00 133.43 ? 214  MET A O   1 
ATOM 1455 C CB  . MET A 1 180 ? 12.708 33.750  19.609  1.00 146.55 ? 214  MET A CB  1 
ATOM 1456 C CG  . MET A 1 180 ? 12.005 34.198  20.876  1.00 168.38 ? 214  MET A CG  1 
ATOM 1457 S SD  . MET A 1 180 ? 11.855 32.868  22.090  1.00 192.16 ? 214  MET A SD  1 
ATOM 1458 C CE  . MET A 1 180 ? 10.776 31.743  21.212  1.00 195.43 ? 214  MET A CE  1 
ATOM 1459 N N   . LYS A 1 181 ? 15.165 33.387  17.678  1.00 119.56 ? 215  LYS A N   1 
ATOM 1460 C CA  . LYS A 1 181 ? 15.821 32.852  16.485  1.00 128.41 ? 215  LYS A CA  1 
ATOM 1461 C C   . LYS A 1 181 ? 16.956 31.904  16.850  1.00 129.68 ? 215  LYS A C   1 
ATOM 1462 O O   . LYS A 1 181 ? 17.170 30.888  16.180  1.00 131.90 ? 215  LYS A O   1 
ATOM 1463 C CB  . LYS A 1 181 ? 16.356 33.982  15.610  1.00 134.08 ? 215  LYS A CB  1 
ATOM 1464 C CG  . LYS A 1 181 ? 15.318 34.698  14.780  1.00 143.67 ? 215  LYS A CG  1 
ATOM 1465 C CD  . LYS A 1 181 ? 16.004 35.745  13.923  1.00 149.66 ? 215  LYS A CD  1 
ATOM 1466 C CE  . LYS A 1 181 ? 15.011 36.688  13.270  1.00 150.98 ? 215  LYS A CE  1 
ATOM 1467 N NZ  . LYS A 1 181 ? 15.699 37.817  12.580  1.00 138.26 ? 215  LYS A NZ  1 
ATOM 1468 N N   . ASN A 1 182 ? 17.700 32.219  17.911  1.00 130.07 ? 216  ASN A N   1 
ATOM 1469 C CA  . ASN A 1 182 ? 18.767 31.319  18.338  1.00 129.13 ? 216  ASN A CA  1 
ATOM 1470 C C   . ASN A 1 182 ? 18.210 30.000  18.865  1.00 134.61 ? 216  ASN A C   1 
ATOM 1471 O O   . ASN A 1 182 ? 18.757 28.927  18.579  1.00 140.88 ? 216  ASN A O   1 
ATOM 1472 C CB  . ASN A 1 182 ? 19.633 31.999  19.396  1.00 126.04 ? 216  ASN A CB  1 
ATOM 1473 C CG  . ASN A 1 182 ? 20.734 32.833  18.792  1.00 121.67 ? 216  ASN A CG  1 
ATOM 1474 O OD1 . ASN A 1 182 ? 21.335 32.445  17.789  1.00 118.89 ? 216  ASN A OD1 1 
ATOM 1475 N ND2 . ASN A 1 182 ? 21.002 33.990  19.388  1.00 120.76 ? 216  ASN A ND2 1 
ATOM 1476 N N   . ILE A 1 183 ? 17.117 30.051  19.625  1.00 129.57 ? 217  ILE A N   1 
ATOM 1477 C CA  . ILE A 1 183 ? 16.621 28.848  20.287  1.00 127.91 ? 217  ILE A CA  1 
ATOM 1478 C C   . ILE A 1 183 ? 15.852 27.966  19.310  1.00 131.75 ? 217  ILE A C   1 
ATOM 1479 O O   . ILE A 1 183 ? 16.192 26.796  19.102  1.00 137.40 ? 217  ILE A O   1 
ATOM 1480 C CB  . ILE A 1 183 ? 15.763 29.228  21.503  1.00 122.64 ? 217  ILE A CB  1 
ATOM 1481 C CG1 . ILE A 1 183 ? 16.646 29.851  22.579  1.00 111.70 ? 217  ILE A CG1 1 
ATOM 1482 C CG2 . ILE A 1 183 ? 15.036 28.016  22.044  1.00 126.66 ? 217  ILE A CG2 1 
ATOM 1483 C CD1 . ILE A 1 183 ? 15.902 30.201  23.826  1.00 119.54 ? 217  ILE A CD1 1 
ATOM 1484 N N   . LEU A 1 184 ? 14.799 28.512  18.701  1.00 126.93 ? 218  LEU A N   1 
ATOM 1485 C CA  . LEU A 1 184 ? 13.994 27.731  17.771  1.00 129.09 ? 218  LEU A CA  1 
ATOM 1486 C C   . LEU A 1 184 ? 14.690 27.497  16.438  1.00 125.29 ? 218  LEU A C   1 
ATOM 1487 O O   . LEU A 1 184 ? 14.243 26.641  15.668  1.00 127.83 ? 218  LEU A O   1 
ATOM 1488 C CB  . LEU A 1 184 ? 12.649 28.422  17.534  1.00 132.04 ? 218  LEU A CB  1 
ATOM 1489 C CG  . LEU A 1 184 ? 11.736 28.581  18.749  1.00 135.25 ? 218  LEU A CG  1 
ATOM 1490 C CD1 . LEU A 1 184 ? 10.411 29.176  18.331  1.00 141.78 ? 218  LEU A CD1 1 
ATOM 1491 C CD2 . LEU A 1 184 ? 11.518 27.245  19.422  1.00 137.15 ? 218  LEU A CD2 1 
ATOM 1492 N N   . GLY A 1 185 ? 15.766 28.221  16.148  1.00 123.08 ? 219  GLY A N   1 
ATOM 1493 C CA  . GLY A 1 185 ? 16.398 28.116  14.850  1.00 123.08 ? 219  GLY A CA  1 
ATOM 1494 C C   . GLY A 1 185 ? 17.709 27.366  14.871  1.00 123.93 ? 219  GLY A C   1 
ATOM 1495 O O   . GLY A 1 185 ? 18.064 26.708  13.889  1.00 132.13 ? 219  GLY A O   1 
ATOM 1496 N N   . PHE A 1 186 ? 18.452 27.469  15.969  1.00 124.43 ? 220  PHE A N   1 
ATOM 1497 C CA  . PHE A 1 186 ? 19.721 26.763  16.075  1.00 127.87 ? 220  PHE A CA  1 
ATOM 1498 C C   . PHE A 1 186 ? 19.788 25.823  17.268  1.00 128.73 ? 220  PHE A C   1 
ATOM 1499 O O   . PHE A 1 186 ? 20.096 24.639  17.091  1.00 125.50 ? 220  PHE A O   1 
ATOM 1500 C CB  . PHE A 1 186 ? 20.874 27.775  16.135  1.00 126.72 ? 220  PHE A CB  1 
ATOM 1501 C CG  . PHE A 1 186 ? 22.220 27.170  15.878  1.00 133.16 ? 220  PHE A CG  1 
ATOM 1502 C CD1 . PHE A 1 186 ? 22.575 26.756  14.605  1.00 133.86 ? 220  PHE A CD1 1 
ATOM 1503 C CD2 . PHE A 1 186 ? 23.134 27.020  16.908  1.00 133.73 ? 220  PHE A CD2 1 
ATOM 1504 C CE1 . PHE A 1 186 ? 23.816 26.198  14.364  1.00 135.04 ? 220  PHE A CE1 1 
ATOM 1505 C CE2 . PHE A 1 186 ? 24.377 26.466  16.672  1.00 133.63 ? 220  PHE A CE2 1 
ATOM 1506 C CZ  . PHE A 1 186 ? 24.717 26.054  15.398  1.00 138.45 ? 220  PHE A CZ  1 
ATOM 1507 N N   . ILE A 1 187 ? 19.464 26.303  18.472  1.00 114.19 ? 221  ILE A N   1 
ATOM 1508 C CA  . ILE A 1 187 ? 19.803 25.573  19.696  1.00 118.36 ? 221  ILE A CA  1 
ATOM 1509 C C   . ILE A 1 187 ? 19.116 24.213  19.725  1.00 121.86 ? 221  ILE A C   1 
ATOM 1510 O O   . ILE A 1 187 ? 19.773 23.165  19.769  1.00 117.82 ? 221  ILE A O   1 
ATOM 1511 C CB  . ILE A 1 187 ? 19.437 26.401  20.939  1.00 106.99 ? 221  ILE A CB  1 
ATOM 1512 C CG1 . ILE A 1 187 ? 20.306 27.657  21.011  1.00 108.16 ? 221  ILE A CG1 1 
ATOM 1513 C CG2 . ILE A 1 187 ? 19.561 25.548  22.202  1.00 96.32  ? 221  ILE A CG2 1 
ATOM 1514 C CD1 . ILE A 1 187 ? 21.782 27.366  20.982  1.00 111.72 ? 221  ILE A CD1 1 
ATOM 1515 N N   . ILE A 1 188 ? 17.782 24.212  19.718  1.00 122.52 ? 222  ILE A N   1 
ATOM 1516 C CA  . ILE A 1 188 ? 17.041 22.952  19.780  1.00 133.91 ? 222  ILE A CA  1 
ATOM 1517 C C   . ILE A 1 188 ? 17.353 22.050  18.589  1.00 147.63 ? 222  ILE A C   1 
ATOM 1518 O O   . ILE A 1 188 ? 17.633 20.856  18.802  1.00 147.00 ? 222  ILE A O   1 
ATOM 1519 C CB  . ILE A 1 188 ? 15.538 23.230  19.941  1.00 128.29 ? 222  ILE A CB  1 
ATOM 1520 C CG1 . ILE A 1 188 ? 15.280 24.073  21.192  1.00 121.94 ? 222  ILE A CG1 1 
ATOM 1521 C CG2 . ILE A 1 188 ? 14.758 21.929  20.010  1.00 137.57 ? 222  ILE A CG2 1 
ATOM 1522 C CD1 . ILE A 1 188 ? 13.814 24.307  21.474  1.00 115.79 ? 222  ILE A CD1 1 
ATOM 1523 N N   . PRO A 1 189 ? 17.337 22.530  17.337  1.00 156.80 ? 223  PRO A N   1 
ATOM 1524 C CA  . PRO A 1 189 ? 17.740 21.643  16.233  1.00 158.18 ? 223  PRO A CA  1 
ATOM 1525 C C   . PRO A 1 189 ? 19.166 21.135  16.359  1.00 158.25 ? 223  PRO A C   1 
ATOM 1526 O O   . PRO A 1 189 ? 19.424 19.969  16.038  1.00 161.59 ? 223  PRO A O   1 
ATOM 1527 C CB  . PRO A 1 189 ? 17.553 22.526  14.991  1.00 161.06 ? 223  PRO A CB  1 
ATOM 1528 C CG  . PRO A 1 189 ? 16.542 23.537  15.394  1.00 156.95 ? 223  PRO A CG  1 
ATOM 1529 C CD  . PRO A 1 189 ? 16.851 23.828  16.829  1.00 157.16 ? 223  PRO A CD  1 
ATOM 1530 N N   . LEU A 1 190 ? 20.105 21.972  16.813  1.00 155.07 ? 224  LEU A N   1 
ATOM 1531 C CA  . LEU A 1 190 ? 21.478 21.508  16.996  1.00 148.02 ? 224  LEU A CA  1 
ATOM 1532 C C   . LEU A 1 190 ? 21.548 20.385  18.020  1.00 140.41 ? 224  LEU A C   1 
ATOM 1533 O O   . LEU A 1 190 ? 22.278 19.404  17.827  1.00 141.30 ? 224  LEU A O   1 
ATOM 1534 C CB  . LEU A 1 190 ? 22.381 22.662  17.425  1.00 145.46 ? 224  LEU A CB  1 
ATOM 1535 C CG  . LEU A 1 190 ? 23.813 22.278  17.802  1.00 150.37 ? 224  LEU A CG  1 
ATOM 1536 C CD1 . LEU A 1 190 ? 24.618 21.906  16.564  1.00 151.63 ? 224  LEU A CD1 1 
ATOM 1537 C CD2 . LEU A 1 190 ? 24.491 23.394  18.579  1.00 147.66 ? 224  LEU A CD2 1 
ATOM 1538 N N   . ILE A 1 191 ? 20.804 20.516  19.120  1.00 136.78 ? 225  ILE A N   1 
ATOM 1539 C CA  . ILE A 1 191 ? 20.783 19.468  20.138  1.00 129.55 ? 225  ILE A CA  1 
ATOM 1540 C C   . ILE A 1 191 ? 20.230 18.171  19.553  1.00 129.19 ? 225  ILE A C   1 
ATOM 1541 O O   . ILE A 1 191 ? 20.833 17.099  19.697  1.00 139.16 ? 225  ILE A O   1 
ATOM 1542 C CB  . ILE A 1 191 ? 19.978 19.927  21.368  1.00 121.06 ? 225  ILE A CB  1 
ATOM 1543 C CG1 . ILE A 1 191 ? 20.654 21.125  22.045  1.00 121.08 ? 225  ILE A CG1 1 
ATOM 1544 C CG2 . ILE A 1 191 ? 19.824 18.790  22.361  1.00 119.49 ? 225  ILE A CG2 1 
ATOM 1545 C CD1 . ILE A 1 191 ? 19.838 21.728  23.176  1.00 104.57 ? 225  ILE A CD1 1 
ATOM 1546 N N   . PHE A 1 192 ? 19.081 18.253  18.872  1.00 128.92 ? 226  PHE A N   1 
ATOM 1547 C CA  . PHE A 1 192 ? 18.480 17.055  18.282  1.00 133.99 ? 226  PHE A CA  1 
ATOM 1548 C C   . PHE A 1 192 ? 19.434 16.370  17.308  1.00 143.86 ? 226  PHE A C   1 
ATOM 1549 O O   . PHE A 1 192 ? 19.685 15.163  17.409  1.00 157.78 ? 226  PHE A O   1 
ATOM 1550 C CB  . PHE A 1 192 ? 17.175 17.412  17.570  1.00 130.60 ? 226  PHE A CB  1 
ATOM 1551 C CG  . PHE A 1 192 ? 15.953 17.294  18.432  1.00 130.24 ? 226  PHE A CG  1 
ATOM 1552 C CD1 . PHE A 1 192 ? 15.342 16.071  18.622  1.00 137.64 ? 226  PHE A CD1 1 
ATOM 1553 C CD2 . PHE A 1 192 ? 15.405 18.413  19.039  1.00 131.79 ? 226  PHE A CD2 1 
ATOM 1554 C CE1 . PHE A 1 192 ? 14.211 15.958  19.411  1.00 142.96 ? 226  PHE A CE1 1 
ATOM 1555 C CE2 . PHE A 1 192 ? 14.278 18.309  19.826  1.00 126.89 ? 226  PHE A CE2 1 
ATOM 1556 C CZ  . PHE A 1 192 ? 13.679 17.077  20.013  1.00 134.15 ? 226  PHE A CZ  1 
ATOM 1557 N N   . ILE A 1 193 ? 19.974 17.132  16.353  1.00 141.84 ? 227  ILE A N   1 
ATOM 1558 C CA  . ILE A 1 193 ? 20.829 16.554  15.319  1.00 147.21 ? 227  ILE A CA  1 
ATOM 1559 C C   . ILE A 1 193 ? 22.093 15.964  15.933  1.00 152.20 ? 227  ILE A C   1 
ATOM 1560 O O   . ILE A 1 193 ? 22.553 14.890  15.527  1.00 168.03 ? 227  ILE A O   1 
ATOM 1561 C CB  . ILE A 1 193 ? 21.158 17.614  14.250  1.00 145.45 ? 227  ILE A CB  1 
ATOM 1562 C CG1 . ILE A 1 193 ? 19.880 18.108  13.567  1.00 140.99 ? 227  ILE A CG1 1 
ATOM 1563 C CG2 . ILE A 1 193 ? 22.127 17.058  13.218  1.00 148.67 ? 227  ILE A CG2 1 
ATOM 1564 C CD1 . ILE A 1 193 ? 20.103 19.292  12.647  1.00 132.71 ? 227  ILE A CD1 1 
ATOM 1565 N N   . ALA A 1 194 ? 22.668 16.648  16.926  1.00 144.04 ? 228  ALA A N   1 
ATOM 1566 C CA  . ALA A 1 194 ? 23.892 16.154  17.552  1.00 146.04 ? 228  ALA A CA  1 
ATOM 1567 C C   . ALA A 1 194 ? 23.643 14.851  18.301  1.00 153.32 ? 228  ALA A C   1 
ATOM 1568 O O   . ALA A 1 194 ? 24.385 13.874  18.131  1.00 162.91 ? 228  ALA A O   1 
ATOM 1569 C CB  . ALA A 1 194 ? 24.466 17.214  18.490  1.00 149.57 ? 228  ALA A CB  1 
ATOM 1570 N N   . THR A 1 195 ? 22.599 14.813  19.136  1.00 149.59 ? 229  THR A N   1 
ATOM 1571 C CA  . THR A 1 195 ? 22.295 13.580  19.859  1.00 160.92 ? 229  THR A CA  1 
ATOM 1572 C C   . THR A 1 195 ? 21.985 12.440  18.895  1.00 164.30 ? 229  THR A C   1 
ATOM 1573 O O   . THR A 1 195 ? 22.449 11.309  19.089  1.00 170.06 ? 229  THR A O   1 
ATOM 1574 C CB  . THR A 1 195 ? 21.133 13.801  20.831  1.00 158.11 ? 229  THR A CB  1 
ATOM 1575 O OG1 . THR A 1 195 ? 19.991 14.294  20.120  1.00 159.27 ? 229  THR A OG1 1 
ATOM 1576 C CG2 . THR A 1 195 ? 21.524 14.800  21.912  1.00 147.83 ? 229  THR A CG2 1 
ATOM 1577 N N   . CYS A 1 196 ? 21.226 12.725  17.832  1.00 159.70 ? 230  CYS A N   1 
ATOM 1578 C CA  . CYS A 1 196 ? 20.920 11.693  16.846  1.00 158.82 ? 230  CYS A CA  1 
ATOM 1579 C C   . CYS A 1 196 ? 22.190 11.163  16.192  1.00 162.16 ? 230  CYS A C   1 
ATOM 1580 O O   . CYS A 1 196 ? 22.363 9.948   16.045  1.00 166.34 ? 230  CYS A O   1 
ATOM 1581 C CB  . CYS A 1 196 ? 19.951 12.235  15.795  1.00 155.69 ? 230  CYS A CB  1 
ATOM 1582 S SG  . CYS A 1 196 ? 18.224 12.275  16.335  1.00 153.67 ? 230  CYS A SG  1 
ATOM 1583 N N   . TYR A 1 197 ? 23.100 12.059  15.803  1.00 160.79 ? 231  TYR A N   1 
ATOM 1584 C CA  . TYR A 1 197 ? 24.355 11.610  15.209  1.00 169.75 ? 231  TYR A CA  1 
ATOM 1585 C C   . TYR A 1 197 ? 25.135 10.732  16.176  1.00 178.27 ? 231  TYR A C   1 
ATOM 1586 O O   . TYR A 1 197 ? 25.658 9.679   15.792  1.00 181.59 ? 231  TYR A O   1 
ATOM 1587 C CB  . TYR A 1 197 ? 25.209 12.801  14.781  1.00 149.71 ? 231  TYR A CB  1 
ATOM 1588 C CG  . TYR A 1 197 ? 26.670 12.442  14.641  1.00 154.07 ? 231  TYR A CG  1 
ATOM 1589 C CD1 . TYR A 1 197 ? 27.130 11.749  13.529  1.00 174.94 ? 231  TYR A CD1 1 
ATOM 1590 C CD2 . TYR A 1 197 ? 27.588 12.777  15.629  1.00 153.97 ? 231  TYR A CD2 1 
ATOM 1591 C CE1 . TYR A 1 197 ? 28.463 11.409  13.401  1.00 162.82 ? 231  TYR A CE1 1 
ATOM 1592 C CE2 . TYR A 1 197 ? 28.921 12.441  15.510  1.00 158.16 ? 231  TYR A CE2 1 
ATOM 1593 C CZ  . TYR A 1 197 ? 29.354 11.758  14.394  1.00 162.62 ? 231  TYR A CZ  1 
ATOM 1594 O OH  . TYR A 1 197 ? 30.683 11.425  14.270  1.00 167.04 ? 231  TYR A OH  1 
ATOM 1595 N N   . PHE A 1 198 ? 25.239 11.158  17.437  1.00 174.05 ? 232  PHE A N   1 
ATOM 1596 C CA  . PHE A 1 198 ? 26.004 10.385  18.411  1.00 177.83 ? 232  PHE A CA  1 
ATOM 1597 C C   . PHE A 1 198 ? 25.415 8.991   18.589  1.00 179.00 ? 232  PHE A C   1 
ATOM 1598 O O   . PHE A 1 198 ? 26.139 7.986   18.548  1.00 191.16 ? 232  PHE A O   1 
ATOM 1599 C CB  . PHE A 1 198 ? 26.059 11.129  19.745  1.00 172.04 ? 232  PHE A CB  1 
ATOM 1600 C CG  . PHE A 1 198 ? 27.205 12.094  19.857  1.00 163.68 ? 232  PHE A CG  1 
ATOM 1601 C CD1 . PHE A 1 198 ? 28.463 11.652  20.232  1.00 168.48 ? 232  PHE A CD1 1 
ATOM 1602 C CD2 . PHE A 1 198 ? 27.024 13.439  19.598  1.00 154.79 ? 232  PHE A CD2 1 
ATOM 1603 C CE1 . PHE A 1 198 ? 29.519 12.533  20.342  1.00 165.78 ? 232  PHE A CE1 1 
ATOM 1604 C CE2 . PHE A 1 198 ? 28.077 14.328  19.705  1.00 150.38 ? 232  PHE A CE2 1 
ATOM 1605 C CZ  . PHE A 1 198 ? 29.325 13.875  20.077  1.00 156.55 ? 232  PHE A CZ  1 
ATOM 1606 N N   . GLY A 1 199 ? 24.094 8.910   18.771  1.00 180.39 ? 233  GLY A N   1 
ATOM 1607 C CA  . GLY A 1 199 ? 23.460 7.611   18.931  1.00 196.53 ? 233  GLY A CA  1 
ATOM 1608 C C   . GLY A 1 199 ? 23.640 6.714   17.721  1.00 207.68 ? 233  GLY A C   1 
ATOM 1609 O O   . GLY A 1 199 ? 23.999 5.540   17.850  1.00 181.87 ? 233  GLY A O   1 
ATOM 1610 N N   . ILE A 1 200 ? 23.400 7.261   16.526  1.00 196.76 ? 234  ILE A N   1 
ATOM 1611 C CA  . ILE A 1 200 ? 23.556 6.480   15.299  1.00 203.46 ? 234  ILE A CA  1 
ATOM 1612 C C   . ILE A 1 200 ? 24.984 5.957   15.178  1.00 211.65 ? 234  ILE A C   1 
ATOM 1613 O O   . ILE A 1 200 ? 25.209 4.779   14.870  1.00 226.15 ? 234  ILE A O   1 
ATOM 1614 C CB  . ILE A 1 200 ? 23.154 7.321   14.073  1.00 197.51 ? 234  ILE A CB  1 
ATOM 1615 C CG1 . ILE A 1 200 ? 21.646 7.568   14.069  1.00 196.97 ? 234  ILE A CG1 1 
ATOM 1616 C CG2 . ILE A 1 200 ? 23.570 6.635   12.781  1.00 199.58 ? 234  ILE A CG2 1 
ATOM 1617 C CD1 . ILE A 1 200 ? 21.193 8.496   12.967  1.00 192.69 ? 234  ILE A CD1 1 
ATOM 1618 N N   . ARG A 1 201 ? 25.972 6.822   15.433  1.00 200.02 ? 235  ARG A N   1 
ATOM 1619 C CA  . ARG A 1 201 ? 27.366 6.388   15.373  1.00 202.08 ? 235  ARG A CA  1 
ATOM 1620 C C   . ARG A 1 201 ? 27.641 5.268   16.366  1.00 209.61 ? 235  ARG A C   1 
ATOM 1621 O O   . ARG A 1 201 ? 28.370 4.317   16.057  1.00 222.38 ? 235  ARG A O   1 
ATOM 1622 C CB  . ARG A 1 201 ? 28.305 7.563   15.640  1.00 199.63 ? 235  ARG A CB  1 
ATOM 1623 C CG  . ARG A 1 201 ? 29.761 7.138   15.762  1.00 206.17 ? 235  ARG A CG  1 
ATOM 1624 C CD  . ARG A 1 201 ? 30.689 8.322   15.944  1.00 207.86 ? 235  ARG A CD  1 
ATOM 1625 N NE  . ARG A 1 201 ? 30.621 8.876   17.292  1.00 209.69 ? 235  ARG A NE  1 
ATOM 1626 C CZ  . ARG A 1 201 ? 31.360 8.445   18.307  1.00 211.26 ? 235  ARG A CZ  1 
ATOM 1627 N NH1 . ARG A 1 201 ? 31.243 9.003   19.504  1.00 207.37 ? 235  ARG A NH1 1 
ATOM 1628 N NH2 . ARG A 1 201 ? 32.218 7.451   18.122  1.00 219.41 ? 235  ARG A NH2 1 
ATOM 1629 N N   . LYS A 1 202 ? 27.069 5.365   17.566  1.00 202.88 ? 236  LYS A N   1 
ATOM 1630 C CA  . LYS A 1 202 ? 27.271 4.328   18.575  1.00 207.61 ? 236  LYS A CA  1 
ATOM 1631 C C   . LYS A 1 202 ? 26.714 2.982   18.108  1.00 210.22 ? 236  LYS A C   1 
ATOM 1632 O O   . LYS A 1 202 ? 27.437 1.973   18.070  1.00 206.80 ? 236  LYS A O   1 
ATOM 1633 C CB  . LYS A 1 202 ? 26.634 4.790   19.888  1.00 203.49 ? 236  LYS A CB  1 
ATOM 1634 C CG  . LYS A 1 202 ? 26.206 3.708   20.852  1.00 211.58 ? 236  LYS A CG  1 
ATOM 1635 C CD  . LYS A 1 202 ? 25.540 4.351   22.062  1.00 210.49 ? 236  LYS A CD  1 
ATOM 1636 C CE  . LYS A 1 202 ? 24.836 3.328   22.934  1.00 223.70 ? 236  LYS A CE  1 
ATOM 1637 N NZ  . LYS A 1 202 ? 24.160 3.980   24.090  1.00 222.75 ? 236  LYS A NZ  1 
ATOM 1638 N N   . HIS A 1 203 ? 25.436 2.958   17.711  1.00 211.24 ? 237  HIS A N   1 
ATOM 1639 C CA  . HIS A 1 203 ? 24.809 1.706   17.288  1.00 218.55 ? 237  HIS A CA  1 
ATOM 1640 C C   . HIS A 1 203 ? 25.538 1.093   16.098  1.00 223.36 ? 237  HIS A C   1 
ATOM 1641 O O   . HIS A 1 203 ? 25.868 -0.103  16.103  1.00 231.11 ? 237  HIS A O   1 
ATOM 1642 C CB  . HIS A 1 203 ? 23.338 1.942   16.945  1.00 200.01 ? 237  HIS A CB  1 
ATOM 1643 C CG  . HIS A 1 203 ? 22.502 2.352   18.116  1.00 200.45 ? 237  HIS A CG  1 
ATOM 1644 N ND1 . HIS A 1 203 ? 22.367 1.572   19.244  1.00 205.83 ? 237  HIS A ND1 1 
ATOM 1645 C CD2 . HIS A 1 203 ? 21.749 3.456   18.331  1.00 200.16 ? 237  HIS A CD2 1 
ATOM 1646 C CE1 . HIS A 1 203 ? 21.572 2.180   20.106  1.00 200.75 ? 237  HIS A CE1 1 
ATOM 1647 N NE2 . HIS A 1 203 ? 21.185 3.326   19.577  1.00 198.53 ? 237  HIS A NE2 1 
ATOM 1648 N N   . LEU A 1 204 ? 25.783 1.898   15.059  1.00 217.21 ? 238  LEU A N   1 
ATOM 1649 C CA  . LEU A 1 204 ? 26.544 1.412   13.913  1.00 225.13 ? 238  LEU A CA  1 
ATOM 1650 C C   . LEU A 1 204 ? 27.873 0.818   14.362  1.00 230.17 ? 238  LEU A C   1 
ATOM 1651 O O   . LEU A 1 204 ? 28.203 -0.324  14.024  1.00 233.87 ? 238  LEU A O   1 
ATOM 1652 C CB  . LEU A 1 204 ? 26.769 2.545   12.909  1.00 221.81 ? 238  LEU A CB  1 
ATOM 1653 C CG  . LEU A 1 204 ? 25.538 3.091   12.182  1.00 217.44 ? 238  LEU A CG  1 
ATOM 1654 C CD1 . LEU A 1 204 ? 25.932 4.200   11.216  1.00 212.46 ? 238  LEU A CD1 1 
ATOM 1655 C CD2 . LEU A 1 204 ? 24.797 1.977   11.457  1.00 224.59 ? 238  LEU A CD2 1 
ATOM 1656 N N   . LEU A 1 205 ? 28.632 1.578   15.159  1.00 235.23 ? 239  LEU A N   1 
ATOM 1657 C CA  . LEU A 1 205 ? 29.932 1.121   15.640  1.00 233.33 ? 239  LEU A CA  1 
ATOM 1658 C C   . LEU A 1 205 ? 29.844 -0.240  16.319  1.00 235.50 ? 239  LEU A C   1 
ATOM 1659 O O   . LEU A 1 205 ? 30.780 -1.046  16.221  1.00 230.40 ? 239  LEU A O   1 
ATOM 1660 C CB  . LEU A 1 205 ? 30.527 2.162   16.595  1.00 217.41 ? 239  LEU A CB  1 
ATOM 1661 C CG  . LEU A 1 205 ? 31.867 1.824   17.254  1.00 224.42 ? 239  LEU A CG  1 
ATOM 1662 C CD1 . LEU A 1 205 ? 32.953 1.603   16.212  1.00 233.74 ? 239  LEU A CD1 1 
ATOM 1663 C CD2 . LEU A 1 205 ? 32.280 2.907   18.240  1.00 210.85 ? 239  LEU A CD2 1 
ATOM 1664 N N   . LYS A 1 206 ? 28.735 -0.525  17.007  1.00 258.27 ? 240  LYS A N   1 
ATOM 1665 C CA  . LYS A 1 206 ? 28.575 -1.864  17.569  1.00 301.10 ? 240  LYS A CA  1 
ATOM 1666 C C   . LYS A 1 206 ? 28.299 -2.902  16.483  1.00 301.98 ? 240  LYS A C   1 
ATOM 1667 O O   . LYS A 1 206 ? 28.891 -3.988  16.488  1.00 345.90 ? 240  LYS A O   1 
ATOM 1668 C CB  . LYS A 1 206 ? 27.459 -1.890  18.616  1.00 227.45 ? 240  LYS A CB  1 
ATOM 1669 C CG  . LYS A 1 206 ? 27.070 -3.318  19.005  1.00 252.38 ? 240  LYS A CG  1 
ATOM 1670 C CD  . LYS A 1 206 ? 26.280 -3.412  20.301  1.00 252.79 ? 240  LYS A CD  1 
ATOM 1671 C CE  . LYS A 1 206 ? 26.077 -4.878  20.681  1.00 241.46 ? 240  LYS A CE  1 
ATOM 1672 N NZ  . LYS A 1 206 ? 25.341 -5.054  21.961  1.00 240.82 ? 240  LYS A NZ  1 
ATOM 1673 N N   . THR A 1 207 ? 27.407 -2.588  15.538  1.00 314.92 ? 241  THR A N   1 
ATOM 1674 C CA  . THR A 1 207 ? 26.817 -3.638  14.705  1.00 323.27 ? 241  THR A CA  1 
ATOM 1675 C C   . THR A 1 207 ? 27.818 -4.235  13.715  1.00 329.13 ? 241  THR A C   1 
ATOM 1676 O O   . THR A 1 207 ? 27.946 -5.461  13.617  1.00 335.42 ? 241  THR A O   1 
ATOM 1677 C CB  . THR A 1 207 ? 25.594 -3.096  13.961  1.00 321.88 ? 241  THR A CB  1 
ATOM 1678 O OG1 . THR A 1 207 ? 25.951 -1.912  13.234  1.00 318.17 ? 241  THR A OG1 1 
ATOM 1679 C CG2 . THR A 1 207 ? 24.475 -2.776  14.939  1.00 317.90 ? 241  THR A CG2 1 
ATOM 1680 N N   . ASN A 1 208 ? 28.538 -3.392  12.977  1.00 322.71 ? 242  ASN A N   1 
ATOM 1681 C CA  . ASN A 1 208 ? 29.226 -3.835  11.765  1.00 374.93 ? 242  ASN A CA  1 
ATOM 1682 C C   . ASN A 1 208 ? 30.741 -3.653  11.827  1.00 248.36 ? 242  ASN A C   1 
ATOM 1683 O O   . ASN A 1 208 ? 31.341 -3.088  10.908  1.00 250.51 ? 242  ASN A O   1 
ATOM 1684 C CB  . ASN A 1 208 ? 28.653 -3.107  10.546  1.00 241.60 ? 242  ASN A CB  1 
ATOM 1685 C CG  . ASN A 1 208 ? 27.246 -3.571  10.198  1.00 241.72 ? 242  ASN A CG  1 
ATOM 1686 O OD1 . ASN A 1 208 ? 26.838 -4.673  10.560  1.00 247.26 ? 242  ASN A OD1 1 
ATOM 1687 N ND2 . ASN A 1 208 ? 26.503 -2.732  9.485   1.00 241.06 ? 242  ASN A ND2 1 
ATOM 1688 N N   . SER A 1 209 ? 31.365 -4.127  12.910  1.00 251.73 ? 243  SER A N   1 
ATOM 1689 C CA  . SER A 1 209 ? 32.758 -3.790  13.198  1.00 252.67 ? 243  SER A CA  1 
ATOM 1690 C C   . SER A 1 209 ? 33.752 -4.349  12.176  1.00 259.13 ? 243  SER A C   1 
ATOM 1691 O O   . SER A 1 209 ? 34.784 -3.713  11.925  1.00 258.09 ? 243  SER A O   1 
ATOM 1692 C CB  . SER A 1 209 ? 33.124 -4.280  14.599  1.00 255.32 ? 243  SER A CB  1 
ATOM 1693 O OG  . SER A 1 209 ? 34.486 -4.022  14.890  1.00 256.75 ? 243  SER A OG  1 
ATOM 1694 N N   . TYR A 1 210 ? 33.489 -5.511  11.580  1.00 266.00 ? 244  TYR A N   1 
ATOM 1695 C CA  . TYR A 1 210 ? 34.524 -6.254  10.859  1.00 284.20 ? 244  TYR A CA  1 
ATOM 1696 C C   . TYR A 1 210 ? 34.313 -6.235  9.342   1.00 282.13 ? 244  TYR A C   1 
ATOM 1697 O O   . TYR A 1 210 ? 33.183 -6.366  8.860   1.00 280.70 ? 244  TYR A O   1 
ATOM 1698 C CB  . TYR A 1 210 ? 34.576 -7.707  11.341  1.00 282.37 ? 244  TYR A CB  1 
ATOM 1699 C CG  . TYR A 1 210 ? 35.928 -8.132  11.875  1.00 287.91 ? 244  TYR A CG  1 
ATOM 1700 C CD1 . TYR A 1 210 ? 36.852 -7.195  12.320  1.00 284.03 ? 244  TYR A CD1 1 
ATOM 1701 C CD2 . TYR A 1 210 ? 36.285 -9.475  11.921  1.00 303.55 ? 244  TYR A CD2 1 
ATOM 1702 C CE1 . TYR A 1 210 ? 38.088 -7.584  12.805  1.00 289.23 ? 244  TYR A CE1 1 
ATOM 1703 C CE2 . TYR A 1 210 ? 37.516 -9.872  12.401  1.00 308.17 ? 244  TYR A CE2 1 
ATOM 1704 C CZ  . TYR A 1 210 ? 38.413 -8.925  12.841  1.00 305.23 ? 244  TYR A CZ  1 
ATOM 1705 O OH  . TYR A 1 210 ? 39.637 -9.335  13.317  1.00 303.89 ? 244  TYR A OH  1 
ATOM 1706 N N   . GLY A 1 211 ? 35.411 -6.069  8.594   1.00 221.29 ? 245  GLY A N   1 
ATOM 1707 C CA  . GLY A 1 211 ? 35.417 -6.324  7.169   1.00 235.32 ? 245  GLY A CA  1 
ATOM 1708 C C   . GLY A 1 211 ? 34.790 -5.238  6.305   1.00 247.77 ? 245  GLY A C   1 
ATOM 1709 O O   . GLY A 1 211 ? 34.865 -4.045  6.602   1.00 246.15 ? 245  GLY A O   1 
ATOM 1710 N N   . LYS A 1 212 ? 34.180 -5.675  5.194   1.00 260.10 ? 246  LYS A N   1 
ATOM 1711 C CA  . LYS A 1 212 ? 33.459 -4.754  4.312   1.00 262.26 ? 246  LYS A CA  1 
ATOM 1712 C C   . LYS A 1 212 ? 32.366 -4.006  5.070   1.00 277.51 ? 246  LYS A C   1 
ATOM 1713 O O   . LYS A 1 212 ? 32.081 -2.837  4.770   1.00 265.39 ? 246  LYS A O   1 
ATOM 1714 C CB  . LYS A 1 212 ? 32.875 -5.530  3.135   1.00 256.01 ? 246  LYS A CB  1 
ATOM 1715 C CG  . LYS A 1 212 ? 33.853 -6.529  2.505   1.00 253.99 ? 246  LYS A CG  1 
ATOM 1716 C CD  . LYS A 1 212 ? 33.163 -7.435  1.496   1.00 249.81 ? 246  LYS A CD  1 
ATOM 1717 C CE  . LYS A 1 212 ? 34.140 -8.420  0.873   1.00 254.56 ? 246  LYS A CE  1 
ATOM 1718 N NZ  . LYS A 1 212 ? 33.462 -9.348  -0.074  1.00 259.78 ? 246  LYS A NZ  1 
ATOM 1719 N N   . ASN A 1 213 ? 31.752 -4.669  6.057   1.00 310.20 ? 247  ASN A N   1 
ATOM 1720 C CA  . ASN A 1 213 ? 30.799 -4.000  6.937   1.00 309.24 ? 247  ASN A CA  1 
ATOM 1721 C C   . ASN A 1 213 ? 31.414 -2.760  7.574   1.00 302.19 ? 247  ASN A C   1 
ATOM 1722 O O   . ASN A 1 213 ? 30.748 -1.727  7.713   1.00 299.30 ? 247  ASN A O   1 
ATOM 1723 C CB  . ASN A 1 213 ? 30.317 -4.966  8.022   1.00 317.08 ? 247  ASN A CB  1 
ATOM 1724 C CG  . ASN A 1 213 ? 29.841 -6.290  7.462   1.00 329.87 ? 247  ASN A CG  1 
ATOM 1725 O OD1 . ASN A 1 213 ? 30.376 -7.346  7.800   1.00 338.92 ? 247  ASN A OD1 1 
ATOM 1726 N ND2 . ASN A 1 213 ? 28.827 -6.242  6.606   1.00 329.46 ? 247  ASN A ND2 1 
ATOM 1727 N N   . ARG A 1 214 ? 32.686 -2.846  7.973   1.00 286.76 ? 248  ARG A N   1 
ATOM 1728 C CA  . ARG A 1 214 ? 33.360 -1.684  8.545   1.00 259.15 ? 248  ARG A CA  1 
ATOM 1729 C C   . ARG A 1 214 ? 33.531 -0.578  7.513   1.00 243.05 ? 248  ARG A C   1 
ATOM 1730 O O   . ARG A 1 214 ? 33.407 0.606   7.843   1.00 244.12 ? 248  ARG A O   1 
ATOM 1731 C CB  . ARG A 1 214 ? 34.716 -2.088  9.124   1.00 258.89 ? 248  ARG A CB  1 
ATOM 1732 C CG  . ARG A 1 214 ? 35.764 -0.990  9.043   1.00 250.13 ? 248  ARG A CG  1 
ATOM 1733 C CD  . ARG A 1 214 ? 36.708 -0.999  10.226  1.00 247.65 ? 248  ARG A CD  1 
ATOM 1734 N NE  . ARG A 1 214 ? 37.651 0.113   10.158  1.00 243.86 ? 248  ARG A NE  1 
ATOM 1735 C CZ  . ARG A 1 214 ? 38.464 0.465   11.148  1.00 242.80 ? 248  ARG A CZ  1 
ATOM 1736 N NH1 . ARG A 1 214 ? 39.290 1.492   10.996  1.00 236.26 ? 248  ARG A NH1 1 
ATOM 1737 N NH2 . ARG A 1 214 ? 38.449 -0.207  12.291  1.00 247.36 ? 248  ARG A NH2 1 
ATOM 1738 N N   . ILE A 1 215 ? 33.816 -0.938  6.260   1.00 230.16 ? 249  ILE A N   1 
ATOM 1739 C CA  . ILE A 1 215 ? 34.012 0.071   5.220   1.00 221.29 ? 249  ILE A CA  1 
ATOM 1740 C C   . ILE A 1 215 ? 32.715 0.835   4.971   1.00 222.71 ? 249  ILE A C   1 
ATOM 1741 O O   . ILE A 1 215 ? 32.662 2.069   5.085   1.00 218.22 ? 249  ILE A O   1 
ATOM 1742 C CB  . ILE A 1 215 ? 34.542 -0.584  3.932   1.00 200.74 ? 249  ILE A CB  1 
ATOM 1743 C CG1 . ILE A 1 215 ? 35.897 -1.238  4.194   1.00 199.15 ? 249  ILE A CG1 1 
ATOM 1744 C CG2 . ILE A 1 215 ? 34.665 0.441   2.820   1.00 190.30 ? 249  ILE A CG2 1 
ATOM 1745 C CD1 . ILE A 1 215 ? 36.476 -1.929  2.987   1.00 203.82 ? 249  ILE A CD1 1 
ATOM 1746 N N   . THR A 1 216 ? 31.644 0.106   4.637   1.00 222.71 ? 250  THR A N   1 
ATOM 1747 C CA  . THR A 1 216 ? 30.362 0.762   4.384   1.00 218.11 ? 250  THR A CA  1 
ATOM 1748 C C   . THR A 1 216 ? 29.878 1.521   5.616   1.00 213.58 ? 250  THR A C   1 
ATOM 1749 O O   . THR A 1 216 ? 29.333 2.629   5.505   1.00 214.82 ? 250  THR A O   1 
ATOM 1750 C CB  . THR A 1 216 ? 29.322 -0.271  3.945   1.00 217.21 ? 250  THR A CB  1 
ATOM 1751 O OG1 . THR A 1 216 ? 29.841 -1.041  2.854   1.00 223.70 ? 250  THR A OG1 1 
ATOM 1752 C CG2 . THR A 1 216 ? 28.038 0.416   3.503   1.00 209.97 ? 250  THR A CG2 1 
ATOM 1753 N N   . ARG A 1 217 ? 30.096 0.947   6.801   1.00 211.20 ? 251  ARG A N   1 
ATOM 1754 C CA  . ARG A 1 217 ? 29.688 1.599   8.041   1.00 203.09 ? 251  ARG A CA  1 
ATOM 1755 C C   . ARG A 1 217 ? 30.424 2.919   8.245   1.00 201.22 ? 251  ARG A C   1 
ATOM 1756 O O   . ARG A 1 217 ? 29.822 3.919   8.655   1.00 191.62 ? 251  ARG A O   1 
ATOM 1757 C CB  . ARG A 1 217 ? 29.932 0.660   9.221   1.00 204.36 ? 251  ARG A CB  1 
ATOM 1758 C CG  . ARG A 1 217 ? 29.677 1.289   10.573  1.00 201.38 ? 251  ARG A CG  1 
ATOM 1759 C CD  . ARG A 1 217 ? 29.981 0.317   11.697  1.00 206.53 ? 251  ARG A CD  1 
ATOM 1760 N NE  . ARG A 1 217 ? 31.404 0.021   11.844  1.00 216.29 ? 251  ARG A NE  1 
ATOM 1761 C CZ  . ARG A 1 217 ? 32.268 0.793   12.497  1.00 218.88 ? 251  ARG A CZ  1 
ATOM 1762 N NH1 . ARG A 1 217 ? 31.863 1.928   13.056  1.00 215.74 ? 251  ARG A NH1 1 
ATOM 1763 N NH2 . ARG A 1 217 ? 33.542 0.436   12.584  1.00 220.13 ? 251  ARG A NH2 1 
ATOM 1764 N N   . ASP A 1 218 ? 31.731 2.939   7.971   1.00 204.68 ? 252  ASP A N   1 
ATOM 1765 C CA  . ASP A 1 218 ? 32.487 4.181   8.077   1.00 199.20 ? 252  ASP A CA  1 
ATOM 1766 C C   . ASP A 1 218 ? 31.997 5.205   7.064   1.00 213.79 ? 252  ASP A C   1 
ATOM 1767 O O   . ASP A 1 218 ? 31.981 6.410   7.345   1.00 207.90 ? 252  ASP A O   1 
ATOM 1768 C CB  . ASP A 1 218 ? 33.979 3.910   7.887   1.00 183.65 ? 252  ASP A CB  1 
ATOM 1769 C CG  . ASP A 1 218 ? 34.576 3.119   9.031   1.00 176.41 ? 252  ASP A CG  1 
ATOM 1770 O OD1 . ASP A 1 218 ? 33.995 3.140   10.136  1.00 163.72 ? 252  ASP A OD1 1 
ATOM 1771 O OD2 . ASP A 1 218 ? 35.627 2.478   8.826   1.00 177.62 ? 252  ASP A OD2 1 
ATOM 1772 N N   . GLN A 1 219 ? 31.591 4.745   5.878   1.00 237.74 ? 253  GLN A N   1 
ATOM 1773 C CA  . GLN A 1 219 ? 31.035 5.664   4.890   1.00 239.22 ? 253  GLN A CA  1 
ATOM 1774 C C   . GLN A 1 219 ? 29.759 6.322   5.410   1.00 229.13 ? 253  GLN A C   1 
ATOM 1775 O O   . GLN A 1 219 ? 29.610 7.551   5.356   1.00 229.02 ? 253  GLN A O   1 
ATOM 1776 C CB  . GLN A 1 219 ? 30.769 4.924   3.579   1.00 250.70 ? 253  GLN A CB  1 
ATOM 1777 C CG  . GLN A 1 219 ? 30.469 5.841   2.407   1.00 258.05 ? 253  GLN A CG  1 
ATOM 1778 C CD  . GLN A 1 219 ? 31.641 6.737   2.056   1.00 264.20 ? 253  GLN A CD  1 
ATOM 1779 O OE1 . GLN A 1 219 ? 32.758 6.264   1.842   1.00 272.91 ? 253  GLN A OE1 1 
ATOM 1780 N NE2 . GLN A 1 219 ? 31.394 8.041   2.003   1.00 260.11 ? 253  GLN A NE2 1 
ATOM 1781 N N   . VAL A 1 220 ? 28.828 5.516   5.930   1.00 203.86 ? 254  VAL A N   1 
ATOM 1782 C CA  . VAL A 1 220 ? 27.578 6.070   6.449   1.00 185.10 ? 254  VAL A CA  1 
ATOM 1783 C C   . VAL A 1 220 ? 27.847 6.993   7.632   1.00 191.43 ? 254  VAL A C   1 
ATOM 1784 O O   . VAL A 1 220 ? 27.201 8.041   7.786   1.00 189.64 ? 254  VAL A O   1 
ATOM 1785 C CB  . VAL A 1 220 ? 26.610 4.934   6.823   1.00 177.23 ? 254  VAL A CB  1 
ATOM 1786 C CG1 . VAL A 1 220 ? 25.366 5.492   7.491   1.00 176.21 ? 254  VAL A CG1 1 
ATOM 1787 C CG2 . VAL A 1 220 ? 26.242 4.135   5.586   1.00 170.79 ? 254  VAL A CG2 1 
ATOM 1788 N N   . LEU A 1 221 ? 28.804 6.620   8.485   1.00 199.29 ? 255  LEU A N   1 
ATOM 1789 C CA  . LEU A 1 221 ? 29.181 7.481   9.599   1.00 201.83 ? 255  LEU A CA  1 
ATOM 1790 C C   . LEU A 1 221 ? 29.675 8.834   9.103   1.00 196.04 ? 255  LEU A C   1 
ATOM 1791 O O   . LEU A 1 221 ? 29.282 9.882   9.632   1.00 193.57 ? 255  LEU A O   1 
ATOM 1792 C CB  . LEU A 1 221 ? 30.251 6.795   10.450  1.00 213.85 ? 255  LEU A CB  1 
ATOM 1793 C CG  . LEU A 1 221 ? 30.865 7.635   11.570  1.00 215.87 ? 255  LEU A CG  1 
ATOM 1794 C CD1 . LEU A 1 221 ? 29.769 8.245   12.417  1.00 215.84 ? 255  LEU A CD1 1 
ATOM 1795 C CD2 . LEU A 1 221 ? 31.802 6.800   12.430  1.00 216.19 ? 255  LEU A CD2 1 
ATOM 1796 N N   . LYS A 1 222 ? 30.530 8.832   8.077   1.00 192.66 ? 256  LYS A N   1 
ATOM 1797 C CA  . LYS A 1 222 ? 30.957 10.094  7.484   1.00 180.10 ? 256  LYS A CA  1 
ATOM 1798 C C   . LYS A 1 222 ? 29.786 10.851  6.872   1.00 176.21 ? 256  LYS A C   1 
ATOM 1799 O O   . LYS A 1 222 ? 29.829 12.083  6.778   1.00 181.64 ? 256  LYS A O   1 
ATOM 1800 C CB  . LYS A 1 222 ? 32.044 9.848   6.437   1.00 173.03 ? 256  LYS A CB  1 
ATOM 1801 C CG  . LYS A 1 222 ? 33.394 9.496   7.042   1.00 173.55 ? 256  LYS A CG  1 
ATOM 1802 C CD  . LYS A 1 222 ? 33.788 10.520  8.099   1.00 171.29 ? 256  LYS A CD  1 
ATOM 1803 C CE  . LYS A 1 222 ? 34.455 9.865   9.300   1.00 174.56 ? 256  LYS A CE  1 
ATOM 1804 N NZ  . LYS A 1 222 ? 34.621 10.819  10.434  1.00 171.31 ? 256  LYS A NZ  1 
ATOM 1805 N N   . MET A 1 223 ? 28.732 10.145  6.457   1.00 173.68 ? 257  MET A N   1 
ATOM 1806 C CA  . MET A 1 223 ? 27.556 10.839  5.939   1.00 174.92 ? 257  MET A CA  1 
ATOM 1807 C C   . MET A 1 223 ? 26.815 11.584  7.045   1.00 167.13 ? 257  MET A C   1 
ATOM 1808 O O   . MET A 1 223 ? 26.490 12.769  6.896   1.00 167.02 ? 257  MET A O   1 
ATOM 1809 C CB  . MET A 1 223 ? 26.627 9.854   5.230   1.00 186.27 ? 257  MET A CB  1 
ATOM 1810 C CG  . MET A 1 223 ? 27.053 9.555   3.806   1.00 194.59 ? 257  MET A CG  1 
ATOM 1811 S SD  . MET A 1 223 ? 27.313 11.076  2.873   1.00 197.21 ? 257  MET A SD  1 
ATOM 1812 C CE  . MET A 1 223 ? 25.687 11.811  2.976   1.00 194.40 ? 257  MET A CE  1 
ATOM 1813 N N   . ALA A 1 224 ? 26.538 10.911  8.166   1.00 171.10 ? 258  ALA A N   1 
ATOM 1814 C CA  . ALA A 1 224 ? 25.853 11.587  9.267   1.00 164.70 ? 258  ALA A CA  1 
ATOM 1815 C C   . ALA A 1 224 ? 26.699 12.732  9.820   1.00 163.58 ? 258  ALA A C   1 
ATOM 1816 O O   . ALA A 1 224 ? 26.205 13.855  10.022  1.00 152.31 ? 258  ALA A O   1 
ATOM 1817 C CB  . ALA A 1 224 ? 25.508 10.585  10.367  1.00 153.33 ? 258  ALA A CB  1 
ATOM 1818 N N   . ALA A 1 225 ? 27.987 12.465  10.064  1.00 176.98 ? 259  ALA A N   1 
ATOM 1819 C CA  . ALA A 1 225 ? 28.888 13.524  10.505  1.00 181.25 ? 259  ALA A CA  1 
ATOM 1820 C C   . ALA A 1 225 ? 28.904 14.677  9.513   1.00 185.67 ? 259  ALA A C   1 
ATOM 1821 O O   . ALA A 1 225 ? 29.007 15.842  9.908   1.00 191.03 ? 259  ALA A O   1 
ATOM 1822 C CB  . ALA A 1 225 ? 30.299 12.972  10.710  1.00 188.32 ? 259  ALA A CB  1 
ATOM 1823 N N   . ALA A 1 226 ? 28.780 14.375  8.220   1.00 175.48 ? 260  ALA A N   1 
ATOM 1824 C CA  . ALA A 1 226 ? 28.753 15.435  7.218   1.00 163.93 ? 260  ALA A CA  1 
ATOM 1825 C C   . ALA A 1 226 ? 27.465 16.251  7.304   1.00 152.05 ? 260  ALA A C   1 
ATOM 1826 O O   . ALA A 1 226 ? 27.478 17.463  7.057   1.00 144.14 ? 260  ALA A O   1 
ATOM 1827 C CB  . ALA A 1 226 ? 28.932 14.842  5.821   1.00 171.76 ? 260  ALA A CB  1 
ATOM 1828 N N   . VAL A 1 227 ? 26.342 15.606  7.638   1.00 146.37 ? 261  VAL A N   1 
ATOM 1829 C CA  . VAL A 1 227 ? 25.095 16.344  7.863   1.00 137.72 ? 261  VAL A CA  1 
ATOM 1830 C C   . VAL A 1 227 ? 25.279 17.356  8.988   1.00 130.89 ? 261  VAL A C   1 
ATOM 1831 O O   . VAL A 1 227 ? 25.031 18.563  8.823   1.00 132.04 ? 261  VAL A O   1 
ATOM 1832 C CB  . VAL A 1 227 ? 23.936 15.377  8.169   1.00 124.85 ? 261  VAL A CB  1 
ATOM 1833 C CG1 . VAL A 1 227 ? 22.774 16.126  8.811   1.00 114.39 ? 261  VAL A CG1 1 
ATOM 1834 C CG2 . VAL A 1 227 ? 23.476 14.667  6.907   1.00 127.39 ? 261  VAL A CG2 1 
ATOM 1835 N N   . VAL A 1 228 ? 25.726 16.871  10.151  1.00 130.42 ? 262  VAL A N   1 
ATOM 1836 C CA  . VAL A 1 228 ? 25.916 17.763  11.294  1.00 133.48 ? 262  VAL A CA  1 
ATOM 1837 C C   . VAL A 1 228 ? 26.902 18.875  10.949  1.00 136.60 ? 262  VAL A C   1 
ATOM 1838 O O   . VAL A 1 228 ? 26.662 20.052  11.251  1.00 139.10 ? 262  VAL A O   1 
ATOM 1839 C CB  . VAL A 1 228 ? 26.373 16.962  12.527  1.00 145.08 ? 262  VAL A CB  1 
ATOM 1840 C CG1 . VAL A 1 228 ? 26.414 17.854  13.755  1.00 140.72 ? 262  VAL A CG1 1 
ATOM 1841 C CG2 . VAL A 1 228 ? 25.456 15.769  12.756  1.00 155.99 ? 262  VAL A CG2 1 
ATOM 1842 N N   . LEU A 1 229 ? 28.010 18.526  10.285  1.00 131.92 ? 263  LEU A N   1 
ATOM 1843 C CA  . LEU A 1 229 ? 29.029 19.521  9.958   1.00 135.16 ? 263  LEU A CA  1 
ATOM 1844 C C   . LEU A 1 229 ? 28.497 20.584  9.006   1.00 139.90 ? 263  LEU A C   1 
ATOM 1845 O O   . LEU A 1 229 ? 28.839 21.763  9.141   1.00 138.98 ? 263  LEU A O   1 
ATOM 1846 C CB  . LEU A 1 229 ? 30.260 18.844  9.355   1.00 126.23 ? 263  LEU A CB  1 
ATOM 1847 C CG  . LEU A 1 229 ? 31.173 18.074  10.313  1.00 127.92 ? 263  LEU A CG  1 
ATOM 1848 C CD1 . LEU A 1 229 ? 32.394 17.507  9.589   1.00 123.25 ? 263  LEU A CD1 1 
ATOM 1849 C CD2 . LEU A 1 229 ? 31.590 18.959  11.476  1.00 129.97 ? 263  LEU A CD2 1 
ATOM 1850 N N   . ALA A 1 230 ? 27.674 20.193  8.030   1.00 146.82 ? 264  ALA A N   1 
ATOM 1851 C CA  . ALA A 1 230 ? 27.096 21.177  7.118   1.00 142.13 ? 264  ALA A CA  1 
ATOM 1852 C C   . ALA A 1 230 ? 26.173 22.132  7.862   1.00 139.46 ? 264  ALA A C   1 
ATOM 1853 O O   . ALA A 1 230 ? 26.294 23.360  7.733   1.00 139.44 ? 264  ALA A O   1 
ATOM 1854 C CB  . ALA A 1 230 ? 26.344 20.475  5.989   1.00 144.85 ? 264  ALA A CB  1 
ATOM 1855 N N   . PHE A 1 231 ? 25.246 21.582  8.654   1.00 139.91 ? 265  PHE A N   1 
ATOM 1856 C CA  . PHE A 1 231 ? 24.349 22.435  9.429   1.00 135.97 ? 265  PHE A CA  1 
ATOM 1857 C C   . PHE A 1 231 ? 25.135 23.416  10.296  1.00 127.69 ? 265  PHE A C   1 
ATOM 1858 O O   . PHE A 1 231 ? 24.859 24.625  10.301  1.00 116.51 ? 265  PHE A O   1 
ATOM 1859 C CB  . PHE A 1 231 ? 23.426 21.568  10.284  1.00 129.72 ? 265  PHE A CB  1 
ATOM 1860 C CG  . PHE A 1 231 ? 22.457 22.351  11.116  1.00 126.79 ? 265  PHE A CG  1 
ATOM 1861 C CD1 . PHE A 1 231 ? 21.324 22.909  10.547  1.00 117.81 ? 265  PHE A CD1 1 
ATOM 1862 C CD2 . PHE A 1 231 ? 22.674 22.523  12.473  1.00 128.92 ? 265  PHE A CD2 1 
ATOM 1863 C CE1 . PHE A 1 231 ? 20.429 23.627  11.314  1.00 113.43 ? 265  PHE A CE1 1 
ATOM 1864 C CE2 . PHE A 1 231 ? 21.782 23.241  13.246  1.00 126.85 ? 265  PHE A CE2 1 
ATOM 1865 C CZ  . PHE A 1 231 ? 20.659 23.793  12.666  1.00 119.44 ? 265  PHE A CZ  1 
ATOM 1866 N N   . ILE A 1 232 ? 26.142 22.914  11.015  1.00 129.37 ? 266  ILE A N   1 
ATOM 1867 C CA  . ILE A 1 232 ? 26.929 23.771  11.900  1.00 129.37 ? 266  ILE A CA  1 
ATOM 1868 C C   . ILE A 1 232 ? 27.670 24.833  11.099  1.00 125.51 ? 266  ILE A C   1 
ATOM 1869 O O   . ILE A 1 232 ? 27.683 26.015  11.463  1.00 121.98 ? 266  ILE A O   1 
ATOM 1870 C CB  . ILE A 1 232 ? 27.901 22.926  12.742  1.00 136.57 ? 266  ILE A CB  1 
ATOM 1871 C CG1 . ILE A 1 232 ? 27.132 22.103  13.772  1.00 138.55 ? 266  ILE A CG1 1 
ATOM 1872 C CG2 . ILE A 1 232 ? 28.941 23.814  13.424  1.00 134.07 ? 266  ILE A CG2 1 
ATOM 1873 C CD1 . ILE A 1 232 ? 28.018 21.243  14.632  1.00 141.89 ? 266  ILE A CD1 1 
ATOM 1874 N N   . ILE A 1 233 ? 28.309 24.425  10.001  1.00 127.11 ? 267  ILE A N   1 
ATOM 1875 C CA  . ILE A 1 233 ? 29.138 25.348  9.231   1.00 129.67 ? 267  ILE A CA  1 
ATOM 1876 C C   . ILE A 1 233 ? 28.296 26.484  8.673   1.00 129.52 ? 267  ILE A C   1 
ATOM 1877 O O   . ILE A 1 233 ? 28.709 27.650  8.693   1.00 130.70 ? 267  ILE A O   1 
ATOM 1878 C CB  . ILE A 1 233 ? 29.888 24.598  8.114   1.00 126.20 ? 267  ILE A CB  1 
ATOM 1879 C CG1 . ILE A 1 233 ? 31.095 23.855  8.682   1.00 133.12 ? 267  ILE A CG1 1 
ATOM 1880 C CG2 . ILE A 1 233 ? 30.345 25.560  7.026   1.00 116.01 ? 267  ILE A CG2 1 
ATOM 1881 C CD1 . ILE A 1 233 ? 31.797 22.981  7.666   1.00 136.42 ? 267  ILE A CD1 1 
ATOM 1882 N N   . CYS A 1 234 ? 27.097 26.177  8.185   1.00 132.79 ? 268  CYS A N   1 
ATOM 1883 C CA  . CYS A 1 234 ? 26.305 27.183  7.497   1.00 130.19 ? 268  CYS A CA  1 
ATOM 1884 C C   . CYS A 1 234 ? 25.234 27.818  8.376   1.00 117.87 ? 268  CYS A C   1 
ATOM 1885 O O   . CYS A 1 234 ? 24.410 28.582  7.866   1.00 110.93 ? 268  CYS A O   1 
ATOM 1886 C CB  . CYS A 1 234 ? 25.660 26.582  6.253   1.00 139.41 ? 268  CYS A CB  1 
ATOM 1887 S SG  . CYS A 1 234 ? 26.733 25.533  5.256   1.00 142.86 ? 268  CYS A SG  1 
ATOM 1888 N N   . TRP A 1 235 ? 25.210 27.519  9.673   1.00 122.77 ? 269  TRP A N   1 
ATOM 1889 C CA  . TRP A 1 235 ? 24.277 28.195  10.566  1.00 126.18 ? 269  TRP A CA  1 
ATOM 1890 C C   . TRP A 1 235 ? 24.908 28.782  11.817  1.00 131.56 ? 269  TRP A C   1 
ATOM 1891 O O   . TRP A 1 235 ? 24.320 29.703  12.401  1.00 122.36 ? 269  TRP A O   1 
ATOM 1892 C CB  . TRP A 1 235 ? 23.140 27.246  10.972  1.00 130.42 ? 269  TRP A CB  1 
ATOM 1893 C CG  . TRP A 1 235 ? 22.008 27.300  10.001  1.00 129.89 ? 269  TRP A CG  1 
ATOM 1894 C CD1 . TRP A 1 235 ? 21.506 26.273  9.255   1.00 131.85 ? 269  TRP A CD1 1 
ATOM 1895 C CD2 . TRP A 1 235 ? 21.251 28.462  9.644   1.00 127.97 ? 269  TRP A CD2 1 
ATOM 1896 N NE1 . TRP A 1 235 ? 20.470 26.722  8.466   1.00 127.54 ? 269  TRP A NE1 1 
ATOM 1897 C CE2 . TRP A 1 235 ? 20.296 28.063  8.688   1.00 125.12 ? 269  TRP A CE2 1 
ATOM 1898 C CE3 . TRP A 1 235 ? 21.282 29.801  10.048  1.00 119.97 ? 269  TRP A CE3 1 
ATOM 1899 C CZ2 . TRP A 1 235 ? 19.384 28.955  8.132   1.00 117.43 ? 269  TRP A CZ2 1 
ATOM 1900 C CZ3 . TRP A 1 235 ? 20.380 30.680  9.494   1.00 113.66 ? 269  TRP A CZ3 1 
ATOM 1901 C CH2 . TRP A 1 235 ? 19.443 30.256  8.549   1.00 114.32 ? 269  TRP A CH2 1 
ATOM 1902 N N   . LEU A 1 236 ? 26.072 28.298  12.243  1.00 133.94 ? 270  LEU A N   1 
ATOM 1903 C CA  . LEU A 1 236 ? 26.747 28.892  13.395  1.00 127.32 ? 270  LEU A CA  1 
ATOM 1904 C C   . LEU A 1 236 ? 27.088 30.363  13.192  1.00 126.34 ? 270  LEU A C   1 
ATOM 1905 O O   . LEU A 1 236 ? 26.838 31.159  14.113  1.00 122.52 ? 270  LEU A O   1 
ATOM 1906 C CB  . LEU A 1 236 ? 28.000 28.079  13.733  1.00 116.13 ? 270  LEU A CB  1 
ATOM 1907 C CG  . LEU A 1 236 ? 28.792 28.555  14.951  1.00 116.84 ? 270  LEU A CG  1 
ATOM 1908 C CD1 . LEU A 1 236 ? 28.032 28.245  16.232  1.00 118.56 ? 270  LEU A CD1 1 
ATOM 1909 C CD2 . LEU A 1 236 ? 30.186 27.942  14.977  1.00 120.04 ? 270  LEU A CD2 1 
ATOM 1910 N N   . PRO A 1 237 ? 27.657 30.796  12.058  1.00 128.24 ? 271  PRO A N   1 
ATOM 1911 C CA  . PRO A 1 237 ? 27.997 32.226  11.939  1.00 120.88 ? 271  PRO A CA  1 
ATOM 1912 C C   . PRO A 1 237 ? 26.793 33.137  12.061  1.00 119.22 ? 271  PRO A C   1 
ATOM 1913 O O   . PRO A 1 237 ? 26.837 34.131  12.799  1.00 120.46 ? 271  PRO A O   1 
ATOM 1914 C CB  . PRO A 1 237 ? 28.638 32.315  10.549  1.00 114.44 ? 271  PRO A CB  1 
ATOM 1915 C CG  . PRO A 1 237 ? 29.142 30.957  10.282  1.00 113.25 ? 271  PRO A CG  1 
ATOM 1916 C CD  . PRO A 1 237 ? 28.118 30.045  10.876  1.00 122.07 ? 271  PRO A CD  1 
ATOM 1917 N N   . PHE A 1 238 ? 25.710 32.821  11.351  1.00 116.83 ? 272  PHE A N   1 
ATOM 1918 C CA  . PHE A 1 238 ? 24.524 33.665  11.415  1.00 118.53 ? 272  PHE A CA  1 
ATOM 1919 C C   . PHE A 1 238 ? 24.007 33.774  12.840  1.00 117.93 ? 272  PHE A C   1 
ATOM 1920 O O   . PHE A 1 238 ? 23.669 34.866  13.306  1.00 112.08 ? 272  PHE A O   1 
ATOM 1921 C CB  . PHE A 1 238 ? 23.438 33.122  10.492  1.00 118.32 ? 272  PHE A CB  1 
ATOM 1922 C CG  . PHE A 1 238 ? 22.133 33.852  10.605  1.00 114.98 ? 272  PHE A CG  1 
ATOM 1923 C CD1 . PHE A 1 238 ? 21.896 34.991  9.858   1.00 117.53 ? 272  PHE A CD1 1 
ATOM 1924 C CD2 . PHE A 1 238 ? 21.141 33.396  11.457  1.00 112.76 ? 272  PHE A CD2 1 
ATOM 1925 C CE1 . PHE A 1 238 ? 20.695 35.662  9.959   1.00 119.58 ? 272  PHE A CE1 1 
ATOM 1926 C CE2 . PHE A 1 238 ? 19.939 34.063  11.561  1.00 112.48 ? 272  PHE A CE2 1 
ATOM 1927 C CZ  . PHE A 1 238 ? 19.714 35.197  10.811  1.00 116.36 ? 272  PHE A CZ  1 
ATOM 1928 N N   . HIS A 1 239 ? 23.947 32.650  13.553  1.00 122.14 ? 273  HIS A N   1 
ATOM 1929 C CA  . HIS A 1 239 ? 23.350 32.671  14.881  1.00 116.36 ? 273  HIS A CA  1 
ATOM 1930 C C   . HIS A 1 239 ? 24.270 33.289  15.917  1.00 108.51 ? 273  HIS A C   1 
ATOM 1931 O O   . HIS A 1 239 ? 23.788 33.885  16.884  1.00 104.66 ? 273  HIS A O   1 
ATOM 1932 C CB  . HIS A 1 239 ? 22.942 31.263  15.296  1.00 113.53 ? 273  HIS A CB  1 
ATOM 1933 C CG  . HIS A 1 239 ? 21.608 30.864  14.759  1.00 114.17 ? 273  HIS A CG  1 
ATOM 1934 N ND1 . HIS A 1 239 ? 21.457 30.177  13.575  1.00 116.62 ? 273  HIS A ND1 1 
ATOM 1935 C CD2 . HIS A 1 239 ? 20.359 31.102  15.221  1.00 113.27 ? 273  HIS A CD2 1 
ATOM 1936 C CE1 . HIS A 1 239 ? 20.170 29.985  13.344  1.00 119.61 ? 273  HIS A CE1 1 
ATOM 1937 N NE2 . HIS A 1 239 ? 19.483 30.537  14.328  1.00 116.64 ? 273  HIS A NE2 1 
ATOM 1938 N N   . VAL A 1 240 ? 25.583 33.154  15.743  1.00 109.36 ? 274  VAL A N   1 
ATOM 1939 C CA  . VAL A 1 240 ? 26.508 33.902  16.583  1.00 120.42 ? 274  VAL A CA  1 
ATOM 1940 C C   . VAL A 1 240 ? 26.320 35.397  16.362  1.00 124.73 ? 274  VAL A C   1 
ATOM 1941 O O   . VAL A 1 240 ? 26.284 36.185  17.317  1.00 124.43 ? 274  VAL A O   1 
ATOM 1942 C CB  . VAL A 1 240 ? 27.957 33.458  16.311  1.00 114.06 ? 274  VAL A CB  1 
ATOM 1943 C CG1 . VAL A 1 240 ? 28.939 34.468  16.886  1.00 115.23 ? 274  VAL A CG1 1 
ATOM 1944 C CG2 . VAL A 1 240 ? 28.197 32.083  16.905  1.00 104.61 ? 274  VAL A CG2 1 
ATOM 1945 N N   . LEU A 1 241 ? 26.171 35.809  15.100  1.00 130.25 ? 275  LEU A N   1 
ATOM 1946 C CA  . LEU A 1 241 ? 25.928 37.219  14.816  1.00 126.59 ? 275  LEU A CA  1 
ATOM 1947 C C   . LEU A 1 241 ? 24.619 37.691  15.433  1.00 123.01 ? 275  LEU A C   1 
ATOM 1948 O O   . LEU A 1 241 ? 24.554 38.788  15.996  1.00 129.29 ? 275  LEU A O   1 
ATOM 1949 C CB  . LEU A 1 241 ? 25.930 37.464  13.308  1.00 120.94 ? 275  LEU A CB  1 
ATOM 1950 C CG  . LEU A 1 241 ? 27.292 37.420  12.617  1.00 113.43 ? 275  LEU A CG  1 
ATOM 1951 C CD1 . LEU A 1 241 ? 27.133 37.678  11.133  1.00 114.57 ? 275  LEU A CD1 1 
ATOM 1952 C CD2 . LEU A 1 241 ? 28.238 38.432  13.236  1.00 108.00 ? 275  LEU A CD2 1 
ATOM 1953 N N   . THR A 1 242 ? 23.562 36.882  15.339  1.00 113.26 ? 276  THR A N   1 
ATOM 1954 C CA  . THR A 1 242 ? 22.291 37.284  15.931  1.00 111.17 ? 276  THR A CA  1 
ATOM 1955 C C   . THR A 1 242 ? 22.363 37.302  17.450  1.00 121.91 ? 276  THR A C   1 
ATOM 1956 O O   . THR A 1 242 ? 21.658 38.089  18.090  1.00 129.50 ? 276  THR A O   1 
ATOM 1957 C CB  . THR A 1 242 ? 21.164 36.355  15.487  1.00 101.62 ? 276  THR A CB  1 
ATOM 1958 O OG1 . THR A 1 242 ? 21.462 35.020  15.908  1.00 111.81 ? 276  THR A OG1 1 
ATOM 1959 C CG2 . THR A 1 242 ? 20.996 36.395  13.977  1.00 84.20  ? 276  THR A CG2 1 
ATOM 1960 N N   . PHE A 1 243 ? 23.186 36.438  18.045  1.00 118.01 ? 277  PHE A N   1 
ATOM 1961 C CA  . PHE A 1 243 ? 23.336 36.459  19.494  1.00 121.04 ? 277  PHE A CA  1 
ATOM 1962 C C   . PHE A 1 243 ? 24.066 37.716  19.944  1.00 130.96 ? 277  PHE A C   1 
ATOM 1963 O O   . PHE A 1 243 ? 23.643 38.383  20.895  1.00 134.57 ? 277  PHE A O   1 
ATOM 1964 C CB  . PHE A 1 243 ? 24.074 35.213  19.974  1.00 117.75 ? 277  PHE A CB  1 
ATOM 1965 C CG  . PHE A 1 243 ? 24.363 35.219  21.447  1.00 118.84 ? 277  PHE A CG  1 
ATOM 1966 C CD1 . PHE A 1 243 ? 23.346 35.004  22.364  1.00 115.08 ? 277  PHE A CD1 1 
ATOM 1967 C CD2 . PHE A 1 243 ? 25.646 35.442  21.916  1.00 115.90 ? 277  PHE A CD2 1 
ATOM 1968 C CE1 . PHE A 1 243 ? 23.605 35.012  23.720  1.00 108.92 ? 277  PHE A CE1 1 
ATOM 1969 C CE2 . PHE A 1 243 ? 25.910 35.447  23.271  1.00 112.59 ? 277  PHE A CE2 1 
ATOM 1970 C CZ  . PHE A 1 243 ? 24.889 35.234  24.173  1.00 110.37 ? 277  PHE A CZ  1 
ATOM 1971 N N   . LEU A 1 244 ? 25.167 38.057  19.268  1.00 137.13 ? 278  LEU A N   1 
ATOM 1972 C CA  . LEU A 1 244 ? 25.860 39.301  19.583  1.00 135.96 ? 278  LEU A CA  1 
ATOM 1973 C C   . LEU A 1 244 ? 24.951 40.502  19.359  1.00 128.73 ? 278  LEU A C   1 
ATOM 1974 O O   . LEU A 1 244 ? 24.969 41.461  20.141  1.00 123.89 ? 278  LEU A O   1 
ATOM 1975 C CB  . LEU A 1 244 ? 27.130 39.424  18.743  1.00 137.12 ? 278  LEU A CB  1 
ATOM 1976 C CG  . LEU A 1 244 ? 28.118 38.264  18.862  1.00 140.12 ? 278  LEU A CG  1 
ATOM 1977 C CD1 . LEU A 1 244 ? 29.400 38.579  18.112  1.00 144.59 ? 278  LEU A CD1 1 
ATOM 1978 C CD2 . LEU A 1 244 ? 28.406 37.951  20.320  1.00 141.70 ? 278  LEU A CD2 1 
ATOM 1979 N N   . ASP A 1 245 ? 24.142 40.462  18.298  1.00 125.18 ? 279  ASP A N   1 
ATOM 1980 C CA  . ASP A 1 245 ? 23.162 41.517  18.070  1.00 122.42 ? 279  ASP A CA  1 
ATOM 1981 C C   . ASP A 1 245 ? 22.191 41.611  19.237  1.00 118.08 ? 279  ASP A C   1 
ATOM 1982 O O   . ASP A 1 245 ? 21.880 42.710  19.709  1.00 118.89 ? 279  ASP A O   1 
ATOM 1983 C CB  . ASP A 1 245 ? 22.413 41.265  16.759  1.00 122.35 ? 279  ASP A CB  1 
ATOM 1984 C CG  . ASP A 1 245 ? 21.792 42.529  16.185  1.00 138.63 ? 279  ASP A CG  1 
ATOM 1985 O OD1 . ASP A 1 245 ? 21.499 43.460  16.963  1.00 148.28 ? 279  ASP A OD1 1 
ATOM 1986 O OD2 . ASP A 1 245 ? 21.596 42.594  14.952  1.00 145.28 ? 279  ASP A OD2 1 
ATOM 1987 N N   . ALA A 1 246 ? 21.720 40.463  19.731  1.00 119.00 ? 280  ALA A N   1 
ATOM 1988 C CA  . ALA A 1 246 ? 20.835 40.463  20.891  1.00 119.65 ? 280  ALA A CA  1 
ATOM 1989 C C   . ALA A 1 246 ? 21.517 41.093  22.098  1.00 127.78 ? 280  ALA A C   1 
ATOM 1990 O O   . ALA A 1 246 ? 20.891 41.849  22.850  1.00 129.02 ? 280  ALA A O   1 
ATOM 1991 C CB  . ALA A 1 246 ? 20.387 39.037  21.211  1.00 114.03 ? 280  ALA A CB  1 
ATOM 1992 N N   . LEU A 1 247 ? 22.802 40.791  22.298  1.00 128.69 ? 281  LEU A N   1 
ATOM 1993 C CA  . LEU A 1 247 ? 23.543 41.408  23.392  1.00 132.14 ? 281  LEU A CA  1 
ATOM 1994 C C   . LEU A 1 247 ? 23.616 42.918  23.220  1.00 138.50 ? 281  LEU A C   1 
ATOM 1995 O O   . LEU A 1 247 ? 23.557 43.667  24.203  1.00 143.76 ? 281  LEU A O   1 
ATOM 1996 C CB  . LEU A 1 247 ? 24.948 40.816  23.474  1.00 134.41 ? 281  LEU A CB  1 
ATOM 1997 C CG  . LEU A 1 247 ? 25.045 39.303  23.668  1.00 129.86 ? 281  LEU A CG  1 
ATOM 1998 C CD1 . LEU A 1 247 ? 26.488 38.869  23.521  1.00 135.22 ? 281  LEU A CD1 1 
ATOM 1999 C CD2 . LEU A 1 247 ? 24.487 38.882  25.019  1.00 124.67 ? 281  LEU A CD2 1 
ATOM 2000 N N   . ALA A 1 248 ? 23.755 43.383  21.977  1.00 138.67 ? 282  ALA A N   1 
ATOM 2001 C CA  . ALA A 1 248 ? 23.796 44.818  21.721  1.00 127.30 ? 282  ALA A CA  1 
ATOM 2002 C C   . ALA A 1 248 ? 22.457 45.472  22.042  1.00 125.72 ? 282  ALA A C   1 
ATOM 2003 O O   . ALA A 1 248 ? 22.410 46.512  22.708  1.00 139.41 ? 282  ALA A O   1 
ATOM 2004 C CB  . ALA A 1 248 ? 24.199 45.078  20.271  1.00 97.57  ? 282  ALA A CB  1 
ATOM 2005 N N   . TRP A 1 249 ? 21.353 44.869  21.583  1.00 120.04 ? 283  TRP A N   1 
ATOM 2006 C CA  . TRP A 1 249 ? 20.028 45.390  21.914  1.00 124.32 ? 283  TRP A CA  1 
ATOM 2007 C C   . TRP A 1 249 ? 19.829 45.481  23.422  1.00 138.53 ? 283  TRP A C   1 
ATOM 2008 O O   . TRP A 1 249 ? 19.164 46.399  23.914  1.00 137.04 ? 283  TRP A O   1 
ATOM 2009 C CB  . TRP A 1 249 ? 18.933 44.514  21.300  1.00 128.65 ? 283  TRP A CB  1 
ATOM 2010 C CG  . TRP A 1 249 ? 18.936 44.412  19.802  1.00 130.86 ? 283  TRP A CG  1 
ATOM 2011 C CD1 . TRP A 1 249 ? 19.126 43.281  19.058  1.00 130.45 ? 283  TRP A CD1 1 
ATOM 2012 C CD2 . TRP A 1 249 ? 18.717 45.474  18.866  1.00 126.89 ? 283  TRP A CD2 1 
ATOM 2013 N NE1 . TRP A 1 249 ? 19.051 43.579  17.718  1.00 127.78 ? 283  TRP A NE1 1 
ATOM 2014 C CE2 . TRP A 1 249 ? 18.800 44.918  17.574  1.00 122.91 ? 283  TRP A CE2 1 
ATOM 2015 C CE3 . TRP A 1 249 ? 18.462 46.841  18.995  1.00 131.11 ? 283  TRP A CE3 1 
ATOM 2016 C CZ2 . TRP A 1 249 ? 18.636 45.681  16.420  1.00 113.54 ? 283  TRP A CZ2 1 
ATOM 2017 C CZ3 . TRP A 1 249 ? 18.302 47.595  17.850  1.00 132.40 ? 283  TRP A CZ3 1 
ATOM 2018 C CH2 . TRP A 1 249 ? 18.389 47.013  16.579  1.00 121.13 ? 283  TRP A CH2 1 
ATOM 2019 N N   . MET A 1 250 ? 20.384 44.525  24.173  1.00 157.79 ? 284  MET A N   1 
ATOM 2020 C CA  . MET A 1 250 ? 20.289 44.586  25.627  1.00 172.79 ? 284  MET A CA  1 
ATOM 2021 C C   . MET A 1 250 ? 21.100 45.743  26.192  1.00 172.96 ? 284  MET A C   1 
ATOM 2022 O O   . MET A 1 250 ? 20.732 46.310  27.227  1.00 179.77 ? 284  MET A O   1 
ATOM 2023 C CB  . MET A 1 250 ? 20.754 43.265  26.243  1.00 183.93 ? 284  MET A CB  1 
ATOM 2024 C CG  . MET A 1 250 ? 19.840 42.073  25.977  1.00 186.88 ? 284  MET A CG  1 
ATOM 2025 S SD  . MET A 1 250 ? 18.487 41.909  27.163  1.00 193.67 ? 284  MET A SD  1 
ATOM 2026 C CE  . MET A 1 250 ? 17.234 42.980  26.454  1.00 192.89 ? 284  MET A CE  1 
ATOM 2027 N N   . GLY A 1 251 ? 22.195 46.108  25.531  1.00 195.95 ? 285  GLY A N   1 
ATOM 2028 C CA  . GLY A 1 251 ? 23.085 47.135  26.022  1.00 191.61 ? 285  GLY A CA  1 
ATOM 2029 C C   . GLY A 1 251 ? 24.335 46.618  26.695  1.00 184.84 ? 285  GLY A C   1 
ATOM 2030 O O   . GLY A 1 251 ? 25.144 47.429  27.162  1.00 184.31 ? 285  GLY A O   1 
ATOM 2031 N N   . VAL A 1 252 ? 24.513 45.297  26.768  1.00 184.22 ? 286  VAL A N   1 
ATOM 2032 C CA  . VAL A 1 252 ? 25.730 44.738  27.351  1.00 186.88 ? 286  VAL A CA  1 
ATOM 2033 C C   . VAL A 1 252 ? 26.947 45.185  26.552  1.00 183.85 ? 286  VAL A C   1 
ATOM 2034 O O   . VAL A 1 252 ? 27.936 45.676  27.110  1.00 195.99 ? 286  VAL A O   1 
ATOM 2035 C CB  . VAL A 1 252 ? 25.635 43.203  27.426  1.00 176.91 ? 286  VAL A CB  1 
ATOM 2036 C CG1 . VAL A 1 252 ? 26.883 42.626  28.077  1.00 181.56 ? 286  VAL A CG1 1 
ATOM 2037 C CG2 . VAL A 1 252 ? 24.389 42.784  28.191  1.00 174.22 ? 286  VAL A CG2 1 
ATOM 2038 N N   . ILE A 1 253 ? 26.885 45.036  25.232  1.00 166.50 ? 287  ILE A N   1 
ATOM 2039 C CA  . ILE A 1 253 ? 27.917 45.526  24.329  1.00 165.85 ? 287  ILE A CA  1 
ATOM 2040 C C   . ILE A 1 253 ? 27.359 46.718  23.565  1.00 172.70 ? 287  ILE A C   1 
ATOM 2041 O O   . ILE A 1 253 ? 26.286 46.632  22.954  1.00 170.03 ? 287  ILE A O   1 
ATOM 2042 C CB  . ILE A 1 253 ? 28.406 44.429  23.369  1.00 143.54 ? 287  ILE A CB  1 
ATOM 2043 C CG1 . ILE A 1 253 ? 27.229 43.754  22.662  1.00 140.35 ? 287  ILE A CG1 1 
ATOM 2044 C CG2 . ILE A 1 253 ? 29.217 43.408  24.132  1.00 144.55 ? 287  ILE A CG2 1 
ATOM 2045 C CD1 . ILE A 1 253 ? 27.637 42.786  21.569  1.00 138.91 ? 287  ILE A CD1 1 
ATOM 2046 N N   . ASN A 1 254 ? 28.080 47.834  23.618  1.00 180.74 ? 288  ASN A N   1 
ATOM 2047 C CA  . ASN A 1 254 ? 27.703 49.043  22.904  1.00 184.96 ? 288  ASN A CA  1 
ATOM 2048 C C   . ASN A 1 254 ? 28.811 49.557  21.999  1.00 180.71 ? 288  ASN A C   1 
ATOM 2049 O O   . ASN A 1 254 ? 28.657 50.631  21.406  1.00 181.60 ? 288  ASN A O   1 
ATOM 2050 C CB  . ASN A 1 254 ? 27.289 50.139  23.898  1.00 197.20 ? 288  ASN A CB  1 
ATOM 2051 C CG  . ASN A 1 254 ? 28.322 50.359  24.994  1.00 209.96 ? 288  ASN A CG  1 
ATOM 2052 O OD1 . ASN A 1 254 ? 29.518 50.149  24.793  1.00 217.45 ? 288  ASN A OD1 1 
ATOM 2053 N ND2 . ASN A 1 254 ? 27.858 50.784  26.165  1.00 213.31 ? 288  ASN A ND2 1 
ATOM 2054 N N   . SER A 1 255 ? 29.918 48.823  21.880  1.00 180.80 ? 289  SER A N   1 
ATOM 2055 C CA  . SER A 1 255 ? 31.044 49.259  21.065  1.00 187.16 ? 289  SER A CA  1 
ATOM 2056 C C   . SER A 1 255 ? 30.610 49.496  19.625  1.00 187.51 ? 289  SER A C   1 
ATOM 2057 O O   . SER A 1 255 ? 30.006 48.624  18.994  1.00 185.05 ? 289  SER A O   1 
ATOM 2058 C CB  . SER A 1 255 ? 32.160 48.216  21.116  1.00 186.55 ? 289  SER A CB  1 
ATOM 2059 O OG  . SER A 1 255 ? 33.225 48.563  20.249  1.00 187.86 ? 289  SER A OG  1 
ATOM 2060 N N   . CYS A 1 256 ? 30.918 50.691  19.113  1.00 188.08 ? 290  CYS A N   1 
ATOM 2061 C CA  . CYS A 1 256 ? 30.593 51.024  17.729  1.00 187.44 ? 290  CYS A CA  1 
ATOM 2062 C C   . CYS A 1 256 ? 31.185 50.008  16.761  1.00 187.41 ? 290  CYS A C   1 
ATOM 2063 O O   . CYS A 1 256 ? 30.519 49.584  15.808  1.00 184.95 ? 290  CYS A O   1 
ATOM 2064 C CB  . CYS A 1 256 ? 31.118 52.417  17.390  1.00 191.27 ? 290  CYS A CB  1 
ATOM 2065 S SG  . CYS A 1 256 ? 32.653 52.350  16.430  1.00 198.92 ? 290  CYS A SG  1 
ATOM 2066 N N   . GLU A 1 257 ? 32.443 49.619  16.987  1.00 194.54 ? 291  GLU A N   1 
ATOM 2067 C CA  . GLU A 1 257 ? 33.128 48.715  16.068  1.00 197.55 ? 291  GLU A CA  1 
ATOM 2068 C C   . GLU A 1 257 ? 32.430 47.364  15.998  1.00 190.87 ? 291  GLU A C   1 
ATOM 2069 O O   . GLU A 1 257 ? 32.237 46.811  14.908  1.00 187.91 ? 291  GLU A O   1 
ATOM 2070 C CB  . GLU A 1 257 ? 34.587 48.548  16.499  1.00 206.55 ? 291  GLU A CB  1 
ATOM 2071 C CG  . GLU A 1 257 ? 35.436 47.673  15.582  1.00 210.83 ? 291  GLU A CG  1 
ATOM 2072 C CD  . GLU A 1 257 ? 36.872 47.546  16.067  1.00 220.00 ? 291  GLU A CD  1 
ATOM 2073 O OE1 . GLU A 1 257 ? 37.185 48.096  17.144  1.00 227.31 ? 291  GLU A OE1 1 
ATOM 2074 O OE2 . GLU A 1 257 ? 37.687 46.900  15.374  1.00 221.09 ? 291  GLU A OE2 1 
ATOM 2075 N N   . VAL A 1 258 ? 32.032 46.823  17.151  1.00 187.78 ? 292  VAL A N   1 
ATOM 2076 C CA  . VAL A 1 258 ? 31.414 45.502  17.172  1.00 178.06 ? 292  VAL A CA  1 
ATOM 2077 C C   . VAL A 1 258 ? 30.081 45.520  16.433  1.00 161.40 ? 292  VAL A C   1 
ATOM 2078 O O   . VAL A 1 258 ? 29.800 44.637  15.615  1.00 161.02 ? 292  VAL A O   1 
ATOM 2079 C CB  . VAL A 1 258 ? 31.258 45.010  18.621  1.00 184.10 ? 292  VAL A CB  1 
ATOM 2080 C CG1 . VAL A 1 258 ? 30.622 43.632  18.644  1.00 179.37 ? 292  VAL A CG1 1 
ATOM 2081 C CG2 . VAL A 1 258 ? 32.610 44.986  19.317  1.00 191.88 ? 292  VAL A CG2 1 
ATOM 2082 N N   . ILE A 1 259 ? 29.248 46.529  16.691  1.00 158.39 ? 293  ILE A N   1 
ATOM 2083 C CA  . ILE A 1 259 ? 27.946 46.589  16.033  1.00 145.85 ? 293  ILE A CA  1 
ATOM 2084 C C   . ILE A 1 259 ? 28.114 46.820  14.534  1.00 138.75 ? 293  ILE A C   1 
ATOM 2085 O O   . ILE A 1 259 ? 27.379 46.247  13.717  1.00 124.20 ? 293  ILE A O   1 
ATOM 2086 C CB  . ILE A 1 259 ? 27.070 47.668  16.693  1.00 143.20 ? 293  ILE A CB  1 
ATOM 2087 C CG1 . ILE A 1 259 ? 26.990 47.422  18.199  1.00 126.53 ? 293  ILE A CG1 1 
ATOM 2088 C CG2 . ILE A 1 259 ? 25.674 47.680  16.085  1.00 122.23 ? 293  ILE A CG2 1 
ATOM 2089 C CD1 . ILE A 1 259 ? 26.056 48.360  18.917  1.00 128.95 ? 293  ILE A CD1 1 
ATOM 2090 N N   . ALA A 1 260 ? 29.091 47.647  14.148  1.00 151.67 ? 294  ALA A N   1 
ATOM 2091 C CA  . ALA A 1 260 ? 29.367 47.856  12.730  1.00 150.49 ? 294  ALA A CA  1 
ATOM 2092 C C   . ALA A 1 260 ? 29.787 46.559  12.054  1.00 144.49 ? 294  ALA A C   1 
ATOM 2093 O O   . ALA A 1 260 ? 29.415 46.301  10.903  1.00 144.51 ? 294  ALA A O   1 
ATOM 2094 C CB  . ALA A 1 260 ? 30.448 48.922  12.558  1.00 164.77 ? 294  ALA A CB  1 
ATOM 2095 N N   . VAL A 1 261 ? 30.568 45.733  12.755  1.00 142.20 ? 295  VAL A N   1 
ATOM 2096 C CA  . VAL A 1 261 ? 30.947 44.428  12.220  1.00 139.41 ? 295  VAL A CA  1 
ATOM 2097 C C   . VAL A 1 261 ? 29.726 43.517  12.113  1.00 138.04 ? 295  VAL A C   1 
ATOM 2098 O O   . VAL A 1 261 ? 29.594 42.741  11.157  1.00 136.79 ? 295  VAL A O   1 
ATOM 2099 C CB  . VAL A 1 261 ? 32.057 43.801  13.086  1.00 129.89 ? 295  VAL A CB  1 
ATOM 2100 C CG1 . VAL A 1 261 ? 32.271 42.348  12.712  1.00 118.69 ? 295  VAL A CG1 1 
ATOM 2101 C CG2 . VAL A 1 261 ? 33.360 44.580  12.939  1.00 139.81 ? 295  VAL A CG2 1 
ATOM 2102 N N   . ILE A 1 262 ? 28.812 43.601  13.087  1.00 140.45 ? 296  ILE A N   1 
ATOM 2103 C CA  . ILE A 1 262 ? 27.594 42.790  13.052  1.00 134.02 ? 296  ILE A CA  1 
ATOM 2104 C C   . ILE A 1 262 ? 26.769 43.122  11.816  1.00 130.58 ? 296  ILE A C   1 
ATOM 2105 O O   . ILE A 1 262 ? 26.374 42.232  11.053  1.00 128.48 ? 296  ILE A O   1 
ATOM 2106 C CB  . ILE A 1 262 ? 26.773 42.991  14.340  1.00 135.34 ? 296  ILE A CB  1 
ATOM 2107 C CG1 . ILE A 1 262 ? 27.473 42.349  15.542  1.00 141.67 ? 296  ILE A CG1 1 
ATOM 2108 C CG2 . ILE A 1 262 ? 25.364 42.433  14.172  1.00 126.39 ? 296  ILE A CG2 1 
ATOM 2109 C CD1 . ILE A 1 262 ? 26.767 42.594  16.870  1.00 140.59 ? 296  ILE A CD1 1 
ATOM 2110 N N   . ASP A 1 263 ? 26.493 44.411  11.601  1.00 133.76 ? 297  ASP A N   1 
ATOM 2111 C CA  . ASP A 1 263 ? 25.697 44.796  10.440  1.00 131.66 ? 297  ASP A CA  1 
ATOM 2112 C C   . ASP A 1 263 ? 26.442 44.540  9.136   1.00 120.72 ? 297  ASP A C   1 
ATOM 2113 O O   . ASP A 1 263 ? 25.815 44.222  8.119   1.00 113.56 ? 297  ASP A O   1 
ATOM 2114 C CB  . ASP A 1 263 ? 25.286 46.263  10.548  1.00 150.13 ? 297  ASP A CB  1 
ATOM 2115 C CG  . ASP A 1 263 ? 24.291 46.502  11.666  1.00 161.89 ? 297  ASP A CG  1 
ATOM 2116 O OD1 . ASP A 1 263 ? 23.602 45.535  12.055  1.00 159.79 ? 297  ASP A OD1 1 
ATOM 2117 O OD2 . ASP A 1 263 ? 24.192 47.648  12.154  1.00 168.67 ? 297  ASP A OD2 1 
ATOM 2118 N N   . LEU A 1 264 ? 27.771 44.656  9.148   1.00 125.45 ? 298  LEU A N   1 
ATOM 2119 C CA  . LEU A 1 264 ? 28.547 44.392  7.941   1.00 122.97 ? 298  LEU A CA  1 
ATOM 2120 C C   . LEU A 1 264 ? 28.486 42.921  7.552   1.00 119.58 ? 298  LEU A C   1 
ATOM 2121 O O   . LEU A 1 264 ? 28.346 42.590  6.369   1.00 118.49 ? 298  LEU A O   1 
ATOM 2122 C CB  . LEU A 1 264 ? 29.995 44.838  8.147   1.00 116.80 ? 298  LEU A CB  1 
ATOM 2123 C CG  . LEU A 1 264 ? 31.046 44.320  7.162   1.00 123.36 ? 298  LEU A CG  1 
ATOM 2124 C CD1 . LEU A 1 264 ? 30.803 44.877  5.782   1.00 118.41 ? 298  LEU A CD1 1 
ATOM 2125 C CD2 . LEU A 1 264 ? 32.462 44.647  7.628   1.00 128.87 ? 298  LEU A CD2 1 
ATOM 2126 N N   . ALA A 1 265 ? 28.579 42.023  8.533   1.00 122.98 ? 299  ALA A N   1 
ATOM 2127 C CA  . ALA A 1 265 ? 28.646 40.594  8.256   1.00 118.12 ? 299  ALA A CA  1 
ATOM 2128 C C   . ALA A 1 265 ? 27.284 39.919  8.179   1.00 111.71 ? 299  ALA A C   1 
ATOM 2129 O O   . ALA A 1 265 ? 27.194 38.807  7.648   1.00 110.32 ? 299  ALA A O   1 
ATOM 2130 C CB  . ALA A 1 265 ? 29.488 39.891  9.326   1.00 120.92 ? 299  ALA A CB  1 
ATOM 2131 N N   . LEU A 1 266 ? 26.229 40.551  8.693   1.00 100.34 ? 300  LEU A N   1 
ATOM 2132 C CA  . LEU A 1 266 ? 24.935 39.874  8.762   1.00 116.99 ? 300  LEU A CA  1 
ATOM 2133 C C   . LEU A 1 266 ? 24.419 39.410  7.403   1.00 120.57 ? 300  LEU A C   1 
ATOM 2134 O O   . LEU A 1 266 ? 24.023 38.236  7.295   1.00 131.07 ? 300  LEU A O   1 
ATOM 2135 C CB  . LEU A 1 266 ? 23.916 40.767  9.476   1.00 110.97 ? 300  LEU A CB  1 
ATOM 2136 C CG  . LEU A 1 266 ? 23.595 40.355  10.916  1.00 107.92 ? 300  LEU A CG  1 
ATOM 2137 C CD1 . LEU A 1 266 ? 22.341 41.051  11.390  1.00 100.58 ? 300  LEU A CD1 1 
ATOM 2138 C CD2 . LEU A 1 266 ? 23.436 38.848  11.030  1.00 112.22 ? 300  LEU A CD2 1 
ATOM 2139 N N   . PRO A 1 267 ? 24.394 40.231  6.343   1.00 122.74 ? 301  PRO A N   1 
ATOM 2140 C CA  . PRO A 1 267 ? 23.871 39.716  5.063   1.00 117.93 ? 301  PRO A CA  1 
ATOM 2141 C C   . PRO A 1 267 ? 24.658 38.532  4.530   1.00 127.62 ? 301  PRO A C   1 
ATOM 2142 O O   . PRO A 1 267 ? 24.075 37.631  3.912   1.00 137.88 ? 301  PRO A O   1 
ATOM 2143 C CB  . PRO A 1 267 ? 23.969 40.931  4.127   1.00 120.08 ? 301  PRO A CB  1 
ATOM 2144 C CG  . PRO A 1 267 ? 24.038 42.107  5.019   1.00 116.61 ? 301  PRO A CG  1 
ATOM 2145 C CD  . PRO A 1 267 ? 24.788 41.648  6.229   1.00 124.21 ? 301  PRO A CD  1 
ATOM 2146 N N   . PHE A 1 268 ? 25.974 38.510  4.761   1.00 120.10 ? 302  PHE A N   1 
ATOM 2147 C CA  . PHE A 1 268 ? 26.784 37.374  4.334   1.00 118.78 ? 302  PHE A CA  1 
ATOM 2148 C C   . PHE A 1 268 ? 26.384 36.102  5.069   1.00 110.03 ? 302  PHE A C   1 
ATOM 2149 O O   . PHE A 1 268 ? 26.322 35.024  4.469   1.00 109.59 ? 302  PHE A O   1 
ATOM 2150 C CB  . PHE A 1 268 ? 28.265 37.673  4.560   1.00 125.14 ? 302  PHE A CB  1 
ATOM 2151 C CG  . PHE A 1 268 ? 28.773 38.863  3.794   1.00 138.70 ? 302  PHE A CG  1 
ATOM 2152 C CD1 . PHE A 1 268 ? 29.272 38.717  2.510   1.00 142.80 ? 302  PHE A CD1 1 
ATOM 2153 C CD2 . PHE A 1 268 ? 28.763 40.126  4.363   1.00 147.18 ? 302  PHE A CD2 1 
ATOM 2154 C CE1 . PHE A 1 268 ? 29.744 39.809  1.806   1.00 145.37 ? 302  PHE A CE1 1 
ATOM 2155 C CE2 . PHE A 1 268 ? 29.235 41.222  3.663   1.00 149.95 ? 302  PHE A CE2 1 
ATOM 2156 C CZ  . PHE A 1 268 ? 29.725 41.062  2.384   1.00 149.87 ? 302  PHE A CZ  1 
ATOM 2157 N N   . ALA A 1 269 ? 26.107 36.210  6.369   1.00 110.74 ? 303  ALA A N   1 
ATOM 2158 C CA  . ALA A 1 269 ? 25.715 35.040  7.149   1.00 111.97 ? 303  ALA A CA  1 
ATOM 2159 C C   . ALA A 1 269 ? 24.324 34.553  6.760   1.00 104.29 ? 303  ALA A C   1 
ATOM 2160 O O   . ALA A 1 269 ? 24.085 33.340  6.673   1.00 109.60 ? 303  ALA A O   1 
ATOM 2161 C CB  . ALA A 1 269 ? 25.774 35.368  8.637   1.00 115.33 ? 303  ALA A CB  1 
ATOM 2162 N N   . ILE A 1 270 ? 23.390 35.482  6.545   1.00 93.73  ? 304  ILE A N   1 
ATOM 2163 C CA  . ILE A 1 270 ? 22.085 35.121  5.993   1.00 107.15 ? 304  ILE A CA  1 
ATOM 2164 C C   . ILE A 1 270 ? 22.271 34.331  4.704   1.00 113.90 ? 304  ILE A C   1 
ATOM 2165 O O   . ILE A 1 270 ? 21.689 33.249  4.511   1.00 118.39 ? 304  ILE A O   1 
ATOM 2166 C CB  . ILE A 1 270 ? 21.238 36.386  5.757   1.00 106.29 ? 304  ILE A CB  1 
ATOM 2167 C CG1 . ILE A 1 270 ? 21.174 37.235  7.021   1.00 102.92 ? 304  ILE A CG1 1 
ATOM 2168 C CG2 . ILE A 1 270 ? 19.832 36.032  5.333   1.00 100.34 ? 304  ILE A CG2 1 
ATOM 2169 C CD1 . ILE A 1 270 ? 20.592 38.598  6.785   1.00 99.83  ? 304  ILE A CD1 1 
ATOM 2170 N N   . LEU A 1 271 ? 23.105 34.861  3.807   1.00 109.41 ? 305  LEU A N   1 
ATOM 2171 C CA  . LEU A 1 271 ? 23.407 34.141  2.578   1.00 115.91 ? 305  LEU A CA  1 
ATOM 2172 C C   . LEU A 1 271 ? 24.019 32.779  2.871   1.00 113.37 ? 305  LEU A C   1 
ATOM 2173 O O   . LEU A 1 271 ? 23.804 31.832  2.112   1.00 109.26 ? 305  LEU A O   1 
ATOM 2174 C CB  . LEU A 1 271 ? 24.340 34.972  1.697   1.00 121.55 ? 305  LEU A CB  1 
ATOM 2175 C CG  . LEU A 1 271 ? 24.677 34.367  0.333   1.00 123.41 ? 305  LEU A CG  1 
ATOM 2176 C CD1 . LEU A 1 271 ? 23.451 34.331  -0.564  1.00 117.15 ? 305  LEU A CD1 1 
ATOM 2177 C CD2 . LEU A 1 271 ? 25.803 35.134  -0.324  1.00 128.08 ? 305  LEU A CD2 1 
ATOM 2178 N N   . LEU A 1 272 ? 24.761 32.655  3.974   1.00 111.79 ? 306  LEU A N   1 
ATOM 2179 C CA  . LEU A 1 272 ? 25.364 31.372  4.318   1.00 106.10 ? 306  LEU A CA  1 
ATOM 2180 C C   . LEU A 1 272 ? 24.305 30.348  4.712   1.00 109.30 ? 306  LEU A C   1 
ATOM 2181 O O   . LEU A 1 272 ? 24.381 29.181  4.305   1.00 107.98 ? 306  LEU A O   1 
ATOM 2182 C CB  . LEU A 1 272 ? 26.382 31.555  5.439   1.00 92.86  ? 306  LEU A CB  1 
ATOM 2183 C CG  . LEU A 1 272 ? 27.265 30.342  5.704   1.00 102.13 ? 306  LEU A CG  1 
ATOM 2184 C CD1 . LEU A 1 272 ? 27.950 29.919  4.423   1.00 101.37 ? 306  LEU A CD1 1 
ATOM 2185 C CD2 . LEU A 1 272 ? 28.291 30.666  6.764   1.00 108.01 ? 306  LEU A CD2 1 
ATOM 2186 N N   . GLY A 1 273 ? 23.311 30.758  5.503   1.00 111.52 ? 307  GLY A N   1 
ATOM 2187 C CA  . GLY A 1 273 ? 22.184 29.872  5.753   1.00 114.33 ? 307  GLY A CA  1 
ATOM 2188 C C   . GLY A 1 273 ? 21.497 29.449  4.469   1.00 117.33 ? 307  GLY A C   1 
ATOM 2189 O O   . GLY A 1 273 ? 21.195 28.263  4.266   1.00 114.73 ? 307  GLY A O   1 
ATOM 2190 N N   . PHE A 1 274 ? 21.269 30.407  3.564   1.00 128.39 ? 308  PHE A N   1 
ATOM 2191 C CA  . PHE A 1 274 ? 20.672 30.049  2.281   1.00 136.87 ? 308  PHE A CA  1 
ATOM 2192 C C   . PHE A 1 274 ? 21.544 29.073  1.500   1.00 144.59 ? 308  PHE A C   1 
ATOM 2193 O O   . PHE A 1 274 ? 21.019 28.219  0.775   1.00 151.92 ? 308  PHE A O   1 
ATOM 2194 C CB  . PHE A 1 274 ? 20.405 31.304  1.457   1.00 144.13 ? 308  PHE A CB  1 
ATOM 2195 C CG  . PHE A 1 274 ? 19.295 32.144  1.997   1.00 145.34 ? 308  PHE A CG  1 
ATOM 2196 C CD1 . PHE A 1 274 ? 18.028 31.612  2.153   1.00 148.21 ? 308  PHE A CD1 1 
ATOM 2197 C CD2 . PHE A 1 274 ? 19.514 33.461  2.346   1.00 142.93 ? 308  PHE A CD2 1 
ATOM 2198 C CE1 . PHE A 1 274 ? 17.004 32.380  2.650   1.00 146.85 ? 308  PHE A CE1 1 
ATOM 2199 C CE2 . PHE A 1 274 ? 18.492 34.232  2.840   1.00 145.30 ? 308  PHE A CE2 1 
ATOM 2200 C CZ  . PHE A 1 274 ? 17.239 33.693  2.997   1.00 144.92 ? 308  PHE A CZ  1 
ATOM 2201 N N   . THR A 1 275 ? 22.872 29.179  1.631   1.00 145.38 ? 309  THR A N   1 
ATOM 2202 C CA  . THR A 1 275 ? 23.759 28.221  0.979   1.00 145.55 ? 309  THR A CA  1 
ATOM 2203 C C   . THR A 1 275 ? 23.681 26.853  1.638   1.00 149.75 ? 309  THR A C   1 
ATOM 2204 O O   . THR A 1 275 ? 23.966 25.842  0.988   1.00 154.09 ? 309  THR A O   1 
ATOM 2205 C CB  . THR A 1 275 ? 25.212 28.705  0.988   1.00 146.74 ? 309  THR A CB  1 
ATOM 2206 O OG1 . THR A 1 275 ? 25.656 28.888  2.337   1.00 151.01 ? 309  THR A OG1 1 
ATOM 2207 C CG2 . THR A 1 275 ? 25.360 30.003  0.222   1.00 148.29 ? 309  THR A CG2 1 
ATOM 2208 N N   . ASN A 1 276 ? 23.337 26.796  2.927   1.00 146.51 ? 310  ASN A N   1 
ATOM 2209 C CA  . ASN A 1 276 ? 23.004 25.507  3.524   1.00 139.39 ? 310  ASN A CA  1 
ATOM 2210 C C   . ASN A 1 276 ? 21.785 24.907  2.841   1.00 121.41 ? 310  ASN A C   1 
ATOM 2211 O O   . ASN A 1 276 ? 21.804 23.747  2.409   1.00 115.57 ? 310  ASN A O   1 
ATOM 2212 C CB  . ASN A 1 276 ? 22.744 25.656  5.021   1.00 147.14 ? 310  ASN A CB  1 
ATOM 2213 C CG  . ASN A 1 276 ? 22.853 24.338  5.765   1.00 155.70 ? 310  ASN A CG  1 
ATOM 2214 O OD1 . ASN A 1 276 ? 23.584 23.436  5.354   1.00 162.45 ? 310  ASN A OD1 1 
ATOM 2215 N ND2 . ASN A 1 276 ? 22.123 24.221  6.866   1.00 157.99 ? 310  ASN A ND2 1 
ATOM 2216 N N   . SER A 1 277 ? 20.713 25.698  2.722   1.00 120.35 ? 311  SER A N   1 
ATOM 2217 C CA  . SER A 1 277 ? 19.530 25.216  2.013   1.00 121.12 ? 311  SER A CA  1 
ATOM 2218 C C   . SER A 1 277 ? 19.859 24.789  0.587   1.00 120.76 ? 311  SER A C   1 
ATOM 2219 O O   . SER A 1 277 ? 19.200 23.902  0.034   1.00 119.40 ? 311  SER A O   1 
ATOM 2220 C CB  . SER A 1 277 ? 18.446 26.290  2.009   1.00 117.70 ? 311  SER A CB  1 
ATOM 2221 O OG  . SER A 1 277 ? 18.142 26.686  3.333   1.00 112.49 ? 311  SER A OG  1 
ATOM 2222 N N   . CYS A 1 278 ? 20.868 25.407  -0.024  1.00 129.62 ? 312  CYS A N   1 
ATOM 2223 C CA  . CYS A 1 278 ? 21.276 25.019  -1.369  1.00 136.70 ? 312  CYS A CA  1 
ATOM 2224 C C   . CYS A 1 278 ? 22.118 23.749  -1.365  1.00 130.93 ? 312  CYS A C   1 
ATOM 2225 O O   . CYS A 1 278 ? 22.080 22.979  -2.332  1.00 135.64 ? 312  CYS A O   1 
ATOM 2226 C CB  . CYS A 1 278 ? 22.038 26.177  -2.020  1.00 148.37 ? 312  CYS A CB  1 
ATOM 2227 S SG  . CYS A 1 278 ? 22.919 25.802  -3.550  1.00 154.94 ? 312  CYS A SG  1 
ATOM 2228 N N   . VAL A 1 279 ? 22.868 23.509  -0.289  1.00 125.92 ? 313  VAL A N   1 
ATOM 2229 C CA  . VAL A 1 279 ? 23.803 22.389  -0.249  1.00 132.34 ? 313  VAL A CA  1 
ATOM 2230 C C   . VAL A 1 279 ? 23.109 21.094  0.161   1.00 125.80 ? 313  VAL A C   1 
ATOM 2231 O O   . VAL A 1 279 ? 23.511 20.013  -0.283  1.00 109.87 ? 313  VAL A O   1 
ATOM 2232 C CB  . VAL A 1 279 ? 24.979 22.733  0.686   1.00 123.42 ? 313  VAL A CB  1 
ATOM 2233 C CG1 . VAL A 1 279 ? 25.475 21.505  1.433   1.00 105.14 ? 313  VAL A CG1 1 
ATOM 2234 C CG2 . VAL A 1 279 ? 26.113 23.370  -0.108  1.00 123.90 ? 313  VAL A CG2 1 
ATOM 2235 N N   . ASN A 1 280 ? 22.060 21.181  0.979   1.00 132.28 ? 314  ASN A N   1 
ATOM 2236 C CA  . ASN A 1 280 ? 21.356 19.989  1.456   1.00 126.16 ? 314  ASN A CA  1 
ATOM 2237 C C   . ASN A 1 280 ? 21.030 18.952  0.383   1.00 138.40 ? 314  ASN A C   1 
ATOM 2238 O O   . ASN A 1 280 ? 21.179 17.751  0.669   1.00 146.41 ? 314  ASN A O   1 
ATOM 2239 C CB  . ASN A 1 280 ? 20.062 20.404  2.169   1.00 124.28 ? 314  ASN A CB  1 
ATOM 2240 C CG  . ASN A 1 280 ? 20.214 20.433  3.670   1.00 136.56 ? 314  ASN A CG  1 
ATOM 2241 O OD1 . ASN A 1 280 ? 19.248 20.664  4.394   1.00 145.21 ? 314  ASN A OD1 1 
ATOM 2242 N ND2 . ASN A 1 280 ? 21.430 20.202  4.150   1.00 136.92 ? 314  ASN A ND2 1 
ATOM 2243 N N   . PRO A 1 281 ? 20.566 19.312  -0.823  1.00 142.55 ? 315  PRO A N   1 
ATOM 2244 C CA  . PRO A 1 281 ? 20.269 18.259  -1.813  1.00 152.76 ? 315  PRO A CA  1 
ATOM 2245 C C   . PRO A 1 281 ? 21.466 17.386  -2.165  1.00 154.28 ? 315  PRO A C   1 
ATOM 2246 O O   . PRO A 1 281 ? 21.309 16.166  -2.297  1.00 160.61 ? 315  PRO A O   1 
ATOM 2247 C CB  . PRO A 1 281 ? 19.763 19.057  -3.020  1.00 150.56 ? 315  PRO A CB  1 
ATOM 2248 C CG  . PRO A 1 281 ? 19.186 20.286  -2.434  1.00 144.39 ? 315  PRO A CG  1 
ATOM 2249 C CD  . PRO A 1 281 ? 20.065 20.628  -1.269  1.00 139.81 ? 315  PRO A CD  1 
ATOM 2250 N N   . PHE A 1 282 ? 22.655 17.974  -2.328  1.00 151.92 ? 316  PHE A N   1 
ATOM 2251 C CA  . PHE A 1 282 ? 23.866 17.173  -2.503  1.00 146.57 ? 316  PHE A CA  1 
ATOM 2252 C C   . PHE A 1 282 ? 24.051 16.193  -1.353  1.00 141.16 ? 316  PHE A C   1 
ATOM 2253 O O   . PHE A 1 282 ? 24.522 15.067  -1.549  1.00 151.81 ? 316  PHE A O   1 
ATOM 2254 C CB  . PHE A 1 282 ? 25.092 18.080  -2.599  1.00 149.61 ? 316  PHE A CB  1 
ATOM 2255 C CG  . PHE A 1 282 ? 25.379 18.582  -3.981  1.00 154.27 ? 316  PHE A CG  1 
ATOM 2256 C CD1 . PHE A 1 282 ? 26.153 17.834  -4.852  1.00 151.97 ? 316  PHE A CD1 1 
ATOM 2257 C CD2 . PHE A 1 282 ? 24.898 19.812  -4.403  1.00 155.15 ? 316  PHE A CD2 1 
ATOM 2258 C CE1 . PHE A 1 282 ? 26.430 18.294  -6.124  1.00 155.77 ? 316  PHE A CE1 1 
ATOM 2259 C CE2 . PHE A 1 282 ? 25.172 20.278  -5.674  1.00 157.75 ? 316  PHE A CE2 1 
ATOM 2260 C CZ  . PHE A 1 282 ? 25.939 19.517  -6.535  1.00 161.42 ? 316  PHE A CZ  1 
ATOM 2261 N N   . LEU A 1 283 ? 23.690 16.612  -0.144  1.00 144.57 ? 317  LEU A N   1 
ATOM 2262 C CA  . LEU A 1 283 ? 23.983 15.834  1.051   1.00 150.20 ? 317  LEU A CA  1 
ATOM 2263 C C   . LEU A 1 283 ? 22.985 14.704  1.275   1.00 147.05 ? 317  LEU A C   1 
ATOM 2264 O O   . LEU A 1 283 ? 23.358 13.659  1.818   1.00 124.65 ? 317  LEU A O   1 
ATOM 2265 C CB  . LEU A 1 283 ? 24.013 16.771  2.258   1.00 138.55 ? 317  LEU A CB  1 
ATOM 2266 C CG  . LEU A 1 283 ? 24.218 16.220  3.663   1.00 140.99 ? 317  LEU A CG  1 
ATOM 2267 C CD1 . LEU A 1 283 ? 25.521 15.447  3.762   1.00 150.58 ? 317  LEU A CD1 1 
ATOM 2268 C CD2 . LEU A 1 283 ? 24.201 17.381  4.633   1.00 109.88 ? 317  LEU A CD2 1 
ATOM 2269 N N   . TYR A 1 284 ? 21.730 14.877  0.864   1.00 163.38 ? 318  TYR A N   1 
ATOM 2270 C CA  . TYR A 1 284 ? 20.682 13.907  1.164   1.00 169.01 ? 318  TYR A CA  1 
ATOM 2271 C C   . TYR A 1 284 ? 20.246 13.078  -0.035  1.00 167.82 ? 318  TYR A C   1 
ATOM 2272 O O   . TYR A 1 284 ? 20.167 11.851  0.065   1.00 170.60 ? 318  TYR A O   1 
ATOM 2273 C CB  . TYR A 1 284 ? 19.465 14.625  1.764   1.00 179.00 ? 318  TYR A CB  1 
ATOM 2274 C CG  . TYR A 1 284 ? 19.624 14.976  3.225   1.00 180.37 ? 318  TYR A CG  1 
ATOM 2275 C CD1 . TYR A 1 284 ? 19.452 14.013  4.207   1.00 183.48 ? 318  TYR A CD1 1 
ATOM 2276 C CD2 . TYR A 1 284 ? 19.942 16.269  3.622   1.00 177.09 ? 318  TYR A CD2 1 
ATOM 2277 C CE1 . TYR A 1 284 ? 19.591 14.322  5.543   1.00 183.01 ? 318  TYR A CE1 1 
ATOM 2278 C CE2 . TYR A 1 284 ? 20.085 16.588  4.959   1.00 176.12 ? 318  TYR A CE2 1 
ATOM 2279 C CZ  . TYR A 1 284 ? 19.907 15.609  5.914   1.00 175.71 ? 318  TYR A CZ  1 
ATOM 2280 O OH  . TYR A 1 284 ? 20.043 15.910  7.248   1.00 170.27 ? 318  TYR A OH  1 
ATOM 2281 N N   . CYS A 1 285 ? 19.952 13.709  -1.173  1.00 214.94 ? 319  CYS A N   1 
ATOM 2282 C CA  . CYS A 1 285 ? 19.376 12.996  -2.311  1.00 224.99 ? 319  CYS A CA  1 
ATOM 2283 C C   . CYS A 1 285 ? 20.430 12.471  -3.278  1.00 208.89 ? 319  CYS A C   1 
ATOM 2284 O O   . CYS A 1 285 ? 20.295 11.356  -3.793  1.00 196.20 ? 319  CYS A O   1 
ATOM 2285 C CB  . CYS A 1 285 ? 18.396 13.906  -3.060  1.00 176.09 ? 319  CYS A CB  1 
ATOM 2286 S SG  . CYS A 1 285 ? 17.565 13.156  -4.491  1.00 175.60 ? 319  CYS A SG  1 
ATOM 2287 N N   . PHE A 1 286 ? 21.481 13.247  -3.536  1.00 180.91 ? 320  PHE A N   1 
ATOM 2288 C CA  . PHE A 1 286 ? 22.477 12.870  -4.532  1.00 211.34 ? 320  PHE A CA  1 
ATOM 2289 C C   . PHE A 1 286 ? 23.454 11.815  -4.028  1.00 213.41 ? 320  PHE A C   1 
ATOM 2290 O O   . PHE A 1 286 ? 24.337 11.399  -4.787  1.00 221.16 ? 320  PHE A O   1 
ATOM 2291 C CB  . PHE A 1 286 ? 23.256 14.105  -5.003  1.00 188.62 ? 320  PHE A CB  1 
ATOM 2292 C CG  . PHE A 1 286 ? 22.437 15.079  -5.815  1.00 192.32 ? 320  PHE A CG  1 
ATOM 2293 C CD1 . PHE A 1 286 ? 21.110 14.818  -6.118  1.00 187.38 ? 320  PHE A CD1 1 
ATOM 2294 C CD2 . PHE A 1 286 ? 23.004 16.253  -6.286  1.00 196.43 ? 320  PHE A CD2 1 
ATOM 2295 C CE1 . PHE A 1 286 ? 20.363 15.711  -6.867  1.00 201.85 ? 320  PHE A CE1 1 
ATOM 2296 C CE2 . PHE A 1 286 ? 22.263 17.146  -7.037  1.00 197.37 ? 320  PHE A CE2 1 
ATOM 2297 C CZ  . PHE A 1 286 ? 20.940 16.875  -7.326  1.00 194.05 ? 320  PHE A CZ  1 
ATOM 2298 N N   . VAL A 1 287 ? 23.316 11.363  -2.782  1.00 201.65 ? 321  VAL A N   1 
ATOM 2299 C CA  . VAL A 1 287 ? 24.266 10.411  -2.217  1.00 206.09 ? 321  VAL A CA  1 
ATOM 2300 C C   . VAL A 1 287 ? 23.907 8.957   -2.520  1.00 207.39 ? 321  VAL A C   1 
ATOM 2301 O O   . VAL A 1 287 ? 24.796 8.091   -2.485  1.00 213.97 ? 321  VAL A O   1 
ATOM 2302 C CB  . VAL A 1 287 ? 24.387 10.626  -0.696  1.00 203.87 ? 321  VAL A CB  1 
ATOM 2303 C CG1 . VAL A 1 287 ? 23.112 10.191  0.015   1.00 197.43 ? 321  VAL A CG1 1 
ATOM 2304 C CG2 . VAL A 1 287 ? 25.604 9.899   -0.136  1.00 205.18 ? 321  VAL A CG2 1 
ATOM 2305 N N   . GLY A 1 288 ? 22.644 8.666   -2.828  1.00 208.23 ? 322  GLY A N   1 
ATOM 2306 C CA  . GLY A 1 288 ? 22.250 7.286   -3.058  1.00 194.30 ? 322  GLY A CA  1 
ATOM 2307 C C   . GLY A 1 288 ? 22.904 6.712   -4.303  1.00 189.31 ? 322  GLY A C   1 
ATOM 2308 O O   . GLY A 1 288 ? 23.081 7.397   -5.312  1.00 192.16 ? 322  GLY A O   1 
ATOM 2309 N N   . ASN A 1 289 ? 23.266 5.429   -4.226  1.00 191.86 ? 323  ASN A N   1 
ATOM 2310 C CA  . ASN A 1 289 ? 23.914 4.775   -5.355  1.00 199.77 ? 323  ASN A CA  1 
ATOM 2311 C C   . ASN A 1 289 ? 22.965 4.589   -6.532  1.00 208.28 ? 323  ASN A C   1 
ATOM 2312 O O   . ASN A 1 289 ? 23.426 4.382   -7.660  1.00 215.11 ? 323  ASN A O   1 
ATOM 2313 C CB  . ASN A 1 289 ? 24.490 3.425   -4.922  1.00 190.48 ? 323  ASN A CB  1 
ATOM 2314 C CG  . ASN A 1 289 ? 25.469 2.863   -5.931  1.00 193.77 ? 323  ASN A CG  1 
ATOM 2315 O OD1 . ASN A 1 289 ? 26.080 3.605   -6.700  1.00 192.84 ? 323  ASN A OD1 1 
ATOM 2316 N ND2 . ASN A 1 289 ? 25.621 1.545   -5.936  1.00 199.34 ? 323  ASN A ND2 1 
ATOM 2317 N N   . ARG A 1 290 ? 21.655 4.653   -6.292  1.00 209.80 ? 324  ARG A N   1 
ATOM 2318 C CA  . ARG A 1 290 ? 20.665 4.642   -7.359  1.00 211.14 ? 324  ARG A CA  1 
ATOM 2319 C C   . ARG A 1 290 ? 20.541 5.987   -8.061  1.00 203.35 ? 324  ARG A C   1 
ATOM 2320 O O   . ARG A 1 290 ? 19.929 6.056   -9.133  1.00 200.49 ? 324  ARG A O   1 
ATOM 2321 C CB  . ARG A 1 290 ? 19.296 4.242   -6.798  1.00 218.26 ? 324  ARG A CB  1 
ATOM 2322 C CG  . ARG A 1 290 ? 19.331 3.103   -5.790  1.00 219.57 ? 324  ARG A CG  1 
ATOM 2323 C CD  . ARG A 1 290 ? 17.977 2.922   -5.113  1.00 219.62 ? 324  ARG A CD  1 
ATOM 2324 N NE  . ARG A 1 290 ? 18.023 1.934   -4.037  1.00 218.48 ? 324  ARG A NE  1 
ATOM 2325 C CZ  . ARG A 1 290 ? 16.987 1.619   -3.265  1.00 210.85 ? 324  ARG A CZ  1 
ATOM 2326 N NH1 . ARG A 1 290 ? 15.815 2.213   -3.447  1.00 211.87 ? 324  ARG A NH1 1 
ATOM 2327 N NH2 . ARG A 1 290 ? 17.121 0.708   -2.309  1.00 199.90 ? 324  ARG A NH2 1 
ATOM 2328 N N   . PHE A 1 291 ? 21.097 7.055   -7.484  1.00 202.38 ? 325  PHE A N   1 
ATOM 2329 C CA  . PHE A 1 291 ? 20.874 8.386   -8.037  1.00 206.31 ? 325  PHE A CA  1 
ATOM 2330 C C   . PHE A 1 291 ? 21.602 8.580   -9.363  1.00 216.40 ? 325  PHE A C   1 
ATOM 2331 O O   . PHE A 1 291 ? 21.034 9.141   -10.307 1.00 223.45 ? 325  PHE A O   1 
ATOM 2332 C CB  . PHE A 1 291 ? 21.301 9.453   -7.031  1.00 194.99 ? 325  PHE A CB  1 
ATOM 2333 C CG  . PHE A 1 291 ? 21.657 10.761  -7.664  1.00 193.56 ? 325  PHE A CG  1 
ATOM 2334 C CD1 . PHE A 1 291 ? 20.675 11.568  -8.217  1.00 190.28 ? 325  PHE A CD1 1 
ATOM 2335 C CD2 . PHE A 1 291 ? 22.975 11.182  -7.716  1.00 197.98 ? 325  PHE A CD2 1 
ATOM 2336 C CE1 . PHE A 1 291 ? 21.002 12.768  -8.809  1.00 191.12 ? 325  PHE A CE1 1 
ATOM 2337 C CE2 . PHE A 1 291 ? 23.307 12.384  -8.304  1.00 202.27 ? 325  PHE A CE2 1 
ATOM 2338 C CZ  . PHE A 1 291 ? 22.320 13.178  -8.851  1.00 197.10 ? 325  PHE A CZ  1 
ATOM 2339 N N   . GLN A 1 292 ? 22.859 8.141   -9.454  1.00 211.92 ? 326  GLN A N   1 
ATOM 2340 C CA  . GLN A 1 292 ? 23.624 8.381   -10.674 1.00 214.12 ? 326  GLN A CA  1 
ATOM 2341 C C   . GLN A 1 292 ? 23.050 7.606   -11.853 1.00 206.03 ? 326  GLN A C   1 
ATOM 2342 O O   . GLN A 1 292 ? 23.034 8.106   -12.986 1.00 205.41 ? 326  GLN A O   1 
ATOM 2343 C CB  . GLN A 1 292 ? 25.091 8.024   -10.450 1.00 225.72 ? 326  GLN A CB  1 
ATOM 2344 C CG  . GLN A 1 292 ? 25.769 8.905   -9.415  1.00 232.93 ? 326  GLN A CG  1 
ATOM 2345 C CD  . GLN A 1 292 ? 27.276 8.788   -9.446  1.00 240.42 ? 326  GLN A CD  1 
ATOM 2346 O OE1 . GLN A 1 292 ? 27.830 7.929   -10.134 1.00 244.52 ? 326  GLN A OE1 1 
ATOM 2347 N NE2 . GLN A 1 292 ? 27.951 9.658   -8.704  1.00 239.09 ? 326  GLN A NE2 1 
ATOM 2348 N N   . GLN A 1 293 ? 22.569 6.387   -11.607 1.00 201.28 ? 327  GLN A N   1 
ATOM 2349 C CA  . GLN A 1 293 ? 21.916 5.626   -12.665 1.00 203.11 ? 327  GLN A CA  1 
ATOM 2350 C C   . GLN A 1 293 ? 20.612 6.290   -13.090 1.00 200.46 ? 327  GLN A C   1 
ATOM 2351 O O   . GLN A 1 293 ? 20.312 6.378   -14.287 1.00 211.44 ? 327  GLN A O   1 
ATOM 2352 C CB  . GLN A 1 293 ? 21.675 4.191   -12.196 1.00 200.16 ? 327  GLN A CB  1 
ATOM 2353 C CG  . GLN A 1 293 ? 21.213 3.234   -13.279 1.00 198.87 ? 327  GLN A CG  1 
ATOM 2354 C CD  . GLN A 1 293 ? 21.304 1.786   -12.835 1.00 196.01 ? 327  GLN A CD  1 
ATOM 2355 O OE1 . GLN A 1 293 ? 21.802 1.491   -11.749 1.00 193.14 ? 327  GLN A OE1 1 
ATOM 2356 N NE2 . GLN A 1 293 ? 20.827 0.875   -13.675 1.00 192.53 ? 327  GLN A NE2 1 
ATOM 2357 N N   . LYS A 1 294 ? 19.831 6.771   -12.119 1.00 189.23 ? 328  LYS A N   1 
ATOM 2358 C CA  . LYS A 1 294 ? 18.614 7.508   -12.440 1.00 188.18 ? 328  LYS A CA  1 
ATOM 2359 C C   . LYS A 1 294 ? 18.932 8.785   -13.209 1.00 202.85 ? 328  LYS A C   1 
ATOM 2360 O O   . LYS A 1 294 ? 18.181 9.181   -14.109 1.00 205.39 ? 328  LYS A O   1 
ATOM 2361 C CB  . LYS A 1 294 ? 17.845 7.823   -11.157 1.00 182.57 ? 328  LYS A CB  1 
ATOM 2362 C CG  . LYS A 1 294 ? 16.489 7.150   -11.048 1.00 178.42 ? 328  LYS A CG  1 
ATOM 2363 C CD  . LYS A 1 294 ? 15.912 7.314   -9.651  1.00 191.82 ? 328  LYS A CD  1 
ATOM 2364 C CE  . LYS A 1 294 ? 14.549 6.655   -9.530  1.00 187.20 ? 328  LYS A CE  1 
ATOM 2365 N NZ  . LYS A 1 294 ? 14.041 6.692   -8.131  1.00 193.05 ? 328  LYS A NZ  1 
ATOM 2366 N N   . LEU A 1 295 ? 20.051 9.438   -12.876 1.00 207.23 ? 329  LEU A N   1 
ATOM 2367 C CA  . LEU A 1 295 ? 20.458 10.637  -13.602 1.00 214.59 ? 329  LEU A CA  1 
ATOM 2368 C C   . LEU A 1 295 ? 20.828 10.311  -15.044 1.00 232.66 ? 329  LEU A C   1 
ATOM 2369 O O   . LEU A 1 295 ? 20.485 11.063  -15.964 1.00 235.89 ? 329  LEU A O   1 
ATOM 2370 C CB  . LEU A 1 295 ? 21.628 11.312  -12.888 1.00 208.99 ? 329  LEU A CB  1 
ATOM 2371 C CG  . LEU A 1 295 ? 22.193 12.571  -13.547 1.00 210.30 ? 329  LEU A CG  1 
ATOM 2372 C CD1 . LEU A 1 295 ? 21.127 13.653  -13.659 1.00 206.55 ? 329  LEU A CD1 1 
ATOM 2373 C CD2 . LEU A 1 295 ? 23.393 13.073  -12.765 1.00 208.90 ? 329  LEU A CD2 1 
ATOM 2374 N N   . ARG A 1 296 ? 21.538 9.199   -15.260 1.00 243.93 ? 330  ARG A N   1 
ATOM 2375 C CA  . ARG A 1 296 ? 21.844 8.783   -16.626 1.00 254.71 ? 330  ARG A CA  1 
ATOM 2376 C C   . ARG A 1 296 ? 20.579 8.402   -17.388 1.00 258.25 ? 330  ARG A C   1 
ATOM 2377 O O   . ARG A 1 296 ? 20.511 8.589   -18.609 1.00 264.53 ? 330  ARG A O   1 
ATOM 2378 C CB  . ARG A 1 296 ? 22.845 7.622   -16.614 1.00 258.26 ? 330  ARG A CB  1 
ATOM 2379 C CG  . ARG A 1 296 ? 22.274 6.252   -16.982 1.00 255.76 ? 330  ARG A CG  1 
ATOM 2380 C CD  . ARG A 1 296 ? 22.461 5.924   -18.462 1.00 258.60 ? 330  ARG A CD  1 
ATOM 2381 N NE  . ARG A 1 296 ? 21.729 4.720   -18.846 1.00 258.36 ? 330  ARG A NE  1 
ATOM 2382 C CZ  . ARG A 1 296 ? 21.710 4.215   -20.075 1.00 261.32 ? 330  ARG A CZ  1 
ATOM 2383 N NH1 . ARG A 1 296 ? 21.015 3.115   -20.331 1.00 256.69 ? 330  ARG A NH1 1 
ATOM 2384 N NH2 . ARG A 1 296 ? 22.388 4.809   -21.048 1.00 267.71 ? 330  ARG A NH2 1 
ATOM 2385 N N   . SER A 1 297 ? 19.574 7.866   -16.692 1.00 251.11 ? 331  SER A N   1 
ATOM 2386 C CA  . SER A 1 297 ? 18.318 7.536   -17.356 1.00 232.08 ? 331  SER A CA  1 
ATOM 2387 C C   . SER A 1 297 ? 17.566 8.794   -17.765 1.00 229.46 ? 331  SER A C   1 
ATOM 2388 O O   . SER A 1 297 ? 17.017 8.862   -18.870 1.00 229.00 ? 331  SER A O   1 
ATOM 2389 C CB  . SER A 1 297 ? 17.449 6.677   -16.439 1.00 224.74 ? 331  SER A CB  1 
ATOM 2390 O OG  . SER A 1 297 ? 17.028 7.418   -15.307 1.00 211.99 ? 331  SER A OG  1 
ATOM 2391 N N   . VAL A 1 298 ? 17.521 9.793   -16.879 1.00 228.77 ? 332  VAL A N   1 
ATOM 2392 C CA  . VAL A 1 298 ? 16.889 11.064  -17.219 1.00 229.69 ? 332  VAL A CA  1 
ATOM 2393 C C   . VAL A 1 298 ? 17.632 11.734  -18.367 1.00 241.42 ? 332  VAL A C   1 
ATOM 2394 O O   . VAL A 1 298 ? 17.018 12.332  -19.258 1.00 213.62 ? 332  VAL A O   1 
ATOM 2395 C CB  . VAL A 1 298 ? 16.815 11.971  -15.975 1.00 201.37 ? 332  VAL A CB  1 
ATOM 2396 C CG1 . VAL A 1 298 ? 16.314 13.352  -16.342 1.00 203.44 ? 332  VAL A CG1 1 
ATOM 2397 C CG2 . VAL A 1 298 ? 15.909 11.348  -14.923 1.00 198.20 ? 332  VAL A CG2 1 
ATOM 2398 N N   . PHE A 1 299 ? 18.963 11.617  -18.383 1.00 245.20 ? 333  PHE A N   1 
ATOM 2399 C CA  . PHE A 1 299 ? 19.750 12.223  -19.452 1.00 254.54 ? 333  PHE A CA  1 
ATOM 2400 C C   . PHE A 1 299 ? 19.471 11.575  -20.804 1.00 253.93 ? 333  PHE A C   1 
ATOM 2401 O O   . PHE A 1 299 ? 19.553 12.246  -21.839 1.00 259.38 ? 333  PHE A O   1 
ATOM 2402 C CB  . PHE A 1 299 ? 21.241 12.136  -19.123 1.00 260.12 ? 333  PHE A CB  1 
ATOM 2403 C CG  . PHE A 1 299 ? 22.126 12.832  -20.121 1.00 270.53 ? 333  PHE A CG  1 
ATOM 2404 C CD1 . PHE A 1 299 ? 22.280 14.209  -20.086 1.00 270.62 ? 333  PHE A CD1 1 
ATOM 2405 C CD2 . PHE A 1 299 ? 22.807 12.111  -21.090 1.00 274.28 ? 333  PHE A CD2 1 
ATOM 2406 C CE1 . PHE A 1 299 ? 23.092 14.854  -21.001 1.00 277.48 ? 333  PHE A CE1 1 
ATOM 2407 C CE2 . PHE A 1 299 ? 23.621 12.751  -22.007 1.00 281.98 ? 333  PHE A CE2 1 
ATOM 2408 C CZ  . PHE A 1 299 ? 23.763 14.124  -21.962 1.00 284.06 ? 333  PHE A CZ  1 
ATOM 2409 N N   . ARG A 1 300 ? 19.146 10.285  -20.821 1.00 257.09 ? 334  ARG A N   1 
ATOM 2410 C CA  . ARG A 1 300 ? 18.865 9.578   -22.063 1.00 257.47 ? 334  ARG A CA  1 
ATOM 2411 C C   . ARG A 1 300 ? 17.380 9.557   -22.413 1.00 252.40 ? 334  ARG A C   1 
ATOM 2412 O O   . ARG A 1 300 ? 17.005 8.936   -23.413 1.00 254.39 ? 334  ARG A O   1 
ATOM 2413 C CB  . ARG A 1 300 ? 19.405 8.141   -21.986 1.00 256.28 ? 334  ARG A CB  1 
ATOM 2414 C CG  . ARG A 1 300 ? 19.705 7.516   -23.345 1.00 261.07 ? 334  ARG A CG  1 
ATOM 2415 C CD  . ARG A 1 300 ? 20.255 6.104   -23.231 1.00 262.75 ? 334  ARG A CD  1 
ATOM 2416 N NE  . ARG A 1 300 ? 20.372 5.468   -24.541 1.00 271.42 ? 334  ARG A NE  1 
ATOM 2417 C CZ  . ARG A 1 300 ? 20.919 4.275   -24.748 1.00 276.69 ? 334  ARG A CZ  1 
ATOM 2418 N NH1 . ARG A 1 300 ? 20.980 3.775   -25.975 1.00 284.33 ? 334  ARG A NH1 1 
ATOM 2419 N NH2 . ARG A 1 300 ? 21.409 3.583   -23.729 1.00 272.38 ? 334  ARG A NH2 1 
ATOM 2420 N N   . VAL A 1 301 ? 16.532 10.208  -21.619 1.00 244.86 ? 335  VAL A N   1 
ATOM 2421 C CA  . VAL A 1 301 ? 15.093 10.265  -21.883 1.00 235.62 ? 335  VAL A CA  1 
ATOM 2422 C C   . VAL A 1 301 ? 14.818 10.848  -23.268 1.00 234.94 ? 335  VAL A C   1 
ATOM 2423 O O   . VAL A 1 301 ? 14.127 10.199  -24.065 1.00 236.29 ? 335  VAL A O   1 
ATOM 2424 C CB  . VAL A 1 301 ? 14.347 11.051  -20.788 1.00 226.59 ? 335  VAL A CB  1 
ATOM 2425 C CG1 . VAL A 1 301 ? 12.970 11.468  -21.283 1.00 225.02 ? 335  VAL A CG1 1 
ATOM 2426 C CG2 . VAL A 1 301 ? 14.212 10.215  -19.524 1.00 223.09 ? 335  VAL A CG2 1 
ATOM 2427 N N   . PRO A 1 302 ? 15.321 12.040  -23.619 1.00 233.53 ? 336  PRO A N   1 
ATOM 2428 C CA  . PRO A 1 302 ? 15.003 12.587  -24.949 1.00 237.16 ? 336  PRO A CA  1 
ATOM 2429 C C   . PRO A 1 302 ? 15.663 11.835  -26.092 1.00 236.13 ? 336  PRO A C   1 
ATOM 2430 O O   . PRO A 1 302 ? 15.142 11.868  -27.214 1.00 239.66 ? 336  PRO A O   1 
ATOM 2431 C CB  . PRO A 1 302 ? 15.514 14.030  -24.863 1.00 236.47 ? 336  PRO A CB  1 
ATOM 2432 C CG  . PRO A 1 302 ? 16.643 13.952  -23.914 1.00 231.85 ? 336  PRO A CG  1 
ATOM 2433 C CD  . PRO A 1 302 ? 16.240 12.933  -22.885 1.00 231.75 ? 336  PRO A CD  1 
ATOM 2434 N N   . ILE A 1 303 ? 16.792 11.165  -25.846 1.00 236.91 ? 337  ILE A N   1 
ATOM 2435 C CA  . ILE A 1 303 ? 17.435 10.377  -26.893 1.00 241.96 ? 337  ILE A CA  1 
ATOM 2436 C C   . ILE A 1 303 ? 16.569 9.178   -27.260 1.00 240.81 ? 337  ILE A C   1 
ATOM 2437 O O   . ILE A 1 303 ? 16.413 8.847   -28.442 1.00 245.32 ? 337  ILE A O   1 
ATOM 2438 C CB  . ILE A 1 303 ? 18.846 9.947   -26.447 1.00 243.00 ? 337  ILE A CB  1 
ATOM 2439 C CG1 . ILE A 1 303 ? 19.662 11.160  -25.989 1.00 244.63 ? 337  ILE A CG1 1 
ATOM 2440 C CG2 . ILE A 1 303 ? 19.573 9.223   -27.575 1.00 248.93 ? 337  ILE A CG2 1 
ATOM 2441 C CD1 . ILE A 1 303 ? 21.059 10.822  -25.492 1.00 245.15 ? 337  ILE A CD1 1 
ATOM 2442 N N   . THR A 1 304 ? 15.995 8.507   -26.256 1.00 240.12 ? 338  THR A N   1 
ATOM 2443 C CA  . THR A 1 304 ? 15.081 7.400   -26.523 1.00 241.09 ? 338  THR A CA  1 
ATOM 2444 C C   . THR A 1 304 ? 13.784 7.887   -27.157 1.00 234.08 ? 338  THR A C   1 
ATOM 2445 O O   . THR A 1 304 ? 13.150 7.146   -27.918 1.00 235.84 ? 338  THR A O   1 
ATOM 2446 C CB  . THR A 1 304 ? 14.781 6.630   -25.232 1.00 236.79 ? 338  THR A CB  1 
ATOM 2447 O OG1 . THR A 1 304 ? 14.267 7.528   -24.240 1.00 232.04 ? 338  THR A OG1 1 
ATOM 2448 C CG2 . THR A 1 304 ? 16.040 5.947   -24.698 1.00 235.36 ? 338  THR A CG2 1 
ATOM 2449 N N   . TRP A 1 305 ? 13.376 9.123   -26.856 1.00 245.48 ? 339  TRP A N   1 
ATOM 2450 C CA  . TRP A 1 305 ? 12.181 9.687   -27.474 1.00 243.97 ? 339  TRP A CA  1 
ATOM 2451 C C   . TRP A 1 305 ? 12.374 9.917   -28.969 1.00 240.44 ? 339  TRP A C   1 
ATOM 2452 O O   . TRP A 1 305 ? 11.403 9.862   -29.733 1.00 242.07 ? 339  TRP A O   1 
ATOM 2453 C CB  . TRP A 1 305 ? 11.798 10.993  -26.771 1.00 230.94 ? 339  TRP A CB  1 
ATOM 2454 C CG  . TRP A 1 305 ? 10.755 11.781  -27.495 1.00 236.05 ? 339  TRP A CG  1 
ATOM 2455 C CD1 . TRP A 1 305 ? 9.417  11.518  -27.549 1.00 234.62 ? 339  TRP A CD1 1 
ATOM 2456 C CD2 . TRP A 1 305 ? 10.963 12.966  -28.274 1.00 238.98 ? 339  TRP A CD2 1 
ATOM 2457 N NE1 . TRP A 1 305 ? 8.780  12.464  -28.315 1.00 237.17 ? 339  TRP A NE1 1 
ATOM 2458 C CE2 . TRP A 1 305 ? 9.707  13.364  -28.771 1.00 237.89 ? 339  TRP A CE2 1 
ATOM 2459 C CE3 . TRP A 1 305 ? 12.091 13.727  -28.599 1.00 241.36 ? 339  TRP A CE3 1 
ATOM 2460 C CZ2 . TRP A 1 305 ? 9.547  14.490  -29.575 1.00 242.05 ? 339  TRP A CZ2 1 
ATOM 2461 C CZ3 . TRP A 1 305 ? 11.929 14.842  -29.396 1.00 245.46 ? 339  TRP A CZ3 1 
ATOM 2462 C CH2 . TRP A 1 305 ? 10.667 15.213  -29.876 1.00 245.75 ? 339  TRP A CH2 1 
ATOM 2463 N N   . LEU A 1 306 ? 13.606 10.165  -29.403 1.00 244.68 ? 340  LEU A N   1 
ATOM 2464 C CA  . LEU A 1 306 ? 13.895 10.380  -30.818 1.00 251.52 ? 340  LEU A CA  1 
ATOM 2465 C C   . LEU A 1 306 ? 13.622 9.118   -31.630 1.00 261.54 ? 340  LEU A C   1 
ATOM 2466 O O   . LEU A 1 306 ? 13.836 8.003   -31.154 1.00 263.50 ? 340  LEU A O   1 
ATOM 2467 C CB  . LEU A 1 306 ? 15.348 10.824  -31.012 1.00 256.33 ? 340  LEU A CB  1 
ATOM 2468 C CG  . LEU A 1 306 ? 15.752 12.186  -30.439 1.00 255.91 ? 340  LEU A CG  1 
ATOM 2469 C CD1 . LEU A 1 306 ? 17.216 12.484  -30.730 1.00 259.23 ? 340  LEU A CD1 1 
ATOM 2470 C CD2 . LEU A 1 306 ? 14.864 13.286  -30.992 1.00 256.13 ? 340  LEU A CD2 1 
ATOM 2471 N N   . ASP B 2 1   ? 15.717 55.070  14.886  1.00 163.32 ? 1    ASP B N   1 
ATOM 2472 C CA  . ASP B 2 1   ? 17.134 54.970  15.215  1.00 168.90 ? 1    ASP B CA  1 
ATOM 2473 C C   . ASP B 2 1   ? 17.777 53.809  14.455  1.00 167.15 ? 1    ASP B C   1 
ATOM 2474 O O   . ASP B 2 1   ? 18.105 53.946  13.276  1.00 174.42 ? 1    ASP B O   1 
ATOM 2475 C CB  . ASP B 2 1   ? 17.318 54.809  16.725  1.00 175.61 ? 1    ASP B CB  1 
ATOM 2476 C CG  . ASP B 2 1   ? 18.613 55.421  17.223  1.00 185.70 ? 1    ASP B CG  1 
ATOM 2477 O OD1 . ASP B 2 1   ? 19.689 54.859  16.931  1.00 189.03 ? 1    ASP B OD1 1 
ATOM 2478 O OD2 . ASP B 2 1   ? 18.555 56.475  17.895  1.00 187.15 ? 1    ASP B OD2 1 
ATOM 2479 N N   . ARG B 2 2   ? 17.953 52.669  15.124  1.00 159.27 ? 2    ARG B N   1 
ATOM 2480 C CA  . ARG B 2 2   ? 18.466 51.455  14.498  1.00 145.19 ? 2    ARG B CA  1 
ATOM 2481 C C   . ARG B 2 2   ? 17.358 50.420  14.390  1.00 130.27 ? 2    ARG B C   1 
ATOM 2482 O O   . ARG B 2 2   ? 16.534 50.286  15.299  1.00 130.47 ? 2    ARG B O   1 
ATOM 2483 C CB  . ARG B 2 2   ? 19.636 50.863  15.287  1.00 135.88 ? 2    ARG B CB  1 
ATOM 2484 C CG  . ARG B 2 2   ? 20.438 49.840  14.498  1.00 130.44 ? 2    ARG B CG  1 
ATOM 2485 C CD  . ARG B 2 2   ? 21.759 49.524  15.171  1.00 134.22 ? 2    ARG B CD  1 
ATOM 2486 N NE  . ARG B 2 2   ? 21.594 48.618  16.301  1.00 143.16 ? 2    ARG B NE  1 
ATOM 2487 C CZ  . ARG B 2 2   ? 21.768 47.302  16.230  1.00 148.61 ? 2    ARG B CZ  1 
ATOM 2488 N NH1 . ARG B 2 2   ? 21.597 46.549  17.308  1.00 146.17 ? 2    ARG B NH1 1 
ATOM 2489 N NH2 . ARG B 2 2   ? 22.116 46.740  15.081  1.00 152.52 ? 2    ARG B NH2 1 
ATOM 2490 N N   . VAL B 2 3   ? 17.340 49.682  13.280  1.00 110.93 ? 3    VAL B N   1 
ATOM 2491 C CA  . VAL B 2 3   ? 16.306 48.687  13.025  1.00 125.31 ? 3    VAL B CA  1 
ATOM 2492 C C   . VAL B 2 3   ? 16.944 47.442  12.418  1.00 126.49 ? 3    VAL B C   1 
ATOM 2493 O O   . VAL B 2 3   ? 18.108 47.442  12.014  1.00 131.91 ? 3    VAL B O   1 
ATOM 2494 C CB  . VAL B 2 3   ? 15.196 49.228  12.100  1.00 118.38 ? 3    VAL B CB  1 
ATOM 2495 C CG1 . VAL B 2 3   ? 14.409 50.337  12.796  1.00 102.79 ? 3    VAL B CG1 1 
ATOM 2496 C CG2 . VAL B 2 3   ? 15.793 49.719  10.794  1.00 105.58 ? 3    VAL B CG2 1 
ATOM 2497 N N   . TYR B 2 4   ? 16.159 46.363  12.369  1.00 115.70 ? 4    TYR B N   1 
ATOM 2498 C CA  . TYR B 2 4   ? 16.588 45.116  11.736  1.00 122.50 ? 4    TYR B CA  1 
ATOM 2499 C C   . TYR B 2 4   ? 16.147 45.188  10.282  1.00 115.51 ? 4    TYR B C   1 
ATOM 2500 O O   . TYR B 2 4   ? 15.004 44.883  9.939   1.00 109.69 ? 4    TYR B O   1 
ATOM 2501 C CB  . TYR B 2 4   ? 16.010 43.902  12.454  1.00 123.50 ? 4    TYR B CB  1 
ATOM 2502 C CG  . TYR B 2 4   ? 16.708 42.594  12.130  1.00 121.79 ? 4    TYR B CG  1 
ATOM 2503 C CD1 . TYR B 2 4   ? 17.798 42.163  12.876  1.00 129.33 ? 4    TYR B CD1 1 
ATOM 2504 C CD2 . TYR B 2 4   ? 16.277 41.790  11.081  1.00 120.18 ? 4    TYR B CD2 1 
ATOM 2505 C CE1 . TYR B 2 4   ? 18.441 40.966  12.587  1.00 136.65 ? 4    TYR B CE1 1 
ATOM 2506 C CE2 . TYR B 2 4   ? 16.913 40.594  10.784  1.00 127.99 ? 4    TYR B CE2 1 
ATOM 2507 C CZ  . TYR B 2 4   ? 17.995 40.188  11.542  1.00 135.22 ? 4    TYR B CZ  1 
ATOM 2508 O OH  . TYR B 2 4   ? 18.640 39.005  11.264  1.00 140.41 ? 4    TYR B OH  1 
ATOM 2509 N N   . ILE B 2 5   ? 17.072 45.613  9.414   1.00 121.78 ? 5    ILE B N   1 
ATOM 2510 C CA  . ILE B 2 5   ? 16.746 45.857  8.015   1.00 124.68 ? 5    ILE B CA  1 
ATOM 2511 C C   . ILE B 2 5   ? 16.909 44.623  7.146   1.00 124.28 ? 5    ILE B C   1 
ATOM 2512 O O   . ILE B 2 5   ? 16.577 44.673  5.954   1.00 125.64 ? 5    ILE B O   1 
ATOM 2513 C CB  . ILE B 2 5   ? 17.620 46.985  7.436   1.00 138.44 ? 5    ILE B CB  1 
ATOM 2514 C CG1 . ILE B 2 5   ? 18.134 47.893  8.550   1.00 144.93 ? 5    ILE B CG1 1 
ATOM 2515 C CG2 . ILE B 2 5   ? 16.828 47.804  6.447   1.00 143.12 ? 5    ILE B CG2 1 
ATOM 2516 C CD1 . ILE B 2 5   ? 18.912 49.085  8.043   1.00 150.54 ? 5    ILE B CD1 1 
ATOM 2517 N N   . HIS B 2 6   ? 17.414 43.505  7.708   1.00 121.55 ? 6    HIS B N   1 
ATOM 2518 C CA  . HIS B 2 6   ? 17.770 42.301  6.975   1.00 122.72 ? 6    HIS B CA  1 
ATOM 2519 C C   . HIS B 2 6   ? 16.559 41.388  6.791   1.00 127.04 ? 6    HIS B C   1 
ATOM 2520 O O   . HIS B 2 6   ? 15.623 41.418  7.595   1.00 133.10 ? 6    HIS B O   1 
ATOM 2521 C CB  . HIS B 2 6   ? 18.883 41.556  7.706   1.00 123.08 ? 6    HIS B CB  1 
ATOM 2522 C CG  . HIS B 2 6   ? 20.116 42.380  7.919   1.00 122.43 ? 6    HIS B CG  1 
ATOM 2523 N ND1 . HIS B 2 6   ? 20.951 42.753  6.887   1.00 120.98 ? 6    HIS B ND1 1 
ATOM 2524 C CD2 . HIS B 2 6   ? 20.649 42.913  9.044   1.00 121.42 ? 6    HIS B CD2 1 
ATOM 2525 C CE1 . HIS B 2 6   ? 21.946 43.477  7.368   1.00 123.47 ? 6    HIS B CE1 1 
ATOM 2526 N NE2 . HIS B 2 6   ? 21.787 43.587  8.674   1.00 125.09 ? 6    HIS B NE2 1 
ATOM 2527 N N   . PRO B 2 7   ? 16.554 40.574  5.730   1.00 131.00 ? 7    PRO B N   1 
ATOM 2528 C CA  . PRO B 2 7   ? 15.362 39.757  5.447   1.00 135.71 ? 7    PRO B CA  1 
ATOM 2529 C C   . PRO B 2 7   ? 15.114 38.640  6.451   1.00 141.94 ? 7    PRO B C   1 
ATOM 2530 O O   . PRO B 2 7   ? 13.948 38.314  6.710   1.00 143.71 ? 7    PRO B O   1 
ATOM 2531 C CB  . PRO B 2 7   ? 15.643 39.204  4.045   1.00 137.80 ? 7    PRO B CB  1 
ATOM 2532 C CG  . PRO B 2 7   ? 17.137 39.239  3.923   1.00 140.54 ? 7    PRO B CG  1 
ATOM 2533 C CD  . PRO B 2 7   ? 17.559 40.472  4.659   1.00 132.32 ? 7    PRO B CD  1 
ATOM 2534 N N   . PHE B 2 8   ? 16.147 38.022  7.012   1.00 144.07 ? 8    PHE B N   1 
ATOM 2535 C CA  . PHE B 2 8   ? 15.907 37.006  8.030   1.00 148.73 ? 8    PHE B CA  1 
ATOM 2536 C C   . PHE B 2 8   ? 16.414 37.493  9.381   1.00 151.01 ? 8    PHE B C   1 
ATOM 2537 O O   . PHE B 2 8   ? 15.629 37.727  10.300  1.00 151.44 ? 8    PHE B O   1 
ATOM 2538 C CB  . PHE B 2 8   ? 16.569 35.678  7.653   1.00 156.25 ? 8    PHE B CB  1 
ATOM 2539 C CG  . PHE B 2 8   ? 16.184 34.531  8.548   1.00 154.54 ? 8    PHE B CG  1 
ATOM 2540 C CD1 . PHE B 2 8   ? 14.981 34.539  9.240   1.00 152.53 ? 8    PHE B CD1 1 
ATOM 2541 C CD2 . PHE B 2 8   ? 17.033 33.451  8.707   1.00 153.73 ? 8    PHE B CD2 1 
ATOM 2542 C CE1 . PHE B 2 8   ? 14.633 33.487  10.065  1.00 152.50 ? 8    PHE B CE1 1 
ATOM 2543 C CE2 . PHE B 2 8   ? 16.692 32.397  9.529   1.00 156.07 ? 8    PHE B CE2 1 
ATOM 2544 C CZ  . PHE B 2 8   ? 15.492 32.413  10.209  1.00 154.40 ? 8    PHE B CZ  1 
ATOM 2545 O OXT . PHE B 2 8   ? 17.613 37.680  9.574   1.00 157.39 ? 8    PHE B OXT 1 
ATOM 2546 N N   . GLU C 3 8   ? 49.084 56.138  27.837  1.00 235.45 ? 1008 GLU C N   1 
ATOM 2547 C CA  . GLU C 3 8   ? 48.066 55.097  27.757  1.00 232.05 ? 1008 GLU C CA  1 
ATOM 2548 C C   . GLU C 3 8   ? 46.851 55.461  28.599  1.00 230.95 ? 1008 GLU C C   1 
ATOM 2549 O O   . GLU C 3 8   ? 45.725 55.078  28.278  1.00 220.05 ? 1008 GLU C O   1 
ATOM 2550 C CB  . GLU C 3 8   ? 48.635 53.751  28.209  1.00 238.48 ? 1008 GLU C CB  1 
ATOM 2551 C CG  . GLU C 3 8   ? 49.719 53.203  27.298  1.00 247.09 ? 1008 GLU C CG  1 
ATOM 2552 C CD  . GLU C 3 8   ? 50.279 51.879  27.783  1.00 255.70 ? 1008 GLU C CD  1 
ATOM 2553 O OE1 . GLU C 3 8   ? 50.022 51.510  28.948  1.00 258.21 ? 1008 GLU C OE1 1 
ATOM 2554 O OE2 . GLU C 3 8   ? 50.977 51.206  26.996  1.00 260.64 ? 1008 GLU C OE2 1 
ATOM 2555 N N   . THR C 3 9   ? 47.092 56.197  29.688  1.00 240.75 ? 1009 THR C N   1 
ATOM 2556 C CA  . THR C 3 9   ? 45.988 56.673  30.516  1.00 238.00 ? 1009 THR C CA  1 
ATOM 2557 C C   . THR C 3 9   ? 45.095 57.628  29.736  1.00 235.48 ? 1009 THR C C   1 
ATOM 2558 O O   . THR C 3 9   ? 43.865 57.586  29.864  1.00 236.31 ? 1009 THR C O   1 
ATOM 2559 C CB  . THR C 3 9   ? 46.523 57.354  31.777  1.00 234.30 ? 1009 THR C CB  1 
ATOM 2560 O OG1 . THR C 3 9   ? 47.320 56.428  32.526  1.00 236.94 ? 1009 THR C OG1 1 
ATOM 2561 C CG2 . THR C 3 9   ? 45.374 57.842  32.647  1.00 230.52 ? 1009 THR C CG2 1 
ATOM 2562 N N   . LEU C 3 10  ? 45.699 58.500  28.925  1.00 229.39 ? 1010 LEU C N   1 
ATOM 2563 C CA  . LEU C 3 10  ? 44.915 59.394  28.080  1.00 227.21 ? 1010 LEU C CA  1 
ATOM 2564 C C   . LEU C 3 10  ? 44.094 58.617  27.059  1.00 239.32 ? 1010 LEU C C   1 
ATOM 2565 O O   . LEU C 3 10  ? 43.001 59.053  26.681  1.00 236.32 ? 1010 LEU C O   1 
ATOM 2566 C CB  . LEU C 3 10  ? 45.837 60.393  27.379  1.00 222.67 ? 1010 LEU C CB  1 
ATOM 2567 C CG  . LEU C 3 10  ? 46.708 61.280  28.275  1.00 213.57 ? 1010 LEU C CG  1 
ATOM 2568 C CD1 . LEU C 3 10  ? 47.708 62.080  27.451  1.00 189.93 ? 1010 LEU C CD1 1 
ATOM 2569 C CD2 . LEU C 3 10  ? 45.846 62.210  29.111  1.00 196.50 ? 1010 LEU C CD2 1 
ATOM 2570 N N   . ASN C 3 11  ? 44.602 57.471  26.599  1.00 267.00 ? 1011 ASN C N   1 
ATOM 2571 C CA  . ASN C 3 11  ? 43.840 56.655  25.659  1.00 270.32 ? 1011 ASN C CA  1 
ATOM 2572 C C   . ASN C 3 11  ? 42.601 56.062  26.319  1.00 270.58 ? 1011 ASN C C   1 
ATOM 2573 O O   . ASN C 3 11  ? 41.535 55.987  25.697  1.00 272.79 ? 1011 ASN C O   1 
ATOM 2574 C CB  . ASN C 3 11  ? 44.722 55.546  25.088  1.00 274.00 ? 1011 ASN C CB  1 
ATOM 2575 C CG  . ASN C 3 11  ? 45.847 56.082  24.232  1.00 277.44 ? 1011 ASN C CG  1 
ATOM 2576 O OD1 . ASN C 3 11  ? 45.730 57.152  23.636  1.00 277.13 ? 1011 ASN C OD1 1 
ATOM 2577 N ND2 . ASN C 3 11  ? 46.948 55.342  24.167  1.00 279.48 ? 1011 ASN C ND2 1 
ATOM 2578 N N   . ASP C 3 12  ? 42.725 55.630  27.576  1.00 266.14 ? 1012 ASP C N   1 
ATOM 2579 C CA  . ASP C 3 12  ? 41.589 55.034  28.272  1.00 237.07 ? 1012 ASP C CA  1 
ATOM 2580 C C   . ASP C 3 12  ? 40.512 56.069  28.567  1.00 220.60 ? 1012 ASP C C   1 
ATOM 2581 O O   . ASP C 3 12  ? 39.318 55.794  28.401  1.00 215.12 ? 1012 ASP C O   1 
ATOM 2582 C CB  . ASP C 3 12  ? 42.058 54.365  29.564  1.00 224.16 ? 1012 ASP C CB  1 
ATOM 2583 C CG  . ASP C 3 12  ? 43.014 53.215  29.311  1.00 210.94 ? 1012 ASP C CG  1 
ATOM 2584 O OD1 . ASP C 3 12  ? 42.980 52.638  28.204  1.00 199.16 ? 1012 ASP C OD1 1 
ATOM 2585 O OD2 . ASP C 3 12  ? 43.796 52.882  30.228  1.00 205.68 ? 1012 ASP C OD2 1 
ATOM 2586 N N   . ASN C 3 13  ? 40.908 57.263  29.014  1.00 225.73 ? 1013 ASN C N   1 
ATOM 2587 C CA  . ASN C 3 13  ? 39.937 58.332  29.219  1.00 227.31 ? 1013 ASN C CA  1 
ATOM 2588 C C   . ASN C 3 13  ? 39.338 58.818  27.904  1.00 238.87 ? 1013 ASN C C   1 
ATOM 2589 O O   . ASN C 3 13  ? 38.230 59.367  27.905  1.00 237.40 ? 1013 ASN C O   1 
ATOM 2590 C CB  . ASN C 3 13  ? 40.581 59.498  29.968  1.00 224.65 ? 1013 ASN C CB  1 
ATOM 2591 C CG  . ASN C 3 13  ? 41.059 59.110  31.360  1.00 221.45 ? 1013 ASN C CG  1 
ATOM 2592 O OD1 . ASN C 3 13  ? 42.137 59.521  31.798  1.00 225.75 ? 1013 ASN C OD1 1 
ATOM 2593 N ND2 . ASN C 3 13  ? 40.260 58.316  32.061  1.00 212.90 ? 1013 ASN C ND2 1 
ATOM 2594 N N   . LEU C 3 14  ? 40.046 58.638  26.784  1.00 254.91 ? 1014 LEU C N   1 
ATOM 2595 C CA  . LEU C 3 14  ? 39.451 58.929  25.484  1.00 250.75 ? 1014 LEU C CA  1 
ATOM 2596 C C   . LEU C 3 14  ? 38.457 57.847  25.079  1.00 243.18 ? 1014 LEU C C   1 
ATOM 2597 O O   . LEU C 3 14  ? 37.514 58.121  24.326  1.00 242.16 ? 1014 LEU C O   1 
ATOM 2598 C CB  . LEU C 3 14  ? 40.543 59.087  24.423  1.00 249.63 ? 1014 LEU C CB  1 
ATOM 2599 C CG  . LEU C 3 14  ? 40.098 59.534  23.027  1.00 244.37 ? 1014 LEU C CG  1 
ATOM 2600 C CD1 . LEU C 3 14  ? 39.510 60.937  23.069  1.00 242.89 ? 1014 LEU C CD1 1 
ATOM 2601 C CD2 . LEU C 3 14  ? 41.250 59.458  22.034  1.00 243.58 ? 1014 LEU C CD2 1 
ATOM 2602 N N   . LYS C 3 15  ? 38.651 56.615  25.559  1.00 244.06 ? 1015 LYS C N   1 
ATOM 2603 C CA  . LYS C 3 15  ? 37.612 55.601  25.421  1.00 229.97 ? 1015 LYS C CA  1 
ATOM 2604 C C   . LYS C 3 15  ? 36.367 55.961  26.219  1.00 235.80 ? 1015 LYS C C   1 
ATOM 2605 O O   . LYS C 3 15  ? 35.250 55.625  25.810  1.00 220.40 ? 1015 LYS C O   1 
ATOM 2606 C CB  . LYS C 3 15  ? 38.128 54.240  25.895  1.00 209.66 ? 1015 LYS C CB  1 
ATOM 2607 C CG  . LYS C 3 15  ? 39.317 53.669  25.136  1.00 203.14 ? 1015 LYS C CG  1 
ATOM 2608 C CD  . LYS C 3 15  ? 39.672 52.298  25.700  1.00 195.68 ? 1015 LYS C CD  1 
ATOM 2609 C CE  . LYS C 3 15  ? 40.856 51.673  24.981  1.00 192.38 ? 1015 LYS C CE  1 
ATOM 2610 N NZ  . LYS C 3 15  ? 41.142 50.305  25.501  1.00 193.82 ? 1015 LYS C NZ  1 
ATOM 2611 N N   . VAL C 3 16  ? 36.544 56.646  27.352  1.00 263.33 ? 1016 VAL C N   1 
ATOM 2612 C CA  . VAL C 3 16  ? 35.435 56.873  28.276  1.00 268.54 ? 1016 VAL C CA  1 
ATOM 2613 C C   . VAL C 3 16  ? 34.328 57.673  27.605  1.00 265.23 ? 1016 VAL C C   1 
ATOM 2614 O O   . VAL C 3 16  ? 33.148 57.332  27.714  1.00 267.12 ? 1016 VAL C O   1 
ATOM 2615 C CB  . VAL C 3 16  ? 35.932 57.566  29.557  1.00 274.75 ? 1016 VAL C CB  1 
ATOM 2616 C CG1 . VAL C 3 16  ? 34.752 57.976  30.434  1.00 278.11 ? 1016 VAL C CG1 1 
ATOM 2617 C CG2 . VAL C 3 16  ? 36.863 56.651  30.328  1.00 280.94 ? 1016 VAL C CG2 1 
ATOM 2618 N N   . ILE C 3 17  ? 34.690 58.746  26.898  1.00 262.60 ? 1017 ILE C N   1 
ATOM 2619 C CA  . ILE C 3 17  ? 33.672 59.629  26.329  1.00 253.17 ? 1017 ILE C CA  1 
ATOM 2620 C C   . ILE C 3 17  ? 32.808 58.885  25.317  1.00 244.42 ? 1017 ILE C C   1 
ATOM 2621 O O   . ILE C 3 17  ? 31.583 59.056  25.281  1.00 242.51 ? 1017 ILE C O   1 
ATOM 2622 C CB  . ILE C 3 17  ? 34.327 60.879  25.715  1.00 235.96 ? 1017 ILE C CB  1 
ATOM 2623 C CG1 . ILE C 3 17  ? 35.604 60.506  24.958  1.00 228.80 ? 1017 ILE C CG1 1 
ATOM 2624 C CG2 . ILE C 3 17  ? 34.613 61.897  26.800  1.00 238.85 ? 1017 ILE C CG2 1 
ATOM 2625 C CD1 . ILE C 3 17  ? 35.548 60.819  23.468  1.00 219.91 ? 1017 ILE C CD1 1 
ATOM 2626 N N   . GLU C 3 18  ? 33.424 58.049  24.479  1.00 236.35 ? 1018 GLU C N   1 
ATOM 2627 C CA  . GLU C 3 18  ? 32.628 57.233  23.569  1.00 222.55 ? 1018 GLU C CA  1 
ATOM 2628 C C   . GLU C 3 18  ? 31.749 56.248  24.330  1.00 219.87 ? 1018 GLU C C   1 
ATOM 2629 O O   . GLU C 3 18  ? 30.638 55.938  23.886  1.00 226.45 ? 1018 GLU C O   1 
ATOM 2630 C CB  . GLU C 3 18  ? 33.535 56.488  22.588  1.00 214.31 ? 1018 GLU C CB  1 
ATOM 2631 C CG  . GLU C 3 18  ? 34.281 57.385  21.615  1.00 210.80 ? 1018 GLU C CG  1 
ATOM 2632 C CD  . GLU C 3 18  ? 35.185 56.602  20.684  1.00 205.76 ? 1018 GLU C CD  1 
ATOM 2633 O OE1 . GLU C 3 18  ? 35.051 55.362  20.632  1.00 202.85 ? 1018 GLU C OE1 1 
ATOM 2634 O OE2 . GLU C 3 18  ? 36.033 57.223  20.007  1.00 206.94 ? 1018 GLU C OE2 1 
ATOM 2635 N N   . LYS C 3 19  ? 32.223 55.756  25.477  1.00 227.77 ? 1019 LYS C N   1 
ATOM 2636 C CA  . LYS C 3 19  ? 31.481 54.810  26.300  1.00 222.09 ? 1019 LYS C CA  1 
ATOM 2637 C C   . LYS C 3 19  ? 30.885 55.465  27.543  1.00 227.06 ? 1019 LYS C C   1 
ATOM 2638 O O   . LYS C 3 19  ? 30.545 54.765  28.504  1.00 225.57 ? 1019 LYS C O   1 
ATOM 2639 C CB  . LYS C 3 19  ? 32.382 53.637  26.703  1.00 198.55 ? 1019 LYS C CB  1 
ATOM 2640 C CG  . LYS C 3 19  ? 33.237 53.067  25.573  1.00 182.30 ? 1019 LYS C CG  1 
ATOM 2641 C CD  . LYS C 3 19  ? 32.407 52.738  24.343  1.00 165.78 ? 1019 LYS C CD  1 
ATOM 2642 C CE  . LYS C 3 19  ? 33.282 52.650  23.102  1.00 155.87 ? 1019 LYS C CE  1 
ATOM 2643 N NZ  . LYS C 3 19  ? 32.472 52.750  21.858  1.00 147.40 ? 1019 LYS C NZ  1 
ATOM 2644 N N   . ALA C 3 20  ? 30.762 56.792  27.544  1.00 229.56 ? 1020 ALA C N   1 
ATOM 2645 C CA  . ALA C 3 20  ? 30.271 57.514  28.711  1.00 234.66 ? 1020 ALA C CA  1 
ATOM 2646 C C   . ALA C 3 20  ? 28.772 57.313  28.880  1.00 234.64 ? 1020 ALA C C   1 
ATOM 2647 O O   . ALA C 3 20  ? 28.008 57.395  27.913  1.00 231.78 ? 1020 ALA C O   1 
ATOM 2648 C CB  . ALA C 3 20  ? 30.593 59.002  28.585  1.00 237.53 ? 1020 ALA C CB  1 
ATOM 2649 N N   . ASP C 3 21  ? 28.353 57.048  30.118  1.00 251.18 ? 1021 ASP C N   1 
ATOM 2650 C CA  . ASP C 3 21  ? 26.935 56.878  30.409  1.00 236.35 ? 1021 ASP C CA  1 
ATOM 2651 C C   . ASP C 3 21  ? 26.225 58.223  30.531  1.00 238.24 ? 1021 ASP C C   1 
ATOM 2652 O O   . ASP C 3 21  ? 25.085 58.369  30.075  1.00 235.23 ? 1021 ASP C O   1 
ATOM 2653 C CB  . ASP C 3 21  ? 26.761 56.057  31.690  1.00 211.23 ? 1021 ASP C CB  1 
ATOM 2654 C CG  . ASP C 3 21  ? 27.307 54.639  31.561  1.00 191.81 ? 1021 ASP C CG  1 
ATOM 2655 O OD1 . ASP C 3 21  ? 26.886 53.910  30.638  1.00 181.50 ? 1021 ASP C OD1 1 
ATOM 2656 O OD2 . ASP C 3 21  ? 28.163 54.256  32.386  1.00 189.09 ? 1021 ASP C OD2 1 
ATOM 2657 N N   . ASN C 3 22  ? 26.879 59.216  31.130  1.00 250.02 ? 1022 ASN C N   1 
ATOM 2658 C CA  . ASN C 3 22  ? 26.277 60.531  31.315  1.00 258.56 ? 1022 ASN C CA  1 
ATOM 2659 C C   . ASN C 3 22  ? 27.389 61.575  31.383  1.00 259.87 ? 1022 ASN C C   1 
ATOM 2660 O O   . ASN C 3 22  ? 28.545 61.302  31.045  1.00 258.88 ? 1022 ASN C O   1 
ATOM 2661 C CB  . ASN C 3 22  ? 25.383 60.547  32.562  1.00 268.13 ? 1022 ASN C CB  1 
ATOM 2662 C CG  . ASN C 3 22  ? 26.088 60.024  33.794  1.00 275.21 ? 1022 ASN C CG  1 
ATOM 2663 O OD1 . ASN C 3 22  ? 27.277 60.271  34.000  1.00 275.42 ? 1022 ASN C OD1 1 
ATOM 2664 N ND2 . ASN C 3 22  ? 25.358 59.288  34.620  1.00 279.48 ? 1022 ASN C ND2 1 
ATOM 2665 N N   . ALA C 3 23  ? 27.028 62.782  31.823  1.00 301.22 ? 1023 ALA C N   1 
ATOM 2666 C CA  . ALA C 3 23  ? 27.983 63.884  31.839  1.00 286.06 ? 1023 ALA C CA  1 
ATOM 2667 C C   . ALA C 3 23  ? 29.004 63.741  32.959  1.00 274.02 ? 1023 ALA C C   1 
ATOM 2668 O O   . ALA C 3 23  ? 30.154 64.167  32.802  1.00 273.38 ? 1023 ALA C O   1 
ATOM 2669 C CB  . ALA C 3 23  ? 27.245 65.215  31.974  1.00 269.00 ? 1023 ALA C CB  1 
ATOM 2670 N N   . ALA C 3 24  ? 28.610 63.157  34.092  1.00 269.98 ? 1024 ALA C N   1 
ATOM 2671 C CA  . ALA C 3 24  ? 29.520 63.085  35.230  1.00 262.56 ? 1024 ALA C CA  1 
ATOM 2672 C C   . ALA C 3 24  ? 30.682 62.134  34.964  1.00 261.92 ? 1024 ALA C C   1 
ATOM 2673 O O   . ALA C 3 24  ? 31.782 62.342  35.489  1.00 266.05 ? 1024 ALA C O   1 
ATOM 2674 C CB  . ALA C 3 24  ? 28.755 62.679  36.490  1.00 261.80 ? 1024 ALA C CB  1 
ATOM 2675 N N   . GLN C 3 25  ? 30.467 61.093  34.152  1.00 301.61 ? 1025 GLN C N   1 
ATOM 2676 C CA  . GLN C 3 25  ? 31.578 60.233  33.749  1.00 228.82 ? 1025 GLN C CA  1 
ATOM 2677 C C   . GLN C 3 25  ? 32.555 60.976  32.846  1.00 303.60 ? 1025 GLN C C   1 
ATOM 2678 O O   . GLN C 3 25  ? 33.772 60.778  32.944  1.00 231.12 ? 1025 GLN C O   1 
ATOM 2679 C CB  . GLN C 3 25  ? 31.054 58.984  33.042  1.00 236.12 ? 1025 GLN C CB  1 
ATOM 2680 C CG  . GLN C 3 25  ? 30.241 58.063  33.923  1.00 236.54 ? 1025 GLN C CG  1 
ATOM 2681 C CD  . GLN C 3 25  ? 29.824 56.799  33.201  1.00 244.52 ? 1025 GLN C CD  1 
ATOM 2682 O OE1 . GLN C 3 25  ? 29.981 56.685  31.985  1.00 249.50 ? 1025 GLN C OE1 1 
ATOM 2683 N NE2 . GLN C 3 25  ? 29.292 55.840  33.947  1.00 246.19 ? 1025 GLN C NE2 1 
ATOM 2684 N N   . VAL C 3 26  ? 32.036 61.811  31.942  1.00 274.31 ? 1026 VAL C N   1 
ATOM 2685 C CA  . VAL C 3 26  ? 32.899 62.657  31.122  1.00 275.34 ? 1026 VAL C CA  1 
ATOM 2686 C C   . VAL C 3 26  ? 33.723 63.581  32.007  1.00 270.96 ? 1026 VAL C C   1 
ATOM 2687 O O   . VAL C 3 26  ? 34.930 63.753  31.797  1.00 276.41 ? 1026 VAL C O   1 
ATOM 2688 C CB  . VAL C 3 26  ? 32.060 63.450  30.101  1.00 273.33 ? 1026 VAL C CB  1 
ATOM 2689 C CG1 . VAL C 3 26  ? 32.955 64.327  29.235  1.00 274.84 ? 1026 VAL C CG1 1 
ATOM 2690 C CG2 . VAL C 3 26  ? 31.233 62.510  29.239  1.00 280.61 ? 1026 VAL C CG2 1 
ATOM 2691 N N   . LYS C 3 27  ? 33.089 64.177  33.020  1.00 255.98 ? 1027 LYS C N   1 
ATOM 2692 C CA  . LYS C 3 27  ? 33.810 65.050  33.943  1.00 244.81 ? 1027 LYS C CA  1 
ATOM 2693 C C   . LYS C 3 27  ? 34.937 64.306  34.649  1.00 253.10 ? 1027 LYS C C   1 
ATOM 2694 O O   . LYS C 3 27  ? 36.050 64.830  34.774  1.00 253.76 ? 1027 LYS C O   1 
ATOM 2695 C CB  . LYS C 3 27  ? 32.839 65.641  34.964  1.00 229.87 ? 1027 LYS C CB  1 
ATOM 2696 C CG  . LYS C 3 27  ? 33.501 66.528  36.004  1.00 214.28 ? 1027 LYS C CG  1 
ATOM 2697 C CD  . LYS C 3 27  ? 32.515 66.958  37.074  1.00 194.67 ? 1027 LYS C CD  1 
ATOM 2698 C CE  . LYS C 3 27  ? 33.146 67.930  38.056  1.00 192.97 ? 1027 LYS C CE  1 
ATOM 2699 N NZ  . LYS C 3 27  ? 32.220 68.242  39.181  1.00 188.16 ? 1027 LYS C NZ  1 
ATOM 2700 N N   . ASP C 3 28  ? 34.669 63.082  35.113  1.00 271.31 ? 1028 ASP C N   1 
ATOM 2701 C CA  . ASP C 3 28  ? 35.694 62.309  35.809  1.00 278.28 ? 1028 ASP C CA  1 
ATOM 2702 C C   . ASP C 3 28  ? 36.858 61.975  34.883  1.00 286.47 ? 1028 ASP C C   1 
ATOM 2703 O O   . ASP C 3 28  ? 38.024 62.057  35.286  1.00 292.07 ? 1028 ASP C O   1 
ATOM 2704 C CB  . ASP C 3 28  ? 35.079 61.032  36.389  1.00 280.14 ? 1028 ASP C CB  1 
ATOM 2705 C CG  . ASP C 3 28  ? 35.896 60.445  37.535  1.00 279.07 ? 1028 ASP C CG  1 
ATOM 2706 O OD1 . ASP C 3 28  ? 37.114 60.712  37.615  1.00 278.43 ? 1028 ASP C OD1 1 
ATOM 2707 O OD2 . ASP C 3 28  ? 35.314 59.707  38.358  1.00 278.56 ? 1028 ASP C OD2 1 
ATOM 2708 N N   . ALA C 3 29  ? 36.562 61.594  33.638  1.00 277.75 ? 1029 ALA C N   1 
ATOM 2709 C CA  . ALA C 3 29  ? 37.625 61.253  32.699  1.00 270.39 ? 1029 ALA C CA  1 
ATOM 2710 C C   . ALA C 3 29  ? 38.447 62.478  32.315  1.00 261.56 ? 1029 ALA C C   1 
ATOM 2711 O O   . ALA C 3 29  ? 39.672 62.389  32.171  1.00 263.10 ? 1029 ALA C O   1 
ATOM 2712 C CB  . ALA C 3 29  ? 37.034 60.590  31.456  1.00 277.82 ? 1029 ALA C CB  1 
ATOM 2713 N N   . LEU C 3 30  ? 37.795 63.632  32.143  1.00 253.13 ? 1030 LEU C N   1 
ATOM 2714 C CA  . LEU C 3 30  ? 38.521 64.841  31.763  1.00 252.08 ? 1030 LEU C CA  1 
ATOM 2715 C C   . LEU C 3 30  ? 39.381 65.370  32.904  1.00 254.45 ? 1030 LEU C C   1 
ATOM 2716 O O   . LEU C 3 30  ? 40.444 65.952  32.658  1.00 254.20 ? 1030 LEU C O   1 
ATOM 2717 C CB  . LEU C 3 30  ? 37.544 65.915  31.289  1.00 240.59 ? 1030 LEU C CB  1 
ATOM 2718 C CG  . LEU C 3 30  ? 36.737 65.538  30.045  1.00 230.22 ? 1030 LEU C CG  1 
ATOM 2719 C CD1 . LEU C 3 30  ? 35.809 66.664  29.625  1.00 227.79 ? 1030 LEU C CD1 1 
ATOM 2720 C CD2 . LEU C 3 30  ? 37.659 65.134  28.905  1.00 238.37 ? 1030 LEU C CD2 1 
ATOM 2721 N N   . THR C 3 31  ? 38.939 65.190  34.152  1.00 257.85 ? 1031 THR C N   1 
ATOM 2722 C CA  . THR C 3 31  ? 39.779 65.559  35.288  1.00 258.50 ? 1031 THR C CA  1 
ATOM 2723 C C   . THR C 3 31  ? 40.987 64.634  35.399  1.00 264.13 ? 1031 THR C C   1 
ATOM 2724 O O   . THR C 3 31  ? 42.074 65.071  35.796  1.00 267.42 ? 1031 THR C O   1 
ATOM 2725 C CB  . THR C 3 31  ? 38.960 65.539  36.582  1.00 250.14 ? 1031 THR C CB  1 
ATOM 2726 O OG1 . THR C 3 31  ? 38.261 64.293  36.693  1.00 253.50 ? 1031 THR C OG1 1 
ATOM 2727 C CG2 . THR C 3 31  ? 37.955 66.689  36.606  1.00 244.86 ? 1031 THR C CG2 1 
ATOM 2728 N N   . LYS C 3 32  ? 40.814 63.352  35.060  1.00 274.23 ? 1032 LYS C N   1 
ATOM 2729 C CA  . LYS C 3 32  ? 41.950 62.434  35.022  1.00 278.82 ? 1032 LYS C CA  1 
ATOM 2730 C C   . LYS C 3 32  ? 42.956 62.843  33.951  1.00 299.33 ? 1032 LYS C C   1 
ATOM 2731 O O   . LYS C 3 32  ? 44.171 62.775  34.172  1.00 296.38 ? 1032 LYS C O   1 
ATOM 2732 C CB  . LYS C 3 32  ? 41.467 61.002  34.779  1.00 268.05 ? 1032 LYS C CB  1 
ATOM 2733 C CG  . LYS C 3 32  ? 41.251 60.178  36.041  1.00 231.06 ? 1032 LYS C CG  1 
ATOM 2734 C CD  . LYS C 3 32  ? 41.031 58.709  35.703  1.00 237.75 ? 1032 LYS C CD  1 
ATOM 2735 C CE  . LYS C 3 32  ? 41.027 57.840  36.950  1.00 236.71 ? 1032 LYS C CE  1 
ATOM 2736 N NZ  . LYS C 3 32  ? 40.930 56.395  36.602  1.00 243.00 ? 1032 LYS C NZ  1 
ATOM 2737 N N   . MET C 3 33  ? 42.468 63.261  32.778  1.00 326.81 ? 1033 MET C N   1 
ATOM 2738 C CA  . MET C 3 33  ? 43.366 63.732  31.727  1.00 332.13 ? 1033 MET C CA  1 
ATOM 2739 C C   . MET C 3 33  ? 44.077 65.013  32.143  1.00 323.47 ? 1033 MET C C   1 
ATOM 2740 O O   . MET C 3 33  ? 45.250 65.217  31.809  1.00 329.29 ? 1033 MET C O   1 
ATOM 2741 C CB  . MET C 3 33  ? 42.591 63.954  30.427  1.00 335.43 ? 1033 MET C CB  1 
ATOM 2742 C CG  . MET C 3 33  ? 41.923 62.709  29.880  1.00 340.71 ? 1033 MET C CG  1 
ATOM 2743 S SD  . MET C 3 33  ? 41.113 62.968  28.290  1.00 345.12 ? 1033 MET C SD  1 
ATOM 2744 C CE  . MET C 3 33  ? 42.531 63.091  27.204  1.00 353.74 ? 1033 MET C CE  1 
ATOM 2745 N N   . ARG C 3 34  ? 43.378 65.892  32.865  1.00 294.37 ? 1034 ARG C N   1 
ATOM 2746 C CA  . ARG C 3 34  ? 44.004 67.111  33.364  1.00 276.72 ? 1034 ARG C CA  1 
ATOM 2747 C C   . ARG C 3 34  ? 45.128 66.793  34.342  1.00 278.43 ? 1034 ARG C C   1 
ATOM 2748 O O   . ARG C 3 34  ? 46.199 67.408  34.291  1.00 281.07 ? 1034 ARG C O   1 
ATOM 2749 C CB  . ARG C 3 34  ? 42.951 67.999  34.024  1.00 250.86 ? 1034 ARG C CB  1 
ATOM 2750 C CG  . ARG C 3 34  ? 43.491 69.267  34.655  1.00 235.05 ? 1034 ARG C CG  1 
ATOM 2751 C CD  . ARG C 3 34  ? 42.352 70.090  35.228  1.00 221.07 ? 1034 ARG C CD  1 
ATOM 2752 N NE  . ARG C 3 34  ? 42.807 71.340  35.826  1.00 213.79 ? 1034 ARG C NE  1 
ATOM 2753 C CZ  . ARG C 3 34  ? 41.991 72.271  36.308  1.00 199.95 ? 1034 ARG C CZ  1 
ATOM 2754 N NH1 . ARG C 3 34  ? 40.677 72.093  36.259  1.00 197.62 ? 1034 ARG C NH1 1 
ATOM 2755 N NH2 . ARG C 3 34  ? 42.486 73.381  36.836  1.00 198.70 ? 1034 ARG C NH2 1 
ATOM 2756 N N   . ALA C 3 35  ? 44.900 65.834  35.243  1.00 277.95 ? 1035 ALA C N   1 
ATOM 2757 C CA  . ALA C 3 35  ? 45.952 65.423  36.167  1.00 278.22 ? 1035 ALA C CA  1 
ATOM 2758 C C   . ALA C 3 35  ? 47.107 64.763  35.426  1.00 283.98 ? 1035 ALA C C   1 
ATOM 2759 O O   . ALA C 3 35  ? 48.274 64.947  35.790  1.00 287.91 ? 1035 ALA C O   1 
ATOM 2760 C CB  . ALA C 3 35  ? 45.384 64.479  37.225  1.00 276.38 ? 1035 ALA C CB  1 
ATOM 2761 N N   . ALA C 3 36  ? 46.800 63.984  34.387  1.00 285.65 ? 1036 ALA C N   1 
ATOM 2762 C CA  . ALA C 3 36  ? 47.855 63.369  33.589  1.00 285.00 ? 1036 ALA C CA  1 
ATOM 2763 C C   . ALA C 3 36  ? 48.647 64.419  32.820  1.00 288.24 ? 1036 ALA C C   1 
ATOM 2764 O O   . ALA C 3 36  ? 49.862 64.278  32.637  1.00 289.22 ? 1036 ALA C O   1 
ATOM 2765 C CB  . ALA C 3 36  ? 47.255 62.338  32.634  1.00 272.07 ? 1036 ALA C CB  1 
ATOM 2766 N N   . ALA C 3 37  ? 47.976 65.480  32.361  1.00 294.73 ? 1037 ALA C N   1 
ATOM 2767 C CA  . ALA C 3 37  ? 48.676 66.550  31.659  1.00 300.48 ? 1037 ALA C CA  1 
ATOM 2768 C C   . ALA C 3 37  ? 49.610 67.310  32.595  1.00 300.61 ? 1037 ALA C C   1 
ATOM 2769 O O   . ALA C 3 37  ? 50.718 67.692  32.198  1.00 304.49 ? 1037 ALA C O   1 
ATOM 2770 C CB  . ALA C 3 37  ? 47.669 67.499  31.007  1.00 297.71 ? 1037 ALA C CB  1 
ATOM 2771 N N   . LEU C 3 38  ? 49.182 67.541  33.840  1.00 299.49 ? 1038 LEU C N   1 
ATOM 2772 C CA  . LEU C 3 38  ? 50.065 68.169  34.819  1.00 296.44 ? 1038 LEU C CA  1 
ATOM 2773 C C   . LEU C 3 38  ? 51.234 67.264  35.185  1.00 309.40 ? 1038 LEU C C   1 
ATOM 2774 O O   . LEU C 3 38  ? 52.336 67.756  35.452  1.00 313.18 ? 1038 LEU C O   1 
ATOM 2775 C CB  . LEU C 3 38  ? 49.274 68.544  36.076  1.00 282.41 ? 1038 LEU C CB  1 
ATOM 2776 C CG  . LEU C 3 38  ? 48.239 69.663  35.940  1.00 270.36 ? 1038 LEU C CG  1 
ATOM 2777 C CD1 . LEU C 3 38  ? 47.540 69.925  37.267  1.00 261.29 ? 1038 LEU C CD1 1 
ATOM 2778 C CD2 . LEU C 3 38  ? 48.889 70.934  35.414  1.00 266.77 ? 1038 LEU C CD2 1 
ATOM 2779 N N   . ASP C 3 39  ? 51.016 65.952  35.204  1.00 340.68 ? 1039 ASP C N   1 
ATOM 2780 C CA  . ASP C 3 39  ? 52.080 64.995  35.482  1.00 347.08 ? 1039 ASP C CA  1 
ATOM 2781 C C   . ASP C 3 39  ? 53.073 64.938  34.321  1.00 351.94 ? 1039 ASP C C   1 
ATOM 2782 O O   . ASP C 3 39  ? 54.285 65.051  34.517  1.00 357.85 ? 1039 ASP C O   1 
ATOM 2783 C CB  . ASP C 3 39  ? 51.493 63.608  35.747  1.00 342.46 ? 1039 ASP C CB  1 
ATOM 2784 C CG  . ASP C 3 39  ? 52.538 62.611  36.221  1.00 346.20 ? 1039 ASP C CG  1 
ATOM 2785 O OD1 . ASP C 3 39  ? 53.680 63.029  36.517  1.00 353.04 ? 1039 ASP C OD1 1 
ATOM 2786 O OD2 . ASP C 3 39  ? 52.215 61.407  36.300  1.00 341.28 ? 1039 ASP C OD2 1 
ATOM 2787 N N   . ILE C 3 47  ? 48.665 73.835  25.556  1.00 264.86 ? 1067 ILE C N   1 
ATOM 2788 C CA  . ILE C 3 47  ? 47.483 73.959  24.714  1.00 261.04 ? 1067 ILE C CA  1 
ATOM 2789 C C   . ILE C 3 47  ? 46.477 72.874  25.077  1.00 256.22 ? 1067 ILE C C   1 
ATOM 2790 O O   . ILE C 3 47  ? 45.269 73.111  25.079  1.00 245.69 ? 1067 ILE C O   1 
ATOM 2791 C CB  . ILE C 3 47  ? 47.853 73.895  23.220  1.00 259.31 ? 1067 ILE C CB  1 
ATOM 2792 C CG1 . ILE C 3 47  ? 48.857 74.996  22.873  1.00 269.19 ? 1067 ILE C CG1 1 
ATOM 2793 C CG2 . ILE C 3 47  ? 46.609 74.019  22.350  1.00 253.36 ? 1067 ILE C CG2 1 
ATOM 2794 C CD1 . ILE C 3 47  ? 48.348 76.392  23.148  1.00 273.70 ? 1067 ILE C CD1 1 
ATOM 2795 N N   . LEU C 3 48  ? 46.986 71.679  25.388  1.00 260.35 ? 1068 LEU C N   1 
ATOM 2796 C CA  . LEU C 3 48  ? 46.110 70.577  25.773  1.00 258.49 ? 1068 LEU C CA  1 
ATOM 2797 C C   . LEU C 3 48  ? 45.367 70.889  27.065  1.00 262.23 ? 1068 LEU C C   1 
ATOM 2798 O O   . LEU C 3 48  ? 44.211 70.487  27.238  1.00 254.69 ? 1068 LEU C O   1 
ATOM 2799 C CB  . LEU C 3 48  ? 46.918 69.287  25.920  1.00 251.38 ? 1068 LEU C CB  1 
ATOM 2800 C CG  . LEU C 3 48  ? 46.154 68.042  26.379  1.00 242.42 ? 1068 LEU C CG  1 
ATOM 2801 C CD1 . LEU C 3 48  ? 45.088 67.654  25.365  1.00 235.16 ? 1068 LEU C CD1 1 
ATOM 2802 C CD2 . LEU C 3 48  ? 47.108 66.885  26.629  1.00 243.04 ? 1068 LEU C CD2 1 
ATOM 2803 N N   . VAL C 3 49  ? 46.016 71.606  27.985  1.00 273.47 ? 1069 VAL C N   1 
ATOM 2804 C CA  . VAL C 3 49  ? 45.387 71.930  29.261  1.00 275.56 ? 1069 VAL C CA  1 
ATOM 2805 C C   . VAL C 3 49  ? 44.194 72.854  29.051  1.00 274.68 ? 1069 VAL C C   1 
ATOM 2806 O O   . VAL C 3 49  ? 43.144 72.691  29.686  1.00 273.65 ? 1069 VAL C O   1 
ATOM 2807 C CB  . VAL C 3 49  ? 46.419 72.546  30.221  1.00 285.16 ? 1069 VAL C CB  1 
ATOM 2808 C CG1 . VAL C 3 49  ? 45.755 72.947  31.529  1.00 289.25 ? 1069 VAL C CG1 1 
ATOM 2809 C CG2 . VAL C 3 49  ? 47.560 71.571  30.469  1.00 287.18 ? 1069 VAL C CG2 1 
ATOM 2810 N N   . GLY C 3 50  ? 44.330 73.835  28.157  1.00 290.27 ? 1070 GLY C N   1 
ATOM 2811 C CA  . GLY C 3 50  ? 43.228 74.748  27.907  1.00 286.64 ? 1070 GLY C CA  1 
ATOM 2812 C C   . GLY C 3 50  ? 42.052 74.077  27.223  1.00 276.29 ? 1070 GLY C C   1 
ATOM 2813 O O   . GLY C 3 50  ? 40.895 74.344  27.559  1.00 261.16 ? 1070 GLY C O   1 
ATOM 2814 N N   . GLN C 3 51  ? 42.330 73.207  26.249  1.00 286.46 ? 1071 GLN C N   1 
ATOM 2815 C CA  . GLN C 3 51  ? 41.260 72.482  25.571  1.00 283.16 ? 1071 GLN C CA  1 
ATOM 2816 C C   . GLN C 3 51  ? 40.524 71.555  26.531  1.00 284.52 ? 1071 GLN C C   1 
ATOM 2817 O O   . GLN C 3 51  ? 39.302 71.391  26.436  1.00 280.94 ? 1071 GLN C O   1 
ATOM 2818 C CB  . GLN C 3 51  ? 41.829 71.692  24.391  1.00 278.72 ? 1071 GLN C CB  1 
ATOM 2819 C CG  . GLN C 3 51  ? 42.505 72.550  23.333  1.00 283.98 ? 1071 GLN C CG  1 
ATOM 2820 C CD  . GLN C 3 51  ? 43.219 71.725  22.277  1.00 281.64 ? 1071 GLN C CD  1 
ATOM 2821 O OE1 . GLN C 3 51  ? 43.530 70.553  22.492  1.00 278.36 ? 1071 GLN C OE1 1 
ATOM 2822 N NE2 . GLN C 3 51  ? 43.482 72.336  21.127  1.00 284.47 ? 1071 GLN C NE2 1 
ATOM 2823 N N   . ILE C 3 52  ? 41.254 70.930  27.458  1.00 293.08 ? 1072 ILE C N   1 
ATOM 2824 C CA  . ILE C 3 52  ? 40.617 70.070  28.451  1.00 276.25 ? 1072 ILE C CA  1 
ATOM 2825 C C   . ILE C 3 52  ? 39.803 70.903  29.435  1.00 268.02 ? 1072 ILE C C   1 
ATOM 2826 O O   . ILE C 3 52  ? 38.722 70.490  29.872  1.00 249.84 ? 1072 ILE C O   1 
ATOM 2827 C CB  . ILE C 3 52  ? 41.675 69.207  29.165  1.00 221.75 ? 1072 ILE C CB  1 
ATOM 2828 C CG1 . ILE C 3 52  ? 42.278 68.189  28.194  1.00 218.32 ? 1072 ILE C CG1 1 
ATOM 2829 C CG2 . ILE C 3 52  ? 41.076 68.494  30.368  1.00 219.44 ? 1072 ILE C CG2 1 
ATOM 2830 C CD1 . ILE C 3 52  ? 43.386 67.347  28.796  1.00 220.39 ? 1072 ILE C CD1 1 
ATOM 2831 N N   . ASP C 3 53  ? 40.297 72.094  29.791  1.00 280.95 ? 1073 ASP C N   1 
ATOM 2832 C CA  . ASP C 3 53  ? 39.555 72.965  30.699  1.00 286.28 ? 1073 ASP C CA  1 
ATOM 2833 C C   . ASP C 3 53  ? 38.262 73.469  30.069  1.00 285.37 ? 1073 ASP C C   1 
ATOM 2834 O O   . ASP C 3 53  ? 37.315 73.806  30.789  1.00 284.36 ? 1073 ASP C O   1 
ATOM 2835 C CB  . ASP C 3 53  ? 40.425 74.146  31.133  1.00 295.99 ? 1073 ASP C CB  1 
ATOM 2836 C CG  . ASP C 3 53  ? 41.514 73.741  32.110  1.00 299.38 ? 1073 ASP C CG  1 
ATOM 2837 O OD1 . ASP C 3 53  ? 41.502 72.580  32.569  1.00 294.35 ? 1073 ASP C OD1 1 
ATOM 2838 O OD2 . ASP C 3 53  ? 42.384 74.584  32.416  1.00 304.98 ? 1073 ASP C OD2 1 
ATOM 2839 N N   . ASP C 3 54  ? 38.203 73.536  28.737  1.00 285.84 ? 1074 ASP C N   1 
ATOM 2840 C CA  . ASP C 3 54  ? 36.960 73.896  28.064  1.00 284.41 ? 1074 ASP C CA  1 
ATOM 2841 C C   . ASP C 3 54  ? 36.023 72.699  27.948  1.00 276.32 ? 1074 ASP C C   1 
ATOM 2842 O O   . ASP C 3 54  ? 34.805 72.845  28.104  1.00 280.65 ? 1074 ASP C O   1 
ATOM 2843 C CB  . ASP C 3 54  ? 37.256 74.473  26.678  1.00 282.58 ? 1074 ASP C CB  1 
ATOM 2844 C CG  . ASP C 3 54  ? 38.016 75.782  26.741  1.00 289.40 ? 1074 ASP C CG  1 
ATOM 2845 O OD1 . ASP C 3 54  ? 38.195 76.316  27.856  1.00 292.42 ? 1074 ASP C OD1 1 
ATOM 2846 O OD2 . ASP C 3 54  ? 38.436 76.275  25.673  1.00 289.17 ? 1074 ASP C OD2 1 
ATOM 2847 N N   . ALA C 3 55  ? 36.570 71.514  27.668  1.00 277.00 ? 1075 ALA C N   1 
ATOM 2848 C CA  . ALA C 3 55  ? 35.748 70.310  27.637  1.00 259.69 ? 1075 ALA C CA  1 
ATOM 2849 C C   . ALA C 3 55  ? 35.189 69.979  29.015  1.00 262.14 ? 1075 ALA C C   1 
ATOM 2850 O O   . ALA C 3 55  ? 34.103 69.398  29.118  1.00 200.30 ? 1075 ALA C O   1 
ATOM 2851 C CB  . ALA C 3 55  ? 36.557 69.134  27.093  1.00 201.29 ? 1075 ALA C CB  1 
ATOM 2852 N N   . LEU C 3 56  ? 35.917 70.330  30.079  1.00 253.69 ? 1076 LEU C N   1 
ATOM 2853 C CA  . LEU C 3 56  ? 35.384 70.162  31.428  1.00 256.57 ? 1076 LEU C CA  1 
ATOM 2854 C C   . LEU C 3 56  ? 34.188 71.075  31.660  1.00 261.62 ? 1076 LEU C C   1 
ATOM 2855 O O   . LEU C 3 56  ? 33.220 70.681  32.322  1.00 265.21 ? 1076 LEU C O   1 
ATOM 2856 C CB  . LEU C 3 56  ? 36.476 70.434  32.464  1.00 263.84 ? 1076 LEU C CB  1 
ATOM 2857 C CG  . LEU C 3 56  ? 36.077 70.328  33.938  1.00 263.97 ? 1076 LEU C CG  1 
ATOM 2858 C CD1 . LEU C 3 56  ? 35.650 68.910  34.282  1.00 254.70 ? 1076 LEU C CD1 1 
ATOM 2859 C CD2 . LEU C 3 56  ? 37.214 70.781  34.843  1.00 269.57 ? 1076 LEU C CD2 1 
ATOM 2860 N N   . LYS C 3 57  ? 34.242 72.303  31.135  1.00 268.81 ? 1077 LYS C N   1 
ATOM 2861 C CA  . LYS C 3 57  ? 33.078 73.182  31.178  1.00 271.79 ? 1077 LYS C CA  1 
ATOM 2862 C C   . LYS C 3 57  ? 31.886 72.547  30.474  1.00 268.75 ? 1077 LYS C C   1 
ATOM 2863 O O   . LYS C 3 57  ? 30.758 72.589  30.980  1.00 265.70 ? 1077 LYS C O   1 
ATOM 2864 C CB  . LYS C 3 57  ? 33.408 74.531  30.537  1.00 266.28 ? 1077 LYS C CB  1 
ATOM 2865 C CG  . LYS C 3 57  ? 34.426 75.380  31.281  1.00 267.90 ? 1077 LYS C CG  1 
ATOM 2866 C CD  . LYS C 3 57  ? 34.623 76.709  30.564  1.00 268.62 ? 1077 LYS C CD  1 
ATOM 2867 C CE  . LYS C 3 57  ? 35.638 77.593  31.265  1.00 273.15 ? 1077 LYS C CE  1 
ATOM 2868 N NZ  . LYS C 3 57  ? 35.818 78.879  30.537  1.00 276.31 ? 1077 LYS C NZ  1 
ATOM 2869 N N   . LEU C 3 58  ? 32.119 71.957  29.298  1.00 269.56 ? 1078 LEU C N   1 
ATOM 2870 C CA  . LEU C 3 58  ? 31.031 71.355  28.534  1.00 264.77 ? 1078 LEU C CA  1 
ATOM 2871 C C   . LEU C 3 58  ? 30.433 70.159  29.266  1.00 261.48 ? 1078 LEU C C   1 
ATOM 2872 O O   . LEU C 3 58  ? 29.227 69.902  29.169  1.00 259.32 ? 1078 LEU C O   1 
ATOM 2873 C CB  . LEU C 3 58  ? 31.532 70.948  27.148  1.00 261.99 ? 1078 LEU C CB  1 
ATOM 2874 C CG  . LEU C 3 58  ? 31.891 72.118  26.229  1.00 266.20 ? 1078 LEU C CG  1 
ATOM 2875 C CD1 . LEU C 3 58  ? 32.419 71.640  24.888  1.00 260.69 ? 1078 LEU C CD1 1 
ATOM 2876 C CD2 . LEU C 3 58  ? 30.679 73.008  26.034  1.00 267.48 ? 1078 LEU C CD2 1 
ATOM 2877 N N   . ALA C 3 59  ? 31.261 69.411  29.998  1.00 308.85 ? 1079 ALA C N   1 
ATOM 2878 C CA  . ALA C 3 59  ? 30.734 68.327  30.818  1.00 193.88 ? 1079 ALA C CA  1 
ATOM 2879 C C   . ALA C 3 59  ? 29.914 68.868  31.984  1.00 363.50 ? 1079 ALA C C   1 
ATOM 2880 O O   . ALA C 3 59  ? 28.881 68.290  32.344  1.00 195.38 ? 1079 ALA C O   1 
ATOM 2881 C CB  . ALA C 3 59  ? 31.877 67.446  31.322  1.00 194.31 ? 1079 ALA C CB  1 
ATOM 2882 N N   . ASN C 3 60  ? 30.354 69.980  32.582  1.00 306.08 ? 1080 ASN C N   1 
ATOM 2883 C CA  . ASN C 3 60  ? 29.622 70.564  33.702  1.00 310.99 ? 1080 ASN C CA  1 
ATOM 2884 C C   . ASN C 3 60  ? 28.288 71.158  33.265  1.00 304.48 ? 1080 ASN C C   1 
ATOM 2885 O O   . ASN C 3 60  ? 27.337 71.187  34.054  1.00 309.89 ? 1080 ASN C O   1 
ATOM 2886 C CB  . ASN C 3 60  ? 30.473 71.634  34.393  1.00 318.36 ? 1080 ASN C CB  1 
ATOM 2887 C CG  . ASN C 3 60  ? 31.633 71.047  35.179  1.00 322.27 ? 1080 ASN C CG  1 
ATOM 2888 O OD1 . ASN C 3 60  ? 31.632 69.865  35.524  1.00 317.93 ? 1080 ASN C OD1 1 
ATOM 2889 N ND2 . ASN C 3 60  ? 32.627 71.878  35.476  1.00 328.29 ? 1080 ASN C ND2 1 
ATOM 2890 N N   . GLU C 3 61  ? 28.197 71.641  32.022  1.00 296.48 ? 1081 GLU C N   1 
ATOM 2891 C CA  . GLU C 3 61  ? 26.949 72.232  31.547  1.00 264.95 ? 1081 GLU C CA  1 
ATOM 2892 C C   . GLU C 3 61  ? 25.837 71.197  31.444  1.00 240.47 ? 1081 GLU C C   1 
ATOM 2893 O O   . GLU C 3 61  ? 24.658 71.539  31.596  1.00 237.93 ? 1081 GLU C O   1 
ATOM 2894 C CB  . GLU C 3 61  ? 27.167 72.908  30.192  1.00 262.22 ? 1081 GLU C CB  1 
ATOM 2895 C CG  . GLU C 3 61  ? 28.076 74.130  30.232  1.00 262.60 ? 1081 GLU C CG  1 
ATOM 2896 C CD  . GLU C 3 61  ? 28.435 74.635  28.846  1.00 254.08 ? 1081 GLU C CD  1 
ATOM 2897 O OE1 . GLU C 3 61  ? 28.054 73.976  27.855  1.00 245.74 ? 1081 GLU C OE1 1 
ATOM 2898 O OE2 . GLU C 3 61  ? 29.098 75.689  28.746  1.00 256.83 ? 1081 GLU C OE2 1 
ATOM 2899 N N   . GLY C 3 62  ? 26.185 69.937  31.195  1.00 242.34 ? 1082 GLY C N   1 
ATOM 2900 C CA  . GLY C 3 62  ? 25.209 68.885  31.022  1.00 238.96 ? 1082 GLY C CA  1 
ATOM 2901 C C   . GLY C 3 62  ? 24.988 68.451  29.591  1.00 234.95 ? 1082 GLY C C   1 
ATOM 2902 O O   . GLY C 3 62  ? 24.229 67.501  29.361  1.00 220.38 ? 1082 GLY C O   1 
ATOM 2903 N N   . LYS C 3 63  ? 25.622 69.113  28.626  1.00 246.95 ? 1083 LYS C N   1 
ATOM 2904 C CA  . LYS C 3 63  ? 25.524 68.733  27.218  1.00 244.38 ? 1083 LYS C CA  1 
ATOM 2905 C C   . LYS C 3 63  ? 26.439 67.536  27.003  1.00 239.83 ? 1083 LYS C C   1 
ATOM 2906 O O   . LYS C 3 63  ? 27.606 67.668  26.631  1.00 242.12 ? 1083 LYS C O   1 
ATOM 2907 C CB  . LYS C 3 63  ? 25.890 69.907  26.318  1.00 246.44 ? 1083 LYS C CB  1 
ATOM 2908 C CG  . LYS C 3 63  ? 25.037 71.142  26.569  1.00 253.23 ? 1083 LYS C CG  1 
ATOM 2909 C CD  . LYS C 3 63  ? 25.446 72.311  25.689  1.00 257.26 ? 1083 LYS C CD  1 
ATOM 2910 C CE  . LYS C 3 63  ? 24.567 73.526  25.955  1.00 263.81 ? 1083 LYS C CE  1 
ATOM 2911 N NZ  . LYS C 3 63  ? 24.936 74.691  25.103  1.00 268.28 ? 1083 LYS C NZ  1 
ATOM 2912 N N   . VAL C 3 64  ? 25.887 66.345  27.244  1.00 233.75 ? 1084 VAL C N   1 
ATOM 2913 C CA  . VAL C 3 64  ? 26.697 65.131  27.282  1.00 223.78 ? 1084 VAL C CA  1 
ATOM 2914 C C   . VAL C 3 64  ? 27.271 64.820  25.906  1.00 236.77 ? 1084 VAL C C   1 
ATOM 2915 O O   . VAL C 3 64  ? 28.479 64.599  25.757  1.00 239.45 ? 1084 VAL C O   1 
ATOM 2916 C CB  . VAL C 3 64  ? 25.865 63.954  27.818  1.00 204.77 ? 1084 VAL C CB  1 
ATOM 2917 C CG1 . VAL C 3 64  ? 26.738 62.717  27.981  1.00 200.23 ? 1084 VAL C CG1 1 
ATOM 2918 C CG2 . VAL C 3 64  ? 25.188 64.333  29.127  1.00 202.74 ? 1084 VAL C CG2 1 
ATOM 2919 N N   . LYS C 3 65  ? 26.415 64.790  24.882  1.00 251.93 ? 1085 LYS C N   1 
ATOM 2920 C CA  . LYS C 3 65  ? 26.875 64.420  23.548  1.00 248.75 ? 1085 LYS C CA  1 
ATOM 2921 C C   . LYS C 3 65  ? 27.880 65.429  23.007  1.00 249.32 ? 1085 LYS C C   1 
ATOM 2922 O O   . LYS C 3 65  ? 28.875 65.050  22.378  1.00 250.43 ? 1085 LYS C O   1 
ATOM 2923 C CB  . LYS C 3 65  ? 25.680 64.289  22.605  1.00 241.76 ? 1085 LYS C CB  1 
ATOM 2924 C CG  . LYS C 3 65  ? 24.652 63.274  23.064  1.00 236.19 ? 1085 LYS C CG  1 
ATOM 2925 C CD  . LYS C 3 65  ? 23.459 63.242  22.130  1.00 232.82 ? 1085 LYS C CD  1 
ATOM 2926 C CE  . LYS C 3 65  ? 22.432 62.226  22.596  1.00 232.77 ? 1085 LYS C CE  1 
ATOM 2927 N NZ  . LYS C 3 65  ? 21.246 62.185  21.700  1.00 231.85 ? 1085 LYS C NZ  1 
ATOM 2928 N N   . GLU C 3 66  ? 27.635 66.720  23.241  1.00 239.29 ? 1086 GLU C N   1 
ATOM 2929 C CA  . GLU C 3 66  ? 28.563 67.745  22.776  1.00 224.22 ? 1086 GLU C CA  1 
ATOM 2930 C C   . GLU C 3 66  ? 29.884 67.693  23.535  1.00 213.25 ? 1086 GLU C C   1 
ATOM 2931 O O   . GLU C 3 66  ? 30.943 67.977  22.959  1.00 216.29 ? 1086 GLU C O   1 
ATOM 2932 C CB  . GLU C 3 66  ? 27.921 69.125  22.908  1.00 223.36 ? 1086 GLU C CB  1 
ATOM 2933 C CG  . GLU C 3 66  ? 28.747 70.257  22.330  1.00 220.50 ? 1086 GLU C CG  1 
ATOM 2934 C CD  . GLU C 3 66  ? 27.994 71.570  22.329  1.00 214.86 ? 1086 GLU C CD  1 
ATOM 2935 O OE1 . GLU C 3 66  ? 26.831 71.584  22.787  1.00 208.98 ? 1086 GLU C OE1 1 
ATOM 2936 O OE2 . GLU C 3 66  ? 28.558 72.583  21.864  1.00 217.08 ? 1086 GLU C OE2 1 
ATOM 2937 N N   . ALA C 3 67  ? 29.841 67.341  24.823  1.00 205.24 ? 1087 ALA C N   1 
ATOM 2938 C CA  . ALA C 3 67  ? 31.071 67.191  25.594  1.00 221.10 ? 1087 ALA C CA  1 
ATOM 2939 C C   . ALA C 3 67  ? 31.864 65.975  25.133  1.00 198.04 ? 1087 ALA C C   1 
ATOM 2940 O O   . ALA C 3 67  ? 33.100 66.003  25.118  1.00 203.95 ? 1087 ALA C O   1 
ATOM 2941 C CB  . ALA C 3 67  ? 30.750 67.093  27.086  1.00 179.86 ? 1087 ALA C CB  1 
ATOM 2942 N N   . GLN C 3 68  ? 31.170 64.894  24.764  1.00 197.91 ? 1088 GLN C N   1 
ATOM 2943 C CA  . GLN C 3 68  ? 31.842 63.745  24.166  1.00 200.94 ? 1088 GLN C CA  1 
ATOM 2944 C C   . GLN C 3 68  ? 32.554 64.133  22.877  1.00 217.01 ? 1088 GLN C C   1 
ATOM 2945 O O   . GLN C 3 68  ? 33.695 63.719  22.641  1.00 218.76 ? 1088 GLN C O   1 
ATOM 2946 C CB  . GLN C 3 68  ? 30.834 62.630  23.894  1.00 178.34 ? 1088 GLN C CB  1 
ATOM 2947 C CG  . GLN C 3 68  ? 30.206 62.029  25.135  1.00 176.19 ? 1088 GLN C CG  1 
ATOM 2948 C CD  . GLN C 3 68  ? 29.086 61.066  24.804  1.00 170.50 ? 1088 GLN C CD  1 
ATOM 2949 O OE1 . GLN C 3 68  ? 28.577 61.044  23.682  1.00 149.87 ? 1088 GLN C OE1 1 
ATOM 2950 N NE2 . GLN C 3 68  ? 28.696 60.260  25.782  1.00 173.44 ? 1088 GLN C NE2 1 
ATOM 2951 N N   . ALA C 3 69  ? 31.890 64.920  22.027  1.00 232.44 ? 1089 ALA C N   1 
ATOM 2952 C CA  . ALA C 3 69  ? 32.509 65.357  20.780  1.00 234.29 ? 1089 ALA C CA  1 
ATOM 2953 C C   . ALA C 3 69  ? 33.712 66.252  21.042  1.00 238.24 ? 1089 ALA C C   1 
ATOM 2954 O O   . ALA C 3 69  ? 34.721 66.170  20.332  1.00 241.91 ? 1089 ALA C O   1 
ATOM 2955 C CB  . ALA C 3 69  ? 31.484 66.085  19.912  1.00 232.31 ? 1089 ALA C CB  1 
ATOM 2956 N N   . ALA C 3 70  ? 33.617 67.123  22.047  1.00 235.64 ? 1090 ALA C N   1 
ATOM 2957 C CA  . ALA C 3 70  ? 34.732 68.009  22.361  1.00 236.00 ? 1090 ALA C CA  1 
ATOM 2958 C C   . ALA C 3 70  ? 35.932 67.227  22.880  1.00 248.27 ? 1090 ALA C C   1 
ATOM 2959 O O   . ALA C 3 70  ? 37.074 67.501  22.493  1.00 248.34 ? 1090 ALA C O   1 
ATOM 2960 C CB  . ALA C 3 70  ? 34.296 69.060  23.378  1.00 224.66 ? 1090 ALA C CB  1 
ATOM 2961 N N   . ALA C 3 71  ? 35.693 66.247  23.754  1.00 262.62 ? 1091 ALA C N   1 
ATOM 2962 C CA  . ALA C 3 71  ? 36.790 65.469  24.314  1.00 269.41 ? 1091 ALA C CA  1 
ATOM 2963 C C   . ALA C 3 71  ? 37.394 64.504  23.303  1.00 265.59 ? 1091 ALA C C   1 
ATOM 2964 O O   . ALA C 3 71  ? 38.565 64.136  23.443  1.00 272.42 ? 1091 ALA C O   1 
ATOM 2965 C CB  . ALA C 3 71  ? 36.315 64.707  25.550  1.00 274.47 ? 1091 ALA C CB  1 
ATOM 2966 N N   . GLU C 3 72  ? 36.627 64.084  22.293  1.00 251.38 ? 1092 GLU C N   1 
ATOM 2967 C CA  . GLU C 3 72  ? 37.209 63.300  21.209  1.00 236.39 ? 1092 GLU C CA  1 
ATOM 2968 C C   . GLU C 3 72  ? 38.219 64.120  20.417  1.00 234.76 ? 1092 GLU C C   1 
ATOM 2969 O O   . GLU C 3 72  ? 39.200 63.570  19.902  1.00 228.51 ? 1092 GLU C O   1 
ATOM 2970 C CB  . GLU C 3 72  ? 36.105 62.774  20.288  1.00 213.65 ? 1092 GLU C CB  1 
ATOM 2971 C CG  . GLU C 3 72  ? 36.601 62.006  19.067  1.00 206.34 ? 1092 GLU C CG  1 
ATOM 2972 C CD  . GLU C 3 72  ? 37.213 60.662  19.417  1.00 201.45 ? 1092 GLU C CD  1 
ATOM 2973 O OE1 . GLU C 3 72  ? 36.920 60.134  20.511  1.00 199.97 ? 1092 GLU C OE1 1 
ATOM 2974 O OE2 . GLU C 3 72  ? 37.987 60.131  18.594  1.00 200.13 ? 1092 GLU C OE2 1 
ATOM 2975 N N   . GLN C 3 73  ? 38.003 65.428  20.322  1.00 241.87 ? 1093 GLN C N   1 
ATOM 2976 C CA  . GLN C 3 73  ? 38.928 66.327  19.645  1.00 249.60 ? 1093 GLN C CA  1 
ATOM 2977 C C   . GLN C 3 73  ? 40.204 66.524  20.458  1.00 256.20 ? 1093 GLN C C   1 
ATOM 2978 O O   . GLN C 3 73  ? 41.252 65.969  20.131  1.00 257.66 ? 1093 GLN C O   1 
ATOM 2979 C CB  . GLN C 3 73  ? 38.258 67.677  19.389  1.00 252.27 ? 1093 GLN C CB  1 
ATOM 2980 C CG  . GLN C 3 73  ? 39.175 68.729  18.795  1.00 261.24 ? 1093 GLN C CG  1 
ATOM 2981 C CD  . GLN C 3 73  ? 38.474 70.057  18.604  1.00 268.27 ? 1093 GLN C CD  1 
ATOM 2982 O OE1 . GLN C 3 73  ? 37.298 70.203  18.936  1.00 267.96 ? 1093 GLN C OE1 1 
ATOM 2983 N NE2 . GLN C 3 73  ? 39.194 71.036  18.068  1.00 275.20 ? 1093 GLN C NE2 1 
ATOM 2984 N N   . ASP D 4 1   ? 35.731 58.607  -8.825  1.00 147.07 ? 1    ASP H N   1 
ATOM 2985 C CA  . ASP D 4 1   ? 35.458 59.874  -9.491  1.00 139.26 ? 1    ASP H CA  1 
ATOM 2986 C C   . ASP D 4 1   ? 33.989 59.993  -9.900  1.00 124.75 ? 1    ASP H C   1 
ATOM 2987 O O   . ASP D 4 1   ? 33.545 59.334  -10.834 1.00 124.16 ? 1    ASP H O   1 
ATOM 2988 C CB  . ASP D 4 1   ? 36.350 60.030  -10.718 1.00 151.98 ? 1    ASP H CB  1 
ATOM 2989 C CG  . ASP D 4 1   ? 36.223 61.393  -11.348 1.00 166.23 ? 1    ASP H CG  1 
ATOM 2990 O OD1 . ASP D 4 1   ? 36.955 62.311  -10.922 1.00 172.13 ? 1    ASP H OD1 1 
ATOM 2991 O OD2 . ASP D 4 1   ? 35.378 61.552  -12.254 1.00 170.46 ? 1    ASP H OD2 1 
ATOM 2992 N N   . VAL D 4 2   ? 33.251 60.853  -9.202  1.00 99.61  ? 2    VAL H N   1 
ATOM 2993 C CA  . VAL D 4 2   ? 31.816 61.034  -9.395  1.00 97.83  ? 2    VAL H CA  1 
ATOM 2994 C C   . VAL D 4 2   ? 31.576 62.349  -10.121 1.00 112.71 ? 2    VAL H C   1 
ATOM 2995 O O   . VAL D 4 2   ? 32.191 63.370  -9.790  1.00 116.28 ? 2    VAL H O   1 
ATOM 2996 C CB  . VAL D 4 2   ? 31.069 61.028  -8.047  1.00 95.52  ? 2    VAL H CB  1 
ATOM 2997 C CG1 . VAL D 4 2   ? 29.604 61.365  -8.252  1.00 92.95  ? 2    VAL H CG1 1 
ATOM 2998 C CG2 . VAL D 4 2   ? 31.230 59.693  -7.348  1.00 83.74  ? 2    VAL H CG2 1 
ATOM 2999 N N   . GLN D 4 3   ? 30.671 62.332  -11.099 1.00 126.73 ? 3    GLN H N   1 
ATOM 3000 C CA  . GLN D 4 3   ? 30.354 63.535  -11.859 1.00 134.10 ? 3    GLN H CA  1 
ATOM 3001 C C   . GLN D 4 3   ? 28.848 63.644  -12.051 1.00 127.17 ? 3    GLN H C   1 
ATOM 3002 O O   . GLN D 4 3   ? 28.207 62.700  -12.525 1.00 130.82 ? 3    GLN H O   1 
ATOM 3003 C CB  . GLN D 4 3   ? 31.068 63.546  -13.222 1.00 144.42 ? 3    GLN H CB  1 
ATOM 3004 C CG  . GLN D 4 3   ? 32.600 63.618  -13.154 1.00 155.85 ? 3    GLN H CG  1 
ATOM 3005 C CD  . GLN D 4 3   ? 33.120 64.884  -12.488 1.00 161.35 ? 3    GLN H CD  1 
ATOM 3006 O OE1 . GLN D 4 3   ? 32.387 65.859  -12.315 1.00 164.96 ? 3    GLN H OE1 1 
ATOM 3007 N NE2 . GLN D 4 3   ? 34.393 64.871  -12.108 1.00 168.04 ? 3    GLN H NE2 1 
ATOM 3008 N N   . LEU D 4 4   ? 28.294 64.796  -11.673 1.00 116.45 ? 4    LEU H N   1 
ATOM 3009 C CA  . LEU D 4 4   ? 26.886 65.119  -11.864 1.00 100.85 ? 4    LEU H CA  1 
ATOM 3010 C C   . LEU D 4 4   ? 26.781 66.366  -12.729 1.00 99.03  ? 4    LEU H C   1 
ATOM 3011 O O   . LEU D 4 4   ? 27.510 67.340  -12.510 1.00 108.28 ? 4    LEU H O   1 
ATOM 3012 C CB  . LEU D 4 4   ? 26.178 65.345  -10.527 1.00 88.89  ? 4    LEU H CB  1 
ATOM 3013 C CG  . LEU D 4 4   ? 26.480 64.320  -9.434  1.00 96.04  ? 4    LEU H CG  1 
ATOM 3014 C CD1 . LEU D 4 4   ? 25.738 64.674  -8.158  1.00 99.12  ? 4    LEU H CD1 1 
ATOM 3015 C CD2 . LEU D 4 4   ? 26.125 62.918  -9.897  1.00 95.71  ? 4    LEU H CD2 1 
ATOM 3016 N N   . VAL D 4 5   ? 25.882 66.334  -13.713 1.00 94.18  ? 5    VAL H N   1 
ATOM 3017 C CA  . VAL D 4 5   ? 25.743 67.412  -14.688 1.00 88.85  ? 5    VAL H CA  1 
ATOM 3018 C C   . VAL D 4 5   ? 24.268 67.769  -14.817 1.00 88.53  ? 5    VAL H C   1 
ATOM 3019 O O   . VAL D 4 5   ? 23.461 66.937  -15.251 1.00 85.79  ? 5    VAL H O   1 
ATOM 3020 C CB  . VAL D 4 5   ? 26.319 67.029  -16.061 1.00 80.19  ? 5    VAL H CB  1 
ATOM 3021 C CG1 . VAL D 4 5   ? 25.877 68.020  -17.112 1.00 81.24  ? 5    VAL H CG1 1 
ATOM 3022 C CG2 . VAL D 4 5   ? 27.839 66.972  -16.011 1.00 90.47  ? 5    VAL H CG2 1 
ATOM 3023 N N   . GLU D 4 6   ? 23.922 69.006  -14.465 1.00 92.80  ? 6    GLU H N   1 
ATOM 3024 C CA  . GLU D 4 6   ? 22.568 69.517  -14.619 1.00 77.87  ? 6    GLU H CA  1 
ATOM 3025 C C   . GLU D 4 6   ? 22.410 70.195  -15.976 1.00 79.90  ? 6    GLU H C   1 
ATOM 3026 O O   . GLU D 4 6   ? 23.374 70.674  -16.578 1.00 88.88  ? 6    GLU H O   1 
ATOM 3027 C CB  . GLU D 4 6   ? 22.223 70.515  -13.509 1.00 73.91  ? 6    GLU H CB  1 
ATOM 3028 C CG  . GLU D 4 6   ? 22.279 69.973  -12.077 1.00 73.51  ? 6    GLU H CG  1 
ATOM 3029 C CD  . GLU D 4 6   ? 23.655 70.095  -11.429 1.00 76.69  ? 6    GLU H CD  1 
ATOM 3030 O OE1 . GLU D 4 6   ? 24.641 70.389  -12.139 1.00 83.21  ? 6    GLU H OE1 1 
ATOM 3031 O OE2 . GLU D 4 6   ? 23.748 69.897  -10.200 1.00 73.51  ? 6    GLU H OE2 1 
ATOM 3032 N N   . SER D 4 7   ? 21.168 70.243  -16.450 1.00 72.90  ? 7    SER H N   1 
ATOM 3033 C CA  . SER D 4 7   ? 20.869 70.907  -17.711 1.00 82.55  ? 7    SER H CA  1 
ATOM 3034 C C   . SER D 4 7   ? 19.374 71.173  -17.774 1.00 89.49  ? 7    SER H C   1 
ATOM 3035 O O   . SER D 4 7   ? 18.581 70.531  -17.078 1.00 96.31  ? 7    SER H O   1 
ATOM 3036 C CB  . SER D 4 7   ? 21.334 70.074  -18.913 1.00 95.34  ? 7    SER H CB  1 
ATOM 3037 O OG  . SER D 4 7   ? 20.769 68.775  -18.894 1.00 113.50 ? 7    SER H OG  1 
ATOM 3038 N N   . GLY D 4 8   ? 18.999 72.143  -18.605 1.00 94.66  ? 8    GLY H N   1 
ATOM 3039 C CA  . GLY D 4 8   ? 17.596 72.448  -18.809 1.00 96.72  ? 8    GLY H CA  1 
ATOM 3040 C C   . GLY D 4 8   ? 17.186 73.838  -18.367 1.00 92.79  ? 8    GLY H C   1 
ATOM 3041 O O   . GLY D 4 8   ? 15.994 74.162  -18.357 1.00 93.23  ? 8    GLY H O   1 
ATOM 3042 N N   . GLY D 4 9   ? 18.158 74.669  -18.004 1.00 90.67  ? 9    GLY H N   1 
ATOM 3043 C CA  . GLY D 4 9   ? 17.875 76.007  -17.533 1.00 88.53  ? 9    GLY H CA  1 
ATOM 3044 C C   . GLY D 4 9   ? 17.470 76.942  -18.657 1.00 93.05  ? 9    GLY H C   1 
ATOM 3045 O O   . GLY D 4 9   ? 17.399 76.576  -19.830 1.00 94.96  ? 9    GLY H O   1 
ATOM 3046 N N   . GLY D 4 10  ? 17.191 78.180  -18.281 1.00 108.19 ? 10   GLY H N   1 
ATOM 3047 C CA  . GLY D 4 10  ? 16.848 79.205  -19.244 1.00 117.85 ? 10   GLY H CA  1 
ATOM 3048 C C   . GLY D 4 10  ? 15.842 80.181  -18.666 1.00 114.37 ? 10   GLY H C   1 
ATOM 3049 O O   . GLY D 4 10  ? 15.615 80.231  -17.460 1.00 114.87 ? 10   GLY H O   1 
ATOM 3050 N N   . LEU D 4 11  ? 15.241 80.961  -19.560 1.00 114.99 ? 11   LEU H N   1 
ATOM 3051 C CA  . LEU D 4 11  ? 14.270 81.982  -19.187 1.00 109.97 ? 11   LEU H CA  1 
ATOM 3052 C C   . LEU D 4 11  ? 12.858 81.471  -19.445 1.00 108.03 ? 11   LEU H C   1 
ATOM 3053 O O   . LEU D 4 11  ? 12.550 81.011  -20.550 1.00 108.18 ? 11   LEU H O   1 
ATOM 3054 C CB  . LEU D 4 11  ? 14.517 83.279  -19.961 1.00 110.98 ? 11   LEU H CB  1 
ATOM 3055 C CG  . LEU D 4 11  ? 13.535 84.423  -19.689 1.00 114.79 ? 11   LEU H CG  1 
ATOM 3056 C CD1 . LEU D 4 11  ? 13.652 84.928  -18.252 1.00 107.74 ? 11   LEU H CD1 1 
ATOM 3057 C CD2 . LEU D 4 11  ? 13.725 85.556  -20.689 1.00 123.31 ? 11   LEU H CD2 1 
ATOM 3058 N N   . VAL D 4 12  ? 12.005 81.559  -18.425 1.00 109.89 ? 12   VAL H N   1 
ATOM 3059 C CA  . VAL D 4 12  ? 10.621 81.106  -18.497 1.00 118.58 ? 12   VAL H CA  1 
ATOM 3060 C C   . VAL D 4 12  ? 9.723  82.211  -17.957 1.00 120.17 ? 12   VAL H C   1 
ATOM 3061 O O   . VAL D 4 12  ? 10.036 82.833  -16.936 1.00 115.40 ? 12   VAL H O   1 
ATOM 3062 C CB  . VAL D 4 12  ? 10.407 79.794  -17.706 1.00 111.87 ? 12   VAL H CB  1 
ATOM 3063 C CG1 . VAL D 4 12  ? 8.953  79.339  -17.785 1.00 114.23 ? 12   VAL H CG1 1 
ATOM 3064 C CG2 . VAL D 4 12  ? 11.333 78.701  -18.219 1.00 112.98 ? 12   VAL H CG2 1 
ATOM 3065 N N   . GLN D 4 13  ? 8.615  82.463  -18.648 1.00 135.73 ? 13   GLN H N   1 
ATOM 3066 C CA  . GLN D 4 13  ? 7.642  83.420  -18.151 1.00 143.51 ? 13   GLN H CA  1 
ATOM 3067 C C   . GLN D 4 13  ? 6.962  82.869  -16.897 1.00 143.72 ? 13   GLN H C   1 
ATOM 3068 O O   . GLN D 4 13  ? 6.903  81.652  -16.699 1.00 144.38 ? 13   GLN H O   1 
ATOM 3069 C CB  . GLN D 4 13  ? 6.601  83.734  -19.223 1.00 148.67 ? 13   GLN H CB  1 
ATOM 3070 C CG  . GLN D 4 13  ? 7.159  84.517  -20.396 1.00 153.09 ? 13   GLN H CG  1 
ATOM 3071 C CD  . GLN D 4 13  ? 6.083  84.957  -21.364 1.00 163.14 ? 13   GLN H CD  1 
ATOM 3072 O OE1 . GLN D 4 13  ? 4.914  84.605  -21.211 1.00 167.29 ? 13   GLN H OE1 1 
ATOM 3073 N NE2 . GLN D 4 13  ? 6.472  85.733  -22.368 1.00 170.34 ? 13   GLN H NE2 1 
ATOM 3074 N N   . PRO D 4 14  ? 6.466  83.745  -16.023 1.00 139.17 ? 14   PRO H N   1 
ATOM 3075 C CA  . PRO D 4 14  ? 5.812  83.273  -14.794 1.00 138.42 ? 14   PRO H CA  1 
ATOM 3076 C C   . PRO D 4 14  ? 4.630  82.364  -15.099 1.00 139.55 ? 14   PRO H C   1 
ATOM 3077 O O   . PRO D 4 14  ? 3.761  82.695  -15.909 1.00 146.44 ? 14   PRO H O   1 
ATOM 3078 C CB  . PRO D 4 14  ? 5.370  84.570  -14.112 1.00 139.22 ? 14   PRO H CB  1 
ATOM 3079 C CG  . PRO D 4 14  ? 6.321  85.600  -14.621 1.00 142.81 ? 14   PRO H CG  1 
ATOM 3080 C CD  . PRO D 4 14  ? 6.618  85.211  -16.040 1.00 143.68 ? 14   PRO H CD  1 
ATOM 3081 N N   . GLY D 4 15  ? 4.608  81.208  -14.441 1.00 136.68 ? 15   GLY H N   1 
ATOM 3082 C CA  . GLY D 4 15  ? 3.570  80.221  -14.652 1.00 130.43 ? 15   GLY H CA  1 
ATOM 3083 C C   . GLY D 4 15  ? 3.890  79.147  -15.666 1.00 130.26 ? 15   GLY H C   1 
ATOM 3084 O O   . GLY D 4 15  ? 3.016  78.327  -15.966 1.00 130.96 ? 15   GLY H O   1 
ATOM 3085 N N   . GLY D 4 16  ? 5.107  79.121  -16.201 1.00 129.17 ? 16   GLY H N   1 
ATOM 3086 C CA  . GLY D 4 16  ? 5.482  78.141  -17.197 1.00 129.33 ? 16   GLY H CA  1 
ATOM 3087 C C   . GLY D 4 16  ? 5.922  76.825  -16.583 1.00 126.52 ? 16   GLY H C   1 
ATOM 3088 O O   . GLY D 4 16  ? 5.840  76.596  -15.376 1.00 126.22 ? 16   GLY H O   1 
ATOM 3089 N N   . SER D 4 17  ? 6.404  75.943  -17.452 1.00 131.72 ? 17   SER H N   1 
ATOM 3090 C CA  . SER D 4 17  ? 6.871  74.627  -17.053 1.00 133.11 ? 17   SER H CA  1 
ATOM 3091 C C   . SER D 4 17  ? 8.262  74.392  -17.617 1.00 134.12 ? 17   SER H C   1 
ATOM 3092 O O   . SER D 4 17  ? 8.627  74.941  -18.659 1.00 147.42 ? 17   SER H O   1 
ATOM 3093 C CB  . SER D 4 17  ? 5.915  73.529  -17.525 1.00 141.14 ? 17   SER H CB  1 
ATOM 3094 O OG  . SER D 4 17  ? 4.611  73.763  -17.025 1.00 148.34 ? 17   SER H OG  1 
ATOM 3095 N N   . ARG D 4 18  ? 9.039  73.572  -16.914 1.00 121.00 ? 18   ARG H N   1 
ATOM 3096 C CA  . ARG D 4 18  ? 10.424 73.337  -17.300 1.00 105.38 ? 18   ARG H CA  1 
ATOM 3097 C C   . ARG D 4 18  ? 10.908 72.071  -16.612 1.00 112.03 ? 18   ARG H C   1 
ATOM 3098 O O   . ARG D 4 18  ? 10.785 71.951  -15.392 1.00 120.59 ? 18   ARG H O   1 
ATOM 3099 C CB  . ARG D 4 18  ? 11.303 74.531  -16.910 1.00 79.74  ? 18   ARG H CB  1 
ATOM 3100 C CG  . ARG D 4 18  ? 12.648 74.585  -17.608 1.00 83.06  ? 18   ARG H CG  1 
ATOM 3101 C CD  . ARG D 4 18  ? 12.508 75.201  -18.985 1.00 103.52 ? 18   ARG H CD  1 
ATOM 3102 N NE  . ARG D 4 18  ? 13.795 75.469  -19.617 1.00 114.95 ? 18   ARG H NE  1 
ATOM 3103 C CZ  . ARG D 4 18  ? 13.928 76.045  -20.808 1.00 133.66 ? 18   ARG H CZ  1 
ATOM 3104 N NH1 . ARG D 4 18  ? 12.851 76.413  -21.490 1.00 141.31 ? 18   ARG H NH1 1 
ATOM 3105 N NH2 . ARG D 4 18  ? 15.135 76.256  -21.318 1.00 138.73 ? 18   ARG H NH2 1 
ATOM 3106 N N   . LYS D 4 19  ? 11.458 71.137  -17.383 1.00 112.44 ? 19   LYS H N   1 
ATOM 3107 C CA  . LYS D 4 19  ? 11.974 69.883  -16.843 1.00 107.82 ? 19   LYS H CA  1 
ATOM 3108 C C   . LYS D 4 19  ? 13.495 69.951  -16.841 1.00 101.21 ? 19   LYS H C   1 
ATOM 3109 O O   . LYS D 4 19  ? 14.124 69.979  -17.905 1.00 102.74 ? 19   LYS H O   1 
ATOM 3110 C CB  . LYS D 4 19  ? 11.470 68.684  -17.647 1.00 117.46 ? 19   LYS H CB  1 
ATOM 3111 C CG  . LYS D 4 19  ? 12.012 67.336  -17.171 1.00 116.60 ? 19   LYS H CG  1 
ATOM 3112 C CD  . LYS D 4 19  ? 11.054 66.191  -17.491 1.00 125.54 ? 19   LYS H CD  1 
ATOM 3113 C CE  . LYS D 4 19  ? 10.851 66.015  -18.988 1.00 132.76 ? 19   LYS H CE  1 
ATOM 3114 N NZ  . LYS D 4 19  ? 9.884  64.920  -19.278 1.00 138.18 ? 19   LYS H NZ  1 
ATOM 3115 N N   . LEU D 4 20  ? 14.080 69.985  -15.645 1.00 96.08  ? 20   LEU H N   1 
ATOM 3116 C CA  . LEU D 4 20  ? 15.526 69.946  -15.482 1.00 98.00  ? 20   LEU H CA  1 
ATOM 3117 C C   . LEU D 4 20  ? 15.997 68.503  -15.381 1.00 101.26 ? 20   LEU H C   1 
ATOM 3118 O O   . LEU D 4 20  ? 15.303 67.650  -14.816 1.00 101.89 ? 20   LEU H O   1 
ATOM 3119 C CB  . LEU D 4 20  ? 15.952 70.715  -14.234 1.00 99.90  ? 20   LEU H CB  1 
ATOM 3120 C CG  . LEU D 4 20  ? 15.402 72.132  -14.116 1.00 100.29 ? 20   LEU H CG  1 
ATOM 3121 C CD1 . LEU D 4 20  ? 15.808 72.727  -12.778 1.00 98.61  ? 20   LEU H CD1 1 
ATOM 3122 C CD2 . LEU D 4 20  ? 15.888 72.991  -15.277 1.00 97.74  ? 20   LEU H CD2 1 
ATOM 3123 N N   . SER D 4 21  ? 17.178 68.232  -15.935 1.00 101.54 ? 21   SER H N   1 
ATOM 3124 C CA  . SER D 4 21  ? 17.736 66.889  -15.948 1.00 105.53 ? 21   SER H CA  1 
ATOM 3125 C C   . SER D 4 21  ? 19.127 66.889  -15.325 1.00 103.18 ? 21   SER H C   1 
ATOM 3126 O O   . SER D 4 21  ? 19.830 67.907  -15.323 1.00 102.22 ? 21   SER H O   1 
ATOM 3127 C CB  . SER D 4 21  ? 17.782 66.313  -17.380 1.00 115.34 ? 21   SER H CB  1 
ATOM 3128 O OG  . SER D 4 21  ? 18.690 67.011  -18.215 1.00 130.42 ? 21   SER H OG  1 
ATOM 3129 N N   . CYS D 4 22  ? 19.506 65.736  -14.776 1.00 102.31 ? 22   CYS H N   1 
ATOM 3130 C CA  . CYS D 4 22  ? 20.790 65.557  -14.107 1.00 100.55 ? 22   CYS H CA  1 
ATOM 3131 C C   . CYS D 4 22  ? 21.347 64.202  -14.505 1.00 99.52  ? 22   CYS H C   1 
ATOM 3132 O O   . CYS D 4 22  ? 20.735 63.170  -14.218 1.00 104.85 ? 22   CYS H O   1 
ATOM 3133 C CB  . CYS D 4 22  ? 20.648 65.649  -12.584 1.00 102.16 ? 22   CYS H CB  1 
ATOM 3134 S SG  . CYS D 4 22  ? 22.115 65.147  -11.629 1.00 106.67 ? 22   CYS H SG  1 
ATOM 3135 N N   . ALA D 4 23  ? 22.492 64.209  -15.173 1.00 102.52 ? 23   ALA H N   1 
ATOM 3136 C CA  . ALA D 4 23  ? 23.159 62.987  -15.585 1.00 107.26 ? 23   ALA H CA  1 
ATOM 3137 C C   . ALA D 4 23  ? 24.294 62.679  -14.619 1.00 105.59 ? 23   ALA H C   1 
ATOM 3138 O O   . ALA D 4 23  ? 25.057 63.572  -14.236 1.00 106.83 ? 23   ALA H O   1 
ATOM 3139 C CB  . ALA D 4 23  ? 23.691 63.113  -17.014 1.00 118.13 ? 23   ALA H CB  1 
ATOM 3140 N N   . ALA D 4 24  ? 24.399 61.411  -14.228 1.00 103.81 ? 24   ALA H N   1 
ATOM 3141 C CA  . ALA D 4 24  ? 25.367 60.969  -13.235 1.00 104.23 ? 24   ALA H CA  1 
ATOM 3142 C C   . ALA D 4 24  ? 26.302 59.930  -13.838 1.00 113.38 ? 24   ALA H C   1 
ATOM 3143 O O   . ALA D 4 24  ? 25.878 59.099  -14.648 1.00 118.58 ? 24   ALA H O   1 
ATOM 3144 C CB  . ALA D 4 24  ? 24.660 60.386  -12.009 1.00 86.23  ? 24   ALA H CB  1 
ATOM 3145 N N   . SER D 4 25  ? 27.576 59.983  -13.447 1.00 115.25 ? 25   SER H N   1 
ATOM 3146 C CA  . SER D 4 25  ? 28.533 58.961  -13.849 1.00 117.81 ? 25   SER H CA  1 
ATOM 3147 C C   . SER D 4 25  ? 29.601 58.814  -12.777 1.00 123.54 ? 25   SER H C   1 
ATOM 3148 O O   . SER D 4 25  ? 29.804 59.701  -11.945 1.00 125.79 ? 25   SER H O   1 
ATOM 3149 C CB  . SER D 4 25  ? 29.198 59.285  -15.190 1.00 130.08 ? 25   SER H CB  1 
ATOM 3150 O OG  . SER D 4 25  ? 30.301 60.154  -15.001 1.00 135.95 ? 25   SER H OG  1 
ATOM 3151 N N   . GLY D 4 26  ? 30.295 57.682  -12.822 1.00 133.07 ? 26   GLY H N   1 
ATOM 3152 C CA  . GLY D 4 26  ? 31.344 57.389  -11.869 1.00 127.97 ? 26   GLY H CA  1 
ATOM 3153 C C   . GLY D 4 26  ? 30.917 56.583  -10.666 1.00 113.67 ? 26   GLY H C   1 
ATOM 3154 O O   . GLY D 4 26  ? 31.730 56.394  -9.753  1.00 102.96 ? 26   GLY H O   1 
ATOM 3155 N N   . PHE D 4 27  ? 29.675 56.098  -10.634 1.00 120.49 ? 27   PHE H N   1 
ATOM 3156 C CA  . PHE D 4 27  ? 29.180 55.309  -9.513  1.00 124.07 ? 27   PHE H CA  1 
ATOM 3157 C C   . PHE D 4 27  ? 27.927 54.553  -9.939  1.00 127.43 ? 27   PHE H C   1 
ATOM 3158 O O   . PHE D 4 27  ? 27.309 54.866  -10.960 1.00 133.88 ? 27   PHE H O   1 
ATOM 3159 C CB  . PHE D 4 27  ? 28.888 56.193  -8.296  1.00 111.94 ? 27   PHE H CB  1 
ATOM 3160 C CG  . PHE D 4 27  ? 27.785 57.187  -8.518  1.00 107.87 ? 27   PHE H CG  1 
ATOM 3161 C CD1 . PHE D 4 27  ? 28.041 58.405  -9.121  1.00 104.85 ? 27   PHE H CD1 1 
ATOM 3162 C CD2 . PHE D 4 27  ? 26.491 56.904  -8.117  1.00 110.65 ? 27   PHE H CD2 1 
ATOM 3163 C CE1 . PHE D 4 27  ? 27.028 59.321  -9.321  1.00 105.60 ? 27   PHE H CE1 1 
ATOM 3164 C CE2 . PHE D 4 27  ? 25.475 57.814  -8.313  1.00 107.04 ? 27   PHE H CE2 1 
ATOM 3165 C CZ  . PHE D 4 27  ? 25.744 59.025  -8.916  1.00 104.77 ? 27   PHE H CZ  1 
ATOM 3166 N N   . THR D 4 28  ? 27.563 53.542  -9.144  1.00 122.85 ? 28   THR H N   1 
ATOM 3167 C CA  . THR D 4 28  ? 26.312 52.810  -9.347  1.00 121.03 ? 28   THR H CA  1 
ATOM 3168 C C   . THR D 4 28  ? 25.143 53.720  -8.981  1.00 115.80 ? 28   THR H C   1 
ATOM 3169 O O   . THR D 4 28  ? 24.953 54.042  -7.805  1.00 112.57 ? 28   THR H O   1 
ATOM 3170 C CB  . THR D 4 28  ? 26.279 51.538  -8.502  1.00 116.85 ? 28   THR H CB  1 
ATOM 3171 O OG1 . THR D 4 28  ? 27.323 50.639  -8.906  1.00 121.11 ? 28   THR H OG1 1 
ATOM 3172 C CG2 . THR D 4 28  ? 24.930 50.837  -8.654  1.00 112.72 ? 28   THR H CG2 1 
ATOM 3173 N N   . PHE D 4 29  ? 24.347 54.131  -9.975  1.00 122.21 ? 29   PHE H N   1 
ATOM 3174 C CA  . PHE D 4 29  ? 23.392 55.216  -9.746  1.00 118.55 ? 29   PHE H CA  1 
ATOM 3175 C C   . PHE D 4 29  ? 22.199 54.730  -8.941  1.00 118.04 ? 29   PHE H C   1 
ATOM 3176 O O   . PHE D 4 29  ? 21.727 55.420  -8.031  1.00 118.31 ? 29   PHE H O   1 
ATOM 3177 C CB  . PHE D 4 29  ? 22.923 55.804  -11.082 1.00 120.62 ? 29   PHE H CB  1 
ATOM 3178 C CG  . PHE D 4 29  ? 21.936 56.939  -10.939 1.00 120.07 ? 29   PHE H CG  1 
ATOM 3179 C CD1 . PHE D 4 29  ? 22.353 58.196  -10.517 1.00 128.78 ? 29   PHE H CD1 1 
ATOM 3180 C CD2 . PHE D 4 29  ? 20.592 56.753  -11.228 1.00 119.51 ? 29   PHE H CD2 1 
ATOM 3181 C CE1 . PHE D 4 29  ? 21.442 59.245  -10.383 1.00 118.61 ? 29   PHE H CE1 1 
ATOM 3182 C CE2 . PHE D 4 29  ? 19.682 57.794  -11.098 1.00 117.36 ? 29   PHE H CE2 1 
ATOM 3183 C CZ  . PHE D 4 29  ? 20.106 59.039  -10.675 1.00 112.64 ? 29   PHE H CZ  1 
ATOM 3184 N N   . SER D 4 30  ? 21.706 53.534  -9.266  1.00 117.26 ? 30   SER H N   1 
ATOM 3185 C CA  . SER D 4 30  ? 20.492 52.991  -8.664  1.00 116.34 ? 30   SER H CA  1 
ATOM 3186 C C   . SER D 4 30  ? 20.761 52.320  -7.319  1.00 118.94 ? 30   SER H C   1 
ATOM 3187 O O   . SER D 4 30  ? 20.307 51.212  -7.032  1.00 146.60 ? 30   SER H O   1 
ATOM 3188 C CB  . SER D 4 30  ? 19.812 52.021  -9.622  1.00 126.45 ? 30   SER H CB  1 
ATOM 3189 O OG  . SER D 4 30  ? 20.572 50.836  -9.822  1.00 134.82 ? 30   SER H OG  1 
ATOM 3190 N N   . GLY D 4 31  ? 21.517 53.024  -6.495  1.00 106.26 ? 31   GLY H N   1 
ATOM 3191 C CA  . GLY D 4 31  ? 21.724 52.598  -5.120  1.00 114.47 ? 31   GLY H CA  1 
ATOM 3192 C C   . GLY D 4 31  ? 21.636 53.708  -4.093  1.00 122.71 ? 31   GLY H C   1 
ATOM 3193 O O   . GLY D 4 31  ? 21.662 53.413  -2.899  1.00 130.59 ? 31   GLY H O   1 
ATOM 3194 N N   . PHE D 4 32  ? 21.493 54.968  -4.514  1.00 120.70 ? 32   PHE H N   1 
ATOM 3195 C CA  . PHE D 4 32  ? 21.581 56.098  -3.594  1.00 110.30 ? 32   PHE H CA  1 
ATOM 3196 C C   . PHE D 4 32  ? 20.470 57.089  -3.900  1.00 110.09 ? 32   PHE H C   1 
ATOM 3197 O O   . PHE D 4 32  ? 19.927 57.111  -5.004  1.00 105.46 ? 32   PHE H O   1 
ATOM 3198 C CB  . PHE D 4 32  ? 22.946 56.791  -3.690  1.00 103.09 ? 32   PHE H CB  1 
ATOM 3199 C CG  . PHE D 4 32  ? 24.111 55.859  -3.528  1.00 99.25  ? 32   PHE H CG  1 
ATOM 3200 C CD1 . PHE D 4 32  ? 24.595 55.556  -2.267  1.00 101.32 ? 32   PHE H CD1 1 
ATOM 3201 C CD2 . PHE D 4 32  ? 24.719 55.284  -4.632  1.00 100.75 ? 32   PHE H CD2 1 
ATOM 3202 C CE1 . PHE D 4 32  ? 25.664 54.699  -2.108  1.00 109.34 ? 32   PHE H CE1 1 
ATOM 3203 C CE2 . PHE D 4 32  ? 25.790 54.423  -4.479  1.00 104.79 ? 32   PHE H CE2 1 
ATOM 3204 C CZ  . PHE D 4 32  ? 26.263 54.133  -3.215  1.00 106.89 ? 32   PHE H CZ  1 
ATOM 3205 N N   . GLY D 4 33  ? 20.132 57.915  -2.917  1.00 125.72 ? 33   GLY H N   1 
ATOM 3206 C CA  . GLY D 4 33  ? 19.122 58.934  -3.111  1.00 126.79 ? 33   GLY H CA  1 
ATOM 3207 C C   . GLY D 4 33  ? 19.719 60.229  -3.632  1.00 126.55 ? 33   GLY H C   1 
ATOM 3208 O O   . GLY D 4 33  ? 20.875 60.549  -3.371  1.00 133.02 ? 33   GLY H O   1 
ATOM 3209 N N   . MET D 4 34  ? 18.908 60.977  -4.374  1.00 110.63 ? 34   MET H N   1 
ATOM 3210 C CA  . MET D 4 34  ? 19.339 62.221  -4.991  1.00 106.32 ? 34   MET H CA  1 
ATOM 3211 C C   . MET D 4 34  ? 18.445 63.362  -4.524  1.00 102.60 ? 34   MET H C   1 
ATOM 3212 O O   . MET D 4 34  ? 17.229 63.195  -4.383  1.00 104.90 ? 34   MET H O   1 
ATOM 3213 C CB  . MET D 4 34  ? 19.304 62.114  -6.519  1.00 109.89 ? 34   MET H CB  1 
ATOM 3214 C CG  . MET D 4 34  ? 19.995 60.874  -7.073  1.00 110.13 ? 34   MET H CG  1 
ATOM 3215 S SD  . MET D 4 34  ? 21.786 60.901  -6.860  1.00 111.90 ? 34   MET H SD  1 
ATOM 3216 C CE  . MET D 4 34  ? 22.250 62.303  -7.873  1.00 121.23 ? 34   MET H CE  1 
ATOM 3217 N N   . HIS D 4 35  ? 19.054 64.518  -4.283  1.00 94.08  ? 35   HIS H N   1 
ATOM 3218 C CA  . HIS D 4 35  ? 18.335 65.718  -3.889  1.00 90.93  ? 35   HIS H CA  1 
ATOM 3219 C C   . HIS D 4 35  ? 18.478 66.782  -4.967  1.00 91.87  ? 35   HIS H C   1 
ATOM 3220 O O   . HIS D 4 35  ? 19.510 66.874  -5.642  1.00 85.98  ? 35   HIS H O   1 
ATOM 3221 C CB  . HIS D 4 35  ? 18.849 66.287  -2.554  1.00 83.95  ? 35   HIS H CB  1 
ATOM 3222 C CG  . HIS D 4 35  ? 18.975 65.273  -1.459  1.00 86.50  ? 35   HIS H CG  1 
ATOM 3223 N ND1 . HIS D 4 35  ? 18.230 65.331  -0.300  1.00 91.07  ? 35   HIS H ND1 1 
ATOM 3224 C CD2 . HIS D 4 35  ? 19.777 64.189  -1.336  1.00 93.11  ? 35   HIS H CD2 1 
ATOM 3225 C CE1 . HIS D 4 35  ? 18.562 64.323  0.486   1.00 94.28  ? 35   HIS H CE1 1 
ATOM 3226 N NE2 . HIS D 4 35  ? 19.495 63.611  -0.121  1.00 97.00  ? 35   HIS H NE2 1 
ATOM 3227 N N   . TRP D 4 36  ? 17.421 67.574  -5.132  1.00 92.77  ? 36   TRP H N   1 
ATOM 3228 C CA  . TRP D 4 36  ? 17.476 68.837  -5.853  1.00 83.95  ? 36   TRP H CA  1 
ATOM 3229 C C   . TRP D 4 36  ? 17.532 69.972  -4.842  1.00 81.90  ? 36   TRP H C   1 
ATOM 3230 O O   . TRP D 4 36  ? 16.685 70.048  -3.943  1.00 82.62  ? 36   TRP H O   1 
ATOM 3231 C CB  . TRP D 4 36  ? 16.265 69.019  -6.766  1.00 91.29  ? 36   TRP H CB  1 
ATOM 3232 C CG  . TRP D 4 36  ? 16.341 68.256  -8.042  1.00 96.41  ? 36   TRP H CG  1 
ATOM 3233 C CD1 . TRP D 4 36  ? 15.629 67.144  -8.372  1.00 102.26 ? 36   TRP H CD1 1 
ATOM 3234 C CD2 . TRP D 4 36  ? 17.172 68.552  -9.169  1.00 92.23  ? 36   TRP H CD2 1 
ATOM 3235 N NE1 . TRP D 4 36  ? 15.963 66.726  -9.637  1.00 102.98 ? 36   TRP H NE1 1 
ATOM 3236 C CE2 . TRP D 4 36  ? 16.912 67.573  -10.147 1.00 93.94  ? 36   TRP H CE2 1 
ATOM 3237 C CE3 . TRP D 4 36  ? 18.112 69.549  -9.446  1.00 89.58  ? 36   TRP H CE3 1 
ATOM 3238 C CZ2 . TRP D 4 36  ? 17.558 67.560  -11.380 1.00 90.13  ? 36   TRP H CZ2 1 
ATOM 3239 C CZ3 . TRP D 4 36  ? 18.752 69.535  -10.671 1.00 90.50  ? 36   TRP H CZ3 1 
ATOM 3240 C CH2 . TRP D 4 36  ? 18.472 68.547  -11.623 1.00 91.71  ? 36   TRP H CH2 1 
ATOM 3241 N N   . VAL D 4 37  ? 18.522 70.849  -4.998  1.00 88.97  ? 37   VAL H N   1 
ATOM 3242 C CA  . VAL D 4 37  ? 18.759 71.966  -4.090  1.00 94.64  ? 37   VAL H CA  1 
ATOM 3243 C C   . VAL D 4 37  ? 19.100 73.198  -4.921  1.00 92.54  ? 37   VAL H C   1 
ATOM 3244 O O   . VAL D 4 37  ? 20.044 73.170  -5.716  1.00 85.40  ? 37   VAL H O   1 
ATOM 3245 C CB  . VAL D 4 37  ? 19.894 71.648  -3.096  1.00 98.03  ? 37   VAL H CB  1 
ATOM 3246 C CG1 . VAL D 4 37  ? 20.273 72.884  -2.286  1.00 100.90 ? 37   VAL H CG1 1 
ATOM 3247 C CG2 . VAL D 4 37  ? 19.495 70.494  -2.183  1.00 100.67 ? 37   VAL H CG2 1 
ATOM 3248 N N   . ARG D 4 38  ? 18.350 74.280  -4.729  1.00 88.47  ? 38   ARG H N   1 
ATOM 3249 C CA  . ARG D 4 38  ? 18.548 75.517  -5.471  1.00 77.93  ? 38   ARG H CA  1 
ATOM 3250 C C   . ARG D 4 38  ? 19.148 76.597  -4.580  1.00 82.78  ? 38   ARG H C   1 
ATOM 3251 O O   . ARG D 4 38  ? 19.107 76.517  -3.348  1.00 94.43  ? 38   ARG H O   1 
ATOM 3252 C CB  . ARG D 4 38  ? 17.229 76.019  -6.067  1.00 73.42  ? 38   ARG H CB  1 
ATOM 3253 C CG  . ARG D 4 38  ? 16.225 76.560  -5.054  1.00 78.07  ? 38   ARG H CG  1 
ATOM 3254 C CD  . ARG D 4 38  ? 14.889 76.817  -5.738  1.00 84.34  ? 38   ARG H CD  1 
ATOM 3255 N NE  . ARG D 4 38  ? 13.852 77.322  -4.842  1.00 89.97  ? 38   ARG H NE  1 
ATOM 3256 C CZ  . ARG D 4 38  ? 12.590 77.521  -5.213  1.00 98.43  ? 38   ARG H CZ  1 
ATOM 3257 N NH1 . ARG D 4 38  ? 12.213 77.251  -6.457  1.00 109.21 ? 38   ARG H NH1 1 
ATOM 3258 N NH2 . ARG D 4 38  ? 11.702 77.985  -4.345  1.00 98.22  ? 38   ARG H NH2 1 
ATOM 3259 N N   . GLN D 4 39  ? 19.710 77.615  -5.234  1.00 83.53  ? 39   GLN H N   1 
ATOM 3260 C CA  . GLN D 4 39  ? 20.305 78.771  -4.568  1.00 91.19  ? 39   GLN H CA  1 
ATOM 3261 C C   . GLN D 4 39  ? 19.881 80.034  -5.298  1.00 87.50  ? 39   GLN H C   1 
ATOM 3262 O O   . GLN D 4 39  ? 20.174 80.190  -6.487  1.00 67.32  ? 39   GLN H O   1 
ATOM 3263 C CB  . GLN D 4 39  ? 21.830 78.673  -4.537  1.00 66.61  ? 39   GLN H CB  1 
ATOM 3264 C CG  . GLN D 4 39  ? 22.513 79.814  -3.814  1.00 69.54  ? 39   GLN H CG  1 
ATOM 3265 C CD  . GLN D 4 39  ? 24.014 79.661  -3.820  1.00 76.92  ? 39   GLN H CD  1 
ATOM 3266 O OE1 . GLN D 4 39  ? 24.577 79.085  -4.747  1.00 88.61  ? 39   GLN H OE1 1 
ATOM 3267 N NE2 . GLN D 4 39  ? 24.672 80.156  -2.778  1.00 84.74  ? 39   GLN H NE2 1 
ATOM 3268 N N   . ALA D 4 40  ? 19.215 80.937  -4.585  1.00 93.57  ? 40   ALA H N   1 
ATOM 3269 C CA  . ALA D 4 40  ? 18.740 82.166  -5.197  1.00 89.47  ? 40   ALA H CA  1 
ATOM 3270 C C   . ALA D 4 40  ? 19.916 83.083  -5.540  1.00 101.16 ? 40   ALA H C   1 
ATOM 3271 O O   . ALA D 4 40  ? 20.984 82.992  -4.924  1.00 108.15 ? 40   ALA H O   1 
ATOM 3272 C CB  . ALA D 4 40  ? 17.773 82.884  -4.260  1.00 99.12  ? 40   ALA H CB  1 
ATOM 3273 N N   . PRO D 4 41  ? 19.748 83.967  -6.528  1.00 101.94 ? 41   PRO H N   1 
ATOM 3274 C CA  . PRO D 4 41  ? 20.833 84.888  -6.890  1.00 94.95  ? 41   PRO H CA  1 
ATOM 3275 C C   . PRO D 4 41  ? 21.223 85.780  -5.723  1.00 97.91  ? 41   PRO H C   1 
ATOM 3276 O O   . PRO D 4 41  ? 20.384 86.464  -5.131  1.00 86.72  ? 41   PRO H O   1 
ATOM 3277 C CB  . PRO D 4 41  ? 20.240 85.698  -8.045  1.00 92.07  ? 41   PRO H CB  1 
ATOM 3278 C CG  . PRO D 4 41  ? 19.196 84.822  -8.616  1.00 95.16  ? 41   PRO H CG  1 
ATOM 3279 C CD  . PRO D 4 41  ? 18.605 84.093  -7.446  1.00 100.45 ? 41   PRO H CD  1 
ATOM 3280 N N   . GLU D 4 42  ? 22.517 85.751  -5.393  1.00 113.95 ? 42   GLU H N   1 
ATOM 3281 C CA  . GLU D 4 42  ? 23.117 86.520  -4.305  1.00 121.47 ? 42   GLU H CA  1 
ATOM 3282 C C   . GLU D 4 42  ? 22.523 86.164  -2.951  1.00 123.13 ? 42   GLU H C   1 
ATOM 3283 O O   . GLU D 4 42  ? 22.625 86.943  -1.999  1.00 135.42 ? 42   GLU H O   1 
ATOM 3284 C CB  . GLU D 4 42  ? 22.991 88.021  -4.556  1.00 129.11 ? 42   GLU H CB  1 
ATOM 3285 C CG  . GLU D 4 42  ? 23.580 88.458  -5.871  1.00 129.91 ? 42   GLU H CG  1 
ATOM 3286 C CD  . GLU D 4 42  ? 23.297 89.906  -6.146  1.00 138.75 ? 42   GLU H CD  1 
ATOM 3287 O OE1 . GLU D 4 42  ? 22.762 90.574  -5.239  1.00 141.00 ? 42   GLU H OE1 1 
ATOM 3288 O OE2 . GLU D 4 42  ? 23.599 90.375  -7.262  1.00 148.70 ? 42   GLU H OE2 1 
ATOM 3289 N N   . LYS D 4 43  ? 21.913 84.989  -2.848  1.00 116.00 ? 43   LYS H N   1 
ATOM 3290 C CA  . LYS D 4 43  ? 21.304 84.519  -1.618  1.00 113.71 ? 43   LYS H CA  1 
ATOM 3291 C C   . LYS D 4 43  ? 21.810 83.111  -1.323  1.00 114.70 ? 43   LYS H C   1 
ATOM 3292 O O   . LYS D 4 43  ? 22.608 82.546  -2.076  1.00 107.62 ? 43   LYS H O   1 
ATOM 3293 C CB  . LYS D 4 43  ? 19.776 84.563  -1.714  1.00 106.39 ? 43   LYS H CB  1 
ATOM 3294 C CG  . LYS D 4 43  ? 19.222 85.959  -1.938  1.00 107.84 ? 43   LYS H CG  1 
ATOM 3295 C CD  . LYS D 4 43  ? 17.707 85.941  -1.991  1.00 120.60 ? 43   LYS H CD  1 
ATOM 3296 C CE  . LYS D 4 43  ? 17.154 87.349  -2.129  1.00 140.86 ? 43   LYS H CE  1 
ATOM 3297 N NZ  . LYS D 4 43  ? 15.666 87.384  -2.207  1.00 147.13 ? 43   LYS H NZ  1 
ATOM 3298 N N   . GLY D 4 44  ? 21.334 82.545  -0.215  1.00 118.78 ? 44   GLY H N   1 
ATOM 3299 C CA  . GLY D 4 44  ? 21.841 81.287  0.293   1.00 107.37 ? 44   GLY H CA  1 
ATOM 3300 C C   . GLY D 4 44  ? 21.209 80.074  -0.367  1.00 99.72  ? 44   GLY H C   1 
ATOM 3301 O O   . GLY D 4 44  ? 20.432 80.168  -1.319  1.00 98.93  ? 44   GLY H O   1 
ATOM 3302 N N   . LEU D 4 45  ? 21.559 78.904  0.170   1.00 97.09  ? 45   LEU H N   1 
ATOM 3303 C CA  . LEU D 4 45  ? 21.097 77.628  -0.364  1.00 84.85  ? 45   LEU H CA  1 
ATOM 3304 C C   . LEU D 4 45  ? 19.700 77.289  0.154   1.00 87.06  ? 45   LEU H C   1 
ATOM 3305 O O   . LEU D 4 45  ? 19.246 77.797  1.184   1.00 96.92  ? 45   LEU H O   1 
ATOM 3306 C CB  . LEU D 4 45  ? 22.070 76.508  0.005   1.00 78.98  ? 45   LEU H CB  1 
ATOM 3307 C CG  . LEU D 4 45  ? 23.428 76.530  -0.696  1.00 83.23  ? 45   LEU H CG  1 
ATOM 3308 C CD1 . LEU D 4 45  ? 24.403 75.574  -0.032  1.00 84.16  ? 45   LEU H CD1 1 
ATOM 3309 C CD2 . LEU D 4 45  ? 23.252 76.180  -2.161  1.00 91.97  ? 45   LEU H CD2 1 
ATOM 3310 N N   . GLU D 4 46  ? 19.021 76.408  -0.577  1.00 78.27  ? 46   GLU H N   1 
ATOM 3311 C CA  . GLU D 4 46  ? 17.659 76.012  -0.233  1.00 86.28  ? 46   GLU H CA  1 
ATOM 3312 C C   . GLU D 4 46  ? 17.401 74.616  -0.772  1.00 83.34  ? 46   GLU H C   1 
ATOM 3313 O O   . GLU D 4 46  ? 17.528 74.384  -1.976  1.00 80.08  ? 46   GLU H O   1 
ATOM 3314 C CB  . GLU D 4 46  ? 16.627 76.994  -0.794  1.00 91.12  ? 46   GLU H CB  1 
ATOM 3315 C CG  . GLU D 4 46  ? 15.188 76.539  -0.605  1.00 99.57  ? 46   GLU H CG  1 
ATOM 3316 C CD  . GLU D 4 46  ? 14.180 77.478  -1.240  1.00 107.88 ? 46   GLU H CD  1 
ATOM 3317 O OE1 . GLU D 4 46  ? 14.602 78.480  -1.854  1.00 112.54 ? 46   GLU H OE1 1 
ATOM 3318 O OE2 . GLU D 4 46  ? 12.964 77.210  -1.125  1.00 109.51 ? 46   GLU H OE2 1 
ATOM 3319 N N   . TRP D 4 47  ? 17.040 73.696  0.115   1.00 85.78  ? 47   TRP H N   1 
ATOM 3320 C CA  . TRP D 4 47  ? 16.702 72.348  -0.317  1.00 87.41  ? 47   TRP H CA  1 
ATOM 3321 C C   . TRP D 4 47  ? 15.349 72.358  -1.022  1.00 87.91  ? 47   TRP H C   1 
ATOM 3322 O O   . TRP D 4 47  ? 14.405 73.016  -0.578  1.00 87.57  ? 47   TRP H O   1 
ATOM 3323 C CB  . TRP D 4 47  ? 16.695 71.398  0.875   1.00 89.54  ? 47   TRP H CB  1 
ATOM 3324 C CG  . TRP D 4 47  ? 16.281 70.010  0.528   1.00 82.04  ? 47   TRP H CG  1 
ATOM 3325 C CD1 . TRP D 4 47  ? 17.069 69.015  0.026   1.00 83.75  ? 47   TRP H CD1 1 
ATOM 3326 C CD2 . TRP D 4 47  ? 14.972 69.460  0.660   1.00 80.06  ? 47   TRP H CD2 1 
ATOM 3327 N NE1 . TRP D 4 47  ? 16.324 67.876  -0.163  1.00 79.87  ? 47   TRP H NE1 1 
ATOM 3328 C CE2 . TRP D 4 47  ? 15.032 68.125  0.220   1.00 80.09  ? 47   TRP H CE2 1 
ATOM 3329 C CE3 . TRP D 4 47  ? 13.750 69.969  1.109   1.00 83.43  ? 47   TRP H CE3 1 
ATOM 3330 C CZ2 . TRP D 4 47  ? 13.918 67.293  0.217   1.00 84.91  ? 47   TRP H CZ2 1 
ATOM 3331 C CZ3 . TRP D 4 47  ? 12.647 69.145  1.103   1.00 87.58  ? 47   TRP H CZ3 1 
ATOM 3332 C CH2 . TRP D 4 47  ? 12.736 67.821  0.659   1.00 89.15  ? 47   TRP H CH2 1 
ATOM 3333 N N   . VAL D 4 48  ? 15.260 71.646  -2.142  1.00 80.39  ? 48   VAL H N   1 
ATOM 3334 C CA  . VAL D 4 48  ? 14.041 71.661  -2.947  1.00 85.63  ? 48   VAL H CA  1 
ATOM 3335 C C   . VAL D 4 48  ? 13.275 70.356  -2.840  1.00 90.00  ? 48   VAL H C   1 
ATOM 3336 O O   . VAL D 4 48  ? 12.098 70.346  -2.459  1.00 84.25  ? 48   VAL H O   1 
ATOM 3337 C CB  . VAL D 4 48  ? 14.343 71.941  -4.424  1.00 84.60  ? 48   VAL H CB  1 
ATOM 3338 C CG1 . VAL D 4 48  ? 13.082 71.752  -5.249  1.00 83.79  ? 48   VAL H CG1 1 
ATOM 3339 C CG2 . VAL D 4 48  ? 14.909 73.337  -4.593  1.00 89.47  ? 48   VAL H CG2 1 
ATOM 3340 N N   . ALA D 4 49  ? 13.919 69.255  -3.227  1.00 99.92  ? 49   ALA H N   1 
ATOM 3341 C CA  . ALA D 4 49  ? 13.259 67.958  -3.184  1.00 89.94  ? 49   ALA H CA  1 
ATOM 3342 C C   . ALA D 4 49  ? 14.298 66.858  -3.025  1.00 78.31  ? 49   ALA H C   1 
ATOM 3343 O O   . ALA D 4 49  ? 15.508 67.097  -3.050  1.00 66.57  ? 49   ALA H O   1 
ATOM 3344 C CB  . ALA D 4 49  ? 12.412 67.695  -4.438  1.00 74.50  ? 49   ALA H CB  1 
ATOM 3345 N N   . TYR D 4 50  ? 13.797 65.638  -2.850  1.00 92.06  ? 50   TYR H N   1 
ATOM 3346 C CA  . TYR D 4 50  ? 14.623 64.455  -2.677  1.00 94.68  ? 50   TYR H CA  1 
ATOM 3347 C C   . TYR D 4 50  ? 13.840 63.228  -3.100  1.00 88.05  ? 50   TYR H C   1 
ATOM 3348 O O   . TYR D 4 50  ? 12.655 63.103  -2.783  1.00 76.90  ? 50   TYR H O   1 
ATOM 3349 C CB  . TYR D 4 50  ? 15.073 64.270  -1.227  1.00 95.06  ? 50   TYR H CB  1 
ATOM 3350 C CG  . TYR D 4 50  ? 15.561 62.872  -0.931  1.00 91.76  ? 50   TYR H CG  1 
ATOM 3351 C CD1 . TYR D 4 50  ? 16.808 62.454  -1.366  1.00 87.44  ? 50   TYR H CD1 1 
ATOM 3352 C CD2 . TYR D 4 50  ? 14.775 61.965  -0.225  1.00 95.94  ? 50   TYR H CD2 1 
ATOM 3353 C CE1 . TYR D 4 50  ? 17.273 61.182  -1.100  1.00 84.83  ? 50   TYR H CE1 1 
ATOM 3354 C CE2 . TYR D 4 50  ? 15.233 60.679  0.043   1.00 86.03  ? 50   TYR H CE2 1 
ATOM 3355 C CZ  . TYR D 4 50  ? 16.486 60.299  -0.400  1.00 85.63  ? 50   TYR H CZ  1 
ATOM 3356 O OH  . TYR D 4 50  ? 16.970 59.038  -0.151  1.00 95.01  ? 50   TYR H OH  1 
ATOM 3357 N N   . ILE D 4 51  ? 14.529 62.310  -3.773  1.00 105.47 ? 51   ILE H N   1 
ATOM 3358 C CA  . ILE D 4 51  ? 13.962 61.043  -4.213  1.00 112.09 ? 51   ILE H CA  1 
ATOM 3359 C C   . ILE D 4 51  ? 14.953 59.932  -3.888  1.00 106.99 ? 51   ILE H C   1 
ATOM 3360 O O   . ILE D 4 51  ? 16.168 60.115  -4.015  1.00 101.35 ? 51   ILE H O   1 
ATOM 3361 C CB  . ILE D 4 51  ? 13.632 61.073  -5.721  1.00 102.18 ? 51   ILE H CB  1 
ATOM 3362 C CG1 . ILE D 4 51  ? 12.840 59.833  -6.123  1.00 110.11 ? 51   ILE H CG1 1 
ATOM 3363 C CG2 . ILE D 4 51  ? 14.902 61.184  -6.563  1.00 97.19  ? 51   ILE H CG2 1 
ATOM 3364 C CD1 . ILE D 4 51  ? 12.398 59.863  -7.557  1.00 115.31 ? 51   ILE H CD1 1 
ATOM 3365 N N   . SER D 4 52  ? 14.437 58.779  -3.474  1.00 103.65 ? 52   SER H N   1 
ATOM 3366 C CA  . SER D 4 52  ? 15.289 57.664  -3.079  1.00 114.43 ? 52   SER H CA  1 
ATOM 3367 C C   . SER D 4 52  ? 15.770 56.910  -4.322  1.00 129.11 ? 52   SER H C   1 
ATOM 3368 O O   . SER D 4 52  ? 15.559 57.337  -5.461  1.00 129.31 ? 52   SER H O   1 
ATOM 3369 C CB  . SER D 4 52  ? 14.546 56.754  -2.108  1.00 105.76 ? 52   SER H CB  1 
ATOM 3370 O OG  . SER D 4 52  ? 13.294 56.385  -2.650  1.00 112.21 ? 52   SER H OG  1 
ATOM 3371 N N   . SER D 4 53  ? 16.429 55.767  -4.113  1.00 129.44 ? 53   SER H N   1 
ATOM 3372 C CA  . SER D 4 53  ? 17.004 55.024  -5.233  1.00 126.70 ? 53   SER H CA  1 
ATOM 3373 C C   . SER D 4 53  ? 15.924 54.381  -6.093  1.00 125.19 ? 53   SER H C   1 
ATOM 3374 O O   . SER D 4 53  ? 15.936 54.502  -7.323  1.00 131.17 ? 53   SER H O   1 
ATOM 3375 C CB  . SER D 4 53  ? 17.971 53.964  -4.714  1.00 127.45 ? 53   SER H CB  1 
ATOM 3376 O OG  . SER D 4 53  ? 17.330 53.133  -3.769  1.00 132.73 ? 53   SER H OG  1 
ATOM 3377 N N   . GLY D 4 54  ? 15.000 53.667  -5.471  1.00 115.88 ? 54   GLY H N   1 
ATOM 3378 C CA  . GLY D 4 54  ? 13.924 53.089  -6.242  1.00 116.03 ? 54   GLY H CA  1 
ATOM 3379 C C   . GLY D 4 54  ? 12.690 53.964  -6.305  1.00 115.76 ? 54   GLY H C   1 
ATOM 3380 O O   . GLY D 4 54  ? 11.598 53.463  -6.588  1.00 106.40 ? 54   GLY H O   1 
ATOM 3381 N N   . SER D 4 55  ? 12.844 55.262  -6.017  1.00 108.63 ? 55   SER H N   1 
ATOM 3382 C CA  . SER D 4 55  ? 11.771 56.257  -6.147  1.00 99.41  ? 55   SER H CA  1 
ATOM 3383 C C   . SER D 4 55  ? 10.567 55.935  -5.263  1.00 108.24 ? 55   SER H C   1 
ATOM 3384 O O   . SER D 4 55  ? 9.434  56.302  -5.587  1.00 109.09 ? 55   SER H O   1 
ATOM 3385 C CB  . SER D 4 55  ? 11.331 56.410  -7.606  1.00 100.09 ? 55   SER H CB  1 
ATOM 3386 O OG  . SER D 4 55  ? 12.426 56.755  -8.437  1.00 99.21  ? 55   SER H OG  1 
ATOM 3387 N N   . SER D 4 56  ? 10.798 55.262  -4.135  1.00 116.62 ? 56   SER H N   1 
ATOM 3388 C CA  . SER D 4 56  ? 9.721  54.927  -3.211  1.00 114.65 ? 56   SER H CA  1 
ATOM 3389 C C   . SER D 4 56  ? 9.457  56.022  -2.187  1.00 114.71 ? 56   SER H C   1 
ATOM 3390 O O   . SER D 4 56  ? 8.315  56.174  -1.736  1.00 126.33 ? 56   SER H O   1 
ATOM 3391 C CB  . SER D 4 56  ? 10.040 53.619  -2.483  1.00 115.07 ? 56   SER H CB  1 
ATOM 3392 O OG  . SER D 4 56  ? 11.158 53.775  -1.632  1.00 112.08 ? 56   SER H OG  1 
ATOM 3393 N N   . LEU D 4 57  ? 10.479 56.787  -1.805  1.00 106.03 ? 57   LEU H N   1 
ATOM 3394 C CA  . LEU D 4 57  ? 10.340 57.867  -0.835  1.00 110.31 ? 57   LEU H CA  1 
ATOM 3395 C C   . LEU D 4 57  ? 10.697 59.187  -1.504  1.00 124.33 ? 57   LEU H C   1 
ATOM 3396 O O   . LEU D 4 57  ? 11.827 59.364  -1.972  1.00 124.26 ? 57   LEU H O   1 
ATOM 3397 C CB  . LEU D 4 57  ? 11.224 57.629  0.389   1.00 95.85  ? 57   LEU H CB  1 
ATOM 3398 C CG  . LEU D 4 57  ? 10.927 58.529  1.588   1.00 95.77  ? 57   LEU H CG  1 
ATOM 3399 C CD1 . LEU D 4 57  ? 9.500  58.326  2.074   1.00 100.61 ? 57   LEU H CD1 1 
ATOM 3400 C CD2 . LEU D 4 57  ? 11.909 58.251  2.700   1.00 96.31  ? 57   LEU H CD2 1 
ATOM 3401 N N   . ILE D 4 58  ? 9.737  60.111  -1.539  1.00 129.72 ? 58   ILE H N   1 
ATOM 3402 C CA  . ILE D 4 58  ? 9.906  61.412  -2.175  1.00 127.73 ? 58   ILE H CA  1 
ATOM 3403 C C   . ILE D 4 58  ? 9.516  62.498  -1.185  1.00 125.61 ? 58   ILE H C   1 
ATOM 3404 O O   . ILE D 4 58  ? 8.425  62.457  -0.604  1.00 124.84 ? 58   ILE H O   1 
ATOM 3405 C CB  . ILE D 4 58  ? 9.064  61.540  -3.459  1.00 134.34 ? 58   ILE H CB  1 
ATOM 3406 C CG1 . ILE D 4 58  ? 9.620  60.634  -4.558  1.00 136.35 ? 58   ILE H CG1 1 
ATOM 3407 C CG2 . ILE D 4 58  ? 9.016  62.989  -3.916  1.00 131.87 ? 58   ILE H CG2 1 
ATOM 3408 C CD1 . ILE D 4 58  ? 8.871  60.734  -5.870  1.00 140.60 ? 58   ILE H CD1 1 
ATOM 3409 N N   . TYR D 4 59  ? 10.399 63.473  -1.003  1.00 119.66 ? 59   TYR H N   1 
ATOM 3410 C CA  . TYR D 4 59  ? 10.148 64.608  -0.132  1.00 116.86 ? 59   TYR H CA  1 
ATOM 3411 C C   . TYR D 4 59  ? 10.252 65.895  -0.935  1.00 124.91 ? 59   TYR H C   1 
ATOM 3412 O O   . TYR D 4 59  ? 11.133 66.040  -1.789  1.00 128.12 ? 59   TYR H O   1 
ATOM 3413 C CB  . TYR D 4 59  ? 11.136 64.637  1.038   1.00 100.27 ? 59   TYR H CB  1 
ATOM 3414 C CG  . TYR D 4 59  ? 10.845 63.624  2.115   1.00 105.76 ? 59   TYR H CG  1 
ATOM 3415 C CD1 . TYR D 4 59  ? 9.649  63.656  2.818   1.00 115.11 ? 59   TYR H CD1 1 
ATOM 3416 C CD2 . TYR D 4 59  ? 11.771 62.642  2.445   1.00 109.86 ? 59   TYR H CD2 1 
ATOM 3417 C CE1 . TYR D 4 59  ? 9.375  62.733  3.813   1.00 111.99 ? 59   TYR H CE1 1 
ATOM 3418 C CE2 . TYR D 4 59  ? 11.508 61.714  3.442   1.00 105.89 ? 59   TYR H CE2 1 
ATOM 3419 C CZ  . TYR D 4 59  ? 10.307 61.767  4.121   1.00 105.08 ? 59   TYR H CZ  1 
ATOM 3420 O OH  . TYR D 4 59  ? 10.034 60.854  5.111   1.00 113.68 ? 59   TYR H OH  1 
ATOM 3421 N N   . TYR D 4 60  ? 9.343  66.824  -0.659  1.00 128.53 ? 60   TYR H N   1 
ATOM 3422 C CA  . TYR D 4 60  ? 9.344  68.137  -1.280  1.00 116.06 ? 60   TYR H CA  1 
ATOM 3423 C C   . TYR D 4 60  ? 9.431  69.210  -0.204  1.00 115.13 ? 60   TYR H C   1 
ATOM 3424 O O   . TYR D 4 60  ? 8.964  69.022  0.924   1.00 108.66 ? 60   TYR H O   1 
ATOM 3425 C CB  . TYR D 4 60  ? 8.085  68.365  -2.128  1.00 116.55 ? 60   TYR H CB  1 
ATOM 3426 C CG  . TYR D 4 60  ? 7.943  67.447  -3.321  1.00 112.14 ? 60   TYR H CG  1 
ATOM 3427 C CD1 . TYR D 4 60  ? 8.760  67.590  -4.438  1.00 104.79 ? 60   TYR H CD1 1 
ATOM 3428 C CD2 . TYR D 4 60  ? 6.976  66.452  -3.340  1.00 115.49 ? 60   TYR H CD2 1 
ATOM 3429 C CE1 . TYR D 4 60  ? 8.623  66.756  -5.533  1.00 110.29 ? 60   TYR H CE1 1 
ATOM 3430 C CE2 . TYR D 4 60  ? 6.831  65.617  -4.431  1.00 120.09 ? 60   TYR H CE2 1 
ATOM 3431 C CZ  . TYR D 4 60  ? 7.656  65.770  -5.523  1.00 119.36 ? 60   TYR H CZ  1 
ATOM 3432 O OH  . TYR D 4 60  ? 7.503  64.930  -6.603  1.00 118.87 ? 60   TYR H OH  1 
ATOM 3433 N N   . ALA D 4 61  ? 10.043 70.334  -0.565  1.00 117.93 ? 61   ALA H N   1 
ATOM 3434 C CA  . ALA D 4 61  ? 10.029 71.507  0.295   1.00 118.07 ? 61   ALA H CA  1 
ATOM 3435 C C   . ALA D 4 61  ? 8.650  72.153  0.272   1.00 123.05 ? 61   ALA H C   1 
ATOM 3436 O O   . ALA D 4 61  ? 7.937  72.110  -0.733  1.00 124.15 ? 61   ALA H O   1 
ATOM 3437 C CB  . ALA D 4 61  ? 11.087 72.515  -0.150  1.00 114.72 ? 61   ALA H CB  1 
ATOM 3438 N N   . ASP D 4 62  ? 8.278  72.765  1.399   1.00 130.05 ? 62   ASP H N   1 
ATOM 3439 C CA  . ASP D 4 62  ? 6.936  73.325  1.518   1.00 133.33 ? 62   ASP H CA  1 
ATOM 3440 C C   . ASP D 4 62  ? 6.677  74.408  0.481   1.00 123.11 ? 62   ASP H C   1 
ATOM 3441 O O   . ASP D 4 62  ? 5.540  74.562  0.019   1.00 120.80 ? 62   ASP H O   1 
ATOM 3442 C CB  . ASP D 4 62  ? 6.721  73.866  2.927   1.00 151.82 ? 62   ASP H CB  1 
ATOM 3443 C CG  . ASP D 4 62  ? 6.646  72.766  3.956   1.00 163.74 ? 62   ASP H CG  1 
ATOM 3444 O OD1 . ASP D 4 62  ? 6.667  71.585  3.550   1.00 165.09 ? 62   ASP H OD1 1 
ATOM 3445 O OD2 . ASP D 4 62  ? 6.569  73.075  5.163   1.00 171.51 ? 62   ASP H OD2 1 
ATOM 3446 N N   . THR D 4 63  ? 7.711  75.160  0.099   1.00 123.48 ? 63   THR H N   1 
ATOM 3447 C CA  . THR D 4 63  ? 7.587  76.162  -0.956  1.00 118.89 ? 63   THR H CA  1 
ATOM 3448 C C   . THR D 4 63  ? 7.508  75.544  -2.339  1.00 112.92 ? 63   THR H C   1 
ATOM 3449 O O   . THR D 4 63  ? 7.304  76.266  -3.320  1.00 111.59 ? 63   THR H O   1 
ATOM 3450 C CB  . THR D 4 63  ? 8.764  77.139  -0.907  1.00 101.77 ? 63   THR H CB  1 
ATOM 3451 O OG1 . THR D 4 63  ? 9.975  76.462  -1.268  1.00 86.09  ? 63   THR H OG1 1 
ATOM 3452 C CG2 . THR D 4 63  ? 8.911  77.713  0.491   1.00 117.97 ? 63   THR H CG2 1 
ATOM 3453 N N   . VAL D 4 64  ? 7.656  74.230  -2.437  1.00 113.00 ? 64   VAL H N   1 
ATOM 3454 C CA  . VAL D 4 64  ? 7.763  73.562  -3.723  1.00 101.52 ? 64   VAL H CA  1 
ATOM 3455 C C   . VAL D 4 64  ? 6.679  72.495  -3.819  1.00 105.67 ? 64   VAL H C   1 
ATOM 3456 O O   . VAL D 4 64  ? 6.205  72.172  -4.916  1.00 108.76 ? 64   VAL H O   1 
ATOM 3457 C CB  . VAL D 4 64  ? 9.178  72.979  -3.886  1.00 97.61  ? 64   VAL H CB  1 
ATOM 3458 C CG1 . VAL D 4 64  ? 9.227  71.979  -4.999  1.00 114.69 ? 64   VAL H CG1 1 
ATOM 3459 C CG2 . VAL D 4 64  ? 10.172 74.093  -4.147  1.00 91.77  ? 64   VAL H CG2 1 
ATOM 3460 N N   . LYS D 4 65  ? 6.244  71.990  -2.664  1.00 105.90 ? 65   LYS H N   1 
ATOM 3461 C CA  . LYS D 4 65  ? 5.331  70.854  -2.617  1.00 110.39 ? 65   LYS H CA  1 
ATOM 3462 C C   . LYS D 4 65  ? 4.044  71.150  -3.378  1.00 120.81 ? 65   LYS H C   1 
ATOM 3463 O O   . LYS D 4 65  ? 3.479  72.243  -3.279  1.00 118.53 ? 65   LYS H O   1 
ATOM 3464 C CB  . LYS D 4 65  ? 5.021  70.497  -1.159  1.00 110.40 ? 65   LYS H CB  1 
ATOM 3465 C CG  . LYS D 4 65  ? 4.103  69.296  -0.964  1.00 107.94 ? 65   LYS H CG  1 
ATOM 3466 C CD  . LYS D 4 65  ? 3.846  69.031  0.517   1.00 107.53 ? 65   LYS H CD  1 
ATOM 3467 C CE  . LYS D 4 65  ? 2.923  67.838  0.716   1.00 112.72 ? 65   LYS H CE  1 
ATOM 3468 N NZ  . LYS D 4 65  ? 2.613  67.592  2.152   1.00 117.07 ? 65   LYS H NZ  1 
ATOM 3469 N N   . GLY D 4 66  ? 3.592  70.170  -4.159  1.00 137.71 ? 66   GLY H N   1 
ATOM 3470 C CA  . GLY D 4 66  ? 2.377  70.284  -4.932  1.00 140.47 ? 66   GLY H CA  1 
ATOM 3471 C C   . GLY D 4 66  ? 2.554  70.868  -6.320  1.00 137.41 ? 66   GLY H C   1 
ATOM 3472 O O   . GLY D 4 66  ? 1.779  70.537  -7.223  1.00 142.87 ? 66   GLY H O   1 
ATOM 3473 N N   . ARG D 4 67  ? 3.556  71.723  -6.516  1.00 122.49 ? 67   ARG H N   1 
ATOM 3474 C CA  . ARG D 4 67  ? 3.810  72.345  -7.810  1.00 114.73 ? 67   ARG H CA  1 
ATOM 3475 C C   . ARG D 4 67  ? 4.869  71.624  -8.630  1.00 105.70 ? 67   ARG H C   1 
ATOM 3476 O O   . ARG D 4 67  ? 4.759  71.576  -9.857  1.00 100.85 ? 67   ARG H O   1 
ATOM 3477 C CB  . ARG D 4 67  ? 4.236  73.802  -7.623  1.00 115.97 ? 67   ARG H CB  1 
ATOM 3478 C CG  . ARG D 4 67  ? 3.218  74.629  -6.885  1.00 118.12 ? 67   ARG H CG  1 
ATOM 3479 C CD  . ARG D 4 67  ? 3.521  76.108  -6.994  1.00 106.44 ? 67   ARG H CD  1 
ATOM 3480 N NE  . ARG D 4 67  ? 4.775  76.495  -6.352  1.00 98.94  ? 67   ARG H NE  1 
ATOM 3481 C CZ  . ARG D 4 67  ? 5.905  76.738  -7.010  1.00 99.27  ? 67   ARG H CZ  1 
ATOM 3482 N NH1 . ARG D 4 67  ? 5.941  76.619  -8.330  1.00 94.56  ? 67   ARG H NH1 1 
ATOM 3483 N NH2 . ARG D 4 67  ? 6.998  77.099  -6.351  1.00 105.07 ? 67   ARG H NH2 1 
ATOM 3484 N N   . PHE D 4 68  ? 5.899  71.077  -7.993  1.00 114.68 ? 68   PHE H N   1 
ATOM 3485 C CA  . PHE D 4 68  ? 6.969  70.388  -8.702  1.00 116.14 ? 68   PHE H CA  1 
ATOM 3486 C C   . PHE D 4 68  ? 6.818  68.876  -8.561  1.00 120.49 ? 68   PHE H C   1 
ATOM 3487 O O   . PHE D 4 68  ? 6.077  68.372  -7.714  1.00 125.81 ? 68   PHE H O   1 
ATOM 3488 C CB  . PHE D 4 68  ? 8.344  70.825  -8.187  1.00 117.48 ? 68   PHE H CB  1 
ATOM 3489 C CG  . PHE D 4 68  ? 8.701  72.253  -8.513  1.00 121.63 ? 68   PHE H CG  1 
ATOM 3490 C CD1 . PHE D 4 68  ? 7.802  73.085  -9.157  1.00 126.54 ? 68   PHE H CD1 1 
ATOM 3491 C CD2 . PHE D 4 68  ? 9.950  72.755  -8.186  1.00 119.30 ? 68   PHE H CD2 1 
ATOM 3492 C CE1 . PHE D 4 68  ? 8.133  74.389  -9.452  1.00 129.18 ? 68   PHE H CE1 1 
ATOM 3493 C CE2 . PHE D 4 68  ? 10.287 74.058  -8.477  1.00 120.03 ? 68   PHE H CE2 1 
ATOM 3494 C CZ  . PHE D 4 68  ? 9.378  74.876  -9.113  1.00 128.07 ? 68   PHE H CZ  1 
ATOM 3495 N N   . THR D 4 69  ? 7.551  68.151  -9.408  1.00 109.57 ? 69   THR H N   1 
ATOM 3496 C CA  . THR D 4 69  ? 7.528  66.689  -9.422  1.00 105.74 ? 69   THR H CA  1 
ATOM 3497 C C   . THR D 4 69  ? 8.930  66.178  -9.728  1.00 95.38  ? 69   THR H C   1 
ATOM 3498 O O   . THR D 4 69  ? 9.398  66.288  -10.865 1.00 99.06  ? 69   THR H O   1 
ATOM 3499 C CB  . THR D 4 69  ? 6.530  66.153  -10.449 1.00 108.11 ? 69   THR H CB  1 
ATOM 3500 O OG1 . THR D 4 69  ? 5.212  66.621  -10.137 1.00 114.63 ? 69   THR H OG1 1 
ATOM 3501 C CG2 . THR D 4 69  ? 6.530  64.639  -10.431 1.00 116.91 ? 69   THR H CG2 1 
ATOM 3502 N N   . ILE D 4 70  ? 9.587  65.601  -8.723  1.00 91.25  ? 70   ILE H N   1 
ATOM 3503 C CA  . ILE D 4 70  ? 10.895 64.980  -8.895  1.00 88.04  ? 70   ILE H CA  1 
ATOM 3504 C C   . ILE D 4 70  ? 10.696 63.531  -9.311  1.00 92.97  ? 70   ILE H C   1 
ATOM 3505 O O   . ILE D 4 70  ? 9.795  62.840  -8.818  1.00 101.55 ? 70   ILE H O   1 
ATOM 3506 C CB  . ILE D 4 70  ? 11.734 65.086  -7.606  1.00 88.39  ? 70   ILE H CB  1 
ATOM 3507 C CG1 . ILE D 4 70  ? 13.163 64.599  -7.848  1.00 85.31  ? 70   ILE H CG1 1 
ATOM 3508 C CG2 . ILE D 4 70  ? 11.099 64.298  -6.473  1.00 90.01  ? 70   ILE H CG2 1 
ATOM 3509 C CD1 . ILE D 4 70  ? 14.035 64.684  -6.620  1.00 84.43  ? 70   ILE H CD1 1 
ATOM 3510 N N   . SER D 4 71  ? 11.526 63.074  -10.244 1.00 88.58  ? 71   SER H N   1 
ATOM 3511 C CA  . SER D 4 71  ? 11.406 61.727  -10.777 1.00 88.55  ? 71   SER H CA  1 
ATOM 3512 C C   . SER D 4 71  ? 12.795 61.218  -11.124 1.00 93.73  ? 71   SER H C   1 
ATOM 3513 O O   . SER D 4 71  ? 13.784 61.954  -11.064 1.00 80.45  ? 71   SER H O   1 
ATOM 3514 C CB  . SER D 4 71  ? 10.474 61.688  -11.994 1.00 92.47  ? 71   SER H CB  1 
ATOM 3515 O OG  . SER D 4 71  ? 10.895 62.598  -12.989 1.00 96.23  ? 71   SER H OG  1 
ATOM 3516 N N   . ARG D 4 72  ? 12.860 59.945  -11.501 1.00 111.84 ? 72   ARG H N   1 
ATOM 3517 C CA  . ARG D 4 72  ? 14.132 59.254  -11.637 1.00 114.04 ? 72   ARG H CA  1 
ATOM 3518 C C   . ARG D 4 72  ? 14.062 58.264  -12.790 1.00 120.32 ? 72   ARG H C   1 
ATOM 3519 O O   . ARG D 4 72  ? 13.025 57.635  -13.017 1.00 126.40 ? 72   ARG H O   1 
ATOM 3520 C CB  . ARG D 4 72  ? 14.487 58.541  -10.327 1.00 111.10 ? 72   ARG H CB  1 
ATOM 3521 C CG  . ARG D 4 72  ? 15.926 58.107  -10.199 1.00 109.55 ? 72   ARG H CG  1 
ATOM 3522 C CD  . ARG D 4 72  ? 16.263 57.797  -8.753  1.00 110.57 ? 72   ARG H CD  1 
ATOM 3523 N NE  . ARG D 4 72  ? 17.646 57.365  -8.609  1.00 112.99 ? 72   ARG H NE  1 
ATOM 3524 C CZ  . ARG D 4 72  ? 18.335 57.437  -7.478  1.00 114.74 ? 72   ARG H CZ  1 
ATOM 3525 N NH1 . ARG D 4 72  ? 17.771 57.936  -6.389  1.00 116.76 ? 72   ARG H NH1 1 
ATOM 3526 N NH2 . ARG D 4 72  ? 19.592 57.020  -7.439  1.00 115.32 ? 72   ARG H NH2 1 
ATOM 3527 N N   . ASP D 4 73  ? 15.168 58.152  -13.527 1.00 121.86 ? 73   ASP H N   1 
ATOM 3528 C CA  . ASP D 4 73  ? 15.330 57.189  -14.619 1.00 124.23 ? 73   ASP H CA  1 
ATOM 3529 C C   . ASP D 4 73  ? 16.637 56.453  -14.334 1.00 121.13 ? 73   ASP H C   1 
ATOM 3530 O O   . ASP D 4 73  ? 17.709 56.866  -14.782 1.00 122.49 ? 73   ASP H O   1 
ATOM 3531 C CB  . ASP D 4 73  ? 15.340 57.879  -15.982 1.00 133.28 ? 73   ASP H CB  1 
ATOM 3532 C CG  . ASP D 4 73  ? 15.305 56.898  -17.142 1.00 141.50 ? 73   ASP H CG  1 
ATOM 3533 O OD1 . ASP D 4 73  ? 15.302 55.673  -16.904 1.00 145.55 ? 73   ASP H OD1 1 
ATOM 3534 O OD2 . ASP D 4 73  ? 15.279 57.362  -18.302 1.00 140.95 ? 73   ASP H OD2 1 
ATOM 3535 N N   . ASN D 4 74  ? 16.536 55.372  -13.577 1.00 108.70 ? 74   ASN H N   1 
ATOM 3536 C CA  . ASN D 4 74  ? 17.673 54.571  -13.135 1.00 114.54 ? 74   ASN H CA  1 
ATOM 3537 C C   . ASN D 4 74  ? 18.374 53.858  -14.289 1.00 122.08 ? 74   ASN H C   1 
ATOM 3538 O O   . ASN D 4 74  ? 19.615 53.904  -14.361 1.00 120.64 ? 74   ASN H O   1 
ATOM 3539 C CB  . ASN D 4 74  ? 17.212 53.566  -12.073 1.00 124.29 ? 74   ASN H CB  1 
ATOM 3540 C CG  . ASN D 4 74  ? 16.836 54.233  -10.764 1.00 121.90 ? 74   ASN H CG  1 
ATOM 3541 O OD1 . ASN D 4 74  ? 17.491 55.176  -10.328 1.00 121.33 ? 74   ASN H OD1 1 
ATOM 3542 N ND2 . ASN D 4 74  ? 15.771 53.748  -10.133 1.00 120.50 ? 74   ASN H ND2 1 
ATOM 3543 N N   . PRO D 4 75  ? 17.652 53.220  -15.222 1.00 122.45 ? 75   PRO H N   1 
ATOM 3544 C CA  . PRO D 4 75  ? 18.347 52.576  -16.354 1.00 123.40 ? 75   PRO H CA  1 
ATOM 3545 C C   . PRO D 4 75  ? 19.173 53.532  -17.188 1.00 123.77 ? 75   PRO H C   1 
ATOM 3546 O O   . PRO D 4 75  ? 20.126 53.091  -17.840 1.00 134.10 ? 75   PRO H O   1 
ATOM 3547 C CB  . PRO D 4 75  ? 17.192 51.978  -17.172 1.00 129.56 ? 75   PRO H CB  1 
ATOM 3548 C CG  . PRO D 4 75  ? 16.119 51.758  -16.177 1.00 130.08 ? 75   PRO H CG  1 
ATOM 3549 C CD  . PRO D 4 75  ? 16.205 52.921  -15.255 1.00 124.60 ? 75   PRO H CD  1 
ATOM 3550 N N   . LYS D 4 76  ? 18.848 54.824  -17.188 1.00 123.43 ? 76   LYS H N   1 
ATOM 3551 C CA  . LYS D 4 76  ? 19.594 55.812  -17.956 1.00 126.14 ? 76   LYS H CA  1 
ATOM 3552 C C   . LYS D 4 76  ? 20.421 56.745  -17.082 1.00 119.42 ? 76   LYS H C   1 
ATOM 3553 O O   . LYS D 4 76  ? 21.043 57.674  -17.609 1.00 111.80 ? 76   LYS H O   1 
ATOM 3554 C CB  . LYS D 4 76  ? 18.640 56.631  -18.837 1.00 127.42 ? 76   LYS H CB  1 
ATOM 3555 C CG  . LYS D 4 76  ? 17.922 55.802  -19.898 1.00 140.36 ? 76   LYS H CG  1 
ATOM 3556 C CD  . LYS D 4 76  ? 17.089 56.663  -20.835 1.00 141.93 ? 76   LYS H CD  1 
ATOM 3557 C CE  . LYS D 4 76  ? 16.330 55.808  -21.840 1.00 150.63 ? 76   LYS H CE  1 
ATOM 3558 N NZ  . LYS D 4 76  ? 15.523 56.642  -22.773 1.00 153.29 ? 76   LYS H NZ  1 
ATOM 3559 N N   . ASN D 4 77  ? 20.445 56.518  -15.767 1.00 121.96 ? 77   ASN H N   1 
ATOM 3560 C CA  . ASN D 4 77  ? 21.227 57.314  -14.819 1.00 113.10 ? 77   ASN H CA  1 
ATOM 3561 C C   . ASN D 4 77  ? 20.872 58.800  -14.916 1.00 107.27 ? 77   ASN H C   1 
ATOM 3562 O O   . ASN D 4 77  ? 21.728 59.664  -15.117 1.00 107.70 ? 77   ASN H O   1 
ATOM 3563 C CB  . ASN D 4 77  ? 22.730 57.094  -15.026 1.00 114.24 ? 77   ASN H CB  1 
ATOM 3564 C CG  . ASN D 4 77  ? 23.150 55.660  -14.781 1.00 116.79 ? 77   ASN H CG  1 
ATOM 3565 O OD1 . ASN D 4 77  ? 22.328 54.744  -14.818 1.00 125.06 ? 77   ASN H OD1 1 
ATOM 3566 N ND2 . ASN D 4 77  ? 24.437 55.457  -14.526 1.00 114.73 ? 77   ASN H ND2 1 
ATOM 3567 N N   . THR D 4 78  ? 19.584 59.086  -14.748 1.00 100.46 ? 78   THR H N   1 
ATOM 3568 C CA  . THR D 4 78  ? 19.089 60.445  -14.897 1.00 103.03 ? 78   THR H CA  1 
ATOM 3569 C C   . THR D 4 78  ? 18.168 60.790  -13.735 1.00 107.40 ? 78   THR H C   1 
ATOM 3570 O O   . THR D 4 78  ? 17.446 59.936  -13.213 1.00 102.49 ? 78   THR H O   1 
ATOM 3571 C CB  . THR D 4 78  ? 18.357 60.628  -16.234 1.00 109.17 ? 78   THR H CB  1 
ATOM 3572 O OG1 . THR D 4 78  ? 19.123 60.018  -17.279 1.00 122.57 ? 78   THR H OG1 1 
ATOM 3573 C CG2 . THR D 4 78  ? 18.194 62.101  -16.553 1.00 103.89 ? 78   THR H CG2 1 
ATOM 3574 N N   . LEU D 4 79  ? 18.221 62.056  -13.329 1.00 107.15 ? 79   LEU H N   1 
ATOM 3575 C CA  . LEU D 4 79  ? 17.355 62.614  -12.298 1.00 98.06  ? 79   LEU H CA  1 
ATOM 3576 C C   . LEU D 4 79  ? 16.580 63.773  -12.906 1.00 100.00 ? 79   LEU H C   1 
ATOM 3577 O O   . LEU D 4 79  ? 17.183 64.725  -13.410 1.00 97.19  ? 79   LEU H O   1 
ATOM 3578 C CB  . LEU D 4 79  ? 18.173 63.082  -11.096 1.00 90.57  ? 79   LEU H CB  1 
ATOM 3579 C CG  . LEU D 4 79  ? 17.421 63.863  -10.021 1.00 88.17  ? 79   LEU H CG  1 
ATOM 3580 C CD1 . LEU D 4 79  ? 16.414 62.986  -9.289  1.00 96.16  ? 79   LEU H CD1 1 
ATOM 3581 C CD2 . LEU D 4 79  ? 18.415 64.477  -9.056  1.00 86.10  ? 79   LEU H CD2 1 
ATOM 3582 N N   . PHE D 4 80  ? 15.254 63.687  -12.874 1.00 111.66 ? 80   PHE H N   1 
ATOM 3583 C CA  . PHE D 4 80  ? 14.398 64.699  -13.473 1.00 120.52 ? 80   PHE H CA  1 
ATOM 3584 C C   . PHE D 4 80  ? 13.710 65.530  -12.398 1.00 126.23 ? 80   PHE H C   1 
ATOM 3585 O O   . PHE D 4 80  ? 13.394 65.037  -11.310 1.00 134.00 ? 80   PHE H O   1 
ATOM 3586 C CB  . PHE D 4 80  ? 13.346 64.063  -14.389 1.00 124.96 ? 80   PHE H CB  1 
ATOM 3587 C CG  . PHE D 4 80  ? 13.915 63.458  -15.643 1.00 132.29 ? 80   PHE H CG  1 
ATOM 3588 C CD1 . PHE D 4 80  ? 14.162 64.246  -16.757 1.00 147.08 ? 80   PHE H CD1 1 
ATOM 3589 C CD2 . PHE D 4 80  ? 14.194 62.105  -15.711 1.00 131.72 ? 80   PHE H CD2 1 
ATOM 3590 C CE1 . PHE D 4 80  ? 14.684 63.693  -17.914 1.00 148.99 ? 80   PHE H CE1 1 
ATOM 3591 C CE2 . PHE D 4 80  ? 14.715 61.547  -16.863 1.00 136.87 ? 80   PHE H CE2 1 
ATOM 3592 C CZ  . PHE D 4 80  ? 14.960 62.341  -17.966 1.00 145.66 ? 80   PHE H CZ  1 
ATOM 3593 N N   . LEU D 4 81  ? 13.491 66.807  -12.715 1.00 122.36 ? 81   LEU H N   1 
ATOM 3594 C CA  . LEU D 4 81  ? 12.708 67.711  -11.871 1.00 115.96 ? 81   LEU H CA  1 
ATOM 3595 C C   . LEU D 4 81  ? 11.794 68.517  -12.788 1.00 111.51 ? 81   LEU H C   1 
ATOM 3596 O O   . LEU D 4 81  ? 12.243 69.449  -13.462 1.00 104.71 ? 81   LEU H O   1 
ATOM 3597 C CB  . LEU D 4 81  ? 13.596 68.627  -11.038 1.00 111.95 ? 81   LEU H CB  1 
ATOM 3598 C CG  . LEU D 4 81  ? 12.845 69.671  -10.204 1.00 99.87  ? 81   LEU H CG  1 
ATOM 3599 C CD1 . LEU D 4 81  ? 11.875 68.998  -9.251  1.00 101.22 ? 81   LEU H CD1 1 
ATOM 3600 C CD2 . LEU D 4 81  ? 13.822 70.541  -9.440  1.00 97.94  ? 81   LEU H CD2 1 
ATOM 3601 N N   . GLN D 4 82  ? 10.518 68.148  -12.811 1.00 110.30 ? 82   GLN H N   1 
ATOM 3602 C CA  . GLN D 4 82  ? 9.511  68.877  -13.567 1.00 106.86 ? 82   GLN H CA  1 
ATOM 3603 C C   . GLN D 4 82  ? 8.974  70.010  -12.703 1.00 105.52 ? 82   GLN H C   1 
ATOM 3604 O O   . GLN D 4 82  ? 8.438  69.770  -11.617 1.00 99.41  ? 82   GLN H O   1 
ATOM 3605 C CB  . GLN D 4 82  ? 8.380  67.947  -13.996 1.00 119.31 ? 82   GLN H CB  1 
ATOM 3606 C CG  . GLN D 4 82  ? 7.314  68.620  -14.837 1.00 124.81 ? 82   GLN H CG  1 
ATOM 3607 C CD  . GLN D 4 82  ? 7.792  68.917  -16.243 1.00 125.39 ? 82   GLN H CD  1 
ATOM 3608 O OE1 . GLN D 4 82  ? 8.422  68.077  -16.883 1.00 122.69 ? 82   GLN H OE1 1 
ATOM 3609 N NE2 . GLN D 4 82  ? 7.497  70.116  -16.729 1.00 128.88 ? 82   GLN H NE2 1 
ATOM 3610 N N   . MET D 4 83  ? 9.107  71.238  -13.194 1.00 106.78 ? 83   MET H N   1 
ATOM 3611 C CA  . MET D 4 83  ? 8.636  72.435  -12.513 1.00 95.43  ? 83   MET H CA  1 
ATOM 3612 C C   . MET D 4 83  ? 7.427  72.986  -13.255 1.00 107.25 ? 83   MET H C   1 
ATOM 3613 O O   . MET D 4 83  ? 7.472  73.163  -14.479 1.00 117.27 ? 83   MET H O   1 
ATOM 3614 C CB  . MET D 4 83  ? 9.741  73.487  -12.442 1.00 91.21  ? 83   MET H CB  1 
ATOM 3615 C CG  . MET D 4 83  ? 11.036 72.973  -11.842 1.00 95.31  ? 83   MET H CG  1 
ATOM 3616 S SD  . MET D 4 83  ? 12.337 74.228  -11.712 1.00 98.05  ? 83   MET H SD  1 
ATOM 3617 C CE  . MET D 4 83  ? 12.564 74.665  -13.433 1.00 98.71  ? 83   MET H CE  1 
ATOM 3618 N N   . THR D 4 84  ? 6.348  73.243  -12.518 1.00 109.39 ? 84   THR H N   1 
ATOM 3619 C CA  . THR D 4 84  ? 5.105  73.736  -13.093 1.00 127.17 ? 84   THR H CA  1 
ATOM 3620 C C   . THR D 4 84  ? 4.613  74.937  -12.301 1.00 141.53 ? 84   THR H C   1 
ATOM 3621 O O   . THR D 4 84  ? 4.775  74.992  -11.077 1.00 148.47 ? 84   THR H O   1 
ATOM 3622 C CB  . THR D 4 84  ? 4.032  72.645  -13.108 1.00 133.58 ? 84   THR H CB  1 
ATOM 3623 O OG1 . THR D 4 84  ? 4.585  71.449  -13.669 1.00 147.78 ? 84   THR H OG1 1 
ATOM 3624 C CG2 . THR D 4 84  ? 2.836  73.078  -13.946 1.00 138.80 ? 84   THR H CG2 1 
ATOM 3625 N N   . SER D 4 85  ? 4.015  75.899  -13.010 1.00 131.36 ? 85   SER H N   1 
ATOM 3626 C CA  . SER D 4 85  ? 3.516  77.139  -12.418 1.00 117.29 ? 85   SER H CA  1 
ATOM 3627 C C   . SER D 4 85  ? 4.635  77.860  -11.666 1.00 101.61 ? 85   SER H C   1 
ATOM 3628 O O   . SER D 4 85  ? 4.602  78.020  -10.445 1.00 97.94  ? 85   SER H O   1 
ATOM 3629 C CB  . SER D 4 85  ? 2.315  76.872  -11.505 1.00 125.20 ? 85   SER H CB  1 
ATOM 3630 O OG  . SER D 4 85  ? 1.233  76.305  -12.225 1.00 133.00 ? 85   SER H OG  1 
ATOM 3631 N N   . LEU D 4 86  ? 5.638  78.286  -12.427 1.00 106.82 ? 86   LEU H N   1 
ATOM 3632 C CA  . LEU D 4 86  ? 6.815  78.911  -11.842 1.00 112.89 ? 86   LEU H CA  1 
ATOM 3633 C C   . LEU D 4 86  ? 6.497  80.314  -11.333 1.00 116.40 ? 86   LEU H C   1 
ATOM 3634 O O   . LEU D 4 86  ? 5.608  81.001  -11.842 1.00 125.74 ? 86   LEU H O   1 
ATOM 3635 C CB  . LEU D 4 86  ? 7.946  78.964  -12.866 1.00 115.99 ? 86   LEU H CB  1 
ATOM 3636 C CG  . LEU D 4 86  ? 8.511  77.603  -13.269 1.00 109.22 ? 86   LEU H CG  1 
ATOM 3637 C CD1 . LEU D 4 86  ? 9.530  77.762  -14.373 1.00 116.54 ? 86   LEU H CD1 1 
ATOM 3638 C CD2 . LEU D 4 86  ? 9.142  76.944  -12.067 1.00 103.20 ? 86   LEU H CD2 1 
ATOM 3639 N N   . ARG D 4 87  ? 7.236  80.733  -10.313 1.00 107.68 ? 87   ARG H N   1 
ATOM 3640 C CA  . ARG D 4 87  ? 7.033  82.014  -9.659  1.00 118.40 ? 87   ARG H CA  1 
ATOM 3641 C C   . ARG D 4 87  ? 8.336  82.802  -9.662  1.00 115.62 ? 87   ARG H C   1 
ATOM 3642 O O   . ARG D 4 87  ? 9.406  82.281  -9.988  1.00 108.31 ? 87   ARG H O   1 
ATOM 3643 C CB  . ARG D 4 87  ? 6.521  81.824  -8.223  1.00 126.45 ? 87   ARG H CB  1 
ATOM 3644 C CG  . ARG D 4 87  ? 5.209  81.052  -8.127  1.00 135.22 ? 87   ARG H CG  1 
ATOM 3645 C CD  . ARG D 4 87  ? 4.889  80.647  -6.692  1.00 140.21 ? 87   ARG H CD  1 
ATOM 3646 N NE  . ARG D 4 87  ? 3.610  79.946  -6.598  1.00 146.28 ? 87   ARG H NE  1 
ATOM 3647 C CZ  . ARG D 4 87  ? 3.123  79.418  -5.480  1.00 151.33 ? 87   ARG H CZ  1 
ATOM 3648 N NH1 . ARG D 4 87  ? 3.809  79.505  -4.349  1.00 155.70 ? 87   ARG H NH1 1 
ATOM 3649 N NH2 . ARG D 4 87  ? 1.949  78.800  -5.492  1.00 153.35 ? 87   ARG H NH2 1 
ATOM 3650 N N   . SER D 4 88  ? 8.235  84.081  -9.292  1.00 126.54 ? 88   SER H N   1 
ATOM 3651 C CA  . SER D 4 88  ? 9.419  84.932  -9.273  1.00 120.65 ? 88   SER H CA  1 
ATOM 3652 C C   . SER D 4 88  ? 10.447 84.419  -8.273  1.00 117.39 ? 88   SER H C   1 
ATOM 3653 O O   . SER D 4 88  ? 11.656 84.497  -8.519  1.00 119.91 ? 88   SER H O   1 
ATOM 3654 C CB  . SER D 4 88  ? 9.026  86.374  -8.952  1.00 126.89 ? 88   SER H CB  1 
ATOM 3655 O OG  . SER D 4 88  ? 8.061  86.856  -9.871  1.00 127.66 ? 88   SER H OG  1 
ATOM 3656 N N   . GLU D 4 89  ? 9.987  83.871  -7.148  1.00 112.53 ? 89   GLU H N   1 
ATOM 3657 C CA  . GLU D 4 89  ? 10.910 83.398  -6.125  1.00 114.20 ? 89   GLU H CA  1 
ATOM 3658 C C   . GLU D 4 89  ? 11.653 82.141  -6.550  1.00 106.84 ? 89   GLU H C   1 
ATOM 3659 O O   . GLU D 4 89  ? 12.702 81.834  -5.974  1.00 106.98 ? 89   GLU H O   1 
ATOM 3660 C CB  . GLU D 4 89  ? 10.162 83.141  -4.816  1.00 134.12 ? 89   GLU H CB  1 
ATOM 3661 C CG  . GLU D 4 89  ? 9.621  84.398  -4.145  1.00 155.12 ? 89   GLU H CG  1 
ATOM 3662 C CD  . GLU D 4 89  ? 8.357  84.919  -4.803  1.00 165.08 ? 89   GLU H CD  1 
ATOM 3663 O OE1 . GLU D 4 89  ? 7.779  84.198  -5.644  1.00 164.22 ? 89   GLU H OE1 1 
ATOM 3664 O OE2 . GLU D 4 89  ? 7.942  86.051  -4.478  1.00 170.59 ? 89   GLU H OE2 1 
ATOM 3665 N N   . ASP D 4 90  ? 11.143 81.417  -7.548  1.00 96.96  ? 90   ASP H N   1 
ATOM 3666 C CA  . ASP D 4 90  ? 11.792 80.205  -8.032  1.00 87.79  ? 90   ASP H CA  1 
ATOM 3667 C C   . ASP D 4 90  ? 13.039 80.489  -8.861  1.00 89.71  ? 90   ASP H C   1 
ATOM 3668 O O   . ASP D 4 90  ? 13.807 79.559  -9.131  1.00 90.31  ? 90   ASP H O   1 
ATOM 3669 C CB  . ASP D 4 90  ? 10.803 79.372  -8.853  1.00 86.05  ? 90   ASP H CB  1 
ATOM 3670 C CG  . ASP D 4 90  ? 9.656  78.829  -8.013  1.00 95.23  ? 90   ASP H CG  1 
ATOM 3671 O OD1 . ASP D 4 90  ? 9.702  78.990  -6.775  1.00 103.06 ? 90   ASP H OD1 1 
ATOM 3672 O OD2 . ASP D 4 90  ? 8.710  78.245  -8.586  1.00 93.54  ? 90   ASP H OD2 1 
ATOM 3673 N N   . THR D 4 91  ? 13.258 81.738  -9.269  1.00 96.30  ? 91   THR H N   1 
ATOM 3674 C CA  . THR D 4 91  ? 14.450 82.093  -10.028 1.00 99.60  ? 91   THR H CA  1 
ATOM 3675 C C   . THR D 4 91  ? 15.699 81.773  -9.222  1.00 105.73 ? 91   THR H C   1 
ATOM 3676 O O   . THR D 4 91  ? 15.942 82.398  -8.185  1.00 118.50 ? 91   THR H O   1 
ATOM 3677 C CB  . THR D 4 91  ? 14.427 83.574  -10.401 1.00 100.96 ? 91   THR H CB  1 
ATOM 3678 O OG1 . THR D 4 91  ? 13.296 83.836  -11.240 1.00 101.66 ? 91   THR H OG1 1 
ATOM 3679 C CG2 . THR D 4 91  ? 15.703 83.956  -11.135 1.00 101.33 ? 91   THR H CG2 1 
ATOM 3680 N N   . ALA D 4 92  ? 16.494 80.809  -9.679  1.00 93.92  ? 92   ALA H N   1 
ATOM 3681 C CA  . ALA D 4 92  ? 17.632 80.365  -8.880  1.00 92.43  ? 92   ALA H CA  1 
ATOM 3682 C C   . ALA D 4 92  ? 18.515 79.447  -9.714  1.00 94.30  ? 92   ALA H C   1 
ATOM 3683 O O   . ALA D 4 92  ? 18.195 79.096  -10.855 1.00 97.07  ? 92   ALA H O   1 
ATOM 3684 C CB  . ALA D 4 92  ? 17.171 79.661  -7.602  1.00 93.04  ? 92   ALA H CB  1 
ATOM 3685 N N   . MET D 4 93  ? 19.643 79.066  -9.117  1.00 93.23  ? 93   MET H N   1 
ATOM 3686 C CA  . MET D 4 93  ? 20.573 78.103  -9.691  1.00 93.19  ? 93   MET H CA  1 
ATOM 3687 C C   . MET D 4 93  ? 20.350 76.755  -9.022  1.00 89.67  ? 93   MET H C   1 
ATOM 3688 O O   . MET D 4 93  ? 20.535 76.621  -7.808  1.00 89.73  ? 93   MET H O   1 
ATOM 3689 C CB  . MET D 4 93  ? 22.020 78.554  -9.502  1.00 96.77  ? 93   MET H CB  1 
ATOM 3690 C CG  . MET D 4 93  ? 23.051 77.574  -10.044 1.00 93.42  ? 93   MET H CG  1 
ATOM 3691 S SD  . MET D 4 93  ? 23.394 77.836  -11.795 1.00 96.28  ? 93   MET H SD  1 
ATOM 3692 C CE  . MET D 4 93  ? 24.141 79.457  -11.739 1.00 102.70 ? 93   MET H CE  1 
ATOM 3693 N N   . TYR D 4 94  ? 19.968 75.760  -9.813  1.00 98.32  ? 94   TYR H N   1 
ATOM 3694 C CA  . TYR D 4 94  ? 19.584 74.452  -9.305  1.00 96.74  ? 94   TYR H CA  1 
ATOM 3695 C C   . TYR D 4 94  ? 20.739 73.468  -9.413  1.00 95.38  ? 94   TYR H C   1 
ATOM 3696 O O   . TYR D 4 94  ? 21.464 73.445  -10.410 1.00 102.67 ? 94   TYR H O   1 
ATOM 3697 C CB  . TYR D 4 94  ? 18.370 73.917  -10.062 1.00 97.77  ? 94   TYR H CB  1 
ATOM 3698 C CG  . TYR D 4 94  ? 17.114 74.700  -9.773  1.00 102.54 ? 94   TYR H CG  1 
ATOM 3699 C CD1 . TYR D 4 94  ? 16.912 75.957  -10.328 1.00 103.25 ? 94   TYR H CD1 1 
ATOM 3700 C CD2 . TYR D 4 94  ? 16.135 74.189  -8.934  1.00 112.07 ? 94   TYR H CD2 1 
ATOM 3701 C CE1 . TYR D 4 94  ? 15.768 76.682  -10.058 1.00 109.96 ? 94   TYR H CE1 1 
ATOM 3702 C CE2 . TYR D 4 94  ? 14.986 74.905  -8.660  1.00 114.62 ? 94   TYR H CE2 1 
ATOM 3703 C CZ  . TYR D 4 94  ? 14.808 76.152  -9.224  1.00 113.91 ? 94   TYR H CZ  1 
ATOM 3704 O OH  . TYR D 4 94  ? 13.665 76.869  -8.952  1.00 115.10 ? 94   TYR H OH  1 
ATOM 3705 N N   . PHE D 4 95  ? 20.889 72.648  -8.381  1.00 77.63  ? 95   PHE H N   1 
ATOM 3706 C CA  . PHE D 4 95  ? 21.912 71.621  -8.306  1.00 73.09  ? 95   PHE H CA  1 
ATOM 3707 C C   . PHE D 4 95  ? 21.260 70.290  -7.980  1.00 85.67  ? 95   PHE H C   1 
ATOM 3708 O O   . PHE D 4 95  ? 20.321 70.234  -7.182  1.00 94.75  ? 95   PHE H O   1 
ATOM 3709 C CB  . PHE D 4 95  ? 22.942 71.910  -7.221  1.00 66.58  ? 95   PHE H CB  1 
ATOM 3710 C CG  . PHE D 4 95  ? 23.622 73.227  -7.345  1.00 69.96  ? 95   PHE H CG  1 
ATOM 3711 C CD1 . PHE D 4 95  ? 23.096 74.354  -6.736  1.00 77.99  ? 95   PHE H CD1 1 
ATOM 3712 C CD2 . PHE D 4 95  ? 24.819 73.334  -8.027  1.00 81.09  ? 95   PHE H CD2 1 
ATOM 3713 C CE1 . PHE D 4 95  ? 23.742 75.569  -6.828  1.00 81.09  ? 95   PHE H CE1 1 
ATOM 3714 C CE2 . PHE D 4 95  ? 25.467 74.543  -8.125  1.00 88.12  ? 95   PHE H CE2 1 
ATOM 3715 C CZ  . PHE D 4 95  ? 24.929 75.662  -7.525  1.00 88.01  ? 95   PHE H CZ  1 
ATOM 3716 N N   . CYS D 4 96  ? 21.777 69.220  -8.575  1.00 83.76  ? 96   CYS H N   1 
ATOM 3717 C CA  . CYS D 4 96  ? 21.515 67.869  -8.098  1.00 91.92  ? 96   CYS H CA  1 
ATOM 3718 C C   . CYS D 4 96  ? 22.693 67.461  -7.227  1.00 93.26  ? 96   CYS H C   1 
ATOM 3719 O O   . CYS D 4 96  ? 23.843 67.490  -7.679  1.00 100.41 ? 96   CYS H O   1 
ATOM 3720 C CB  . CYS D 4 96  ? 21.304 66.873  -9.242  1.00 103.35 ? 96   CYS H CB  1 
ATOM 3721 S SG  . CYS D 4 96  ? 22.607 66.774  -10.510 1.00 109.79 ? 96   CYS H SG  1 
ATOM 3722 N N   . ALA D 4 97  ? 22.415 67.117  -5.976  1.00 86.20  ? 97   ALA H N   1 
ATOM 3723 C CA  . ALA D 4 97  ? 23.458 66.713  -5.050  1.00 77.17  ? 97   ALA H CA  1 
ATOM 3724 C C   . ALA D 4 97  ? 23.029 65.439  -4.341  1.00 77.58  ? 97   ALA H C   1 
ATOM 3725 O O   . ALA D 4 97  ? 21.840 65.223  -4.092  1.00 77.40  ? 97   ALA H O   1 
ATOM 3726 C CB  . ALA D 4 97  ? 23.764 67.819  -4.033  1.00 71.51  ? 97   ALA H CB  1 
ATOM 3727 N N   . THR D 4 98  ? 24.008 64.592  -4.031  1.00 81.49  ? 98   THR H N   1 
ATOM 3728 C CA  . THR D 4 98  ? 23.769 63.354  -3.305  1.00 86.10  ? 98   THR H CA  1 
ATOM 3729 C C   . THR D 4 98  ? 24.831 63.188  -2.231  1.00 85.19  ? 98   THR H C   1 
ATOM 3730 O O   . THR D 4 98  ? 25.956 63.677  -2.366  1.00 83.31  ? 98   THR H O   1 
ATOM 3731 C CB  . THR D 4 98  ? 23.775 62.122  -4.230  1.00 90.14  ? 98   THR H CB  1 
ATOM 3732 O OG1 . THR D 4 98  ? 23.750 60.925  -3.438  1.00 89.44  ? 98   THR H OG1 1 
ATOM 3733 C CG2 . THR D 4 98  ? 25.013 62.113  -5.119  1.00 94.63  ? 98   THR H CG2 1 
ATOM 3734 N N   . SER D 4 99  ? 24.455 62.509  -1.148  1.00 93.40  ? 99   SER H N   1 
ATOM 3735 C CA  . SER D 4 99  ? 25.435 62.095  -0.152  1.00 99.45  ? 99   SER H CA  1 
ATOM 3736 C C   . SER D 4 99  ? 26.266 60.911  -0.615  1.00 90.28  ? 99   SER H C   1 
ATOM 3737 O O   . SER D 4 99  ? 27.307 60.630  -0.008  1.00 86.14  ? 99   SER H O   1 
ATOM 3738 C CB  . SER D 4 99  ? 24.732 61.734  1.149   1.00 100.82 ? 99   SER H CB  1 
ATOM 3739 O OG  . SER D 4 99  ? 23.779 60.714  0.923   1.00 91.55  ? 99   SER H OG  1 
ATOM 3740 N N   . LEU D 4 100 ? 25.821 60.217  -1.666  1.00 93.37  ? 100  LEU H N   1 
ATOM 3741 C CA  . LEU D 4 100 ? 26.457 58.992  -2.157  1.00 101.10 ? 100  LEU H CA  1 
ATOM 3742 C C   . LEU D 4 100 ? 26.598 57.966  -1.040  1.00 99.00  ? 100  LEU H C   1 
ATOM 3743 O O   . LEU D 4 100 ? 27.542 57.172  -1.006  1.00 91.10  ? 100  LEU H O   1 
ATOM 3744 C CB  . LEU D 4 100 ? 27.811 59.282  -2.804  1.00 108.83 ? 100  LEU H CB  1 
ATOM 3745 C CG  . LEU D 4 100 ? 28.130 58.314  -3.945  1.00 118.50 ? 100  LEU H CG  1 
ATOM 3746 C CD1 . LEU D 4 100 ? 27.138 58.514  -5.081  1.00 108.40 ? 100  LEU H CD1 1 
ATOM 3747 C CD2 . LEU D 4 100 ? 29.567 58.456  -4.431  1.00 133.41 ? 100  LEU H CD2 1 
ATOM 3748 N N   . TYR D 4 101 ? 25.654 57.999  -0.107  1.00 97.21  ? 101  TYR H N   1 
ATOM 3749 C CA  . TYR D 4 101 ? 25.655 57.096  1.037   1.00 88.05  ? 101  TYR H CA  1 
ATOM 3750 C C   . TYR D 4 101 ? 24.187 56.884  1.408   1.00 95.93  ? 101  TYR H C   1 
ATOM 3751 O O   . TYR D 4 101 ? 23.613 57.653  2.182   1.00 99.61  ? 101  TYR H O   1 
ATOM 3752 C CB  . TYR D 4 101 ? 26.463 57.679  2.186   1.00 88.10  ? 101  TYR H CB  1 
ATOM 3753 C CG  . TYR D 4 101 ? 26.610 56.779  3.381   1.00 96.84  ? 101  TYR H CG  1 
ATOM 3754 C CD1 . TYR D 4 101 ? 27.672 55.892  3.476   1.00 115.09 ? 101  TYR H CD1 1 
ATOM 3755 C CD2 . TYR D 4 101 ? 25.693 56.821  4.424   1.00 100.91 ? 101  TYR H CD2 1 
ATOM 3756 C CE1 . TYR D 4 101 ? 27.813 55.062  4.575   1.00 118.64 ? 101  TYR H CE1 1 
ATOM 3757 C CE2 . TYR D 4 101 ? 25.825 56.000  5.523   1.00 108.34 ? 101  TYR H CE2 1 
ATOM 3758 C CZ  . TYR D 4 101 ? 26.887 55.123  5.594   1.00 115.25 ? 101  TYR H CZ  1 
ATOM 3759 O OH  . TYR D 4 101 ? 27.026 54.303  6.689   1.00 130.47 ? 101  TYR H OH  1 
ATOM 3760 N N   . TYR D 4 102 ? 23.588 55.851  0.822   1.00 103.87 ? 102  TYR H N   1 
ATOM 3761 C CA  . TYR D 4 102 ? 22.234 55.392  1.124   1.00 114.51 ? 102  TYR H CA  1 
ATOM 3762 C C   . TYR D 4 102 ? 21.172 56.460  0.906   1.00 117.83 ? 102  TYR H C   1 
ATOM 3763 O O   . TYR D 4 102 ? 20.014 56.254  1.282   1.00 131.67 ? 102  TYR H O   1 
ATOM 3764 C CB  . TYR D 4 102 ? 22.128 54.869  2.563   1.00 120.66 ? 102  TYR H CB  1 
ATOM 3765 C CG  . TYR D 4 102 ? 22.984 53.657  2.873   1.00 124.55 ? 102  TYR H CG  1 
ATOM 3766 C CD1 . TYR D 4 102 ? 23.666 52.975  1.870   1.00 121.92 ? 102  TYR H CD1 1 
ATOM 3767 C CD2 . TYR D 4 102 ? 23.094 53.188  4.174   1.00 135.42 ? 102  TYR H CD2 1 
ATOM 3768 C CE1 . TYR D 4 102 ? 24.439 51.867  2.162   1.00 139.29 ? 102  TYR H CE1 1 
ATOM 3769 C CE2 . TYR D 4 102 ? 23.862 52.078  4.475   1.00 143.07 ? 102  TYR H CE2 1 
ATOM 3770 C CZ  . TYR D 4 102 ? 24.532 51.421  3.469   1.00 145.84 ? 102  TYR H CZ  1 
ATOM 3771 O OH  . TYR D 4 102 ? 25.297 50.316  3.780   1.00 145.17 ? 102  TYR H OH  1 
ATOM 3772 N N   . GLY D 4 103 ? 21.521 57.595  0.316   1.00 117.73 ? 103  GLY H N   1 
ATOM 3773 C CA  . GLY D 4 103 ? 20.571 58.687  0.228   1.00 122.77 ? 103  GLY H CA  1 
ATOM 3774 C C   . GLY D 4 103 ? 20.280 59.323  1.573   1.00 122.79 ? 103  GLY H C   1 
ATOM 3775 O O   . GLY D 4 103 ? 19.118 59.502  1.949   1.00 122.92 ? 103  GLY H O   1 
ATOM 3776 N N   . THR D 4 104 ? 21.333 59.663  2.312   1.00 119.93 ? 104  THR H N   1 
ATOM 3777 C CA  . THR D 4 104 ? 21.204 60.370  3.574   1.00 110.30 ? 104  THR H CA  1 
ATOM 3778 C C   . THR D 4 104 ? 21.056 61.871  3.333   1.00 104.44 ? 104  THR H C   1 
ATOM 3779 O O   . THR D 4 104 ? 21.519 62.390  2.314   1.00 103.42 ? 104  THR H O   1 
ATOM 3780 C CB  . THR D 4 104 ? 22.421 60.118  4.448   1.00 108.15 ? 104  THR H CB  1 
ATOM 3781 O OG1 . THR D 4 104 ? 23.606 60.367  3.685   1.00 108.77 ? 104  THR H OG1 1 
ATOM 3782 C CG2 . THR D 4 104 ? 22.427 58.689  4.955   1.00 111.44 ? 104  THR H CG2 1 
ATOM 3783 N N   . PRO D 4 105 ? 20.429 62.592  4.274   1.00 105.78 ? 105  PRO H N   1 
ATOM 3784 C CA  . PRO D 4 105 ? 20.080 64.002  4.034   1.00 105.41 ? 105  PRO H CA  1 
ATOM 3785 C C   . PRO D 4 105 ? 21.247 64.983  4.109   1.00 98.56  ? 105  PRO H C   1 
ATOM 3786 O O   . PRO D 4 105 ? 21.185 65.977  4.838   1.00 100.23 ? 105  PRO H O   1 
ATOM 3787 C CB  . PRO D 4 105 ? 19.051 64.286  5.136   1.00 106.08 ? 105  PRO H CB  1 
ATOM 3788 C CG  . PRO D 4 105 ? 19.383 63.321  6.220   1.00 102.59 ? 105  PRO H CG  1 
ATOM 3789 C CD  . PRO D 4 105 ? 19.858 62.085  5.535   1.00 99.88  ? 105  PRO H CD  1 
ATOM 3790 N N   . TRP D 4 106 ? 22.307 64.728  3.347   1.00 86.84  ? 106  TRP H N   1 
ATOM 3791 C CA  . TRP D 4 106 ? 23.392 65.682  3.177   1.00 74.01  ? 106  TRP H CA  1 
ATOM 3792 C C   . TRP D 4 106 ? 23.915 65.555  1.750   1.00 77.66  ? 106  TRP H C   1 
ATOM 3793 O O   . TRP D 4 106 ? 23.420 64.752  0.953   1.00 74.23  ? 106  TRP H O   1 
ATOM 3794 C CB  . TRP D 4 106 ? 24.493 65.493  4.235   1.00 76.00  ? 106  TRP H CB  1 
ATOM 3795 C CG  . TRP D 4 106 ? 25.327 64.250  4.114   1.00 84.75  ? 106  TRP H CG  1 
ATOM 3796 C CD1 . TRP D 4 106 ? 26.331 64.019  3.221   1.00 87.50  ? 106  TRP H CD1 1 
ATOM 3797 C CD2 . TRP D 4 106 ? 25.261 63.088  4.952   1.00 97.75  ? 106  TRP H CD2 1 
ATOM 3798 N NE1 . TRP D 4 106 ? 26.881 62.774  3.435   1.00 95.22  ? 106  TRP H NE1 1 
ATOM 3799 C CE2 . TRP D 4 106 ? 26.241 62.184  4.493   1.00 95.44  ? 106  TRP H CE2 1 
ATOM 3800 C CE3 . TRP D 4 106 ? 24.461 62.718  6.038   1.00 104.71 ? 106  TRP H CE3 1 
ATOM 3801 C CZ2 . TRP D 4 106 ? 26.442 60.940  5.080   1.00 97.62  ? 106  TRP H CZ2 1 
ATOM 3802 C CZ3 . TRP D 4 106 ? 24.667 61.482  6.621   1.00 104.35 ? 106  TRP H CZ3 1 
ATOM 3803 C CH2 . TRP D 4 106 ? 25.646 60.607  6.139   1.00 94.49  ? 106  TRP H CH2 1 
ATOM 3804 N N   . PHE D 4 107 ? 24.908 66.372  1.408   1.00 92.89  ? 107  PHE H N   1 
ATOM 3805 C CA  . PHE D 4 107 ? 25.344 66.519  0.022   1.00 94.49  ? 107  PHE H CA  1 
ATOM 3806 C C   . PHE D 4 107 ? 26.867 66.502  -0.022  1.00 103.58 ? 107  PHE H C   1 
ATOM 3807 O O   . PHE D 4 107 ? 27.516 67.535  0.174   1.00 98.88  ? 107  PHE H O   1 
ATOM 3808 C CB  . PHE D 4 107 ? 24.779 67.800  -0.580  1.00 88.12  ? 107  PHE H CB  1 
ATOM 3809 C CG  . PHE D 4 107 ? 23.372 68.099  -0.143  1.00 88.91  ? 107  PHE H CG  1 
ATOM 3810 C CD1 . PHE D 4 107 ? 22.301 67.423  -0.702  1.00 94.37  ? 107  PHE H CD1 1 
ATOM 3811 C CD2 . PHE D 4 107 ? 23.122 69.048  0.834   1.00 88.32  ? 107  PHE H CD2 1 
ATOM 3812 C CE1 . PHE D 4 107 ? 21.007 67.692  -0.296  1.00 96.62  ? 107  PHE H CE1 1 
ATOM 3813 C CE2 . PHE D 4 107 ? 21.830 69.320  1.242   1.00 87.18  ? 107  PHE H CE2 1 
ATOM 3814 C CZ  . PHE D 4 107 ? 20.771 68.643  0.678   1.00 87.25  ? 107  PHE H CZ  1 
ATOM 3815 N N   . ALA D 4 108 ? 27.433 65.329  -0.294  1.00 108.56 ? 108  ALA H N   1 
ATOM 3816 C CA  . ALA D 4 108 ? 28.878 65.212  -0.424  1.00 110.58 ? 108  ALA H CA  1 
ATOM 3817 C C   . ALA D 4 108 ? 29.358 65.567  -1.825  1.00 103.86 ? 108  ALA H C   1 
ATOM 3818 O O   . ALA D 4 108 ? 30.386 66.237  -1.977  1.00 115.91 ? 108  ALA H O   1 
ATOM 3819 C CB  . ALA D 4 108 ? 29.329 63.796  -0.062  1.00 117.07 ? 108  ALA H CB  1 
ATOM 3820 N N   . TYR D 4 109 ? 28.625 65.138  -2.846  1.00 91.22  ? 109  TYR H N   1 
ATOM 3821 C CA  . TYR D 4 109 ? 28.985 65.353  -4.241  1.00 89.48  ? 109  TYR H CA  1 
ATOM 3822 C C   . TYR D 4 109 ? 27.967 66.305  -4.853  1.00 80.12  ? 109  TYR H C   1 
ATOM 3823 O O   . TYR D 4 109 ? 26.768 66.006  -4.878  1.00 79.40  ? 109  TYR H O   1 
ATOM 3824 C CB  . TYR D 4 109 ? 29.041 64.020  -4.997  1.00 99.58  ? 109  TYR H CB  1 
ATOM 3825 C CG  . TYR D 4 109 ? 30.144 63.104  -4.497  1.00 96.38  ? 109  TYR H CG  1 
ATOM 3826 C CD1 . TYR D 4 109 ? 31.432 63.193  -5.012  1.00 100.52 ? 109  TYR H CD1 1 
ATOM 3827 C CD2 . TYR D 4 109 ? 29.906 62.177  -3.489  1.00 89.36  ? 109  TYR H CD2 1 
ATOM 3828 C CE1 . TYR D 4 109 ? 32.451 62.373  -4.548  1.00 105.22 ? 109  TYR H CE1 1 
ATOM 3829 C CE2 . TYR D 4 109 ? 30.921 61.354  -3.017  1.00 97.98  ? 109  TYR H CE2 1 
ATOM 3830 C CZ  . TYR D 4 109 ? 32.191 61.455  -3.552  1.00 104.80 ? 109  TYR H CZ  1 
ATOM 3831 O OH  . TYR D 4 109 ? 33.206 60.643  -3.092  1.00 109.83 ? 109  TYR H OH  1 
ATOM 3832 N N   . TRP D 4 110 ? 28.438 67.461  -5.308  1.00 87.52  ? 110  TRP H N   1 
ATOM 3833 C CA  . TRP D 4 110 ? 27.572 68.475  -5.890  1.00 90.97  ? 110  TRP H CA  1 
ATOM 3834 C C   . TRP D 4 110 ? 27.737 68.522  -7.401  1.00 93.95  ? 110  TRP H C   1 
ATOM 3835 O O   . TRP D 4 110 ? 28.827 68.307  -7.935  1.00 102.71 ? 110  TRP H O   1 
ATOM 3836 C CB  . TRP D 4 110 ? 27.859 69.860  -5.304  1.00 81.49  ? 110  TRP H CB  1 
ATOM 3837 C CG  . TRP D 4 110 ? 27.318 70.061  -3.923  1.00 78.38  ? 110  TRP H CG  1 
ATOM 3838 C CD1 . TRP D 4 110 ? 27.883 69.638  -2.757  1.00 87.54  ? 110  TRP H CD1 1 
ATOM 3839 C CD2 . TRP D 4 110 ? 26.108 70.738  -3.560  1.00 79.30  ? 110  TRP H CD2 1 
ATOM 3840 N NE1 . TRP D 4 110 ? 27.104 70.004  -1.693  1.00 90.07  ? 110  TRP H NE1 1 
ATOM 3841 C CE2 . TRP D 4 110 ? 26.008 70.682  -2.156  1.00 84.99  ? 110  TRP H CE2 1 
ATOM 3842 C CE3 . TRP D 4 110 ? 25.101 71.385  -4.283  1.00 77.30  ? 110  TRP H CE3 1 
ATOM 3843 C CZ2 . TRP D 4 110 ? 24.940 71.249  -1.460  1.00 85.19  ? 110  TRP H CZ2 1 
ATOM 3844 C CZ3 . TRP D 4 110 ? 24.039 71.948  -3.589  1.00 75.43  ? 110  TRP H CZ3 1 
ATOM 3845 C CH2 . TRP D 4 110 ? 23.969 71.876  -2.193  1.00 78.01  ? 110  TRP H CH2 1 
ATOM 3846 N N   . GLY D 4 111 ? 26.635 68.805  -8.086  1.00 93.14  ? 111  GLY H N   1 
ATOM 3847 C CA  . GLY D 4 111 ? 26.658 69.005  -9.515  1.00 94.06  ? 111  GLY H CA  1 
ATOM 3848 C C   . GLY D 4 111 ? 27.155 70.390  -9.870  1.00 94.32  ? 111  GLY H C   1 
ATOM 3849 O O   . GLY D 4 111 ? 27.572 71.180  -9.022  1.00 99.67  ? 111  GLY H O   1 
ATOM 3850 N N   . GLN D 4 112 ? 27.108 70.687  -11.167 1.00 108.88 ? 112  GLN H N   1 
ATOM 3851 C CA  . GLN D 4 112 ? 27.591 71.983  -11.627 1.00 116.85 ? 112  GLN H CA  1 
ATOM 3852 C C   . GLN D 4 112 ? 26.520 73.057  -11.487 1.00 104.72 ? 112  GLN H C   1 
ATOM 3853 O O   . GLN D 4 112 ? 26.835 74.216  -11.200 1.00 100.55 ? 112  GLN H O   1 
ATOM 3854 C CB  . GLN D 4 112 ? 28.075 71.876  -13.072 1.00 138.86 ? 112  GLN H CB  1 
ATOM 3855 C CG  . GLN D 4 112 ? 29.310 70.998  -13.234 1.00 163.78 ? 112  GLN H CG  1 
ATOM 3856 C CD  . GLN D 4 112 ? 30.490 71.481  -12.402 1.00 176.01 ? 112  GLN H CD  1 
ATOM 3857 O OE1 . GLN D 4 112 ? 30.711 72.683  -12.252 1.00 179.21 ? 112  GLN H OE1 1 
ATOM 3858 N NE2 . GLN D 4 112 ? 31.253 70.540  -11.857 1.00 181.44 ? 112  GLN H NE2 1 
ATOM 3859 N N   . GLY D 4 113 ? 25.265 72.694  -11.671 1.00 98.79  ? 113  GLY H N   1 
ATOM 3860 C CA  . GLY D 4 113 ? 24.177 73.637  -11.525 1.00 88.08  ? 113  GLY H CA  1 
ATOM 3861 C C   . GLY D 4 113 ? 23.683 74.152  -12.862 1.00 88.42  ? 113  GLY H C   1 
ATOM 3862 O O   . GLY D 4 113 ? 24.417 74.199  -13.855 1.00 95.10  ? 113  GLY H O   1 
ATOM 3863 N N   . THR D 4 114 ? 22.414 74.551  -12.890 1.00 91.72  ? 114  THR H N   1 
ATOM 3864 C CA  . THR D 4 114 ? 21.802 75.142  -14.071 1.00 98.15  ? 114  THR H CA  1 
ATOM 3865 C C   . THR D 4 114 ? 20.904 76.294  -13.639 1.00 114.85 ? 114  THR H C   1 
ATOM 3866 O O   . THR D 4 114 ? 20.175 76.188  -12.649 1.00 130.93 ? 114  THR H O   1 
ATOM 3867 C CB  . THR D 4 114 ? 21.002 74.104  -14.870 1.00 94.78  ? 114  THR H CB  1 
ATOM 3868 O OG1 . THR D 4 114 ? 20.310 74.752  -15.941 1.00 105.92 ? 114  THR H OG1 1 
ATOM 3869 C CG2 . THR D 4 114 ? 20.001 73.391  -13.980 1.00 92.83  ? 114  THR H CG2 1 
ATOM 3870 N N   . LEU D 4 115 ? 20.964 77.394  -14.381 1.00 117.59 ? 115  LEU H N   1 
ATOM 3871 C CA  . LEU D 4 115 ? 20.252 78.609  -14.014 1.00 110.58 ? 115  LEU H CA  1 
ATOM 3872 C C   . LEU D 4 115 ? 18.849 78.627  -14.606 1.00 106.04 ? 115  LEU H C   1 
ATOM 3873 O O   . LEU D 4 115 ? 18.652 78.311  -15.782 1.00 114.11 ? 115  LEU H O   1 
ATOM 3874 C CB  . LEU D 4 115 ? 21.022 79.843  -14.484 1.00 118.16 ? 115  LEU H CB  1 
ATOM 3875 C CG  . LEU D 4 115 ? 20.405 81.192  -14.119 1.00 118.49 ? 115  LEU H CG  1 
ATOM 3876 C CD1 . LEU D 4 115 ? 20.248 81.307  -12.615 1.00 111.58 ? 115  LEU H CD1 1 
ATOM 3877 C CD2 . LEU D 4 115 ? 21.275 82.307  -14.659 1.00 128.93 ? 115  LEU H CD2 1 
ATOM 3878 N N   . VAL D 4 116 ? 17.877 79.011  -13.781 1.00 97.65  ? 116  VAL H N   1 
ATOM 3879 C CA  . VAL D 4 116 ? 16.491 79.155  -14.209 1.00 88.76  ? 116  VAL H CA  1 
ATOM 3880 C C   . VAL D 4 116 ? 16.004 80.530  -13.783 1.00 98.28  ? 116  VAL H C   1 
ATOM 3881 O O   . VAL D 4 116 ? 15.985 80.842  -12.584 1.00 107.74 ? 116  VAL H O   1 
ATOM 3882 C CB  . VAL D 4 116 ? 15.580 78.064  -13.626 1.00 89.14  ? 116  VAL H CB  1 
ATOM 3883 C CG1 . VAL D 4 116 ? 14.139 78.322  -14.037 1.00 86.10  ? 116  VAL H CG1 1 
ATOM 3884 C CG2 . VAL D 4 116 ? 16.035 76.690  -14.082 1.00 94.33  ? 116  VAL H CG2 1 
ATOM 3885 N N   . THR D 4 117 ? 15.606 81.342  -14.758 1.00 105.42 ? 117  THR H N   1 
ATOM 3886 C CA  . THR D 4 117 ? 15.102 82.688  -14.529 1.00 98.54  ? 117  THR H CA  1 
ATOM 3887 C C   . THR D 4 117 ? 13.612 82.740  -14.844 1.00 106.88 ? 117  THR H C   1 
ATOM 3888 O O   . THR D 4 117 ? 13.166 82.196  -15.859 1.00 111.41 ? 117  THR H O   1 
ATOM 3889 C CB  . THR D 4 117 ? 15.852 83.698  -15.397 1.00 101.08 ? 117  THR H CB  1 
ATOM 3890 O OG1 . THR D 4 117 ? 17.264 83.516  -15.229 1.00 100.99 ? 117  THR H OG1 1 
ATOM 3891 C CG2 . THR D 4 117 ? 15.474 85.123  -15.018 1.00 106.72 ? 117  THR H CG2 1 
ATOM 3892 N N   . VAL D 4 118 ? 12.845 83.398  -13.980 1.00 101.94 ? 118  VAL H N   1 
ATOM 3893 C CA  . VAL D 4 118 ? 11.395 83.495  -14.126 1.00 100.91 ? 118  VAL H CA  1 
ATOM 3894 C C   . VAL D 4 118 ? 11.047 84.973  -14.259 1.00 110.47 ? 118  VAL H C   1 
ATOM 3895 O O   . VAL D 4 118 ? 10.949 85.698  -13.260 1.00 110.93 ? 118  VAL H O   1 
ATOM 3896 C CB  . VAL D 4 118 ? 10.652 82.846  -12.954 1.00 92.00  ? 118  VAL H CB  1 
ATOM 3897 C CG1 . VAL D 4 118 ? 9.152  82.817  -13.226 1.00 97.26  ? 118  VAL H CG1 1 
ATOM 3898 C CG2 . VAL D 4 118 ? 11.181 81.446  -12.710 1.00 75.05  ? 118  VAL H CG2 1 
ATOM 3899 N N   . SER D 4 119 ? 10.858 85.430  -15.494 1.00 105.58 ? 119  SER H N   1 
ATOM 3900 C CA  . SER D 4 119 ? 10.554 86.830  -15.747 1.00 112.44 ? 119  SER H CA  1 
ATOM 3901 C C   . SER D 4 119 ? 9.947  86.958  -17.135 1.00 114.40 ? 119  SER H C   1 
ATOM 3902 O O   . SER D 4 119 ? 10.459 86.382  -18.100 1.00 112.73 ? 119  SER H O   1 
ATOM 3903 C CB  . SER D 4 119 ? 11.808 87.704  -15.632 1.00 112.54 ? 119  SER H CB  1 
ATOM 3904 O OG  . SER D 4 119 ? 11.499 89.064  -15.870 1.00 118.58 ? 119  SER H OG  1 
ATOM 3905 N N   . ALA D 4 120 ? 8.865  87.724  -17.227 1.00 115.10 ? 120  ALA H N   1 
ATOM 3906 C CA  . ALA D 4 120 ? 8.206  87.951  -18.505 1.00 113.94 ? 120  ALA H CA  1 
ATOM 3907 C C   . ALA D 4 120 ? 8.934  88.968  -19.372 1.00 110.61 ? 120  ALA H C   1 
ATOM 3908 O O   . ALA D 4 120 ? 8.473  89.247  -20.485 1.00 117.25 ? 120  ALA H O   1 
ATOM 3909 C CB  . ALA D 4 120 ? 6.763  88.402  -18.279 1.00 116.80 ? 120  ALA H CB  1 
ATOM 3910 N N   . ALA D 4 121 ? 10.046 89.522  -18.893 1.00 104.93 ? 121  ALA H N   1 
ATOM 3911 C CA  . ALA D 4 121 ? 10.789 90.519  -19.646 1.00 111.16 ? 121  ALA H CA  1 
ATOM 3912 C C   . ALA D 4 121 ? 11.453 89.890  -20.868 1.00 119.43 ? 121  ALA H C   1 
ATOM 3913 O O   . ALA D 4 121 ? 11.752 88.693  -20.899 1.00 125.35 ? 121  ALA H O   1 
ATOM 3914 C CB  . ALA D 4 121 ? 11.843 91.180  -18.760 1.00 102.12 ? 121  ALA H CB  1 
ATOM 3915 N N   . LYS D 4 122 ? 11.682 90.719  -21.887 1.00 118.78 ? 122  LYS H N   1 
ATOM 3916 C CA  . LYS D 4 122 ? 12.305 90.249  -23.115 1.00 119.40 ? 122  LYS H CA  1 
ATOM 3917 C C   . LYS D 4 122 ? 13.754 89.837  -22.857 1.00 112.30 ? 122  LYS H C   1 
ATOM 3918 O O   . LYS D 4 122 ? 14.340 90.126  -21.809 1.00 116.46 ? 122  LYS H O   1 
ATOM 3919 C CB  . LYS D 4 122 ? 12.259 91.328  -24.198 1.00 129.66 ? 122  LYS H CB  1 
ATOM 3920 C CG  . LYS D 4 122 ? 10.869 91.828  -24.553 1.00 134.50 ? 122  LYS H CG  1 
ATOM 3921 C CD  . LYS D 4 122 ? 10.949 92.948  -25.579 1.00 138.49 ? 122  LYS H CD  1 
ATOM 3922 C CE  . LYS D 4 122 ? 9.576  93.515  -25.884 1.00 145.17 ? 122  LYS H CE  1 
ATOM 3923 N NZ  . LYS D 4 122 ? 9.659  94.619  -26.876 1.00 150.28 ? 122  LYS H NZ  1 
ATOM 3924 N N   . THR D 4 123 ? 14.333 89.149  -23.839 1.00 105.86 ? 123  THR H N   1 
ATOM 3925 C CA  . THR D 4 123 ? 15.734 88.730  -23.794 1.00 101.26 ? 123  THR H CA  1 
ATOM 3926 C C   . THR D 4 123 ? 16.521 89.738  -24.626 1.00 99.68  ? 123  THR H C   1 
ATOM 3927 O O   . THR D 4 123 ? 16.664 89.596  -25.839 1.00 114.78 ? 123  THR H O   1 
ATOM 3928 C CB  . THR D 4 123 ? 15.901 87.303  -24.308 1.00 99.65  ? 123  THR H CB  1 
ATOM 3929 O OG1 . THR D 4 123 ? 15.095 86.416  -23.523 1.00 104.36 ? 123  THR H OG1 1 
ATOM 3930 C CG2 . THR D 4 123 ? 17.353 86.868  -24.215 1.00 91.16  ? 123  THR H CG2 1 
ATOM 3931 N N   . THR D 4 124 ? 17.016 90.774  -23.968 1.00 89.84  ? 124  THR H N   1 
ATOM 3932 C CA  . THR D 4 124 ? 17.712 91.835  -24.683 1.00 88.60  ? 124  THR H CA  1 
ATOM 3933 C C   . THR D 4 124 ? 19.203 91.528  -24.727 1.00 75.76  ? 124  THR H C   1 
ATOM 3934 O O   . THR D 4 124 ? 19.790 91.200  -23.690 1.00 71.40  ? 124  THR H O   1 
ATOM 3935 C CB  . THR D 4 124 ? 17.469 93.186  -24.014 1.00 102.31 ? 124  THR H CB  1 
ATOM 3936 O OG1 . THR D 4 124 ? 16.064 93.463  -23.984 1.00 111.09 ? 124  THR H OG1 1 
ATOM 3937 C CG2 . THR D 4 124 ? 18.181 94.307  -24.764 1.00 110.15 ? 124  THR H CG2 1 
ATOM 3938 N N   . PRO D 4 125 ? 19.838 91.572  -25.900 1.00 77.65  ? 125  PRO H N   1 
ATOM 3939 C CA  . PRO D 4 125 ? 21.291 91.425  -25.937 1.00 74.81  ? 125  PRO H CA  1 
ATOM 3940 C C   . PRO D 4 125 ? 21.967 92.667  -25.390 1.00 83.48  ? 125  PRO H C   1 
ATOM 3941 O O   . PRO D 4 125 ? 21.376 93.759  -25.385 1.00 95.17  ? 125  PRO H O   1 
ATOM 3942 C CB  . PRO D 4 125 ? 21.590 91.228  -27.433 1.00 92.43  ? 125  PRO H CB  1 
ATOM 3943 C CG  . PRO D 4 125 ? 20.447 91.869  -28.133 1.00 111.15 ? 125  PRO H CG  1 
ATOM 3944 C CD  . PRO D 4 125 ? 19.247 91.694  -27.246 1.00 100.74 ? 125  PRO H CD  1 
ATOM 3945 N N   . PRO D 4 126 ? 23.198 92.550  -24.906 1.00 89.77  ? 126  PRO H N   1 
ATOM 3946 C CA  . PRO D 4 126 ? 23.860 93.688  -24.262 1.00 94.64  ? 126  PRO H CA  1 
ATOM 3947 C C   . PRO D 4 126 ? 24.405 94.703  -25.258 1.00 101.34 ? 126  PRO H C   1 
ATOM 3948 O O   . PRO D 4 126 ? 24.645 94.411  -26.431 1.00 111.24 ? 126  PRO H O   1 
ATOM 3949 C CB  . PRO D 4 126 ? 25.009 93.029  -23.491 1.00 95.03  ? 126  PRO H CB  1 
ATOM 3950 C CG  . PRO D 4 126 ? 25.335 91.818  -24.304 1.00 103.22 ? 126  PRO H CG  1 
ATOM 3951 C CD  . PRO D 4 126 ? 24.025 91.329  -24.864 1.00 100.82 ? 126  PRO H CD  1 
ATOM 3952 N N   . SER D 4 127 ? 24.598 95.922  -24.751 1.00 88.78  ? 127  SER H N   1 
ATOM 3953 C CA  . SER D 4 127 ? 25.316 96.975  -25.455 1.00 77.65  ? 127  SER H CA  1 
ATOM 3954 C C   . SER D 4 127 ? 26.688 97.122  -24.811 1.00 75.30  ? 127  SER H C   1 
ATOM 3955 O O   . SER D 4 127 ? 26.788 97.313  -23.595 1.00 80.98  ? 127  SER H O   1 
ATOM 3956 C CB  . SER D 4 127 ? 24.545 98.293  -25.401 1.00 72.65  ? 127  SER H CB  1 
ATOM 3957 O OG  . SER D 4 127 ? 23.201 98.099  -25.804 1.00 72.73  ? 127  SER H OG  1 
ATOM 3958 N N   . VAL D 4 128 ? 27.740 97.013  -25.613 1.00 72.33  ? 128  VAL H N   1 
ATOM 3959 C CA  . VAL D 4 128 ? 29.102 96.935  -25.099 1.00 72.76  ? 128  VAL H CA  1 
ATOM 3960 C C   . VAL D 4 128 ? 29.833 98.215  -25.472 1.00 78.86  ? 128  VAL H C   1 
ATOM 3961 O O   . VAL D 4 128 ? 29.949 98.555  -26.655 1.00 83.43  ? 128  VAL H O   1 
ATOM 3962 C CB  . VAL D 4 128 ? 29.841 95.701  -25.632 1.00 82.06  ? 128  VAL H CB  1 
ATOM 3963 C CG1 . VAL D 4 128 ? 31.209 95.615  -24.995 1.00 80.98  ? 128  VAL H CG1 1 
ATOM 3964 C CG2 . VAL D 4 128 ? 29.034 94.443  -25.349 1.00 91.99  ? 128  VAL H CG2 1 
ATOM 3965 N N   . TYR D 4 129 ? 30.332 98.915  -24.460 1.00 74.87  ? 129  TYR H N   1 
ATOM 3966 C CA  . TYR D 4 129 ? 31.013 100.172 -24.631 1.00 67.23  ? 129  TYR H CA  1 
ATOM 3967 C C   . TYR D 4 129 ? 32.453 100.048 -24.155 1.00 71.59  ? 129  TYR H C   1 
ATOM 3968 O O   . TYR D 4 129 ? 32.690 99.623  -23.016 1.00 72.81  ? 129  TYR H O   1 
ATOM 3969 C CB  . TYR D 4 129 ? 30.299 101.280 -23.856 1.00 65.69  ? 129  TYR H CB  1 
ATOM 3970 C CG  . TYR D 4 129 ? 28.869 101.483 -24.281 1.00 71.96  ? 129  TYR H CG  1 
ATOM 3971 C CD1 . TYR D 4 129 ? 28.559 101.930 -25.564 1.00 71.05  ? 129  TYR H CD1 1 
ATOM 3972 C CD2 . TYR D 4 129 ? 27.828 101.223 -23.409 1.00 64.81  ? 129  TYR H CD2 1 
ATOM 3973 C CE1 . TYR D 4 129 ? 27.247 102.109 -25.958 1.00 72.46  ? 129  TYR H CE1 1 
ATOM 3974 C CE2 . TYR D 4 129 ? 26.509 101.401 -23.792 1.00 76.43  ? 129  TYR H CE2 1 
ATOM 3975 C CZ  . TYR D 4 129 ? 26.225 101.843 -25.064 1.00 91.85  ? 129  TYR H CZ  1 
ATOM 3976 O OH  . TYR D 4 129 ? 24.906 102.010 -25.414 1.00 108.34 ? 129  TYR H OH  1 
ATOM 3977 N N   . PRO D 4 130 ? 33.430 100.406 -24.981 1.00 72.33  ? 130  PRO H N   1 
ATOM 3978 C CA  . PRO D 4 130 ? 34.826 100.327 -24.548 1.00 79.05  ? 130  PRO H CA  1 
ATOM 3979 C C   . PRO D 4 130 ? 35.153 101.424 -23.544 1.00 92.50  ? 130  PRO H C   1 
ATOM 3980 O O   . PRO D 4 130 ? 34.534 102.491 -23.519 1.00 95.74  ? 130  PRO H O   1 
ATOM 3981 C CB  . PRO D 4 130 ? 35.606 100.511 -25.852 1.00 76.07  ? 130  PRO H CB  1 
ATOM 3982 C CG  . PRO D 4 130 ? 34.699 101.341 -26.702 1.00 87.16  ? 130  PRO H CG  1 
ATOM 3983 C CD  . PRO D 4 130 ? 33.299 100.914 -26.356 1.00 74.70  ? 130  PRO H CD  1 
ATOM 3984 N N   . LEU D 4 131 ? 36.156 101.149 -22.703 1.00 87.82  ? 131  LEU H N   1 
ATOM 3985 C CA  . LEU D 4 131 ? 36.624 102.113 -21.700 1.00 77.08  ? 131  LEU H CA  1 
ATOM 3986 C C   . LEU D 4 131 ? 38.151 102.154 -21.752 1.00 88.86  ? 131  LEU H C   1 
ATOM 3987 O O   . LEU D 4 131 ? 38.832 101.348 -21.113 1.00 91.25  ? 131  LEU H O   1 
ATOM 3988 C CB  . LEU D 4 131 ? 36.122 101.763 -20.306 1.00 67.69  ? 131  LEU H CB  1 
ATOM 3989 C CG  . LEU D 4 131 ? 34.604 101.704 -20.132 1.00 68.56  ? 131  LEU H CG  1 
ATOM 3990 C CD1 . LEU D 4 131 ? 34.248 101.100 -18.789 1.00 69.68  ? 131  LEU H CD1 1 
ATOM 3991 C CD2 . LEU D 4 131 ? 33.957 103.075 -20.285 1.00 65.14  ? 131  LEU H CD2 1 
ATOM 3992 N N   . ALA D 4 132 ? 38.681 103.105 -22.514 1.00 98.81  ? 132  ALA H N   1 
ATOM 3993 C CA  . ALA D 4 132 ? 40.116 103.302 -22.585 1.00 112.71 ? 132  ALA H CA  1 
ATOM 3994 C C   . ALA D 4 132 ? 40.485 104.668 -22.018 1.00 119.68 ? 132  ALA H C   1 
ATOM 3995 O O   . ALA D 4 132 ? 39.656 105.585 -22.011 1.00 128.85 ? 132  ALA H O   1 
ATOM 3996 C CB  . ALA D 4 132 ? 40.619 103.189 -24.029 1.00 127.05 ? 132  ALA H CB  1 
ATOM 3997 N N   . PRO D 4 133 ? 41.709 104.831 -21.518 1.00 111.15 ? 133  PRO H N   1 
ATOM 3998 C CA  . PRO D 4 133 ? 42.129 106.149 -21.028 1.00 113.50 ? 133  PRO H CA  1 
ATOM 3999 C C   . PRO D 4 133 ? 42.150 107.169 -22.155 1.00 133.67 ? 133  PRO H C   1 
ATOM 4000 O O   . PRO D 4 133 ? 42.733 106.938 -23.218 1.00 135.00 ? 133  PRO H O   1 
ATOM 4001 C CB  . PRO D 4 133 ? 43.536 105.892 -20.477 1.00 111.23 ? 133  PRO H CB  1 
ATOM 4002 C CG  . PRO D 4 133 ? 43.601 104.428 -20.237 1.00 107.49 ? 133  PRO H CG  1 
ATOM 4003 C CD  . PRO D 4 133 ? 42.749 103.812 -21.303 1.00 109.02 ? 133  PRO H CD  1 
ATOM 4004 N N   . GLY D 4 134 ? 41.508 108.306 -21.913 1.00 149.46 ? 134  GLY H N   1 
ATOM 4005 C CA  . GLY D 4 134 ? 41.480 109.379 -22.882 1.00 172.17 ? 134  GLY H CA  1 
ATOM 4006 C C   . GLY D 4 134 ? 42.821 110.081 -23.002 1.00 195.35 ? 134  GLY H C   1 
ATOM 4007 O O   . GLY D 4 134 ? 43.800 109.771 -22.321 1.00 198.49 ? 134  GLY H O   1 
ATOM 4008 N N   . CYS D 4 135 ? 42.856 111.058 -23.905 1.00 215.02 ? 135  CYS H N   1 
ATOM 4009 C CA  . CYS D 4 135 ? 44.066 111.843 -24.098 1.00 220.81 ? 135  CYS H CA  1 
ATOM 4010 C C   . CYS D 4 135 ? 44.378 112.643 -22.840 1.00 208.53 ? 135  CYS H C   1 
ATOM 4011 O O   . CYS D 4 135 ? 43.476 113.138 -22.158 1.00 207.82 ? 135  CYS H O   1 
ATOM 4012 C CB  . CYS D 4 135 ? 43.909 112.778 -25.297 1.00 234.40 ? 135  CYS H CB  1 
ATOM 4013 S SG  . CYS D 4 135 ? 45.341 113.839 -25.595 1.00 246.68 ? 135  CYS H SG  1 
ATOM 4014 N N   . GLY D 4 136 ? 45.666 112.758 -22.529 1.00 204.22 ? 136  GLY H N   1 
ATOM 4015 C CA  . GLY D 4 136 ? 46.110 113.453 -21.341 1.00 206.00 ? 136  GLY H CA  1 
ATOM 4016 C C   . GLY D 4 136 ? 46.377 112.573 -20.139 1.00 203.33 ? 136  GLY H C   1 
ATOM 4017 O O   . GLY D 4 136 ? 46.819 113.087 -19.104 1.00 200.34 ? 136  GLY H O   1 
ATOM 4018 N N   . ASP D 4 137 ? 46.123 111.271 -20.238 1.00 201.73 ? 137  ASP H N   1 
ATOM 4019 C CA  . ASP D 4 137 ? 46.399 110.328 -19.161 1.00 204.62 ? 137  ASP H CA  1 
ATOM 4020 C C   . ASP D 4 137 ? 47.754 109.679 -19.408 1.00 207.63 ? 137  ASP H C   1 
ATOM 4021 O O   . ASP D 4 137 ? 47.967 109.057 -20.455 1.00 213.45 ? 137  ASP H O   1 
ATOM 4022 C CB  . ASP D 4 137 ? 45.306 109.264 -19.068 1.00 205.84 ? 137  ASP H CB  1 
ATOM 4023 C CG  . ASP D 4 137 ? 43.964 109.842 -18.672 1.00 209.49 ? 137  ASP H CG  1 
ATOM 4024 O OD1 . ASP D 4 137 ? 43.946 110.868 -17.961 1.00 212.83 ? 137  ASP H OD1 1 
ATOM 4025 O OD2 . ASP D 4 137 ? 42.927 109.269 -19.070 1.00 209.76 ? 137  ASP H OD2 1 
ATOM 4026 N N   . THR D 4 138 ? 48.663 109.824 -18.448 1.00 183.98 ? 138  THR H N   1 
ATOM 4027 C CA  . THR D 4 138 ? 49.985 109.238 -18.585 1.00 168.46 ? 138  THR H CA  1 
ATOM 4028 C C   . THR D 4 138 ? 49.924 107.725 -18.396 1.00 167.71 ? 138  THR H C   1 
ATOM 4029 O O   . THR D 4 138 ? 49.025 107.182 -17.746 1.00 159.92 ? 138  THR H O   1 
ATOM 4030 C CB  . THR D 4 138 ? 50.957 109.848 -17.576 1.00 155.19 ? 138  THR H CB  1 
ATOM 4031 O OG1 . THR D 4 138 ? 52.252 109.254 -17.736 1.00 149.01 ? 138  THR H OG1 1 
ATOM 4032 C CG2 . THR D 4 138 ? 50.466 109.612 -16.154 1.00 154.45 ? 138  THR H CG2 1 
ATOM 4033 N N   . THR D 4 139 ? 50.906 107.045 -18.976 1.00 175.50 ? 139  THR H N   1 
ATOM 4034 C CA  . THR D 4 139 ? 51.010 105.595 -18.910 1.00 177.82 ? 139  THR H CA  1 
ATOM 4035 C C   . THR D 4 139 ? 52.121 105.231 -17.935 1.00 172.89 ? 139  THR H C   1 
ATOM 4036 O O   . THR D 4 139 ? 53.275 105.631 -18.125 1.00 177.12 ? 139  THR H O   1 
ATOM 4037 C CB  . THR D 4 139 ? 51.284 105.003 -20.293 1.00 183.90 ? 139  THR H CB  1 
ATOM 4038 O OG1 . THR D 4 139 ? 52.468 105.597 -20.840 1.00 192.82 ? 139  THR H OG1 1 
ATOM 4039 C CG2 . THR D 4 139 ? 50.111 105.269 -21.226 1.00 178.61 ? 139  THR H CG2 1 
ATOM 4040 N N   . GLY D 4 140 ? 51.767 104.493 -16.890 1.00 164.24 ? 140  GLY H N   1 
ATOM 4041 C CA  . GLY D 4 140 ? 52.725 104.001 -15.927 1.00 164.12 ? 140  GLY H CA  1 
ATOM 4042 C C   . GLY D 4 140 ? 53.194 102.606 -16.272 1.00 161.25 ? 140  GLY H C   1 
ATOM 4043 O O   . GLY D 4 140 ? 53.107 102.154 -17.417 1.00 163.86 ? 140  GLY H O   1 
ATOM 4044 N N   . SER D 4 141 ? 53.693 101.905 -15.251 1.00 156.62 ? 141  SER H N   1 
ATOM 4045 C CA  . SER D 4 141 ? 54.153 100.536 -15.450 1.00 149.02 ? 141  SER H CA  1 
ATOM 4046 C C   . SER D 4 141 ? 53.011 99.588  -15.793 1.00 129.23 ? 141  SER H C   1 
ATOM 4047 O O   . SER D 4 141 ? 53.267 98.475  -16.263 1.00 125.70 ? 141  SER H O   1 
ATOM 4048 C CB  . SER D 4 141 ? 54.906 100.045 -14.211 1.00 154.62 ? 141  SER H CB  1 
ATOM 4049 O OG  . SER D 4 141 ? 54.209 100.358 -13.018 1.00 159.68 ? 141  SER H OG  1 
ATOM 4050 N N   . SER D 4 142 ? 51.765 100.002 -15.573 1.00 118.33 ? 142  SER H N   1 
ATOM 4051 C CA  . SER D 4 142 ? 50.614 99.210  -15.979 1.00 124.40 ? 142  SER H CA  1 
ATOM 4052 C C   . SER D 4 142 ? 49.471 100.141 -16.353 1.00 121.86 ? 142  SER H C   1 
ATOM 4053 O O   . SER D 4 142 ? 49.423 101.303 -15.938 1.00 133.25 ? 142  SER H O   1 
ATOM 4054 C CB  . SER D 4 142 ? 50.178 98.236  -14.880 1.00 131.52 ? 142  SER H CB  1 
ATOM 4055 O OG  . SER D 4 142 ? 51.207 97.308  -14.599 1.00 146.73 ? 142  SER H OG  1 
ATOM 4056 N N   . VAL D 4 143 ? 48.551 99.607  -17.153 1.00 106.32 ? 143  VAL H N   1 
ATOM 4057 C CA  . VAL D 4 143 ? 47.402 100.343 -17.662 1.00 94.77  ? 143  VAL H CA  1 
ATOM 4058 C C   . VAL D 4 143 ? 46.146 99.539  -17.360 1.00 101.81 ? 143  VAL H C   1 
ATOM 4059 O O   . VAL D 4 143 ? 46.109 98.323  -17.584 1.00 102.92 ? 143  VAL H O   1 
ATOM 4060 C CB  . VAL D 4 143 ? 47.523 100.604 -19.178 1.00 109.04 ? 143  VAL H CB  1 
ATOM 4061 C CG1 . VAL D 4 143 ? 46.332 101.392 -19.685 1.00 92.39  ? 143  VAL H CG1 1 
ATOM 4062 C CG2 . VAL D 4 143 ? 48.820 101.330 -19.495 1.00 127.86 ? 143  VAL H CG2 1 
ATOM 4063 N N   . THR D 4 144 ? 45.118 100.216 -16.857 1.00 94.93  ? 144  THR H N   1 
ATOM 4064 C CA  . THR D 4 144 ? 43.833 99.591  -16.576 1.00 88.70  ? 144  THR H CA  1 
ATOM 4065 C C   . THR D 4 144 ? 42.843 99.947  -17.675 1.00 87.50  ? 144  THR H C   1 
ATOM 4066 O O   . THR D 4 144 ? 42.742 101.113 -18.075 1.00 87.36  ? 144  THR H O   1 
ATOM 4067 C CB  . THR D 4 144 ? 43.282 100.035 -15.223 1.00 87.48  ? 144  THR H CB  1 
ATOM 4068 O OG1 . THR D 4 144 ? 42.981 101.433 -15.274 1.00 115.69 ? 144  THR H OG1 1 
ATOM 4069 C CG2 . THR D 4 144 ? 44.302 99.792  -14.135 1.00 88.05  ? 144  THR H CG2 1 
ATOM 4070 N N   . LEU D 4 145 ? 42.108 98.944  -18.148 1.00 86.30  ? 145  LEU H N   1 
ATOM 4071 C CA  . LEU D 4 145 ? 41.140 99.103  -19.221 1.00 80.39  ? 145  LEU H CA  1 
ATOM 4072 C C   . LEU D 4 145 ? 39.798 98.541  -18.779 1.00 84.06  ? 145  LEU H C   1 
ATOM 4073 O O   . LEU D 4 145 ? 39.712 97.770  -17.822 1.00 87.76  ? 145  LEU H O   1 
ATOM 4074 C CB  . LEU D 4 145 ? 41.606 98.400  -20.496 1.00 86.94  ? 145  LEU H CB  1 
ATOM 4075 C CG  . LEU D 4 145 ? 43.002 98.810  -20.960 1.00 98.66  ? 145  LEU H CG  1 
ATOM 4076 C CD1 . LEU D 4 145 ? 43.558 97.795  -21.933 1.00 100.25 ? 145  LEU H CD1 1 
ATOM 4077 C CD2 . LEU D 4 145 ? 42.990 100.204 -21.575 1.00 107.05 ? 145  LEU H CD2 1 
ATOM 4078 N N   . GLY D 4 146 ? 38.747 98.923  -19.489 1.00 77.26  ? 146  GLY H N   1 
ATOM 4079 C CA  . GLY D 4 146 ? 37.401 98.592  -19.067 1.00 73.54  ? 146  GLY H CA  1 
ATOM 4080 C C   . GLY D 4 146 ? 36.520 98.212  -20.235 1.00 79.77  ? 146  GLY H C   1 
ATOM 4081 O O   . GLY D 4 146 ? 36.747 98.615  -21.378 1.00 88.05  ? 146  GLY H O   1 
ATOM 4082 N N   . CYS D 4 147 ? 35.501 97.418  -19.926 1.00 78.43  ? 147  CYS H N   1 
ATOM 4083 C CA  . CYS D 4 147 ? 34.453 97.045  -20.865 1.00 79.83  ? 147  CYS H CA  1 
ATOM 4084 C C   . CYS D 4 147 ? 33.138 97.197  -20.115 1.00 79.14  ? 147  CYS H C   1 
ATOM 4085 O O   . CYS D 4 147 ? 32.925 96.527  -19.098 1.00 85.07  ? 147  CYS H O   1 
ATOM 4086 C CB  . CYS D 4 147 ? 34.659 95.608  -21.364 1.00 108.07 ? 147  CYS H CB  1 
ATOM 4087 S SG  . CYS D 4 147 ? 34.060 95.151  -23.025 1.00 116.03 ? 147  CYS H SG  1 
ATOM 4088 N N   . LEU D 4 148 ? 32.281 98.099  -20.586 1.00 83.47  ? 148  LEU H N   1 
ATOM 4089 C CA  . LEU D 4 148 ? 31.012 98.399  -19.932 1.00 72.74  ? 148  LEU H CA  1 
ATOM 4090 C C   . LEU D 4 148 ? 29.882 97.685  -20.662 1.00 75.61  ? 148  LEU H C   1 
ATOM 4091 O O   . LEU D 4 148 ? 29.689 97.887  -21.863 1.00 89.02  ? 148  LEU H O   1 
ATOM 4092 C CB  . LEU D 4 148 ? 30.755 99.905  -19.902 1.00 73.87  ? 148  LEU H CB  1 
ATOM 4093 C CG  . LEU D 4 148 ? 29.365 100.342 -19.432 1.00 74.06  ? 148  LEU H CG  1 
ATOM 4094 C CD1 . LEU D 4 148 ? 29.129 99.942  -17.986 1.00 76.95  ? 148  LEU H CD1 1 
ATOM 4095 C CD2 . LEU D 4 148 ? 29.208 101.838 -19.597 1.00 67.50  ? 148  LEU H CD2 1 
ATOM 4096 N N   . VAL D 4 149 ? 29.145 96.852  -19.936 1.00 76.39  ? 149  VAL H N   1 
ATOM 4097 C CA  . VAL D 4 149 ? 28.028 96.081  -20.472 1.00 77.06  ? 149  VAL H CA  1 
ATOM 4098 C C   . VAL D 4 149 ? 26.745 96.710  -19.952 1.00 84.32  ? 149  VAL H C   1 
ATOM 4099 O O   . VAL D 4 149 ? 26.538 96.800  -18.737 1.00 99.42  ? 149  VAL H O   1 
ATOM 4100 C CB  . VAL D 4 149 ? 28.124 94.600  -20.072 1.00 65.51  ? 149  VAL H CB  1 
ATOM 4101 C CG1 . VAL D 4 149 ? 26.994 93.812  -20.690 1.00 68.32  ? 149  VAL H CG1 1 
ATOM 4102 C CG2 . VAL D 4 149 ? 29.479 94.020  -20.470 1.00 60.51  ? 149  VAL H CG2 1 
ATOM 4103 N N   . LYS D 4 150 ? 25.876 97.131  -20.861 1.00 72.77  ? 150  LYS H N   1 
ATOM 4104 C CA  . LYS D 4 150 ? 24.744 97.967  -20.499 1.00 69.12  ? 150  LYS H CA  1 
ATOM 4105 C C   . LYS D 4 150 ? 23.468 97.425  -21.121 1.00 79.49  ? 150  LYS H C   1 
ATOM 4106 O O   . LYS D 4 150 ? 23.457 97.033  -22.292 1.00 78.81  ? 150  LYS H O   1 
ATOM 4107 C CB  . LYS D 4 150 ? 24.983 99.407  -20.951 1.00 72.01  ? 150  LYS H CB  1 
ATOM 4108 C CG  . LYS D 4 150 ? 24.329 100.454 -20.081 1.00 86.21  ? 150  LYS H CG  1 
ATOM 4109 C CD  . LYS D 4 150 ? 24.697 101.833 -20.574 1.00 106.93 ? 150  LYS H CD  1 
ATOM 4110 C CE  . LYS D 4 150 ? 24.040 102.922 -19.755 1.00 121.82 ? 150  LYS H CE  1 
ATOM 4111 N NZ  . LYS D 4 150 ? 24.337 104.256 -20.347 1.00 136.97 ? 150  LYS H NZ  1 
ATOM 4112 N N   . GLY D 4 151 ? 22.403 97.386  -20.323 1.00 98.39  ? 151  GLY H N   1 
ATOM 4113 C CA  . GLY D 4 151 ? 21.072 97.111  -20.835 1.00 98.75  ? 151  GLY H CA  1 
ATOM 4114 C C   . GLY D 4 151 ? 20.881 95.745  -21.456 1.00 101.75 ? 151  GLY H C   1 
ATOM 4115 O O   . GLY D 4 151 ? 20.580 95.635  -22.649 1.00 120.18 ? 151  GLY H O   1 
ATOM 4116 N N   . TYR D 4 152 ? 21.049 94.695  -20.655 1.00 92.94  ? 152  TYR H N   1 
ATOM 4117 C CA  . TYR D 4 152 ? 20.860 93.326  -21.107 1.00 86.71  ? 152  TYR H CA  1 
ATOM 4118 C C   . TYR D 4 152 ? 19.978 92.568  -20.127 1.00 99.29  ? 152  TYR H C   1 
ATOM 4119 O O   . TYR D 4 152 ? 19.833 92.946  -18.963 1.00 117.27 ? 152  TYR H O   1 
ATOM 4120 C CB  . TYR D 4 152 ? 22.193 92.587  -21.263 1.00 81.65  ? 152  TYR H CB  1 
ATOM 4121 C CG  . TYR D 4 152 ? 22.931 92.285  -19.969 1.00 81.14  ? 152  TYR H CG  1 
ATOM 4122 C CD1 . TYR D 4 152 ? 23.872 93.171  -19.456 1.00 89.23  ? 152  TYR H CD1 1 
ATOM 4123 C CD2 . TYR D 4 152 ? 22.710 91.099  -19.282 1.00 78.76  ? 152  TYR H CD2 1 
ATOM 4124 C CE1 . TYR D 4 152 ? 24.561 92.887  -18.288 1.00 92.28  ? 152  TYR H CE1 1 
ATOM 4125 C CE2 . TYR D 4 152 ? 23.389 90.810  -18.116 1.00 79.36  ? 152  TYR H CE2 1 
ATOM 4126 C CZ  . TYR D 4 152 ? 24.310 91.703  -17.622 1.00 78.90  ? 152  TYR H CZ  1 
ATOM 4127 O OH  . TYR D 4 152 ? 24.982 91.392  -16.463 1.00 65.98  ? 152  TYR H OH  1 
ATOM 4128 N N   . PHE D 4 153 ? 19.416 91.470  -20.614 1.00 101.07 ? 153  PHE H N   1 
ATOM 4129 C CA  . PHE D 4 153 ? 18.573 90.589  -19.817 1.00 102.74 ? 153  PHE H CA  1 
ATOM 4130 C C   . PHE D 4 153 ? 18.366 89.288  -20.578 1.00 109.88 ? 153  PHE H C   1 
ATOM 4131 O O   . PHE D 4 153 ? 18.215 89.316  -21.806 1.00 116.24 ? 153  PHE H O   1 
ATOM 4132 C CB  . PHE D 4 153 ? 17.232 91.253  -19.520 1.00 99.49  ? 153  PHE H CB  1 
ATOM 4133 C CG  . PHE D 4 153 ? 16.408 90.534  -18.497 1.00 93.83  ? 153  PHE H CG  1 
ATOM 4134 C CD1 . PHE D 4 153 ? 16.643 90.730  -17.149 1.00 92.24  ? 153  PHE H CD1 1 
ATOM 4135 C CD2 . PHE D 4 153 ? 15.388 89.679  -18.880 1.00 96.76  ? 153  PHE H CD2 1 
ATOM 4136 C CE1 . PHE D 4 153 ? 15.884 90.083  -16.200 1.00 100.74 ? 153  PHE H CE1 1 
ATOM 4137 C CE2 . PHE D 4 153 ? 14.623 89.028  -17.934 1.00 106.37 ? 153  PHE H CE2 1 
ATOM 4138 C CZ  . PHE D 4 153 ? 14.872 89.231  -16.591 1.00 105.54 ? 153  PHE H CZ  1 
ATOM 4139 N N   . PRO D 4 154 ? 18.348 88.131  -19.900 1.00 111.09 ? 154  PRO H N   1 
ATOM 4140 C CA  . PRO D 4 154 ? 18.578 87.945  -18.464 1.00 107.95 ? 154  PRO H CA  1 
ATOM 4141 C C   . PRO D 4 154 ? 20.045 88.006  -18.057 1.00 106.27 ? 154  PRO H C   1 
ATOM 4142 O O   . PRO D 4 154 ? 20.887 88.441  -18.856 1.00 109.04 ? 154  PRO H O   1 
ATOM 4143 C CB  . PRO D 4 154 ? 18.032 86.538  -18.199 1.00 106.26 ? 154  PRO H CB  1 
ATOM 4144 C CG  . PRO D 4 154 ? 17.160 86.234  -19.349 1.00 109.46 ? 154  PRO H CG  1 
ATOM 4145 C CD  . PRO D 4 154 ? 17.792 86.917  -20.511 1.00 116.31 ? 154  PRO H CD  1 
ATOM 4146 N N   . GLU D 4 155 ? 20.313 87.512  -16.848 1.00 96.45  ? 155  GLU H N   1 
ATOM 4147 C CA  . GLU D 4 155 ? 21.615 87.585  -16.192 1.00 103.71 ? 155  GLU H CA  1 
ATOM 4148 C C   . GLU D 4 155 ? 22.629 86.673  -16.912 1.00 121.66 ? 155  GLU H C   1 
ATOM 4149 O O   . GLU D 4 155 ? 22.378 86.144  -18.004 1.00 127.45 ? 155  GLU H O   1 
ATOM 4150 C CB  . GLU D 4 155 ? 21.438 87.237  -14.707 1.00 102.48 ? 155  GLU H CB  1 
ATOM 4151 C CG  . GLU D 4 155 ? 22.640 87.506  -13.782 1.00 103.92 ? 155  GLU H CG  1 
ATOM 4152 C CD  . GLU D 4 155 ? 23.258 88.867  -13.995 1.00 100.91 ? 155  GLU H CD  1 
ATOM 4153 O OE1 . GLU D 4 155 ? 22.496 89.844  -14.135 1.00 111.77 ? 155  GLU H OE1 1 
ATOM 4154 O OE2 . GLU D 4 155 ? 24.504 88.959  -14.028 1.00 95.13  ? 155  GLU H OE2 1 
ATOM 4155 N N   . SER D 4 156 ? 23.802 86.515  -16.288 1.00 130.79 ? 156  SER H N   1 
ATOM 4156 C CA  . SER D 4 156 ? 24.901 85.662  -16.725 1.00 132.39 ? 156  SER H CA  1 
ATOM 4157 C C   . SER D 4 156 ? 25.480 86.051  -18.082 1.00 121.30 ? 156  SER H C   1 
ATOM 4158 O O   . SER D 4 156 ? 25.407 85.249  -19.016 1.00 126.52 ? 156  SER H O   1 
ATOM 4159 C CB  . SER D 4 156 ? 24.449 84.206  -16.807 1.00 146.69 ? 156  SER H CB  1 
ATOM 4160 O OG  . SER D 4 156 ? 23.514 84.058  -17.850 1.00 153.12 ? 156  SER H OG  1 
ATOM 4161 N N   . VAL D 4 157 ? 26.017 87.264  -18.227 1.00 110.42 ? 157  VAL H N   1 
ATOM 4162 C CA  . VAL D 4 157 ? 26.931 87.587  -19.326 1.00 99.49  ? 157  VAL H CA  1 
ATOM 4163 C C   . VAL D 4 157 ? 28.357 87.381  -18.835 1.00 88.76  ? 157  VAL H C   1 
ATOM 4164 O O   . VAL D 4 157 ? 28.661 87.657  -17.668 1.00 87.90  ? 157  VAL H O   1 
ATOM 4165 C CB  . VAL D 4 157 ? 26.756 89.034  -19.829 1.00 105.27 ? 157  VAL H CB  1 
ATOM 4166 C CG1 . VAL D 4 157 ? 25.425 89.234  -20.526 1.00 112.32 ? 157  VAL H CG1 1 
ATOM 4167 C CG2 . VAL D 4 157 ? 26.909 89.999  -18.687 1.00 102.58 ? 157  VAL H CG2 1 
ATOM 4168 N N   . THR D 4 158 ? 29.243 86.921  -19.716 1.00 97.21  ? 158  THR H N   1 
ATOM 4169 C CA  . THR D 4 158 ? 30.638 86.675  -19.357 1.00 101.34 ? 158  THR H CA  1 
ATOM 4170 C C   . THR D 4 158 ? 31.551 87.544  -20.213 1.00 96.23  ? 158  THR H C   1 
ATOM 4171 O O   . THR D 4 158 ? 31.535 87.442  -21.444 1.00 106.76 ? 158  THR H O   1 
ATOM 4172 C CB  . THR D 4 158 ? 31.001 85.200  -19.525 1.00 106.41 ? 158  THR H CB  1 
ATOM 4173 O OG1 . THR D 4 158 ? 30.971 84.856  -20.914 1.00 125.22 ? 158  THR H OG1 1 
ATOM 4174 C CG2 . THR D 4 158 ? 30.003 84.335  -18.784 1.00 99.75  ? 158  THR H CG2 1 
ATOM 4175 N N   . VAL D 4 159 ? 32.344 88.395  -19.565 1.00 92.04  ? 159  VAL H N   1 
ATOM 4176 C CA  . VAL D 4 159 ? 33.250 89.310  -20.254 1.00 89.03  ? 159  VAL H CA  1 
ATOM 4177 C C   . VAL D 4 159 ? 34.630 88.668  -20.231 1.00 93.91  ? 159  VAL H C   1 
ATOM 4178 O O   . VAL D 4 159 ? 35.310 88.662  -19.202 1.00 107.61 ? 159  VAL H O   1 
ATOM 4179 C CB  . VAL D 4 159 ? 33.253 90.701  -19.615 1.00 80.44  ? 159  VAL H CB  1 
ATOM 4180 C CG1 . VAL D 4 159 ? 34.204 91.635  -20.365 1.00 78.69  ? 159  VAL H CG1 1 
ATOM 4181 C CG2 . VAL D 4 159 ? 31.829 91.269  -19.580 1.00 72.31  ? 159  VAL H CG2 1 
ATOM 4182 N N   . THR D 4 160 ? 35.042 88.114  -21.364 1.00 99.52  ? 160  THR H N   1 
ATOM 4183 C CA  . THR D 4 160 ? 36.314 87.415  -21.472 1.00 107.70 ? 160  THR H CA  1 
ATOM 4184 C C   . THR D 4 160 ? 37.339 88.330  -22.126 1.00 107.56 ? 160  THR H C   1 
ATOM 4185 O O   . THR D 4 160 ? 37.103 88.857  -23.218 1.00 117.26 ? 160  THR H O   1 
ATOM 4186 C CB  . THR D 4 160 ? 36.165 86.120  -22.275 1.00 114.23 ? 160  THR H CB  1 
ATOM 4187 O OG1 . THR D 4 160 ? 35.142 85.304  -21.689 1.00 121.29 ? 160  THR H OG1 1 
ATOM 4188 C CG2 . THR D 4 160 ? 37.471 85.348  -22.275 1.00 119.75 ? 160  THR H CG2 1 
ATOM 4189 N N   . TRP D 4 161 ? 38.463 88.535  -21.443 1.00 97.77  ? 161  TRP H N   1 
ATOM 4190 C CA  . TRP D 4 161 ? 39.579 89.313  -21.975 1.00 101.69 ? 161  TRP H CA  1 
ATOM 4191 C C   . TRP D 4 161 ? 40.613 88.329  -22.513 1.00 122.88 ? 161  TRP H C   1 
ATOM 4192 O O   . TRP D 4 161 ? 41.656 88.080  -21.909 1.00 120.80 ? 161  TRP H O   1 
ATOM 4193 C CB  . TRP D 4 161 ? 40.147 90.223  -20.893 1.00 97.52  ? 161  TRP H CB  1 
ATOM 4194 C CG  . TRP D 4 161 ? 39.182 91.276  -20.476 1.00 94.27  ? 161  TRP H CG  1 
ATOM 4195 C CD1 . TRP D 4 161 ? 38.105 91.124  -19.652 1.00 94.34  ? 161  TRP H CD1 1 
ATOM 4196 C CD2 . TRP D 4 161 ? 39.193 92.650  -20.874 1.00 93.32  ? 161  TRP H CD2 1 
ATOM 4197 N NE1 . TRP D 4 161 ? 37.445 92.326  -19.507 1.00 87.62  ? 161  TRP H NE1 1 
ATOM 4198 C CE2 . TRP D 4 161 ? 38.096 93.278  -20.247 1.00 83.84  ? 161  TRP H CE2 1 
ATOM 4199 C CE3 . TRP D 4 161 ? 40.031 93.414  -21.688 1.00 93.91  ? 161  TRP H CE3 1 
ATOM 4200 C CZ2 . TRP D 4 161 ? 37.816 94.628  -20.416 1.00 75.75  ? 161  TRP H CZ2 1 
ATOM 4201 C CZ3 . TRP D 4 161 ? 39.749 94.749  -21.854 1.00 91.71  ? 161  TRP H CZ3 1 
ATOM 4202 C CH2 . TRP D 4 161 ? 38.651 95.346  -21.223 1.00 81.90  ? 161  TRP H CH2 1 
ATOM 4203 N N   . ASN D 4 162 ? 40.307 87.760  -23.682 1.00 152.40 ? 162  ASN H N   1 
ATOM 4204 C CA  . ASN D 4 162 ? 41.076 86.620  -24.174 1.00 165.80 ? 162  ASN H CA  1 
ATOM 4205 C C   . ASN D 4 162 ? 42.405 87.045  -24.783 1.00 181.78 ? 162  ASN H C   1 
ATOM 4206 O O   . ASN D 4 162 ? 43.413 86.345  -24.627 1.00 188.24 ? 162  ASN H O   1 
ATOM 4207 C CB  . ASN D 4 162 ? 40.256 85.833  -25.199 1.00 164.63 ? 162  ASN H CB  1 
ATOM 4208 C CG  . ASN D 4 162 ? 40.709 84.388  -25.324 1.00 164.55 ? 162  ASN H CG  1 
ATOM 4209 O OD1 . ASN D 4 162 ? 41.198 83.795  -24.363 1.00 163.56 ? 162  ASN H OD1 1 
ATOM 4210 N ND2 . ASN D 4 162 ? 40.544 83.814  -26.512 1.00 165.80 ? 162  ASN H ND2 1 
ATOM 4211 N N   . SER D 4 163 ? 42.426 88.177  -25.481 1.00 184.63 ? 163  SER H N   1 
ATOM 4212 C CA  . SER D 4 163 ? 43.598 88.625  -26.221 1.00 189.39 ? 163  SER H CA  1 
ATOM 4213 C C   . SER D 4 163 ? 44.405 89.596  -25.367 1.00 180.38 ? 163  SER H C   1 
ATOM 4214 O O   . SER D 4 163 ? 43.896 90.649  -24.970 1.00 168.61 ? 163  SER H O   1 
ATOM 4215 C CB  . SER D 4 163 ? 43.187 89.285  -27.539 1.00 189.69 ? 163  SER H CB  1 
ATOM 4216 O OG  . SER D 4 163 ? 42.597 88.352  -28.430 1.00 191.39 ? 163  SER H OG  1 
ATOM 4217 N N   . GLY D 4 164 ? 45.660 89.238  -25.092 1.00 198.47 ? 164  GLY H N   1 
ATOM 4218 C CA  . GLY D 4 164 ? 46.592 90.133  -24.434 1.00 211.85 ? 164  GLY H CA  1 
ATOM 4219 C C   . GLY D 4 164 ? 46.820 89.876  -22.958 1.00 223.38 ? 164  GLY H C   1 
ATOM 4220 O O   . GLY D 4 164 ? 47.958 89.949  -22.483 1.00 221.92 ? 164  GLY H O   1 
ATOM 4221 N N   . SER D 4 165 ? 45.752 89.578  -22.219 1.00 228.91 ? 165  SER H N   1 
ATOM 4222 C CA  . SER D 4 165 ? 45.843 89.396  -20.774 1.00 240.48 ? 165  SER H CA  1 
ATOM 4223 C C   . SER D 4 165 ? 45.521 87.969  -20.348 1.00 258.88 ? 165  SER H C   1 
ATOM 4224 O O   . SER D 4 165 ? 46.355 87.324  -19.702 1.00 265.63 ? 165  SER H O   1 
ATOM 4225 C CB  . SER D 4 165 ? 44.918 90.396  -20.067 1.00 223.73 ? 165  SER H CB  1 
ATOM 4226 O OG  . SER D 4 165 ? 43.583 90.278  -20.528 1.00 210.17 ? 165  SER H OG  1 
ATOM 4227 N N   . LEU D 4 166 ? 44.345 87.454  -20.701 1.00 274.09 ? 166  LEU H N   1 
ATOM 4228 C CA  . LEU D 4 166 ? 43.881 86.134  -20.273 1.00 274.22 ? 166  LEU H CA  1 
ATOM 4229 C C   . LEU D 4 166 ? 43.948 86.002  -18.750 1.00 271.03 ? 166  LEU H C   1 
ATOM 4230 O O   . LEU D 4 166 ? 44.701 85.201  -18.191 1.00 276.24 ? 166  LEU H O   1 
ATOM 4231 C CB  . LEU D 4 166 ? 44.666 85.018  -20.968 1.00 277.88 ? 166  LEU H CB  1 
ATOM 4232 C CG  . LEU D 4 166 ? 44.051 83.620  -20.868 1.00 277.71 ? 166  LEU H CG  1 
ATOM 4233 C CD1 . LEU D 4 166 ? 42.616 83.627  -21.375 1.00 270.26 ? 166  LEU H CD1 1 
ATOM 4234 C CD2 . LEU D 4 166 ? 44.888 82.608  -21.631 1.00 284.48 ? 166  LEU H CD2 1 
ATOM 4235 N N   . SER D 4 167 ? 43.149 86.842  -18.088 1.00 244.59 ? 167  SER H N   1 
ATOM 4236 C CA  . SER D 4 167 ? 42.985 86.829  -16.633 1.00 216.35 ? 167  SER H CA  1 
ATOM 4237 C C   . SER D 4 167 ? 44.295 87.153  -15.912 1.00 212.84 ? 167  SER H C   1 
ATOM 4238 O O   . SER D 4 167 ? 44.690 86.477  -14.959 1.00 210.77 ? 167  SER H O   1 
ATOM 4239 C CB  . SER D 4 167 ? 42.409 85.493  -16.155 1.00 195.89 ? 167  SER H CB  1 
ATOM 4240 O OG  . SER D 4 167 ? 42.211 85.497  -14.752 1.00 186.51 ? 167  SER H OG  1 
ATOM 4241 N N   . SER D 4 168 ? 44.970 88.208  -16.376 1.00 216.80 ? 168  SER H N   1 
ATOM 4242 C CA  . SER D 4 168 ? 46.135 88.718  -15.658 1.00 210.13 ? 168  SER H CA  1 
ATOM 4243 C C   . SER D 4 168 ? 45.708 89.405  -14.365 1.00 197.19 ? 168  SER H C   1 
ATOM 4244 O O   . SER D 4 168 ? 46.085 88.984  -13.265 1.00 202.20 ? 168  SER H O   1 
ATOM 4245 C CB  . SER D 4 168 ? 46.925 89.681  -16.549 1.00 209.57 ? 168  SER H CB  1 
ATOM 4246 O OG  . SER D 4 168 ? 47.461 89.018  -17.681 1.00 214.81 ? 168  SER H OG  1 
ATOM 4247 N N   . SER D 4 169 ? 44.916 90.468  -14.482 1.00 173.31 ? 169  SER H N   1 
ATOM 4248 C CA  . SER D 4 169 ? 44.286 91.105  -13.326 1.00 150.36 ? 169  SER H CA  1 
ATOM 4249 C C   . SER D 4 169 ? 42.922 91.594  -13.815 1.00 120.38 ? 169  SER H C   1 
ATOM 4250 O O   . SER D 4 169 ? 42.807 92.677  -14.390 1.00 124.09 ? 169  SER H O   1 
ATOM 4251 C CB  . SER D 4 169 ? 45.138 92.237  -12.768 1.00 158.51 ? 169  SER H CB  1 
ATOM 4252 O OG  . SER D 4 169 ? 44.552 92.816  -11.612 1.00 159.95 ? 169  SER H OG  1 
ATOM 4253 N N   . VAL D 4 170 ? 41.901 90.770  -13.604 1.00 100.78 ? 170  VAL H N   1 
ATOM 4254 C CA  . VAL D 4 170 ? 40.560 91.033  -14.104 1.00 91.55  ? 170  VAL H CA  1 
ATOM 4255 C C   . VAL D 4 170 ? 39.631 91.199  -12.916 1.00 89.44  ? 170  VAL H C   1 
ATOM 4256 O O   . VAL D 4 170 ? 39.614 90.360  -12.008 1.00 105.11 ? 170  VAL H O   1 
ATOM 4257 C CB  . VAL D 4 170 ? 40.068 89.910  -15.032 1.00 93.44  ? 170  VAL H CB  1 
ATOM 4258 C CG1 . VAL D 4 170 ? 38.637 90.178  -15.481 1.00 89.52  ? 170  VAL H CG1 1 
ATOM 4259 C CG2 . VAL D 4 170 ? 40.986 89.789  -16.226 1.00 85.91  ? 170  VAL H CG2 1 
ATOM 4260 N N   . HIS D 4 171 ? 38.873 92.284  -12.916 1.00 81.11  ? 171  HIS H N   1 
ATOM 4261 C CA  . HIS D 4 171 ? 37.849 92.526  -11.913 1.00 83.65  ? 171  HIS H CA  1 
ATOM 4262 C C   . HIS D 4 171 ? 36.523 92.588  -12.654 1.00 81.32  ? 171  HIS H C   1 
ATOM 4263 O O   . HIS D 4 171 ? 36.283 93.515  -13.435 1.00 80.43  ? 171  HIS H O   1 
ATOM 4264 C CB  . HIS D 4 171 ? 38.134 93.808  -11.128 1.00 86.20  ? 171  HIS H CB  1 
ATOM 4265 C CG  . HIS D 4 171 ? 39.493 93.838  -10.498 1.00 95.25  ? 171  HIS H CG  1 
ATOM 4266 N ND1 . HIS D 4 171 ? 39.784 93.173  -9.326  1.00 103.34 ? 171  HIS H ND1 1 
ATOM 4267 C CD2 . HIS D 4 171 ? 40.641 94.447  -10.879 1.00 103.87 ? 171  HIS H CD2 1 
ATOM 4268 C CE1 . HIS D 4 171 ? 41.051 93.374  -9.010  1.00 108.25 ? 171  HIS H CE1 1 
ATOM 4269 N NE2 . HIS D 4 171 ? 41.594 94.143  -9.936  1.00 107.49 ? 171  HIS H NE2 1 
ATOM 4270 N N   . THR D 4 172 ? 35.684 91.582  -12.447 1.00 96.48  ? 172  THR H N   1 
ATOM 4271 C CA  . THR D 4 172 ? 34.360 91.532  -13.049 1.00 94.56  ? 172  THR H CA  1 
ATOM 4272 C C   . THR D 4 172 ? 33.350 92.005  -12.010 1.00 93.36  ? 172  THR H C   1 
ATOM 4273 O O   . THR D 4 172 ? 33.072 91.295  -11.038 1.00 107.92 ? 172  THR H O   1 
ATOM 4274 C CB  . THR D 4 172 ? 34.042 90.122  -13.540 1.00 86.39  ? 172  THR H CB  1 
ATOM 4275 O OG1 . THR D 4 172 ? 35.001 89.740  -14.534 1.00 83.79  ? 172  THR H OG1 1 
ATOM 4276 C CG2 . THR D 4 172 ? 32.652 90.074  -14.148 1.00 90.29  ? 172  THR H CG2 1 
ATOM 4277 N N   . PHE D 4 173 ? 32.815 93.206  -12.205 1.00 75.25  ? 173  PHE H N   1 
ATOM 4278 C CA  . PHE D 4 173 ? 31.891 93.760  -11.222 1.00 75.63  ? 173  PHE H CA  1 
ATOM 4279 C C   . PHE D 4 173 ? 30.497 93.171  -11.420 1.00 76.04  ? 173  PHE H C   1 
ATOM 4280 O O   . PHE D 4 173 ? 30.029 93.067  -12.561 1.00 75.28  ? 173  PHE H O   1 
ATOM 4281 C CB  . PHE D 4 173 ? 31.851 95.282  -11.314 1.00 92.38  ? 173  PHE H CB  1 
ATOM 4282 C CG  . PHE D 4 173 ? 33.206 95.913  -11.269 1.00 83.49  ? 173  PHE H CG  1 
ATOM 4283 C CD1 . PHE D 4 173 ? 33.811 96.211  -10.061 1.00 76.14  ? 173  PHE H CD1 1 
ATOM 4284 C CD2 . PHE D 4 173 ? 33.889 96.188  -12.439 1.00 87.73  ? 173  PHE H CD2 1 
ATOM 4285 C CE1 . PHE D 4 173 ? 35.070 96.775  -10.023 1.00 76.73  ? 173  PHE H CE1 1 
ATOM 4286 C CE2 . PHE D 4 173 ? 35.144 96.756  -12.407 1.00 88.34  ? 173  PHE H CE2 1 
ATOM 4287 C CZ  . PHE D 4 173 ? 35.734 97.050  -11.198 1.00 94.06  ? 173  PHE H CZ  1 
ATOM 4288 N N   . PRO D 4 174 ? 29.824 92.764  -10.342 1.00 77.67  ? 174  PRO H N   1 
ATOM 4289 C CA  . PRO D 4 174 ? 28.506 92.128  -10.465 1.00 78.79  ? 174  PRO H CA  1 
ATOM 4290 C C   . PRO D 4 174 ? 27.474 93.042  -11.106 1.00 80.58  ? 174  PRO H C   1 
ATOM 4291 O O   . PRO D 4 174 ? 27.570 94.270  -11.062 1.00 90.76  ? 174  PRO H O   1 
ATOM 4292 C CB  . PRO D 4 174 ? 28.135 91.811  -9.013  1.00 81.00  ? 174  PRO H CB  1 
ATOM 4293 C CG  . PRO D 4 174 ? 29.456 91.659  -8.330  1.00 83.61  ? 174  PRO H CG  1 
ATOM 4294 C CD  . PRO D 4 174 ? 30.364 92.662  -8.977  1.00 79.19  ? 174  PRO H CD  1 
ATOM 4295 N N   . ALA D 4 175 ? 26.462 92.422  -11.703 1.00 79.13  ? 175  ALA H N   1 
ATOM 4296 C CA  . ALA D 4 175 ? 25.467 93.195  -12.431 1.00 91.69  ? 175  ALA H CA  1 
ATOM 4297 C C   . ALA D 4 175 ? 24.485 93.855  -11.474 1.00 100.06 ? 175  ALA H C   1 
ATOM 4298 O O   . ALA D 4 175 ? 24.136 93.301  -10.427 1.00 102.79 ? 175  ALA H O   1 
ATOM 4299 C CB  . ALA D 4 175 ? 24.719 92.317  -13.434 1.00 80.19  ? 175  ALA H CB  1 
ATOM 4300 N N   . LEU D 4 176 ? 24.067 95.064  -11.836 1.00 91.81  ? 176  LEU H N   1 
ATOM 4301 C CA  . LEU D 4 176 ? 23.057 95.816  -11.112 1.00 86.64  ? 176  LEU H CA  1 
ATOM 4302 C C   . LEU D 4 176 ? 21.870 96.042  -12.031 1.00 84.74  ? 176  LEU H C   1 
ATOM 4303 O O   . LEU D 4 176 ? 22.039 96.338  -13.219 1.00 83.57  ? 176  LEU H O   1 
ATOM 4304 C CB  . LEU D 4 176 ? 23.598 97.159  -10.626 1.00 90.14  ? 176  LEU H CB  1 
ATOM 4305 C CG  . LEU D 4 176 ? 24.865 97.122  -9.778  1.00 91.14  ? 176  LEU H CG  1 
ATOM 4306 C CD1 . LEU D 4 176 ? 25.192 98.522  -9.287  1.00 95.94  ? 176  LEU H CD1 1 
ATOM 4307 C CD2 . LEU D 4 176 ? 24.702 96.153  -8.618  1.00 94.17  ? 176  LEU H CD2 1 
ATOM 4308 N N   . LEU D 4 177 ? 20.673 95.902  -11.474 1.00 91.86  ? 177  LEU H N   1 
ATOM 4309 C CA  . LEU D 4 177 ? 19.440 95.981  -12.244 1.00 100.84 ? 177  LEU H CA  1 
ATOM 4310 C C   . LEU D 4 177 ? 18.923 97.413  -12.180 1.00 123.97 ? 177  LEU H C   1 
ATOM 4311 O O   . LEU D 4 177 ? 18.523 97.891  -11.113 1.00 129.52 ? 177  LEU H O   1 
ATOM 4312 C CB  . LEU D 4 177 ? 18.414 94.987  -11.707 1.00 97.65  ? 177  LEU H CB  1 
ATOM 4313 C CG  . LEU D 4 177 ? 17.156 94.776  -12.550 1.00 105.97 ? 177  LEU H CG  1 
ATOM 4314 C CD1 . LEU D 4 177 ? 17.531 94.249  -13.923 1.00 108.57 ? 177  LEU H CD1 1 
ATOM 4315 C CD2 . LEU D 4 177 ? 16.180 93.833  -11.861 1.00 112.32 ? 177  LEU H CD2 1 
ATOM 4316 N N   . GLN D 4 178 ? 18.944 98.100  -13.320 1.00 131.99 ? 178  GLN H N   1 
ATOM 4317 C CA  . GLN D 4 178 ? 18.412 99.451  -13.437 1.00 143.46 ? 178  GLN H CA  1 
ATOM 4318 C C   . GLN D 4 178 ? 17.436 99.498  -14.602 1.00 146.78 ? 178  GLN H C   1 
ATOM 4319 O O   . GLN D 4 178 ? 17.739 98.998  -15.690 1.00 141.96 ? 178  GLN H O   1 
ATOM 4320 C CB  . GLN D 4 178 ? 19.533 100.479 -13.636 1.00 154.71 ? 178  GLN H CB  1 
ATOM 4321 C CG  . GLN D 4 178 ? 20.508 100.141 -14.754 1.00 160.26 ? 178  GLN H CG  1 
ATOM 4322 C CD  . GLN D 4 178 ? 21.438 101.292 -15.078 1.00 164.92 ? 178  GLN H CD  1 
ATOM 4323 O OE1 . GLN D 4 178 ? 21.226 102.419 -14.633 1.00 172.81 ? 178  GLN H OE1 1 
ATOM 4324 N NE2 . GLN D 4 178 ? 22.478 101.013 -15.856 1.00 158.07 ? 178  GLN H NE2 1 
ATOM 4325 N N   . SER D 4 179 ? 16.262 100.088 -14.362 1.00 161.90 ? 179  SER H N   1 
ATOM 4326 C CA  . SER D 4 179 ? 15.223 100.254 -15.384 1.00 169.11 ? 179  SER H CA  1 
ATOM 4327 C C   . SER D 4 179 ? 14.845 98.924  -16.031 1.00 162.51 ? 179  SER H C   1 
ATOM 4328 O O   . SER D 4 179 ? 14.456 98.873  -17.200 1.00 166.20 ? 179  SER H O   1 
ATOM 4329 C CB  . SER D 4 179 ? 15.650 101.268 -16.450 1.00 174.56 ? 179  SER H CB  1 
ATOM 4330 O OG  . SER D 4 179 ? 16.766 100.801 -17.189 1.00 172.99 ? 179  SER H OG  1 
ATOM 4331 N N   . GLY D 4 180 ? 14.950 97.837  -15.272 1.00 137.56 ? 180  GLY H N   1 
ATOM 4332 C CA  . GLY D 4 180 ? 14.601 96.526  -15.774 1.00 127.87 ? 180  GLY H CA  1 
ATOM 4333 C C   . GLY D 4 180 ? 15.653 95.852  -16.624 1.00 117.20 ? 180  GLY H C   1 
ATOM 4334 O O   . GLY D 4 180 ? 15.353 94.830  -17.251 1.00 122.80 ? 180  GLY H O   1 
ATOM 4335 N N   . LEU D 4 181 ? 16.872 96.384  -16.670 1.00 106.02 ? 181  LEU H N   1 
ATOM 4336 C CA  . LEU D 4 181 ? 17.947 95.786  -17.450 1.00 96.28  ? 181  LEU H CA  1 
ATOM 4337 C C   . LEU D 4 181 ? 19.235 95.819  -16.641 1.00 90.98  ? 181  LEU H C   1 
ATOM 4338 O O   . LEU D 4 181 ? 19.452 96.720  -15.826 1.00 103.52 ? 181  LEU H O   1 
ATOM 4339 C CB  . LEU D 4 181 ? 18.148 96.512  -18.784 1.00 102.29 ? 181  LEU H CB  1 
ATOM 4340 C CG  . LEU D 4 181 ? 17.007 96.421  -19.791 1.00 102.28 ? 181  LEU H CG  1 
ATOM 4341 C CD1 . LEU D 4 181 ? 17.315 97.278  -21.005 1.00 108.31 ? 181  LEU H CD1 1 
ATOM 4342 C CD2 . LEU D 4 181 ? 16.813 94.975  -20.181 1.00 101.93 ? 181  LEU H CD2 1 
ATOM 4343 N N   . TYR D 4 182 ? 20.095 94.836  -16.885 1.00 86.91  ? 182  TYR H N   1 
ATOM 4344 C CA  . TYR D 4 182 ? 21.314 94.674  -16.111 1.00 93.60  ? 182  TYR H CA  1 
ATOM 4345 C C   . TYR D 4 182 ? 22.450 95.499  -16.699 1.00 91.65  ? 182  TYR H C   1 
ATOM 4346 O O   . TYR D 4 182 ? 22.513 95.742  -17.907 1.00 90.58  ? 182  TYR H O   1 
ATOM 4347 C CB  . TYR D 4 182 ? 21.722 93.199  -16.032 1.00 95.75  ? 182  TYR H CB  1 
ATOM 4348 C CG  . TYR D 4 182 ? 20.856 92.378  -15.098 1.00 97.20  ? 182  TYR H CG  1 
ATOM 4349 C CD1 . TYR D 4 182 ? 20.986 92.493  -13.719 1.00 94.36  ? 182  TYR H CD1 1 
ATOM 4350 C CD2 . TYR D 4 182 ? 19.905 91.495  -15.594 1.00 100.12 ? 182  TYR H CD2 1 
ATOM 4351 C CE1 . TYR D 4 182 ? 20.194 91.751  -12.861 1.00 92.55  ? 182  TYR H CE1 1 
ATOM 4352 C CE2 . TYR D 4 182 ? 19.110 90.748  -14.744 1.00 104.69 ? 182  TYR H CE2 1 
ATOM 4353 C CZ  . TYR D 4 182 ? 19.258 90.880  -13.379 1.00 100.77 ? 182  TYR H CZ  1 
ATOM 4354 O OH  . TYR D 4 182 ? 18.468 90.139  -12.531 1.00 109.16 ? 182  TYR H OH  1 
ATOM 4355 N N   . THR D 4 183 ? 23.341 95.949  -15.816 1.00 95.28  ? 183  THR H N   1 
ATOM 4356 C CA  . THR D 4 183 ? 24.522 96.711  -16.198 1.00 98.78  ? 183  THR H CA  1 
ATOM 4357 C C   . THR D 4 183 ? 25.690 96.198  -15.372 1.00 100.26 ? 183  THR H C   1 
ATOM 4358 O O   . THR D 4 183 ? 25.560 96.030  -14.156 1.00 103.94 ? 183  THR H O   1 
ATOM 4359 C CB  . THR D 4 183 ? 24.321 98.220  -15.964 1.00 106.07 ? 183  THR H CB  1 
ATOM 4360 O OG1 . THR D 4 183 ? 23.195 98.689  -16.720 1.00 119.86 ? 183  THR H OG1 1 
ATOM 4361 C CG2 . THR D 4 183 ? 25.569 99.015  -16.353 1.00 90.34  ? 183  THR H CG2 1 
ATOM 4362 N N   . MET D 4 184 ? 26.820 95.942  -16.027 1.00 102.13 ? 184  MET H N   1 
ATOM 4363 C CA  . MET D 4 184 ? 28.031 95.507  -15.346 1.00 97.78  ? 184  MET H CA  1 
ATOM 4364 C C   . MET D 4 184 ? 29.238 96.086  -16.072 1.00 95.69  ? 184  MET H C   1 
ATOM 4365 O O   . MET D 4 184 ? 29.104 96.775  -17.083 1.00 104.35 ? 184  MET H O   1 
ATOM 4366 C CB  . MET D 4 184 ? 28.124 93.992  -15.312 1.00 93.52  ? 184  MET H CB  1 
ATOM 4367 C CG  . MET D 4 184 ? 28.201 93.431  -16.702 1.00 90.49  ? 184  MET H CG  1 
ATOM 4368 S SD  . MET D 4 184 ? 29.250 91.987  -16.826 1.00 95.58  ? 184  MET H SD  1 
ATOM 4369 C CE  . MET D 4 184 ? 30.822 92.626  -16.282 1.00 93.85  ? 184  MET H CE  1 
ATOM 4370 N N   . SER D 4 185 ? 30.428 95.787  -15.555 1.00 96.08  ? 185  SER H N   1 
ATOM 4371 C CA  . SER D 4 185 ? 31.662 96.270  -16.159 1.00 87.66  ? 185  SER H CA  1 
ATOM 4372 C C   . SER D 4 185 ? 32.800 95.336  -15.768 1.00 85.42  ? 185  SER H C   1 
ATOM 4373 O O   . SER D 4 185 ? 32.731 94.630  -14.758 1.00 84.07  ? 185  SER H O   1 
ATOM 4374 C CB  . SER D 4 185 ? 31.957 97.717  -15.740 1.00 86.40  ? 185  SER H CB  1 
ATOM 4375 O OG  . SER D 4 185 ? 31.753 97.917  -14.352 1.00 83.15  ? 185  SER H OG  1 
ATOM 4376 N N   . SER D 4 186 ? 33.846 95.331  -16.590 1.00 77.09  ? 186  SER H N   1 
ATOM 4377 C CA  . SER D 4 186 ? 35.003 94.473  -16.362 1.00 84.32  ? 186  SER H CA  1 
ATOM 4378 C C   . SER D 4 186 ? 36.258 95.308  -16.548 1.00 83.90  ? 186  SER H C   1 
ATOM 4379 O O   . SER D 4 186 ? 36.452 95.918  -17.605 1.00 94.18  ? 186  SER H O   1 
ATOM 4380 C CB  . SER D 4 186 ? 34.994 93.265  -17.307 1.00 97.34  ? 186  SER H CB  1 
ATOM 4381 O OG  . SER D 4 186 ? 36.042 92.352  -17.020 1.00 100.79 ? 186  SER H OG  1 
ATOM 4382 N N   . SER D 4 187 ? 37.080 95.370  -15.510 1.00 88.22  ? 187  SER H N   1 
ATOM 4383 C CA  . SER D 4 187 ? 38.348 96.075  -15.570 1.00 99.87  ? 187  SER H CA  1 
ATOM 4384 C C   . SER D 4 187 ? 39.470 95.057  -15.691 1.00 101.28 ? 187  SER H C   1 
ATOM 4385 O O   . SER D 4 187 ? 39.370 93.936  -15.191 1.00 108.72 ? 187  SER H O   1 
ATOM 4386 C CB  . SER D 4 187 ? 38.558 96.970  -14.339 1.00 111.25 ? 187  SER H CB  1 
ATOM 4387 O OG  . SER D 4 187 ? 38.874 96.222  -13.176 1.00 108.27 ? 187  SER H OG  1 
ATOM 4388 N N   . VAL D 4 188 ? 40.525 95.442  -16.401 1.00 99.38  ? 188  VAL H N   1 
ATOM 4389 C CA  . VAL D 4 188 ? 41.667 94.566  -16.623 1.00 105.11 ? 188  VAL H CA  1 
ATOM 4390 C C   . VAL D 4 188 ? 42.936 95.400  -16.579 1.00 101.42 ? 188  VAL H C   1 
ATOM 4391 O O   . VAL D 4 188 ? 43.090 96.348  -17.358 1.00 95.32  ? 188  VAL H O   1 
ATOM 4392 C CB  . VAL D 4 188 ? 41.583 93.819  -17.961 1.00 100.85 ? 188  VAL H CB  1 
ATOM 4393 C CG1 . VAL D 4 188 ? 42.870 93.099  -18.221 1.00 99.31  ? 188  VAL H CG1 1 
ATOM 4394 C CG2 . VAL D 4 188 ? 40.471 92.824  -17.903 1.00 112.09 ? 188  VAL H CG2 1 
ATOM 4395 N N   . THR D 4 189 ? 43.853 95.032  -15.695 1.00 86.19  ? 189  THR H N   1 
ATOM 4396 C CA  . THR D 4 189 ? 45.139 95.702  -15.571 1.00 89.15  ? 189  THR H CA  1 
ATOM 4397 C C   . THR D 4 189 ? 46.190 94.880  -16.306 1.00 117.86 ? 189  THR H C   1 
ATOM 4398 O O   . THR D 4 189 ? 46.392 93.700  -15.994 1.00 110.03 ? 189  THR H O   1 
ATOM 4399 C CB  . THR D 4 189 ? 45.512 95.880  -14.102 1.00 112.84 ? 189  THR H CB  1 
ATOM 4400 O OG1 . THR D 4 189 ? 44.409 96.483  -13.411 1.00 116.10 ? 189  THR H OG1 1 
ATOM 4401 C CG2 . THR D 4 189 ? 46.763 96.755  -13.960 1.00 97.77  ? 189  THR H CG2 1 
ATOM 4402 N N   . VAL D 4 190 ? 46.853 95.506  -17.275 1.00 112.60 ? 190  VAL H N   1 
ATOM 4403 C CA  . VAL D 4 190 ? 47.838 94.843  -18.131 1.00 119.11 ? 190  VAL H CA  1 
ATOM 4404 C C   . VAL D 4 190 ? 49.116 95.674  -18.157 1.00 124.42 ? 190  VAL H C   1 
ATOM 4405 O O   . VAL D 4 190 ? 49.040 96.910  -18.097 1.00 132.42 ? 190  VAL H O   1 
ATOM 4406 C CB  . VAL D 4 190 ? 47.290 94.651  -19.555 1.00 122.53 ? 190  VAL H CB  1 
ATOM 4407 C CG1 . VAL D 4 190 ? 48.219 93.797  -20.368 1.00 137.04 ? 190  VAL H CG1 1 
ATOM 4408 C CG2 . VAL D 4 190 ? 45.933 94.012  -19.517 1.00 119.23 ? 190  VAL H CG2 1 
ATOM 4409 N N   . PRO D 4 191 ? 50.300 95.062  -18.235 1.00 111.94 ? 191  PRO H N   1 
ATOM 4410 C CA  . PRO D 4 191 ? 51.526 95.858  -18.352 1.00 121.78 ? 191  PRO H CA  1 
ATOM 4411 C C   . PRO D 4 191 ? 51.509 96.766  -19.577 1.00 124.57 ? 191  PRO H C   1 
ATOM 4412 O O   . PRO D 4 191 ? 50.747 96.571  -20.527 1.00 128.69 ? 191  PRO H O   1 
ATOM 4413 C CB  . PRO D 4 191 ? 52.627 94.796  -18.456 1.00 128.14 ? 191  PRO H CB  1 
ATOM 4414 C CG  . PRO D 4 191 ? 52.080 93.636  -17.704 1.00 125.94 ? 191  PRO H CG  1 
ATOM 4415 C CD  . PRO D 4 191 ? 50.595 93.641  -17.977 1.00 109.90 ? 191  PRO H CD  1 
ATOM 4416 N N   . SER D 4 192 ? 52.373 97.784  -19.536 1.00 122.45 ? 192  SER H N   1 
ATOM 4417 C CA  . SER D 4 192 ? 52.492 98.748  -20.622 1.00 124.76 ? 192  SER H CA  1 
ATOM 4418 C C   . SER D 4 192 ? 53.007 98.125  -21.912 1.00 141.06 ? 192  SER H C   1 
ATOM 4419 O O   . SER D 4 192 ? 52.910 98.763  -22.965 1.00 149.35 ? 192  SER H O   1 
ATOM 4420 C CB  . SER D 4 192 ? 53.414 99.896  -20.204 1.00 128.08 ? 192  SER H CB  1 
ATOM 4421 O OG  . SER D 4 192 ? 54.751 99.440  -20.037 1.00 131.75 ? 192  SER H OG  1 
ATOM 4422 N N   . SER D 4 193 ? 53.547 96.906  -21.859 1.00 142.96 ? 193  SER H N   1 
ATOM 4423 C CA  . SER D 4 193 ? 54.021 96.258  -23.077 1.00 141.32 ? 193  SER H CA  1 
ATOM 4424 C C   . SER D 4 193 ? 52.861 95.858  -23.978 1.00 136.53 ? 193  SER H C   1 
ATOM 4425 O O   . SER D 4 193 ? 52.939 96.004  -25.202 1.00 158.24 ? 193  SER H O   1 
ATOM 4426 C CB  . SER D 4 193 ? 54.865 95.034  -22.726 1.00 144.21 ? 193  SER H CB  1 
ATOM 4427 O OG  . SER D 4 193 ? 55.915 95.375  -21.842 1.00 149.17 ? 193  SER H OG  1 
ATOM 4428 N N   . THR D 4 194 ? 51.777 95.354  -23.390 1.00 112.28 ? 194  THR H N   1 
ATOM 4429 C CA  . THR D 4 194 ? 50.655 94.825  -24.155 1.00 114.99 ? 194  THR H CA  1 
ATOM 4430 C C   . THR D 4 194 ? 49.704 95.905  -24.657 1.00 114.43 ? 194  THR H C   1 
ATOM 4431 O O   . THR D 4 194 ? 48.846 95.616  -25.498 1.00 105.32 ? 194  THR H O   1 
ATOM 4432 C CB  . THR D 4 194 ? 49.884 93.822  -23.300 1.00 111.99 ? 194  THR H CB  1 
ATOM 4433 O OG1 . THR D 4 194 ? 50.809 93.055  -22.521 1.00 112.68 ? 194  THR H OG1 1 
ATOM 4434 C CG2 . THR D 4 194 ? 49.045 92.882  -24.160 1.00 119.55 ? 194  THR H CG2 1 
ATOM 4435 N N   . TRP D 4 195 ? 49.823 97.136  -24.171 1.00 122.89 ? 195  TRP H N   1 
ATOM 4436 C CA  . TRP D 4 195 ? 48.958 98.190  -24.656 1.00 120.39 ? 195  TRP H CA  1 
ATOM 4437 C C   . TRP D 4 195 ? 49.704 99.514  -24.690 1.00 131.98 ? 195  TRP H C   1 
ATOM 4438 O O   . TRP D 4 195 ? 50.437 99.839  -23.746 1.00 138.08 ? 195  TRP H O   1 
ATOM 4439 C CB  . TRP D 4 195 ? 47.720 98.333  -23.782 1.00 107.56 ? 195  TRP H CB  1 
ATOM 4440 C CG  . TRP D 4 195 ? 46.560 98.923  -24.487 1.00 101.97 ? 195  TRP H CG  1 
ATOM 4441 C CD1 . TRP D 4 195 ? 45.686 98.274  -25.295 1.00 97.55  ? 195  TRP H CD1 1 
ATOM 4442 C CD2 . TRP D 4 195 ? 46.127 100.287 -24.437 1.00 107.08 ? 195  TRP H CD2 1 
ATOM 4443 N NE1 . TRP D 4 195 ? 44.727 99.141  -25.752 1.00 98.00  ? 195  TRP H NE1 1 
ATOM 4444 C CE2 . TRP D 4 195 ? 44.977 100.387 -25.241 1.00 101.44 ? 195  TRP H CE2 1 
ATOM 4445 C CE3 . TRP D 4 195 ? 46.600 101.434 -23.791 1.00 117.42 ? 195  TRP H CE3 1 
ATOM 4446 C CZ2 . TRP D 4 195 ? 44.290 101.586 -25.419 1.00 102.53 ? 195  TRP H CZ2 1 
ATOM 4447 C CZ3 . TRP D 4 195 ? 45.917 102.626 -23.968 1.00 118.25 ? 195  TRP H CZ3 1 
ATOM 4448 C CH2 . TRP D 4 195 ? 44.774 102.693 -24.776 1.00 109.99 ? 195  TRP H CH2 1 
ATOM 4449 N N   . PRO D 4 196 ? 49.517 100.309 -25.748 1.00 136.35 ? 196  PRO H N   1 
ATOM 4450 C CA  . PRO D 4 196 ? 48.666 99.960  -26.890 1.00 127.31 ? 196  PRO H CA  1 
ATOM 4451 C C   . PRO D 4 196 ? 49.427 99.200  -27.970 1.00 124.72 ? 196  PRO H C   1 
ATOM 4452 O O   . PRO D 4 196 ? 48.951 99.093  -29.105 1.00 120.15 ? 196  PRO H O   1 
ATOM 4453 C CB  . PRO D 4 196 ? 48.206 101.322 -27.399 1.00 133.79 ? 196  PRO H CB  1 
ATOM 4454 C CG  . PRO D 4 196 ? 49.351 102.223 -27.077 1.00 141.85 ? 196  PRO H CG  1 
ATOM 4455 C CD  . PRO D 4 196 ? 49.959 101.712 -25.799 1.00 141.49 ? 196  PRO H CD  1 
ATOM 4456 N N   . SER D 4 197 ? 50.599 98.671  -27.601 1.00 126.70 ? 197  SER H N   1 
ATOM 4457 C CA  . SER D 4 197 ? 51.458 98.005  -28.576 1.00 127.51 ? 197  SER H CA  1 
ATOM 4458 C C   . SER D 4 197 ? 50.763 96.800  -29.193 1.00 128.69 ? 197  SER H C   1 
ATOM 4459 O O   . SER D 4 197 ? 50.880 96.553  -30.399 1.00 126.88 ? 197  SER H O   1 
ATOM 4460 C CB  . SER D 4 197 ? 52.764 97.583  -27.908 1.00 117.00 ? 197  SER H CB  1 
ATOM 4461 O OG  . SER D 4 197 ? 53.286 98.632  -27.111 1.00 131.34 ? 197  SER H OG  1 
ATOM 4462 N N   . GLN D 4 198 ? 50.034 96.045  -28.384 1.00 126.19 ? 198  GLN H N   1 
ATOM 4463 C CA  . GLN D 4 198 ? 49.353 94.839  -28.816 1.00 123.39 ? 198  GLN H CA  1 
ATOM 4464 C C   . GLN D 4 198 ? 47.843 95.054  -28.769 1.00 122.17 ? 198  GLN H C   1 
ATOM 4465 O O   . GLN D 4 198 ? 47.347 96.113  -28.372 1.00 118.98 ? 198  GLN H O   1 
ATOM 4466 C CB  . GLN D 4 198 ? 49.792 93.650  -27.957 1.00 120.98 ? 198  GLN H CB  1 
ATOM 4467 C CG  . GLN D 4 198 ? 51.292 93.350  -28.057 1.00 114.63 ? 198  GLN H CG  1 
ATOM 4468 C CD  . GLN D 4 198 ? 51.712 92.130  -27.260 1.00 126.89 ? 198  GLN H CD  1 
ATOM 4469 O OE1 . GLN D 4 198 ? 51.001 91.691  -26.356 1.00 124.36 ? 198  GLN H OE1 1 
ATOM 4470 N NE2 . GLN D 4 198 ? 52.872 91.574  -27.593 1.00 123.18 ? 198  GLN H NE2 1 
ATOM 4471 N N   . THR D 4 199 ? 47.107 94.040  -29.204 1.00 137.32 ? 199  THR H N   1 
ATOM 4472 C CA  . THR D 4 199 ? 45.656 94.111  -29.287 1.00 142.50 ? 199  THR H CA  1 
ATOM 4473 C C   . THR D 4 199 ? 45.057 93.493  -28.034 1.00 147.83 ? 199  THR H C   1 
ATOM 4474 O O   . THR D 4 199 ? 45.359 92.343  -27.700 1.00 160.32 ? 199  THR H O   1 
ATOM 4475 C CB  . THR D 4 199 ? 45.141 93.386  -30.529 1.00 144.00 ? 199  THR H CB  1 
ATOM 4476 O OG1 . THR D 4 199 ? 45.648 94.026  -31.707 1.00 153.33 ? 199  THR H OG1 1 
ATOM 4477 C CG2 . THR D 4 199 ? 43.626 93.404  -30.557 1.00 139.91 ? 199  THR H CG2 1 
ATOM 4478 N N   . VAL D 4 200 ? 44.215 94.251  -27.340 1.00 139.29 ? 200  VAL H N   1 
ATOM 4479 C CA  . VAL D 4 200 ? 43.486 93.741  -26.188 1.00 129.36 ? 200  VAL H CA  1 
ATOM 4480 C C   . VAL D 4 200 ? 42.005 93.941  -26.472 1.00 125.63 ? 200  VAL H C   1 
ATOM 4481 O O   . VAL D 4 200 ? 41.562 95.060  -26.764 1.00 126.98 ? 200  VAL H O   1 
ATOM 4482 C CB  . VAL D 4 200 ? 43.922 94.416  -24.876 1.00 126.58 ? 200  VAL H CB  1 
ATOM 4483 C CG1 . VAL D 4 200 ? 45.427 94.261  -24.685 1.00 127.76 ? 200  VAL H CG1 1 
ATOM 4484 C CG2 . VAL D 4 200 ? 43.549 95.877  -24.852 1.00 129.71 ? 200  VAL H CG2 1 
ATOM 4485 N N   . THR D 4 201 ? 41.251 92.850  -26.461 1.00 122.96 ? 201  THR H N   1 
ATOM 4486 C CA  . THR D 4 201 ? 39.826 92.908  -26.733 1.00 117.34 ? 201  THR H CA  1 
ATOM 4487 C C   . THR D 4 201 ? 39.048 92.333  -25.562 1.00 112.31 ? 201  THR H C   1 
ATOM 4488 O O   . THR D 4 201 ? 39.542 91.481  -24.815 1.00 101.75 ? 201  THR H O   1 
ATOM 4489 C CB  . THR D 4 201 ? 39.454 92.144  -28.010 1.00 108.13 ? 201  THR H CB  1 
ATOM 4490 O OG1 . THR D 4 201 ? 39.739 90.752  -27.833 1.00 121.51 ? 201  THR H OG1 1 
ATOM 4491 C CG2 . THR D 4 201 ? 40.241 92.672  -29.195 1.00 107.46 ? 201  THR H CG2 1 
ATOM 4492 N N   . CYS D 4 202 ? 37.820 92.810  -25.412 1.00 121.49 ? 202  CYS H N   1 
ATOM 4493 C CA  . CYS D 4 202 ? 36.875 92.228  -24.476 1.00 121.89 ? 202  CYS H CA  1 
ATOM 4494 C C   . CYS D 4 202 ? 35.714 91.650  -25.265 1.00 122.70 ? 202  CYS H C   1 
ATOM 4495 O O   . CYS D 4 202 ? 35.113 92.339  -26.099 1.00 122.48 ? 202  CYS H O   1 
ATOM 4496 C CB  . CYS D 4 202 ? 36.377 93.251  -23.453 1.00 126.08 ? 202  CYS H CB  1 
ATOM 4497 S SG  . CYS D 4 202 ? 35.736 94.804  -24.124 1.00 133.09 ? 202  CYS H SG  1 
ATOM 4498 N N   . SER D 4 203 ? 35.426 90.379  -25.013 1.00 108.57 ? 203  SER H N   1 
ATOM 4499 C CA  . SER D 4 203 ? 34.339 89.657  -25.659 1.00 104.17 ? 203  SER H CA  1 
ATOM 4500 C C   . SER D 4 203 ? 33.240 89.447  -24.632 1.00 84.51  ? 203  SER H C   1 
ATOM 4501 O O   . SER D 4 203 ? 33.397 88.656  -23.698 1.00 82.27  ? 203  SER H O   1 
ATOM 4502 C CB  . SER D 4 203 ? 34.826 88.326  -26.220 1.00 120.50 ? 203  SER H CB  1 
ATOM 4503 O OG  . SER D 4 203 ? 35.760 88.534  -27.261 1.00 133.21 ? 203  SER H OG  1 
ATOM 4504 N N   . VAL D 4 204 ? 32.135 90.158  -24.802 1.00 84.84  ? 204  VAL H N   1 
ATOM 4505 C CA  . VAL D 4 204 ? 30.972 89.996  -23.946 1.00 82.69  ? 204  VAL H CA  1 
ATOM 4506 C C   . VAL D 4 204 ? 30.086 88.928  -24.571 1.00 97.95  ? 204  VAL H C   1 
ATOM 4507 O O   . VAL D 4 204 ? 29.552 89.111  -25.673 1.00 97.34  ? 204  VAL H O   1 
ATOM 4508 C CB  . VAL D 4 204 ? 30.221 91.316  -23.766 1.00 77.96  ? 204  VAL H CB  1 
ATOM 4509 C CG1 . VAL D 4 204 ? 29.006 91.106  -22.885 1.00 82.83  ? 204  VAL H CG1 1 
ATOM 4510 C CG2 . VAL D 4 204 ? 31.156 92.347  -23.166 1.00 77.09  ? 204  VAL H CG2 1 
ATOM 4511 N N   . ALA D 4 205 ? 29.944 87.806  -23.867 1.00 92.31  ? 205  ALA H N   1 
ATOM 4512 C CA  . ALA D 4 205 ? 29.132 86.679  -24.305 1.00 93.78  ? 205  ALA H CA  1 
ATOM 4513 C C   . ALA D 4 205 ? 27.849 86.647  -23.485 1.00 88.94  ? 205  ALA H C   1 
ATOM 4514 O O   . ALA D 4 205 ? 27.897 86.587  -22.254 1.00 86.87  ? 205  ALA H O   1 
ATOM 4515 C CB  . ALA D 4 205 ? 29.899 85.365  -24.158 1.00 87.47  ? 205  ALA H CB  1 
ATOM 4516 N N   . HIS D 4 206 ? 26.707 86.718  -24.169 1.00 98.63  ? 206  HIS H N   1 
ATOM 4517 C CA  . HIS D 4 206 ? 25.387 86.618  -23.553 1.00 101.66 ? 206  HIS H CA  1 
ATOM 4518 C C   . HIS D 4 206 ? 24.738 85.349  -24.086 1.00 124.90 ? 206  HIS H C   1 
ATOM 4519 O O   . HIS D 4 206 ? 24.132 85.362  -25.168 1.00 127.42 ? 206  HIS H O   1 
ATOM 4520 C CB  . HIS D 4 206 ? 24.533 87.850  -23.871 1.00 100.62 ? 206  HIS H CB  1 
ATOM 4521 C CG  . HIS D 4 206 ? 23.279 87.960  -23.056 1.00 98.84  ? 206  HIS H CG  1 
ATOM 4522 N ND1 . HIS D 4 206 ? 22.217 88.755  -23.433 1.00 98.56  ? 206  HIS H ND1 1 
ATOM 4523 C CD2 . HIS D 4 206 ? 22.921 87.391  -21.880 1.00 99.85  ? 206  HIS H CD2 1 
ATOM 4524 C CE1 . HIS D 4 206 ? 21.258 88.666  -22.529 1.00 100.03 ? 206  HIS H CE1 1 
ATOM 4525 N NE2 . HIS D 4 206 ? 21.661 87.846  -21.575 1.00 100.86 ? 206  HIS H NE2 1 
ATOM 4526 N N   . PRO D 4 207 ? 24.850 84.219  -23.383 1.00 126.12 ? 207  PRO H N   1 
ATOM 4527 C CA  . PRO D 4 207 ? 24.252 82.986  -23.910 1.00 98.60  ? 207  PRO H CA  1 
ATOM 4528 C C   . PRO D 4 207 ? 22.738 83.021  -23.930 1.00 101.02 ? 207  PRO H C   1 
ATOM 4529 O O   . PRO D 4 207 ? 22.133 82.379  -24.796 1.00 115.86 ? 207  PRO H O   1 
ATOM 4530 C CB  . PRO D 4 207 ? 24.785 81.905  -22.961 1.00 100.25 ? 207  PRO H CB  1 
ATOM 4531 C CG  . PRO D 4 207 ? 25.031 82.625  -21.685 1.00 121.84 ? 207  PRO H CG  1 
ATOM 4532 C CD  . PRO D 4 207 ? 25.495 84.004  -22.076 1.00 126.71 ? 207  PRO H CD  1 
ATOM 4533 N N   . ALA D 4 208 ? 22.104 83.758  -23.015 1.00 99.57  ? 208  ALA H N   1 
ATOM 4534 C CA  . ALA D 4 208 ? 20.645 83.785  -22.976 1.00 120.06 ? 208  ALA H CA  1 
ATOM 4535 C C   . ALA D 4 208 ? 20.072 84.377  -24.253 1.00 122.15 ? 208  ALA H C   1 
ATOM 4536 O O   . ALA D 4 208 ? 19.004 83.960  -24.715 1.00 107.56 ? 208  ALA H O   1 
ATOM 4537 C CB  . ALA D 4 208 ? 20.165 84.568  -21.759 1.00 100.98 ? 208  ALA H CB  1 
ATOM 4538 N N   . SER D 4 209 ? 20.759 85.362  -24.825 1.00 133.37 ? 209  SER H N   1 
ATOM 4539 C CA  . SER D 4 209 ? 20.431 85.908  -26.134 1.00 131.25 ? 209  SER H CA  1 
ATOM 4540 C C   . SER D 4 209 ? 21.306 85.325  -27.232 1.00 123.98 ? 209  SER H C   1 
ATOM 4541 O O   . SER D 4 209 ? 21.101 85.647  -28.406 1.00 122.40 ? 209  SER H O   1 
ATOM 4542 C CB  . SER D 4 209 ? 20.555 87.437  -26.121 1.00 126.58 ? 209  SER H CB  1 
ATOM 4543 O OG  . SER D 4 209 ? 21.886 87.860  -25.863 1.00 120.22 ? 209  SER H OG  1 
ATOM 4544 N N   . SER D 4 210 ? 22.268 84.471  -26.872 1.00 126.55 ? 210  SER H N   1 
ATOM 4545 C CA  . SER D 4 210 ? 23.174 83.830  -27.825 1.00 127.05 ? 210  SER H CA  1 
ATOM 4546 C C   . SER D 4 210 ? 23.897 84.867  -28.685 1.00 124.73 ? 210  SER H C   1 
ATOM 4547 O O   . SER D 4 210 ? 23.951 84.762  -29.912 1.00 114.51 ? 210  SER H O   1 
ATOM 4548 C CB  . SER D 4 210 ? 22.428 82.817  -28.693 1.00 130.87 ? 210  SER H CB  1 
ATOM 4549 O OG  . SER D 4 210 ? 21.463 83.468  -29.501 1.00 139.64 ? 210  SER H OG  1 
ATOM 4550 N N   . THR D 4 211 ? 24.454 85.883  -28.024 1.00 125.88 ? 211  THR H N   1 
ATOM 4551 C CA  . THR D 4 211 ? 25.187 86.954  -28.682 1.00 93.15  ? 211  THR H CA  1 
ATOM 4552 C C   . THR D 4 211 ? 26.613 87.022  -28.151 1.00 108.07 ? 211  THR H C   1 
ATOM 4553 O O   . THR D 4 211 ? 26.902 86.607  -27.027 1.00 89.58  ? 211  THR H O   1 
ATOM 4554 C CB  . THR D 4 211 ? 24.502 88.311  -28.476 1.00 93.44  ? 211  THR H CB  1 
ATOM 4555 O OG1 . THR D 4 211 ? 24.541 88.670  -27.089 1.00 109.39 ? 211  THR H OG1 1 
ATOM 4556 C CG2 . THR D 4 211 ? 23.064 88.244  -28.925 1.00 94.70  ? 211  THR H CG2 1 
ATOM 4557 N N   . THR D 4 212 ? 27.510 87.552  -28.978 1.00 107.36 ? 212  THR H N   1 
ATOM 4558 C CA  . THR D 4 212 ? 28.898 87.758  -28.577 1.00 109.25 ? 212  THR H CA  1 
ATOM 4559 C C   . THR D 4 212 ? 29.412 89.006  -29.273 1.00 115.20 ? 212  THR H C   1 
ATOM 4560 O O   . THR D 4 212 ? 29.473 89.049  -30.506 1.00 120.83 ? 212  THR H O   1 
ATOM 4561 C CB  . THR D 4 212 ? 29.774 86.557  -28.925 1.00 110.68 ? 212  THR H CB  1 
ATOM 4562 O OG1 . THR D 4 212 ? 29.295 85.399  -28.230 1.00 119.20 ? 212  THR H OG1 1 
ATOM 4563 C CG2 . THR D 4 212 ? 31.221 86.821  -28.522 1.00 108.63 ? 212  THR H CG2 1 
ATOM 4564 N N   . VAL D 4 213 ? 29.782 90.011  -28.484 1.00 106.23 ? 213  VAL H N   1 
ATOM 4565 C CA  . VAL D 4 213 ? 30.215 91.305  -28.996 1.00 88.00  ? 213  VAL H CA  1 
ATOM 4566 C C   . VAL D 4 213 ? 31.662 91.520  -28.576 1.00 94.09  ? 213  VAL H C   1 
ATOM 4567 O O   . VAL D 4 213 ? 31.987 91.410  -27.389 1.00 79.27  ? 213  VAL H O   1 
ATOM 4568 C CB  . VAL D 4 213 ? 29.313 92.434  -28.469 1.00 82.50  ? 213  VAL H CB  1 
ATOM 4569 C CG1 . VAL D 4 213 ? 29.684 93.775  -29.100 1.00 93.69  ? 213  VAL H CG1 1 
ATOM 4570 C CG2 . VAL D 4 213 ? 27.841 92.086  -28.694 1.00 84.16  ? 213  VAL H CG2 1 
ATOM 4571 N N   . ASP D 4 214 ? 32.531 91.823  -29.537 1.00 100.45 ? 214  ASP H N   1 
ATOM 4572 C CA  . ASP D 4 214 ? 33.943 92.063  -29.261 1.00 114.08 ? 214  ASP H CA  1 
ATOM 4573 C C   . ASP D 4 214 ? 34.267 93.542  -29.424 1.00 117.95 ? 214  ASP H C   1 
ATOM 4574 O O   . ASP D 4 214 ? 33.857 94.166  -30.409 1.00 129.48 ? 214  ASP H O   1 
ATOM 4575 C CB  . ASP D 4 214 ? 34.836 91.233  -30.184 1.00 116.48 ? 214  ASP H CB  1 
ATOM 4576 C CG  . ASP D 4 214 ? 34.660 89.750  -29.977 1.00 118.25 ? 214  ASP H CG  1 
ATOM 4577 O OD1 . ASP D 4 214 ? 33.828 89.372  -29.130 1.00 119.42 ? 214  ASP H OD1 1 
ATOM 4578 O OD2 . ASP D 4 214 ? 35.348 88.964  -30.662 1.00 121.51 ? 214  ASP H OD2 1 
ATOM 4579 N N   . LYS D 4 215 ? 35.003 94.099  -28.463 1.00 108.96 ? 215  LYS H N   1 
ATOM 4580 C CA  . LYS D 4 215 ? 35.490 95.470  -28.544 1.00 110.70 ? 215  LYS H CA  1 
ATOM 4581 C C   . LYS D 4 215 ? 37.008 95.471  -28.437 1.00 117.32 ? 215  LYS H C   1 
ATOM 4582 O O   . LYS D 4 215 ? 37.574 94.785  -27.577 1.00 122.13 ? 215  LYS H O   1 
ATOM 4583 C CB  . LYS D 4 215 ? 34.872 96.345  -27.456 1.00 114.71 ? 215  LYS H CB  1 
ATOM 4584 C CG  . LYS D 4 215 ? 33.388 96.574  -27.649 1.00 120.84 ? 215  LYS H CG  1 
ATOM 4585 C CD  . LYS D 4 215 ? 33.096 97.110  -29.041 1.00 131.37 ? 215  LYS H CD  1 
ATOM 4586 C CE  . LYS D 4 215 ? 31.601 97.239  -29.281 1.00 137.35 ? 215  LYS H CE  1 
ATOM 4587 N NZ  . LYS D 4 215 ? 31.280 97.594  -30.692 1.00 141.14 ? 215  LYS H NZ  1 
ATOM 4588 N N   . LYS D 4 216 ? 37.661 96.242  -29.309 1.00 116.57 ? 216  LYS H N   1 
ATOM 4589 C CA  . LYS D 4 216 ? 39.107 96.155  -29.476 1.00 125.20 ? 216  LYS H CA  1 
ATOM 4590 C C   . LYS D 4 216 ? 39.880 97.141  -28.611 1.00 130.74 ? 216  LYS H C   1 
ATOM 4591 O O   . LYS D 4 216 ? 41.106 97.012  -28.501 1.00 142.92 ? 216  LYS H O   1 
ATOM 4592 C CB  . LYS D 4 216 ? 39.484 96.363  -30.950 1.00 131.65 ? 216  LYS H CB  1 
ATOM 4593 C CG  . LYS D 4 216 ? 40.893 95.899  -31.325 1.00 137.35 ? 216  LYS H CG  1 
ATOM 4594 C CD  . LYS D 4 216 ? 41.137 96.051  -32.821 1.00 150.31 ? 216  LYS H CD  1 
ATOM 4595 C CE  . LYS D 4 216 ? 42.576 95.725  -33.215 1.00 159.26 ? 216  LYS H CE  1 
ATOM 4596 N NZ  . LYS D 4 216 ? 42.822 95.893  -34.681 1.00 161.25 ? 216  LYS H NZ  1 
ATOM 4597 N N   . LEU D 4 217 ? 39.209 98.116  -27.998 1.00 114.95 ? 217  LEU H N   1 
ATOM 4598 C CA  . LEU D 4 217 ? 39.853 99.058  -27.082 1.00 112.25 ? 217  LEU H CA  1 
ATOM 4599 C C   . LEU D 4 217 ? 40.973 99.834  -27.783 1.00 111.72 ? 217  LEU H C   1 
ATOM 4600 O O   . LEU D 4 217 ? 42.158 99.715  -27.466 1.00 106.19 ? 217  LEU H O   1 
ATOM 4601 C CB  . LEU D 4 217 ? 40.386 98.333  -25.845 1.00 97.88  ? 217  LEU H CB  1 
ATOM 4602 C CG  . LEU D 4 217 ? 39.369 97.980  -24.771 1.00 94.54  ? 217  LEU H CG  1 
ATOM 4603 C CD1 . LEU D 4 217 ? 40.142 97.527  -23.589 1.00 99.98  ? 217  LEU H CD1 1 
ATOM 4604 C CD2 . LEU D 4 217 ? 38.523 99.177  -24.399 1.00 95.16  ? 217  LEU H CD2 1 
ATOM 4605 N N   . GLU D 4 218 ? 40.562 100.614 -28.759 1.00 124.86 ? 218  GLU H N   1 
ATOM 4606 C CA  . GLU D 4 218 ? 41.529 101.472 -29.414 1.00 128.14 ? 218  GLU H CA  1 
ATOM 4607 C C   . GLU D 4 218 ? 41.833 102.690 -28.540 1.00 126.55 ? 218  GLU H C   1 
ATOM 4608 O O   . GLU D 4 218 ? 40.970 103.158 -27.791 1.00 115.51 ? 218  GLU H O   1 
ATOM 4609 C CB  . GLU D 4 218 ? 41.008 101.917 -30.780 1.00 123.87 ? 218  GLU H CB  1 
ATOM 4610 C CG  . GLU D 4 218 ? 40.900 100.781 -31.781 1.00 125.26 ? 218  GLU H CG  1 
ATOM 4611 C CD  . GLU D 4 218 ? 42.246 100.150 -32.085 1.00 138.51 ? 218  GLU H CD  1 
ATOM 4612 O OE1 . GLU D 4 218 ? 43.275 100.847 -31.950 1.00 142.79 ? 218  GLU H OE1 1 
ATOM 4613 O OE2 . GLU D 4 218 ? 42.280 98.958  -32.455 1.00 145.44 ? 218  GLU H OE2 1 
ATOM 4614 N N   . PRO D 4 219 ? 43.061 103.200 -28.597 1.00 125.66 ? 219  PRO H N   1 
ATOM 4615 C CA  . PRO D 4 219 ? 43.392 104.415 -27.846 1.00 126.74 ? 219  PRO H CA  1 
ATOM 4616 C C   . PRO D 4 219 ? 42.700 105.638 -28.429 1.00 131.60 ? 219  PRO H C   1 
ATOM 4617 O O   . PRO D 4 219 ? 42.271 105.658 -29.584 1.00 136.44 ? 219  PRO H O   1 
ATOM 4618 C CB  . PRO D 4 219 ? 44.914 104.526 -27.989 1.00 127.28 ? 219  PRO H CB  1 
ATOM 4619 C CG  . PRO D 4 219 ? 45.369 103.172 -28.435 1.00 124.11 ? 219  PRO H CG  1 
ATOM 4620 C CD  . PRO D 4 219 ? 44.246 102.601 -29.233 1.00 125.15 ? 219  PRO H CD  1 
ATOM 4621 N N   . SER D 4 220 ? 42.610 106.677 -27.604 1.00 139.37 ? 220  SER H N   1 
ATOM 4622 C CA  . SER D 4 220 ? 41.990 107.937 -28.007 1.00 138.85 ? 220  SER H CA  1 
ATOM 4623 C C   . SER D 4 220 ? 42.921 109.124 -27.767 1.00 133.56 ? 220  SER H C   1 
ATOM 4624 O O   . SER D 4 220 ? 43.414 109.743 -28.709 1.00 135.99 ? 220  SER H O   1 
ATOM 4625 C CB  . SER D 4 220 ? 40.676 108.147 -27.254 1.00 141.43 ? 220  SER H CB  1 
ATOM 4626 O OG  . SER D 4 220 ? 40.891 108.125 -25.852 1.00 139.54 ? 220  SER H OG  1 
ATOM 4627 N N   . ASP E 5 1   ? 10.415 73.375  8.805   1.00 156.76 ? 1    ASP L N   1 
ATOM 4628 C CA  . ASP E 5 1   ? 9.844  74.465  9.586   1.00 163.58 ? 1    ASP L CA  1 
ATOM 4629 C C   . ASP E 5 1   ? 10.834 74.951  10.646  1.00 158.46 ? 1    ASP L C   1 
ATOM 4630 O O   . ASP E 5 1   ? 10.537 75.865  11.414  1.00 163.03 ? 1    ASP L O   1 
ATOM 4631 C CB  . ASP E 5 1   ? 8.533  74.024  10.243  1.00 172.62 ? 1    ASP L CB  1 
ATOM 4632 C CG  . ASP E 5 1   ? 7.663  75.197  10.659  1.00 187.21 ? 1    ASP L CG  1 
ATOM 4633 O OD1 . ASP E 5 1   ? 8.001  76.347  10.307  1.00 191.40 ? 1    ASP L OD1 1 
ATOM 4634 O OD2 . ASP E 5 1   ? 6.638  74.969  11.336  1.00 194.24 ? 1    ASP L OD2 1 
ATOM 4635 N N   . ILE E 5 2   ? 12.011 74.337  10.683  1.00 149.70 ? 2    ILE L N   1 
ATOM 4636 C CA  . ILE E 5 2   ? 13.051 74.706  11.637  1.00 141.66 ? 2    ILE L CA  1 
ATOM 4637 C C   . ILE E 5 2   ? 13.936 75.771  11.002  1.00 145.41 ? 2    ILE L C   1 
ATOM 4638 O O   . ILE E 5 2   ? 14.502 75.560  9.924   1.00 150.26 ? 2    ILE L O   1 
ATOM 4639 C CB  . ILE E 5 2   ? 13.872 73.480  12.065  1.00 126.02 ? 2    ILE L CB  1 
ATOM 4640 C CG1 . ILE E 5 2   ? 13.013 72.552  12.925  1.00 125.15 ? 2    ILE L CG1 1 
ATOM 4641 C CG2 . ILE E 5 2   ? 15.124 73.903  12.818  1.00 123.08 ? 2    ILE L CG2 1 
ATOM 4642 C CD1 . ILE E 5 2   ? 13.779 71.403  13.520  1.00 120.91 ? 2    ILE L CD1 1 
ATOM 4643 N N   . VAL E 5 3   ? 14.054 76.917  11.671  1.00 142.89 ? 3    VAL L N   1 
ATOM 4644 C CA  . VAL E 5 3   ? 14.801 78.057  11.150  1.00 131.53 ? 3    VAL L CA  1 
ATOM 4645 C C   . VAL E 5 3   ? 16.217 78.025  11.712  1.00 117.08 ? 3    VAL L C   1 
ATOM 4646 O O   . VAL E 5 3   ? 16.412 77.857  12.922  1.00 117.33 ? 3    VAL L O   1 
ATOM 4647 C CB  . VAL E 5 3   ? 14.100 79.379  11.506  1.00 131.16 ? 3    VAL L CB  1 
ATOM 4648 C CG1 . VAL E 5 3   ? 14.769 80.541  10.791  1.00 138.52 ? 3    VAL L CG1 1 
ATOM 4649 C CG2 . VAL E 5 3   ? 12.627 79.308  11.153  1.00 140.68 ? 3    VAL L CG2 1 
ATOM 4650 N N   . LEU E 5 4   ? 17.207 78.191  10.837  1.00 109.93 ? 4    LEU L N   1 
ATOM 4651 C CA  . LEU E 5 4   ? 18.614 78.187  11.221  1.00 110.60 ? 4    LEU L CA  1 
ATOM 4652 C C   . LEU E 5 4   ? 19.177 79.597  11.090  1.00 117.25 ? 4    LEU L C   1 
ATOM 4653 O O   . LEU E 5 4   ? 19.113 80.199  10.012  1.00 123.52 ? 4    LEU L O   1 
ATOM 4654 C CB  . LEU E 5 4   ? 19.416 77.206  10.363  1.00 112.09 ? 4    LEU L CB  1 
ATOM 4655 C CG  . LEU E 5 4   ? 19.682 75.818  10.951  1.00 106.50 ? 4    LEU L CG  1 
ATOM 4656 C CD1 . LEU E 5 4   ? 18.399 75.206  11.466  1.00 108.91 ? 4    LEU L CD1 1 
ATOM 4657 C CD2 . LEU E 5 4   ? 20.321 74.904  9.919   1.00 104.24 ? 4    LEU L CD2 1 
ATOM 4658 N N   . THR E 5 5   ? 19.730 80.115  12.185  1.00 114.08 ? 5    THR L N   1 
ATOM 4659 C CA  . THR E 5 5   ? 20.317 81.449  12.233  1.00 112.99 ? 5    THR L CA  1 
ATOM 4660 C C   . THR E 5 5   ? 21.801 81.320  12.545  1.00 100.79 ? 5    THR L C   1 
ATOM 4661 O O   . THR E 5 5   ? 22.172 80.824  13.615  1.00 100.17 ? 5    THR L O   1 
ATOM 4662 C CB  . THR E 5 5   ? 19.628 82.314  13.292  1.00 119.98 ? 5    THR L CB  1 
ATOM 4663 O OG1 . THR E 5 5   ? 18.211 82.295  13.084  1.00 119.71 ? 5    THR L OG1 1 
ATOM 4664 C CG2 . THR E 5 5   ? 20.132 83.751  13.219  1.00 122.08 ? 5    THR L CG2 1 
ATOM 4665 N N   . GLN E 5 6   ? 22.643 81.776  11.624  1.00 99.24  ? 6    GLN L N   1 
ATOM 4666 C CA  . GLN E 5 6   ? 24.084 81.688  11.800  1.00 107.29 ? 6    GLN L CA  1 
ATOM 4667 C C   . GLN E 5 6   ? 24.645 83.014  12.302  1.00 114.89 ? 6    GLN L C   1 
ATOM 4668 O O   . GLN E 5 6   ? 24.068 84.082  12.080  1.00 112.62 ? 6    GLN L O   1 
ATOM 4669 C CB  . GLN E 5 6   ? 24.778 81.295  10.498  1.00 107.19 ? 6    GLN L CB  1 
ATOM 4670 C CG  . GLN E 5 6   ? 24.163 80.111  9.800   1.00 101.92 ? 6    GLN L CG  1 
ATOM 4671 C CD  . GLN E 5 6   ? 25.025 79.619  8.664   1.00 102.71 ? 6    GLN L CD  1 
ATOM 4672 O OE1 . GLN E 5 6   ? 24.523 79.186  7.623   1.00 103.58 ? 6    GLN L OE1 1 
ATOM 4673 N NE2 . GLN E 5 6   ? 26.337 79.689  8.854   1.00 101.93 ? 6    GLN L NE2 1 
ATOM 4674 N N   . SER E 5 7   ? 25.787 82.929  12.987  1.00 110.11 ? 7    SER L N   1 
ATOM 4675 C CA  . SER E 5 7   ? 26.379 84.092  13.608  1.00 112.84 ? 7    SER L CA  1 
ATOM 4676 C C   . SER E 5 7   ? 27.890 83.931  13.541  1.00 107.86 ? 7    SER L C   1 
ATOM 4677 O O   . SER E 5 7   ? 28.399 82.851  13.883  1.00 110.32 ? 7    SER L O   1 
ATOM 4678 C CB  . SER E 5 7   ? 25.938 84.265  15.064  1.00 128.61 ? 7    SER L CB  1 
ATOM 4679 O OG  . SER E 5 7   ? 24.530 84.389  15.174  1.00 134.56 ? 7    SER L OG  1 
ATOM 4680 N N   . PRO E 5 8   ? 28.626 84.961  13.101  1.00 107.64 ? 8    PRO L N   1 
ATOM 4681 C CA  . PRO E 5 8   ? 28.024 86.187  12.577  1.00 118.94 ? 8    PRO L CA  1 
ATOM 4682 C C   . PRO E 5 8   ? 27.794 86.111  11.073  1.00 117.25 ? 8    PRO L C   1 
ATOM 4683 O O   . PRO E 5 8   ? 28.145 85.112  10.445  1.00 113.67 ? 8    PRO L O   1 
ATOM 4684 C CB  . PRO E 5 8   ? 29.069 87.247  12.911  1.00 128.88 ? 8    PRO L CB  1 
ATOM 4685 C CG  . PRO E 5 8   ? 30.364 86.506  12.785  1.00 117.62 ? 8    PRO L CG  1 
ATOM 4686 C CD  . PRO E 5 8   ? 30.088 85.086  13.241  1.00 105.54 ? 8    PRO L CD  1 
ATOM 4687 N N   . ALA E 5 9   ? 27.219 87.167  10.498  1.00 113.67 ? 9    ALA L N   1 
ATOM 4688 C CA  . ALA E 5 9   ? 27.062 87.197  9.051   1.00 108.20 ? 9    ALA L CA  1 
ATOM 4689 C C   . ALA E 5 9   ? 28.402 87.421  8.360   1.00 106.34 ? 9    ALA L C   1 
ATOM 4690 O O   . ALA E 5 9   ? 28.716 86.743  7.377   1.00 101.86 ? 9    ALA L O   1 
ATOM 4691 C CB  . ALA E 5 9   ? 26.053 88.270  8.657   1.00 113.67 ? 9    ALA L CB  1 
ATOM 4692 N N   . ILE E 5 10  ? 29.206 88.362  8.861   1.00 113.23 ? 10   ILE L N   1 
ATOM 4693 C CA  . ILE E 5 10  ? 30.521 88.677  8.309   1.00 109.41 ? 10   ILE L CA  1 
ATOM 4694 C C   . ILE E 5 10  ? 31.551 88.615  9.429   1.00 110.61 ? 10   ILE L C   1 
ATOM 4695 O O   . ILE E 5 10  ? 31.263 88.989  10.572  1.00 114.58 ? 10   ILE L O   1 
ATOM 4696 C CB  . ILE E 5 10  ? 30.553 90.070  7.639   1.00 114.19 ? 10   ILE L CB  1 
ATOM 4697 C CG1 . ILE E 5 10  ? 29.197 90.420  7.027   1.00 116.16 ? 10   ILE L CG1 1 
ATOM 4698 C CG2 . ILE E 5 10  ? 31.642 90.132  6.573   1.00 111.92 ? 10   ILE L CG2 1 
ATOM 4699 C CD1 . ILE E 5 10  ? 29.080 91.874  6.609   1.00 145.70 ? 10   ILE L CD1 1 
ATOM 4700 N N   . MET E 5 11  ? 32.756 88.158  9.097   1.00 109.31 ? 11   MET L N   1 
ATOM 4701 C CA  . MET E 5 11  ? 33.846 88.110  10.062  1.00 113.12 ? 11   MET L CA  1 
ATOM 4702 C C   . MET E 5 11  ? 35.162 88.052  9.304   1.00 121.74 ? 11   MET L C   1 
ATOM 4703 O O   . MET E 5 11  ? 35.288 87.299  8.335   1.00 132.09 ? 11   MET L O   1 
ATOM 4704 C CB  . MET E 5 11  ? 33.706 86.910  11.010  1.00 113.08 ? 11   MET L CB  1 
ATOM 4705 C CG  . MET E 5 11  ? 33.649 85.547  10.341  1.00 114.05 ? 11   MET L CG  1 
ATOM 4706 S SD  . MET E 5 11  ? 33.301 84.240  11.543  1.00 118.66 ? 11   MET L SD  1 
ATOM 4707 C CE  . MET E 5 11  ? 34.660 84.469  12.682  1.00 123.22 ? 11   MET L CE  1 
ATOM 4708 N N   . SER E 5 12  ? 36.122 88.863  9.725   1.00 127.93 ? 12   SER L N   1 
ATOM 4709 C CA  . SER E 5 12  ? 37.460 88.837  9.159   1.00 129.20 ? 12   SER L CA  1 
ATOM 4710 C C   . SER E 5 12  ? 38.349 87.975  10.044  1.00 132.28 ? 12   SER L C   1 
ATOM 4711 O O   . SER E 5 12  ? 38.157 87.918  11.262  1.00 142.63 ? 12   SER L O   1 
ATOM 4712 C CB  . SER E 5 12  ? 38.030 90.252  9.029   1.00 144.11 ? 12   SER L CB  1 
ATOM 4713 O OG  . SER E 5 12  ? 38.083 90.904  10.287  1.00 160.01 ? 12   SER L OG  1 
ATOM 4714 N N   . ALA E 5 13  ? 39.302 87.280  9.428   1.00 126.33 ? 13   ALA L N   1 
ATOM 4715 C CA  . ALA E 5 13  ? 40.184 86.387  10.175  1.00 109.87 ? 13   ALA L CA  1 
ATOM 4716 C C   . ALA E 5 13  ? 41.535 86.323  9.484   1.00 133.10 ? 13   ALA L C   1 
ATOM 4717 O O   . ALA E 5 13  ? 41.618 85.932  8.317   1.00 106.69 ? 13   ALA L O   1 
ATOM 4718 C CB  . ALA E 5 13  ? 39.577 84.990  10.300  1.00 110.75 ? 13   ALA L CB  1 
ATOM 4719 N N   . SER E 5 14  ? 42.587 86.703  10.207  1.00 131.30 ? 14   SER L N   1 
ATOM 4720 C CA  . SER E 5 14  ? 43.936 86.641  9.671   1.00 134.57 ? 14   SER L CA  1 
ATOM 4721 C C   . SER E 5 14  ? 44.418 85.193  9.621   1.00 128.54 ? 14   SER L C   1 
ATOM 4722 O O   . SER E 5 14  ? 43.931 84.342  10.368  1.00 127.44 ? 14   SER L O   1 
ATOM 4723 C CB  . SER E 5 14  ? 44.882 87.486  10.521  1.00 152.03 ? 14   SER L CB  1 
ATOM 4724 O OG  . SER E 5 14  ? 44.477 88.844  10.536  1.00 164.85 ? 14   SER L OG  1 
ATOM 4725 N N   . PRO E 5 15  ? 45.372 84.885  8.742   1.00 129.23 ? 15   PRO L N   1 
ATOM 4726 C CA  . PRO E 5 15  ? 45.880 83.509  8.666   1.00 124.63 ? 15   PRO L CA  1 
ATOM 4727 C C   . PRO E 5 15  ? 46.520 83.088  9.979   1.00 129.96 ? 15   PRO L C   1 
ATOM 4728 O O   . PRO E 5 15  ? 47.321 83.820  10.563  1.00 147.89 ? 15   PRO L O   1 
ATOM 4729 C CB  . PRO E 5 15  ? 46.907 83.572  7.530   1.00 129.46 ? 15   PRO L CB  1 
ATOM 4730 C CG  . PRO E 5 15  ? 46.501 84.744  6.715   1.00 127.34 ? 15   PRO L CG  1 
ATOM 4731 C CD  . PRO E 5 15  ? 45.954 85.740  7.694   1.00 130.23 ? 15   PRO L CD  1 
ATOM 4732 N N   . GLY E 5 16  ? 46.153 81.899  10.444  1.00 122.07 ? 16   GLY L N   1 
ATOM 4733 C CA  . GLY E 5 16  ? 46.648 81.367  11.690  1.00 127.99 ? 16   GLY L CA  1 
ATOM 4734 C C   . GLY E 5 16  ? 45.706 81.528  12.864  1.00 118.96 ? 16   GLY L C   1 
ATOM 4735 O O   . GLY E 5 16  ? 45.869 80.829  13.868  1.00 135.87 ? 16   GLY L O   1 
ATOM 4736 N N   . GLU E 5 17  ? 44.730 82.427  12.768  1.00 126.72 ? 17   GLU L N   1 
ATOM 4737 C CA  . GLU E 5 17  ? 43.794 82.626  13.863  1.00 136.42 ? 17   GLU L CA  1 
ATOM 4738 C C   . GLU E 5 17  ? 42.794 81.478  13.935  1.00 142.68 ? 17   GLU L C   1 
ATOM 4739 O O   . GLU E 5 17  ? 42.584 80.732  12.976  1.00 107.89 ? 17   GLU L O   1 
ATOM 4740 C CB  . GLU E 5 17  ? 43.042 83.948  13.705  1.00 150.31 ? 17   GLU L CB  1 
ATOM 4741 C CG  . GLU E 5 17  ? 43.906 85.191  13.809  1.00 165.89 ? 17   GLU L CG  1 
ATOM 4742 C CD  . GLU E 5 17  ? 43.088 86.470  13.797  1.00 167.75 ? 17   GLU L CD  1 
ATOM 4743 O OE1 . GLU E 5 17  ? 41.843 86.385  13.740  1.00 162.24 ? 17   GLU L OE1 1 
ATOM 4744 O OE2 . GLU E 5 17  ? 43.692 87.562  13.846  1.00 172.88 ? 17   GLU L OE2 1 
ATOM 4745 N N   . LYS E 5 18  ? 42.169 81.347  15.098  1.00 135.36 ? 18   LYS L N   1 
ATOM 4746 C CA  . LYS E 5 18  ? 41.151 80.331  15.320  1.00 134.05 ? 18   LYS L CA  1 
ATOM 4747 C C   . LYS E 5 18  ? 39.791 80.932  14.991  1.00 126.78 ? 18   LYS L C   1 
ATOM 4748 O O   . LYS E 5 18  ? 39.404 81.957  15.562  1.00 132.56 ? 18   LYS L O   1 
ATOM 4749 C CB  . LYS E 5 18  ? 41.208 79.828  16.763  1.00 135.77 ? 18   LYS L CB  1 
ATOM 4750 C CG  . LYS E 5 18  ? 40.218 78.719  17.113  1.00 131.82 ? 18   LYS L CG  1 
ATOM 4751 C CD  . LYS E 5 18  ? 40.554 78.119  18.483  1.00 145.23 ? 18   LYS L CD  1 
ATOM 4752 C CE  . LYS E 5 18  ? 39.502 77.123  18.962  1.00 143.29 ? 18   LYS L CE  1 
ATOM 4753 N NZ  . LYS E 5 18  ? 38.203 77.779  19.280  1.00 140.40 ? 18   LYS L NZ  1 
ATOM 4754 N N   . VAL E 5 19  ? 39.080 80.315  14.062  1.00 126.92 ? 19   VAL L N   1 
ATOM 4755 C CA  . VAL E 5 19  ? 37.784 80.812  13.615  1.00 129.13 ? 19   VAL L CA  1 
ATOM 4756 C C   . VAL E 5 19  ? 36.689 79.943  14.215  1.00 127.07 ? 19   VAL L C   1 
ATOM 4757 O O   . VAL E 5 19  ? 36.824 78.718  14.279  1.00 128.96 ? 19   VAL L O   1 
ATOM 4758 C CB  . VAL E 5 19  ? 37.708 80.824  12.077  1.00 128.95 ? 19   VAL L CB  1 
ATOM 4759 C CG1 . VAL E 5 19  ? 36.411 81.458  11.618  1.00 124.81 ? 19   VAL L CG1 1 
ATOM 4760 C CG2 . VAL E 5 19  ? 38.907 81.563  11.498  1.00 133.40 ? 19   VAL L CG2 1 
ATOM 4761 N N   . THR E 5 20  ? 35.602 80.573  14.663  1.00 125.71 ? 20   THR L N   1 
ATOM 4762 C CA  . THR E 5 20  ? 34.487 79.838  15.258  1.00 124.92 ? 20   THR L CA  1 
ATOM 4763 C C   . THR E 5 20  ? 33.182 80.539  14.910  1.00 122.00 ? 20   THR L C   1 
ATOM 4764 O O   . THR E 5 20  ? 32.974 81.686  15.316  1.00 129.95 ? 20   THR L O   1 
ATOM 4765 C CB  . THR E 5 20  ? 34.639 79.729  16.782  1.00 118.79 ? 20   THR L CB  1 
ATOM 4766 O OG1 . THR E 5 20  ? 35.837 79.010  17.105  1.00 118.43 ? 20   THR L OG1 1 
ATOM 4767 C CG2 . THR E 5 20  ? 33.443 79.005  17.389  1.00 110.60 ? 20   THR L CG2 1 
ATOM 4768 N N   . MET E 5 21  ? 32.300 79.850  14.186  1.00 115.79 ? 21   MET L N   1 
ATOM 4769 C CA  . MET E 5 21  ? 30.992 80.383  13.828  1.00 111.89 ? 21   MET L CA  1 
ATOM 4770 C C   . MET E 5 21  ? 29.892 79.488  14.381  1.00 112.83 ? 21   MET L C   1 
ATOM 4771 O O   . MET E 5 21  ? 30.056 78.272  14.489  1.00 118.50 ? 21   MET L O   1 
ATOM 4772 C CB  . MET E 5 21  ? 30.838 80.510  12.313  1.00 103.14 ? 21   MET L CB  1 
ATOM 4773 C CG  . MET E 5 21  ? 31.090 79.213  11.575  1.00 105.07 ? 21   MET L CG  1 
ATOM 4774 S SD  . MET E 5 21  ? 31.524 79.448  9.841   1.00 105.58 ? 21   MET L SD  1 
ATOM 4775 C CE  . MET E 5 21  ? 33.076 80.329  9.991   1.00 111.94 ? 21   MET L CE  1 
ATOM 4776 N N   . THR E 5 22  ? 28.759 80.095  14.712  1.00 114.45 ? 22   THR L N   1 
ATOM 4777 C CA  . THR E 5 22  ? 27.670 79.392  15.367  1.00 104.23 ? 22   THR L CA  1 
ATOM 4778 C C   . THR E 5 22  ? 26.455 79.284  14.454  1.00 106.46 ? 22   THR L C   1 
ATOM 4779 O O   . THR E 5 22  ? 26.273 80.061  13.509  1.00 108.26 ? 22   THR L O   1 
ATOM 4780 C CB  . THR E 5 22  ? 27.281 80.085  16.671  1.00 109.45 ? 22   THR L CB  1 
ATOM 4781 O OG1 . THR E 5 22  ? 26.880 81.433  16.392  1.00 126.40 ? 22   THR L OG1 1 
ATOM 4782 C CG2 . THR E 5 22  ? 28.461 80.104  17.618  1.00 115.87 ? 22   THR L CG2 1 
ATOM 4783 N N   . CYS E 5 23  ? 25.625 78.291  14.766  1.00 112.32 ? 23   CYS L N   1 
ATOM 4784 C CA  . CYS E 5 23  ? 24.402 77.982  14.036  1.00 110.77 ? 23   CYS L CA  1 
ATOM 4785 C C   . CYS E 5 23  ? 23.359 77.567  15.058  1.00 115.51 ? 23   CYS L C   1 
ATOM 4786 O O   . CYS E 5 23  ? 23.545 76.570  15.763  1.00 118.54 ? 23   CYS L O   1 
ATOM 4787 C CB  . CYS E 5 23  ? 24.637 76.869  13.010  1.00 107.90 ? 23   CYS L CB  1 
ATOM 4788 S SG  . CYS E 5 23  ? 23.192 76.347  12.042  1.00 114.40 ? 23   CYS L SG  1 
ATOM 4789 N N   . SER E 5 24  ? 22.279 78.338  15.157  1.00 119.12 ? 24   SER L N   1 
ATOM 4790 C CA  . SER E 5 24  ? 21.248 78.120  16.163  1.00 121.58 ? 24   SER L CA  1 
ATOM 4791 C C   . SER E 5 24  ? 19.926 77.787  15.489  1.00 132.07 ? 24   SER L C   1 
ATOM 4792 O O   . SER E 5 24  ? 19.507 78.481  14.558  1.00 132.19 ? 24   SER L O   1 
ATOM 4793 C CB  . SER E 5 24  ? 21.082 79.350  17.052  1.00 127.17 ? 24   SER L CB  1 
ATOM 4794 O OG  . SER E 5 24  ? 20.048 79.144  17.996  1.00 137.59 ? 24   SER L OG  1 
ATOM 4795 N N   . ALA E 5 25  ? 19.264 76.741  15.976  1.00 135.50 ? 25   ALA L N   1 
ATOM 4796 C CA  . ALA E 5 25  ? 17.980 76.308  15.446  1.00 137.28 ? 25   ALA L CA  1 
ATOM 4797 C C   . ALA E 5 25  ? 16.864 76.634  16.431  1.00 136.45 ? 25   ALA L C   1 
ATOM 4798 O O   . ALA E 5 25  ? 17.082 76.704  17.644  1.00 139.79 ? 25   ALA L O   1 
ATOM 4799 C CB  . ALA E 5 25  ? 17.987 74.807  15.145  1.00 136.44 ? 25   ALA L CB  1 
ATOM 4800 N N   . SER E 5 26  ? 15.657 76.828  15.891  1.00 124.08 ? 26   SER L N   1 
ATOM 4801 C CA  . SER E 5 26  ? 14.514 77.177  16.728  1.00 120.75 ? 26   SER L CA  1 
ATOM 4802 C C   . SER E 5 26  ? 14.048 76.003  17.581  1.00 121.29 ? 26   SER L C   1 
ATOM 4803 O O   . SER E 5 26  ? 13.486 76.215  18.662  1.00 125.58 ? 26   SER L O   1 
ATOM 4804 C CB  . SER E 5 26  ? 13.367 77.693  15.858  1.00 123.56 ? 26   SER L CB  1 
ATOM 4805 O OG  . SER E 5 26  ? 12.983 76.742  14.883  1.00 110.73 ? 26   SER L OG  1 
ATOM 4806 N N   . SER E 5 27  ? 14.266 74.771  17.123  1.00 116.58 ? 27   SER L N   1 
ATOM 4807 C CA  . SER E 5 27  ? 13.830 73.579  17.833  1.00 125.24 ? 27   SER L CA  1 
ATOM 4808 C C   . SER E 5 27  ? 14.999 72.614  17.985  1.00 134.83 ? 27   SER L C   1 
ATOM 4809 O O   . SER E 5 27  ? 16.088 72.832  17.450  1.00 123.21 ? 27   SER L O   1 
ATOM 4810 C CB  . SER E 5 27  ? 12.663 72.893  17.109  1.00 124.53 ? 27   SER L CB  1 
ATOM 4811 O OG  . SER E 5 27  ? 11.573 73.783  16.945  1.00 127.82 ? 27   SER L OG  1 
ATOM 4812 N N   . SER E 5 28  ? 14.766 71.539  18.736  1.00 155.69 ? 28   SER L N   1 
ATOM 4813 C CA  . SER E 5 28  ? 15.782 70.507  18.906  1.00 158.10 ? 28   SER L CA  1 
ATOM 4814 C C   . SER E 5 28  ? 15.997 69.784  17.584  1.00 152.81 ? 28   SER L C   1 
ATOM 4815 O O   . SER E 5 28  ? 15.054 69.231  17.006  1.00 156.60 ? 28   SER L O   1 
ATOM 4816 C CB  . SER E 5 28  ? 15.373 69.525  20.001  1.00 165.02 ? 28   SER L CB  1 
ATOM 4817 O OG  . SER E 5 28  ? 15.228 70.181  21.249  1.00 174.05 ? 28   SER L OG  1 
ATOM 4818 N N   . VAL E 5 29  ? 17.236 69.792  17.106  1.00 139.63 ? 29   VAL L N   1 
ATOM 4819 C CA  . VAL E 5 29  ? 17.600 69.229  15.813  1.00 126.37 ? 29   VAL L CA  1 
ATOM 4820 C C   . VAL E 5 29  ? 18.459 67.993  16.037  1.00 118.91 ? 29   VAL L C   1 
ATOM 4821 O O   . VAL E 5 29  ? 19.320 67.973  16.925  1.00 127.83 ? 29   VAL L O   1 
ATOM 4822 C CB  . VAL E 5 29  ? 18.330 70.275  14.949  1.00 115.17 ? 29   VAL L CB  1 
ATOM 4823 C CG1 . VAL E 5 29  ? 19.015 69.621  13.775  1.00 117.44 ? 29   VAL L CG1 1 
ATOM 4824 C CG2 . VAL E 5 29  ? 17.342 71.306  14.462  1.00 119.27 ? 29   VAL L CG2 1 
ATOM 4825 N N   . THR E 5 30  ? 18.218 66.957  15.228  1.00 106.78 ? 30   THR L N   1 
ATOM 4826 C CA  . THR E 5 30  ? 18.947 65.703  15.386  1.00 113.99 ? 30   THR L CA  1 
ATOM 4827 C C   . THR E 5 30  ? 20.390 65.831  14.904  1.00 106.03 ? 30   THR L C   1 
ATOM 4828 O O   . THR E 5 30  ? 21.329 65.506  15.638  1.00 112.71 ? 30   THR L O   1 
ATOM 4829 C CB  . THR E 5 30  ? 18.234 64.577  14.635  1.00 93.61  ? 30   THR L CB  1 
ATOM 4830 O OG1 . THR E 5 30  ? 16.831 64.614  14.921  1.00 96.41  ? 30   THR L OG1 1 
ATOM 4831 C CG2 . THR E 5 30  ? 18.779 63.243  15.072  1.00 95.80  ? 30   THR L CG2 1 
ATOM 4832 N N   . TYR E 5 31  ? 20.589 66.299  13.671  1.00 109.57 ? 31   TYR L N   1 
ATOM 4833 C CA  . TYR E 5 31  ? 21.915 66.342  13.071  1.00 114.49 ? 31   TYR L CA  1 
ATOM 4834 C C   . TYR E 5 31  ? 22.122 67.661  12.341  1.00 112.32 ? 31   TYR L C   1 
ATOM 4835 O O   . TYR E 5 31  ? 21.176 68.252  11.817  1.00 117.25 ? 31   TYR L O   1 
ATOM 4836 C CB  . TYR E 5 31  ? 22.137 65.179  12.095  1.00 122.45 ? 31   TYR L CB  1 
ATOM 4837 C CG  . TYR E 5 31  ? 22.434 63.855  12.763  1.00 124.68 ? 31   TYR L CG  1 
ATOM 4838 C CD1 . TYR E 5 31  ? 23.697 63.582  13.264  1.00 124.83 ? 31   TYR L CD1 1 
ATOM 4839 C CD2 . TYR E 5 31  ? 21.456 62.880  12.885  1.00 126.43 ? 31   TYR L CD2 1 
ATOM 4840 C CE1 . TYR E 5 31  ? 23.981 62.379  13.871  1.00 126.68 ? 31   TYR L CE1 1 
ATOM 4841 C CE2 . TYR E 5 31  ? 21.730 61.671  13.494  1.00 133.15 ? 31   TYR L CE2 1 
ATOM 4842 C CZ  . TYR E 5 31  ? 22.995 61.427  13.985  1.00 133.83 ? 31   TYR L CZ  1 
ATOM 4843 O OH  . TYR E 5 31  ? 23.280 60.226  14.591  1.00 144.71 ? 31   TYR L OH  1 
ATOM 4844 N N   . MET E 5 32  ? 23.379 68.105  12.301  1.00 112.96 ? 32   MET L N   1 
ATOM 4845 C CA  . MET E 5 32  ? 23.770 69.364  11.680  1.00 104.96 ? 32   MET L CA  1 
ATOM 4846 C C   . MET E 5 32  ? 24.930 69.119  10.722  1.00 99.62  ? 32   MET L C   1 
ATOM 4847 O O   . MET E 5 32  ? 25.852 68.359  11.028  1.00 97.95  ? 32   MET L O   1 
ATOM 4848 C CB  . MET E 5 32  ? 24.164 70.402  12.750  1.00 97.40  ? 32   MET L CB  1 
ATOM 4849 C CG  . MET E 5 32  ? 24.491 71.802  12.237  1.00 90.96  ? 32   MET L CG  1 
ATOM 4850 S SD  . MET E 5 32  ? 23.115 72.753  11.541  1.00 88.11  ? 32   MET L SD  1 
ATOM 4851 C CE  . MET E 5 32  ? 21.847 72.649  12.799  1.00 84.60  ? 32   MET L CE  1 
ATOM 4852 N N   . TYR E 5 33  ? 24.882 69.769  9.565   1.00 101.66 ? 33   TYR L N   1 
ATOM 4853 C CA  . TYR E 5 33  ? 25.878 69.592  8.522   1.00 98.11  ? 33   TYR L CA  1 
ATOM 4854 C C   . TYR E 5 33  ? 26.411 70.955  8.105   1.00 92.48  ? 33   TYR L C   1 
ATOM 4855 O O   . TYR E 5 33  ? 25.686 71.950  8.104   1.00 88.00  ? 33   TYR L O   1 
ATOM 4856 C CB  . TYR E 5 33  ? 25.292 68.850  7.312   1.00 97.93  ? 33   TYR L CB  1 
ATOM 4857 C CG  . TYR E 5 33  ? 24.472 67.638  7.682   1.00 95.26  ? 33   TYR L CG  1 
ATOM 4858 C CD1 . TYR E 5 33  ? 25.075 66.403  7.872   1.00 101.04 ? 33   TYR L CD1 1 
ATOM 4859 C CD2 . TYR E 5 33  ? 23.096 67.727  7.846   1.00 93.93  ? 33   TYR L CD2 1 
ATOM 4860 C CE1 . TYR E 5 33  ? 24.331 65.286  8.216   1.00 98.26  ? 33   TYR L CE1 1 
ATOM 4861 C CE2 . TYR E 5 33  ? 22.341 66.615  8.189   1.00 103.76 ? 33   TYR L CE2 1 
ATOM 4862 C CZ  . TYR E 5 33  ? 22.968 65.396  8.371   1.00 102.31 ? 33   TYR L CZ  1 
ATOM 4863 O OH  . TYR E 5 33  ? 22.244 64.276  8.710   1.00 106.33 ? 33   TYR L OH  1 
ATOM 4864 N N   . TRP E 5 34  ? 27.692 70.989  7.763   1.00 87.94  ? 34   TRP L N   1 
ATOM 4865 C CA  . TRP E 5 34  ? 28.396 72.221  7.453   1.00 82.41  ? 34   TRP L CA  1 
ATOM 4866 C C   . TRP E 5 34  ? 29.016 72.115  6.073   1.00 78.45  ? 34   TRP L C   1 
ATOM 4867 O O   . TRP E 5 34  ? 29.750 71.161  5.789   1.00 77.93  ? 34   TRP L O   1 
ATOM 4868 C CB  . TRP E 5 34  ? 29.483 72.503  8.483   1.00 85.98  ? 34   TRP L CB  1 
ATOM 4869 C CG  . TRP E 5 34  ? 28.962 72.827  9.822   1.00 89.75  ? 34   TRP L CG  1 
ATOM 4870 C CD1 . TRP E 5 34  ? 28.715 71.957  10.844  1.00 95.43  ? 34   TRP L CD1 1 
ATOM 4871 C CD2 . TRP E 5 34  ? 28.630 74.125  10.308  1.00 100.52 ? 34   TRP L CD2 1 
ATOM 4872 N NE1 . TRP E 5 34  ? 28.247 72.639  11.939  1.00 106.54 ? 34   TRP L NE1 1 
ATOM 4873 C CE2 . TRP E 5 34  ? 28.186 73.974  11.635  1.00 111.47 ? 34   TRP L CE2 1 
ATOM 4874 C CE3 . TRP E 5 34  ? 28.666 75.405  9.749   1.00 98.87  ? 34   TRP L CE3 1 
ATOM 4875 C CZ2 . TRP E 5 34  ? 27.779 75.055  12.410  1.00 111.95 ? 34   TRP L CZ2 1 
ATOM 4876 C CZ3 . TRP E 5 34  ? 28.263 76.472  10.516  1.00 106.65 ? 34   TRP L CZ3 1 
ATOM 4877 C CH2 . TRP E 5 34  ? 27.826 76.293  11.833  1.00 111.07 ? 34   TRP L CH2 1 
ATOM 4878 N N   . TYR E 5 35  ? 28.744 73.112  5.239   1.00 82.23  ? 35   TYR L N   1 
ATOM 4879 C CA  . TYR E 5 35  ? 29.227 73.179  3.870   1.00 85.56  ? 35   TYR L CA  1 
ATOM 4880 C C   . TYR E 5 35  ? 29.996 74.476  3.658   1.00 80.80  ? 35   TYR L C   1 
ATOM 4881 O O   . TYR E 5 35  ? 29.642 75.514  4.219   1.00 84.50  ? 35   TYR L O   1 
ATOM 4882 C CB  . TYR E 5 35  ? 28.070 73.112  2.871   1.00 84.35  ? 35   TYR L CB  1 
ATOM 4883 C CG  . TYR E 5 35  ? 27.168 71.914  3.017   1.00 88.60  ? 35   TYR L CG  1 
ATOM 4884 C CD1 . TYR E 5 35  ? 26.134 71.903  3.945   1.00 88.55  ? 35   TYR L CD1 1 
ATOM 4885 C CD2 . TYR E 5 35  ? 27.336 70.800  2.208   1.00 91.78  ? 35   TYR L CD2 1 
ATOM 4886 C CE1 . TYR E 5 35  ? 25.303 70.807  4.069   1.00 93.26  ? 35   TYR L CE1 1 
ATOM 4887 C CE2 . TYR E 5 35  ? 26.513 69.706  2.323   1.00 89.31  ? 35   TYR L CE2 1 
ATOM 4888 C CZ  . TYR E 5 35  ? 25.500 69.713  3.253   1.00 89.66  ? 35   TYR L CZ  1 
ATOM 4889 O OH  . TYR E 5 35  ? 24.681 68.622  3.368   1.00 97.78  ? 35   TYR L OH  1 
ATOM 4890 N N   . GLN E 5 36  ? 31.043 74.413  2.842   1.00 85.43  ? 36   GLN L N   1 
ATOM 4891 C CA  . GLN E 5 36  ? 31.779 75.590  2.401   1.00 72.00  ? 36   GLN L CA  1 
ATOM 4892 C C   . GLN E 5 36  ? 31.504 75.823  0.924   1.00 78.76  ? 36   GLN L C   1 
ATOM 4893 O O   . GLN E 5 36  ? 31.584 74.889  0.118   1.00 100.87 ? 36   GLN L O   1 
ATOM 4894 C CB  . GLN E 5 36  ? 33.282 75.420  2.634   1.00 72.42  ? 36   GLN L CB  1 
ATOM 4895 C CG  . GLN E 5 36  ? 34.157 76.423  1.901   1.00 74.05  ? 36   GLN L CG  1 
ATOM 4896 C CD  . GLN E 5 36  ? 35.637 76.092  1.994   1.00 88.77  ? 36   GLN L CD  1 
ATOM 4897 O OE1 . GLN E 5 36  ? 36.016 75.055  2.529   1.00 103.12 ? 36   GLN L OE1 1 
ATOM 4898 N NE2 . GLN E 5 36  ? 36.479 76.975  1.471   1.00 99.84  ? 36   GLN L NE2 1 
ATOM 4899 N N   . GLN E 5 37  ? 31.185 77.067  0.571   1.00 79.44  ? 37   GLN L N   1 
ATOM 4900 C CA  . GLN E 5 37  ? 30.933 77.453  -0.813  1.00 87.55  ? 37   GLN L CA  1 
ATOM 4901 C C   . GLN E 5 37  ? 31.754 78.687  -1.148  1.00 88.27  ? 37   GLN L C   1 
ATOM 4902 O O   . GLN E 5 37  ? 31.640 79.717  -0.473  1.00 87.54  ? 37   GLN L O   1 
ATOM 4903 C CB  . GLN E 5 37  ? 29.453 77.730  -1.065  1.00 77.00  ? 37   GLN L CB  1 
ATOM 4904 C CG  . GLN E 5 37  ? 29.133 77.875  -2.536  1.00 78.99  ? 37   GLN L CG  1 
ATOM 4905 C CD  . GLN E 5 37  ? 27.675 78.138  -2.773  1.00 80.80  ? 37   GLN L CD  1 
ATOM 4906 O OE1 . GLN E 5 37  ? 26.956 78.551  -1.863  1.00 83.73  ? 37   GLN L OE1 1 
ATOM 4907 N NE2 . GLN E 5 37  ? 27.220 77.896  -3.996  1.00 82.51  ? 37   GLN L NE2 1 
ATOM 4908 N N   . LYS E 5 38  ? 32.586 78.578  -2.190  1.00 86.75  ? 38   LYS L N   1 
ATOM 4909 C CA  . LYS E 5 38  ? 33.344 79.712  -2.679  1.00 91.05  ? 38   LYS L CA  1 
ATOM 4910 C C   . LYS E 5 38  ? 32.605 80.368  -3.839  1.00 90.29  ? 38   LYS L C   1 
ATOM 4911 O O   . LYS E 5 38  ? 31.817 79.715  -4.528  1.00 89.74  ? 38   LYS L O   1 
ATOM 4912 C CB  . LYS E 5 38  ? 34.749 79.275  -3.117  1.00 99.85  ? 38   LYS L CB  1 
ATOM 4913 C CG  . LYS E 5 38  ? 35.551 78.583  -2.002  1.00 107.49 ? 38   LYS L CG  1 
ATOM 4914 C CD  . LYS E 5 38  ? 37.017 78.365  -2.368  1.00 126.65 ? 38   LYS L CD  1 
ATOM 4915 C CE  . LYS E 5 38  ? 37.745 79.691  -2.520  1.00 152.10 ? 38   LYS L CE  1 
ATOM 4916 N NZ  . LYS E 5 38  ? 39.196 79.534  -2.822  1.00 163.35 ? 38   LYS L NZ  1 
ATOM 4917 N N   . PRO E 5 39  ? 32.786 81.671  -4.052  1.00 102.97 ? 39   PRO L N   1 
ATOM 4918 C CA  . PRO E 5 39  ? 32.071 82.339  -5.149  1.00 99.86  ? 39   PRO L CA  1 
ATOM 4919 C C   . PRO E 5 39  ? 32.429 81.722  -6.490  1.00 92.80  ? 39   PRO L C   1 
ATOM 4920 O O   . PRO E 5 39  ? 33.592 81.715  -6.901  1.00 93.49  ? 39   PRO L O   1 
ATOM 4921 C CB  . PRO E 5 39  ? 32.545 83.792  -5.044  1.00 99.67  ? 39   PRO L CB  1 
ATOM 4922 C CG  . PRO E 5 39  ? 32.932 83.952  -3.619  1.00 115.28 ? 39   PRO L CG  1 
ATOM 4923 C CD  . PRO E 5 39  ? 33.529 82.632  -3.218  1.00 116.18 ? 39   PRO L CD  1 
ATOM 4924 N N   . GLY E 5 40  ? 31.416 81.177  -7.164  1.00 93.19  ? 40   GLY L N   1 
ATOM 4925 C CA  . GLY E 5 40  ? 31.552 80.636  -8.496  1.00 103.03 ? 40   GLY L CA  1 
ATOM 4926 C C   . GLY E 5 40  ? 31.553 79.122  -8.550  1.00 102.99 ? 40   GLY L C   1 
ATOM 4927 O O   . GLY E 5 40  ? 31.217 78.549  -9.593  1.00 119.65 ? 40   GLY L O   1 
ATOM 4928 N N   . SER E 5 41  ? 31.928 78.465  -7.460  1.00 87.36  ? 41   SER L N   1 
ATOM 4929 C CA  . SER E 5 41  ? 31.999 77.014  -7.421  1.00 111.87 ? 41   SER L CA  1 
ATOM 4930 C C   . SER E 5 41  ? 30.830 76.454  -6.617  1.00 107.09 ? 41   SER L C   1 
ATOM 4931 O O   . SER E 5 41  ? 30.134 77.177  -5.899  1.00 95.14  ? 41   SER L O   1 
ATOM 4932 C CB  . SER E 5 41  ? 33.340 76.543  -6.833  1.00 118.62 ? 41   SER L CB  1 
ATOM 4933 O OG  . SER E 5 41  ? 33.480 76.898  -5.465  1.00 117.90 ? 41   SER L OG  1 
ATOM 4934 N N   . SER E 5 42  ? 30.602 75.152  -6.772  1.00 101.56 ? 42   SER L N   1 
ATOM 4935 C CA  . SER E 5 42  ? 29.568 74.474  -6.010  1.00 88.42  ? 42   SER L CA  1 
ATOM 4936 C C   . SER E 5 42  ? 30.023 74.288  -4.563  1.00 76.63  ? 42   SER L C   1 
ATOM 4937 O O   . SER E 5 42  ? 31.218 74.342  -4.271  1.00 79.69  ? 42   SER L O   1 
ATOM 4938 C CB  . SER E 5 42  ? 29.243 73.129  -6.647  1.00 92.53  ? 42   SER L CB  1 
ATOM 4939 O OG  . SER E 5 42  ? 28.759 73.303  -7.966  1.00 100.43 ? 42   SER L OG  1 
ATOM 4940 N N   . PRO E 5 43  ? 29.087 74.094  -3.631  1.00 75.39  ? 43   PRO L N   1 
ATOM 4941 C CA  . PRO E 5 43  ? 29.481 73.864  -2.237  1.00 82.54  ? 43   PRO L CA  1 
ATOM 4942 C C   . PRO E 5 43  ? 30.221 72.548  -2.076  1.00 90.21  ? 43   PRO L C   1 
ATOM 4943 O O   . PRO E 5 43  ? 30.155 71.651  -2.921  1.00 102.38 ? 43   PRO L O   1 
ATOM 4944 C CB  . PRO E 5 43  ? 28.147 73.831  -1.480  1.00 73.02  ? 43   PRO L CB  1 
ATOM 4945 C CG  . PRO E 5 43  ? 27.163 74.455  -2.381  1.00 75.20  ? 43   PRO L CG  1 
ATOM 4946 C CD  . PRO E 5 43  ? 27.626 74.182  -3.777  1.00 76.48  ? 43   PRO L CD  1 
ATOM 4947 N N   . ARG E 5 44  ? 30.917 72.427  -0.955  1.00 80.27  ? 44   ARG L N   1 
ATOM 4948 C CA  . ARG E 5 44  ? 31.563 71.173  -0.617  1.00 95.79  ? 44   ARG L CA  1 
ATOM 4949 C C   . ARG E 5 44  ? 31.248 70.826  0.830   1.00 108.79 ? 44   ARG L C   1 
ATOM 4950 O O   . ARG E 5 44  ? 31.196 71.705  1.695   1.00 101.59 ? 44   ARG L O   1 
ATOM 4951 C CB  . ARG E 5 44  ? 33.080 71.235  -0.872  1.00 86.16  ? 44   ARG L CB  1 
ATOM 4952 C CG  . ARG E 5 44  ? 33.920 71.860  0.213   1.00 87.39  ? 44   ARG L CG  1 
ATOM 4953 C CD  . ARG E 5 44  ? 35.336 71.319  0.126   1.00 95.21  ? 44   ARG L CD  1 
ATOM 4954 N NE  . ARG E 5 44  ? 36.191 71.868  1.169   1.00 112.81 ? 44   ARG L NE  1 
ATOM 4955 C CZ  . ARG E 5 44  ? 37.443 71.483  1.398   1.00 123.24 ? 44   ARG L CZ  1 
ATOM 4956 N NH1 . ARG E 5 44  ? 37.999 70.532  0.658   1.00 122.41 ? 44   ARG L NH1 1 
ATOM 4957 N NH2 . ARG E 5 44  ? 38.137 72.049  2.375   1.00 126.72 ? 44   ARG L NH2 1 
ATOM 4958 N N   . LEU E 5 45  ? 30.994 69.546  1.078   1.00 112.12 ? 45   LEU L N   1 
ATOM 4959 C CA  . LEU E 5 45  ? 30.639 69.104  2.418   1.00 103.16 ? 45   LEU L CA  1 
ATOM 4960 C C   . LEU E 5 45  ? 31.867 69.159  3.316   1.00 101.05 ? 45   LEU L C   1 
ATOM 4961 O O   . LEU E 5 45  ? 32.872 68.493  3.046   1.00 105.40 ? 45   LEU L O   1 
ATOM 4962 C CB  . LEU E 5 45  ? 30.065 67.693  2.375   1.00 108.69 ? 45   LEU L CB  1 
ATOM 4963 C CG  . LEU E 5 45  ? 29.773 67.054  3.732   1.00 107.71 ? 45   LEU L CG  1 
ATOM 4964 C CD1 . LEU E 5 45  ? 28.676 67.822  4.456   1.00 109.72 ? 45   LEU L CD1 1 
ATOM 4965 C CD2 . LEU E 5 45  ? 29.401 65.587  3.573   1.00 106.69 ? 45   LEU L CD2 1 
ATOM 4966 N N   . LEU E 5 46  ? 31.790 69.967  4.375   1.00 97.35  ? 46   LEU L N   1 
ATOM 4967 C CA  . LEU E 5 46  ? 32.841 70.027  5.384   1.00 91.61  ? 46   LEU L CA  1 
ATOM 4968 C C   . LEU E 5 46  ? 32.589 69.055  6.533   1.00 82.78  ? 46   LEU L C   1 
ATOM 4969 O O   . LEU E 5 46  ? 33.453 68.232  6.851   1.00 76.98  ? 46   LEU L O   1 
ATOM 4970 C CB  . LEU E 5 46  ? 32.971 71.449  5.937   1.00 94.67  ? 46   LEU L CB  1 
ATOM 4971 C CG  . LEU E 5 46  ? 33.473 72.535  4.993   1.00 102.53 ? 46   LEU L CG  1 
ATOM 4972 C CD1 . LEU E 5 46  ? 33.629 73.828  5.760   1.00 109.98 ? 46   LEU L CD1 1 
ATOM 4973 C CD2 . LEU E 5 46  ? 34.791 72.128  4.359   1.00 101.86 ? 46   LEU L CD2 1 
ATOM 4974 N N   . ILE E 5 47  ? 31.414 69.139  7.161   1.00 85.41  ? 47   ILE L N   1 
ATOM 4975 C CA  . ILE E 5 47  ? 31.098 68.362  8.356   1.00 87.69  ? 47   ILE L CA  1 
ATOM 4976 C C   . ILE E 5 47  ? 29.746 67.685  8.171   1.00 94.55  ? 47   ILE L C   1 
ATOM 4977 O O   . ILE E 5 47  ? 28.771 68.335  7.777   1.00 92.22  ? 47   ILE L O   1 
ATOM 4978 C CB  . ILE E 5 47  ? 31.076 69.241  9.623   1.00 75.05  ? 47   ILE L CB  1 
ATOM 4979 C CG1 . ILE E 5 47  ? 32.464 69.812  9.931   1.00 80.30  ? 47   ILE L CG1 1 
ATOM 4980 C CG2 . ILE E 5 47  ? 30.556 68.450  10.812  1.00 77.11  ? 47   ILE L CG2 1 
ATOM 4981 C CD1 . ILE E 5 47  ? 33.526 68.760  10.163  1.00 78.44  ? 47   ILE L CD1 1 
ATOM 4982 N N   . TYR E 5 48  ? 29.680 66.387  8.475   1.00 104.45 ? 48   TYR L N   1 
ATOM 4983 C CA  . TYR E 5 48  ? 28.419 65.656  8.500   1.00 98.89  ? 48   TYR L CA  1 
ATOM 4984 C C   . TYR E 5 48  ? 28.187 65.045  9.877   1.00 99.17  ? 48   TYR L C   1 
ATOM 4985 O O   . TYR E 5 48  ? 29.134 64.699  10.589  1.00 96.85  ? 48   TYR L O   1 
ATOM 4986 C CB  . TYR E 5 48  ? 28.371 64.553  7.434   1.00 97.65  ? 48   TYR L CB  1 
ATOM 4987 C CG  . TYR E 5 48  ? 29.321 63.404  7.662   1.00 103.15 ? 48   TYR L CG  1 
ATOM 4988 C CD1 . TYR E 5 48  ? 30.643 63.492  7.259   1.00 112.07 ? 48   TYR L CD1 1 
ATOM 4989 C CD2 . TYR E 5 48  ? 28.894 62.222  8.259   1.00 99.54  ? 48   TYR L CD2 1 
ATOM 4990 C CE1 . TYR E 5 48  ? 31.519 62.446  7.451   1.00 121.25 ? 48   TYR L CE1 1 
ATOM 4991 C CE2 . TYR E 5 48  ? 29.765 61.170  8.458   1.00 99.49  ? 48   TYR L CE2 1 
ATOM 4992 C CZ  . TYR E 5 48  ? 31.077 61.291  8.050   1.00 116.50 ? 48   TYR L CZ  1 
ATOM 4993 O OH  . TYR E 5 48  ? 31.961 60.259  8.234   1.00 129.95 ? 48   TYR L OH  1 
ATOM 4994 N N   . ASP E 5 49  ? 26.906 64.923  10.239  1.00 103.65 ? 49   ASP L N   1 
ATOM 4995 C CA  . ASP E 5 49  ? 26.469 64.347  11.515  1.00 105.10 ? 49   ASP L CA  1 
ATOM 4996 C C   . ASP E 5 49  ? 27.054 65.088  12.712  1.00 107.18 ? 49   ASP L C   1 
ATOM 4997 O O   . ASP E 5 49  ? 27.387 64.480  13.733  1.00 118.34 ? 49   ASP L O   1 
ATOM 4998 C CB  . ASP E 5 49  ? 26.786 62.856  11.596  1.00 118.66 ? 49   ASP L CB  1 
ATOM 4999 C CG  . ASP E 5 49  ? 26.040 62.056  10.555  1.00 119.32 ? 49   ASP L CG  1 
ATOM 5000 O OD1 . ASP E 5 49  ? 24.900 62.436  10.207  1.00 113.60 ? 49   ASP L OD1 1 
ATOM 5001 O OD2 . ASP E 5 49  ? 26.602 61.053  10.076  1.00 118.69 ? 49   ASP L OD2 1 
ATOM 5002 N N   . THR E 5 50  ? 27.215 66.399  12.550  1.00 98.61  ? 50   THR L N   1 
ATOM 5003 C CA  . THR E 5 50  ? 27.420 67.392  13.602  1.00 97.04  ? 50   THR L CA  1 
ATOM 5004 C C   . THR E 5 50  ? 28.815 67.369  14.223  1.00 93.80  ? 50   THR L C   1 
ATOM 5005 O O   . THR E 5 50  ? 29.255 68.376  14.788  1.00 100.80 ? 50   THR L O   1 
ATOM 5006 C CB  . THR E 5 50  ? 26.361 67.185  14.698  1.00 100.55 ? 50   THR L CB  1 
ATOM 5007 O OG1 . THR E 5 50  ? 25.061 67.083  14.105  1.00 99.94  ? 50   THR L OG1 1 
ATOM 5008 C CG2 . THR E 5 50  ? 26.363 68.325  15.688  1.00 110.74 ? 50   THR L CG2 1 
ATOM 5009 N N   . SER E 5 51  ? 29.554 66.278  14.056  1.00 85.24  ? 51   SER L N   1 
ATOM 5010 C CA  . SER E 5 51  ? 30.927 66.260  14.545  1.00 96.73  ? 51   SER L CA  1 
ATOM 5011 C C   . SER E 5 51  ? 31.877 65.446  13.683  1.00 103.07 ? 51   SER L C   1 
ATOM 5012 O O   . SER E 5 51  ? 33.059 65.366  14.027  1.00 103.32 ? 51   SER L O   1 
ATOM 5013 C CB  . SER E 5 51  ? 30.967 65.746  15.998  1.00 92.74  ? 51   SER L CB  1 
ATOM 5014 O OG  . SER E 5 51  ? 30.413 64.448  16.111  1.00 108.25 ? 51   SER L OG  1 
ATOM 5015 N N   . ASN E 5 52  ? 31.424 64.857  12.582  1.00 108.29 ? 52   ASN L N   1 
ATOM 5016 C CA  . ASN E 5 52  ? 32.223 63.906  11.823  1.00 108.89 ? 52   ASN L CA  1 
ATOM 5017 C C   . ASN E 5 52  ? 32.852 64.619  10.632  1.00 99.27  ? 52   ASN L C   1 
ATOM 5018 O O   . ASN E 5 52  ? 32.140 65.159  9.777   1.00 95.55  ? 52   ASN L O   1 
ATOM 5019 C CB  . ASN E 5 52  ? 31.378 62.714  11.366  1.00 112.92 ? 52   ASN L CB  1 
ATOM 5020 C CG  . ASN E 5 52  ? 30.769 61.942  12.528  1.00 119.37 ? 52   ASN L CG  1 
ATOM 5021 O OD1 . ASN E 5 52  ? 31.305 61.931  13.638  1.00 125.56 ? 52   ASN L OD1 1 
ATOM 5022 N ND2 . ASN E 5 52  ? 29.646 61.283  12.270  1.00 127.32 ? 52   ASN L ND2 1 
ATOM 5023 N N   . LEU E 5 53  ? 34.182 64.610  10.583  1.00 92.40  ? 53   LEU L N   1 
ATOM 5024 C CA  . LEU E 5 53  ? 34.912 65.225  9.486   1.00 90.92  ? 53   LEU L CA  1 
ATOM 5025 C C   . LEU E 5 53  ? 34.658 64.460  8.192   1.00 94.03  ? 53   LEU L C   1 
ATOM 5026 O O   . LEU E 5 53  ? 34.865 63.244  8.127   1.00 99.46  ? 53   LEU L O   1 
ATOM 5027 C CB  . LEU E 5 53  ? 36.405 65.251  9.809   1.00 93.65  ? 53   LEU L CB  1 
ATOM 5028 C CG  . LEU E 5 53  ? 37.285 66.233  9.038   1.00 98.57  ? 53   LEU L CG  1 
ATOM 5029 C CD1 . LEU E 5 53  ? 36.834 67.669  9.285   1.00 91.27  ? 53   LEU L CD1 1 
ATOM 5030 C CD2 . LEU E 5 53  ? 38.754 66.046  9.410   1.00 93.56  ? 53   LEU L CD2 1 
ATOM 5031 N N   . ALA E 5 54  ? 34.211 65.177  7.163   1.00 97.38  ? 54   ALA L N   1 
ATOM 5032 C CA  . ALA E 5 54  ? 33.905 64.560  5.881   1.00 100.09 ? 54   ALA L CA  1 
ATOM 5033 C C   . ALA E 5 54  ? 35.182 64.153  5.153   1.00 112.49 ? 54   ALA L C   1 
ATOM 5034 O O   . ALA E 5 54  ? 36.257 64.725  5.364   1.00 107.43 ? 54   ALA L O   1 
ATOM 5035 C CB  . ALA E 5 54  ? 33.082 65.508  5.012   1.00 91.13  ? 54   ALA L CB  1 
ATOM 5036 N N   . SER E 5 55  ? 35.050 63.148  4.287   1.00 125.29 ? 55   SER L N   1 
ATOM 5037 C CA  . SER E 5 55  ? 36.205 62.593  3.590   1.00 127.63 ? 55   SER L CA  1 
ATOM 5038 C C   . SER E 5 55  ? 36.815 63.643  2.673   1.00 122.84 ? 55   SER L C   1 
ATOM 5039 O O   . SER E 5 55  ? 36.145 64.157  1.772   1.00 120.10 ? 55   SER L O   1 
ATOM 5040 C CB  . SER E 5 55  ? 35.804 61.351  2.792   1.00 131.43 ? 55   SER L CB  1 
ATOM 5041 O OG  . SER E 5 55  ? 35.281 60.338  3.634   1.00 135.91 ? 55   SER L OG  1 
ATOM 5042 N N   . GLY E 5 56  ? 38.080 63.971  2.915   1.00 123.35 ? 56   GLY L N   1 
ATOM 5043 C CA  . GLY E 5 56  ? 38.786 64.957  2.135   1.00 116.90 ? 56   GLY L CA  1 
ATOM 5044 C C   . GLY E 5 56  ? 38.940 66.313  2.794   1.00 110.61 ? 56   GLY L C   1 
ATOM 5045 O O   . GLY E 5 56  ? 39.737 67.126  2.309   1.00 111.16 ? 56   GLY L O   1 
ATOM 5046 N N   . VAL E 5 57  ? 38.212 66.576  3.882   1.00 111.50 ? 57   VAL L N   1 
ATOM 5047 C CA  . VAL E 5 57  ? 38.258 67.860  4.592   1.00 100.92 ? 57   VAL L CA  1 
ATOM 5048 C C   . VAL E 5 57  ? 39.501 67.887  5.475   1.00 103.19 ? 57   VAL L C   1 
ATOM 5049 O O   . VAL E 5 57  ? 39.793 66.902  6.165   1.00 113.24 ? 57   VAL L O   1 
ATOM 5050 C CB  . VAL E 5 57  ? 36.979 68.094  5.410   1.00 95.16  ? 57   VAL L CB  1 
ATOM 5051 C CG1 . VAL E 5 57  ? 37.027 69.432  6.137   1.00 95.49  ? 57   VAL L CG1 1 
ATOM 5052 C CG2 . VAL E 5 57  ? 35.756 68.013  4.521   1.00 91.56  ? 57   VAL L CG2 1 
ATOM 5053 N N   . PRO E 5 58  ? 40.255 68.985  5.482   1.00 98.22  ? 58   PRO L N   1 
ATOM 5054 C CA  . PRO E 5 58  ? 41.462 69.058  6.314   1.00 112.23 ? 58   PRO L CA  1 
ATOM 5055 C C   . PRO E 5 58  ? 41.134 68.943  7.795   1.00 113.66 ? 58   PRO L C   1 
ATOM 5056 O O   . PRO E 5 58  ? 39.998 69.142  8.233   1.00 110.30 ? 58   PRO L O   1 
ATOM 5057 C CB  . PRO E 5 58  ? 42.043 70.443  5.978   1.00 115.87 ? 58   PRO L CB  1 
ATOM 5058 C CG  . PRO E 5 58  ? 41.498 70.758  4.618   1.00 107.80 ? 58   PRO L CG  1 
ATOM 5059 C CD  . PRO E 5 58  ? 40.133 70.140  4.574   1.00 100.33 ? 58   PRO L CD  1 
ATOM 5060 N N   . VAL E 5 59  ? 42.163 68.603  8.573   1.00 128.69 ? 59   VAL L N   1 
ATOM 5061 C CA  . VAL E 5 59  ? 41.987 68.375  10.001  1.00 132.49 ? 59   VAL L CA  1 
ATOM 5062 C C   . VAL E 5 59  ? 41.649 69.658  10.746  1.00 139.47 ? 59   VAL L C   1 
ATOM 5063 O O   . VAL E 5 59  ? 41.150 69.602  11.877  1.00 139.00 ? 59   VAL L O   1 
ATOM 5064 C CB  . VAL E 5 59  ? 43.260 67.728  10.576  1.00 138.00 ? 59   VAL L CB  1 
ATOM 5065 C CG1 . VAL E 5 59  ? 42.988 67.134  11.948  1.00 144.47 ? 59   VAL L CG1 1 
ATOM 5066 C CG2 . VAL E 5 59  ? 43.792 66.676  9.614   1.00 140.50 ? 59   VAL L CG2 1 
ATOM 5067 N N   . ARG E 5 60  ? 41.912 70.819  10.141  1.00 133.56 ? 60   ARG L N   1 
ATOM 5068 C CA  . ARG E 5 60  ? 41.669 72.084  10.823  1.00 128.50 ? 60   ARG L CA  1 
ATOM 5069 C C   . ARG E 5 60  ? 40.189 72.292  11.114  1.00 120.71 ? 60   ARG L C   1 
ATOM 5070 O O   . ARG E 5 60  ? 39.835 72.931  12.112  1.00 127.27 ? 60   ARG L O   1 
ATOM 5071 C CB  . ARG E 5 60  ? 42.209 73.240  9.984   1.00 116.59 ? 60   ARG L CB  1 
ATOM 5072 C CG  . ARG E 5 60  ? 43.659 73.073  9.564   1.00 112.89 ? 60   ARG L CG  1 
ATOM 5073 C CD  . ARG E 5 60  ? 44.122 74.251  8.719   1.00 111.16 ? 60   ARG L CD  1 
ATOM 5074 N NE  . ARG E 5 60  ? 43.258 74.473  7.562   1.00 109.91 ? 60   ARG L NE  1 
ATOM 5075 C CZ  . ARG E 5 60  ? 43.486 73.987  6.345   1.00 105.76 ? 60   ARG L CZ  1 
ATOM 5076 N NH1 . ARG E 5 60  ? 44.557 73.239  6.107   1.00 117.78 ? 60   ARG L NH1 1 
ATOM 5077 N NH2 . ARG E 5 60  ? 42.640 74.252  5.361   1.00 90.81  ? 60   ARG L NH2 1 
ATOM 5078 N N   . PHE E 5 61  ? 39.319 71.763  10.261  1.00 118.60 ? 61   PHE L N   1 
ATOM 5079 C CA  . PHE E 5 61  ? 37.885 71.923  10.435  1.00 115.19 ? 61   PHE L CA  1 
ATOM 5080 C C   . PHE E 5 61  ? 37.364 70.957  11.487  1.00 117.75 ? 61   PHE L C   1 
ATOM 5081 O O   . PHE E 5 61  ? 37.833 69.820  11.595  1.00 137.37 ? 61   PHE L O   1 
ATOM 5082 C CB  . PHE E 5 61  ? 37.160 71.692  9.112   1.00 124.17 ? 61   PHE L CB  1 
ATOM 5083 C CG  . PHE E 5 61  ? 37.549 72.658  8.029   1.00 131.09 ? 61   PHE L CG  1 
ATOM 5084 C CD1 . PHE E 5 61  ? 38.652 72.416  7.226   1.00 135.99 ? 61   PHE L CD1 1 
ATOM 5085 C CD2 . PHE E 5 61  ? 36.807 73.806  7.812   1.00 132.48 ? 61   PHE L CD2 1 
ATOM 5086 C CE1 . PHE E 5 61  ? 39.008 73.303  6.230   1.00 135.95 ? 61   PHE L CE1 1 
ATOM 5087 C CE2 . PHE E 5 61  ? 37.157 74.695  6.817   1.00 130.64 ? 61   PHE L CE2 1 
ATOM 5088 C CZ  . PHE E 5 61  ? 38.259 74.444  6.024   1.00 131.38 ? 61   PHE L CZ  1 
ATOM 5089 N N   . SER E 5 62  ? 36.391 71.418  12.268  1.00 117.62 ? 62   SER L N   1 
ATOM 5090 C CA  . SER E 5 62  ? 35.814 70.592  13.320  1.00 132.45 ? 62   SER L CA  1 
ATOM 5091 C C   . SER E 5 62  ? 34.431 71.120  13.661  1.00 140.30 ? 62   SER L C   1 
ATOM 5092 O O   . SER E 5 62  ? 34.276 72.306  13.969  1.00 149.12 ? 62   SER L O   1 
ATOM 5093 C CB  . SER E 5 62  ? 36.707 70.577  14.566  1.00 125.91 ? 62   SER L CB  1 
ATOM 5094 O OG  . SER E 5 62  ? 36.835 71.873  15.122  1.00 115.12 ? 62   SER L OG  1 
ATOM 5095 N N   . GLY E 5 63  ? 33.436 70.243  13.603  1.00 139.01 ? 63   GLY L N   1 
ATOM 5096 C CA  . GLY E 5 63  ? 32.077 70.589  13.960  1.00 136.49 ? 63   GLY L CA  1 
ATOM 5097 C C   . GLY E 5 63  ? 31.766 70.150  15.377  1.00 140.12 ? 63   GLY L C   1 
ATOM 5098 O O   . GLY E 5 63  ? 32.342 69.195  15.889  1.00 150.94 ? 63   GLY L O   1 
ATOM 5099 N N   . SER E 5 64  ? 30.850 70.869  16.015  1.00 129.51 ? 64   SER L N   1 
ATOM 5100 C CA  . SER E 5 64  ? 30.440 70.540  17.370  1.00 128.85 ? 64   SER L CA  1 
ATOM 5101 C C   . SER E 5 64  ? 29.017 71.038  17.567  1.00 121.38 ? 64   SER L C   1 
ATOM 5102 O O   . SER E 5 64  ? 28.453 71.723  16.711  1.00 119.93 ? 64   SER L O   1 
ATOM 5103 C CB  . SER E 5 64  ? 31.398 71.147  18.403  1.00 137.88 ? 64   SER L CB  1 
ATOM 5104 O OG  . SER E 5 64  ? 30.996 70.831  19.725  1.00 150.50 ? 64   SER L OG  1 
ATOM 5105 N N   . GLY E 5 65  ? 28.433 70.677  18.699  1.00 136.57 ? 65   GLY L N   1 
ATOM 5106 C CA  . GLY E 5 65  ? 27.126 71.171  19.078  1.00 143.36 ? 65   GLY L CA  1 
ATOM 5107 C C   . GLY E 5 65  ? 26.150 70.050  19.391  1.00 145.79 ? 65   GLY L C   1 
ATOM 5108 O O   . GLY E 5 65  ? 26.405 68.869  19.163  1.00 133.39 ? 65   GLY L O   1 
ATOM 5109 N N   . SER E 5 66  ? 25.009 70.466  19.936  1.00 156.66 ? 66   SER L N   1 
ATOM 5110 C CA  . SER E 5 66  ? 23.902 69.571  20.245  1.00 162.51 ? 66   SER L CA  1 
ATOM 5111 C C   . SER E 5 66  ? 22.662 70.423  20.472  1.00 161.16 ? 66   SER L C   1 
ATOM 5112 O O   . SER E 5 66  ? 22.730 71.657  20.515  1.00 167.55 ? 66   SER L O   1 
ATOM 5113 C CB  . SER E 5 66  ? 24.203 68.702  21.469  1.00 180.27 ? 66   SER L CB  1 
ATOM 5114 O OG  . SER E 5 66  ? 24.244 69.489  22.647  1.00 186.91 ? 66   SER L OG  1 
ATOM 5115 N N   . GLY E 5 67  ? 21.523 69.750  20.602  1.00 149.48 ? 67   GLY L N   1 
ATOM 5116 C CA  . GLY E 5 67  ? 20.274 70.427  20.901  1.00 150.89 ? 67   GLY L CA  1 
ATOM 5117 C C   . GLY E 5 67  ? 19.895 71.491  19.892  1.00 130.45 ? 67   GLY L C   1 
ATOM 5118 O O   . GLY E 5 67  ? 19.498 71.182  18.765  1.00 131.14 ? 67   GLY L O   1 
ATOM 5119 N N   . THR E 5 68  ? 20.006 72.759  20.283  1.00 129.52 ? 68   THR L N   1 
ATOM 5120 C CA  . THR E 5 68  ? 19.683 73.860  19.385  1.00 136.31 ? 68   THR L CA  1 
ATOM 5121 C C   . THR E 5 68  ? 20.886 74.739  19.071  1.00 125.83 ? 68   THR L C   1 
ATOM 5122 O O   . THR E 5 68  ? 20.721 75.780  18.424  1.00 118.15 ? 68   THR L O   1 
ATOM 5123 C CB  . THR E 5 68  ? 18.557 74.718  19.967  1.00 128.24 ? 68   THR L CB  1 
ATOM 5124 O OG1 . THR E 5 68  ? 18.989 75.297  21.202  1.00 136.42 ? 68   THR L OG1 1 
ATOM 5125 C CG2 . THR E 5 68  ? 17.323 73.875  20.219  1.00 133.14 ? 68   THR L CG2 1 
ATOM 5126 N N   . SER E 5 69  ? 22.089 74.353  19.497  1.00 122.81 ? 69   SER L N   1 
ATOM 5127 C CA  . SER E 5 69  ? 23.276 75.176  19.297  1.00 126.24 ? 69   SER L CA  1 
ATOM 5128 C C   . SER E 5 69  ? 24.399 74.338  18.711  1.00 129.91 ? 69   SER L C   1 
ATOM 5129 O O   . SER E 5 69  ? 24.748 73.292  19.263  1.00 139.40 ? 69   SER L O   1 
ATOM 5130 C CB  . SER E 5 69  ? 23.723 75.816  20.610  1.00 136.28 ? 69   SER L CB  1 
ATOM 5131 O OG  . SER E 5 69  ? 22.711 76.670  21.110  1.00 152.96 ? 69   SER L OG  1 
ATOM 5132 N N   . TYR E 5 70  ? 24.963 74.802  17.599  1.00 131.55 ? 70   TYR L N   1 
ATOM 5133 C CA  . TYR E 5 70  ? 26.050 74.092  16.939  1.00 132.63 ? 70   TYR L CA  1 
ATOM 5134 C C   . TYR E 5 70  ? 27.104 75.091  16.488  1.00 125.95 ? 70   TYR L C   1 
ATOM 5135 O O   . TYR E 5 70  ? 26.853 76.294  16.416  1.00 126.06 ? 70   TYR L O   1 
ATOM 5136 C CB  . TYR E 5 70  ? 25.543 73.278  15.748  1.00 132.38 ? 70   TYR L CB  1 
ATOM 5137 C CG  . TYR E 5 70  ? 24.382 72.376  16.083  1.00 130.67 ? 70   TYR L CG  1 
ATOM 5138 C CD1 . TYR E 5 70  ? 23.077 72.834  15.985  1.00 135.02 ? 70   TYR L CD1 1 
ATOM 5139 C CD2 . TYR E 5 70  ? 24.589 71.073  16.502  1.00 126.37 ? 70   TYR L CD2 1 
ATOM 5140 C CE1 . TYR E 5 70  ? 22.013 72.017  16.287  1.00 137.24 ? 70   TYR L CE1 1 
ATOM 5141 C CE2 . TYR E 5 70  ? 23.531 70.245  16.805  1.00 135.33 ? 70   TYR L CE2 1 
ATOM 5142 C CZ  . TYR E 5 70  ? 22.243 70.725  16.697  1.00 140.21 ? 70   TYR L CZ  1 
ATOM 5143 O OH  . TYR E 5 70  ? 21.171 69.918  16.996  1.00 156.51 ? 70   TYR L OH  1 
ATOM 5144 N N   . SER E 5 71  ? 28.292 74.579  16.172  1.00 123.93 ? 71   SER L N   1 
ATOM 5145 C CA  . SER E 5 71  ? 29.412 75.451  15.853  1.00 113.99 ? 71   SER L CA  1 
ATOM 5146 C C   . SER E 5 71  ? 30.367 74.771  14.885  1.00 119.18 ? 71   SER L C   1 
ATOM 5147 O O   . SER E 5 71  ? 30.557 73.552  14.925  1.00 135.42 ? 71   SER L O   1 
ATOM 5148 C CB  . SER E 5 71  ? 30.175 75.848  17.115  1.00 110.68 ? 71   SER L CB  1 
ATOM 5149 O OG  . SER E 5 71  ? 30.797 74.712  17.677  1.00 114.57 ? 71   SER L OG  1 
ATOM 5150 N N   . LEU E 5 72  ? 30.983 75.588  14.030  1.00 114.83 ? 72   LEU L N   1 
ATOM 5151 C CA  . LEU E 5 72  ? 32.053 75.175  13.129  1.00 106.42 ? 72   LEU L CA  1 
ATOM 5152 C C   . LEU E 5 72  ? 33.326 75.923  13.495  1.00 106.14 ? 72   LEU L C   1 
ATOM 5153 O O   . LEU E 5 72  ? 33.303 77.149  13.661  1.00 103.06 ? 72   LEU L O   1 
ATOM 5154 C CB  . LEU E 5 72  ? 31.691 75.455  11.672  1.00 94.74  ? 72   LEU L CB  1 
ATOM 5155 C CG  . LEU E 5 72  ? 32.796 75.200  10.650  1.00 90.63  ? 72   LEU L CG  1 
ATOM 5156 C CD1 . LEU E 5 72  ? 33.240 73.751  10.694  1.00 112.12 ? 72   LEU L CD1 1 
ATOM 5157 C CD2 . LEU E 5 72  ? 32.287 75.557  9.280   1.00 84.91  ? 72   LEU L CD2 1 
ATOM 5158 N N   . THR E 5 73  ? 34.436 75.194  13.592  1.00 103.10 ? 73   THR L N   1 
ATOM 5159 C CA  . THR E 5 73  ? 35.682 75.751  14.093  1.00 109.14 ? 73   THR L CA  1 
ATOM 5160 C C   . THR E 5 73  ? 36.842 75.380  13.181  1.00 110.73 ? 73   THR L C   1 
ATOM 5161 O O   . THR E 5 73  ? 36.968 74.230  12.752  1.00 122.65 ? 73   THR L O   1 
ATOM 5162 C CB  . THR E 5 73  ? 35.959 75.262  15.522  1.00 102.82 ? 73   THR L CB  1 
ATOM 5163 O OG1 . THR E 5 73  ? 34.837 75.579  16.355  1.00 103.46 ? 73   THR L OG1 1 
ATOM 5164 C CG2 . THR E 5 73  ? 37.215 75.914  16.093  1.00 105.86 ? 73   THR L CG2 1 
ATOM 5165 N N   . ILE E 5 74  ? 37.686 76.368  12.896  1.00 106.14 ? 74   ILE L N   1 
ATOM 5166 C CA  . ILE E 5 74  ? 38.939 76.183  12.175  1.00 108.40 ? 74   ILE L CA  1 
ATOM 5167 C C   . ILE E 5 74  ? 40.075 76.498  13.134  1.00 121.66 ? 74   ILE L C   1 
ATOM 5168 O O   . ILE E 5 74  ? 40.153 77.612  13.669  1.00 138.36 ? 74   ILE L O   1 
ATOM 5169 C CB  . ILE E 5 74  ? 39.013 77.073  10.929  1.00 98.99  ? 74   ILE L CB  1 
ATOM 5170 C CG1 . ILE E 5 74  ? 37.909 76.693  9.950   1.00 96.55  ? 74   ILE L CG1 1 
ATOM 5171 C CG2 . ILE E 5 74  ? 40.370 76.936  10.265  1.00 100.82 ? 74   ILE L CG2 1 
ATOM 5172 C CD1 . ILE E 5 74  ? 37.844 77.590  8.757   1.00 93.46  ? 74   ILE L CD1 1 
ATOM 5173 N N   . SER E 5 75  ? 40.952 75.516  13.352  1.00 149.98 ? 75   SER L N   1 
ATOM 5174 C CA  . SER E 5 75  ? 42.051 75.694  14.294  1.00 147.71 ? 75   SER L CA  1 
ATOM 5175 C C   . SER E 5 75  ? 43.041 76.741  13.801  1.00 148.22 ? 75   SER L C   1 
ATOM 5176 O O   . SER E 5 75  ? 43.382 77.679  14.530  1.00 152.52 ? 75   SER L O   1 
ATOM 5177 C CB  . SER E 5 75  ? 42.757 74.360  14.531  1.00 151.61 ? 75   SER L CB  1 
ATOM 5178 O OG  . SER E 5 75  ? 43.256 73.827  13.319  1.00 151.68 ? 75   SER L OG  1 
ATOM 5179 N N   . ARG E 5 76  ? 43.522 76.593  12.571  1.00 146.52 ? 76   ARG L N   1 
ATOM 5180 C CA  . ARG E 5 76  ? 44.483 77.520  11.984  1.00 152.06 ? 76   ARG L CA  1 
ATOM 5181 C C   . ARG E 5 76  ? 43.888 78.054  10.687  1.00 153.21 ? 76   ARG L C   1 
ATOM 5182 O O   . ARG E 5 76  ? 43.699 77.298  9.729   1.00 161.26 ? 76   ARG L O   1 
ATOM 5183 C CB  . ARG E 5 76  ? 45.829 76.835  11.744  1.00 163.04 ? 76   ARG L CB  1 
ATOM 5184 C CG  . ARG E 5 76  ? 46.926 77.775  11.277  1.00 176.29 ? 76   ARG L CG  1 
ATOM 5185 C CD  . ARG E 5 76  ? 48.243 77.045  11.074  1.00 193.20 ? 76   ARG L CD  1 
ATOM 5186 N NE  . ARG E 5 76  ? 49.303 77.948  10.633  1.00 203.33 ? 76   ARG L NE  1 
ATOM 5187 C CZ  . ARG E 5 76  ? 49.538 78.262  9.362   1.00 212.17 ? 76   ARG L CZ  1 
ATOM 5188 N NH1 . ARG E 5 76  ? 48.787 77.747  8.396   1.00 212.31 ? 76   ARG L NH1 1 
ATOM 5189 N NH2 . ARG E 5 76  ? 50.525 79.093  9.055   1.00 218.09 ? 76   ARG L NH2 1 
ATOM 5190 N N   . MET E 5 77  ? 43.582 79.350  10.665  1.00 146.21 ? 77   MET L N   1 
ATOM 5191 C CA  . MET E 5 77  ? 43.021 79.976  9.474   1.00 137.41 ? 77   MET L CA  1 
ATOM 5192 C C   . MET E 5 77  ? 44.040 79.971  8.342   1.00 134.91 ? 77   MET L C   1 
ATOM 5193 O O   . MET E 5 77  ? 45.210 80.309  8.544   1.00 132.74 ? 77   MET L O   1 
ATOM 5194 C CB  . MET E 5 77  ? 42.588 81.408  9.787   1.00 139.73 ? 77   MET L CB  1 
ATOM 5195 C CG  . MET E 5 77  ? 42.168 82.230  8.572   1.00 137.72 ? 77   MET L CG  1 
ATOM 5196 S SD  . MET E 5 77  ? 40.497 81.840  8.028   1.00 133.60 ? 77   MET L SD  1 
ATOM 5197 C CE  . MET E 5 77  ? 40.273 82.988  6.675   1.00 127.20 ? 77   MET L CE  1 
ATOM 5198 N N   . GLU E 5 78  ? 43.595 79.584  7.148   1.00 142.35 ? 78   GLU L N   1 
ATOM 5199 C CA  . GLU E 5 78  ? 44.434 79.587  5.959   1.00 145.02 ? 78   GLU L CA  1 
ATOM 5200 C C   . GLU E 5 78  ? 43.701 80.282  4.819   1.00 135.33 ? 78   GLU L C   1 
ATOM 5201 O O   . GLU E 5 78  ? 42.490 80.505  4.872   1.00 131.44 ? 78   GLU L O   1 
ATOM 5202 C CB  . GLU E 5 78  ? 44.841 78.165  5.554   1.00 149.74 ? 78   GLU L CB  1 
ATOM 5203 C CG  . GLU E 5 78  ? 45.844 77.535  6.500   1.00 156.84 ? 78   GLU L CG  1 
ATOM 5204 C CD  . GLU E 5 78  ? 46.721 76.512  5.814   1.00 167.64 ? 78   GLU L CD  1 
ATOM 5205 O OE1 . GLU E 5 78  ? 46.404 76.130  4.667   1.00 167.14 ? 78   GLU L OE1 1 
ATOM 5206 O OE2 . GLU E 5 78  ? 47.732 76.096  6.418   1.00 176.32 ? 78   GLU L OE2 1 
ATOM 5207 N N   . ALA E 5 79  ? 44.458 80.617  3.770   1.00 128.36 ? 79   ALA L N   1 
ATOM 5208 C CA  . ALA E 5 79  ? 43.904 81.418  2.683   1.00 120.67 ? 79   ALA L CA  1 
ATOM 5209 C C   . ALA E 5 79  ? 42.784 80.684  1.958   1.00 131.14 ? 79   ALA L C   1 
ATOM 5210 O O   . ALA E 5 79  ? 41.759 81.287  1.618   1.00 130.38 ? 79   ALA L O   1 
ATOM 5211 C CB  . ALA E 5 79  ? 45.008 81.811  1.702   1.00 124.35 ? 79   ALA L CB  1 
ATOM 5212 N N   . GLU E 5 80  ? 42.954 79.383  1.713   1.00 130.10 ? 80   GLU L N   1 
ATOM 5213 C CA  . GLU E 5 80  ? 41.951 78.635  0.965   1.00 130.16 ? 80   GLU L CA  1 
ATOM 5214 C C   . GLU E 5 80  ? 40.620 78.549  1.699   1.00 125.18 ? 80   GLU L C   1 
ATOM 5215 O O   . GLU E 5 80  ? 39.603 78.227  1.075   1.00 127.49 ? 80   GLU L O   1 
ATOM 5216 C CB  . GLU E 5 80  ? 42.459 77.225  0.663   1.00 145.23 ? 80   GLU L CB  1 
ATOM 5217 C CG  . GLU E 5 80  ? 42.722 76.383  1.898   1.00 157.98 ? 80   GLU L CG  1 
ATOM 5218 C CD  . GLU E 5 80  ? 42.960 74.927  1.564   1.00 167.34 ? 80   GLU L CD  1 
ATOM 5219 O OE1 . GLU E 5 80  ? 42.810 74.559  0.381   1.00 168.07 ? 80   GLU L OE1 1 
ATOM 5220 O OE2 . GLU E 5 80  ? 43.294 74.150  2.484   1.00 174.33 ? 80   GLU L OE2 1 
ATOM 5221 N N   . ASP E 5 81  ? 40.606 78.824  3.003   1.00 124.89 ? 81   ASP L N   1 
ATOM 5222 C CA  . ASP E 5 81  ? 39.407 78.663  3.814   1.00 122.01 ? 81   ASP L CA  1 
ATOM 5223 C C   . ASP E 5 81  ? 38.430 79.822  3.673   1.00 114.76 ? 81   ASP L C   1 
ATOM 5224 O O   . ASP E 5 81  ? 37.281 79.694  4.107   1.00 103.18 ? 81   ASP L O   1 
ATOM 5225 C CB  . ASP E 5 81  ? 39.786 78.498  5.291   1.00 121.57 ? 81   ASP L CB  1 
ATOM 5226 C CG  . ASP E 5 81  ? 40.741 77.335  5.536   1.00 123.89 ? 81   ASP L CG  1 
ATOM 5227 O OD1 . ASP E 5 81  ? 40.681 76.322  4.803   1.00 124.39 ? 81   ASP L OD1 1 
ATOM 5228 O OD2 . ASP E 5 81  ? 41.549 77.434  6.483   1.00 126.25 ? 81   ASP L OD2 1 
ATOM 5229 N N   . ALA E 5 82  ? 38.860 80.943  3.098   1.00 113.59 ? 82   ALA L N   1 
ATOM 5230 C CA  . ALA E 5 82  ? 38.006 82.116  2.957   1.00 103.35 ? 82   ALA L CA  1 
ATOM 5231 C C   . ALA E 5 82  ? 36.901 81.820  1.953   1.00 98.85  ? 82   ALA L C   1 
ATOM 5232 O O   . ALA E 5 82  ? 37.159 81.680  0.753   1.00 100.16 ? 82   ALA L O   1 
ATOM 5233 C CB  . ALA E 5 82  ? 38.835 83.322  2.526   1.00 102.61 ? 82   ALA L CB  1 
ATOM 5234 N N   . ALA E 5 83  ? 35.678 81.710  2.447   1.00 96.03  ? 83   ALA L N   1 
ATOM 5235 C CA  . ALA E 5 83  ? 34.501 81.396  1.642   1.00 107.70 ? 83   ALA L CA  1 
ATOM 5236 C C   . ALA E 5 83  ? 33.279 81.650  2.515   1.00 91.55  ? 83   ALA L C   1 
ATOM 5237 O O   . ALA E 5 83  ? 33.389 82.223  3.605   1.00 91.23  ? 83   ALA L O   1 
ATOM 5238 C CB  . ALA E 5 83  ? 34.545 79.960  1.119   1.00 112.18 ? 83   ALA L CB  1 
ATOM 5239 N N   . THR E 5 84  ? 32.113 81.228  2.037   1.00 98.67  ? 84   THR L N   1 
ATOM 5240 C CA  . THR E 5 84  ? 30.870 81.355  2.787   1.00 94.04  ? 84   THR L CA  1 
ATOM 5241 C C   . THR E 5 84  ? 30.476 79.984  3.324   1.00 99.85  ? 84   THR L C   1 
ATOM 5242 O O   . THR E 5 84  ? 30.524 78.993  2.592   1.00 109.94 ? 84   THR L O   1 
ATOM 5243 C CB  . THR E 5 84  ? 29.764 81.933  1.903   1.00 95.44  ? 84   THR L CB  1 
ATOM 5244 O OG1 . THR E 5 84  ? 30.216 83.162  1.319   1.00 99.36  ? 84   THR L OG1 1 
ATOM 5245 C CG2 . THR E 5 84  ? 28.515 82.199  2.716   1.00 92.19  ? 84   THR L CG2 1 
ATOM 5246 N N   . PHE E 5 85  ? 30.105 79.924  4.602   1.00 96.68  ? 85   PHE L N   1 
ATOM 5247 C CA  . PHE E 5 85  ? 29.862 78.662  5.292   1.00 87.40  ? 85   PHE L CA  1 
ATOM 5248 C C   . PHE E 5 85  ? 28.396 78.538  5.682   1.00 85.66  ? 85   PHE L C   1 
ATOM 5249 O O   . PHE E 5 85  ? 27.837 79.445  6.304   1.00 98.42  ? 85   PHE L O   1 
ATOM 5250 C CB  . PHE E 5 85  ? 30.751 78.548  6.528   1.00 88.97  ? 85   PHE L CB  1 
ATOM 5251 C CG  . PHE E 5 85  ? 32.214 78.511  6.211   1.00 91.50  ? 85   PHE L CG  1 
ATOM 5252 C CD1 . PHE E 5 85  ? 32.933 79.681  6.059   1.00 91.77  ? 85   PHE L CD1 1 
ATOM 5253 C CD2 . PHE E 5 85  ? 32.867 77.300  6.047   1.00 94.25  ? 85   PHE L CD2 1 
ATOM 5254 C CE1 . PHE E 5 85  ? 34.275 79.647  5.756   1.00 94.47  ? 85   PHE L CE1 1 
ATOM 5255 C CE2 . PHE E 5 85  ? 34.207 77.258  5.746   1.00 97.30  ? 85   PHE L CE2 1 
ATOM 5256 C CZ  . PHE E 5 85  ? 34.914 78.435  5.600   1.00 97.27  ? 85   PHE L CZ  1 
ATOM 5257 N N   . TYR E 5 86  ? 27.783 77.411  5.323   1.00 85.88  ? 86   TYR L N   1 
ATOM 5258 C CA  . TYR E 5 86  ? 26.366 77.172  5.558   1.00 89.62  ? 86   TYR L CA  1 
ATOM 5259 C C   . TYR E 5 86  ? 26.172 75.972  6.473   1.00 85.60  ? 86   TYR L C   1 
ATOM 5260 O O   . TYR E 5 86  ? 26.942 75.011  6.437   1.00 90.18  ? 86   TYR L O   1 
ATOM 5261 C CB  . TYR E 5 86  ? 25.605 76.921  4.248   1.00 97.59  ? 86   TYR L CB  1 
ATOM 5262 C CG  . TYR E 5 86  ? 25.598 78.078  3.273   1.00 107.09 ? 86   TYR L CG  1 
ATOM 5263 C CD1 . TYR E 5 86  ? 26.609 78.217  2.333   1.00 111.69 ? 86   TYR L CD1 1 
ATOM 5264 C CD2 . TYR E 5 86  ? 24.567 79.012  3.273   1.00 103.23 ? 86   TYR L CD2 1 
ATOM 5265 C CE1 . TYR E 5 86  ? 26.606 79.261  1.434   1.00 106.32 ? 86   TYR L CE1 1 
ATOM 5266 C CE2 . TYR E 5 86  ? 24.556 80.059  2.373   1.00 102.74 ? 86   TYR L CE2 1 
ATOM 5267 C CZ  . TYR E 5 86  ? 25.580 80.177  1.456   1.00 102.45 ? 86   TYR L CZ  1 
ATOM 5268 O OH  . TYR E 5 86  ? 25.583 81.212  0.554   1.00 106.86 ? 86   TYR L OH  1 
ATOM 5269 N N   . CYS E 5 87  ? 25.132 76.033  7.294   1.00 97.01  ? 87   CYS L N   1 
ATOM 5270 C CA  . CYS E 5 87  ? 24.727 74.908  8.120   1.00 103.53 ? 87   CYS L CA  1 
ATOM 5271 C C   . CYS E 5 87  ? 23.343 74.457  7.676   1.00 110.50 ? 87   CYS L C   1 
ATOM 5272 O O   . CYS E 5 87  ? 22.498 75.280  7.310   1.00 119.04 ? 87   CYS L O   1 
ATOM 5273 C CB  . CYS E 5 87  ? 24.743 75.268  9.617   1.00 99.25  ? 87   CYS L CB  1 
ATOM 5274 S SG  . CYS E 5 87  ? 23.697 76.665  10.092  1.00 105.63 ? 87   CYS L SG  1 
ATOM 5275 N N   . GLN E 5 88  ? 23.137 73.144  7.670   1.00 100.84 ? 88   GLN L N   1 
ATOM 5276 C CA  . GLN E 5 88  ? 21.883 72.527  7.271   1.00 93.18  ? 88   GLN L CA  1 
ATOM 5277 C C   . GLN E 5 88  ? 21.482 71.548  8.359   1.00 96.65  ? 88   GLN L C   1 
ATOM 5278 O O   . GLN E 5 88  ? 22.311 70.758  8.819   1.00 105.66 ? 88   GLN L O   1 
ATOM 5279 C CB  . GLN E 5 88  ? 22.025 71.811  5.922   1.00 97.46  ? 88   GLN L CB  1 
ATOM 5280 C CG  . GLN E 5 88  ? 20.859 70.905  5.564   1.00 108.75 ? 88   GLN L CG  1 
ATOM 5281 C CD  . GLN E 5 88  ? 21.309 69.656  4.831   1.00 115.56 ? 88   GLN L CD  1 
ATOM 5282 O OE1 . GLN E 5 88  ? 22.411 69.610  4.285   1.00 116.52 ? 88   GLN L OE1 1 
ATOM 5283 N NE2 . GLN E 5 88  ? 20.464 68.630  4.828   1.00 120.65 ? 88   GLN L NE2 1 
ATOM 5284 N N   . GLN E 5 89  ? 20.224 71.601  8.773   1.00 102.49 ? 89   GLN L N   1 
ATOM 5285 C CA  . GLN E 5 89  ? 19.734 70.738  9.835   1.00 98.17  ? 89   GLN L CA  1 
ATOM 5286 C C   . GLN E 5 89  ? 18.953 69.569  9.255   1.00 93.37  ? 89   GLN L C   1 
ATOM 5287 O O   . GLN E 5 89  ? 18.368 69.658  8.174   1.00 93.83  ? 89   GLN L O   1 
ATOM 5288 C CB  . GLN E 5 89  ? 18.842 71.514  10.806  1.00 108.25 ? 89   GLN L CB  1 
ATOM 5289 C CG  . GLN E 5 89  ? 17.515 71.967  10.205  1.00 112.81 ? 89   GLN L CG  1 
ATOM 5290 C CD  . GLN E 5 89  ? 16.389 70.967  10.406  1.00 111.77 ? 89   GLN L CD  1 
ATOM 5291 O OE1 . GLN E 5 89  ? 16.350 70.253  11.409  1.00 123.37 ? 89   GLN L OE1 1 
ATOM 5292 N NE2 . GLN E 5 89  ? 15.466 70.913  9.451   1.00 103.89 ? 89   GLN L NE2 1 
ATOM 5293 N N   . TRP E 5 90  ? 18.954 68.466  9.992   1.00 102.17 ? 90   TRP L N   1 
ATOM 5294 C CA  . TRP E 5 90  ? 18.018 67.379  9.755   1.00 102.57 ? 90   TRP L CA  1 
ATOM 5295 C C   . TRP E 5 90  ? 17.469 66.935  11.097  1.00 106.52 ? 90   TRP L C   1 
ATOM 5296 O O   . TRP E 5 90  ? 18.234 66.559  11.989  1.00 105.26 ? 90   TRP L O   1 
ATOM 5297 C CB  . TRP E 5 90  ? 18.665 66.200  9.026   1.00 105.78 ? 90   TRP L CB  1 
ATOM 5298 C CG  . TRP E 5 90  ? 17.715 65.044  8.844   1.00 117.87 ? 90   TRP L CG  1 
ATOM 5299 C CD1 . TRP E 5 90  ? 16.823 64.860  7.825   1.00 126.91 ? 90   TRP L CD1 1 
ATOM 5300 C CD2 . TRP E 5 90  ? 17.556 63.925  9.721   1.00 122.70 ? 90   TRP L CD2 1 
ATOM 5301 N NE1 . TRP E 5 90  ? 16.123 63.687  8.012   1.00 115.21 ? 90   TRP L NE1 1 
ATOM 5302 C CE2 . TRP E 5 90  ? 16.555 63.097  9.170   1.00 108.81 ? 90   TRP L CE2 1 
ATOM 5303 C CE3 . TRP E 5 90  ? 18.166 63.540  10.918  1.00 121.23 ? 90   TRP L CE3 1 
ATOM 5304 C CZ2 . TRP E 5 90  ? 16.155 61.912  9.777   1.00 127.83 ? 90   TRP L CZ2 1 
ATOM 5305 C CZ3 . TRP E 5 90  ? 17.767 62.367  11.517  1.00 127.56 ? 90   TRP L CZ3 1 
ATOM 5306 C CH2 . TRP E 5 90  ? 16.772 61.564  10.948  1.00 133.51 ? 90   TRP L CH2 1 
ATOM 5307 N N   . SER E 5 91  ? 16.172 67.044  11.249  1.00 91.38  ? 91   SER L N   1 
ATOM 5308 C CA  . SER E 5 91  ? 15.387 66.351  12.262  1.00 113.03 ? 91   SER L CA  1 
ATOM 5309 C C   . SER E 5 91  ? 14.224 65.602  11.638  1.00 113.90 ? 91   SER L C   1 
ATOM 5310 O O   . SER E 5 91  ? 13.882 64.506  12.090  1.00 114.49 ? 91   SER L O   1 
ATOM 5311 C CB  . SER E 5 91  ? 14.865 67.338  13.301  1.00 116.05 ? 91   SER L CB  1 
ATOM 5312 O OG  . SER E 5 91  ? 14.043 68.300  12.670  1.00 116.50 ? 91   SER L OG  1 
ATOM 5313 N N   . SER E 5 92  ? 13.613 66.172  10.605  1.00 116.15 ? 92   SER L N   1 
ATOM 5314 C CA  . SER E 5 92  ? 12.591 65.540  9.787   1.00 125.75 ? 92   SER L CA  1 
ATOM 5315 C C   . SER E 5 92  ? 12.446 66.382  8.532   1.00 121.37 ? 92   SER L C   1 
ATOM 5316 O O   . SER E 5 92  ? 12.604 67.603  8.588   1.00 129.14 ? 92   SER L O   1 
ATOM 5317 C CB  . SER E 5 92  ? 11.252 65.434  10.530  1.00 134.93 ? 92   SER L CB  1 
ATOM 5318 O OG  . SER E 5 92  ? 10.841 66.698  11.019  1.00 144.21 ? 92   SER L OG  1 
ATOM 5319 N N   . TYR E 5 93  ? 12.183 65.730  7.404   1.00 107.92 ? 93   TYR L N   1 
ATOM 5320 C CA  . TYR E 5 93  ? 12.004 66.476  6.173   1.00 105.09 ? 93   TYR L CA  1 
ATOM 5321 C C   . TYR E 5 93  ? 10.793 67.399  6.304   1.00 115.85 ? 93   TYR L C   1 
ATOM 5322 O O   . TYR E 5 93  ? 9.821  67.066  6.989   1.00 120.02 ? 93   TYR L O   1 
ATOM 5323 C CB  . TYR E 5 93  ? 11.830 65.529  4.991   1.00 103.46 ? 93   TYR L CB  1 
ATOM 5324 C CG  . TYR E 5 93  ? 13.126 64.929  4.494   1.00 101.21 ? 93   TYR L CG  1 
ATOM 5325 C CD1 . TYR E 5 93  ? 13.683 63.821  5.117   1.00 98.59  ? 93   TYR L CD1 1 
ATOM 5326 C CD2 . TYR E 5 93  ? 13.792 65.471  3.402   1.00 100.70 ? 93   TYR L CD2 1 
ATOM 5327 C CE1 . TYR E 5 93  ? 14.865 63.268  4.666   1.00 100.29 ? 93   TYR L CE1 1 
ATOM 5328 C CE2 . TYR E 5 93  ? 14.975 64.925  2.945   1.00 100.65 ? 93   TYR L CE2 1 
ATOM 5329 C CZ  . TYR E 5 93  ? 15.508 63.822  3.581   1.00 101.16 ? 93   TYR L CZ  1 
ATOM 5330 O OH  . TYR E 5 93  ? 16.685 63.268  3.133   1.00 100.11 ? 93   TYR L OH  1 
ATOM 5331 N N   . PRO E 5 94  ? 10.819 68.577  5.653   1.00 114.28 ? 94   PRO L N   1 
ATOM 5332 C CA  . PRO E 5 94  ? 11.833 69.081  4.718   1.00 105.35 ? 94   PRO L CA  1 
ATOM 5333 C C   . PRO E 5 94  ? 13.123 69.558  5.373   1.00 99.61  ? 94   PRO L C   1 
ATOM 5334 O O   . PRO E 5 94  ? 13.129 69.937  6.544   1.00 110.93 ? 94   PRO L O   1 
ATOM 5335 C CB  . PRO E 5 94  ? 11.124 70.258  4.053   1.00 110.44 ? 94   PRO L CB  1 
ATOM 5336 C CG  . PRO E 5 94  ? 10.232 70.777  5.114   1.00 108.97 ? 94   PRO L CG  1 
ATOM 5337 C CD  . PRO E 5 94  ? 9.727  69.551  5.831   1.00 111.41 ? 94   PRO L CD  1 
ATOM 5338 N N   . LEU E 5 95  ? 14.206 69.544  4.601   1.00 84.90  ? 95   LEU L N   1 
ATOM 5339 C CA  . LEU E 5 95  ? 15.490 70.023  5.084   1.00 81.79  ? 95   LEU L CA  1 
ATOM 5340 C C   . LEU E 5 95  ? 15.557 71.536  4.959   1.00 97.08  ? 95   LEU L C   1 
ATOM 5341 O O   . LEU E 5 95  ? 14.998 72.125  4.030   1.00 114.49 ? 95   LEU L O   1 
ATOM 5342 C CB  . LEU E 5 95  ? 16.631 69.382  4.295   1.00 86.10  ? 95   LEU L CB  1 
ATOM 5343 C CG  . LEU E 5 95  ? 16.814 67.868  4.420   1.00 84.40  ? 95   LEU L CG  1 
ATOM 5344 C CD1 . LEU E 5 95  ? 17.719 67.339  3.315   1.00 69.99  ? 95   LEU L CD1 1 
ATOM 5345 C CD2 . LEU E 5 95  ? 17.379 67.523  5.785   1.00 85.81  ? 95   LEU L CD2 1 
ATOM 5346 N N   . THR E 5 96  ? 16.233 72.171  5.909   1.00 91.06  ? 96   THR L N   1 
ATOM 5347 C CA  . THR E 5 96  ? 16.392 73.614  5.889   1.00 91.24  ? 96   THR L CA  1 
ATOM 5348 C C   . THR E 5 96  ? 17.860 73.976  6.050   1.00 97.46  ? 96   THR L C   1 
ATOM 5349 O O   . THR E 5 96  ? 18.612 73.302  6.761   1.00 79.58  ? 96   THR L O   1 
ATOM 5350 C CB  . THR E 5 96  ? 15.581 74.295  6.991   1.00 95.10  ? 96   THR L CB  1 
ATOM 5351 O OG1 . THR E 5 96  ? 16.165 73.988  8.262   1.00 95.58  ? 96   THR L OG1 1 
ATOM 5352 C CG2 . THR E 5 96  ? 14.130 73.821  6.965   1.00 93.06  ? 96   THR L CG2 1 
ATOM 5353 N N   . PHE E 5 97  ? 18.250 75.060  5.384   1.00 110.39 ? 97   PHE L N   1 
ATOM 5354 C CA  . PHE E 5 97  ? 19.607 75.587  5.411   1.00 101.08 ? 97   PHE L CA  1 
ATOM 5355 C C   . PHE E 5 97  ? 19.705 76.816  6.313   1.00 102.63 ? 97   PHE L C   1 
ATOM 5356 O O   . PHE E 5 97  ? 18.704 77.389  6.759   1.00 100.21 ? 97   PHE L O   1 
ATOM 5357 C CB  . PHE E 5 97  ? 20.072 75.952  4.000   1.00 87.30  ? 97   PHE L CB  1 
ATOM 5358 C CG  . PHE E 5 97  ? 20.667 74.814  3.245   1.00 79.73  ? 97   PHE L CG  1 
ATOM 5359 C CD1 . PHE E 5 97  ? 19.866 73.976  2.488   1.00 82.10  ? 97   PHE L CD1 1 
ATOM 5360 C CD2 . PHE E 5 97  ? 22.031 74.581  3.286   1.00 78.86  ? 97   PHE L CD2 1 
ATOM 5361 C CE1 . PHE E 5 97  ? 20.419 72.921  1.786   1.00 85.59  ? 97   PHE L CE1 1 
ATOM 5362 C CE2 . PHE E 5 97  ? 22.589 73.529  2.584   1.00 83.92  ? 97   PHE L CE2 1 
ATOM 5363 C CZ  . PHE E 5 97  ? 21.782 72.699  1.834   1.00 84.83  ? 97   PHE L CZ  1 
ATOM 5364 N N   . GLY E 5 98  ? 20.948 77.240  6.549   1.00 97.20  ? 98   GLY L N   1 
ATOM 5365 C CA  . GLY E 5 98  ? 21.218 78.454  7.283   1.00 91.22  ? 98   GLY L CA  1 
ATOM 5366 C C   . GLY E 5 98  ? 21.423 79.650  6.355   1.00 97.61  ? 98   GLY L C   1 
ATOM 5367 O O   . GLY E 5 98  ? 21.535 79.523  5.135   1.00 105.33 ? 98   GLY L O   1 
ATOM 5368 N N   . ALA E 5 99  ? 21.479 80.834  6.971   1.00 109.40 ? 99   ALA L N   1 
ATOM 5369 C CA  . ALA E 5 99  ? 21.605 82.078  6.215   1.00 104.83 ? 99   ALA L CA  1 
ATOM 5370 C C   . ALA E 5 99  ? 22.992 82.236  5.609   1.00 103.92 ? 99   ALA L C   1 
ATOM 5371 O O   . ALA E 5 99  ? 23.148 82.930  4.596   1.00 102.85 ? 99   ALA L O   1 
ATOM 5372 C CB  . ALA E 5 99  ? 21.279 83.271  7.110   1.00 121.21 ? 99   ALA L CB  1 
ATOM 5373 N N   . GLY E 5 100 ? 24.000 81.619  6.208   1.00 111.58 ? 100  GLY L N   1 
ATOM 5374 C CA  . GLY E 5 100 ? 25.364 81.672  5.720   1.00 94.75  ? 100  GLY L CA  1 
ATOM 5375 C C   . GLY E 5 100 ? 26.244 82.589  6.551   1.00 98.33  ? 100  GLY L C   1 
ATOM 5376 O O   . GLY E 5 100 ? 25.774 83.519  7.216   1.00 101.44 ? 100  GLY L O   1 
ATOM 5377 N N   . THR E 5 101 ? 27.549 82.319  6.519   1.00 98.47  ? 101  THR L N   1 
ATOM 5378 C CA  . THR E 5 101 ? 28.541 83.149  7.194   1.00 102.21 ? 101  THR L CA  1 
ATOM 5379 C C   . THR E 5 101 ? 29.705 83.398  6.249   1.00 105.08 ? 101  THR L C   1 
ATOM 5380 O O   . THR E 5 101 ? 30.331 82.450  5.765   1.00 103.10 ? 101  THR L O   1 
ATOM 5381 C CB  . THR E 5 101 ? 29.034 82.512  8.496   1.00 100.25 ? 101  THR L CB  1 
ATOM 5382 O OG1 . THR E 5 101 ? 28.008 82.591  9.492   1.00 99.45  ? 101  THR L OG1 1 
ATOM 5383 C CG2 . THR E 5 101 ? 30.282 83.232  9.007   1.00 104.36 ? 101  THR L CG2 1 
ATOM 5384 N N   . LYS E 5 102 ? 29.987 84.675  5.995   1.00 90.45  ? 102  LYS L N   1 
ATOM 5385 C CA  . LYS E 5 102 ? 31.061 85.092  5.101   1.00 88.05  ? 102  LYS L CA  1 
ATOM 5386 C C   . LYS E 5 102 ? 32.342 85.212  5.912   1.00 87.62  ? 102  LYS L C   1 
ATOM 5387 O O   . LYS E 5 102 ? 32.459 86.084  6.777   1.00 114.93 ? 102  LYS L O   1 
ATOM 5388 C CB  . LYS E 5 102 ? 30.714 86.416  4.427   1.00 87.23  ? 102  LYS L CB  1 
ATOM 5389 C CG  . LYS E 5 102 ? 31.794 86.970  3.508   1.00 85.40  ? 102  LYS L CG  1 
ATOM 5390 C CD  . LYS E 5 102 ? 31.647 86.457  2.083   1.00 90.46  ? 102  LYS L CD  1 
ATOM 5391 C CE  . LYS E 5 102 ? 32.565 87.204  1.127   1.00 92.76  ? 102  LYS L CE  1 
ATOM 5392 N NZ  . LYS E 5 102 ? 34.002 87.074  1.500   1.00 90.91  ? 102  LYS L NZ  1 
ATOM 5393 N N   . LEU E 5 103 ? 33.298 84.338  5.642   1.00 94.05  ? 103  LEU L N   1 
ATOM 5394 C CA  . LEU E 5 103 ? 34.598 84.384  6.294   1.00 99.90  ? 103  LEU L CA  1 
ATOM 5395 C C   . LEU E 5 103 ? 35.567 85.072  5.343   1.00 99.79  ? 103  LEU L C   1 
ATOM 5396 O O   . LEU E 5 103 ? 35.941 84.506  4.310   1.00 102.87 ? 103  LEU L O   1 
ATOM 5397 C CB  . LEU E 5 103 ? 35.071 82.984  6.667   1.00 100.57 ? 103  LEU L CB  1 
ATOM 5398 C CG  . LEU E 5 103 ? 36.471 82.924  7.270   1.00 101.30 ? 103  LEU L CG  1 
ATOM 5399 C CD1 . LEU E 5 103 ? 36.488 83.626  8.611   1.00 111.18 ? 103  LEU L CD1 1 
ATOM 5400 C CD2 . LEU E 5 103 ? 36.912 81.489  7.415   1.00 104.12 ? 103  LEU L CD2 1 
ATOM 5401 N N   . GLU E 5 104 ? 35.946 86.300  5.679   1.00 94.61  ? 104  GLU L N   1 
ATOM 5402 C CA  . GLU E 5 104 ? 36.853 87.097  4.868   1.00 101.35 ? 104  GLU L CA  1 
ATOM 5403 C C   . GLU E 5 104 ? 38.258 87.025  5.443   1.00 90.05  ? 104  GLU L C   1 
ATOM 5404 O O   . GLU E 5 104 ? 38.442 87.033  6.662   1.00 94.17  ? 104  GLU L O   1 
ATOM 5405 C CB  . GLU E 5 104 ? 36.395 88.557  4.799   1.00 122.38 ? 104  GLU L CB  1 
ATOM 5406 C CG  . GLU E 5 104 ? 35.011 88.754  4.197   1.00 135.02 ? 104  GLU L CG  1 
ATOM 5407 C CD  . GLU E 5 104 ? 34.564 90.207  4.196   1.00 136.95 ? 104  GLU L CD  1 
ATOM 5408 O OE1 . GLU E 5 104 ? 35.400 91.102  4.455   1.00 136.68 ? 104  GLU L OE1 1 
ATOM 5409 O OE2 . GLU E 5 104 ? 33.369 90.453  3.935   1.00 136.24 ? 104  GLU L OE2 1 
ATOM 5410 N N   . LEU E 5 105 ? 39.246 86.956  4.560   1.00 90.18  ? 105  LEU L N   1 
ATOM 5411 C CA  . LEU E 5 105 ? 40.641 86.913  4.977   1.00 104.59 ? 105  LEU L CA  1 
ATOM 5412 C C   . LEU E 5 105 ? 41.120 88.330  5.272   1.00 118.77 ? 105  LEU L C   1 
ATOM 5413 O O   . LEU E 5 105 ? 41.144 89.180  4.376   1.00 117.61 ? 105  LEU L O   1 
ATOM 5414 C CB  . LEU E 5 105 ? 41.493 86.256  3.891   1.00 103.83 ? 105  LEU L CB  1 
ATOM 5415 C CG  . LEU E 5 105 ? 42.965 85.986  4.212   1.00 108.04 ? 105  LEU L CG  1 
ATOM 5416 C CD1 . LEU E 5 105 ? 43.098 85.078  5.421   1.00 118.06 ? 105  LEU L CD1 1 
ATOM 5417 C CD2 . LEU E 5 105 ? 43.674 85.378  3.016   1.00 102.54 ? 105  LEU L CD2 1 
ATOM 5418 N N   . LYS E 5 106 ? 41.488 88.594  6.524   1.00 140.71 ? 106  LYS L N   1 
ATOM 5419 C CA  . LYS E 5 106 ? 41.926 89.933  6.895   1.00 140.96 ? 106  LYS L CA  1 
ATOM 5420 C C   . LYS E 5 106 ? 43.295 90.222  6.287   1.00 130.02 ? 106  LYS L C   1 
ATOM 5421 O O   . LYS E 5 106 ? 44.241 89.448  6.458   1.00 134.09 ? 106  LYS L O   1 
ATOM 5422 C CB  . LYS E 5 106 ? 41.968 90.085  8.416   1.00 150.21 ? 106  LYS L CB  1 
ATOM 5423 C CG  . LYS E 5 106 ? 42.266 91.509  8.877   1.00 164.35 ? 106  LYS L CG  1 
ATOM 5424 C CD  . LYS E 5 106 ? 42.220 91.642  10.392  1.00 174.50 ? 106  LYS L CD  1 
ATOM 5425 C CE  . LYS E 5 106 ? 42.507 93.076  10.822  1.00 178.09 ? 106  LYS L CE  1 
ATOM 5426 N NZ  . LYS E 5 106 ? 42.444 93.258  12.300  1.00 180.06 ? 106  LYS L NZ  1 
ATOM 5427 N N   . ARG E 5 107 ? 43.394 91.340  5.574   1.00 116.33 ? 107  ARG L N   1 
ATOM 5428 C CA  . ARG E 5 107 ? 44.593 91.733  4.854   1.00 99.31  ? 107  ARG L CA  1 
ATOM 5429 C C   . ARG E 5 107 ? 45.103 93.057  5.411   1.00 94.54  ? 107  ARG L C   1 
ATOM 5430 O O   . ARG E 5 107 ? 44.389 93.770  6.123   1.00 97.12  ? 107  ARG L O   1 
ATOM 5431 C CB  . ARG E 5 107 ? 44.297 91.860  3.347   1.00 101.05 ? 107  ARG L CB  1 
ATOM 5432 C CG  . ARG E 5 107 ? 45.507 92.061  2.450   1.00 93.59  ? 107  ARG L CG  1 
ATOM 5433 C CD  . ARG E 5 107 ? 45.123 92.752  1.150   1.00 81.83  ? 107  ARG L CD  1 
ATOM 5434 N NE  . ARG E 5 107 ? 46.303 93.059  0.351   1.00 83.06  ? 107  ARG L NE  1 
ATOM 5435 C CZ  . ARG E 5 107 ? 47.074 94.122  0.545   1.00 91.86  ? 107  ARG L CZ  1 
ATOM 5436 N NH1 . ARG E 5 107 ? 46.785 94.979  1.510   1.00 100.69 ? 107  ARG L NH1 1 
ATOM 5437 N NH2 . ARG E 5 107 ? 48.134 94.327  -0.221  1.00 98.96  ? 107  ARG L NH2 1 
ATOM 5438 N N   . ALA E 5 108 ? 46.361 93.369  5.107   1.00 88.94  ? 108  ALA L N   1 
ATOM 5439 C CA  . ALA E 5 108 ? 46.879 94.699  5.395   1.00 96.83  ? 108  ALA L CA  1 
ATOM 5440 C C   . ALA E 5 108 ? 46.106 95.741  4.593   1.00 106.76 ? 108  ALA L C   1 
ATOM 5441 O O   . ALA E 5 108 ? 45.665 95.487  3.470   1.00 117.13 ? 108  ALA L O   1 
ATOM 5442 C CB  . ALA E 5 108 ? 48.372 94.777  5.070   1.00 95.22  ? 108  ALA L CB  1 
ATOM 5443 N N   . ASP E 5 109 ? 45.920 96.920  5.183   1.00 115.90 ? 109  ASP L N   1 
ATOM 5444 C CA  . ASP E 5 109 ? 45.176 97.970  4.500   1.00 111.21 ? 109  ASP L CA  1 
ATOM 5445 C C   . ASP E 5 109 ? 45.922 98.422  3.252   1.00 75.14  ? 109  ASP L C   1 
ATOM 5446 O O   . ASP E 5 109 ? 47.152 98.508  3.247   1.00 75.11  ? 109  ASP L O   1 
ATOM 5447 C CB  . ASP E 5 109 ? 44.950 99.159  5.432   1.00 121.07 ? 109  ASP L CB  1 
ATOM 5448 C CG  . ASP E 5 109 ? 43.954 98.858  6.529   1.00 117.85 ? 109  ASP L CG  1 
ATOM 5449 O OD1 . ASP E 5 109 ? 43.531 97.687  6.651   1.00 118.99 ? 109  ASP L OD1 1 
ATOM 5450 O OD2 . ASP E 5 109 ? 43.591 99.798  7.266   1.00 122.41 ? 109  ASP L OD2 1 
ATOM 5451 N N   . ALA E 5 110 ? 45.175 98.703  2.184   1.00 74.36  ? 110  ALA L N   1 
ATOM 5452 C CA  . ALA E 5 110 ? 45.791 99.125  0.931   1.00 80.42  ? 110  ALA L CA  1 
ATOM 5453 C C   . ALA E 5 110 ? 44.995 100.251 0.289   1.00 82.19  ? 110  ALA L C   1 
ATOM 5454 O O   . ALA E 5 110 ? 43.763 100.197 0.228   1.00 75.33  ? 110  ALA L O   1 
ATOM 5455 C CB  . ALA E 5 110 ? 45.913 97.959  -0.057  1.00 85.25  ? 110  ALA L CB  1 
ATOM 5456 N N   . ALA E 5 111 ? 45.709 101.260 -0.213  1.00 77.50  ? 111  ALA L N   1 
ATOM 5457 C CA  . ALA E 5 111 ? 45.027 102.375 -0.853  1.00 87.76  ? 111  ALA L CA  1 
ATOM 5458 C C   . ALA E 5 111 ? 44.534 101.971 -2.242  1.00 77.22  ? 111  ALA L C   1 
ATOM 5459 O O   . ALA E 5 111 ? 45.230 101.252 -2.966  1.00 75.37  ? 111  ALA L O   1 
ATOM 5460 C CB  . ALA E 5 111 ? 45.950 103.589 -0.962  1.00 105.65 ? 111  ALA L CB  1 
ATOM 5461 N N   . PRO E 5 112 ? 43.344 102.423 -2.635  1.00 76.43  ? 112  PRO L N   1 
ATOM 5462 C CA  . PRO E 5 112 ? 42.811 102.043 -3.944  1.00 78.26  ? 112  PRO L CA  1 
ATOM 5463 C C   . PRO E 5 112 ? 43.530 102.763 -5.070  1.00 89.50  ? 112  PRO L C   1 
ATOM 5464 O O   . PRO E 5 112 ? 43.949 103.916 -4.936  1.00 88.55  ? 112  PRO L O   1 
ATOM 5465 C CB  . PRO E 5 112 ? 41.342 102.464 -3.861  1.00 77.87  ? 112  PRO L CB  1 
ATOM 5466 C CG  . PRO E 5 112 ? 41.343 103.596 -2.907  1.00 77.17  ? 112  PRO L CG  1 
ATOM 5467 C CD  . PRO E 5 112 ? 42.409 103.279 -1.888  1.00 83.78  ? 112  PRO L CD  1 
ATOM 5468 N N   . THR E 5 113 ? 43.683 102.052 -6.182  1.00 94.94  ? 113  THR L N   1 
ATOM 5469 C CA  . THR E 5 113 ? 44.195 102.628 -7.415  1.00 95.56  ? 113  THR L CA  1 
ATOM 5470 C C   . THR E 5 113 ? 43.011 103.132 -8.225  1.00 99.20  ? 113  THR L C   1 
ATOM 5471 O O   . THR E 5 113 ? 42.116 102.354 -8.575  1.00 104.71 ? 113  THR L O   1 
ATOM 5472 C CB  . THR E 5 113 ? 44.987 101.598 -8.214  1.00 96.14  ? 113  THR L CB  1 
ATOM 5473 O OG1 . THR E 5 113 ? 46.008 101.031 -7.385  1.00 93.99  ? 113  THR L OG1 1 
ATOM 5474 C CG2 . THR E 5 113 ? 45.618 102.252 -9.430  1.00 96.75  ? 113  THR L CG2 1 
ATOM 5475 N N   . VAL E 5 114 ? 43.004 104.425 -8.520  1.00 91.74  ? 114  VAL L N   1 
ATOM 5476 C CA  . VAL E 5 114 ? 41.866 105.069 -9.157  1.00 86.08  ? 114  VAL L CA  1 
ATOM 5477 C C   . VAL E 5 114 ? 42.197 105.337 -10.615 1.00 78.44  ? 114  VAL L C   1 
ATOM 5478 O O   . VAL E 5 114 ? 43.295 105.808 -10.937 1.00 85.91  ? 114  VAL L O   1 
ATOM 5479 C CB  . VAL E 5 114 ? 41.491 106.371 -8.439  1.00 78.13  ? 114  VAL L CB  1 
ATOM 5480 C CG1 . VAL E 5 114 ? 40.248 106.959 -9.070  1.00 72.25  ? 114  VAL L CG1 1 
ATOM 5481 C CG2 . VAL E 5 114 ? 41.295 106.111 -6.954  1.00 71.77  ? 114  VAL L CG2 1 
ATOM 5482 N N   . SER E 5 115 ? 41.249 105.038 -11.498 1.00 72.71  ? 115  SER L N   1 
ATOM 5483 C CA  . SER E 5 115 ? 41.413 105.307 -12.920 1.00 78.70  ? 115  SER L CA  1 
ATOM 5484 C C   . SER E 5 115 ? 40.069 105.734 -13.486 1.00 83.13  ? 115  SER L C   1 
ATOM 5485 O O   . SER E 5 115 ? 39.079 105.008 -13.352 1.00 82.92  ? 115  SER L O   1 
ATOM 5486 C CB  . SER E 5 115 ? 41.955 104.077 -13.649 1.00 84.82  ? 115  SER L CB  1 
ATOM 5487 O OG  . SER E 5 115 ? 41.062 102.984 -13.525 1.00 99.69  ? 115  SER L OG  1 
ATOM 5488 N N   . ILE E 5 116 ? 40.029 106.913 -14.104 1.00 95.65  ? 116  ILE L N   1 
ATOM 5489 C CA  . ILE E 5 116 ? 38.789 107.484 -14.617 1.00 97.19  ? 116  ILE L CA  1 
ATOM 5490 C C   . ILE E 5 116 ? 38.751 107.311 -16.127 1.00 92.75  ? 116  ILE L C   1 
ATOM 5491 O O   . ILE E 5 116 ? 39.777 107.414 -16.812 1.00 96.90  ? 116  ILE L O   1 
ATOM 5492 C CB  . ILE E 5 116 ? 38.632 108.966 -14.215 1.00 87.07  ? 116  ILE L CB  1 
ATOM 5493 C CG1 . ILE E 5 116 ? 37.220 109.452 -14.554 1.00 86.78  ? 116  ILE L CG1 1 
ATOM 5494 C CG2 . ILE E 5 116 ? 39.676 109.842 -14.900 1.00 89.31  ? 116  ILE L CG2 1 
ATOM 5495 C CD1 . ILE E 5 116 ? 36.862 110.812 -14.001 1.00 75.68  ? 116  ILE L CD1 1 
ATOM 5496 N N   . PHE E 5 117 ? 37.559 107.026 -16.644 1.00 78.16  ? 117  PHE L N   1 
ATOM 5497 C CA  . PHE E 5 117 ? 37.340 106.764 -18.059 1.00 81.53  ? 117  PHE L CA  1 
ATOM 5498 C C   . PHE E 5 117 ? 36.184 107.644 -18.514 1.00 90.30  ? 117  PHE L C   1 
ATOM 5499 O O   . PHE E 5 117 ? 35.072 107.550 -17.949 1.00 95.09  ? 117  PHE L O   1 
ATOM 5500 C CB  . PHE E 5 117 ? 37.053 105.281 -18.320 1.00 79.49  ? 117  PHE L CB  1 
ATOM 5501 C CG  . PHE E 5 117 ? 38.159 104.361 -17.881 1.00 76.56  ? 117  PHE L CG  1 
ATOM 5502 C CD1 . PHE E 5 117 ? 38.235 103.926 -16.566 1.00 75.53  ? 117  PHE L CD1 1 
ATOM 5503 C CD2 . PHE E 5 117 ? 39.123 103.933 -18.778 1.00 76.92  ? 117  PHE L CD2 1 
ATOM 5504 C CE1 . PHE E 5 117 ? 39.253 103.083 -16.154 1.00 74.83  ? 117  PHE L CE1 1 
ATOM 5505 C CE2 . PHE E 5 117 ? 40.146 103.084 -18.371 1.00 87.83  ? 117  PHE L CE2 1 
ATOM 5506 C CZ  . PHE E 5 117 ? 40.210 102.661 -17.059 1.00 75.14  ? 117  PHE L CZ  1 
ATOM 5507 N N   . PRO E 5 118 ? 36.397 108.514 -19.495 1.00 95.40  ? 118  PRO L N   1 
ATOM 5508 C CA  . PRO E 5 118 ? 35.307 109.321 -20.046 1.00 97.05  ? 118  PRO L CA  1 
ATOM 5509 C C   . PRO E 5 118 ? 34.369 108.460 -20.873 1.00 114.28 ? 118  PRO L C   1 
ATOM 5510 O O   . PRO E 5 118 ? 34.720 107.324 -21.230 1.00 121.26 ? 118  PRO L O   1 
ATOM 5511 C CB  . PRO E 5 118 ? 36.050 110.340 -20.922 1.00 88.77  ? 118  PRO L CB  1 
ATOM 5512 C CG  . PRO E 5 118 ? 37.285 109.602 -21.354 1.00 84.04  ? 118  PRO L CG  1 
ATOM 5513 C CD  . PRO E 5 118 ? 37.680 108.766 -20.177 1.00 91.58  ? 118  PRO L CD  1 
ATOM 5514 N N   . PRO E 5 119 ? 33.175 108.959 -21.208 1.00 114.59 ? 119  PRO L N   1 
ATOM 5515 C CA  . PRO E 5 119 ? 32.238 108.153 -22.003 1.00 118.56 ? 119  PRO L CA  1 
ATOM 5516 C C   . PRO E 5 119 ? 32.788 107.830 -23.385 1.00 121.29 ? 119  PRO L C   1 
ATOM 5517 O O   . PRO E 5 119 ? 33.489 108.636 -24.000 1.00 122.16 ? 119  PRO L O   1 
ATOM 5518 C CB  . PRO E 5 119 ? 30.991 109.042 -22.091 1.00 108.65 ? 119  PRO L CB  1 
ATOM 5519 C CG  . PRO E 5 119 ? 31.487 110.420 -21.837 1.00 102.42 ? 119  PRO L CG  1 
ATOM 5520 C CD  . PRO E 5 119 ? 32.596 110.262 -20.843 1.00 105.59 ? 119  PRO L CD  1 
ATOM 5521 N N   . SER E 5 120 ? 32.454 106.636 -23.871 1.00 135.57 ? 120  SER L N   1 
ATOM 5522 C CA  . SER E 5 120 ? 32.866 106.216 -25.203 1.00 145.46 ? 120  SER L CA  1 
ATOM 5523 C C   . SER E 5 120 ? 32.084 106.968 -26.277 1.00 137.44 ? 120  SER L C   1 
ATOM 5524 O O   . SER E 5 120 ? 30.972 107.449 -26.047 1.00 136.39 ? 120  SER L O   1 
ATOM 5525 C CB  . SER E 5 120 ? 32.669 104.709 -25.371 1.00 160.17 ? 120  SER L CB  1 
ATOM 5526 O OG  . SER E 5 120 ? 31.346 104.326 -25.038 1.00 168.20 ? 120  SER L OG  1 
ATOM 5527 N N   . SER E 5 121 ? 32.685 107.066 -27.467 1.00 137.47 ? 121  SER L N   1 
ATOM 5528 C CA  . SER E 5 121 ? 32.059 107.831 -28.544 1.00 145.42 ? 121  SER L CA  1 
ATOM 5529 C C   . SER E 5 121 ? 30.780 107.164 -29.026 1.00 144.88 ? 121  SER L C   1 
ATOM 5530 O O   . SER E 5 121 ? 29.797 107.849 -29.333 1.00 147.14 ? 121  SER L O   1 
ATOM 5531 C CB  . SER E 5 121 ? 33.029 108.013 -29.710 1.00 149.48 ? 121  SER L CB  1 
ATOM 5532 O OG  . SER E 5 121 ? 33.470 106.764 -30.215 1.00 153.47 ? 121  SER L OG  1 
ATOM 5533 N N   . GLU E 5 122 ? 30.778 105.831 -29.103 1.00 146.26 ? 122  GLU L N   1 
ATOM 5534 C CA  . GLU E 5 122 ? 29.579 105.105 -29.508 1.00 152.96 ? 122  GLU L CA  1 
ATOM 5535 C C   . GLU E 5 122 ? 28.419 105.405 -28.569 1.00 143.14 ? 122  GLU L C   1 
ATOM 5536 O O   . GLU E 5 122 ? 27.308 105.727 -29.010 1.00 147.74 ? 122  GLU L O   1 
ATOM 5537 C CB  . GLU E 5 122 ? 29.866 103.601 -29.552 1.00 168.02 ? 122  GLU L CB  1 
ATOM 5538 C CG  . GLU E 5 122 ? 31.031 103.219 -30.462 1.00 175.58 ? 122  GLU L CG  1 
ATOM 5539 C CD  . GLU E 5 122 ? 31.350 101.733 -30.435 1.00 178.11 ? 122  GLU L CD  1 
ATOM 5540 O OE1 . GLU E 5 122 ? 30.830 101.031 -29.546 1.00 178.88 ? 122  GLU L OE1 1 
ATOM 5541 O OE2 . GLU E 5 122 ? 32.122 101.263 -31.300 1.00 183.06 ? 122  GLU L OE2 1 
ATOM 5542 N N   . GLN E 5 123 ? 28.667 105.323 -27.262 1.00 128.36 ? 123  GLN L N   1 
ATOM 5543 C CA  . GLN E 5 123 ? 27.625 105.641 -26.296 1.00 119.39 ? 123  GLN L CA  1 
ATOM 5544 C C   . GLN E 5 123 ? 27.188 107.094 -26.412 1.00 117.16 ? 123  GLN L C   1 
ATOM 5545 O O   . GLN E 5 123 ? 25.991 107.396 -26.341 1.00 124.26 ? 123  GLN L O   1 
ATOM 5546 C CB  . GLN E 5 123 ? 28.120 105.347 -24.889 1.00 124.91 ? 123  GLN L CB  1 
ATOM 5547 C CG  . GLN E 5 123 ? 27.072 105.605 -23.849 1.00 124.45 ? 123  GLN L CG  1 
ATOM 5548 C CD  . GLN E 5 123 ? 27.589 105.397 -22.462 1.00 114.58 ? 123  GLN L CD  1 
ATOM 5549 O OE1 . GLN E 5 123 ? 26.846 105.512 -21.487 1.00 118.75 ? 123  GLN L OE1 1 
ATOM 5550 N NE2 . GLN E 5 123 ? 28.875 105.087 -22.355 1.00 106.45 ? 123  GLN L NE2 1 
ATOM 5551 N N   . LEU E 5 124 ? 28.145 108.008 -26.594 1.00 112.80 ? 124  LEU L N   1 
ATOM 5552 C CA  . LEU E 5 124 ? 27.809 109.415 -26.791 1.00 112.17 ? 124  LEU L CA  1 
ATOM 5553 C C   . LEU E 5 124 ? 26.832 109.594 -27.946 1.00 120.79 ? 124  LEU L C   1 
ATOM 5554 O O   . LEU E 5 124 ? 25.818 110.288 -27.816 1.00 122.57 ? 124  LEU L O   1 
ATOM 5555 C CB  . LEU E 5 124 ? 29.080 110.223 -27.034 1.00 111.88 ? 124  LEU L CB  1 
ATOM 5556 C CG  . LEU E 5 124 ? 29.807 110.743 -25.801 1.00 106.79 ? 124  LEU L CG  1 
ATOM 5557 C CD1 . LEU E 5 124 ? 31.173 111.298 -26.173 1.00 90.55  ? 124  LEU L CD1 1 
ATOM 5558 C CD2 . LEU E 5 124 ? 28.952 111.812 -25.153 1.00 100.27 ? 124  LEU L CD2 1 
ATOM 5559 N N   . THR E 5 125 ? 27.103 108.951 -29.081 1.00 117.84 ? 125  THR L N   1 
ATOM 5560 C CA  . THR E 5 125 ? 26.148 109.005 -30.178 1.00 124.41 ? 125  THR L CA  1 
ATOM 5561 C C   . THR E 5 125 ? 24.853 108.278 -29.845 1.00 136.75 ? 125  THR L C   1 
ATOM 5562 O O   . THR E 5 125 ? 23.833 108.543 -30.486 1.00 148.92 ? 125  THR L O   1 
ATOM 5563 C CB  . THR E 5 125 ? 26.757 108.414 -31.445 1.00 121.93 ? 125  THR L CB  1 
ATOM 5564 O OG1 . THR E 5 125 ? 27.029 107.022 -31.236 1.00 132.63 ? 125  THR L OG1 1 
ATOM 5565 C CG2 . THR E 5 125 ? 28.046 109.128 -31.788 1.00 111.12 ? 125  THR L CG2 1 
ATOM 5566 N N   . SER E 5 126 ? 24.867 107.368 -28.862 1.00 133.56 ? 126  SER L N   1 
ATOM 5567 C CA  . SER E 5 126 ? 23.638 106.658 -28.515 1.00 134.65 ? 126  SER L CA  1 
ATOM 5568 C C   . SER E 5 126 ? 22.629 107.579 -27.842 1.00 131.35 ? 126  SER L C   1 
ATOM 5569 O O   . SER E 5 126 ? 21.418 107.370 -27.974 1.00 135.68 ? 126  SER L O   1 
ATOM 5570 C CB  . SER E 5 126 ? 23.940 105.458 -27.612 1.00 134.41 ? 126  SER L CB  1 
ATOM 5571 O OG  . SER E 5 126 ? 22.767 104.699 -27.359 1.00 130.72 ? 126  SER L OG  1 
ATOM 5572 N N   . GLY E 5 127 ? 23.095 108.599 -27.132 1.00 124.46 ? 127  GLY L N   1 
ATOM 5573 C CA  . GLY E 5 127 ? 22.174 109.515 -26.493 1.00 122.11 ? 127  GLY L CA  1 
ATOM 5574 C C   . GLY E 5 127 ? 22.520 109.818 -25.053 1.00 118.48 ? 127  GLY L C   1 
ATOM 5575 O O   . GLY E 5 127 ? 22.029 110.797 -24.485 1.00 128.55 ? 127  GLY L O   1 
ATOM 5576 N N   . GLY E 5 128 ? 23.360 108.975 -24.448 1.00 107.08 ? 128  GLY L N   1 
ATOM 5577 C CA  . GLY E 5 128 ? 23.768 109.162 -23.076 1.00 102.61 ? 128  GLY L CA  1 
ATOM 5578 C C   . GLY E 5 128 ? 25.278 109.085 -22.948 1.00 91.56  ? 128  GLY L C   1 
ATOM 5579 O O   . GLY E 5 128 ? 25.984 108.683 -23.872 1.00 89.80  ? 128  GLY L O   1 
ATOM 5580 N N   . ALA E 5 129 ? 25.760 109.477 -21.775 1.00 90.27  ? 129  ALA L N   1 
ATOM 5581 C CA  . ALA E 5 129 ? 27.193 109.499 -21.523 1.00 97.39  ? 129  ALA L CA  1 
ATOM 5582 C C   . ALA E 5 129 ? 27.424 109.093 -20.081 1.00 98.31  ? 129  ALA L C   1 
ATOM 5583 O O   . ALA E 5 129 ? 26.958 109.772 -19.166 1.00 99.49  ? 129  ALA L O   1 
ATOM 5584 C CB  . ALA E 5 129 ? 27.783 110.881 -21.800 1.00 87.11  ? 129  ALA L CB  1 
ATOM 5585 N N   . SER E 5 130 ? 28.131 107.989 -19.884 1.00 94.33  ? 130  SER L N   1 
ATOM 5586 C CA  . SER E 5 130 ? 28.429 107.469 -18.560 1.00 90.71  ? 130  SER L CA  1 
ATOM 5587 C C   . SER E 5 130 ? 29.933 107.538 -18.340 1.00 89.52  ? 130  SER L C   1 
ATOM 5588 O O   . SER E 5 130 ? 30.703 106.939 -19.099 1.00 83.43  ? 130  SER L O   1 
ATOM 5589 C CB  . SER E 5 130 ? 27.915 106.038 -18.412 1.00 92.24  ? 130  SER L CB  1 
ATOM 5590 O OG  . SER E 5 130 ? 28.521 105.171 -19.352 1.00 98.03  ? 130  SER L OG  1 
ATOM 5591 N N   . VAL E 5 131 ? 30.347 108.274 -17.314 1.00 98.62  ? 131  VAL L N   1 
ATOM 5592 C CA  . VAL E 5 131 ? 31.743 108.337 -16.901 1.00 101.12 ? 131  VAL L CA  1 
ATOM 5593 C C   . VAL E 5 131 ? 31.987 107.228 -15.889 1.00 96.10  ? 131  VAL L C   1 
ATOM 5594 O O   . VAL E 5 131 ? 31.207 107.056 -14.945 1.00 106.45 ? 131  VAL L O   1 
ATOM 5595 C CB  . VAL E 5 131 ? 32.079 109.713 -16.304 1.00 103.81 ? 131  VAL L CB  1 
ATOM 5596 C CG1 . VAL E 5 131 ? 33.582 109.858 -16.134 1.00 103.97 ? 131  VAL L CG1 1 
ATOM 5597 C CG2 . VAL E 5 131 ? 31.520 110.820 -17.175 1.00 114.60 ? 131  VAL L CG2 1 
ATOM 5598 N N   . VAL E 5 132 ? 33.058 106.471 -16.086 1.00 80.40  ? 132  VAL L N   1 
ATOM 5599 C CA  . VAL E 5 132 ? 33.333 105.310 -15.251 1.00 81.02  ? 132  VAL L CA  1 
ATOM 5600 C C   . VAL E 5 132 ? 34.571 105.610 -14.424 1.00 85.06  ? 132  VAL L C   1 
ATOM 5601 O O   . VAL E 5 132 ? 35.498 106.280 -14.883 1.00 76.98  ? 132  VAL L O   1 
ATOM 5602 C CB  . VAL E 5 132 ? 33.498 104.026 -16.093 1.00 73.77  ? 132  VAL L CB  1 
ATOM 5603 C CG1 . VAL E 5 132 ? 33.706 102.809 -15.211 1.00 66.67  ? 132  VAL L CG1 1 
ATOM 5604 C CG2 . VAL E 5 132 ? 32.269 103.832 -16.962 1.00 76.78  ? 132  VAL L CG2 1 
ATOM 5605 N N   . CYS E 5 133 ? 34.571 105.135 -13.183 1.00 93.80  ? 133  CYS L N   1 
ATOM 5606 C CA  . CYS E 5 133 ? 35.717 105.297 -12.298 1.00 96.03  ? 133  CYS L CA  1 
ATOM 5607 C C   . CYS E 5 133 ? 35.982 103.952 -11.642 1.00 95.31  ? 133  CYS L C   1 
ATOM 5608 O O   . CYS E 5 133 ? 35.129 103.443 -10.911 1.00 111.58 ? 133  CYS L O   1 
ATOM 5609 C CB  . CYS E 5 133 ? 35.470 106.385 -11.257 1.00 108.18 ? 133  CYS L CB  1 
ATOM 5610 S SG  . CYS E 5 133 ? 36.973 107.182 -10.674 1.00 115.49 ? 133  CYS L SG  1 
ATOM 5611 N N   . PHE E 5 134 ? 37.143 103.366 -11.930 1.00 71.63  ? 134  PHE L N   1 
ATOM 5612 C CA  . PHE E 5 134 ? 37.560 102.095 -11.350 1.00 71.65  ? 134  PHE L CA  1 
ATOM 5613 C C   . PHE E 5 134 ? 38.481 102.354 -10.162 1.00 79.87  ? 134  PHE L C   1 
ATOM 5614 O O   . PHE E 5 134 ? 39.560 102.941 -10.321 1.00 81.55  ? 134  PHE L O   1 
ATOM 5615 C CB  . PHE E 5 134 ? 38.273 101.221 -12.383 1.00 67.01  ? 134  PHE L CB  1 
ATOM 5616 C CG  . PHE E 5 134 ? 37.362 100.634 -13.425 1.00 74.35  ? 134  PHE L CG  1 
ATOM 5617 C CD1 . PHE E 5 134 ? 36.046 100.326 -13.124 1.00 79.89  ? 134  PHE L CD1 1 
ATOM 5618 C CD2 . PHE E 5 134 ? 37.827 100.387 -14.711 1.00 70.94  ? 134  PHE L CD2 1 
ATOM 5619 C CE1 . PHE E 5 134 ? 35.206 99.783  -14.088 1.00 71.50  ? 134  PHE L CE1 1 
ATOM 5620 C CE2 . PHE E 5 134 ? 36.987 99.846  -15.678 1.00 73.06  ? 134  PHE L CE2 1 
ATOM 5621 C CZ  . PHE E 5 134 ? 35.677 99.546  -15.363 1.00 66.94  ? 134  PHE L CZ  1 
ATOM 5622 N N   . LEU E 5 135 ? 38.056 101.906 -8.979  1.00 84.34  ? 135  LEU L N   1 
ATOM 5623 C CA  . LEU E 5 135 ? 38.856 101.947 -7.756  1.00 86.96  ? 135  LEU L CA  1 
ATOM 5624 C C   . LEU E 5 135 ? 39.230 100.507 -7.432  1.00 82.04  ? 135  LEU L C   1 
ATOM 5625 O O   . LEU E 5 135 ? 38.425 99.764  -6.866  1.00 85.04  ? 135  LEU L O   1 
ATOM 5626 C CB  . LEU E 5 135 ? 38.079 102.588 -6.613  1.00 99.45  ? 135  LEU L CB  1 
ATOM 5627 C CG  . LEU E 5 135 ? 37.107 103.696 -7.015  1.00 106.44 ? 135  LEU L CG  1 
ATOM 5628 C CD1 . LEU E 5 135 ? 36.218 104.065 -5.849  1.00 103.04 ? 135  LEU L CD1 1 
ATOM 5629 C CD2 . LEU E 5 135 ? 37.874 104.901 -7.491  1.00 112.45 ? 135  LEU L CD2 1 
ATOM 5630 N N   . ASN E 5 136 ? 40.443 100.108 -7.795  1.00 67.15  ? 136  ASN L N   1 
ATOM 5631 C CA  . ASN E 5 136 ? 40.835 98.710  -7.731  1.00 68.11  ? 136  ASN L CA  1 
ATOM 5632 C C   . ASN E 5 136 ? 41.887 98.463  -6.661  1.00 79.61  ? 136  ASN L C   1 
ATOM 5633 O O   . ASN E 5 136 ? 42.684 99.344  -6.327  1.00 77.40  ? 136  ASN L O   1 
ATOM 5634 C CB  . ASN E 5 136 ? 41.387 98.229  -9.071  1.00 71.20  ? 136  ASN L CB  1 
ATOM 5635 C CG  . ASN E 5 136 ? 40.436 98.471  -10.205 1.00 75.65  ? 136  ASN L CG  1 
ATOM 5636 O OD1 . ASN E 5 136 ? 39.220 98.430  -10.030 1.00 83.44  ? 136  ASN L OD1 1 
ATOM 5637 N ND2 . ASN E 5 136 ? 40.981 98.735  -11.382 1.00 74.39  ? 136  ASN L ND2 1 
ATOM 5638 N N   . ASN E 5 137 ? 41.882 97.227  -6.155  1.00 95.09  ? 137  ASN L N   1 
ATOM 5639 C CA  . ASN E 5 137 ? 42.942 96.663  -5.321  1.00 91.14  ? 137  ASN L CA  1 
ATOM 5640 C C   . ASN E 5 137 ? 43.134 97.465  -4.030  1.00 80.98  ? 137  ASN L C   1 
ATOM 5641 O O   . ASN E 5 137 ? 44.176 98.077  -3.785  1.00 86.65  ? 137  ASN L O   1 
ATOM 5642 C CB  . ASN E 5 137 ? 44.246 96.570  -6.116  1.00 101.03 ? 137  ASN L CB  1 
ATOM 5643 C CG  . ASN E 5 137 ? 44.064 95.864  -7.433  1.00 114.91 ? 137  ASN L CG  1 
ATOM 5644 O OD1 . ASN E 5 137 ? 43.164 95.040  -7.582  1.00 121.61 ? 137  ASN L OD1 1 
ATOM 5645 N ND2 . ASN E 5 137 ? 44.907 96.190  -8.404  1.00 122.30 ? 137  ASN L ND2 1 
ATOM 5646 N N   . PHE E 5 138 ? 42.096 97.429  -3.198  1.00 82.67  ? 138  PHE L N   1 
ATOM 5647 C CA  . PHE E 5 138 ? 42.142 98.088  -1.900  1.00 96.05  ? 138  PHE L CA  1 
ATOM 5648 C C   . PHE E 5 138 ? 41.533 97.184  -0.835  1.00 92.10  ? 138  PHE L C   1 
ATOM 5649 O O   . PHE E 5 138 ? 40.911 96.160  -1.134  1.00 94.93  ? 138  PHE L O   1 
ATOM 5650 C CB  . PHE E 5 138 ? 41.431 99.447  -1.937  1.00 94.64  ? 138  PHE L CB  1 
ATOM 5651 C CG  . PHE E 5 138 ? 39.962 99.367  -2.238  1.00 89.57  ? 138  PHE L CG  1 
ATOM 5652 C CD1 . PHE E 5 138 ? 39.507 99.375  -3.545  1.00 63.80  ? 138  PHE L CD1 1 
ATOM 5653 C CD2 . PHE E 5 138 ? 39.036 99.313  -1.210  1.00 67.25  ? 138  PHE L CD2 1 
ATOM 5654 C CE1 . PHE E 5 138 ? 38.155 99.315  -3.823  1.00 65.83  ? 138  PHE L CE1 1 
ATOM 5655 C CE2 . PHE E 5 138 ? 37.682 99.251  -1.482  1.00 69.39  ? 138  PHE L CE2 1 
ATOM 5656 C CZ  . PHE E 5 138 ? 37.242 99.253  -2.788  1.00 68.64  ? 138  PHE L CZ  1 
ATOM 5657 N N   . TYR E 5 139 ? 41.730 97.578  0.430   1.00 81.65  ? 139  TYR L N   1 
ATOM 5658 C CA  . TYR E 5 139 ? 41.237 96.843  1.590   1.00 84.22  ? 139  TYR L CA  1 
ATOM 5659 C C   . TYR E 5 139 ? 41.195 97.786  2.779   1.00 84.82  ? 139  TYR L C   1 
ATOM 5660 O O   . TYR E 5 139 ? 42.184 98.497  3.013   1.00 68.51  ? 139  TYR L O   1 
ATOM 5661 C CB  . TYR E 5 139 ? 42.124 95.629  1.922   1.00 83.42  ? 139  TYR L CB  1 
ATOM 5662 C CG  . TYR E 5 139 ? 41.550 94.764  3.019   1.00 77.34  ? 139  TYR L CG  1 
ATOM 5663 C CD1 . TYR E 5 139 ? 40.659 93.740  2.722   1.00 86.07  ? 139  TYR L CD1 1 
ATOM 5664 C CD2 . TYR E 5 139 ? 41.866 94.991  4.350   1.00 78.94  ? 139  TYR L CD2 1 
ATOM 5665 C CE1 . TYR E 5 139 ? 40.108 92.954  3.727   1.00 96.62  ? 139  TYR L CE1 1 
ATOM 5666 C CE2 . TYR E 5 139 ? 41.321 94.212  5.363   1.00 84.99  ? 139  TYR L CE2 1 
ATOM 5667 C CZ  . TYR E 5 139 ? 40.445 93.196  5.046   1.00 92.44  ? 139  TYR L CZ  1 
ATOM 5668 O OH  . TYR E 5 139 ? 39.911 92.427  6.054   1.00 100.50 ? 139  TYR L OH  1 
ATOM 5669 N N   . PRO E 5 140 ? 40.106 97.796  3.577   1.00 81.04  ? 140  PRO L N   1 
ATOM 5670 C CA  . PRO E 5 140 ? 38.897 96.961  3.485   1.00 80.80  ? 140  PRO L CA  1 
ATOM 5671 C C   . PRO E 5 140 ? 37.882 97.432  2.449   1.00 82.78  ? 140  PRO L C   1 
ATOM 5672 O O   . PRO E 5 140 ? 38.204 98.292  1.635   1.00 84.46  ? 140  PRO L O   1 
ATOM 5673 C CB  . PRO E 5 140 ? 38.281 97.068  4.893   1.00 82.49  ? 140  PRO L CB  1 
ATOM 5674 C CG  . PRO E 5 140 ? 39.302 97.736  5.744   1.00 78.94  ? 140  PRO L CG  1 
ATOM 5675 C CD  . PRO E 5 140 ? 40.125 98.571  4.827   1.00 74.82  ? 140  PRO L CD  1 
ATOM 5676 N N   . LYS E 5 141 ? 36.664 96.879  2.505   1.00 96.70  ? 141  LYS L N   1 
ATOM 5677 C CA  . LYS E 5 141 ? 35.623 97.265  1.557   1.00 115.68 ? 141  LYS L CA  1 
ATOM 5678 C C   . LYS E 5 141 ? 35.226 98.725  1.712   1.00 124.21 ? 141  LYS L C   1 
ATOM 5679 O O   . LYS E 5 141 ? 34.794 99.354  0.739   1.00 133.91 ? 141  LYS L O   1 
ATOM 5680 C CB  . LYS E 5 141 ? 34.380 96.395  1.735   1.00 123.39 ? 141  LYS L CB  1 
ATOM 5681 C CG  . LYS E 5 141 ? 34.596 94.909  1.580   1.00 140.62 ? 141  LYS L CG  1 
ATOM 5682 C CD  . LYS E 5 141 ? 33.256 94.185  1.566   1.00 163.83 ? 141  LYS L CD  1 
ATOM 5683 C CE  . LYS E 5 141 ? 33.421 92.681  1.696   1.00 177.69 ? 141  LYS L CE  1 
ATOM 5684 N NZ  . LYS E 5 141 ? 32.137 91.944  1.527   1.00 185.92 ? 141  LYS L NZ  1 
ATOM 5685 N N   . ASP E 5 142 ? 35.351 99.270  2.916   1.00 122.11 ? 142  ASP L N   1 
ATOM 5686 C CA  . ASP E 5 142 ? 34.823 100.596 3.196   1.00 125.62 ? 142  ASP L CA  1 
ATOM 5687 C C   . ASP E 5 142 ? 35.535 101.641 2.351   1.00 109.60 ? 142  ASP L C   1 
ATOM 5688 O O   . ASP E 5 142 ? 36.759 101.786 2.426   1.00 117.90 ? 142  ASP L O   1 
ATOM 5689 C CB  . ASP E 5 142 ? 34.970 100.903 4.685   1.00 147.00 ? 142  ASP L CB  1 
ATOM 5690 C CG  . ASP E 5 142 ? 34.327 99.843  5.559   1.00 166.17 ? 142  ASP L CG  1 
ATOM 5691 O OD1 . ASP E 5 142 ? 33.676 98.933  5.003   1.00 173.13 ? 142  ASP L OD1 1 
ATOM 5692 O OD2 . ASP E 5 142 ? 34.474 99.914  6.797   1.00 174.17 ? 142  ASP L OD2 1 
ATOM 5693 N N   . ILE E 5 143 ? 34.762 102.347 1.530   1.00 93.23  ? 143  ILE L N   1 
ATOM 5694 C CA  . ILE E 5 143 ? 35.281 103.429 0.702   1.00 94.09  ? 143  ILE L CA  1 
ATOM 5695 C C   . ILE E 5 143 ? 34.103 104.288 0.268   1.00 96.65  ? 143  ILE L C   1 
ATOM 5696 O O   . ILE E 5 143 ? 33.041 103.774 -0.093  1.00 107.03 ? 143  ILE L O   1 
ATOM 5697 C CB  . ILE E 5 143 ? 36.074 102.875 -0.506  1.00 90.84  ? 143  ILE L CB  1 
ATOM 5698 C CG1 . ILE E 5 143 ? 36.600 103.993 -1.395  1.00 89.62  ? 143  ILE L CG1 1 
ATOM 5699 C CG2 . ILE E 5 143 ? 35.225 101.957 -1.338  1.00 74.10  ? 143  ILE L CG2 1 
ATOM 5700 C CD1 . ILE E 5 143 ? 37.520 103.472 -2.464  1.00 71.46  ? 143  ILE L CD1 1 
ATOM 5701 N N   . ASN E 5 144 ? 34.294 105.603 0.321   1.00 89.99  ? 144  ASN L N   1 
ATOM 5702 C CA  . ASN E 5 144 ? 33.283 106.562 -0.101  1.00 89.54  ? 144  ASN L CA  1 
ATOM 5703 C C   . ASN E 5 144 ? 33.678 107.127 -1.462  1.00 82.98  ? 144  ASN L C   1 
ATOM 5704 O O   . ASN E 5 144 ? 34.869 107.262 -1.764  1.00 82.19  ? 144  ASN L O   1 
ATOM 5705 C CB  . ASN E 5 144 ? 33.126 107.678 0.940   1.00 110.49 ? 144  ASN L CB  1 
ATOM 5706 C CG  . ASN E 5 144 ? 32.096 108.722 0.539   1.00 139.69 ? 144  ASN L CG  1 
ATOM 5707 O OD1 . ASN E 5 144 ? 31.125 108.424 -0.157  1.00 159.96 ? 144  ASN L OD1 1 
ATOM 5708 N ND2 . ASN E 5 144 ? 32.307 109.957 0.982   1.00 147.42 ? 144  ASN L ND2 1 
ATOM 5709 N N   . VAL E 5 145 ? 32.675 107.421 -2.293  1.00 80.16  ? 145  VAL L N   1 
ATOM 5710 C CA  . VAL E 5 145 ? 32.869 107.924 -3.651  1.00 79.28  ? 145  VAL L CA  1 
ATOM 5711 C C   . VAL E 5 145 ? 32.013 109.168 -3.840  1.00 97.52  ? 145  VAL L C   1 
ATOM 5712 O O   . VAL E 5 145 ? 30.830 109.164 -3.485  1.00 112.52 ? 145  VAL L O   1 
ATOM 5713 C CB  . VAL E 5 145 ? 32.503 106.865 -4.711  1.00 89.30  ? 145  VAL L CB  1 
ATOM 5714 C CG1 . VAL E 5 145 ? 32.696 107.404 -6.113  1.00 77.33  ? 145  VAL L CG1 1 
ATOM 5715 C CG2 . VAL E 5 145 ? 33.337 105.623 -4.526  1.00 95.47  ? 145  VAL L CG2 1 
ATOM 5716 N N   . LYS E 5 146 ? 32.607 110.224 -4.402  1.00 96.59  ? 146  LYS L N   1 
ATOM 5717 C CA  . LYS E 5 146 ? 31.896 111.443 -4.772  1.00 101.53 ? 146  LYS L CA  1 
ATOM 5718 C C   . LYS E 5 146 ? 32.247 111.822 -6.202  1.00 103.07 ? 146  LYS L C   1 
ATOM 5719 O O   . LYS E 5 146 ? 33.394 111.666 -6.631  1.00 102.97 ? 146  LYS L O   1 
ATOM 5720 C CB  . LYS E 5 146 ? 32.238 112.624 -3.846  1.00 120.52 ? 146  LYS L CB  1 
ATOM 5721 C CG  . LYS E 5 146 ? 31.746 112.478 -2.417  1.00 139.48 ? 146  LYS L CG  1 
ATOM 5722 C CD  . LYS E 5 146 ? 32.048 113.716 -1.584  1.00 149.53 ? 146  LYS L CD  1 
ATOM 5723 C CE  . LYS E 5 146 ? 31.541 113.535 -0.162  1.00 166.23 ? 146  LYS L CE  1 
ATOM 5724 N NZ  . LYS E 5 146 ? 31.807 114.725 0.692   1.00 174.52 ? 146  LYS L NZ  1 
ATOM 5725 N N   . TRP E 5 147 ? 31.260 112.328 -6.934  1.00 103.23 ? 147  TRP L N   1 
ATOM 5726 C CA  . TRP E 5 147 ? 31.459 112.832 -8.284  1.00 92.68  ? 147  TRP L CA  1 
ATOM 5727 C C   . TRP E 5 147 ? 31.279 114.342 -8.290  1.00 98.84  ? 147  TRP L C   1 
ATOM 5728 O O   . TRP E 5 147 ? 30.339 114.865 -7.684  1.00 101.39 ? 147  TRP L O   1 
ATOM 5729 C CB  . TRP E 5 147 ? 30.480 112.188 -9.269  1.00 88.42  ? 147  TRP L CB  1 
ATOM 5730 C CG  . TRP E 5 147 ? 30.887 110.813 -9.692  1.00 93.08  ? 147  TRP L CG  1 
ATOM 5731 C CD1 . TRP E 5 147 ? 30.494 109.634 -9.134  1.00 82.38  ? 147  TRP L CD1 1 
ATOM 5732 C CD2 . TRP E 5 147 ? 31.772 110.474 -10.765 1.00 102.19 ? 147  TRP L CD2 1 
ATOM 5733 N NE1 . TRP E 5 147 ? 31.078 108.580 -9.791  1.00 80.10  ? 147  TRP L NE1 1 
ATOM 5734 C CE2 . TRP E 5 147 ? 31.868 109.069 -10.798 1.00 94.94  ? 147  TRP L CE2 1 
ATOM 5735 C CE3 . TRP E 5 147 ? 32.493 111.222 -11.703 1.00 100.87 ? 147  TRP L CE3 1 
ATOM 5736 C CZ2 . TRP E 5 147 ? 32.654 108.398 -11.731 1.00 96.20  ? 147  TRP L CZ2 1 
ATOM 5737 C CZ3 . TRP E 5 147 ? 33.275 110.556 -12.628 1.00 92.30  ? 147  TRP L CZ3 1 
ATOM 5738 C CH2 . TRP E 5 147 ? 33.350 109.158 -12.634 1.00 96.91  ? 147  TRP L CH2 1 
ATOM 5739 N N   . LYS E 5 148 ? 32.181 115.043 -8.971  1.00 114.64 ? 148  LYS L N   1 
ATOM 5740 C CA  . LYS E 5 148 ? 32.131 116.500 -9.033  1.00 125.83 ? 148  LYS L CA  1 
ATOM 5741 C C   . LYS E 5 148 ? 32.145 116.938 -10.491 1.00 130.66 ? 148  LYS L C   1 
ATOM 5742 O O   . LYS E 5 148 ? 33.149 116.760 -11.189 1.00 137.30 ? 148  LYS L O   1 
ATOM 5743 C CB  . LYS E 5 148 ? 33.294 117.124 -8.260  1.00 129.73 ? 148  LYS L CB  1 
ATOM 5744 C CG  . LYS E 5 148 ? 33.189 116.970 -6.754  1.00 129.48 ? 148  LYS L CG  1 
ATOM 5745 C CD  . LYS E 5 148 ? 34.335 117.673 -6.049  1.00 130.41 ? 148  LYS L CD  1 
ATOM 5746 C CE  . LYS E 5 148 ? 34.190 117.584 -4.540  1.00 133.60 ? 148  LYS L CE  1 
ATOM 5747 N NZ  . LYS E 5 148 ? 35.283 118.300 -3.826  1.00 138.70 ? 148  LYS L NZ  1 
ATOM 5748 N N   . ILE E 5 149 ? 31.036 117.512 -10.945 1.00 117.14 ? 149  ILE L N   1 
ATOM 5749 C CA  . ILE E 5 149 ? 30.931 118.109 -12.271 1.00 118.70 ? 149  ILE L CA  1 
ATOM 5750 C C   . ILE E 5 149 ? 31.177 119.605 -12.117 1.00 114.37 ? 149  ILE L C   1 
ATOM 5751 O O   . ILE E 5 149 ? 30.374 120.312 -11.498 1.00 118.93 ? 149  ILE L O   1 
ATOM 5752 C CB  . ILE E 5 149 ? 29.566 117.826 -12.911 1.00 118.02 ? 149  ILE L CB  1 
ATOM 5753 C CG1 . ILE E 5 149 ? 29.250 116.333 -12.830 1.00 110.43 ? 149  ILE L CG1 1 
ATOM 5754 C CG2 . ILE E 5 149 ? 29.556 118.289 -14.357 1.00 107.09 ? 149  ILE L CG2 1 
ATOM 5755 C CD1 . ILE E 5 149 ? 27.898 115.963 -13.380 1.00 104.21 ? 149  ILE L CD1 1 
ATOM 5756 N N   . ASP E 5 150 ? 32.292 120.084 -12.673 1.00 110.95 ? 150  ASP L N   1 
ATOM 5757 C CA  . ASP E 5 150 ? 32.698 121.487 -12.557 1.00 142.52 ? 150  ASP L CA  1 
ATOM 5758 C C   . ASP E 5 150 ? 32.749 121.933 -11.097 1.00 137.67 ? 150  ASP L C   1 
ATOM 5759 O O   . ASP E 5 150 ? 32.404 123.069 -10.765 1.00 139.52 ? 150  ASP L O   1 
ATOM 5760 C CB  . ASP E 5 150 ? 31.778 122.410 -13.367 1.00 142.17 ? 150  ASP L CB  1 
ATOM 5761 C CG  . ASP E 5 150 ? 31.909 122.201 -14.863 1.00 133.40 ? 150  ASP L CG  1 
ATOM 5762 O OD1 . ASP E 5 150 ? 32.988 121.768 -15.316 1.00 132.62 ? 150  ASP L OD1 1 
ATOM 5763 O OD2 . ASP E 5 150 ? 30.930 122.484 -15.587 1.00 136.68 ? 150  ASP L OD2 1 
ATOM 5764 N N   . GLY E 5 151 ? 33.164 121.030 -10.209 1.00 123.72 ? 151  GLY L N   1 
ATOM 5765 C CA  . GLY E 5 151 ? 33.235 121.316 -8.799  1.00 113.60 ? 151  GLY L CA  1 
ATOM 5766 C C   . GLY E 5 151 ? 31.976 121.012 -8.018  1.00 112.90 ? 151  GLY L C   1 
ATOM 5767 O O   . GLY E 5 151 ? 32.061 120.787 -6.808  1.00 136.38 ? 151  GLY L O   1 
ATOM 5768 N N   . SER E 5 152 ? 30.812 120.988 -8.665  1.00 113.63 ? 152  SER L N   1 
ATOM 5769 C CA  . SER E 5 152 ? 29.563 120.744 -7.952  1.00 113.90 ? 152  SER L CA  1 
ATOM 5770 C C   . SER E 5 152 ? 29.321 119.249 -7.785  1.00 124.32 ? 152  SER L C   1 
ATOM 5771 O O   . SER E 5 152 ? 29.461 118.476 -8.736  1.00 121.45 ? 152  SER L O   1 
ATOM 5772 C CB  . SER E 5 152 ? 28.390 121.386 -8.690  1.00 117.57 ? 152  SER L CB  1 
ATOM 5773 O OG  . SER E 5 152 ? 28.543 122.789 -8.753  1.00 123.09 ? 152  SER L OG  1 
ATOM 5774 N N   . GLU E 5 153 ? 28.944 118.847 -6.575  1.00 108.24 ? 153  GLU L N   1 
ATOM 5775 C CA  . GLU E 5 153 ? 28.686 117.443 -6.300  1.00 104.17 ? 153  GLU L CA  1 
ATOM 5776 C C   . GLU E 5 153 ? 27.486 116.953 -7.098  1.00 104.07 ? 153  GLU L C   1 
ATOM 5777 O O   . GLU E 5 153 ? 26.508 117.679 -7.299  1.00 107.80 ? 153  GLU L O   1 
ATOM 5778 C CB  . GLU E 5 153 ? 28.446 117.229 -4.807  1.00 127.87 ? 153  GLU L CB  1 
ATOM 5779 C CG  . GLU E 5 153 ? 28.282 115.769 -4.411  1.00 118.43 ? 153  GLU L CG  1 
ATOM 5780 C CD  . GLU E 5 153 ? 28.090 115.586 -2.921  1.00 118.34 ? 153  GLU L CD  1 
ATOM 5781 O OE1 . GLU E 5 153 ? 28.005 116.602 -2.198  1.00 124.12 ? 153  GLU L OE1 1 
ATOM 5782 O OE2 . GLU E 5 153 ? 28.026 114.423 -2.472  1.00 116.80 ? 153  GLU L OE2 1 
ATOM 5783 N N   . ARG E 5 154 ? 27.575 115.712 -7.567  1.00 117.17 ? 154  ARG L N   1 
ATOM 5784 C CA  . ARG E 5 154 ? 26.504 115.051 -8.303  1.00 110.92 ? 154  ARG L CA  1 
ATOM 5785 C C   . ARG E 5 154 ? 26.158 113.776 -7.552  1.00 98.43  ? 154  ARG L C   1 
ATOM 5786 O O   . ARG E 5 154 ? 26.982 112.862 -7.465  1.00 98.83  ? 154  ARG L O   1 
ATOM 5787 C CB  . ARG E 5 154 ? 26.928 114.754 -9.741  1.00 117.42 ? 154  ARG L CB  1 
ATOM 5788 C CG  . ARG E 5 154 ? 25.837 114.154 -10.607 1.00 128.19 ? 154  ARG L CG  1 
ATOM 5789 C CD  . ARG E 5 154 ? 24.552 114.951 -10.479 1.00 142.79 ? 154  ARG L CD  1 
ATOM 5790 N NE  . ARG E 5 154 ? 23.610 114.652 -11.551 1.00 146.16 ? 154  ARG L NE  1 
ATOM 5791 C CZ  . ARG E 5 154 ? 23.526 115.348 -12.678 1.00 148.56 ? 154  ARG L CZ  1 
ATOM 5792 N NH1 . ARG E 5 154 ? 22.640 115.010 -13.605 1.00 160.06 ? 154  ARG L NH1 1 
ATOM 5793 N NH2 . ARG E 5 154 ? 24.328 116.383 -12.879 1.00 148.25 ? 154  ARG L NH2 1 
ATOM 5794 N N   . GLN E 5 155 ? 24.954 113.720 -6.989  1.00 91.39  ? 155  GLN L N   1 
ATOM 5795 C CA  . GLN E 5 155 ? 24.531 112.541 -6.245  1.00 117.23 ? 155  GLN L CA  1 
ATOM 5796 C C   . GLN E 5 155 ? 23.547 111.667 -7.006  1.00 133.16 ? 155  GLN L C   1 
ATOM 5797 O O   . GLN E 5 155 ? 23.515 110.453 -6.783  1.00 120.40 ? 155  GLN L O   1 
ATOM 5798 C CB  . GLN E 5 155 ? 23.894 112.945 -4.911  1.00 108.05 ? 155  GLN L CB  1 
ATOM 5799 C CG  . GLN E 5 155 ? 24.705 113.932 -4.098  1.00 105.70 ? 155  GLN L CG  1 
ATOM 5800 C CD  . GLN E 5 155 ? 23.954 114.409 -2.875  1.00 109.83 ? 155  GLN L CD  1 
ATOM 5801 O OE1 . GLN E 5 155 ? 22.921 113.844 -2.510  1.00 105.93 ? 155  GLN L OE1 1 
ATOM 5802 N NE2 . GLN E 5 155 ? 24.462 115.458 -2.236  1.00 116.71 ? 155  GLN L NE2 1 
ATOM 5803 N N   . ASN E 5 156 ? 22.735 112.250 -7.882  1.00 155.97 ? 156  ASN L N   1 
ATOM 5804 C CA  . ASN E 5 156 ? 21.709 111.507 -8.596  1.00 165.43 ? 156  ASN L CA  1 
ATOM 5805 C C   . ASN E 5 156 ? 22.303 110.916 -9.868  1.00 161.62 ? 156  ASN L C   1 
ATOM 5806 O O   . ASN E 5 156 ? 22.971 111.618 -10.634 1.00 169.54 ? 156  ASN L O   1 
ATOM 5807 C CB  . ASN E 5 156 ? 20.518 112.413 -8.922  1.00 180.37 ? 156  ASN L CB  1 
ATOM 5808 C CG  . ASN E 5 156 ? 19.322 111.644 -9.466  1.00 195.06 ? 156  ASN L CG  1 
ATOM 5809 O OD1 . ASN E 5 156 ? 19.216 110.429 -9.294  1.00 200.72 ? 156  ASN L OD1 1 
ATOM 5810 N ND2 . ASN E 5 156 ? 18.411 112.356 -10.122 1.00 200.95 ? 156  ASN L ND2 1 
ATOM 5811 N N   . GLY E 5 157 ? 22.072 109.622 -10.079 1.00 142.33 ? 157  GLY L N   1 
ATOM 5812 C CA  . GLY E 5 157 ? 22.509 108.960 -11.294 1.00 128.47 ? 157  GLY L CA  1 
ATOM 5813 C C   . GLY E 5 157 ? 23.879 108.318 -11.208 1.00 110.44 ? 157  GLY L C   1 
ATOM 5814 O O   . GLY E 5 157 ? 24.675 108.392 -12.149 1.00 108.22 ? 157  GLY L O   1 
ATOM 5815 N N   . VAL E 5 158 ? 24.164 107.670 -10.086 1.00 106.62 ? 158  VAL L N   1 
ATOM 5816 C CA  . VAL E 5 158 ? 25.440 107.005 -9.869  1.00 101.55 ? 158  VAL L CA  1 
ATOM 5817 C C   . VAL E 5 158 ? 25.155 105.581 -9.419  1.00 96.36  ? 158  VAL L C   1 
ATOM 5818 O O   . VAL E 5 158 ? 24.328 105.362 -8.527  1.00 95.04  ? 158  VAL L O   1 
ATOM 5819 C CB  . VAL E 5 158 ? 26.306 107.758 -8.840  1.00 97.37  ? 158  VAL L CB  1 
ATOM 5820 C CG1 . VAL E 5 158 ? 27.611 107.024 -8.603  1.00 94.30  ? 158  VAL L CG1 1 
ATOM 5821 C CG2 . VAL E 5 158 ? 26.576 109.184 -9.318  1.00 94.33  ? 158  VAL L CG2 1 
ATOM 5822 N N   . LEU E 5 159 ? 25.796 104.615 -10.072 1.00 98.47  ? 159  LEU L N   1 
ATOM 5823 C CA  . LEU E 5 159 ? 25.668 103.207 -9.721  1.00 104.64 ? 159  LEU L CA  1 
ATOM 5824 C C   . LEU E 5 159 ? 27.048 102.644 -9.433  1.00 115.60 ? 159  LEU L C   1 
ATOM 5825 O O   . LEU E 5 159 ? 27.935 102.686 -10.294 1.00 113.21 ? 159  LEU L O   1 
ATOM 5826 C CB  . LEU E 5 159 ? 24.990 102.408 -10.828 1.00 119.83 ? 159  LEU L CB  1 
ATOM 5827 C CG  . LEU E 5 159 ? 23.475 102.557 -10.944 1.00 137.00 ? 159  LEU L CG  1 
ATOM 5828 C CD1 . LEU E 5 159 ? 22.933 101.538 -11.934 1.00 147.20 ? 159  LEU L CD1 1 
ATOM 5829 C CD2 . LEU E 5 159 ? 22.812 102.408 -9.581  1.00 136.75 ? 159  LEU L CD2 1 
ATOM 5830 N N   . ASN E 5 160 ? 27.217 102.105 -8.230  1.00 122.13 ? 160  ASN L N   1 
ATOM 5831 C CA  . ASN E 5 160 ? 28.473 101.532 -7.779  1.00 115.64 ? 160  ASN L CA  1 
ATOM 5832 C C   . ASN E 5 160 ? 28.310 100.035 -7.584  1.00 103.93 ? 160  ASN L C   1 
ATOM 5833 O O   . ASN E 5 160 ? 27.277 99.574  -7.088  1.00 102.36 ? 160  ASN L O   1 
ATOM 5834 C CB  . ASN E 5 160 ? 28.930 102.172 -6.471  1.00 91.49  ? 160  ASN L CB  1 
ATOM 5835 C CG  . ASN E 5 160 ? 29.154 103.650 -6.606  1.00 90.93  ? 160  ASN L CG  1 
ATOM 5836 O OD1 . ASN E 5 160 ? 29.187 104.181 -7.713  1.00 93.13  ? 160  ASN L OD1 1 
ATOM 5837 N ND2 . ASN E 5 160 ? 29.321 104.329 -5.481  1.00 121.58 ? 160  ASN L ND2 1 
ATOM 5838 N N   . SER E 5 161 ? 29.340 99.286  -7.964  1.00 97.82  ? 161  SER L N   1 
ATOM 5839 C CA  . SER E 5 161 ? 29.332 97.832  -7.870  1.00 99.36  ? 161  SER L CA  1 
ATOM 5840 C C   . SER E 5 161 ? 30.646 97.368  -7.262  1.00 100.21 ? 161  SER L C   1 
ATOM 5841 O O   . SER E 5 161 ? 31.714 97.601  -7.840  1.00 105.83 ? 161  SER L O   1 
ATOM 5842 C CB  . SER E 5 161 ? 29.121 97.197  -9.247  1.00 104.49 ? 161  SER L CB  1 
ATOM 5843 O OG  . SER E 5 161 ? 29.036 95.790  -9.144  1.00 106.50 ? 161  SER L OG  1 
ATOM 5844 N N   . TRP E 5 162 ? 30.564 96.719  -6.101  1.00 95.50  ? 162  TRP L N   1 
ATOM 5845 C CA  . TRP E 5 162 ? 31.724 96.142  -5.435  1.00 104.16 ? 162  TRP L CA  1 
ATOM 5846 C C   . TRP E 5 162 ? 31.895 94.677  -5.817  1.00 97.11  ? 162  TRP L C   1 
ATOM 5847 O O   . TRP E 5 162 ? 30.919 93.950  -6.026  1.00 99.05  ? 162  TRP L O   1 
ATOM 5848 C CB  . TRP E 5 162 ? 31.595 96.228  -3.914  1.00 101.10 ? 162  TRP L CB  1 
ATOM 5849 C CG  . TRP E 5 162 ? 31.789 97.576  -3.307  1.00 91.49  ? 162  TRP L CG  1 
ATOM 5850 C CD1 . TRP E 5 162 ? 32.881 98.012  -2.609  1.00 87.65  ? 162  TRP L CD1 1 
ATOM 5851 C CD2 . TRP E 5 162 ? 30.853 98.659  -3.306  1.00 96.02  ? 162  TRP L CD2 1 
ATOM 5852 N NE1 . TRP E 5 162 ? 32.684 99.304  -2.186  1.00 90.71  ? 162  TRP L NE1 1 
ATOM 5853 C CE2 . TRP E 5 162 ? 31.447 99.725  -2.602  1.00 93.86  ? 162  TRP L CE2 1 
ATOM 5854 C CE3 . TRP E 5 162 ? 29.573 98.833  -3.839  1.00 101.65 ? 162  TRP L CE3 1 
ATOM 5855 C CZ2 . TRP E 5 162 ? 30.804 100.948 -2.418  1.00 95.68  ? 162  TRP L CZ2 1 
ATOM 5856 C CZ3 . TRP E 5 162 ? 28.939 100.047 -3.655  1.00 106.44 ? 162  TRP L CZ3 1 
ATOM 5857 C CH2 . TRP E 5 162 ? 29.554 101.089 -2.951  1.00 99.32  ? 162  TRP L CH2 1 
ATOM 5858 N N   . THR E 5 163 ? 33.149 94.239  -5.868  1.00 97.81  ? 163  THR L N   1 
ATOM 5859 C CA  . THR E 5 163 ? 33.471 92.837  -6.078  1.00 100.51 ? 163  THR L CA  1 
ATOM 5860 C C   . THR E 5 163 ? 33.734 92.148  -4.745  1.00 133.21 ? 163  THR L C   1 
ATOM 5861 O O   . THR E 5 163 ? 33.906 92.785  -3.703  1.00 132.98 ? 163  THR L O   1 
ATOM 5862 C CB  . THR E 5 163 ? 34.693 92.673  -6.989  1.00 104.07 ? 163  THR L CB  1 
ATOM 5863 O OG1 . THR E 5 163 ? 35.852 93.218  -6.348  1.00 101.51 ? 163  THR L OG1 1 
ATOM 5864 C CG2 . THR E 5 163 ? 34.470 93.364  -8.315  1.00 126.66 ? 163  THR L CG2 1 
ATOM 5865 N N   . ASP E 5 164 ? 33.755 90.821  -4.788  1.00 125.71 ? 164  ASP L N   1 
ATOM 5866 C CA  . ASP E 5 164 ? 34.167 90.071  -3.618  1.00 125.67 ? 164  ASP L CA  1 
ATOM 5867 C C   . ASP E 5 164 ? 35.689 90.080  -3.514  1.00 123.46 ? 164  ASP L C   1 
ATOM 5868 O O   . ASP E 5 164 ? 36.401 90.536  -4.412  1.00 134.97 ? 164  ASP L O   1 
ATOM 5869 C CB  . ASP E 5 164 ? 33.629 88.644  -3.670  1.00 140.42 ? 164  ASP L CB  1 
ATOM 5870 C CG  . ASP E 5 164 ? 33.687 87.955  -2.318  1.00 149.07 ? 164  ASP L CG  1 
ATOM 5871 O OD1 . ASP E 5 164 ? 34.131 88.602  -1.343  1.00 150.80 ? 164  ASP L OD1 1 
ATOM 5872 O OD2 . ASP E 5 164 ? 33.297 86.773  -2.224  1.00 153.52 ? 164  ASP L OD2 1 
ATOM 5873 N N   . GLN E 5 165 ? 36.186 89.581  -2.390  1.00 128.13 ? 165  GLN L N   1 
ATOM 5874 C CA  . GLN E 5 165 ? 37.614 89.624  -2.126  1.00 92.79  ? 165  GLN L CA  1 
ATOM 5875 C C   . GLN E 5 165 ? 38.363 88.813  -3.176  1.00 97.70  ? 165  GLN L C   1 
ATOM 5876 O O   . GLN E 5 165 ? 38.109 87.618  -3.345  1.00 100.04 ? 165  GLN L O   1 
ATOM 5877 C CB  . GLN E 5 165 ? 37.886 89.097  -0.721  1.00 95.78  ? 165  GLN L CB  1 
ATOM 5878 C CG  . GLN E 5 165 ? 39.266 89.421  -0.210  1.00 102.20 ? 165  GLN L CG  1 
ATOM 5879 C CD  . GLN E 5 165 ? 39.392 89.192  1.275   1.00 104.74 ? 165  GLN L CD  1 
ATOM 5880 O OE1 . GLN E 5 165 ? 38.454 88.727  1.927   1.00 110.63 ? 165  GLN L OE1 1 
ATOM 5881 N NE2 . GLN E 5 165 ? 40.554 89.521  1.823   1.00 105.83 ? 165  GLN L NE2 1 
ATOM 5882 N N   . ASP E 5 166 ? 39.264 89.473  -3.904  1.00 99.90  ? 166  ASP L N   1 
ATOM 5883 C CA  . ASP E 5 166 ? 40.019 88.801  -4.953  1.00 107.21 ? 166  ASP L CA  1 
ATOM 5884 C C   . ASP E 5 166 ? 40.932 87.755  -4.325  1.00 110.90 ? 166  ASP L C   1 
ATOM 5885 O O   . ASP E 5 166 ? 41.737 88.071  -3.445  1.00 104.70 ? 166  ASP L O   1 
ATOM 5886 C CB  . ASP E 5 166 ? 40.823 89.813  -5.769  1.00 131.43 ? 166  ASP L CB  1 
ATOM 5887 C CG  . ASP E 5 166 ? 41.346 89.231  -7.085  1.00 155.56 ? 166  ASP L CG  1 
ATOM 5888 O OD1 . ASP E 5 166 ? 40.994 88.080  -7.426  1.00 163.69 ? 166  ASP L OD1 1 
ATOM 5889 O OD2 . ASP E 5 166 ? 42.114 89.932  -7.782  1.00 159.65 ? 166  ASP L OD2 1 
ATOM 5890 N N   . SER E 5 167 ? 40.796 86.505  -4.772  1.00 126.65 ? 167  SER L N   1 
ATOM 5891 C CA  . SER E 5 167 ? 41.583 85.390  -4.255  1.00 126.50 ? 167  SER L CA  1 
ATOM 5892 C C   . SER E 5 167 ? 43.067 85.504  -4.565  1.00 128.19 ? 167  SER L C   1 
ATOM 5893 O O   . SER E 5 167 ? 43.857 84.729  -4.014  1.00 133.74 ? 167  SER L O   1 
ATOM 5894 C CB  . SER E 5 167 ? 41.055 84.092  -4.842  1.00 120.98 ? 167  SER L CB  1 
ATOM 5895 O OG  . SER E 5 167 ? 41.030 84.193  -6.252  1.00 119.97 ? 167  SER L OG  1 
ATOM 5896 N N   . LYS E 5 168 ? 43.460 86.419  -5.447  1.00 130.03 ? 168  LYS L N   1 
ATOM 5897 C CA  . LYS E 5 168 ? 44.873 86.598  -5.758  1.00 134.20 ? 168  LYS L CA  1 
ATOM 5898 C C   . LYS E 5 168 ? 45.586 87.360  -4.644  1.00 122.17 ? 168  LYS L C   1 
ATOM 5899 O O   . LYS E 5 168 ? 46.526 86.847  -4.029  1.00 118.17 ? 168  LYS L O   1 
ATOM 5900 C CB  . LYS E 5 168 ? 45.022 87.321  -7.102  1.00 139.80 ? 168  LYS L CB  1 
ATOM 5901 C CG  . LYS E 5 168 ? 46.461 87.558  -7.536  1.00 141.84 ? 168  LYS L CG  1 
ATOM 5902 C CD  . LYS E 5 168 ? 46.517 88.381  -8.816  1.00 143.28 ? 168  LYS L CD  1 
ATOM 5903 C CE  . LYS E 5 168 ? 47.952 88.649  -9.248  1.00 143.22 ? 168  LYS L CE  1 
ATOM 5904 N NZ  . LYS E 5 168 ? 48.000 89.458  -10.498 1.00 146.04 ? 168  LYS L NZ  1 
ATOM 5905 N N   . ASP E 5 169 ? 45.138 88.585  -4.357  1.00 128.02 ? 169  ASP L N   1 
ATOM 5906 C CA  . ASP E 5 169 ? 45.823 89.454  -3.406  1.00 131.82 ? 169  ASP L CA  1 
ATOM 5907 C C   . ASP E 5 169 ? 44.941 89.894  -2.243  1.00 113.62 ? 169  ASP L C   1 
ATOM 5908 O O   . ASP E 5 169 ? 45.327 90.807  -1.504  1.00 109.45 ? 169  ASP L O   1 
ATOM 5909 C CB  . ASP E 5 169 ? 46.387 90.686  -4.121  1.00 148.63 ? 169  ASP L CB  1 
ATOM 5910 C CG  . ASP E 5 169 ? 45.311 91.508  -4.807  1.00 153.49 ? 169  ASP L CG  1 
ATOM 5911 O OD1 . ASP E 5 169 ? 44.215 90.965  -5.063  1.00 156.62 ? 169  ASP L OD1 1 
ATOM 5912 O OD2 . ASP E 5 169 ? 45.560 92.698  -5.095  1.00 154.55 ? 169  ASP L OD2 1 
ATOM 5913 N N   . SER E 5 170 ? 43.772 89.276  -2.065  1.00 110.79 ? 170  SER L N   1 
ATOM 5914 C CA  . SER E 5 170 ? 42.894 89.536  -0.920  1.00 111.90 ? 170  SER L CA  1 
ATOM 5915 C C   . SER E 5 170 ? 42.424 90.987  -0.870  1.00 120.93 ? 170  SER L C   1 
ATOM 5916 O O   . SER E 5 170 ? 42.100 91.509  0.200   1.00 120.22 ? 170  SER L O   1 
ATOM 5917 C CB  . SER E 5 170 ? 43.573 89.158  0.398   1.00 110.97 ? 170  SER L CB  1 
ATOM 5918 O OG  . SER E 5 170 ? 43.964 87.799  0.392   1.00 123.07 ? 170  SER L OG  1 
ATOM 5919 N N   . THR E 5 171 ? 42.375 91.649  -2.020  1.00 124.75 ? 171  THR L N   1 
ATOM 5920 C CA  . THR E 5 171 ? 41.934 93.030  -2.114  1.00 118.83 ? 171  THR L CA  1 
ATOM 5921 C C   . THR E 5 171 ? 40.551 93.094  -2.743  1.00 116.24 ? 171  THR L C   1 
ATOM 5922 O O   . THR E 5 171 ? 40.038 92.118  -3.292  1.00 121.95 ? 171  THR L O   1 
ATOM 5923 C CB  . THR E 5 171 ? 42.915 93.867  -2.937  1.00 128.36 ? 171  THR L CB  1 
ATOM 5924 O OG1 . THR E 5 171 ? 42.994 93.333  -4.264  1.00 137.72 ? 171  THR L OG1 1 
ATOM 5925 C CG2 . THR E 5 171 ? 44.288 93.840  -2.301  1.00 136.57 ? 171  THR L CG2 1 
ATOM 5926 N N   . TYR E 5 172 ? 39.951 94.271  -2.657  1.00 114.86 ? 172  TYR L N   1 
ATOM 5927 C CA  . TYR E 5 172 ? 38.648 94.513  -3.244  1.00 111.30 ? 172  TYR L CA  1 
ATOM 5928 C C   . TYR E 5 172 ? 38.767 95.524  -4.372  1.00 107.20 ? 172  TYR L C   1 
ATOM 5929 O O   . TYR E 5 172 ? 39.776 96.217  -4.518  1.00 123.38 ? 172  TYR L O   1 
ATOM 5930 C CB  . TYR E 5 172 ? 37.658 95.016  -2.193  1.00 104.72 ? 172  TYR L CB  1 
ATOM 5931 C CG  . TYR E 5 172 ? 37.344 94.010  -1.116  1.00 104.39 ? 172  TYR L CG  1 
ATOM 5932 C CD1 . TYR E 5 172 ? 36.344 93.067  -1.295  1.00 107.68 ? 172  TYR L CD1 1 
ATOM 5933 C CD2 . TYR E 5 172 ? 38.042 94.006  0.084   1.00 104.86 ? 172  TYR L CD2 1 
ATOM 5934 C CE1 . TYR E 5 172 ? 36.048 92.147  -0.313  1.00 119.03 ? 172  TYR L CE1 1 
ATOM 5935 C CE2 . TYR E 5 172 ? 37.752 93.089  1.075   1.00 106.68 ? 172  TYR L CE2 1 
ATOM 5936 C CZ  . TYR E 5 172 ? 36.753 92.162  0.871   1.00 122.22 ? 172  TYR L CZ  1 
ATOM 5937 O OH  . TYR E 5 172 ? 36.460 91.245  1.854   1.00 135.82 ? 172  TYR L OH  1 
ATOM 5938 N N   . SER E 5 173 ? 37.717 95.595  -5.178  1.00 96.48  ? 173  SER L N   1 
ATOM 5939 C CA  . SER E 5 173 ? 37.642 96.595  -6.225  1.00 99.02  ? 173  SER L CA  1 
ATOM 5940 C C   . SER E 5 173 ? 36.193 97.031  -6.359  1.00 125.28 ? 173  SER L C   1 
ATOM 5941 O O   . SER E 5 173 ? 35.272 96.358  -5.887  1.00 96.17  ? 173  SER L O   1 
ATOM 5942 C CB  . SER E 5 173 ? 38.198 96.067  -7.550  1.00 104.58 ? 173  SER L CB  1 
ATOM 5943 O OG  . SER E 5 173 ? 39.538 95.630  -7.395  1.00 106.16 ? 173  SER L OG  1 
ATOM 5944 N N   . MET E 5 174 ? 36.005 98.187  -6.987  1.00 92.99  ? 174  MET L N   1 
ATOM 5945 C CA  . MET E 5 174 ? 34.676 98.756  -7.134  1.00 84.50  ? 174  MET L CA  1 
ATOM 5946 C C   . MET E 5 174 ? 34.644 99.646  -8.369  1.00 77.96  ? 174  MET L C   1 
ATOM 5947 O O   . MET E 5 174 ? 35.607 100.363 -8.654  1.00 78.72  ? 174  MET L O   1 
ATOM 5948 C CB  . MET E 5 174 ? 34.280 99.548  -5.883  1.00 76.28  ? 174  MET L CB  1 
ATOM 5949 C CG  . MET E 5 174 ? 32.841 100.008 -5.881  1.00 84.51  ? 174  MET L CG  1 
ATOM 5950 S SD  . MET E 5 174 ? 32.767 101.793 -5.902  1.00 87.80  ? 174  MET L SD  1 
ATOM 5951 C CE  . MET E 5 174 ? 33.524 102.158 -4.339  1.00 93.88  ? 174  MET L CE  1 
ATOM 5952 N N   . SER E 5 175 ? 33.540 99.575  -9.109  1.00 70.94  ? 175  SER L N   1 
ATOM 5953 C CA  . SER E 5 175 ? 33.296 100.463 -10.236 1.00 70.08  ? 175  SER L CA  1 
ATOM 5954 C C   . SER E 5 175 ? 32.208 101.464 -9.879  1.00 94.06  ? 175  SER L C   1 
ATOM 5955 O O   . SER E 5 175 ? 31.201 101.108 -9.260  1.00 96.88  ? 175  SER L O   1 
ATOM 5956 C CB  . SER E 5 175 ? 32.857 99.699  -11.476 1.00 78.50  ? 175  SER L CB  1 
ATOM 5957 O OG  . SER E 5 175 ? 31.450 99.824  -11.636 1.00 83.02  ? 175  SER L OG  1 
ATOM 5958 N N   . SER E 5 176 ? 32.402 102.711 -10.300 1.00 104.42 ? 176  SER L N   1 
ATOM 5959 C CA  . SER E 5 176 ? 31.447 103.783 -10.045 1.00 98.65  ? 176  SER L CA  1 
ATOM 5960 C C   . SER E 5 176 ? 31.098 104.439 -11.374 1.00 100.77 ? 176  SER L C   1 
ATOM 5961 O O   . SER E 5 176 ? 31.946 105.099 -11.983 1.00 95.23  ? 176  SER L O   1 
ATOM 5962 C CB  . SER E 5 176 ? 32.014 104.797 -9.057  1.00 82.86  ? 176  SER L CB  1 
ATOM 5963 O OG  . SER E 5 176 ? 31.033 105.751 -8.699  1.00 83.88  ? 176  SER L OG  1 
ATOM 5964 N N   . THR E 5 177 ? 29.853 104.264 -11.816 1.00 103.36 ? 177  THR L N   1 
ATOM 5965 C CA  . THR E 5 177 ? 29.383 104.758 -13.105 1.00 96.19  ? 177  THR L CA  1 
ATOM 5966 C C   . THR E 5 177 ? 28.407 105.907 -12.894 1.00 93.52  ? 177  THR L C   1 
ATOM 5967 O O   . THR E 5 177 ? 27.316 105.709 -12.345 1.00 103.62 ? 177  THR L O   1 
ATOM 5968 C CB  . THR E 5 177 ? 28.708 103.648 -13.909 1.00 106.33 ? 177  THR L CB  1 
ATOM 5969 O OG1 . THR E 5 177 ? 29.630 102.571 -14.115 1.00 125.64 ? 177  THR L OG1 1 
ATOM 5970 C CG2 . THR E 5 177 ? 28.241 104.176 -15.255 1.00 106.05 ? 177  THR L CG2 1 
ATOM 5971 N N   . LEU E 5 178 ? 28.794 107.095 -13.355 1.00 86.03  ? 178  LEU L N   1 
ATOM 5972 C CA  . LEU E 5 178 ? 27.932 108.273 -13.371 1.00 86.16  ? 178  LEU L CA  1 
ATOM 5973 C C   . LEU E 5 178 ? 27.347 108.414 -14.773 1.00 81.50  ? 178  LEU L C   1 
ATOM 5974 O O   . LEU E 5 178 ? 28.062 108.759 -15.717 1.00 71.87  ? 178  LEU L O   1 
ATOM 5975 C CB  . LEU E 5 178 ? 28.721 109.521 -12.978 1.00 94.88  ? 178  LEU L CB  1 
ATOM 5976 C CG  . LEU E 5 178 ? 28.102 110.895 -13.253 1.00 95.49  ? 178  LEU L CG  1 
ATOM 5977 C CD1 . LEU E 5 178 ? 26.826 111.085 -12.447 1.00 99.28  ? 178  LEU L CD1 1 
ATOM 5978 C CD2 . LEU E 5 178 ? 29.103 112.009 -12.959 1.00 76.95  ? 178  LEU L CD2 1 
ATOM 5979 N N   . THR E 5 179 ? 26.056 108.126 -14.914 1.00 90.82  ? 179  THR L N   1 
ATOM 5980 C CA  . THR E 5 179 ? 25.366 108.253 -16.190 1.00 73.93  ? 179  THR L CA  1 
ATOM 5981 C C   . THR E 5 179 ? 24.664 109.601 -16.249 1.00 94.42  ? 179  THR L C   1 
ATOM 5982 O O   . THR E 5 179 ? 23.969 109.993 -15.307 1.00 77.05  ? 179  THR L O   1 
ATOM 5983 C CB  . THR E 5 179 ? 24.353 107.126 -16.407 1.00 94.43  ? 179  THR L CB  1 
ATOM 5984 O OG1 . THR E 5 179 ? 23.390 107.135 -15.347 1.00 112.96 ? 179  THR L OG1 1 
ATOM 5985 C CG2 . THR E 5 179 ? 25.044 105.770 -16.449 1.00 87.41  ? 179  THR L CG2 1 
ATOM 5986 N N   . LEU E 5 180 ? 24.849 110.299 -17.363 1.00 98.25  ? 180  LEU L N   1 
ATOM 5987 C CA  . LEU E 5 180 ? 24.265 111.604 -17.603 1.00 100.52 ? 180  LEU L CA  1 
ATOM 5988 C C   . LEU E 5 180 ? 23.696 111.626 -19.009 1.00 110.10 ? 180  LEU L C   1 
ATOM 5989 O O   . LEU E 5 180 ? 24.042 110.797 -19.854 1.00 100.68 ? 180  LEU L O   1 
ATOM 5990 C CB  . LEU E 5 180 ? 25.296 112.720 -17.466 1.00 90.66  ? 180  LEU L CB  1 
ATOM 5991 C CG  . LEU E 5 180 ? 26.136 112.719 -16.206 1.00 89.70  ? 180  LEU L CG  1 
ATOM 5992 C CD1 . LEU E 5 180 ? 27.233 113.727 -16.422 1.00 76.33  ? 180  LEU L CD1 1 
ATOM 5993 C CD2 . LEU E 5 180 ? 25.267 113.072 -15.005 1.00 109.00 ? 180  LEU L CD2 1 
ATOM 5994 N N   . THR E 5 181 ? 22.832 112.601 -19.258 1.00 121.27 ? 181  THR L N   1 
ATOM 5995 C CA  . THR E 5 181 ? 22.339 112.823 -20.604 1.00 117.60 ? 181  THR L CA  1 
ATOM 5996 C C   . THR E 5 181 ? 23.444 113.435 -21.463 1.00 109.93 ? 181  THR L C   1 
ATOM 5997 O O   . THR E 5 181 ? 24.390 114.050 -20.961 1.00 112.33 ? 181  THR L O   1 
ATOM 5998 C CB  . THR E 5 181 ? 21.109 113.729 -20.571 1.00 121.86 ? 181  THR L CB  1 
ATOM 5999 O OG1 . THR E 5 181 ? 21.505 115.065 -20.242 1.00 130.98 ? 181  THR L OG1 1 
ATOM 6000 C CG2 . THR E 5 181 ? 20.147 113.241 -19.511 1.00 124.03 ? 181  THR L CG2 1 
ATOM 6001 N N   . LYS E 5 182 ? 23.329 113.239 -22.778 1.00 92.61  ? 182  LYS L N   1 
ATOM 6002 C CA  . LYS E 5 182 ? 24.306 113.826 -23.688 1.00 93.67  ? 182  LYS L CA  1 
ATOM 6003 C C   . LYS E 5 182 ? 24.269 115.351 -23.631 1.00 101.86 ? 182  LYS L C   1 
ATOM 6004 O O   . LYS E 5 182 ? 25.316 116.004 -23.703 1.00 99.59  ? 182  LYS L O   1 
ATOM 6005 C CB  . LYS E 5 182 ? 24.066 113.336 -25.118 1.00 102.20 ? 182  LYS L CB  1 
ATOM 6006 C CG  . LYS E 5 182 ? 25.100 113.831 -26.129 1.00 108.91 ? 182  LYS L CG  1 
ATOM 6007 C CD  . LYS E 5 182 ? 24.765 113.375 -27.542 1.00 117.51 ? 182  LYS L CD  1 
ATOM 6008 C CE  . LYS E 5 182 ? 25.868 113.730 -28.533 1.00 123.58 ? 182  LYS L CE  1 
ATOM 6009 N NZ  . LYS E 5 182 ? 25.612 113.165 -29.893 1.00 126.95 ? 182  LYS L NZ  1 
ATOM 6010 N N   . ASP E 5 183 ? 23.076 115.939 -23.492 1.00 99.49  ? 183  ASP L N   1 
ATOM 6011 C CA  . ASP E 5 183 ? 22.977 117.396 -23.480 1.00 100.86 ? 183  ASP L CA  1 
ATOM 6012 C C   . ASP E 5 183 ? 23.596 117.983 -22.221 1.00 107.16 ? 183  ASP L C   1 
ATOM 6013 O O   . ASP E 5 183 ? 24.295 119.000 -22.284 1.00 116.00 ? 183  ASP L O   1 
ATOM 6014 C CB  . ASP E 5 183 ? 21.519 117.837 -23.608 1.00 113.08 ? 183  ASP L CB  1 
ATOM 6015 C CG  . ASP E 5 183 ? 21.372 119.351 -23.657 1.00 116.06 ? 183  ASP L CG  1 
ATOM 6016 O OD1 . ASP E 5 183 ? 21.922 119.972 -24.591 1.00 117.38 ? 183  ASP L OD1 1 
ATOM 6017 O OD2 . ASP E 5 183 ? 20.708 119.920 -22.763 1.00 116.28 ? 183  ASP L OD2 1 
ATOM 6018 N N   . GLU E 5 184 ? 23.339 117.365 -21.066 1.00 117.99 ? 184  GLU L N   1 
ATOM 6019 C CA  . GLU E 5 184 ? 23.955 117.829 -19.829 1.00 125.89 ? 184  GLU L CA  1 
ATOM 6020 C C   . GLU E 5 184 ? 25.461 117.616 -19.854 1.00 116.58 ? 184  GLU L C   1 
ATOM 6021 O O   . GLU E 5 184 ? 26.221 118.444 -19.340 1.00 124.89 ? 184  GLU L O   1 
ATOM 6022 C CB  . GLU E 5 184 ? 23.335 117.111 -18.634 1.00 143.59 ? 184  GLU L CB  1 
ATOM 6023 C CG  . GLU E 5 184 ? 23.791 117.654 -17.293 1.00 154.34 ? 184  GLU L CG  1 
ATOM 6024 C CD  . GLU E 5 184 ? 23.186 116.901 -16.128 1.00 160.43 ? 184  GLU L CD  1 
ATOM 6025 O OE1 . GLU E 5 184 ? 22.670 115.782 -16.342 1.00 158.10 ? 184  GLU L OE1 1 
ATOM 6026 O OE2 . GLU E 5 184 ? 23.225 117.429 -14.997 1.00 164.72 ? 184  GLU L OE2 1 
ATOM 6027 N N   . TYR E 5 185 ? 25.910 116.515 -20.451 1.00 95.30  ? 185  TYR L N   1 
ATOM 6028 C CA  . TYR E 5 185 ? 27.342 116.301 -20.599 1.00 91.28  ? 185  TYR L CA  1 
ATOM 6029 C C   . TYR E 5 185 ? 27.967 117.345 -21.519 1.00 112.29 ? 185  TYR L C   1 
ATOM 6030 O O   . TYR E 5 185 ? 29.111 117.754 -21.296 1.00 112.11 ? 185  TYR L O   1 
ATOM 6031 C CB  . TYR E 5 185 ? 27.599 114.884 -21.120 1.00 86.09  ? 185  TYR L CB  1 
ATOM 6032 C CG  . TYR E 5 185 ? 29.059 114.521 -21.264 1.00 79.99  ? 185  TYR L CG  1 
ATOM 6033 C CD1 . TYR E 5 185 ? 29.785 114.040 -20.185 1.00 77.15  ? 185  TYR L CD1 1 
ATOM 6034 C CD2 . TYR E 5 185 ? 29.710 114.649 -22.485 1.00 81.42  ? 185  TYR L CD2 1 
ATOM 6035 C CE1 . TYR E 5 185 ? 31.119 113.710 -20.308 1.00 77.34  ? 185  TYR L CE1 1 
ATOM 6036 C CE2 . TYR E 5 185 ? 31.047 114.319 -22.620 1.00 80.83  ? 185  TYR L CE2 1 
ATOM 6037 C CZ  . TYR E 5 185 ? 31.747 113.850 -21.523 1.00 79.32  ? 185  TYR L CZ  1 
ATOM 6038 O OH  . TYR E 5 185 ? 33.078 113.510 -21.620 1.00 80.38  ? 185  TYR L OH  1 
ATOM 6039 N N   . GLU E 5 186 ? 27.220 117.820 -22.522 1.00 133.64 ? 186  GLU L N   1 
ATOM 6040 C CA  . GLU E 5 186 ? 27.742 118.723 -23.543 1.00 147.99 ? 186  GLU L CA  1 
ATOM 6041 C C   . GLU E 5 186 ? 27.926 120.151 -23.052 1.00 146.27 ? 186  GLU L C   1 
ATOM 6042 O O   . GLU E 5 186 ? 28.274 121.022 -23.853 1.00 155.50 ? 186  GLU L O   1 
ATOM 6043 C CB  . GLU E 5 186 ? 26.823 118.731 -24.774 1.00 163.59 ? 186  GLU L CB  1 
ATOM 6044 C CG  . GLU E 5 186 ? 27.094 117.626 -25.792 1.00 168.94 ? 186  GLU L CG  1 
ATOM 6045 C CD  . GLU E 5 186 ? 26.238 117.761 -27.044 1.00 178.95 ? 186  GLU L CD  1 
ATOM 6046 O OE1 . GLU E 5 186 ? 25.427 118.709 -27.116 1.00 183.42 ? 186  GLU L OE1 1 
ATOM 6047 O OE2 . GLU E 5 186 ? 26.374 116.920 -27.958 1.00 182.96 ? 186  GLU L OE2 1 
ATOM 6048 N N   . ARG E 5 187 ? 27.702 120.414 -21.768 1.00 130.16 ? 187  ARG L N   1 
ATOM 6049 C CA  . ARG E 5 187 ? 27.719 121.768 -21.235 1.00 133.05 ? 187  ARG L CA  1 
ATOM 6050 C C   . ARG E 5 187 ? 28.505 121.837 -19.934 1.00 129.79 ? 187  ARG L C   1 
ATOM 6051 O O   . ARG E 5 187 ? 28.283 122.731 -19.114 1.00 131.08 ? 187  ARG L O   1 
ATOM 6052 C CB  . ARG E 5 187 ? 26.298 122.287 -21.047 1.00 128.62 ? 187  ARG L CB  1 
ATOM 6053 C CG  . ARG E 5 187 ? 25.591 122.532 -22.374 1.00 134.81 ? 187  ARG L CG  1 
ATOM 6054 C CD  . ARG E 5 187 ? 24.156 122.961 -22.202 1.00 134.17 ? 187  ARG L CD  1 
ATOM 6055 N NE  . ARG E 5 187 ? 23.495 123.183 -23.484 1.00 139.79 ? 187  ARG L NE  1 
ATOM 6056 C CZ  . ARG E 5 187 ? 22.197 123.430 -23.613 1.00 141.89 ? 187  ARG L CZ  1 
ATOM 6057 N NH1 . ARG E 5 187 ? 21.665 123.625 -24.813 1.00 138.37 ? 187  ARG L NH1 1 
ATOM 6058 N NH2 . ARG E 5 187 ? 21.429 123.477 -22.534 1.00 146.52 ? 187  ARG L NH2 1 
ATOM 6059 N N   . HIS E 5 188 ? 29.435 120.903 -19.737 1.00 125.92 ? 188  HIS L N   1 
ATOM 6060 C CA  . HIS E 5 188 ? 30.310 120.911 -18.572 1.00 107.41 ? 188  HIS L CA  1 
ATOM 6061 C C   . HIS E 5 188 ? 31.686 120.404 -18.975 1.00 109.13 ? 188  HIS L C   1 
ATOM 6062 O O   . HIS E 5 188 ? 31.800 119.477 -19.784 1.00 113.96 ? 188  HIS L O   1 
ATOM 6063 C CB  . HIS E 5 188 ? 29.752 120.054 -17.436 1.00 94.61  ? 188  HIS L CB  1 
ATOM 6064 C CG  . HIS E 5 188 ? 28.498 120.596 -16.831 1.00 92.23  ? 188  HIS L CG  1 
ATOM 6065 N ND1 . HIS E 5 188 ? 28.479 121.740 -16.062 1.00 97.65  ? 188  HIS L ND1 1 
ATOM 6066 C CD2 . HIS E 5 188 ? 27.220 120.151 -16.878 1.00 91.03  ? 188  HIS L CD2 1 
ATOM 6067 C CE1 . HIS E 5 188 ? 27.242 121.977 -15.663 1.00 107.23 ? 188  HIS L CE1 1 
ATOM 6068 N NE2 . HIS E 5 188 ? 26.459 121.028 -16.145 1.00 102.46 ? 188  HIS L NE2 1 
ATOM 6069 N N   . ASN E 5 189 ? 32.725 121.000 -18.387 1.00 119.46 ? 189  ASN L N   1 
ATOM 6070 C CA  . ASN E 5 189 ? 34.106 120.729 -18.775 1.00 114.26 ? 189  ASN L CA  1 
ATOM 6071 C C   . ASN E 5 189 ? 34.770 119.648 -17.926 1.00 112.07 ? 189  ASN L C   1 
ATOM 6072 O O   . ASN E 5 189 ? 35.192 118.618 -18.458 1.00 115.19 ? 189  ASN L O   1 
ATOM 6073 C CB  . ASN E 5 189 ? 34.933 122.019 -18.703 1.00 128.71 ? 189  ASN L CB  1 
ATOM 6074 C CG  . ASN E 5 189 ? 36.360 121.813 -19.174 1.00 143.60 ? 189  ASN L CG  1 
ATOM 6075 O OD1 . ASN E 5 189 ? 36.620 120.975 -20.033 1.00 153.52 ? 189  ASN L OD1 1 
ATOM 6076 N ND2 . ASN E 5 189 ? 37.294 122.568 -18.603 1.00 147.23 ? 189  ASN L ND2 1 
ATOM 6077 N N   . SER E 5 190 ? 34.887 119.864 -16.617 1.00 116.23 ? 190  SER L N   1 
ATOM 6078 C CA  . SER E 5 190 ? 35.689 119.001 -15.758 1.00 117.97 ? 190  SER L CA  1 
ATOM 6079 C C   . SER E 5 190 ? 34.795 117.999 -15.032 1.00 109.01 ? 190  SER L C   1 
ATOM 6080 O O   . SER E 5 190 ? 33.842 118.390 -14.351 1.00 103.92 ? 190  SER L O   1 
ATOM 6081 C CB  . SER E 5 190 ? 36.494 119.828 -14.753 1.00 129.10 ? 190  SER L CB  1 
ATOM 6082 O OG  . SER E 5 190 ? 35.639 120.579 -13.911 1.00 140.17 ? 190  SER L OG  1 
ATOM 6083 N N   . TYR E 5 191 ? 35.118 116.713 -15.168 1.00 112.40 ? 191  TYR L N   1 
ATOM 6084 C CA  . TYR E 5 191 ? 34.458 115.636 -14.440 1.00 104.01 ? 191  TYR L CA  1 
ATOM 6085 C C   . TYR E 5 191 ? 35.467 114.989 -13.502 1.00 105.03 ? 191  TYR L C   1 
ATOM 6086 O O   . TYR E 5 191 ? 36.558 114.595 -13.929 1.00 104.69 ? 191  TYR L O   1 
ATOM 6087 C CB  . TYR E 5 191 ? 33.866 114.596 -15.395 1.00 92.70  ? 191  TYR L CB  1 
ATOM 6088 C CG  . TYR E 5 191 ? 32.792 115.161 -16.300 1.00 86.15  ? 191  TYR L CG  1 
ATOM 6089 C CD1 . TYR E 5 191 ? 33.123 115.737 -17.516 1.00 93.34  ? 191  TYR L CD1 1 
ATOM 6090 C CD2 . TYR E 5 191 ? 31.452 115.140 -15.929 1.00 82.23  ? 191  TYR L CD2 1 
ATOM 6091 C CE1 . TYR E 5 191 ? 32.154 116.270 -18.344 1.00 95.07  ? 191  TYR L CE1 1 
ATOM 6092 C CE2 . TYR E 5 191 ? 30.473 115.671 -16.751 1.00 82.53  ? 191  TYR L CE2 1 
ATOM 6093 C CZ  . TYR E 5 191 ? 30.832 116.235 -17.958 1.00 89.01  ? 191  TYR L CZ  1 
ATOM 6094 O OH  . TYR E 5 191 ? 29.872 116.766 -18.787 1.00 91.23  ? 191  TYR L OH  1 
ATOM 6095 N N   . THR E 5 192 ? 35.102 114.889 -12.229 1.00 105.66 ? 192  THR L N   1 
ATOM 6096 C CA  . THR E 5 192 ? 36.030 114.501 -11.182 1.00 98.53  ? 192  THR L CA  1 
ATOM 6097 C C   . THR E 5 192 ? 35.456 113.346 -10.383 1.00 96.44  ? 192  THR L C   1 
ATOM 6098 O O   . THR E 5 192 ? 34.259 113.312 -10.077 1.00 79.72  ? 192  THR L O   1 
ATOM 6099 C CB  . THR E 5 192 ? 36.340 115.677 -10.245 1.00 97.29  ? 192  THR L CB  1 
ATOM 6100 O OG1 . THR E 5 192 ? 36.773 116.800 -11.022 1.00 99.63  ? 192  THR L OG1 1 
ATOM 6101 C CG2 . THR E 5 192 ? 37.430 115.306 -9.254  1.00 96.40  ? 192  THR L CG2 1 
ATOM 6102 N N   . CYS E 5 193 ? 36.327 112.408 -10.046 1.00 95.73  ? 193  CYS L N   1 
ATOM 6103 C CA  . CYS E 5 193 ? 35.978 111.229 -9.269  1.00 102.37 ? 193  CYS L CA  1 
ATOM 6104 C C   . CYS E 5 193 ? 36.871 111.219 -8.036  1.00 111.09 ? 193  CYS L C   1 
ATOM 6105 O O   . CYS E 5 193 ? 38.095 111.082 -8.152  1.00 118.35 ? 193  CYS L O   1 
ATOM 6106 C CB  . CYS E 5 193 ? 36.153 109.974 -10.120 1.00 112.71 ? 193  CYS L CB  1 
ATOM 6107 S SG  . CYS E 5 193 ? 36.326 108.449 -9.229  1.00 116.89 ? 193  CYS L SG  1 
ATOM 6108 N N   . GLU E 5 194 ? 36.266 111.407 -6.864  1.00 105.16 ? 194  GLU L N   1 
ATOM 6109 C CA  . GLU E 5 194 ? 36.978 111.413 -5.593  1.00 109.01 ? 194  GLU L CA  1 
ATOM 6110 C C   . GLU E 5 194 ? 36.601 110.179 -4.783  1.00 108.88 ? 194  GLU L C   1 
ATOM 6111 O O   . GLU E 5 194 ? 35.427 109.803 -4.718  1.00 110.81 ? 194  GLU L O   1 
ATOM 6112 C CB  . GLU E 5 194 ? 36.665 112.674 -4.782  1.00 108.62 ? 194  GLU L CB  1 
ATOM 6113 C CG  . GLU E 5 194 ? 37.074 113.973 -5.443  1.00 121.60 ? 194  GLU L CG  1 
ATOM 6114 C CD  . GLU E 5 194 ? 36.841 115.173 -4.545  1.00 143.33 ? 194  GLU L CD  1 
ATOM 6115 O OE1 . GLU E 5 194 ? 36.327 114.984 -3.421  1.00 150.18 ? 194  GLU L OE1 1 
ATOM 6116 O OE2 . GLU E 5 194 ? 37.173 116.304 -4.960  1.00 149.69 ? 194  GLU L OE2 1 
ATOM 6117 N N   . ALA E 5 195 ? 37.600 109.557 -4.157  1.00 108.84 ? 195  ALA L N   1 
ATOM 6118 C CA  . ALA E 5 195 ? 37.410 108.338 -3.373  1.00 97.94  ? 195  ALA L CA  1 
ATOM 6119 C C   . ALA E 5 195 ? 38.099 108.501 -2.026  1.00 90.93  ? 195  ALA L C   1 
ATOM 6120 O O   . ALA E 5 195 ? 39.333 108.537 -1.958  1.00 94.00  ? 195  ALA L O   1 
ATOM 6121 C CB  . ALA E 5 195 ? 37.959 107.121 -4.115  1.00 97.43  ? 195  ALA L CB  1 
ATOM 6122 N N   . THR E 5 196 ? 37.312 108.603 -0.959  1.00 96.33  ? 196  THR L N   1 
ATOM 6123 C CA  . THR E 5 196 ? 37.866 108.713 0.384   1.00 110.11 ? 196  THR L CA  1 
ATOM 6124 C C   . THR E 5 196 ? 37.964 107.322 0.998   1.00 101.25 ? 196  THR L C   1 
ATOM 6125 O O   . THR E 5 196 ? 36.995 106.552 0.980   1.00 88.35  ? 196  THR L O   1 
ATOM 6126 C CB  . THR E 5 196 ? 37.023 109.643 1.265   1.00 108.10 ? 196  THR L CB  1 
ATOM 6127 O OG1 . THR E 5 196 ? 35.938 108.919 1.857   1.00 110.10 ? 196  THR L OG1 1 
ATOM 6128 C CG2 . THR E 5 196 ? 36.468 110.799 0.438   1.00 106.97 ? 196  THR L CG2 1 
ATOM 6129 N N   . HIS E 5 197 ? 39.145 106.995 1.513   1.00 103.41 ? 197  HIS L N   1 
ATOM 6130 C CA  . HIS E 5 197 ? 39.406 105.671 2.046   1.00 101.54 ? 197  HIS L CA  1 
ATOM 6131 C C   . HIS E 5 197 ? 40.081 105.785 3.406   1.00 120.05 ? 197  HIS L C   1 
ATOM 6132 O O   . HIS E 5 197 ? 40.644 106.823 3.765   1.00 135.76 ? 197  HIS L O   1 
ATOM 6133 C CB  . HIS E 5 197 ? 40.274 104.841 1.087   1.00 92.74  ? 197  HIS L CB  1 
ATOM 6134 C CG  . HIS E 5 197 ? 40.307 103.382 1.419   1.00 88.45  ? 197  HIS L CG  1 
ATOM 6135 N ND1 . HIS E 5 197 ? 41.382 102.783 2.040   1.00 90.08  ? 197  HIS L ND1 1 
ATOM 6136 C CD2 . HIS E 5 197 ? 39.387 102.406 1.236   1.00 86.25  ? 197  HIS L CD2 1 
ATOM 6137 C CE1 . HIS E 5 197 ? 41.125 101.500 2.218   1.00 88.48  ? 197  HIS L CE1 1 
ATOM 6138 N NE2 . HIS E 5 197 ? 39.921 101.245 1.740   1.00 84.42  ? 197  HIS L NE2 1 
ATOM 6139 N N   . LYS E 5 198 ? 40.000 104.691 4.164   1.00 97.30  ? 198  LYS L N   1 
ATOM 6140 C CA  . LYS E 5 198 ? 40.638 104.627 5.472   1.00 94.92  ? 198  LYS L CA  1 
ATOM 6141 C C   . LYS E 5 198 ? 42.148 104.818 5.379   1.00 89.25  ? 198  LYS L C   1 
ATOM 6142 O O   . LYS E 5 198 ? 42.771 105.299 6.331   1.00 92.30  ? 198  LYS L O   1 
ATOM 6143 C CB  . LYS E 5 198 ? 40.299 103.285 6.127   1.00 98.24  ? 198  LYS L CB  1 
ATOM 6144 C CG  . LYS E 5 198 ? 40.964 103.020 7.460   1.00 101.15 ? 198  LYS L CG  1 
ATOM 6145 C CD  . LYS E 5 198 ? 40.678 101.603 7.936   1.00 109.62 ? 198  LYS L CD  1 
ATOM 6146 C CE  . LYS E 5 198 ? 41.364 101.320 9.264   1.00 126.40 ? 198  LYS L CE  1 
ATOM 6147 N NZ  . LYS E 5 198 ? 41.089 99.952  9.787   1.00 134.52 ? 198  LYS L NZ  1 
ATOM 6148 N N   . THR E 5 199 ? 42.753 104.458 4.244   1.00 85.53  ? 199  THR L N   1 
ATOM 6149 C CA  . THR E 5 199 ? 44.209 104.456 4.137   1.00 88.35  ? 199  THR L CA  1 
ATOM 6150 C C   . THR E 5 199 ? 44.796 105.851 3.992   1.00 89.10  ? 199  THR L C   1 
ATOM 6151 O O   . THR E 5 199 ? 46.004 106.025 4.189   1.00 91.15  ? 199  THR L O   1 
ATOM 6152 C CB  . THR E 5 199 ? 44.658 103.600 2.950   1.00 93.18  ? 199  THR L CB  1 
ATOM 6153 O OG1 . THR E 5 199 ? 43.925 103.975 1.776   1.00 105.17 ? 199  THR L OG1 1 
ATOM 6154 C CG2 . THR E 5 199 ? 44.437 102.130 3.236   1.00 94.01  ? 199  THR L CG2 1 
ATOM 6155 N N   . SER E 5 200 ? 43.986 106.836 3.631   1.00 103.71 ? 200  SER L N   1 
ATOM 6156 C CA  . SER E 5 200 ? 44.470 108.179 3.369   1.00 114.16 ? 200  SER L CA  1 
ATOM 6157 C C   . SER E 5 200 ? 43.559 109.170 4.065   1.00 97.97  ? 200  SER L C   1 
ATOM 6158 O O   . SER E 5 200 ? 42.343 108.971 4.128   1.00 96.33  ? 200  SER L O   1 
ATOM 6159 C CB  . SER E 5 200 ? 44.527 108.468 1.862   1.00 131.87 ? 200  SER L CB  1 
ATOM 6160 O OG  . SER E 5 200 ? 43.250 108.313 1.261   1.00 133.40 ? 200  SER L OG  1 
ATOM 6161 N N   . THR E 5 201 ? 44.157 110.224 4.609   1.00 114.91 ? 201  THR L N   1 
ATOM 6162 C CA  . THR E 5 201 ? 43.355 111.256 5.249   1.00 117.87 ? 201  THR L CA  1 
ATOM 6163 C C   . THR E 5 201 ? 42.680 112.151 4.219   1.00 111.17 ? 201  THR L C   1 
ATOM 6164 O O   . THR E 5 201 ? 41.565 112.631 4.451   1.00 109.44 ? 201  THR L O   1 
ATOM 6165 C CB  . THR E 5 201 ? 44.226 112.075 6.196   1.00 127.03 ? 201  THR L CB  1 
ATOM 6166 O OG1 . THR E 5 201 ? 43.478 113.194 6.682   1.00 135.82 ? 201  THR L OG1 1 
ATOM 6167 C CG2 . THR E 5 201 ? 45.480 112.559 5.479   1.00 129.15 ? 201  THR L CG2 1 
ATOM 6168 N N   . SER E 5 202 ? 43.326 112.370 3.078   1.00 115.30 ? 202  SER L N   1 
ATOM 6169 C CA  . SER E 5 202 ? 42.854 113.161 1.956   1.00 114.76 ? 202  SER L CA  1 
ATOM 6170 C C   . SER E 5 202 ? 42.346 112.253 0.842   1.00 105.99 ? 202  SER L C   1 
ATOM 6171 O O   . SER E 5 202 ? 42.942 111.203 0.575   1.00 101.89 ? 202  SER L O   1 
ATOM 6172 C CB  . SER E 5 202 ? 43.971 114.061 1.420   1.00 129.78 ? 202  SER L CB  1 
ATOM 6173 O OG  . SER E 5 202 ? 45.140 113.318 1.113   1.00 136.03 ? 202  SER L OG  1 
ATOM 6174 N N   . PRO E 5 203 ? 41.249 112.629 0.186   1.00 108.78 ? 203  PRO L N   1 
ATOM 6175 C CA  . PRO E 5 203 ? 40.662 111.758 -0.839  1.00 94.97  ? 203  PRO L CA  1 
ATOM 6176 C C   . PRO E 5 203 ? 41.568 111.604 -2.052  1.00 103.21 ? 203  PRO L C   1 
ATOM 6177 O O   . PRO E 5 203 ? 42.341 112.500 -2.399  1.00 107.70 ? 203  PRO L O   1 
ATOM 6178 C CB  . PRO E 5 203 ? 39.358 112.480 -1.209  1.00 95.25  ? 203  PRO L CB  1 
ATOM 6179 C CG  . PRO E 5 203 ? 39.095 113.442 -0.075  1.00 100.18 ? 203  PRO L CG  1 
ATOM 6180 C CD  . PRO E 5 203 ? 40.445 113.842 0.416   1.00 115.56 ? 203  PRO L CD  1 
ATOM 6181 N N   . ILE E 5 204 ? 41.467 110.441 -2.696  1.00 106.21 ? 204  ILE L N   1 
ATOM 6182 C CA  . ILE E 5 204 ? 42.184 110.176 -3.942  1.00 106.20 ? 204  ILE L CA  1 
ATOM 6183 C C   . ILE E 5 204 ? 41.338 110.703 -5.095  1.00 104.42 ? 204  ILE L C   1 
ATOM 6184 O O   . ILE E 5 204 ? 40.184 110.299 -5.263  1.00 104.51 ? 204  ILE L O   1 
ATOM 6185 C CB  . ILE E 5 204 ? 42.487 108.679 -4.109  1.00 97.71  ? 204  ILE L CB  1 
ATOM 6186 C CG1 . ILE E 5 204 ? 43.098 108.108 -2.831  1.00 99.42  ? 204  ILE L CG1 1 
ATOM 6187 C CG2 . ILE E 5 204 ? 43.453 108.443 -5.264  1.00 99.98  ? 204  ILE L CG2 1 
ATOM 6188 C CD1 . ILE E 5 204 ? 43.453 106.645 -2.942  1.00 98.90  ? 204  ILE L CD1 1 
ATOM 6189 N N   . VAL E 5 205 ? 41.914 111.598 -5.892  1.00 109.14 ? 205  VAL L N   1 
ATOM 6190 C CA  . VAL E 5 205 ? 41.186 112.349 -6.907  1.00 109.81 ? 205  VAL L CA  1 
ATOM 6191 C C   . VAL E 5 205 ? 41.696 111.938 -8.281  1.00 111.67 ? 205  VAL L C   1 
ATOM 6192 O O   . VAL E 5 205 ? 42.910 111.890 -8.509  1.00 124.65 ? 205  VAL L O   1 
ATOM 6193 C CB  . VAL E 5 205 ? 41.344 113.868 -6.695  1.00 122.43 ? 205  VAL L CB  1 
ATOM 6194 C CG1 . VAL E 5 205 ? 40.660 114.645 -7.804  1.00 127.40 ? 205  VAL L CG1 1 
ATOM 6195 C CG2 . VAL E 5 205 ? 40.793 114.277 -5.337  1.00 125.65 ? 205  VAL L CG2 1 
ATOM 6196 N N   . LYS E 5 206 ? 40.769 111.632 -9.188  1.00 103.06 ? 206  LYS L N   1 
ATOM 6197 C CA  . LYS E 5 206 ? 41.074 111.447 -10.604 1.00 100.41 ? 206  LYS L CA  1 
ATOM 6198 C C   . LYS E 5 206 ? 40.025 112.197 -11.406 1.00 103.28 ? 206  LYS L C   1 
ATOM 6199 O O   . LYS E 5 206 ? 38.839 111.868 -11.333 1.00 106.37 ? 206  LYS L O   1 
ATOM 6200 C CB  . LYS E 5 206 ? 41.091 109.966 -10.996 1.00 91.85  ? 206  LYS L CB  1 
ATOM 6201 C CG  . LYS E 5 206 ? 42.425 109.273 -10.794 1.00 96.67  ? 206  LYS L CG  1 
ATOM 6202 C CD  . LYS E 5 206 ? 43.445 109.730 -11.817 1.00 103.87 ? 206  LYS L CD  1 
ATOM 6203 C CE  . LYS E 5 206 ? 44.723 108.911 -11.722 1.00 113.38 ? 206  LYS L CE  1 
ATOM 6204 N NZ  . LYS E 5 206 ? 45.327 108.929 -10.357 1.00 113.64 ? 206  LYS L NZ  1 
ATOM 6205 N N   . SER E 5 207 ? 40.454 113.202 -12.162 1.00 105.30 ? 207  SER L N   1 
ATOM 6206 C CA  . SER E 5 207 ? 39.539 114.039 -12.923 1.00 104.06 ? 207  SER L CA  1 
ATOM 6207 C C   . SER E 5 207 ? 40.042 114.182 -14.351 1.00 102.51 ? 207  SER L C   1 
ATOM 6208 O O   . SER E 5 207 ? 41.191 113.860 -14.662 1.00 117.51 ? 207  SER L O   1 
ATOM 6209 C CB  . SER E 5 207 ? 39.379 115.425 -12.285 1.00 116.54 ? 207  SER L CB  1 
ATOM 6210 O OG  . SER E 5 207 ? 40.611 116.127 -12.270 1.00 129.22 ? 207  SER L OG  1 
ATOM 6211 N N   . PHE E 5 208 ? 39.161 114.666 -15.222 1.00 100.16 ? 208  PHE L N   1 
ATOM 6212 C CA  . PHE E 5 208 ? 39.541 114.980 -16.592 1.00 104.29 ? 208  PHE L CA  1 
ATOM 6213 C C   . PHE E 5 208 ? 38.678 116.128 -17.091 1.00 112.05 ? 208  PHE L C   1 
ATOM 6214 O O   . PHE E 5 208 ? 37.654 116.465 -16.498 1.00 112.38 ? 208  PHE L O   1 
ATOM 6215 C CB  . PHE E 5 208 ? 39.400 113.764 -17.515 1.00 103.05 ? 208  PHE L CB  1 
ATOM 6216 C CG  . PHE E 5 208 ? 37.974 113.374 -17.799 1.00 97.73  ? 208  PHE L CG  1 
ATOM 6217 C CD1 . PHE E 5 208 ? 37.274 112.578 -16.911 1.00 99.87  ? 208  PHE L CD1 1 
ATOM 6218 C CD2 . PHE E 5 208 ? 37.340 113.792 -18.958 1.00 102.77 ? 208  PHE L CD2 1 
ATOM 6219 C CE1 . PHE E 5 208 ? 35.967 112.213 -17.165 1.00 90.24  ? 208  PHE L CE1 1 
ATOM 6220 C CE2 . PHE E 5 208 ? 36.031 113.432 -19.217 1.00 105.28 ? 208  PHE L CE2 1 
ATOM 6221 C CZ  . PHE E 5 208 ? 35.343 112.640 -18.318 1.00 88.78  ? 208  PHE L CZ  1 
ATOM 6222 N N   . ASN E 5 209 ? 39.094 116.717 -18.208 1.00 130.49 ? 209  ASN L N   1 
ATOM 6223 C CA  . ASN E 5 209 ? 38.310 117.751 -18.864 1.00 136.81 ? 209  ASN L CA  1 
ATOM 6224 C C   . ASN E 5 209 ? 38.329 117.517 -20.367 1.00 130.73 ? 209  ASN L C   1 
ATOM 6225 O O   . ASN E 5 209 ? 39.304 116.997 -20.918 1.00 132.60 ? 209  ASN L O   1 
ATOM 6226 C CB  . ASN E 5 209 ? 38.839 119.148 -18.525 1.00 157.62 ? 209  ASN L CB  1 
ATOM 6227 C CG  . ASN E 5 209 ? 40.348 119.218 -18.567 1.00 178.12 ? 209  ASN L CG  1 
ATOM 6228 O OD1 . ASN E 5 209 ? 40.983 118.634 -19.445 1.00 187.79 ? 209  ASN L OD1 1 
ATOM 6229 N ND2 . ASN E 5 209 ? 40.936 119.918 -17.605 1.00 182.21 ? 209  ASN L ND2 1 
ATOM 6230 N N   . ARG E 5 210 ? 37.242 117.912 -21.026 1.00 116.49 ? 210  ARG L N   1 
ATOM 6231 C CA  . ARG E 5 210 ? 37.081 117.671 -22.456 1.00 126.00 ? 210  ARG L CA  1 
ATOM 6232 C C   . ARG E 5 210 ? 37.931 118.589 -23.329 1.00 140.13 ? 210  ARG L C   1 
ATOM 6233 O O   . ARG E 5 210 ? 37.801 118.538 -24.557 1.00 139.61 ? 210  ARG L O   1 
ATOM 6234 C CB  . ARG E 5 210 ? 35.608 117.818 -22.842 1.00 118.36 ? 210  ARG L CB  1 
ATOM 6235 C CG  . ARG E 5 210 ? 34.670 117.066 -21.924 1.00 105.61 ? 210  ARG L CG  1 
ATOM 6236 C CD  . ARG E 5 210 ? 33.248 117.204 -22.402 1.00 106.14 ? 210  ARG L CD  1 
ATOM 6237 N NE  . ARG E 5 210 ? 32.838 118.602 -22.449 1.00 115.79 ? 210  ARG L NE  1 
ATOM 6238 C CZ  . ARG E 5 210 ? 31.694 119.021 -22.973 1.00 122.91 ? 210  ARG L CZ  1 
ATOM 6239 N NH1 . ARG E 5 210 ? 30.856 118.144 -23.500 1.00 124.60 ? 210  ARG L NH1 1 
ATOM 6240 N NH2 . ARG E 5 210 ? 31.393 120.311 -22.975 1.00 130.18 ? 210  ARG L NH2 1 
ATOM 6241 N N   . ASN E 5 211 ? 38.790 119.421 -22.732 1.00 149.86 ? 211  ASN L N   1 
ATOM 6242 C CA  . ASN E 5 211 ? 39.687 120.258 -23.522 1.00 157.00 ? 211  ASN L CA  1 
ATOM 6243 C C   . ASN E 5 211 ? 40.738 119.418 -24.236 1.00 166.21 ? 211  ASN L C   1 
ATOM 6244 O O   . ASN E 5 211 ? 41.083 119.693 -25.392 1.00 176.65 ? 211  ASN L O   1 
ATOM 6245 C CB  . ASN E 5 211 ? 40.360 121.297 -22.627 1.00 152.73 ? 211  ASN L CB  1 
ATOM 6246 C CG  . ASN E 5 211 ? 39.387 121.969 -21.685 1.00 138.30 ? 211  ASN L CG  1 
ATOM 6247 O OD1 . ASN E 5 211 ? 39.659 122.115 -20.492 1.00 134.99 ? 211  ASN L OD1 1 
ATOM 6248 N ND2 . ASN E 5 211 ? 38.239 122.374 -22.215 1.00 132.79 ? 211  ASN L ND2 1 
ATOM 6249 N N   . GLU E 5 212 ? 41.263 118.400 -23.562 1.00 164.20 ? 212  GLU L N   1 
ATOM 6250 C CA  . GLU E 5 212 ? 42.264 117.515 -24.143 1.00 172.77 ? 212  GLU L CA  1 
ATOM 6251 C C   . GLU E 5 212 ? 41.627 116.548 -25.138 1.00 166.52 ? 212  GLU L C   1 
ATOM 6252 O O   . GLU E 5 212 ? 41.950 115.360 -25.161 1.00 158.57 ? 212  GLU L O   1 
ATOM 6253 C CB  . GLU E 5 212 ? 42.988 116.740 -23.040 1.00 185.28 ? 212  GLU L CB  1 
ATOM 6254 C CG  . GLU E 5 212 ? 43.666 117.622 -21.998 1.00 197.95 ? 212  GLU L CG  1 
ATOM 6255 C CD  . GLU E 5 212 ? 44.104 116.845 -20.768 1.00 198.14 ? 212  GLU L CD  1 
ATOM 6256 O OE1 . GLU E 5 212 ? 43.689 115.676 -20.623 1.00 195.36 ? 212  GLU L OE1 1 
ATOM 6257 O OE2 . GLU E 5 212 ? 44.863 117.403 -19.946 1.00 201.21 ? 212  GLU L OE2 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . CYS A 1   ? 3.0804 2.1226 3.6221 -0.0588 -1.5424 -0.3580 35   CYS A N   
2    C CA  . CYS A 1   ? 3.0166 2.0075 3.4664 0.0434  -1.4269 -0.3873 35   CYS A CA  
3    C C   . CYS A 1   ? 2.9645 1.8076 3.4256 0.0522  -1.3865 -0.4033 35   CYS A C   
4    O O   . CYS A 1   ? 2.8046 1.7008 3.3208 0.0640  -1.3066 -0.3656 35   CYS A O   
5    C CB  . CYS A 1   ? 3.2666 2.1660 3.5485 0.1292  -1.4203 -0.4619 35   CYS A CB  
6    S SG  . CYS A 1   ? 3.2919 2.2533 3.4750 0.2425  -1.2897 -0.4650 35   CYS A SG  
7    N N   . SER A 2   ? 3.1902 1.8480 3.5976 0.0475  -1.4453 -0.4607 36   SER A N   
8    C CA  . SER A 2   ? 3.2396 1.7414 3.6413 0.0691  -1.4112 -0.4858 36   SER A CA  
9    C C   . SER A 2   ? 3.1480 1.7122 3.7018 -0.0000 -1.4041 -0.4145 36   SER A C   
10   O O   . SER A 2   ? 3.0797 1.5458 3.6420 0.0234  -1.3608 -0.4241 36   SER A O   
11   C CB  . SER A 2   ? 3.4721 1.7719 3.7982 0.0660  -1.4950 -0.5557 36   SER A CB  
12   O OG  . SER A 2   ? 3.4805 1.7009 3.7853 0.1076  -1.4238 -0.5590 36   SER A OG  
13   N N   . GLN A 3   ? 3.0774 1.8075 3.7498 -0.0816 -1.4446 -0.3421 37   GLN A N   
14   C CA  . GLN A 3   ? 2.9562 1.7694 3.7711 -0.1457 -1.4330 -0.2669 37   GLN A CA  
15   C C   . GLN A 3   ? 2.8287 1.6986 3.6477 -0.0854 -1.3127 -0.2491 37   GLN A C   
16   O O   . GLN A 3   ? 2.8300 1.7343 3.5648 -0.0101 -1.2408 -0.2741 37   GLN A O   
17   C CB  . GLN A 3   ? 2.7924 1.8023 3.7202 -0.2326 -1.4872 -0.1920 37   GLN A CB  
18   C CG  . GLN A 3   ? 2.6715 1.7480 3.7489 -0.3212 -1.5098 -0.1131 37   GLN A CG  
19   C CD  . GLN A 3   ? 2.7488 1.7804 3.8485 -0.3912 -1.5824 -0.0846 37   GLN A CD  
20   O OE1 . GLN A 3   ? 2.6164 1.7208 3.8049 -0.4507 -1.5780 -0.0064 37   GLN A OE1 
21   N NE2 . GLN A 3   ? 2.8049 1.7159 3.8104 -0.3777 -1.6406 -0.1467 37   GLN A NE2 
22   N N   . LYS A 4   ? 2.8070 1.6835 3.7236 -0.1211 -1.2933 -0.2040 38   LYS A N   
23   C CA  . LYS A 4   ? 2.6950 1.6170 3.6217 -0.0717 -1.1863 -0.1882 38   LYS A CA  
24   C C   . LYS A 4   ? 2.6029 1.7328 3.5684 -0.0727 -1.1369 -0.1354 38   LYS A C   
25   O O   . LYS A 4   ? 2.6538 1.9198 3.6939 -0.1359 -1.1884 -0.0839 38   LYS A O   
26   C CB  . LYS A 4   ? 2.6451 1.5302 3.6698 -0.1127 -1.1865 -0.1505 38   LYS A CB  
27   C CG  . LYS A 4   ? 2.7982 1.5064 3.7559 -0.0733 -1.1855 -0.2027 38   LYS A CG  
28   C CD  . LYS A 4   ? 2.7693 1.4182 3.6042 0.0281  -1.0938 -0.2651 38   LYS A CD  
29   C CE  . LYS A 4   ? 2.8930 1.4353 3.6346 0.0692  -1.0770 -0.3111 38   LYS A CE  
30   N NZ  . LYS A 4   ? 2.8568 1.3720 3.4831 0.1560  -0.9764 -0.3594 38   LYS A NZ  
31   N N   . PRO A 5   ? 2.3771 1.5351 3.2930 -0.0034 -1.0371 -0.1462 39   PRO A N   
32   C CA  . PRO A 5   ? 2.1353 1.4675 3.0600 0.0120  -0.9872 -0.1088 39   PRO A CA  
33   C C   . PRO A 5   ? 1.9540 1.4367 3.0096 -0.0467 -0.9760 -0.0298 39   PRO A C   
34   O O   . PRO A 5   ? 1.9626 1.4208 3.1060 -0.1028 -1.0076 0.0010  39   PRO A O   
35   C CB  . PRO A 5   ? 2.1651 1.4371 2.9860 0.1032  -0.8868 -0.1523 39   PRO A CB  
36   C CG  . PRO A 5   ? 2.2318 1.3638 3.0572 0.1124  -0.8674 -0.1780 39   PRO A CG  
37   C CD  . PRO A 5   ? 2.3675 1.3932 3.2102 0.0672  -0.9652 -0.1962 39   PRO A CD  
38   N N   . SER A 6   ? 1.8114 1.4497 2.8727 -0.0282 -0.9292 0.0028  40   SER A N   
39   C CA  . SER A 6   ? 1.6542 1.4574 2.8252 -0.0738 -0.9131 0.0767  40   SER A CA  
40   C C   . SER A 6   ? 1.5111 1.2966 2.6866 -0.0431 -0.8273 0.0800  40   SER A C   
41   O O   . SER A 6   ? 1.5279 1.2086 2.6142 0.0228  -0.7657 0.0288  40   SER A O   
42   C CB  . SER A 6   ? 1.5370 1.5182 2.7062 -0.0611 -0.9029 0.1075  40   SER A CB  
43   O OG  . SER A 6   ? 1.6515 1.6515 2.8033 -0.0789 -0.9771 0.0973  40   SER A OG  
44   N N   . ASP A 7   ? 1.7237 1.6204 3.0063 -0.0945 -0.8248 0.1437  41   ASP A N   
45   C CA  . ASP A 7   ? 1.6890 1.5982 2.9881 -0.0742 -0.7494 0.1551  41   ASP A CA  
46   C C   . ASP A 7   ? 1.6684 1.7705 3.0254 -0.0904 -0.7204 0.2157  41   ASP A C   
47   O O   . ASP A 7   ? 1.1476 1.2879 2.5443 -0.0946 -0.6748 0.2404  41   ASP A O   
48   C CB  . ASP A 7   ? 1.5581 1.3773 2.9242 -0.1136 -0.7711 0.1657  41   ASP A CB  
49   C CG  . ASP A 7   ? 1.6308 1.5371 3.1192 -0.2024 -0.8423 0.2361  41   ASP A CG  
50   O OD1 . ASP A 7   ? 1.3774 1.3475 2.8917 -0.2438 -0.9062 0.2585  41   ASP A OD1 
51   O OD2 . ASP A 7   ? 1.3012 1.2129 2.8612 -0.2325 -0.8348 0.2714  41   ASP A OD2 
52   N N   . LYS A 8   ? 1.6084 1.8363 2.9671 -0.0955 -0.7456 0.2384  42   LYS A N   
53   C CA  . LYS A 8   ? 1.5293 1.9527 2.9475 -0.1114 -0.7253 0.2994  42   LYS A CA  
54   C C   . LYS A 8   ? 1.5047 1.9485 2.8576 -0.0443 -0.6323 0.2819  42   LYS A C   
55   O O   . LYS A 8   ? 1.5386 2.0986 2.9417 -0.0567 -0.6009 0.3252  42   LYS A O   
56   C CB  . LYS A 8   ? 1.5466 2.1015 2.9751 -0.1224 -0.7716 0.3230  42   LYS A CB  
57   C CG  . LYS A 8   ? 1.6812 2.1499 3.0939 -0.1469 -0.8505 0.2951  42   LYS A CG  
58   C CD  . LYS A 8   ? 1.7786 2.2482 3.2942 -0.2422 -0.9266 0.3394  42   LYS A CD  
59   C CE  . LYS A 8   ? 1.9596 2.3535 3.4595 -0.2713 -1.0125 0.3124  42   LYS A CE  
60   N NZ  . LYS A 8   ? 2.0762 2.4249 3.6114 -0.3529 -1.0500 0.3495  42   LYS A NZ  
61   N N   . HIS A 9   ? 1.4808 1.8092 2.7185 0.0256  -0.5885 0.2192  43   HIS A N   
62   C CA  . HIS A 9   ? 1.2209 1.5644 2.3841 0.0900  -0.5048 0.2016  43   HIS A CA  
63   C C   . HIS A 9   ? 1.1153 1.4232 2.3023 0.0847  -0.4518 0.2042  43   HIS A C   
64   O O   . HIS A 9   ? 1.1772 1.5554 2.3481 0.1091  -0.3965 0.2161  43   HIS A O   
65   C CB  . HIS A 9   ? 1.2583 1.4767 2.2915 0.1608  -0.4752 0.1377  43   HIS A CB  
66   C CG  . HIS A 9   ? 1.3891 1.4320 2.3902 0.1621  -0.4884 0.0902  43   HIS A CG  
67   N ND1 . HIS A 9   ? 1.4373 1.4305 2.4678 0.1243  -0.5654 0.0839  43   HIS A ND1 
68   C CD2 . HIS A 9   ? 1.4149 1.3222 2.3550 0.1985  -0.4340 0.0462  43   HIS A CD2 
69   C CE1 . HIS A 9   ? 1.5154 1.3465 2.4992 0.1433  -0.5569 0.0355  43   HIS A CE1 
70   N NE2 . HIS A 9   ? 1.4619 1.2452 2.3939 0.1883  -0.4762 0.0138  43   HIS A NE2 
71   N N   . LEU A 10  ? 1.1370 1.3387 2.3613 0.0545  -0.4696 0.1931  44   LEU A N   
72   C CA  . LEU A 10  ? 1.2108 1.3695 2.4516 0.0554  -0.4189 0.1891  44   LEU A CA  
73   C C   . LEU A 10  ? 1.2112 1.5150 2.5316 0.0204  -0.4070 0.2466  44   LEU A C   
74   O O   . LEU A 10  ? 1.1380 1.4264 2.4632 0.0264  -0.3590 0.2432  44   LEU A O   
75   C CB  . LEU A 10  ? 1.3346 1.3707 2.6142 0.0282  -0.4506 0.1744  44   LEU A CB  
76   C CG  . LEU A 10  ? 1.4932 1.3688 2.6889 0.0680  -0.4557 0.1114  44   LEU A CG  
77   C CD1 . LEU A 10  ? 1.5660 1.3270 2.8004 0.0504  -0.4739 0.0975  44   LEU A CD1 
78   C CD2 . LEU A 10  ? 1.4176 1.2389 2.4999 0.1385  -0.3791 0.0649  44   LEU A CD2 
79   N N   . ASP A 11  ? 1.3485 1.7973 2.7322 -0.0169 -0.4497 0.3000  45   ASP A N   
80   C CA  . ASP A 11  ? 1.4241 2.0203 2.8741 -0.0442 -0.4345 0.3552  45   ASP A CA  
81   C C   . ASP A 11  ? 1.4202 2.0694 2.7960 0.0130  -0.3637 0.3398  45   ASP A C   
82   O O   . ASP A 11  ? 1.3496 2.0556 2.7467 0.0079  -0.3280 0.3589  45   ASP A O   
83   C CB  . ASP A 11  ? 1.4923 2.2112 2.9838 -0.0964 -0.4820 0.4099  45   ASP A CB  
84   C CG  . ASP A 11  ? 1.5694 2.2113 3.1014 -0.1585 -0.5395 0.4267  45   ASP A CG  
85   O OD1 . ASP A 11  ? 1.6271 2.1866 3.1795 -0.1589 -0.5935 0.3999  45   ASP A OD1 
86   O OD2 . ASP A 11  ? 1.5846 2.2409 3.1230 -0.2013 -0.5337 0.4653  45   ASP A OD2 
87   N N   . ALA A 12  ? 1.4912 2.1172 2.7753 0.0688  -0.3448 0.3049  46   ALA A N   
88   C CA  . ALA A 12  ? 1.4437 2.1126 2.6490 0.1272  -0.2827 0.2911  46   ALA A CA  
89   C C   . ALA A 12  ? 1.4841 2.0044 2.5952 0.1742  -0.2178 0.2337  46   ALA A C   
90   O O   . ALA A 12  ? 1.5508 2.0904 2.6063 0.2106  -0.1629 0.2245  46   ALA A O   
91   C CB  . ALA A 12  ? 1.5161 2.2500 2.6712 0.1671  -0.2966 0.2901  46   ALA A CB  
92   N N   . ILE A 13  ? 1.4321 1.8059 2.5230 0.1735  -0.2229 0.1959  47   ILE A N   
93   C CA  . ILE A 13  ? 1.3609 1.5976 2.3591 0.2188  -0.1603 0.1430  47   ILE A CA  
94   C C   . ILE A 13  ? 1.3250 1.5677 2.3392 0.2086  -0.1107 0.1462  47   ILE A C   
95   O O   . ILE A 13  ? 1.4062 1.6200 2.3390 0.2496  -0.0531 0.1227  47   ILE A O   
96   C CB  . ILE A 13  ? 1.2133 1.3067 2.1942 0.2196  -0.1781 0.1057  47   ILE A CB  
97   C CG1 . ILE A 13  ? 1.2302 1.2964 2.1501 0.2499  -0.2104 0.0867  47   ILE A CG1 
98   C CG2 . ILE A 13  ? 1.1892 1.1578 2.1068 0.2494  -0.1134 0.0625  47   ILE A CG2 
99   C CD1 . ILE A 13  ? 1.2712 1.1960 2.1596 0.2576  -0.2301 0.0458  47   ILE A CD1 
100  N N   . PRO A 14  ? 1.2677 1.5430 2.3793 0.1562  -0.1310 0.1740  48   PRO A N   
101  C CA  . PRO A 14  ? 1.2207 1.4983 2.3415 0.1484  -0.0842 0.1724  48   PRO A CA  
102  C C   . PRO A 14  ? 1.2529 1.6338 2.3452 0.1644  -0.0532 0.1888  48   PRO A C   
103  O O   . PRO A 14  ? 1.3464 1.6855 2.3823 0.1856  0.0011  0.1634  48   PRO A O   
104  C CB  . PRO A 14  ? 1.1456 1.4609 2.3839 0.0892  -0.1261 0.2090  48   PRO A CB  
105  C CG  . PRO A 14  ? 1.1767 1.5635 2.4722 0.0603  -0.1931 0.2471  48   PRO A CG  
106  C CD  . PRO A 14  ? 1.2538 1.5676 2.4701 0.1005  -0.1989 0.2109  48   PRO A CD  
107  N N   . ILE A 15  ? 1.1614 1.6783 2.2917 0.1539  -0.0872 0.2314  49   ILE A N   
108  C CA  . ILE A 15  ? 1.0929 1.7156 2.1917 0.1768  -0.0582 0.2467  49   ILE A CA  
109  C C   . ILE A 15  ? 1.1531 1.6972 2.1226 0.2447  -0.0070 0.2008  49   ILE A C   
110  O O   . ILE A 15  ? 1.3055 1.8335 2.2177 0.2675  0.0413  0.1830  49   ILE A O   
111  C CB  . ILE A 15  ? 1.0253 1.8150 2.1862 0.1592  -0.1037 0.3016  49   ILE A CB  
112  C CG1 . ILE A 15  ? 1.0919 1.9672 2.3761 0.0895  -0.1458 0.3546  49   ILE A CG1 
113  C CG2 . ILE A 15  ? 0.9429 1.8331 2.0468 0.2035  -0.0696 0.3083  49   ILE A CG2 
114  C CD1 . ILE A 15  ? 1.0807 1.9784 2.3753 0.0733  -0.1135 0.3601  49   ILE A CD1 
115  N N   . LEU A 16  ? 1.1423 1.6318 2.0603 0.2777  -0.0190 0.1814  50   LEU A N   
116  C CA  . LEU A 16  ? 1.2039 1.6040 1.9939 0.3444  0.0281  0.1398  50   LEU A CA  
117  C C   . LEU A 16  ? 1.2198 1.4772 1.9534 0.3508  0.0822  0.0983  50   LEU A C   
118  O O   . LEU A 16  ? 1.2931 1.5066 1.9394 0.3881  0.1323  0.0760  50   LEU A O   
119  C CB  . LEU A 16  ? 1.1039 1.4579 1.8539 0.3730  0.0011  0.1254  50   LEU A CB  
120  C CG  . LEU A 16  ? 1.0986 1.5928 1.9021 0.3657  -0.0557 0.1646  50   LEU A CG  
121  C CD1 . LEU A 16  ? 1.2950 1.7275 2.0357 0.4030  -0.0754 0.1409  50   LEU A CD1 
122  C CD2 . LEU A 16  ? 1.0565 1.6891 1.8485 0.3939  -0.0398 0.1918  50   LEU A CD2 
123  N N   . TYR A 17  ? 0.8509 1.0343 1.6336 0.3147  0.0724  0.0881  51   TYR A N   
124  C CA  . TYR A 17  ? 1.0546 1.1223 1.7997 0.3144  0.1230  0.0541  51   TYR A CA  
125  C C   . TYR A 17  ? 1.1240 1.2400 1.8759 0.2993  0.1543  0.0613  51   TYR A C   
126  O O   . TYR A 17  ? 1.2725 1.3073 1.9459 0.3202  0.2062  0.0314  51   TYR A O   
127  C CB  . TYR A 17  ? 1.0703 1.0831 1.8871 0.2765  0.1030  0.0497  51   TYR A CB  
128  C CG  . TYR A 17  ? 1.1427 1.0369 1.9035 0.3055  0.1039  0.0166  51   TYR A CG  
129  C CD1 . TYR A 17  ? 1.2809 1.1839 2.0111 0.3307  0.0683  0.0176  51   TYR A CD1 
130  C CD2 . TYR A 17  ? 1.0460 0.8270 1.7847 0.3082  0.1397  -0.0151 51   TYR A CD2 
131  C CE1 . TYR A 17  ? 1.3689 1.1640 2.0406 0.3594  0.0669  -0.0145 51   TYR A CE1 
132  C CE2 . TYR A 17  ? 1.1994 0.8759 1.8807 0.3389  0.1422  -0.0454 51   TYR A CE2 
133  C CZ  . TYR A 17  ? 1.3619 1.0424 2.0064 0.3650  0.1049  -0.0462 51   TYR A CZ  
134  O OH  . TYR A 17  ? 1.4423 1.0197 2.0224 0.3974  0.1049  -0.0780 51   TYR A OH  
135  N N   . TYR A 18  ? 1.0612 1.3070 1.9042 0.2608  0.1219  0.1017  52   TYR A N   
136  C CA  . TYR A 18  ? 1.1170 1.4144 1.9656 0.2456  0.1473  0.1078  52   TYR A CA  
137  C C   . TYR A 18  ? 1.1460 1.4589 1.8942 0.2959  0.1796  0.0957  52   TYR A C   
138  O O   . TYR A 18  ? 1.2679 1.5392 1.9611 0.3028  0.2203  0.0733  52   TYR A O   
139  C CB  . TYR A 18  ? 1.2088 1.6470 2.1734 0.1961  0.1039  0.1580  52   TYR A CB  
140  C CG  . TYR A 18  ? 1.3770 1.7965 2.4210 0.1464  0.0990  0.1628  52   TYR A CG  
141  C CD1 . TYR A 18  ? 1.4610 1.8065 2.5520 0.1282  0.0795  0.1564  52   TYR A CD1 
142  C CD2 . TYR A 18  ? 1.4314 1.9102 2.5010 0.1215  0.1123  0.1732  52   TYR A CD2 
143  C CE1 . TYR A 18  ? 1.4990 1.8324 2.6635 0.0898  0.0751  0.1619  52   TYR A CE1 
144  C CE2 . TYR A 18  ? 1.4374 1.9080 2.5824 0.0789  0.1058  0.1796  52   TYR A CE2 
145  C CZ  . TYR A 18  ? 1.4775 1.8768 2.6714 0.0648  0.0879  0.1750  52   TYR A CZ  
146  O OH  . TYR A 18  ? 1.4810 1.8758 2.7506 0.0293  0.0815  0.1821  52   TYR A OH  
147  N N   . ILE A 19  ? 1.1242 1.4992 1.8484 0.3316  0.1597  0.1107  53   ILE A N   
148  C CA  . ILE A 19  ? 1.1203 1.5083 1.7435 0.3913  0.1891  0.0989  53   ILE A CA  
149  C C   . ILE A 19  ? 1.2002 1.4195 1.7026 0.4303  0.2416  0.0492  53   ILE A C   
150  O O   . ILE A 19  ? 1.2983 1.4744 1.7298 0.4478  0.2810  0.0280  53   ILE A O   
151  C CB  . ILE A 19  ? 1.0300 1.5082 1.6532 0.4254  0.1563  0.1227  53   ILE A CB  
152  C CG1 . ILE A 19  ? 0.7773 1.4353 1.5185 0.3831  0.1078  0.1781  53   ILE A CG1 
153  C CG2 . ILE A 19  ? 1.0736 1.5416 1.5785 0.5008  0.1899  0.1048  53   ILE A CG2 
154  C CD1 . ILE A 19  ? 0.7748 1.5317 1.5400 0.4007  0.0672  0.2068  53   ILE A CD1 
155  N N   . ILE A 20  ? 1.2776 1.3959 1.7519 0.4433  0.2417  0.0306  54   ILE A N   
156  C CA  . ILE A 20  ? 1.4928 1.4480 1.8550 0.4764  0.2920  -0.0111 54   ILE A CA  
157  C C   . ILE A 20  ? 1.6013 1.4893 1.9682 0.4376  0.3277  -0.0297 54   ILE A C   
158  O O   . ILE A 20  ? 1.8073 1.6014 2.0787 0.4600  0.3731  -0.0566 54   ILE A O   
159  C CB  . ILE A 20  ? 1.4604 1.3299 1.8076 0.4875  0.2825  -0.0245 54   ILE A CB  
160  C CG1 . ILE A 20  ? 1.4723 1.4113 1.8093 0.5257  0.2441  -0.0079 54   ILE A CG1 
161  C CG2 . ILE A 20  ? 1.5187 1.2258 1.7525 0.5121  0.3333  -0.0624 54   ILE A CG2 
162  C CD1 . ILE A 20  ? 1.4276 1.4197 1.6893 0.5831  0.2574  -0.0025 54   ILE A CD1 
163  N N   . PHE A 21  ? 1.3958 1.3311 1.8740 0.3782  0.3056  -0.0145 55   PHE A N   
164  C CA  . PHE A 21  ? 1.3992 1.2881 1.8963 0.3374  0.3344  -0.0293 55   PHE A CA  
165  C C   . PHE A 21  ? 1.4383 1.3603 1.8958 0.3386  0.3545  -0.0335 55   PHE A C   
166  O O   . PHE A 21  ? 1.5509 1.3785 1.9458 0.3345  0.3956  -0.0621 55   PHE A O   
167  C CB  . PHE A 21  ? 1.3403 1.2966 1.9701 0.2796  0.3002  -0.0061 55   PHE A CB  
168  C CG  . PHE A 21  ? 1.3511 1.3207 2.0208 0.2352  0.3172  -0.0093 55   PHE A CG  
169  C CD1 . PHE A 21  ? 1.3903 1.2566 2.0392 0.2194  0.3561  -0.0376 55   PHE A CD1 
170  C CD2 . PHE A 21  ? 1.2826 1.3751 2.0104 0.2088  0.2941  0.0175  55   PHE A CD2 
171  C CE1 . PHE A 21  ? 1.3724 1.2593 2.0617 0.1759  0.3685  -0.0404 55   PHE A CE1 
172  C CE2 . PHE A 21  ? 1.2790 1.3867 2.0400 0.1685  0.3064  0.0133  55   PHE A CE2 
173  C CZ  . PHE A 21  ? 1.3281 1.3340 2.0720 0.1510  0.3420  -0.0163 55   PHE A CZ  
174  N N   . VAL A 22  ? 1.4156 1.4744 1.9130 0.3394  0.3247  -0.0043 56   VAL A N   
175  C CA  . VAL A 22  ? 1.4846 1.5791 1.9420 0.3426  0.3418  -0.0104 56   VAL A CA  
176  C C   . VAL A 22  ? 1.5154 1.5150 1.8288 0.4058  0.3797  -0.0416 56   VAL A C   
177  O O   . VAL A 22  ? 1.5671 1.4913 1.8094 0.4059  0.4125  -0.0700 56   VAL A O   
178  C CB  . VAL A 22  ? 1.5226 1.7955 2.0552 0.3313  0.3032  0.0315  56   VAL A CB  
179  C CG1 . VAL A 22  ? 1.5268 1.8769 2.0399 0.3807  0.2834  0.0529  56   VAL A CG1 
180  C CG2 . VAL A 22  ? 1.5558 1.8646 2.0528 0.3279  0.3198  0.0222  56   VAL A CG2 
181  N N   . ILE A 23  ? 1.5126 1.5045 1.7775 0.4598  0.3745  -0.0379 57   ILE A N   
182  C CA  . ILE A 23  ? 1.5888 1.4883 1.7127 0.5276  0.4089  -0.0647 57   ILE A CA  
183  C C   . ILE A 23  ? 1.6006 1.3193 1.6434 0.5154  0.4480  -0.1018 57   ILE A C   
184  O O   . ILE A 23  ? 1.7589 1.4077 1.7195 0.5106  0.4659  -0.1254 57   ILE A O   
185  C CB  . ILE A 23  ? 1.4953 1.4276 1.5896 0.5864  0.3917  -0.0511 57   ILE A CB  
186  C CG1 . ILE A 23  ? 1.4287 1.5551 1.6004 0.5910  0.3500  -0.0106 57   ILE A CG1 
187  C CG2 . ILE A 23  ? 1.4073 1.2434 1.3571 0.6247  0.4036  -0.0758 57   ILE A CG2 
188  C CD1 . ILE A 23  ? 1.4112 1.5894 1.5550 0.6498  0.3313  0.0042  57   ILE A CD1 
189  N N   . GLY A 24  ? 1.4390 1.0993 1.5066 0.4876  0.4399  -0.1034 58   GLY A N   
190  C CA  . GLY A 24  ? 1.6860 1.2180 1.6839 0.4533  0.4523  -0.1261 58   GLY A CA  
191  C C   . GLY A 24  ? 1.7380 1.2334 1.7630 0.4053  0.4803  -0.1386 58   GLY A C   
192  O O   . GLY A 24  ? 1.8684 1.2714 1.8163 0.3870  0.4967  -0.1556 58   GLY A O   
193  N N   . PHE A 25  ? 1.7317 1.3054 1.8805 0.3816  0.4865  -0.1277 59   PHE A N   
194  C CA  . PHE A 25  ? 1.8533 1.4182 2.0440 0.3245  0.5019  -0.1383 59   PHE A CA  
195  C C   . PHE A 25  ? 1.9699 1.5320 2.0907 0.3323  0.5129  -0.1543 59   PHE A C   
196  O O   . PHE A 25  ? 2.0634 1.5757 2.1759 0.2901  0.5318  -0.1734 59   PHE A O   
197  C CB  . PHE A 25  ? 1.7957 1.4925 2.1349 0.2727  0.4625  -0.1095 59   PHE A CB  
198  C CG  . PHE A 25  ? 1.7267 1.4049 2.1254 0.2107  0.4755  -0.1181 59   PHE A CG  
199  C CD1 . PHE A 25  ? 1.6964 1.2945 2.1131 0.1932  0.4979  -0.1276 59   PHE A CD1 
200  C CD2 . PHE A 25  ? 1.7261 1.4748 2.1624 0.1720  0.4654  -0.1161 59   PHE A CD2 
201  C CE1 . PHE A 25  ? 1.7524 1.3474 2.2299 0.1381  0.5107  -0.1332 59   PHE A CE1 
202  C CE2 . PHE A 25  ? 1.7234 1.4652 2.2186 0.1147  0.4748  -0.1229 59   PHE A CE2 
203  C CZ  . PHE A 25  ? 1.7726 1.4409 2.2919 0.0975  0.4978  -0.1306 59   PHE A CZ  
204  N N   . LEU A 26  ? 1.9216 1.5415 1.9933 0.3851  0.4998  -0.1474 60   LEU A N   
205  C CA  . LEU A 26  ? 1.9932 1.5811 1.9687 0.4081  0.5161  -0.1704 60   LEU A CA  
206  C C   . LEU A 26  ? 2.1124 1.5487 1.9506 0.4296  0.5305  -0.1950 60   LEU A C   
207  O O   . LEU A 26  ? 2.2355 1.5779 2.0157 0.4017  0.5475  -0.2192 60   LEU A O   
208  C CB  . LEU A 26  ? 1.8359 1.5620 1.8118 0.4545  0.4895  -0.1498 60   LEU A CB  
209  C CG  . LEU A 26  ? 1.6211 1.5285 1.7285 0.4112  0.4492  -0.1144 60   LEU A CG  
210  C CD1 . LEU A 26  ? 1.5057 1.5440 1.5941 0.4590  0.4321  -0.0963 60   LEU A CD1 
211  C CD2 . LEU A 26  ? 1.6113 1.5151 1.7635 0.3431  0.4508  -0.1260 60   LEU A CD2 
212  N N   . VAL A 27  ? 2.0914 1.5230 1.8897 0.4636  0.5082  -0.1822 61   VAL A N   
213  C CA  . VAL A 27  ? 2.2402 1.5674 1.9269 0.4761  0.5059  -0.1924 61   VAL A CA  
214  C C   . VAL A 27  ? 2.3508 1.5668 2.0204 0.4233  0.5239  -0.2008 61   VAL A C   
215  O O   . VAL A 27  ? 2.6452 1.7707 2.2420 0.4109  0.5388  -0.2172 61   VAL A O   
216  C CB  . VAL A 27  ? 2.2294 1.5823 1.8970 0.5155  0.4837  -0.1742 61   VAL A CB  
217  C CG1 . VAL A 27  ? 2.3940 1.6471 1.9547 0.5314  0.4866  -0.1790 61   VAL A CG1 
218  C CG2 . VAL A 27  ? 2.1999 1.6749 1.8900 0.5659  0.4681  -0.1602 61   VAL A CG2 
219  N N   . ASN A 28  ? 2.0965 1.3203 1.8321 0.3928  0.5233  -0.1879 62   ASN A N   
220  C CA  . ASN A 28  ? 2.1082 1.2471 1.8361 0.3437  0.5445  -0.1902 62   ASN A CA  
221  C C   . ASN A 28  ? 2.1164 1.2184 1.8573 0.2992  0.5710  -0.2090 62   ASN A C   
222  O O   . ASN A 28  ? 2.1606 1.1689 1.8482 0.2697  0.5922  -0.2173 62   ASN A O   
223  C CB  . ASN A 28  ? 2.1330 1.3073 1.9419 0.3207  0.5396  -0.1749 62   ASN A CB  
224  C CG  . ASN A 28  ? 2.1718 1.3437 1.9437 0.3530  0.5194  -0.1625 62   ASN A CG  
225  O OD1 . ASN A 28  ? 2.1997 1.2998 1.9094 0.3487  0.5311  -0.1593 62   ASN A OD1 
226  N ND2 . ASN A 28  ? 2.1434 1.3942 1.9553 0.3851  0.4922  -0.1547 62   ASN A ND2 
227  N N   . ILE A 29  ? 2.0192 1.1955 1.8344 0.2917  0.5732  -0.2160 63   ILE A N   
228  C CA  . ILE A 29  ? 2.0949 1.2403 1.9228 0.2481  0.5983  -0.2405 63   ILE A CA  
229  C C   . ILE A 29  ? 2.3544 1.4133 2.0567 0.2656  0.6008  -0.2623 63   ILE A C   
230  O O   . ILE A 29  ? 2.4200 1.3897 2.0864 0.2220  0.6203  -0.2806 63   ILE A O   
231  C CB  . ILE A 29  ? 1.7893 1.0486 1.7240 0.2432  0.6006  -0.2439 63   ILE A CB  
232  C CG1 . ILE A 29  ? 1.7491 1.0769 1.8228 0.1790  0.5905  -0.2258 63   ILE A CG1 
233  C CG2 . ILE A 29  ? 1.6222 0.8931 1.5191 0.2236  0.5939  -0.2651 63   ILE A CG2 
234  C CD1 . ILE A 29  ? 1.6511 1.1452 1.8412 0.1452  0.5487  -0.2041 63   ILE A CD1 
235  N N   . VAL A 30  ? 2.4763 1.5619 2.1139 0.3286  0.5803  -0.2605 64   VAL A N   
236  C CA  . VAL A 30  ? 2.5930 1.5990 2.1141 0.3524  0.5790  -0.2810 64   VAL A CA  
237  C C   . VAL A 30  ? 2.6608 1.5422 2.1148 0.3303  0.5894  -0.2780 64   VAL A C   
238  O O   . VAL A 30  ? 2.8359 1.6192 2.2295 0.3024  0.6037  -0.2988 64   VAL A O   
239  C CB  . VAL A 30  ? 2.6420 1.7123 2.1196 0.4260  0.5560  -0.2742 64   VAL A CB  
240  C CG1 . VAL A 30  ? 2.8270 1.8082 2.1874 0.4526  0.5549  -0.2938 64   VAL A CG1 
241  C CG2 . VAL A 30  ? 2.5544 1.7572 2.0931 0.4486  0.5522  -0.2736 64   VAL A CG2 
242  N N   . VAL A 31  ? 2.5003 1.3843 1.9617 0.3418  0.5837  -0.2520 65   VAL A N   
243  C CA  . VAL A 31  ? 2.5696 1.3460 1.9679 0.3250  0.5999  -0.2436 65   VAL A CA  
244  C C   . VAL A 31  ? 2.6807 1.3944 2.1036 0.2541  0.6304  -0.2523 65   VAL A C   
245  O O   . VAL A 31  ? 2.8863 1.4940 2.2387 0.2310  0.6479  -0.2652 65   VAL A O   
246  C CB  . VAL A 31  ? 2.3966 1.2028 1.8117 0.3443  0.5914  -0.2158 65   VAL A CB  
247  C CG1 . VAL A 31  ? 2.4820 1.1806 1.8285 0.3290  0.6150  -0.2049 65   VAL A CG1 
248  C CG2 . VAL A 31  ? 2.3655 1.2342 1.7591 0.4084  0.5629  -0.2086 65   VAL A CG2 
249  N N   . VAL A 32  ? 2.5510 1.3316 2.0790 0.2172  0.6377  -0.2457 66   VAL A N   
250  C CA  . VAL A 32  ? 2.6008 1.3417 2.1724 0.1473  0.6697  -0.2510 66   VAL A CA  
251  C C   . VAL A 32  ? 2.6336 1.3245 2.1842 0.1092  0.6796  -0.2833 66   VAL A C   
252  O O   . VAL A 32  ? 2.7016 1.3178 2.2396 0.0537  0.7046  -0.2924 66   VAL A O   
253  C CB  . VAL A 32  ? 2.4616 1.2995 2.1626 0.1221  0.6724  -0.2390 66   VAL A CB  
254  C CG1 . VAL A 32  ? 2.4703 1.2846 2.2320 0.0496  0.7069  -0.2462 66   VAL A CG1 
255  C CG2 . VAL A 32  ? 2.4550 1.3275 2.1627 0.1563  0.6596  -0.2116 66   VAL A CG2 
256  N N   . THR A 33  ? 2.6230 1.3579 2.1698 0.1358  0.6606  -0.3025 67   THR A N   
257  C CA  . THR A 33  ? 2.7485 1.4321 2.2599 0.1031  0.6656  -0.3390 67   THR A CA  
258  C C   . THR A 33  ? 2.9499 1.5071 2.3303 0.1162  0.6645  -0.3501 67   THR A C   
259  O O   . THR A 33  ? 3.0269 1.4963 2.3768 0.0606  0.6782  -0.3701 67   THR A O   
260  C CB  . THR A 33  ? 2.7501 1.5180 2.2782 0.1370  0.6495  -0.3580 67   THR A CB  
261  O OG1 . THR A 33  ? 2.7730 1.5788 2.2473 0.2184  0.6265  -0.3430 67   THR A OG1 
262  C CG2 . THR A 33  ? 2.5921 1.4754 2.2636 0.1083  0.6574  -0.3529 67   THR A CG2 
263  N N   . LEU A 34  ? 3.0228 1.5714 2.3301 0.1869  0.6469  -0.3379 68   LEU A N   
264  C CA  . LEU A 34  ? 3.1144 1.5408 2.3031 0.2037  0.6477  -0.3455 68   LEU A CA  
265  C C   . LEU A 34  ? 3.0885 1.4163 2.2588 0.1510  0.6762  -0.3330 68   LEU A C   
266  O O   . LEU A 34  ? 3.3114 1.5201 2.3976 0.1327  0.6842  -0.3475 68   LEU A O   
267  C CB  . LEU A 34  ? 3.0944 1.5412 2.2292 0.2836  0.6288  -0.3278 68   LEU A CB  
268  C CG  . LEU A 34  ? 3.0425 1.5737 2.1680 0.3457  0.6033  -0.3405 68   LEU A CG  
269  C CD1 . LEU A 34  ? 3.0732 1.6166 2.1487 0.4145  0.5895  -0.3199 68   LEU A CD1 
270  C CD2 . LEU A 34  ? 3.1484 1.6211 2.2074 0.3424  0.5999  -0.3801 68   LEU A CD2 
271  N N   . PHE A 35  ? 2.9907 1.3658 2.2363 0.1269  0.6929  -0.3067 69   PHE A N   
272  C CA  . PHE A 35  ? 3.1934 1.4855 2.4187 0.0832  0.7257  -0.2925 69   PHE A CA  
273  C C   . PHE A 35  ? 3.4653 1.7471 2.7558 -0.0028 0.7495  -0.3066 69   PHE A C   
274  O O   . PHE A 35  ? 3.5564 1.7425 2.8048 -0.0475 0.7736  -0.3080 69   PHE A O   
275  C CB  . PHE A 35  ? 3.0311 1.3741 2.2913 0.1060  0.7346  -0.2576 69   PHE A CB  
276  C CG  . PHE A 35  ? 3.0596 1.3053 2.2578 0.0903  0.7679  -0.2401 69   PHE A CG  
277  C CD1 . PHE A 35  ? 2.9857 1.2101 2.2280 0.0253  0.8057  -0.2367 69   PHE A CD1 
278  C CD2 . PHE A 35  ? 3.1599 1.3377 2.2568 0.1408  0.7643  -0.2267 69   PHE A CD2 
279  C CE1 . PHE A 35  ? 3.0944 1.2288 2.2758 0.0121  0.8416  -0.2202 69   PHE A CE1 
280  C CE2 . PHE A 35  ? 3.2814 1.3639 2.3148 0.1273  0.7990  -0.2097 69   PHE A CE2 
281  C CZ  . PHE A 35  ? 3.2686 1.3276 2.3415 0.0633  0.8389  -0.2063 69   PHE A CZ  
282  N N   . CYS A 36  ? 3.6633 2.0445 3.0593 -0.0293 0.7430  -0.3168 70   CYS A N   
283  C CA  . CYS A 36  ? 3.7306 2.1402 3.2237 -0.1091 0.7665  -0.3203 70   CYS A CA  
284  C C   . CYS A 36  ? 3.9556 2.2921 3.4210 -0.1756 0.7667  -0.3510 70   CYS A C   
285  O O   . CYS A 36  ? 4.1015 2.3762 3.5574 -0.2296 0.7889  -0.3472 70   CYS A O   
286  C CB  . CYS A 36  ? 3.5362 2.0801 3.1595 -0.1144 0.7570  -0.3199 70   CYS A CB  
287  S SG  . CYS A 36  ? 3.4516 2.0602 3.2192 -0.2113 0.7771  -0.3244 70   CYS A SG  
288  N N   . CYS A 37  ? 2.5899 1.9317 3.2981 0.2145  0.2003  -0.0389 71   CYS A N   
289  C CA  . CYS A 37  ? 2.5247 1.9401 3.3542 0.1842  0.2484  -0.0635 71   CYS A CA  
290  C C   . CYS A 37  ? 2.4173 1.8449 3.3216 0.1842  0.2734  -0.0488 71   CYS A C   
291  O O   . CYS A 37  ? 2.4329 1.8775 3.4106 0.1669  0.3284  -0.0571 71   CYS A O   
292  C CB  . CYS A 37  ? 2.4184 1.9294 3.3099 0.1528  0.2304  -0.0987 71   CYS A CB  
293  S SG  . CYS A 37  ? 2.3009 1.8946 3.3307 0.1078  0.2843  -0.1304 71   CYS A SG  
294  N N   . GLN A 38  ? 2.3605 1.7793 3.2502 0.2021  0.2385  -0.0243 72   GLN A N   
295  C CA  . GLN A 38  ? 2.3007 1.7264 3.2635 0.2047  0.2678  -0.0021 72   GLN A CA  
296  C C   . GLN A 38  ? 2.4203 1.7731 3.3540 0.2288  0.2999  0.0351  72   GLN A C   
297  O O   . GLN A 38  ? 2.4888 1.7728 3.3234 0.2537  0.2690  0.0607  72   GLN A O   
298  C CB  . GLN A 38  ? 2.2342 1.6761 3.1962 0.2168  0.2217  0.0204  72   GLN A CB  
299  C CG  . GLN A 38  ? 2.0955 1.5833 3.0292 0.2062  0.1663  -0.0052 72   GLN A CG  
300  C CD  . GLN A 38  ? 1.9841 1.5524 2.9949 0.1659  0.1820  -0.0554 72   GLN A CD  
301  O OE1 . GLN A 38  ? 1.9531 1.5429 2.9337 0.1548  0.1636  -0.0806 72   GLN A OE1 
302  N NE2 . GLN A 38  ? 1.9267 1.5393 3.0396 0.1420  0.2183  -0.0674 72   GLN A NE2 
303  N N   . LYS A 39  ? 2.5200 1.8852 3.5385 0.2183  0.3635  0.0384  73   LYS A N   
304  C CA  . LYS A 39  ? 2.7327 2.0397 3.7378 0.2380  0.4026  0.0723  73   LYS A CA  
305  C C   . LYS A 39  ? 3.0326 2.2922 3.9884 0.2717  0.3650  0.1288  73   LYS A C   
306  O O   . LYS A 39  ? 2.9466 2.2300 3.9125 0.2772  0.3266  0.1456  73   LYS A O   
307  C CB  . LYS A 39  ? 2.5422 1.8766 3.6550 0.2195  0.4813  0.0687  73   LYS A CB  
308  C CG  . LYS A 39  ? 2.3656 1.7483 3.5334 0.1797  0.5170  0.0178  73   LYS A CG  
309  C CD  . LYS A 39  ? 2.2826 1.6393 3.3969 0.1779  0.5237  0.0025  73   LYS A CD  
310  C CE  . LYS A 39  ? 2.1475 1.5583 3.3281 0.1366  0.5593  -0.0403 73   LYS A CE  
311  N NZ  . LYS A 39  ? 2.1117 1.4992 3.2537 0.1348  0.5753  -0.0478 73   LYS A NZ  
312  N N   . GLY A 40  ? 3.4160 2.6100 4.3202 0.2917  0.3756  0.1618  74   GLY A N   
313  C CA  . GLY A 40  ? 3.5218 2.6580 4.3491 0.3180  0.3250  0.2175  74   GLY A CA  
314  C C   . GLY A 40  ? 3.6176 2.6657 4.3343 0.3282  0.3089  0.2331  74   GLY A C   
315  O O   . GLY A 40  ? 3.7533 2.7476 4.4350 0.3442  0.2913  0.2960  74   GLY A O   
316  N N   . PRO A 41  ? 2.8584 1.8934 3.5410 0.3155  0.3273  0.1875  75   PRO A N   
317  C CA  . PRO A 41  ? 2.7150 1.6651 3.3133 0.3219  0.3330  0.2046  75   PRO A CA  
318  C C   . PRO A 41  ? 2.8139 1.7458 3.4591 0.3318  0.3966  0.2341  75   PRO A C   
319  O O   . PRO A 41  ? 2.8013 1.7786 3.5390 0.3368  0.4308  0.2522  75   PRO A O   
320  C CB  . PRO A 41  ? 2.6181 1.5811 3.1907 0.3038  0.3442  0.1474  75   PRO A CB  
321  C CG  . PRO A 41  ? 2.5510 1.5805 3.1512 0.2920  0.3125  0.1151  75   PRO A CG  
322  C CD  . PRO A 41  ? 2.5028 1.5920 3.2022 0.2938  0.3254  0.1292  75   PRO A CD  
323  N N   . LYS A 42  ? 2.9335 1.7967 3.5129 0.3340  0.4155  0.2413  76   LYS A N   
324  C CA  . LYS A 42  ? 2.9157 1.7469 3.5140 0.3445  0.4749  0.2683  76   LYS A CA  
325  C C   . LYS A 42  ? 2.8138 1.5861 3.3850 0.3629  0.4635  0.3482  76   LYS A C   
326  O O   . LYS A 42  ? 2.9940 1.7531 3.5985 0.3748  0.5151  0.3775  76   LYS A O   
327  C CB  . LYS A 42  ? 2.8226 1.7273 3.5382 0.3405  0.5395  0.2480  76   LYS A CB  
328  C CG  . LYS A 42  ? 2.6705 1.6153 3.4262 0.3181  0.5894  0.1921  76   LYS A CG  
329  C CD  . LYS A 42  ? 2.4916 1.5095 3.2990 0.2959  0.5721  0.1509  76   LYS A CD  
330  C CE  . LYS A 42  ? 2.3371 1.4151 3.2530 0.2906  0.5983  0.1588  76   LYS A CE  
331  N NZ  . LYS A 42  ? 2.1241 1.2701 3.0887 0.2645  0.5822  0.1180  76   LYS A NZ  
332  N N   . LYS A 43  ? 2.7146 1.4546 3.2257 0.3631  0.3969  0.3903  77   LYS A N   
333  C CA  . LYS A 43  ? 2.8285 1.5106 3.2932 0.3709  0.3738  0.4795  77   LYS A CA  
334  C C   . LYS A 43  ? 2.9632 1.5431 3.2721 0.3519  0.3193  0.5033  77   LYS A C   
335  O O   . LYS A 43  ? 2.9555 1.5282 3.2114 0.3373  0.2772  0.4667  77   LYS A O   
336  C CB  . LYS A 43  ? 2.2431 0.9846 2.7731 0.3790  0.3401  0.5317  77   LYS A CB  
337  C CG  . LYS A 43  ? 2.3574 1.0693 2.8666 0.3848  0.3248  0.6348  77   LYS A CG  
338  C CD  . LYS A 43  ? 2.3256 1.1166 2.9158 0.3920  0.2969  0.6880  77   LYS A CD  
339  C CE  . LYS A 43  ? 2.4416 1.2193 3.0097 0.3923  0.2759  0.7976  77   LYS A CE  
340  N NZ  . LYS A 43  ? 2.4099 1.2774 3.0618 0.3970  0.2479  0.8527  77   LYS A NZ  
341  N N   . VAL A 44  ? 3.1927 1.3618 3.2597 -0.4016 -0.0721 -0.1761 78   VAL A N   
342  C CA  . VAL A 44  ? 3.0996 1.3481 3.1770 -0.4211 -0.0661 -0.1346 78   VAL A CA  
343  C C   . VAL A 44  ? 2.8852 1.1799 2.9696 -0.3519 -0.0837 -0.1212 78   VAL A C   
344  O O   . VAL A 44  ? 2.7774 1.1771 2.8983 -0.3521 -0.0826 -0.1290 78   VAL A O   
345  C CB  . VAL A 44  ? 3.2724 1.4717 3.3301 -0.4580 -0.0587 -0.0759 78   VAL A CB  
346  C CG1 . VAL A 44  ? 3.2732 1.5545 3.3296 -0.4787 -0.0497 -0.0358 78   VAL A CG1 
347  C CG2 . VAL A 44  ? 3.3853 1.5639 3.4623 -0.5259 -0.0494 -0.0890 78   VAL A CG2 
348  N N   . SER A 45  ? 2.7980 1.0248 2.8648 -0.2899 -0.0993 -0.1011 79   SER A N   
349  C CA  . SER A 45  ? 2.7511 1.0309 2.8392 -0.2205 -0.1154 -0.0925 79   SER A CA  
350  C C   . SER A 45  ? 2.6493 1.0184 2.7819 -0.1903 -0.1161 -0.1524 79   SER A C   
351  O O   . SER A 45  ? 2.5487 1.0342 2.7009 -0.1588 -0.1104 -0.1478 79   SER A O   
352  C CB  . SER A 45  ? 2.7951 0.9927 2.8681 -0.1563 -0.1312 -0.0698 79   SER A CB  
353  O OG  . SER A 45  ? 2.7358 0.8843 2.8164 -0.1243 -0.1310 -0.1221 79   SER A OG  
354  N N   . SER A 46  ? 2.5862 0.9256 2.7216 -0.2020 -0.1147 -0.2064 80   SER A N   
355  C CA  . SER A 46  ? 2.4585 0.8933 2.6264 -0.1822 -0.1138 -0.2625 80   SER A CA  
356  C C   . SER A 46  ? 2.3976 0.9636 2.5921 -0.2257 -0.1012 -0.2622 80   SER A C   
357  O O   . SER A 46  ? 2.3867 1.0681 2.6040 -0.1953 -0.0991 -0.2724 80   SER A O   
358  C CB  . SER A 46  ? 2.5554 0.9233 2.7099 -0.1937 -0.1160 -0.3191 80   SER A CB  
359  O OG  . SER A 46  ? 2.6998 1.0025 2.8387 -0.1300 -0.1193 -0.3343 80   SER A OG  
360  N N   . ILE A 47  ? 2.3754 0.9258 2.5703 -0.2968 -0.0922 -0.2509 81   ILE A N   
361  C CA  . ILE A 47  ? 2.2759 0.9517 2.5077 -0.3354 -0.0779 -0.2491 81   ILE A CA  
362  C C   . ILE A 47  ? 2.1153 0.8705 2.3527 -0.3046 -0.0685 -0.2087 81   ILE A C   
363  O O   . ILE A 47  ? 1.9896 0.8644 2.2624 -0.2941 -0.0629 -0.2179 81   ILE A O   
364  C CB  . ILE A 47  ? 2.3004 0.9414 2.5325 -0.4178 -0.0651 -0.2402 81   ILE A CB  
365  C CG1 . ILE A 47  ? 2.2167 0.8043 2.4446 -0.4540 -0.0745 -0.2854 81   ILE A CG1 
366  C CG2 . ILE A 47  ? 2.1915 0.9635 2.4701 -0.4518 -0.0453 -0.2339 81   ILE A CG2 
367  C CD1 . ILE A 47  ? 2.3444 0.8982 2.5466 -0.5309 -0.0665 -0.2688 81   ILE A CD1 
368  N N   . TYR A 48  ? 2.1013 0.7880 2.3023 -0.2906 -0.0692 -0.1623 82   TYR A N   
369  C CA  . TYR A 48  ? 2.0235 0.7799 2.2225 -0.2641 -0.0619 -0.1244 82   TYR A CA  
370  C C   . TYR A 48  ? 1.9238 0.7530 2.1399 -0.1949 -0.0711 -0.1420 82   TYR A C   
371  O O   . TYR A 48  ? 1.8573 0.7906 2.0929 -0.1838 -0.0620 -0.1352 82   TYR A O   
372  C CB  . TYR A 48  ? 2.1508 0.8146 2.3027 -0.2643 -0.0677 -0.0698 82   TYR A CB  
373  C CG  . TYR A 48  ? 2.3020 0.9163 2.4278 -0.3413 -0.0532 -0.0419 82   TYR A CG  
374  C CD1 . TYR A 48  ? 2.3173 1.0099 2.4720 -0.3983 -0.0277 -0.0588 82   TYR A CD1 
375  C CD2 . TYR A 48  ? 2.5031 0.9945 2.5774 -0.3579 -0.0653 0.0020  82   TYR A CD2 
376  C CE1 . TYR A 48  ? 2.4471 1.1024 2.5784 -0.4731 -0.0094 -0.0369 82   TYR A CE1 
377  C CE2 . TYR A 48  ? 2.6070 1.0588 2.6502 -0.4336 -0.0491 0.0287  82   TYR A CE2 
378  C CZ  . TYR A 48  ? 2.5892 1.1238 2.6603 -0.4931 -0.0197 0.0072  82   TYR A CZ  
379  O OH  . TYR A 48  ? 2.6869 1.2296 2.7489 -0.5562 0.0008  0.0299  82   TYR A OH  
380  N N   . ILE A 49  ? 1.9410 0.7153 2.1498 -0.1498 -0.0872 -0.1666 83   ILE A N   
381  C CA  . ILE A 49  ? 1.9697 0.8169 2.1925 -0.0896 -0.0927 -0.1888 83   ILE A CA  
382  C C   . ILE A 49  ? 1.8791 0.8350 2.1314 -0.1046 -0.0882 -0.2233 83   ILE A C   
383  O O   . ILE A 49  ? 1.7891 0.8407 2.0537 -0.0773 -0.0863 -0.2198 83   ILE A O   
384  C CB  . ILE A 49  ? 2.1509 0.9181 2.3643 -0.0445 -0.1052 -0.2198 83   ILE A CB  
385  C CG1 . ILE A 49  ? 2.3308 1.0006 2.5255 -0.0161 -0.1150 -0.1788 83   ILE A CG1 
386  C CG2 . ILE A 49  ? 2.0633 0.9162 2.2897 0.0076  -0.1059 -0.2518 83   ILE A CG2 
387  C CD1 . ILE A 49  ? 2.5028 1.0860 2.6985 0.0324  -0.1254 -0.2107 83   ILE A CD1 
388  N N   . PHE A 50  ? 1.9613 0.9036 2.2255 -0.1501 -0.0891 -0.2547 84   PHE A N   
389  C CA  . PHE A 50  ? 1.8359 0.8806 2.1324 -0.1657 -0.0916 -0.2846 84   PHE A CA  
390  C C   . PHE A 50  ? 1.7620 0.9013 2.0895 -0.1823 -0.0792 -0.2555 84   PHE A C   
391  O O   . PHE A 50  ? 1.7843 1.0188 2.1327 -0.1620 -0.0829 -0.2606 84   PHE A O   
392  C CB  . PHE A 50  ? 2.0192 1.0302 2.3255 -0.2173 -0.0972 -0.3203 84   PHE A CB  
393  C CG  . PHE A 50  ? 1.9330 1.0534 2.2820 -0.2435 -0.1036 -0.3420 84   PHE A CG  
394  C CD1 . PHE A 50  ? 1.9744 1.1530 2.3230 -0.2200 -0.1203 -0.3747 84   PHE A CD1 
395  C CD2 . PHE A 50  ? 1.8922 1.0589 2.2832 -0.2930 -0.0935 -0.3297 84   PHE A CD2 
396  C CE1 . PHE A 50  ? 1.9145 1.1920 2.3030 -0.2439 -0.1329 -0.3887 84   PHE A CE1 
397  C CE2 . PHE A 50  ? 1.8737 1.1439 2.3157 -0.3125 -0.1032 -0.3476 84   PHE A CE2 
398  C CZ  . PHE A 50  ? 1.8405 1.1641 2.2808 -0.2873 -0.1260 -0.3743 84   PHE A CZ  
399  N N   . ASN A 51  ? 1.7761 0.8874 2.1048 -0.2218 -0.0632 -0.2259 85   ASN A N   
400  C CA  . ASN A 51  ? 1.8221 1.0192 2.1824 -0.2402 -0.0456 -0.2048 85   ASN A CA  
401  C C   . ASN A 51  ? 1.7516 0.9921 2.0976 -0.1942 -0.0427 -0.1775 85   ASN A C   
402  O O   . ASN A 51  ? 1.5374 0.8690 1.9140 -0.1857 -0.0378 -0.1770 85   ASN A O   
403  C CB  . ASN A 51  ? 1.8631 1.0167 2.2185 -0.2969 -0.0247 -0.1824 85   ASN A CB  
404  C CG  . ASN A 51  ? 2.0349 1.1619 2.4115 -0.3508 -0.0250 -0.2103 85   ASN A CG  
405  O OD1 . ASN A 51  ? 2.0708 1.2660 2.4941 -0.3601 -0.0331 -0.2429 85   ASN A OD1 
406  N ND2 . ASN A 51  ? 2.2105 1.2374 2.5513 -0.3894 -0.0190 -0.1953 85   ASN A ND2 
407  N N   . LEU A 52  ? 1.8765 1.0526 2.1794 -0.1640 -0.0475 -0.1542 86   LEU A N   
408  C CA  . LEU A 52  ? 1.7704 0.9914 2.0601 -0.1211 -0.0474 -0.1301 86   LEU A CA  
409  C C   . LEU A 52  ? 1.8800 1.1752 2.1858 -0.0816 -0.0587 -0.1569 86   LEU A C   
410  O O   . LEU A 52  ? 1.9421 1.3141 2.2576 -0.0678 -0.0538 -0.1454 86   LEU A O   
411  C CB  . LEU A 52  ? 1.7289 0.8702 1.9788 -0.0928 -0.0566 -0.1030 86   LEU A CB  
412  C CG  . LEU A 52  ? 1.7396 0.9254 1.9766 -0.0476 -0.0600 -0.0779 86   LEU A CG  
413  C CD1 . LEU A 52  ? 1.7665 1.0036 1.9984 -0.0746 -0.0426 -0.0455 86   LEU A CD1 
414  C CD2 . LEU A 52  ? 1.8612 0.9673 2.0728 -0.0153 -0.0752 -0.0559 86   LEU A CD2 
415  N N   . ALA A 53  ? 2.0026 1.2729 2.3065 -0.0675 -0.0732 -0.1936 87   ALA A N   
416  C CA  . ALA A 53  ? 2.0039 1.3428 2.3127 -0.0370 -0.0840 -0.2202 87   ALA A CA  
417  C C   . ALA A 53  ? 1.9975 1.4231 2.3421 -0.0612 -0.0863 -0.2283 87   ALA A C   
418  O O   . ALA A 53  ? 1.9274 1.4251 2.2745 -0.0392 -0.0925 -0.2287 87   ALA A O   
419  C CB  . ALA A 53  ? 2.1329 1.4210 2.4262 -0.0245 -0.0959 -0.2627 87   ALA A CB  
420  N N   . VAL A 54  ? 2.0632 1.4841 2.4387 -0.1066 -0.0823 -0.2336 88   VAL A N   
421  C CA  . VAL A 54  ? 2.0298 1.5367 2.4539 -0.1262 -0.0858 -0.2385 88   VAL A CA  
422  C C   . VAL A 54  ? 1.9508 1.5077 2.3911 -0.1197 -0.0688 -0.2059 88   VAL A C   
423  O O   . VAL A 54  ? 1.9666 1.5970 2.4312 -0.1067 -0.0759 -0.2034 88   VAL A O   
424  C CB  . VAL A 54  ? 2.0162 1.5124 2.4785 -0.1773 -0.0843 -0.2555 88   VAL A CB  
425  C CG1 . VAL A 54  ? 1.9179 1.5087 2.4471 -0.1946 -0.0850 -0.2550 88   VAL A CG1 
426  C CG2 . VAL A 54  ? 2.1006 1.5583 2.5471 -0.1871 -0.1044 -0.2933 88   VAL A CG2 
427  N N   . ALA A 55  ? 1.9243 1.4381 2.3475 -0.1314 -0.0472 -0.1800 89   ALA A N   
428  C CA  . ALA A 55  ? 1.7544 1.3085 2.1832 -0.1289 -0.0283 -0.1524 89   ALA A CA  
429  C C   . ALA A 55  ? 1.6210 1.2115 2.0250 -0.0846 -0.0378 -0.1413 89   ALA A C   
430  O O   . ALA A 55  ? 1.6077 1.2593 2.0326 -0.0781 -0.0340 -0.1335 89   ALA A O   
431  C CB  . ALA A 55  ? 1.7696 1.2644 2.1672 -0.1524 -0.0069 -0.1258 89   ALA A CB  
432  N N   . ASP A 56  ? 1.7299 1.2832 2.0924 -0.0542 -0.0493 -0.1418 90   ASP A N   
433  C CA  . ASP A 56  ? 1.7385 1.3342 2.0793 -0.0153 -0.0565 -0.1344 90   ASP A CA  
434  C C   . ASP A 56  ? 1.7056 1.3624 2.0621 -0.0056 -0.0735 -0.1565 90   ASP A C   
435  O O   . ASP A 56  ? 1.6967 1.4073 2.0468 0.0112  -0.0759 -0.1450 90   ASP A O   
436  C CB  . ASP A 56  ? 1.9314 1.4803 2.2356 0.0167  -0.0630 -0.1343 90   ASP A CB  
437  C CG  . ASP A 56  ? 2.0857 1.5786 2.3697 0.0110  -0.0532 -0.1024 90   ASP A CG  
438  O OD1 . ASP A 56  ? 2.0645 1.5673 2.3518 -0.0175 -0.0380 -0.0791 90   ASP A OD1 
439  O OD2 . ASP A 56  ? 2.1614 1.6001 2.4263 0.0346  -0.0613 -0.1008 90   ASP A OD2 
440  N N   . LEU A 57  ? 1.6891 1.3375 2.0616 -0.0200 -0.0874 -0.1862 91   LEU A N   
441  C CA  . LEU A 57  ? 1.6035 1.3096 1.9840 -0.0157 -0.1088 -0.2045 91   LEU A CA  
442  C C   . LEU A 57  ? 1.3811 1.1494 1.8064 -0.0283 -0.1110 -0.1883 91   LEU A C   
443  O O   . LEU A 57  ? 1.3536 1.1709 1.7715 -0.0120 -0.1196 -0.1759 91   LEU A O   
444  C CB  . LEU A 57  ? 1.7181 1.3993 2.1026 -0.0344 -0.1246 -0.2407 91   LEU A CB  
445  C CG  . LEU A 57  ? 1.7317 1.4685 2.1124 -0.0354 -0.1515 -0.2615 91   LEU A CG  
446  C CD1 . LEU A 57  ? 1.7283 1.4801 2.0560 -0.0035 -0.1543 -0.2683 91   LEU A CD1 
447  C CD2 . LEU A 57  ? 1.7180 1.4313 2.1065 -0.0646 -0.1667 -0.2970 91   LEU A CD2 
448  N N   . LEU A 58  ? 1.2262 0.9923 1.7011 -0.0578 -0.1020 -0.1886 92   LEU A N   
449  C CA  . LEU A 58  ? 1.2995 1.1219 1.8301 -0.0657 -0.0996 -0.1758 92   LEU A CA  
450  C C   . LEU A 58  ? 1.3830 1.2134 1.8989 -0.0508 -0.0790 -0.1479 92   LEU A C   
451  O O   . LEU A 58  ? 1.2720 1.1479 1.8204 -0.0453 -0.0815 -0.1368 92   LEU A O   
452  C CB  . LEU A 58  ? 1.2148 1.0349 1.8046 -0.1010 -0.0854 -0.1852 92   LEU A CB  
453  C CG  . LEU A 58  ? 1.3132 1.1293 1.9254 -0.1254 -0.1045 -0.2133 92   LEU A CG  
454  C CD1 . LEU A 58  ? 1.3197 1.1470 1.9978 -0.1633 -0.0855 -0.2202 92   LEU A CD1 
455  C CD2 . LEU A 58  ? 1.3013 1.1744 1.9288 -0.1154 -0.1428 -0.2231 92   LEU A CD2 
456  N N   . LEU A 59  ? 1.4451 1.2304 1.9136 -0.0449 -0.0610 -0.1358 93   LEU A N   
457  C CA  . LEU A 59  ? 1.3309 1.1240 1.7773 -0.0354 -0.0432 -0.1100 93   LEU A CA  
458  C C   . LEU A 59  ? 1.4102 1.2418 1.8293 -0.0074 -0.0597 -0.1017 93   LEU A C   
459  O O   . LEU A 59  ? 1.6241 1.4895 2.0560 -0.0049 -0.0567 -0.0876 93   LEU A O   
460  C CB  . LEU A 59  ? 1.3749 1.1133 1.7765 -0.0375 -0.0276 -0.0967 93   LEU A CB  
461  C CG  . LEU A 59  ? 1.4886 1.2309 1.8580 -0.0334 -0.0109 -0.0692 93   LEU A CG  
462  C CD1 . LEU A 59  ? 1.6437 1.4087 2.0466 -0.0576 0.0120  -0.0645 93   LEU A CD1 
463  C CD2 . LEU A 59  ? 1.5332 1.2187 1.8642 -0.0390 -0.0038 -0.0547 93   LEU A CD2 
464  N N   . LEU A 60  ? 1.4361 1.2609 1.8166 0.0121  -0.0753 -0.1122 94   LEU A N   
465  C CA  . LEU A 60  ? 1.3973 1.2631 1.7466 0.0332  -0.0884 -0.1066 94   LEU A CA  
466  C C   . LEU A 60  ? 1.2926 1.2021 1.6642 0.0286  -0.1128 -0.1124 94   LEU A C   
467  O O   . LEU A 60  ? 1.2548 1.2001 1.6019 0.0384  -0.1236 -0.1008 94   LEU A O   
468  C CB  . LEU A 60  ? 1.5064 1.3573 1.8129 0.0545  -0.0933 -0.1221 94   LEU A CB  
469  C CG  . LEU A 60  ? 1.5365 1.3391 1.8273 0.0633  -0.0769 -0.1140 94   LEU A CG  
470  C CD1 . LEU A 60  ? 1.4820 1.2718 1.7448 0.0908  -0.0823 -0.1340 94   LEU A CD1 
471  C CD2 . LEU A 60  ? 1.5845 1.4012 1.8634 0.0635  -0.0614 -0.0813 94   LEU A CD2 
472  N N   . ALA A 61  ? 1.1576 1.0666 1.5745 0.0115  -0.1239 -0.1277 95   ALA A N   
473  C CA  . ALA A 61  ? 1.3277 1.2824 1.7744 0.0067  -0.1525 -0.1272 95   ALA A CA  
474  C C   . ALA A 61  ? 1.5414 1.5225 2.0188 0.0101  -0.1493 -0.1002 95   ALA A C   
475  O O   . ALA A 61  ? 1.5706 1.5873 2.0587 0.0131  -0.1767 -0.0894 95   ALA A O   
476  C CB  . ALA A 61  ? 1.2659 1.2218 1.7663 -0.0144 -0.1647 -0.1478 95   ALA A CB  
477  N N   . THR A 62  ? 1.5112 1.4716 1.9999 0.0078  -0.1175 -0.0890 96   THR A N   
478  C CA  . THR A 62  ? 1.3160 1.2911 1.8295 0.0104  -0.1082 -0.0682 96   THR A CA  
479  C C   . THR A 62  ? 1.2960 1.2725 1.7478 0.0217  -0.1038 -0.0477 96   THR A C   
480  O O   . THR A 62  ? 1.3639 1.3469 1.8268 0.0225  -0.0984 -0.0302 96   THR A O   
481  C CB  . THR A 62  ? 1.1745 1.1288 1.7282 -0.0048 -0.0719 -0.0714 96   THR A CB  
482  O OG1 . THR A 62  ? 0.9582 0.8756 1.4619 -0.0110 -0.0487 -0.0713 96   THR A OG1 
483  C CG2 . THR A 62  ? 1.2402 1.2059 1.8681 -0.0197 -0.0740 -0.0914 96   THR A CG2 
484  N N   . LEU A 63  ? 1.2823 1.2538 1.6738 0.0299  -0.1048 -0.0512 97   LEU A N   
485  C CA  . LEU A 63  ? 1.3601 1.3446 1.6976 0.0381  -0.1003 -0.0331 97   LEU A CA  
486  C C   . LEU A 63  ? 1.5212 1.5373 1.8465 0.0394  -0.1243 -0.0173 97   LEU A C   
487  O O   . LEU A 63  ? 1.6679 1.6891 1.9685 0.0375  -0.1157 0.0035  97   LEU A O   
488  C CB  . LEU A 63  ? 1.3938 1.3765 1.6822 0.0503  -0.0980 -0.0445 97   LEU A CB  
489  C CG  . LEU A 63  ? 1.4319 1.3779 1.7176 0.0514  -0.0755 -0.0472 97   LEU A CG  
490  C CD1 . LEU A 63  ? 1.5061 1.4569 1.7512 0.0713  -0.0762 -0.0551 97   LEU A CD1 
491  C CD2 . LEU A 63  ? 1.4028 1.3399 1.6892 0.0394  -0.0525 -0.0250 97   LEU A CD2 
492  N N   . PRO A 64  ? 1.4666 1.5027 1.8017 0.0387  -0.1559 -0.0235 98   PRO A N   
493  C CA  . PRO A 64  ? 1.4673 1.5274 1.7878 0.0362  -0.1822 -0.0004 98   PRO A CA  
494  C C   . PRO A 64  ? 1.3192 1.3666 1.6877 0.0352  -0.1785 0.0215  98   PRO A C   
495  O O   . PRO A 64  ? 1.1946 1.2437 1.5362 0.0329  -0.1850 0.0465  98   PRO A O   
496  C CB  . PRO A 64  ? 1.4988 1.5799 1.8302 0.0316  -0.2190 -0.0118 98   PRO A CB  
497  C CG  . PRO A 64  ? 1.4946 1.5659 1.8122 0.0327  -0.2080 -0.0451 98   PRO A CG  
498  C CD  . PRO A 64  ? 1.4682 1.5055 1.8141 0.0367  -0.1720 -0.0502 98   PRO A CD  
499  N N   . LEU A 65  ? 1.4284 1.4614 1.8684 0.0354  -0.1659 0.0104  99   LEU A N   
500  C CA  . LEU A 65  ? 1.4512 1.4710 1.9463 0.0369  -0.1558 0.0233  99   LEU A CA  
501  C C   . LEU A 65  ? 1.3548 1.3509 1.8102 0.0316  -0.1223 0.0337  99   LEU A C   
502  O O   . LEU A 65  ? 1.5163 1.5008 1.9739 0.0316  -0.1237 0.0530  99   LEU A O   
503  C CB  . LEU A 65  ? 1.5338 1.5512 2.1136 0.0350  -0.1407 0.0021  99   LEU A CB  
504  C CG  . LEU A 65  ? 1.6504 1.6973 2.2799 0.0361  -0.1752 -0.0087 99   LEU A CG  
505  C CD1 . LEU A 65  ? 1.7836 1.8312 2.4836 0.0272  -0.1520 -0.0346 99   LEU A CD1 
506  C CD2 . LEU A 65  ? 1.6216 1.6894 2.2957 0.0468  -0.2147 0.0138  99   LEU A CD2 
507  N N   . TRP A 66  ? 1.2176 1.2038 1.6361 0.0255  -0.0944 0.0226  100  TRP A N   
508  C CA  . TRP A 66  ? 1.2921 1.2623 1.6699 0.0161  -0.0659 0.0334  100  TRP A CA  
509  C C   . TRP A 66  ? 1.2375 1.2249 1.5488 0.0156  -0.0799 0.0538  100  TRP A C   
510  O O   . TRP A 66  ? 1.0590 1.0354 1.3454 0.0050  -0.0661 0.0688  100  TRP A O   
511  C CB  . TRP A 66  ? 1.4473 1.4051 1.8039 0.0088  -0.0387 0.0215  100  TRP A CB  
512  C CG  . TRP A 66  ? 1.4845 1.4267 1.8956 0.0028  -0.0249 0.0014  100  TRP A CG  
513  C CD1 . TRP A 66  ? 1.5414 1.4763 1.9511 0.0025  -0.0252 -0.0129 100  TRP A CD1 
514  C CD2 . TRP A 66  ? 1.4948 1.4274 1.9722 -0.0055 -0.0071 -0.0083 100  TRP A CD2 
515  N NE1 . TRP A 66  ? 1.5633 1.4860 2.0290 -0.0104 -0.0092 -0.0286 100  TRP A NE1 
516  C CE2 . TRP A 66  ? 1.5100 1.4364 2.0211 -0.0147 0.0037  -0.0279 100  TRP A CE2 
517  C CE3 . TRP A 66  ? 1.4896 1.4166 2.0039 -0.0061 0.0024  -0.0043 100  TRP A CE3 
518  C CZ2 . TRP A 66  ? 1.5339 1.4596 2.1157 -0.0264 0.0258  -0.0448 100  TRP A CZ2 
519  C CZ3 . TRP A 66  ? 1.4784 1.4015 2.0680 -0.0123 0.0246  -0.0234 100  TRP A CZ3 
520  C CH2 . TRP A 66  ? 1.4923 1.4200 2.1157 -0.0233 0.0372  -0.0440 100  TRP A CH2 
521  N N   . ALA A 67  ? 1.4630 1.4781 1.7424 0.0228  -0.1048 0.0521  101  ALA A N   
522  C CA  . ALA A 67  ? 1.4965 1.5359 1.7127 0.0178  -0.1161 0.0695  101  ALA A CA  
523  C C   . ALA A 67  ? 1.4805 1.5114 1.7012 0.0110  -0.1376 0.0945  101  ALA A C   
524  O O   . ALA A 67  ? 1.5912 1.6218 1.7680 -0.0019 -0.1343 0.1150  101  ALA A O   
525  C CB  . ALA A 67  ? 1.5587 1.6312 1.7407 0.0247  -0.1334 0.0555  101  ALA A CB  
526  N N   . THR A 68  ? 1.4059 1.4294 1.6815 0.0185  -0.1620 0.0949  102  THR A N   
527  C CA  . THR A 68  ? 1.4232 1.4292 1.7187 0.0169  -0.1851 0.1219  102  THR A CA  
528  C C   . THR A 68  ? 1.3847 1.3503 1.7091 0.0140  -0.1556 0.1265  102  THR A C   
529  O O   . THR A 68  ? 1.4212 1.3637 1.7238 0.0056  -0.1615 0.1510  102  THR A O   
530  C CB  . THR A 68  ? 1.3871 1.4010 1.7490 0.0288  -0.2196 0.1204  102  THR A CB  
531  O OG1 . THR A 68  ? 1.4249 1.4741 1.7444 0.0244  -0.2495 0.1173  102  THR A OG1 
532  C CG2 . THR A 68  ? 1.4684 1.4588 1.8682 0.0335  -0.2460 0.1505  102  THR A CG2 
533  N N   . TYR A 69  ? 1.4262 1.3799 1.7937 0.0169  -0.1222 0.1021  103  TYR A N   
534  C CA  . TYR A 69  ? 1.5113 1.4277 1.9031 0.0099  -0.0886 0.0990  103  TYR A CA  
535  C C   . TYR A 69  ? 1.4326 1.3394 1.7473 -0.0105 -0.0698 0.1120  103  TYR A C   
536  O O   . TYR A 69  ? 1.4557 1.3275 1.7681 -0.0203 -0.0596 0.1226  103  TYR A O   
537  C CB  . TYR A 69  ? 1.6162 1.5290 2.0542 0.0091  -0.0550 0.0690  103  TYR A CB  
538  C CG  . TYR A 69  ? 1.6262 1.5046 2.0818 -0.0040 -0.0131 0.0579  103  TYR A CG  
539  C CD1 . TYR A 69  ? 1.5986 1.4513 2.1249 0.0043  -0.0072 0.0530  103  TYR A CD1 
540  C CD2 . TYR A 69  ? 1.5648 1.4372 1.9687 -0.0251 0.0204  0.0504  103  TYR A CD2 
541  C CE1 . TYR A 69  ? 1.6069 1.4269 2.1475 -0.0100 0.0363  0.0355  103  TYR A CE1 
542  C CE2 . TYR A 69  ? 1.5246 1.3666 1.9355 -0.0436 0.0598  0.0373  103  TYR A CE2 
543  C CZ  . TYR A 69  ? 1.5362 1.3510 2.0135 -0.0370 0.0704  0.0270  103  TYR A CZ  
544  O OH  . TYR A 69  ? 1.5356 1.3187 2.0167 -0.0578 0.1148  0.0073  103  TYR A OH  
545  N N   . TYR A 70  ? 1.3305 1.2684 1.5857 -0.0171 -0.0650 0.1100  104  TYR A N   
546  C CA  . TYR A 70  ? 1.2261 1.1701 1.4122 -0.0374 -0.0512 0.1233  104  TYR A CA  
547  C C   . TYR A 70  ? 1.1931 1.1482 1.3322 -0.0458 -0.0778 0.1496  104  TYR A C   
548  O O   . TYR A 70  ? 1.0251 0.9769 1.1149 -0.0681 -0.0674 0.1640  104  TYR A O   
549  C CB  . TYR A 70  ? 1.3232 1.3035 1.4735 -0.0375 -0.0392 0.1130  104  TYR A CB  
550  C CG  . TYR A 70  ? 1.3527 1.3160 1.5198 -0.0434 -0.0084 0.0973  104  TYR A CG  
551  C CD1 . TYR A 70  ? 1.3717 1.3270 1.5036 -0.0672 0.0162  0.1029  104  TYR A CD1 
552  C CD2 . TYR A 70  ? 1.4234 1.3792 1.6357 -0.0307 -0.0051 0.0781  104  TYR A CD2 
553  C CE1 . TYR A 70  ? 1.4539 1.3939 1.5912 -0.0785 0.0424  0.0913  104  TYR A CE1 
554  C CE2 . TYR A 70  ? 1.4733 1.4114 1.6924 -0.0422 0.0226  0.0670  104  TYR A CE2 
555  C CZ  . TYR A 70  ? 1.4720 1.4024 1.6515 -0.0662 0.0456  0.0745  104  TYR A CZ  
556  O OH  . TYR A 70  ? 1.4266 1.3396 1.6035 -0.0832 0.0711  0.0660  104  TYR A OH  
557  N N   . SER A 71  ? 1.4607 1.4308 1.6086 -0.0337 -0.1125 0.1566  105  SER A N   
558  C CA  . SER A 71  ? 1.6086 1.5868 1.7050 -0.0474 -0.1402 0.1849  105  SER A CA  
559  C C   . SER A 71  ? 1.5694 1.4917 1.6816 -0.0555 -0.1479 0.2091  105  SER A C   
560  O O   . SER A 71  ? 1.5761 1.4865 1.6325 -0.0796 -0.1494 0.2324  105  SER A O   
561  C CB  . SER A 71  ? 1.7866 1.7938 1.8840 -0.0367 -0.1772 0.1860  105  SER A CB  
562  O OG  . SER A 71  ? 1.8837 1.9328 1.9713 -0.0273 -0.1682 0.1586  105  SER A OG  
563  N N   . TYR A 72  ? 1.4421 1.3294 1.6338 -0.0359 -0.1524 0.2029  106  TYR A N   
564  C CA  . TYR A 72  ? 1.3134 1.1402 1.5395 -0.0356 -0.1560 0.2196  106  TYR A CA  
565  C C   . TYR A 72  ? 1.2694 1.0587 1.4996 -0.0483 -0.1095 0.2025  106  TYR A C   
566  O O   . TYR A 72  ? 1.4158 1.1493 1.6918 -0.0434 -0.1026 0.2036  106  TYR A O   
567  C CB  . TYR A 72  ? 1.2845 1.0990 1.6071 -0.0057 -0.1800 0.2167  106  TYR A CB  
568  C CG  . TYR A 72  ? 1.4094 1.2471 1.7239 0.0004  -0.2354 0.2440  106  TYR A CG  
569  C CD1 . TYR A 72  ? 1.5395 1.3653 1.7816 -0.0198 -0.2650 0.2826  106  TYR A CD1 
570  C CD2 . TYR A 72  ? 1.5142 1.3867 1.8873 0.0206  -0.2587 0.2318  106  TYR A CD2 
571  C CE1 . TYR A 72  ? 1.6381 1.4854 1.8620 -0.0206 -0.3170 0.3095  106  TYR A CE1 
572  C CE2 . TYR A 72  ? 1.6058 1.5019 1.9644 0.0208  -0.3117 0.2568  106  TYR A CE2 
573  C CZ  . TYR A 72  ? 1.6953 1.5784 1.9773 -0.0000 -0.3411 0.2962  106  TYR A CZ  
574  O OH  . TYR A 72  ? 1.8096 1.7167 2.0680 -0.0056 -0.3951 0.3226  106  TYR A OH  
575  N N   . ARG A 73  ? 1.2083 1.0266 1.3933 -0.0643 -0.0787 0.1861  107  ARG A N   
576  C CA  . ARG A 73  ? 1.1764 0.9667 1.3448 -0.0860 -0.0371 0.1726  107  ARG A CA  
577  C C   . ARG A 73  ? 1.3052 1.0509 1.5526 -0.0738 -0.0121 0.1477  107  ARG A C   
578  O O   . ARG A 73  ? 1.5345 1.2242 1.7954 -0.0824 0.0027  0.1470  107  ARG A O   
579  C CB  . ARG A 73  ? 1.2379 1.0003 1.3416 -0.1163 -0.0386 0.1974  107  ARG A CB  
580  C CG  . ARG A 73  ? 1.2784 1.0932 1.3080 -0.1313 -0.0609 0.2202  107  ARG A CG  
581  C CD  . ARG A 73  ? 1.4262 1.2404 1.3835 -0.1717 -0.0430 0.2313  107  ARG A CD  
582  N NE  . ARG A 73  ? 1.5508 1.4343 1.4457 -0.1860 -0.0551 0.2445  107  ARG A NE  
583  C CZ  . ARG A 73  ? 1.5812 1.4962 1.4171 -0.2199 -0.0396 0.2503  107  ARG A CZ  
584  N NH1 . ARG A 73  ? 1.5265 1.5136 1.3175 -0.2294 -0.0487 0.2583  107  ARG A NH1 
585  N NH2 . ARG A 73  ? 1.6027 1.4814 1.4257 -0.2463 -0.0135 0.2453  107  ARG A NH2 
586  N N   . TYR A 74  ? 1.3516 1.1233 1.6533 -0.0546 -0.0063 0.1250  108  TYR A N   
587  C CA  . TYR A 74  ? 1.3013 1.0535 1.6777 -0.0467 0.0252  0.0933  108  TYR A CA  
588  C C   . TYR A 74  ? 1.3388 1.0635 1.8080 -0.0195 0.0094  0.0925  108  TYR A C   
589  O O   . TYR A 74  ? 1.3733 1.0891 1.9181 -0.0106 0.0369  0.0628  108  TYR A O   
590  C CB  . TYR A 74  ? 1.2875 1.0072 1.6347 -0.0766 0.0734  0.0745  108  TYR A CB  
591  C CG  . TYR A 74  ? 1.3534 1.1056 1.6199 -0.1024 0.0865  0.0766  108  TYR A CG  
592  C CD1 . TYR A 74  ? 1.4414 1.2278 1.7131 -0.0996 0.0950  0.0629  108  TYR A CD1 
593  C CD2 . TYR A 74  ? 1.3746 1.1239 1.5631 -0.1299 0.0879  0.0943  108  TYR A CD2 
594  C CE1 . TYR A 74  ? 1.4449 1.2593 1.6503 -0.1187 0.1019  0.0688  108  TYR A CE1 
595  C CE2 . TYR A 74  ? 1.4403 1.2282 1.5657 -0.1505 0.0960  0.0981  108  TYR A CE2 
596  C CZ  . TYR A 74  ? 1.4530 1.2722 1.5892 -0.1422 0.1016  0.0864  108  TYR A CZ  
597  O OH  . TYR A 74  ? 1.4072 1.2626 1.4878 -0.1584 0.1050  0.0939  108  TYR A OH  
598  N N   . ASP A 75  ? 1.3434 1.0576 1.8127 -0.0067 -0.0343 0.1243  109  ASP A N   
599  C CA  . ASP A 75  ? 1.3691 1.0656 1.9354 0.0243  -0.0594 0.1290  109  ASP A CA  
600  C C   . ASP A 75  ? 1.3313 1.0851 1.9519 0.0449  -0.0840 0.1213  109  ASP A C   
601  O O   . ASP A 75  ? 1.4028 1.1938 1.9751 0.0428  -0.1183 0.1396  109  ASP A O   
602  C CB  . ASP A 75  ? 1.3270 0.9881 1.8674 0.0270  -0.1034 0.1722  109  ASP A CB  
603  C CG  . ASP A 75  ? 1.3139 0.9462 1.9604 0.0610  -0.1305 0.1810  109  ASP A CG  
604  O OD1 . ASP A 75  ? 1.2186 0.7990 1.9223 0.0695  -0.1010 0.1630  109  ASP A OD1 
605  O OD2 . ASP A 75  ? 1.5512 1.2144 2.2260 0.0792  -0.1817 0.2048  109  ASP A OD2 
606  N N   . TRP A 76  ? 1.1639 0.9263 1.8835 0.0615  -0.0638 0.0910  110  TRP A N   
607  C CA  . TRP A 76  ? 1.1582 0.9752 1.9358 0.0751  -0.0800 0.0777  110  TRP A CA  
608  C C   . TRP A 76  ? 1.3533 1.1799 2.2217 0.1058  -0.1287 0.0963  110  TRP A C   
609  O O   . TRP A 76  ? 1.4039 1.2046 2.3617 0.1258  -0.1202 0.0893  110  TRP A O   
610  C CB  . TRP A 76  ? 1.0393 0.8677 1.8695 0.0682  -0.0273 0.0336  110  TRP A CB  
611  C CG  . TRP A 76  ? 1.0329 0.9139 1.9270 0.0762  -0.0377 0.0163  110  TRP A CG  
612  C CD1 . TRP A 76  ? 1.1350 1.0422 2.1505 0.0976  -0.0449 0.0015  110  TRP A CD1 
613  C CD2 . TRP A 76  ? 1.0540 0.9674 1.8975 0.0615  -0.0413 0.0102  110  TRP A CD2 
614  N NE1 . TRP A 76  ? 1.1820 1.1382 2.2210 0.0922  -0.0531 -0.0129 110  TRP A NE1 
615  C CE2 . TRP A 76  ? 1.1041 1.0586 2.0362 0.0704  -0.0508 -0.0082 110  TRP A CE2 
616  C CE3 . TRP A 76  ? 1.0763 0.9880 1.8135 0.0429  -0.0379 0.0177  110  TRP A CE3 
617  C CZ2 . TRP A 76  ? 1.1038 1.0878 2.0134 0.0579  -0.0564 -0.0192 110  TRP A CZ2 
618  C CZ3 . TRP A 76  ? 1.0657 1.0057 1.7870 0.0365  -0.0437 0.0065  110  TRP A CZ3 
619  C CH2 . TRP A 76  ? 1.1332 1.1042 1.9362 0.0424  -0.0525 -0.0119 110  TRP A CH2 
620  N N   . LEU A 77  ? 1.3825 1.2466 2.2285 0.1091  -0.1803 0.1196  111  LEU A N   
621  C CA  . LEU A 77  ? 1.3426 1.2211 2.2616 0.1338  -0.2373 0.1456  111  LEU A CA  
622  C C   . LEU A 77  ? 1.2941 1.2266 2.3270 0.1504  -0.2436 0.1206  111  LEU A C   
623  O O   . LEU A 77  ? 1.3708 1.3121 2.5099 0.1777  -0.2729 0.1305  111  LEU A O   
624  C CB  . LEU A 77  ? 1.2814 1.1771 2.1128 0.1224  -0.2929 0.1838  111  LEU A CB  
625  C CG  . LEU A 77  ? 1.2258 1.1084 1.9192 0.0934  -0.2825 0.1960  111  LEU A CG  
626  C CD1 . LEU A 77  ? 1.2242 1.1427 1.8519 0.0823  -0.3343 0.2214  111  LEU A CD1 
627  C CD2 . LEU A 77  ? 1.3419 1.1621 1.9968 0.0866  -0.2722 0.2192  111  LEU A CD2 
628  N N   . PHE A 78  ? 1.2308 1.1998 2.2476 0.1341  -0.2184 0.0897  112  PHE A N   
629  C CA  . PHE A 78  ? 1.2383 1.2657 2.3412 0.1404  -0.2343 0.0708  112  PHE A CA  
630  C C   . PHE A 78  ? 1.2979 1.3397 2.5351 0.1562  -0.1999 0.0388  112  PHE A C   
631  O O   . PHE A 78  ? 1.2293 1.3262 2.5604 0.1643  -0.2185 0.0265  112  PHE A O   
632  C CB  . PHE A 78  ? 1.1126 1.1624 2.1448 0.1144  -0.2179 0.0492  112  PHE A CB  
633  C CG  . PHE A 78  ? 1.1039 1.1407 2.0055 0.0995  -0.2379 0.0711  112  PHE A CG  
634  C CD1 . PHE A 78  ? 1.1201 1.1789 1.9913 0.1004  -0.2966 0.0989  112  PHE A CD1 
635  C CD2 . PHE A 78  ? 1.0812 1.0888 1.8919 0.0828  -0.1980 0.0636  112  PHE A CD2 
636  C CE1 . PHE A 78  ? 1.1159 1.1689 1.8689 0.0844  -0.3095 0.1139  112  PHE A CE1 
637  C CE2 . PHE A 78  ? 1.0445 1.0500 1.7467 0.0712  -0.2137 0.0804  112  PHE A CE2 
638  C CZ  . PHE A 78  ? 1.0777 1.1062 1.7512 0.0717  -0.2665 0.1032  112  PHE A CZ  
639  N N   . GLY A 79  ? 1.5044 1.5026 2.7547 0.1582  -0.1493 0.0225  113  GLY A N   
640  C CA  . GLY A 79  ? 1.6172 1.6294 2.9982 0.1744  -0.1133 -0.0112 113  GLY A CA  
641  C C   . GLY A 79  ? 1.6755 1.6891 3.0456 0.1466  -0.0410 -0.0570 113  GLY A C   
642  O O   . GLY A 79  ? 1.7208 1.7271 2.9873 0.1163  -0.0239 -0.0604 113  GLY A O   
643  N N   . PRO A 80  ? 1.7056 1.7291 3.1847 0.1560  0.0030  -0.0934 114  PRO A N   
644  C CA  . PRO A 80  ? 1.6975 1.7225 3.1610 0.1227  0.0749  -0.1373 114  PRO A CA  
645  C C   . PRO A 80  ? 1.6667 1.7492 3.1440 0.0999  0.0774  -0.1546 114  PRO A C   
646  O O   . PRO A 80  ? 1.6913 1.7611 3.0851 0.0630  0.1131  -0.1679 114  PRO A O   
647  C CB  . PRO A 80  ? 1.7310 1.7554 3.3178 0.1418  0.1185  -0.1732 114  PRO A CB  
648  C CG  . PRO A 80  ? 1.7575 1.8166 3.4690 0.1881  0.0619  -0.1537 114  PRO A CG  
649  C CD  . PRO A 80  ? 1.7269 1.7617 3.3495 0.1968  -0.0097 -0.0968 114  PRO A CD  
650  N N   . VAL A 81  ? 1.5402 1.6843 3.1205 0.1190  0.0377  -0.1527 115  VAL A N   
651  C CA  . VAL A 81  ? 1.3683 1.5654 2.9624 0.0935  0.0370  -0.1692 115  VAL A CA  
652  C C   . VAL A 81  ? 1.3201 1.4913 2.7737 0.0705  0.0118  -0.1458 115  VAL A C   
653  O O   . VAL A 81  ? 1.3875 1.5595 2.7931 0.0367  0.0382  -0.1627 115  VAL A O   
654  C CB  . VAL A 81  ? 1.2095 1.4817 2.9407 0.1179  -0.0092 -0.1678 115  VAL A CB  
655  C CG1 . VAL A 81  ? 1.1477 1.4639 3.0314 0.1305  0.0345  -0.2075 115  VAL A CG1 
656  C CG2 . VAL A 81  ? 1.2587 1.5210 2.9939 0.1549  -0.0802 -0.1223 115  VAL A CG2 
657  N N   . MET A 82  ? 1.2247 1.3702 2.6100 0.0875  -0.0379 -0.1072 116  MET A N   
658  C CA  . MET A 82  ? 1.1542 1.2785 2.4116 0.0691  -0.0582 -0.0896 116  MET A CA  
659  C C   . MET A 82  ? 1.1875 1.2608 2.3419 0.0453  -0.0092 -0.0962 116  MET A C   
660  O O   . MET A 82  ? 1.3015 1.3649 2.3788 0.0233  -0.0039 -0.0985 116  MET A O   
661  C CB  . MET A 82  ? 1.1935 1.3083 2.4026 0.0890  -0.1180 -0.0493 116  MET A CB  
662  C CG  . MET A 82  ? 1.2101 1.3780 2.4967 0.1051  -0.1780 -0.0363 116  MET A CG  
663  S SD  . MET A 82  ? 1.1105 1.3299 2.4125 0.0789  -0.1885 -0.0613 116  MET A SD  
664  C CE  . MET A 82  ? 1.1409 1.4195 2.5163 0.0975  -0.2697 -0.0356 116  MET A CE  
665  N N   . CYS A 83  ? 1.2103 1.2488 2.3621 0.0491  0.0246  -0.0987 117  CYS A N   
666  C CA  . CYS A 83  ? 1.2668 1.2627 2.3245 0.0221  0.0704  -0.1050 117  CYS A CA  
667  C C   . CYS A 83  ? 1.1225 1.1301 2.1915 -0.0100 0.1162  -0.1366 117  CYS A C   
668  O O   . CYS A 83  ? 0.9256 0.9124 1.9053 -0.0353 0.1286  -0.1331 117  CYS A O   
669  C CB  . CYS A 83  ? 1.3844 1.3419 2.4448 0.0285  0.0979  -0.1061 117  CYS A CB  
670  S SG  . CYS A 83  ? 1.4698 1.3812 2.4305 -0.0106 0.1593  -0.1195 117  CYS A SG  
671  N N   . LYS A 84  ? 1.0862 1.1289 2.2676 -0.0101 0.1409  -0.1667 118  LYS A N   
672  C CA  . LYS A 84  ? 1.1136 1.1754 2.3126 -0.0457 0.1820  -0.1966 118  LYS A CA  
673  C C   . LYS A 84  ? 1.1698 1.2398 2.3219 -0.0601 0.1514  -0.1857 118  LYS A C   
674  O O   . LYS A 84  ? 1.3444 1.3840 2.4118 -0.0908 0.1711  -0.1846 118  LYS A O   
675  C CB  . LYS A 84  ? 1.1135 1.2305 2.4594 -0.0385 0.2029  -0.2300 118  LYS A CB  
676  C CG  . LYS A 84  ? 1.1892 1.2962 2.5818 -0.0414 0.2615  -0.2604 118  LYS A CG  
677  C CD  . LYS A 84  ? 1.2391 1.3390 2.5903 -0.0934 0.3265  -0.2902 118  LYS A CD  
678  C CE  . LYS A 84  ? 1.4007 1.4833 2.7770 -0.1005 0.3874  -0.3228 118  LYS A CE  
679  N NZ  . LYS A 84  ? 1.5025 1.5629 2.7942 -0.1581 0.4462  -0.3422 118  LYS A NZ  
680  N N   . VAL A 85  ? 1.0653 1.1729 2.2709 -0.0383 0.1006  -0.1769 119  VAL A N   
681  C CA  . VAL A 85  ? 0.9344 1.0545 2.1165 -0.0545 0.0745  -0.1765 119  VAL A CA  
682  C C   . VAL A 85  ? 0.9168 0.9858 1.9668 -0.0607 0.0611  -0.1548 119  VAL A C   
683  O O   . VAL A 85  ? 1.0762 1.1238 2.0764 -0.0872 0.0725  -0.1605 119  VAL A O   
684  C CB  . VAL A 85  ? 0.8946 1.0666 2.1532 -0.0314 0.0183  -0.1700 119  VAL A CB  
685  C CG1 . VAL A 85  ? 0.9462 1.1182 2.1543 -0.0480 -0.0138 -0.1680 119  VAL A CG1 
686  C CG2 . VAL A 85  ? 0.7527 0.9872 2.1567 -0.0288 0.0323  -0.1955 119  VAL A CG2 
687  N N   . PHE A 86  ? 0.8981 0.9472 1.8930 -0.0364 0.0367  -0.1293 120  PHE A N   
688  C CA  . PHE A 86  ? 1.1314 1.1454 2.0142 -0.0376 0.0214  -0.1109 120  PHE A CA  
689  C C   . PHE A 86  ? 1.3800 1.3512 2.1876 -0.0570 0.0625  -0.1079 120  PHE A C   
690  O O   . PHE A 86  ? 1.4597 1.4040 2.1899 -0.0646 0.0583  -0.0991 120  PHE A O   
691  C CB  . PHE A 86  ? 1.2686 1.2863 2.1196 -0.0098 -0.0203 -0.0854 120  PHE A CB  
692  C CG  . PHE A 86  ? 1.3730 1.4301 2.2726 0.0039  -0.0696 -0.0827 120  PHE A CG  
693  C CD1 . PHE A 86  ? 1.3738 1.4452 2.2770 -0.0093 -0.0858 -0.0974 120  PHE A CD1 
694  C CD2 . PHE A 86  ? 1.4398 1.5168 2.3805 0.0268  -0.1016 -0.0644 120  PHE A CD2 
695  C CE1 . PHE A 86  ? 1.4203 1.5314 2.3635 -0.0025 -0.1330 -0.0958 120  PHE A CE1 
696  C CE2 . PHE A 86  ? 1.4669 1.5832 2.4486 0.0356  -0.1520 -0.0580 120  PHE A CE2 
697  C CZ  . PHE A 86  ? 1.4681 1.6049 2.4500 0.0197  -0.1675 -0.0748 120  PHE A CZ  
698  N N   . GLY A 87  ? 1.5999 1.5641 2.4288 -0.0654 0.1010  -0.1155 121  GLY A N   
699  C CA  . GLY A 87  ? 1.6409 1.5691 2.3977 -0.0927 0.1401  -0.1142 121  GLY A CA  
700  C C   . GLY A 87  ? 1.6675 1.5870 2.4196 -0.1272 0.1649  -0.1288 121  GLY A C   
701  O O   . GLY A 87  ? 1.7444 1.6311 2.4172 -0.1428 0.1656  -0.1153 121  GLY A O   
702  N N   . SER A 88  ? 1.6718 1.6217 2.5121 -0.1401 0.1842  -0.1553 122  SER A N   
703  C CA  . SER A 88  ? 1.6085 1.5514 2.4457 -0.1793 0.2083  -0.1692 122  SER A CA  
704  C C   . SER A 88  ? 1.5520 1.4804 2.3571 -0.1769 0.1700  -0.1586 122  SER A C   
705  O O   . SER A 88  ? 1.6246 1.5177 2.3785 -0.2070 0.1812  -0.1553 122  SER A O   
706  C CB  . SER A 88  ? 1.4615 1.4526 2.4109 -0.1935 0.2372  -0.2028 122  SER A CB  
707  O OG  . SER A 88  ? 1.5055 1.5435 2.5445 -0.1600 0.1994  -0.2071 122  SER A OG  
708  N N   . PHE A 89  ? 1.3835 1.3350 2.2152 -0.1438 0.1244  -0.1535 123  PHE A N   
709  C CA  . PHE A 89  ? 1.2414 1.1764 2.0370 -0.1402 0.0887  -0.1483 123  PHE A CA  
710  C C   . PHE A 89  ? 1.1082 0.9926 1.7989 -0.1332 0.0818  -0.1258 123  PHE A C   
711  O O   . PHE A 89  ? 1.2002 1.0458 1.8465 -0.1468 0.0778  -0.1239 123  PHE A O   
712  C CB  . PHE A 89  ? 1.2568 1.2325 2.0974 -0.1097 0.0425  -0.1484 123  PHE A CB  
713  C CG  . PHE A 89  ? 1.2764 1.2443 2.0964 -0.1122 0.0088  -0.1539 123  PHE A CG  
714  C CD1 . PHE A 89  ? 1.2548 1.2439 2.1339 -0.1365 0.0061  -0.1753 123  PHE A CD1 
715  C CD2 . PHE A 89  ? 1.2942 1.2368 2.0382 -0.0919 -0.0186 -0.1413 123  PHE A CD2 
716  C CE1 . PHE A 89  ? 1.2913 1.2681 2.1477 -0.1426 -0.0243 -0.1840 123  PHE A CE1 
717  C CE2 . PHE A 89  ? 1.3060 1.2377 2.0300 -0.0950 -0.0460 -0.1527 123  PHE A CE2 
718  C CZ  . PHE A 89  ? 1.3262 1.2710 2.1034 -0.1211 -0.0496 -0.1741 123  PHE A CZ  
719  N N   . LEU A 90  ? 1.1134 0.9976 1.7676 -0.1120 0.0797  -0.1085 124  LEU A N   
720  C CA  . LEU A 90  ? 1.2645 1.1135 1.8292 -0.1050 0.0751  -0.0869 124  LEU A CA  
721  C C   . LEU A 90  ? 1.3378 1.1458 1.8590 -0.1382 0.1052  -0.0812 124  LEU A C   
722  O O   . LEU A 90  ? 1.3935 1.1640 1.8643 -0.1396 0.0939  -0.0705 124  LEU A O   
723  C CB  . LEU A 90  ? 1.3676 1.2300 1.9083 -0.0867 0.0747  -0.0711 124  LEU A CB  
724  C CG  . LEU A 90  ? 1.3804 1.2270 1.8415 -0.0722 0.0607  -0.0495 124  LEU A CG  
725  C CD1 . LEU A 90  ? 1.4952 1.3548 1.9512 -0.0456 0.0232  -0.0519 124  LEU A CD1 
726  C CD2 . LEU A 90  ? 1.2262 1.0841 1.6625 -0.0679 0.0695  -0.0349 124  LEU A CD2 
727  N N   . THR A 91  ? 1.3882 1.2007 1.9272 -0.1663 0.1437  -0.0883 125  THR A N   
728  C CA  . THR A 91  ? 1.4280 1.2030 1.9154 -0.2057 0.1728  -0.0802 125  THR A CA  
729  C C   . THR A 91  ? 1.3842 1.1322 1.8775 -0.2300 0.1711  -0.0868 125  THR A C   
730  O O   . THR A 91  ? 1.4422 1.1412 1.8718 -0.2467 0.1684  -0.0674 125  THR A O   
731  C CB  . THR A 91  ? 1.4998 1.2901 2.0081 -0.2356 0.2189  -0.0946 125  THR A CB  
732  O OG1 . THR A 91  ? 1.5980 1.3955 2.0782 -0.2195 0.2208  -0.0841 125  THR A OG1 
733  C CG2 . THR A 91  ? 1.4594 1.2156 1.9157 -0.2871 0.2511  -0.0896 125  THR A CG2 
734  N N   . LEU A 92  ? 1.2980 1.0766 1.8686 -0.2327 0.1694  -0.1121 126  LEU A N   
735  C CA  . LEU A 92  ? 1.2942 1.0492 1.8743 -0.2603 0.1671  -0.1212 126  LEU A CA  
736  C C   . LEU A 92  ? 1.4009 1.1084 1.9282 -0.2396 0.1292  -0.1066 126  LEU A C   
737  O O   . LEU A 92  ? 1.5595 1.2118 2.0469 -0.2651 0.1305  -0.0982 126  LEU A O   
738  C CB  . LEU A 92  ? 1.2333 1.0435 1.9138 -0.2626 0.1656  -0.1514 126  LEU A CB  
739  C CG  . LEU A 92  ? 1.2674 1.0634 1.9669 -0.2837 0.1502  -0.1642 126  LEU A CG  
740  C CD1 . LEU A 92  ? 1.3283 1.0810 1.9944 -0.3391 0.1825  -0.1622 126  LEU A CD1 
741  C CD2 . LEU A 92  ? 1.2274 1.0947 2.0331 -0.2800 0.1415  -0.1914 126  LEU A CD2 
742  N N   . ASN A 93  ? 1.3974 1.1224 1.9229 -0.1948 0.0964  -0.1042 127  ASN A N   
743  C CA  . ASN A 93  ? 1.4503 1.1333 1.9300 -0.1732 0.0655  -0.0973 127  ASN A CA  
744  C C   . ASN A 93  ? 1.5921 1.2311 1.9967 -0.1643 0.0658  -0.0680 127  ASN A C   
745  O O   . ASN A 93  ? 1.7156 1.3019 2.0837 -0.1571 0.0495  -0.0606 127  ASN A O   
746  C CB  . ASN A 93  ? 1.4659 1.1866 1.9639 -0.1337 0.0330  -0.1077 127  ASN A CB  
747  C CG  . ASN A 93  ? 1.5106 1.2516 2.0630 -0.1427 0.0163  -0.1342 127  ASN A CG  
748  O OD1 . ASN A 93  ? 1.5968 1.3524 2.1482 -0.1199 -0.0138 -0.1445 127  ASN A OD1 
749  N ND2 . ASN A 93  ? 1.4458 1.1915 2.0440 -0.1804 0.0364  -0.1467 127  ASN A ND2 
750  N N   . MET A 94  ? 1.6482 1.3078 2.0317 -0.1636 0.0818  -0.0514 128  MET A N   
751  C CA  . MET A 94  ? 1.7385 1.3622 2.0538 -0.1643 0.0821  -0.0208 128  MET A CA  
752  C C   . MET A 94  ? 1.7142 1.2795 1.9999 -0.2064 0.0956  -0.0087 128  MET A C   
753  O O   . MET A 94  ? 1.7857 1.2969 2.0289 -0.1996 0.0773  0.0117  128  MET A O   
754  C CB  . MET A 94  ? 1.9272 1.5849 2.2246 -0.1682 0.1003  -0.0083 128  MET A CB  
755  C CG  . MET A 94  ? 2.0236 1.7308 2.3387 -0.1310 0.0859  -0.0134 128  MET A CG  
756  S SD  . MET A 94  ? 2.1072 1.8126 2.3903 -0.0836 0.0482  -0.0027 128  MET A SD  
757  C CE  . MET A 94  ? 2.1185 1.8590 2.3609 -0.0749 0.0518  0.0211  128  MET A CE  
758  N N   . PHE A 95  ? 1.5601 1.1351 1.8701 -0.2508 0.1280  -0.0214 129  PHE A N   
759  C CA  . PHE A 95  ? 1.5680 1.0901 1.8433 -0.3009 0.1447  -0.0091 129  PHE A CA  
760  C C   . PHE A 95  ? 1.6309 1.1020 1.9136 -0.3035 0.1244  -0.0152 129  PHE A C   
761  O O   . PHE A 95  ? 1.6860 1.0876 1.9179 -0.3263 0.1186  0.0087  129  PHE A O   
762  C CB  . PHE A 95  ? 1.6279 1.1835 1.9346 -0.3495 0.1896  -0.0290 129  PHE A CB  
763  C CG  . PHE A 95  ? 1.6580 1.2393 1.9352 -0.3622 0.2160  -0.0209 129  PHE A CG  
764  C CD1 . PHE A 95  ? 1.5715 1.1278 1.7744 -0.3543 0.2014  0.0141  129  PHE A CD1 
765  C CD2 . PHE A 95  ? 1.6282 1.2600 1.9555 -0.3819 0.2551  -0.0502 129  PHE A CD2 
766  C CE1 . PHE A 95  ? 1.4423 1.0218 1.6129 -0.3719 0.2252  0.0197  129  PHE A CE1 
767  C CE2 . PHE A 95  ? 1.5329 1.1811 1.8293 -0.3966 0.2821  -0.0477 129  PHE A CE2 
768  C CZ  . PHE A 95  ? 1.4457 1.0670 1.6595 -0.3942 0.2669  -0.0127 129  PHE A CZ  
769  N N   . ALA A 96  ? 1.5414 1.0419 1.8838 -0.2828 0.1112  -0.0457 130  ALA A N   
770  C CA  . ALA A 96  ? 1.4766 0.9265 1.8227 -0.2864 0.0910  -0.0560 130  ALA A CA  
771  C C   . ALA A 96  ? 1.4719 0.8638 1.7692 -0.2465 0.0590  -0.0374 130  ALA A C   
772  O O   . ALA A 96  ? 1.6005 0.9138 1.8660 -0.2602 0.0489  -0.0264 130  ALA A O   
773  C CB  . ALA A 96  ? 1.2786 0.7814 1.6965 -0.2751 0.0810  -0.0932 130  ALA A CB  
774  N N   . SER A 97  ? 1.4519 0.8805 1.7448 -0.1975 0.0436  -0.0338 131  SER A N   
775  C CA  . SER A 97  ? 1.5313 0.9176 1.7879 -0.1558 0.0170  -0.0196 131  SER A CA  
776  C C   . SER A 97  ? 1.5981 0.9246 1.7994 -0.1701 0.0168  0.0220  131  SER A C   
777  O O   . SER A 97  ? 1.6801 0.9309 1.8578 -0.1619 -0.0015 0.0340  131  SER A O   
778  C CB  . SER A 97  ? 1.5727 1.0233 1.8358 -0.1081 0.0060  -0.0233 131  SER A CB  
779  O OG  . SER A 97  ? 1.6755 1.0973 1.9134 -0.0659 -0.0161 -0.0145 131  SER A OG  
780  N N   . ILE A 98  ? 1.5408 0.8966 1.7193 -0.1933 0.0356  0.0449  132  ILE A N   
781  C CA  . ILE A 98  ? 1.6416 0.9490 1.7608 -0.2088 0.0303  0.0891  132  ILE A CA  
782  C C   . ILE A 98  ? 1.8109 1.0381 1.9043 -0.2587 0.0355  0.1020  132  ILE A C   
783  O O   . ILE A 98  ? 1.8721 1.0232 1.9271 -0.2546 0.0125  0.1335  132  ILE A O   
784  C CB  . ILE A 98  ? 1.5100 0.8703 1.6050 -0.2304 0.0514  0.1058  132  ILE A CB  
785  C CG1 . ILE A 98  ? 1.4731 0.9019 1.5856 -0.1819 0.0418  0.0987  132  ILE A CG1 
786  C CG2 . ILE A 98  ? 1.5377 0.8500 1.5647 -0.2587 0.0447  0.1536  132  ILE A CG2 
787  C CD1 . ILE A 98  ? 1.5580 1.0362 1.6474 -0.2028 0.0622  0.1105  132  ILE A CD1 
788  N N   . PHE A 99  ? 1.9680 1.2115 2.0852 -0.3070 0.0652  0.0787  133  PHE A N   
789  C CA  . PHE A 99  ? 2.1642 1.3378 2.2587 -0.3625 0.0741  0.0869  133  PHE A CA  
790  C C   . PHE A 99  ? 2.2046 1.3030 2.3063 -0.3424 0.0457  0.0795  133  PHE A C   
791  O O   . PHE A 99  ? 2.3396 1.3491 2.4009 -0.3751 0.0383  0.1036  133  PHE A O   
792  C CB  . PHE A 99  ? 2.1831 1.4076 2.3199 -0.4130 0.1134  0.0540  133  PHE A CB  
793  C CG  . PHE A 99  ? 2.1222 1.4009 2.2446 -0.4463 0.1492  0.0590  133  PHE A CG  
794  C CD1 . PHE A 99  ? 2.1450 1.4085 2.2001 -0.4497 0.1450  0.0981  133  PHE A CD1 
795  C CD2 . PHE A 99  ? 2.0203 1.3667 2.1995 -0.4750 0.1872  0.0224  133  PHE A CD2 
796  C CE1 . PHE A 99  ? 2.1036 1.4134 2.1393 -0.4854 0.1803  0.0977  133  PHE A CE1 
797  C CE2 . PHE A 99  ? 2.0000 1.3918 2.1682 -0.5053 0.2246  0.0202  133  PHE A CE2 
798  C CZ  . PHE A 99  ? 2.0407 1.4115 2.1323 -0.5128 0.2224  0.0565  133  PHE A CZ  
799  N N   . PHE A 100 ? 2.0082 1.1359 2.1562 -0.2926 0.0299  0.0460  134  PHE A N   
800  C CA  . PHE A 100 ? 1.9814 1.0355 2.1332 -0.2726 0.0052  0.0324  134  PHE A CA  
801  C C   . PHE A 100 ? 2.0656 1.0544 2.1810 -0.2269 -0.0247 0.0639  134  PHE A C   
802  O O   . PHE A 100 ? 2.2111 1.1022 2.3087 -0.2268 -0.0424 0.0711  134  PHE A O   
803  C CB  . PHE A 100 ? 1.9411 1.0505 2.1479 -0.2408 -0.0009 -0.0164 134  PHE A CB  
804  C CG  . PHE A 100 ? 1.9899 1.1217 2.2376 -0.2873 0.0148  -0.0493 134  PHE A CG  
805  C CD1 . PHE A 100 ? 2.0877 1.1493 2.3192 -0.3432 0.0229  -0.0443 134  PHE A CD1 
806  C CD2 . PHE A 100 ? 1.9782 1.2035 2.2824 -0.2772 0.0195  -0.0827 134  PHE A CD2 
807  C CE1 . PHE A 100 ? 2.0805 1.1731 2.3561 -0.3886 0.0378  -0.0756 134  PHE A CE1 
808  C CE2 . PHE A 100 ? 1.9756 1.2317 2.3275 -0.3184 0.0305  -0.1114 134  PHE A CE2 
809  C CZ  . PHE A 100 ? 2.0356 1.2297 2.3757 -0.3745 0.0409  -0.1097 134  PHE A CZ  
810  N N   . ILE A 101 ? 1.9960 1.0368 2.1044 -0.1872 -0.0316 0.0823  135  ILE A N   
811  C CA  . ILE A 101 ? 1.9944 0.9843 2.0758 -0.1459 -0.0602 0.1174  135  ILE A CA  
812  C C   . ILE A 101 ? 2.0668 0.9699 2.0937 -0.1902 -0.0669 0.1676  135  ILE A C   
813  O O   . ILE A 101 ? 2.1298 0.9369 2.1402 -0.1741 -0.0932 0.1891  135  ILE A O   
814  C CB  . ILE A 101 ? 1.8604 0.9361 1.9450 -0.1062 -0.0638 0.1299  135  ILE A CB  
815  C CG1 . ILE A 101 ? 1.7524 0.9063 1.8830 -0.0652 -0.0598 0.0837  135  ILE A CG1 
816  C CG2 . ILE A 101 ? 1.9108 0.9455 1.9772 -0.0642 -0.0950 0.1684  135  ILE A CG2 
817  C CD1 . ILE A 101 ? 1.7739 1.0184 1.9059 -0.0393 -0.0578 0.0937  135  ILE A CD1 
818  N N   . THR A 102 ? 2.0018 0.9345 1.9985 -0.2486 -0.0427 0.1865  136  THR A N   
819  C CA  . THR A 102 ? 2.1151 0.9702 2.0490 -0.3037 -0.0458 0.2348  136  THR A CA  
820  C C   . THR A 102 ? 2.1153 0.8703 2.0427 -0.3380 -0.0483 0.2282  136  THR A C   
821  O O   . THR A 102 ? 2.1111 0.7621 1.9947 -0.3490 -0.0732 0.2701  136  THR A O   
822  C CB  . THR A 102 ? 2.0370 0.9521 1.9424 -0.3668 -0.0097 0.2418  136  THR A CB  
823  O OG1 . THR A 102 ? 1.7850 0.7704 1.6792 -0.3414 -0.0130 0.2588  136  THR A OG1 
824  C CG2 . THR A 102 ? 2.2234 1.0598 2.0584 -0.4398 -0.0058 0.2844  136  THR A CG2 
825  N N   . CYS A 103 ? 2.1296 0.9133 2.1010 -0.3565 -0.0254 0.1776  137  CYS A N   
826  C CA  . CYS A 103 ? 2.2817 0.9785 2.2490 -0.3969 -0.0251 0.1663  137  CYS A CA  
827  C C   . CYS A 103 ? 2.4697 1.0704 2.4421 -0.3458 -0.0611 0.1642  137  CYS A C   
828  O O   . CYS A 103 ? 2.5796 1.0661 2.5208 -0.3764 -0.0730 0.1817  137  CYS A O   
829  C CB  . CYS A 103 ? 2.2085 0.9769 2.2318 -0.4244 0.0046  0.1106  137  CYS A CB  
830  S SG  . CYS A 103 ? 2.5332 1.2150 2.5590 -0.4829 0.0085  0.0889  137  CYS A SG  
831  N N   . MET A 104 ? 2.4936 1.1354 2.5040 -0.2704 -0.0767 0.1414  138  MET A N   
832  C CA  . MET A 104 ? 2.6072 1.1620 2.6267 -0.2167 -0.1066 0.1339  138  MET A CA  
833  C C   . MET A 104 ? 2.6389 1.1132 2.6209 -0.1931 -0.1376 0.1942  138  MET A C   
834  O O   . MET A 104 ? 2.7965 1.1533 2.7707 -0.1763 -0.1615 0.2034  138  MET A O   
835  C CB  . MET A 104 ? 2.6747 1.3077 2.7447 -0.1473 -0.1094 0.0884  138  MET A CB  
836  C CG  . MET A 104 ? 2.6761 1.3834 2.7838 -0.1654 -0.0878 0.0318  138  MET A CG  
837  S SD  . MET A 104 ? 2.6754 1.4472 2.8264 -0.0904 -0.0961 -0.0202 138  MET A SD  
838  C CE  . MET A 104 ? 2.8805 1.5123 3.0226 -0.0509 -0.1212 -0.0257 138  MET A CE  
839  N N   . SER A 105 ? 2.4387 0.9720 2.3986 -0.1910 -0.1401 0.2358  139  SER A N   
840  C CA  . SER A 105 ? 2.4526 0.9135 2.3738 -0.1777 -0.1743 0.3009  139  SER A CA  
841  C C   . SER A 105 ? 2.4999 0.8552 2.3603 -0.2491 -0.1765 0.3416  139  SER A C   
842  O O   . SER A 105 ? 2.5691 0.8470 2.4128 -0.2288 -0.2000 0.3744  139  SER A O   
843  C CB  . SER A 105 ? 2.4412 0.9982 2.3468 -0.1702 -0.1757 0.3350  139  SER A CB  
844  O OG  . SER A 105 ? 2.3016 0.9569 2.2606 -0.1042 -0.1742 0.3010  139  SER A OG  
845  N N   . VAL A 106 ? 2.5656 0.9581 2.4018 -0.3261 -0.1399 0.3315  140  VAL A N   
846  C CA  . VAL A 106 ? 2.6651 1.0099 2.4569 -0.3904 -0.1252 0.3547  140  VAL A CA  
847  C C   . VAL A 106 ? 2.7979 1.0577 2.6121 -0.3814 -0.1290 0.3273  140  VAL A C   
848  O O   . VAL A 106 ? 3.0466 1.2256 2.8288 -0.3967 -0.1404 0.3602  140  VAL A O   
849  C CB  . VAL A 106 ? 2.6003 1.0249 2.3802 -0.4684 -0.0793 0.3378  140  VAL A CB  
850  C CG1 . VAL A 106 ? 2.6595 1.0442 2.4107 -0.5326 -0.0622 0.3489  140  VAL A CG1 
851  C CG2 . VAL A 106 ? 2.5978 1.0934 2.3402 -0.4847 -0.0730 0.3705  140  VAL A CG2 
852  N N   . ASP A 107 ? 2.7205 0.9964 2.5875 -0.3581 -0.1205 0.2664  141  ASP A N   
853  C CA  . ASP A 107 ? 2.7995 0.9992 2.6862 -0.3516 -0.1216 0.2334  141  ASP A CA  
854  C C   . ASP A 107 ? 2.7746 0.8843 2.6607 -0.2837 -0.1554 0.2540  141  ASP A C   
855  O O   . ASP A 107 ? 2.9021 0.9199 2.7743 -0.2939 -0.1596 0.2624  141  ASP A O   
856  C CB  . ASP A 107 ? 2.7430 0.9909 2.6824 -0.3398 -0.1085 0.1625  141  ASP A CB  
857  C CG  . ASP A 107 ? 2.7690 0.9453 2.7244 -0.3408 -0.1065 0.1228  141  ASP A CG  
858  O OD1 . ASP A 107 ? 2.8001 0.9506 2.7444 -0.4040 -0.0892 0.1239  141  ASP A OD1 
859  O OD2 . ASP A 107 ? 2.7794 0.9303 2.7602 -0.2795 -0.1210 0.0883  141  ASP A OD2 
860  N N   . ARG A 108 ? 2.7004 0.8397 2.6080 -0.2129 -0.1789 0.2618  142  ARG A N   
861  C CA  . ARG A 108 ? 2.8473 0.9179 2.7665 -0.1426 -0.2095 0.2816  142  ARG A CA  
862  C C   . ARG A 108 ? 3.0710 1.0800 2.9400 -0.1646 -0.2288 0.3546  142  ARG A C   
863  O O   . ARG A 108 ? 3.1574 1.0727 3.0255 -0.1392 -0.2452 0.3695  142  ARG A O   
864  C CB  . ARG A 108 ? 2.7287 0.8678 2.6908 -0.0651 -0.2282 0.2749  142  ARG A CB  
865  C CG  . ARG A 108 ? 2.6868 0.8763 2.7022 -0.0285 -0.2151 0.2009  142  ARG A CG  
866  C CD  . ARG A 108 ? 2.7446 1.0126 2.8037 0.0442  -0.2316 0.1988  142  ARG A CD  
867  N NE  . ARG A 108 ? 2.7038 1.0308 2.8118 0.0828  -0.2163 0.1261  142  ARG A NE  
868  C CZ  . ARG A 108 ? 2.5791 1.0024 2.7278 0.1466  -0.2160 0.1066  142  ARG A CZ  
869  N NH1 . ARG A 108 ? 2.5233 1.0065 2.7042 0.1717  -0.1971 0.0398  142  ARG A NH1 
870  N NH2 . ARG A 108 ? 2.5286 0.9914 2.6833 0.1811  -0.2353 0.1546  142  ARG A NH2 
871  N N   . TYR A 109 ? 3.1557 1.2163 2.9809 -0.2130 -0.2267 0.3998  143  TYR A N   
872  C CA  . TYR A 109 ? 3.3228 1.3341 3.0921 -0.2406 -0.2466 0.4700  143  TYR A CA  
873  C C   . TYR A 109 ? 3.4229 1.3479 3.1610 -0.2985 -0.2332 0.4736  143  TYR A C   
874  O O   . TYR A 109 ? 3.6329 1.4641 3.3541 -0.2838 -0.2578 0.5098  143  TYR A O   
875  C CB  . TYR A 109 ? 3.2761 1.3714 2.9989 -0.2902 -0.2395 0.5068  143  TYR A CB  
876  C CG  . TYR A 109 ? 3.3522 1.4116 3.0062 -0.3315 -0.2578 0.5766  143  TYR A CG  
877  C CD1 . TYR A 109 ? 3.3691 1.4059 3.0159 -0.2825 -0.3030 0.6306  143  TYR A CD1 
878  C CD2 . TYR A 109 ? 3.3792 1.4378 2.9784 -0.4199 -0.2303 0.5870  143  TYR A CD2 
879  C CE1 . TYR A 109 ? 3.4724 1.4792 3.0530 -0.3224 -0.3239 0.6953  143  TYR A CE1 
880  C CE2 . TYR A 109 ? 3.4873 1.5164 3.0176 -0.4604 -0.2480 0.6489  143  TYR A CE2 
881  C CZ  . TYR A 109 ? 3.5544 1.5550 3.0724 -0.4127 -0.2964 0.7041  143  TYR A CZ  
882  O OH  . TYR A 109 ? 3.6959 1.6676 3.1423 -0.4551 -0.3183 0.7668  143  TYR A OH  
883  N N   . GLN A 110 ? 3.3213 1.2804 3.0566 -0.3643 -0.1949 0.4364  144  GLN A N   
884  C CA  . GLN A 110 ? 3.3733 1.2657 3.0845 -0.4257 -0.1797 0.4372  144  GLN A CA  
885  C C   . GLN A 110 ? 3.2936 1.0940 3.0411 -0.3918 -0.1844 0.4002  144  GLN A C   
886  O O   . GLN A 110 ? 3.3410 1.0637 3.0674 -0.4335 -0.1803 0.4095  144  GLN A O   
887  C CB  . GLN A 110 ? 3.3703 1.3450 3.0820 -0.5027 -0.1366 0.4045  144  GLN A CB  
888  C CG  . GLN A 110 ? 3.3768 1.4337 3.0436 -0.5496 -0.1238 0.4393  144  GLN A CG  
889  C CD  . GLN A 110 ? 3.4043 1.5336 3.0735 -0.6284 -0.0794 0.4099  144  GLN A CD  
890  O OE1 . GLN A 110 ? 3.4089 1.5405 3.1221 -0.6457 -0.0606 0.3621  144  GLN A OE1 
891  N NE2 . GLN A 110 ? 3.4253 1.6202 3.0502 -0.6762 -0.0624 0.4361  144  GLN A NE2 
892  N N   . SER A 111 ? 3.2527 1.0610 3.0519 -0.3200 -0.1912 0.3566  145  SER A N   
893  C CA  . SER A 111 ? 3.2093 0.9260 3.0380 -0.2806 -0.1959 0.3217  145  SER A CA  
894  C C   . SER A 111 ? 3.4745 1.1073 3.3023 -0.2140 -0.2312 0.3634  145  SER A C   
895  O O   . SER A 111 ? 3.6835 1.2127 3.5189 -0.1977 -0.2352 0.3537  145  SER A O   
896  C CB  . SER A 111 ? 3.1933 0.9615 3.0754 -0.2376 -0.1831 0.2474  145  SER A CB  
897  O OG  . SER A 111 ? 3.1302 0.9562 3.0375 -0.1655 -0.2015 0.2511  145  SER A OG  
898  N N   . VAL A 112 ? 3.3994 1.0771 3.2222 -0.1754 -0.2570 0.4090  146  VAL A N   
899  C CA  . VAL A 112 ? 3.4968 1.1067 3.3249 -0.1135 -0.2940 0.4548  146  VAL A CA  
900  C C   . VAL A 112 ? 3.6366 1.1655 3.4040 -0.1660 -0.3101 0.5225  146  VAL A C   
901  O O   . VAL A 112 ? 3.6996 1.1219 3.4692 -0.1373 -0.3300 0.5443  146  VAL A O   
902  C CB  . VAL A 112 ? 3.4247 1.1234 3.2766 -0.0536 -0.3185 0.4785  146  VAL A CB  
903  C CG1 . VAL A 112 ? 3.4924 1.1353 3.3458 -0.0027 -0.3603 0.5392  146  VAL A CG1 
904  C CG2 . VAL A 112 ? 3.3698 1.1303 3.2888 0.0128  -0.3070 0.4108  146  VAL A CG2 
905  N N   . ILE A 113 ? 3.6686 1.2461 3.3801 -0.2443 -0.3003 0.5550  147  ILE A N   
906  C CA  . ILE A 113 ? 3.8012 1.3080 3.4475 -0.3010 -0.3144 0.6177  147  ILE A CA  
907  C C   . ILE A 113 ? 3.7864 1.1938 3.4265 -0.3422 -0.2963 0.5952  147  ILE A C   
908  O O   . ILE A 113 ? 3.9544 1.2555 3.5644 -0.3505 -0.3178 0.6388  147  ILE A O   
909  C CB  . ILE A 113 ? 3.6820 1.2748 3.2678 -0.3785 -0.3016 0.6491  147  ILE A CB  
910  C CG1 . ILE A 113 ? 3.5319 1.2072 3.1148 -0.3406 -0.3265 0.6830  147  ILE A CG1 
911  C CG2 . ILE A 113 ? 3.7717 1.2944 3.2847 -0.4486 -0.3099 0.7041  147  ILE A CG2 
912  C CD1 . ILE A 113 ? 3.5435 1.2709 3.0499 -0.4133 -0.3259 0.7328  147  ILE A CD1 
913  N N   . TYR A 114 ? 3.3609 1.8290 1.4194 -0.8124 0.0280  0.1357  148  TYR A N   
914  C CA  . TYR A 114 ? 3.3493 1.9661 1.5282 -0.7839 0.0269  0.1266  148  TYR A CA  
915  C C   . TYR A 114 ? 3.4204 2.0714 1.6354 -0.8351 0.0432  0.0969  148  TYR A C   
916  O O   . TYR A 114 ? 3.5753 2.1709 1.6741 -0.8206 0.0352  0.0912  148  TYR A O   
917  C CB  . TYR A 114 ? 3.4731 2.0915 1.5576 -0.6923 -0.0020 0.1442  148  TYR A CB  
918  C CG  . TYR A 114 ? 3.5961 2.2213 1.6646 -0.6248 -0.0202 0.1720  148  TYR A CG  
919  C CD1 . TYR A 114 ? 3.6169 2.2133 1.7258 -0.6492 -0.0125 0.1810  148  TYR A CD1 
920  C CD2 . TYR A 114 ? 3.6886 2.3590 1.7015 -0.5332 -0.0452 0.1897  148  TYR A CD2 
921  C CE1 . TYR A 114 ? 3.6384 2.2438 1.7296 -0.5837 -0.0297 0.2053  148  TYR A CE1 
922  C CE2 . TYR A 114 ? 3.7052 2.3946 1.7000 -0.4639 -0.0619 0.2146  148  TYR A CE2 
923  C CZ  . TYR A 114 ? 3.6838 2.3381 1.7173 -0.4893 -0.0543 0.2216  148  TYR A CZ  
924  O OH  . TYR A 114 ? 3.7104 2.3862 1.7233 -0.4169 -0.0715 0.2452  148  TYR A OH  
925  N N   . PRO A 115 ? 3.3430 2.0831 1.7113 -0.8910 0.0639  0.0760  149  PRO A N   
926  C CA  . PRO A 115 ? 3.4058 2.1767 1.8004 -0.9334 0.0777  0.0440  149  PRO A CA  
927  C C   . PRO A 115 ? 3.3744 2.2351 1.8169 -0.9003 0.0620  0.0337  149  PRO A C   
928  O O   . PRO A 115 ? 3.3978 2.2658 1.8267 -0.9229 0.0684  0.0078  149  PRO A O   
929  C CB  . PRO A 115 ? 2.9971 1.8330 1.5387 -0.9926 0.1001  0.0247  149  PRO A CB  
930  C CG  . PRO A 115 ? 2.9661 1.7798 1.5338 -0.9905 0.1010  0.0496  149  PRO A CG  
931  C CD  . PRO A 115 ? 3.1960 2.0010 1.7083 -0.9178 0.0747  0.0787  149  PRO A CD  
932  N N   . PHE A 116 ? 3.3980 2.3331 1.8941 -0.8488 0.0403  0.0551  150  PHE A N   
933  C CA  . PHE A 116 ? 3.4577 2.4960 2.0194 -0.8260 0.0216  0.0511  150  PHE A CA  
934  C C   . PHE A 116 ? 3.5814 2.5915 2.0109 -0.7631 0.0029  0.0671  150  PHE A C   
935  O O   . PHE A 116 ? 3.5061 2.6128 1.9836 -0.7319 -0.0176 0.0764  150  PHE A O   
936  C CB  . PHE A 116 ? 3.3883 2.5531 2.1094 -0.8181 0.0059  0.0693  150  PHE A CB  
937  C CG  . PHE A 116 ? 3.3733 2.5721 2.0623 -0.7505 -0.0132 0.1106  150  PHE A CG  
938  C CD1 . PHE A 116 ? 3.3917 2.4959 1.9689 -0.7180 -0.0081 0.1278  150  PHE A CD1 
939  C CD2 . PHE A 116 ? 3.2885 2.6184 2.0554 -0.7184 -0.0396 0.1337  150  PHE A CD2 
940  C CE1 . PHE A 116 ? 3.3801 2.5208 1.9215 -0.6458 -0.0271 0.1626  150  PHE A CE1 
941  C CE2 . PHE A 116 ? 3.2591 2.6414 1.9969 -0.6510 -0.0562 0.1733  150  PHE A CE2 
942  C CZ  . PHE A 116 ? 3.3150 2.6030 1.9388 -0.6101 -0.0490 0.1855  150  PHE A CZ  
943  N N   . LEU A 117 ? 3.7519 2.6312 2.0131 -0.7455 0.0060  0.0719  151  LEU A N   
944  C CA  . LEU A 117 ? 3.8131 2.6499 1.9328 -0.6816 -0.0137 0.0846  151  LEU A CA  
945  C C   . LEU A 117 ? 3.9603 2.7602 2.0160 -0.7083 -0.0076 0.0586  151  LEU A C   
946  O O   . LEU A 117 ? 3.9913 2.7010 1.9848 -0.7582 0.0098  0.0425  151  LEU A O   
947  C CB  . LEU A 117 ? 3.8233 2.5239 1.7808 -0.6412 -0.0231 0.1050  151  LEU A CB  
948  C CG  . LEU A 117 ? 3.7206 2.4609 1.7144 -0.5907 -0.0351 0.1332  151  LEU A CG  
949  C CD1 . LEU A 117 ? 3.8502 2.4388 1.6577 -0.5397 -0.0525 0.1494  151  LEU A CD1 
950  C CD2 . LEU A 117 ? 3.6028 2.4987 1.6786 -0.5327 -0.0528 0.1511  151  LEU A CD2 
951  N N   . SER A 118 ? 4.1659 3.0434 2.2373 -0.6765 -0.0228 0.0573  152  SER A N   
952  C CA  . SER A 118 ? 4.3689 3.2286 2.3936 -0.6983 -0.0187 0.0318  152  SER A CA  
953  C C   . SER A 118 ? 4.7369 3.4518 2.5608 -0.6784 -0.0213 0.0357  152  SER A C   
954  O O   . SER A 118 ? 4.7346 3.3605 2.4482 -0.6386 -0.0327 0.0583  152  SER A O   
955  C CB  . SER A 118 ? 4.2002 3.1780 2.2873 -0.6668 -0.0392 0.0344  152  SER A CB  
956  O OG  . SER A 118 ? 4.0460 3.1481 2.3133 -0.6938 -0.0445 0.0327  152  SER A OG  
957  N N   . GLN A 119 ? 5.1212 3.8082 2.8923 -0.7060 -0.0143 0.0131  153  GLN A N   
958  C CA  . GLN A 119 ? 5.2637 3.8095 2.8454 -0.7001 -0.0186 0.0173  153  GLN A CA  
959  C C   . GLN A 119 ? 5.3496 3.8686 2.8131 -0.6173 -0.0469 0.0361  153  GLN A C   
960  O O   . GLN A 119 ? 5.5066 3.8897 2.7995 -0.5901 -0.0619 0.0498  153  GLN A O   
961  C CB  . GLN A 119 ? 5.2819 3.8180 2.8480 -0.7574 -0.0011 -0.0111 153  GLN A CB  
962  C CG  . GLN A 119 ? 5.1360 3.7113 2.8134 -0.8318 0.0271  -0.0321 153  GLN A CG  
963  C CD  . GLN A 119 ? 5.1074 3.6713 2.7460 -0.8819 0.0444  -0.0574 153  GLN A CD  
964  O OE1 . GLN A 119 ? 5.2082 3.7033 2.7127 -0.8710 0.0359  -0.0536 153  GLN A OE1 
965  N NE2 . GLN A 119 ? 5.0083 3.6434 2.7615 -0.9337 0.0676  -0.0835 153  GLN A NE2 
966  N N   . ARG A 120 ? 5.2829 3.9280 2.8284 -0.5769 -0.0582 0.0381  154  ARG A N   
967  C CA  . ARG A 120 ? 5.2829 3.9289 2.7293 -0.4898 -0.0849 0.0597  154  ARG A CA  
968  C C   . ARG A 120 ? 5.2289 3.8262 2.6136 -0.4315 -0.0998 0.0872  154  ARG A C   
969  O O   . ARG A 120 ? 5.3882 3.8690 2.5994 -0.3749 -0.1200 0.0986  154  ARG A O   
970  C CB  . ARG A 120 ? 5.2141 4.0292 2.7830 -0.4658 -0.0951 0.0637  154  ARG A CB  
971  C CG  . ARG A 120 ? 5.2062 4.0616 2.8201 -0.5130 -0.0874 0.0354  154  ARG A CG  
972  C CD  . ARG A 120 ? 5.1383 4.1567 2.8762 -0.4959 -0.1046 0.0441  154  ARG A CD  
973  N NE  . ARG A 120 ? 5.2091 4.2669 2.8676 -0.4125 -0.1284 0.0733  154  ARG A NE  
974  C CZ  . ARG A 120 ? 5.1267 4.3335 2.8699 -0.3865 -0.1487 0.0931  154  ARG A CZ  
975  N NH1 . ARG A 120 ? 5.1849 4.4327 2.8454 -0.3057 -0.1685 0.1209  154  ARG A NH1 
976  N NH2 . ARG A 120 ? 4.9875 4.3030 2.8941 -0.4409 -0.1527 0.0867  154  ARG A NH2 
977  N N   . ARG A 121 ? 5.0623 3.7424 2.5829 -0.4428 -0.0928 0.0968  155  ARG A N   
978  C CA  . ARG A 121 ? 5.0721 3.7096 2.5520 -0.3972 -0.1033 0.1199  155  ARG A CA  
979  C C   . ARG A 121 ? 5.1949 3.8282 2.5504 -0.2881 -0.1333 0.1424  155  ARG A C   
980  O O   . ARG A 121 ? 5.3387 3.8400 2.5402 -0.2381 -0.1512 0.1518  155  ARG A O   
981  C CB  . ARG A 121 ? 5.0448 3.5090 2.4230 -0.4416 -0.0961 0.1139  155  ARG A CB  
982  C CG  . ARG A 121 ? 4.9383 3.3655 2.3146 -0.4186 -0.1023 0.1327  155  ARG A CG  
983  C CD  . ARG A 121 ? 4.9444 3.1939 2.2099 -0.4701 -0.1002 0.1301  155  ARG A CD  
984  N NE  . ARG A 121 ? 4.9331 3.1149 2.1481 -0.4311 -0.1162 0.1495  155  ARG A NE  
985  C CZ  . ARG A 121 ? 5.0051 3.0423 2.1392 -0.4742 -0.1194 0.1540  155  ARG A CZ  
986  N NH1 . ARG A 121 ? 5.0361 3.0145 2.1240 -0.4318 -0.1374 0.1709  155  ARG A NH1 
987  N NH2 . ARG A 121 ? 5.0517 3.0089 2.1501 -0.5603 -0.1061 0.1439  155  ARG A NH2 
988  N N   . ASN A 122 ? 5.1459 3.9281 2.5669 -0.2495 -0.1421 0.1517  156  ASN A N   
989  C CA  . ASN A 122 ? 5.2724 4.0845 2.5866 -0.1424 -0.1692 0.1730  156  ASN A CA  
990  C C   . ASN A 122 ? 5.5384 4.1618 2.6303 -0.1095 -0.1842 0.1616  156  ASN A C   
991  O O   . ASN A 122 ? 5.6452 4.1442 2.5913 -0.0508 -0.2041 0.1699  156  ASN A O   
992  C CB  . ASN A 122 ? 5.2170 4.0809 2.5411 -0.0721 -0.1820 0.2007  156  ASN A CB  
993  C CG  . ASN A 122 ? 5.2585 4.1994 2.4969 0.0458  -0.2092 0.2247  156  ASN A CG  
994  O OD1 . ASN A 122 ? 5.2667 4.2769 2.4918 0.0670  -0.2163 0.2261  156  ASN A OD1 
995  N ND2 . ASN A 122 ? 5.2932 4.2280 2.4706 0.1269  -0.2252 0.2437  156  ASN A ND2 
996  N N   . PRO A 123 ? 2.8768 2.6314 3.7661 0.0730  -0.3029 -0.0174 157  PRO A N   
997  C CA  . PRO A 123 ? 2.8324 2.6575 3.7377 0.1208  -0.3313 -0.0235 157  PRO A CA  
998  C C   . PRO A 123 ? 2.9165 2.7318 3.8581 0.1017  -0.2569 -0.0640 157  PRO A C   
999  O O   . PRO A 123 ? 2.9381 2.7724 3.8366 0.1173  -0.2631 -0.0565 157  PRO A O   
1000 C CB  . PRO A 123 ? 2.6533 2.5948 3.7078 0.2025  -0.4004 -0.0507 157  PRO A CB  
1001 C CG  . PRO A 123 ? 2.6432 2.5770 3.8023 0.1907  -0.3806 -0.0834 157  PRO A CG  
1002 C CD  . PRO A 123 ? 2.7856 2.6051 3.8129 0.1166  -0.3457 -0.0432 157  PRO A CD  
1003 N N   . TRP A 124 ? 2.9428 2.7283 3.9635 0.0682  -0.1855 -0.1065 158  TRP A N   
1004 C CA  . TRP A 124 ? 2.9661 2.7368 4.0143 0.0470  -0.1104 -0.1439 158  TRP A CA  
1005 C C   . TRP A 124 ? 3.0822 2.7503 3.9528 -0.0147 -0.0645 -0.1062 158  TRP A C   
1006 O O   . TRP A 124 ? 3.1271 2.7889 3.9832 -0.0215 -0.0237 -0.1235 158  TRP A O   
1007 C CB  . TRP A 124 ? 2.9719 2.7372 4.1517 0.0260  -0.0448 -0.1971 158  TRP A CB  
1008 C CG  . TRP A 124 ? 2.8350 2.7124 4.2082 0.0931  -0.0815 -0.2494 158  TRP A CG  
1009 C CD1 . TRP A 124 ? 2.7445 2.6632 4.2167 0.1205  -0.1249 -0.2610 158  TRP A CD1 
1010 C CD2 . TRP A 124 ? 2.7482 2.7097 4.2373 0.1438  -0.0803 -0.2983 158  TRP A CD2 
1011 N NE1 . TRP A 124 ? 2.6410 2.6643 4.2840 0.1856  -0.1517 -0.3154 158  TRP A NE1 
1012 C CE2 . TRP A 124 ? 2.6413 2.6930 4.2972 0.2015  -0.1247 -0.3388 158  TRP A CE2 
1013 C CE3 . TRP A 124 ? 2.7205 2.6881 4.1874 0.1471  -0.0467 -0.3124 158  TRP A CE3 
1014 C CZ2 . TRP A 124 ? 2.5428 2.6901 4.3409 0.2631  -0.1365 -0.3928 158  TRP A CZ2 
1015 C CZ3 . TRP A 124 ? 2.6050 2.6671 4.2132 0.2073  -0.0570 -0.3648 158  TRP A CZ3 
1016 C CH2 . TRP A 124 ? 2.5248 2.6757 4.2957 0.2651  -0.1016 -0.4045 158  TRP A CH2 
1017 N N   . GLN A 125 ? 2.9500 2.5358 3.6826 -0.0583 -0.0715 -0.0557 159  GLN A N   
1018 C CA  . GLN A 125 ? 2.7747 2.2645 3.3287 -0.1111 -0.0394 -0.0172 159  GLN A CA  
1019 C C   . GLN A 125 ? 2.5288 2.0568 3.0178 -0.0783 -0.0934 0.0084  159  GLN A C   
1020 O O   . GLN A 125 ? 2.6004 2.0806 2.9985 -0.1057 -0.0584 0.0153  159  GLN A O   
1021 C CB  . GLN A 125 ? 2.8486 2.2462 3.2703 -0.1588 -0.0427 0.0315  159  GLN A CB  
1022 C CG  . GLN A 125 ? 2.8647 2.2660 3.1721 -0.1419 -0.1258 0.0888  159  GLN A CG  
1023 C CD  . GLN A 125 ? 3.0128 2.3276 3.2028 -0.1849 -0.1300 0.1324  159  GLN A CD  
1024 O OE1 . GLN A 125 ? 3.1424 2.3809 3.3150 -0.2333 -0.0640 0.1239  159  GLN A OE1 
1025 N NE2 . GLN A 125 ? 2.9899 2.3159 3.0987 -0.1661 -0.2068 0.1799  159  GLN A NE2 
1026 N N   . ALA A 126 ? 2.2063 1.8205 2.7435 -0.0183 -0.1778 0.0220  160  ALA A N   
1027 C CA  . ALA A 126 ? 1.8989 1.5650 2.4058 0.0215  -0.2267 0.0401  160  ALA A CA  
1028 C C   . ALA A 126 ? 1.7933 1.5245 2.4173 0.0569  -0.1991 -0.0116 160  ALA A C   
1029 O O   . ALA A 126 ? 1.9553 1.6865 2.5275 0.0608  -0.1959 -0.0043 160  ALA A O   
1030 C CB  . ALA A 126 ? 1.6564 1.3979 2.1854 0.0788  -0.3220 0.0699  160  ALA A CB  
1031 N N   . SER A 127 ? 1.6292 1.4138 2.4114 0.0822  -0.1782 -0.0651 161  SER A N   
1032 C CA  . SER A 127 ? 1.5183 1.3578 2.4136 0.1116  -0.1437 -0.1191 161  SER A CA  
1033 C C   . SER A 127 ? 1.6023 1.3610 2.4323 0.0536  -0.0566 -0.1330 161  SER A C   
1034 O O   . SER A 127 ? 1.6246 1.4181 2.5184 0.0737  -0.0268 -0.1709 161  SER A O   
1035 C CB  . SER A 127 ? 1.4610 1.3682 2.5389 0.1460  -0.1383 -0.1746 161  SER A CB  
1036 O OG  . SER A 127 ? 1.4450 1.4057 2.6356 0.1751  -0.1041 -0.2295 161  SER A OG  
1037 N N   . TYR A 128 ? 1.6665 1.3176 2.3710 -0.0155 -0.0145 -0.1045 162  TYR A N   
1038 C CA  . TYR A 128 ? 1.8659 1.4310 2.4766 -0.0699 0.0610  -0.1078 162  TYR A CA  
1039 C C   . TYR A 128 ? 2.0071 1.5198 2.4479 -0.0893 0.0352  -0.0567 162  TYR A C   
1040 O O   . TYR A 128 ? 2.0490 1.5271 2.4352 -0.1074 0.0748  -0.0645 162  TYR A O   
1041 C CB  . TYR A 128 ? 1.9356 1.4074 2.5084 -0.1345 0.1317  -0.1102 162  TYR A CB  
1042 C CG  . TYR A 128 ? 1.9199 1.4281 2.6588 -0.1283 0.1803  -0.1669 162  TYR A CG  
1043 C CD1 . TYR A 128 ? 1.9349 1.4783 2.7728 -0.1152 0.2309  -0.2197 162  TYR A CD1 
1044 C CD2 . TYR A 128 ? 1.8574 1.3628 2.6550 -0.1367 0.1759  -0.1680 162  TYR A CD2 
1045 C CE1 . TYR A 128 ? 1.8861 1.4651 2.8815 -0.1100 0.2747  -0.2726 162  TYR A CE1 
1046 C CE2 . TYR A 128 ? 1.7941 1.3331 2.7497 -0.1325 0.2193  -0.2204 162  TYR A CE2 
1047 C CZ  . TYR A 128 ? 1.7791 1.3559 2.8346 -0.1193 0.2685  -0.2727 162  TYR A CZ  
1048 O OH  . TYR A 128 ? 1.7370 1.3492 2.9550 -0.1155 0.3108  -0.3256 162  TYR A OH  
1049 N N   . ILE A 129 ? 2.0514 1.5584 2.4100 -0.0850 -0.0317 -0.0055 163  ILE A N   
1050 C CA  . ILE A 129 ? 2.0769 1.5346 2.2765 -0.1045 -0.0605 0.0443  163  ILE A CA  
1051 C C   . ILE A 129 ? 1.9279 1.4592 2.1615 -0.0549 -0.0986 0.0410  163  ILE A C   
1052 O O   . ILE A 129 ? 2.0498 1.5377 2.1907 -0.0762 -0.0822 0.0530  163  ILE A O   
1053 C CB  . ILE A 129 ? 2.1192 1.5568 2.2308 -0.1105 -0.1234 0.0987  163  ILE A CB  
1054 C CG1 . ILE A 129 ? 2.2427 1.5774 2.2710 -0.1725 -0.0764 0.1111  163  ILE A CG1 
1055 C CG2 . ILE A 129 ? 2.0816 1.5012 2.0631 -0.1123 -0.1723 0.1478  163  ILE A CG2 
1056 C CD1 . ILE A 129 ? 2.2410 1.5574 2.1933 -0.1763 -0.1360 0.1603  163  ILE A CD1 
1057 N N   . VAL A 130 ? 1.6694 1.3107 2.0334 0.0129  -0.1507 0.0254  164  VAL A N   
1058 C CA  . VAL A 130 ? 1.5996 1.3132 1.9978 0.0649  -0.1884 0.0249  164  VAL A CA  
1059 C C   . VAL A 130 ? 1.6608 1.3573 2.0744 0.0537  -0.1245 -0.0132 164  VAL A C   
1060 O O   . VAL A 130 ? 1.7724 1.4480 2.1034 0.0478  -0.1311 0.0081  164  VAL A O   
1061 C CB  . VAL A 130 ? 1.4626 1.2956 2.0064 0.1429  -0.2476 0.0081  164  VAL A CB  
1062 C CG1 . VAL A 130 ? 1.4264 1.3325 2.0022 0.1994  -0.2848 0.0104  164  VAL A CG1 
1063 C CG2 . VAL A 130 ? 1.5932 1.4367 2.1067 0.1525  -0.3122 0.0496  164  VAL A CG2 
1064 N N   . PRO A 131 ? 1.5814 1.2831 2.0952 0.0488  -0.0617 -0.0683 165  PRO A N   
1065 C CA  . PRO A 131 ? 1.6523 1.3269 2.1640 0.0328  0.0026  -0.1016 165  PRO A CA  
1066 C C   . PRO A 131 ? 1.8013 1.3576 2.1450 -0.0367 0.0459  -0.0741 165  PRO A C   
1067 O O   . PRO A 131 ? 1.8924 1.4266 2.1923 -0.0434 0.0708  -0.0811 165  PRO A O   
1068 C CB  . PRO A 131 ? 1.5530 1.2489 2.2004 0.0339  0.0612  -0.1615 165  PRO A CB  
1069 C CG  . PRO A 131 ? 1.4530 1.2266 2.2122 0.0786  0.0076  -0.1668 165  PRO A CG  
1070 C CD  . PRO A 131 ? 1.4883 1.2265 2.1311 0.0615  -0.0479 -0.1052 165  PRO A CD  
1071 N N   . LEU A 132 ? 1.8807 1.3584 2.1267 -0.0871 0.0547  -0.0436 166  LEU A N   
1072 C CA  . LEU A 132 ? 2.0782 1.4401 2.1552 -0.1504 0.0911  -0.0159 166  LEU A CA  
1073 C C   . LEU A 132 ? 2.2065 1.5618 2.1761 -0.1438 0.0345  0.0287  166  LEU A C   
1074 O O   . LEU A 132 ? 2.4195 1.7168 2.2987 -0.1708 0.0630  0.0315  166  LEU A O   
1075 C CB  . LEU A 132 ? 2.1549 1.4384 2.1526 -0.1992 0.1069  0.0091  166  LEU A CB  
1076 C CG  . LEU A 132 ? 2.2943 1.4498 2.1112 -0.2652 0.1467  0.0374  166  LEU A CG  
1077 C CD1 . LEU A 132 ? 2.3376 1.4427 2.1533 -0.2936 0.2352  -0.0027 166  LEU A CD1 
1078 C CD2 . LEU A 132 ? 2.4492 1.5375 2.1944 -0.3040 0.1518  0.0655  166  LEU A CD2 
1079 N N   . VAL A 133 ? 2.1584 1.5737 2.1395 -0.1071 -0.0461 0.0634  167  VAL A N   
1080 C CA  . VAL A 133 ? 2.2198 1.6377 2.1121 -0.0978 -0.1030 0.1071  167  VAL A CA  
1081 C C   . VAL A 133 ? 2.0896 1.5620 2.0428 -0.0599 -0.1008 0.0836  167  VAL A C   
1082 O O   . VAL A 133 ? 2.0759 1.5056 1.9361 -0.0787 -0.1004 0.1016  167  VAL A O   
1083 C CB  . VAL A 133 ? 2.2126 1.6904 2.1165 -0.0622 -0.1880 0.1482  167  VAL A CB  
1084 C CG1 . VAL A 133 ? 2.2535 1.7311 2.0641 -0.0565 -0.2449 0.1964  167  VAL A CG1 
1085 C CG2 . VAL A 133 ? 2.3281 1.7503 2.1744 -0.0987 -0.1879 0.1691  167  VAL A CG2 
1086 N N   . TRP A 134 ? 2.0330 1.5983 2.1426 -0.0055 -0.0997 0.0422  168  TRP A N   
1087 C CA  . TRP A 134 ? 1.9320 1.5492 2.1021 0.0337  -0.0954 0.0181  168  TRP A CA  
1088 C C   . TRP A 134 ? 2.0039 1.5447 2.1206 -0.0098 -0.0192 -0.0100 168  TRP A C   
1089 O O   . TRP A 134 ? 2.1975 1.7317 2.2771 -0.0044 -0.0193 -0.0066 168  TRP A O   
1090 C CB  . TRP A 134 ? 1.8576 1.5850 2.2051 0.1010  -0.1057 -0.0251 168  TRP A CB  
1091 C CG  . TRP A 134 ? 1.8492 1.6667 2.2497 0.1616  -0.1893 0.0031  168  TRP A CG  
1092 C CD1 . TRP A 134 ? 1.8747 1.7358 2.3347 0.1845  -0.2270 0.0080  168  TRP A CD1 
1093 C CD2 . TRP A 134 ? 1.8316 1.7050 2.2284 0.2079  -0.2448 0.0315  168  TRP A CD2 
1094 N NE1 . TRP A 134 ? 1.8023 1.7437 2.2936 0.2440  -0.3027 0.0372  168  TRP A NE1 
1095 C CE2 . TRP A 134 ? 1.7878 1.7387 2.2422 0.2593  -0.3138 0.0530  168  TRP A CE2 
1096 C CE3 . TRP A 134 ? 1.7656 1.6299 2.1170 0.2115  -0.2421 0.0414  168  TRP A CE3 
1097 C CZ2 . TRP A 134 ? 1.6504 1.6705 2.1174 0.3144  -0.3773 0.0852  168  TRP A CZ2 
1098 C CZ3 . TRP A 134 ? 1.6596 1.5919 2.0268 0.2644  -0.3051 0.0735  168  TRP A CZ3 
1099 C CH2 . TRP A 134 ? 1.5770 1.5867 2.0012 0.3155  -0.3707 0.0956  168  TRP A CH2 
1100 N N   . CYS A 135 ? 1.9902 1.4703 2.1000 -0.0534 0.0470  -0.0367 169  CYS A N   
1101 C CA  . CYS A 135 ? 2.1515 1.5573 2.2091 -0.0937 0.1227  -0.0640 169  CYS A CA  
1102 C C   . CYS A 135 ? 2.2659 1.5692 2.1425 -0.1459 0.1220  -0.0223 169  CYS A C   
1103 O O   . CYS A 135 ? 2.3184 1.5786 2.1404 -0.1616 0.1545  -0.0331 169  CYS A O   
1104 C CB  . CYS A 135 ? 2.1839 1.5546 2.2869 -0.1245 0.1953  -0.1018 169  CYS A CB  
1105 S SG  . CYS A 135 ? 2.0972 1.5770 2.4180 -0.0682 0.2190  -0.1688 169  CYS A SG  
1106 N N   . MET A 136 ? 2.2990 1.5606 2.0797 -0.1724 0.0842  0.0243  170  MET A N   
1107 C CA  . MET A 136 ? 2.4886 1.6590 2.0988 -0.2169 0.0726  0.0655  170  MET A CA  
1108 C C   . MET A 136 ? 2.4075 1.6176 2.0027 -0.1872 0.0183  0.0878  170  MET A C   
1109 O O   . MET A 136 ? 2.5291 1.6743 2.0229 -0.2154 0.0314  0.0964  170  MET A O   
1110 C CB  . MET A 136 ? 2.6577 1.7845 2.1775 -0.2453 0.0375  0.1104  170  MET A CB  
1111 C CG  . MET A 136 ? 2.9025 1.9374 2.3602 -0.2980 0.1022  0.1007  170  MET A CG  
1112 S SD  . MET A 136 ? 3.1346 2.0858 2.4279 -0.3412 0.0626  0.1608  170  MET A SD  
1113 C CE  . MET A 136 ? 3.2404 2.1359 2.3879 -0.3606 0.0314  0.1929  170  MET A CE  
1114 N N   . ALA A 137 ? 2.2061 1.5213 1.9012 -0.1293 -0.0430 0.0978  171  ALA A N   
1115 C CA  . ALA A 137 ? 2.0219 1.3817 1.7164 -0.0963 -0.0917 0.1190  171  ALA A CA  
1116 C C   . ALA A 137 ? 1.8829 1.2495 1.6222 -0.0832 -0.0461 0.0782  171  ALA A C   
1117 O O   . ALA A 137 ? 1.8919 1.2291 1.5634 -0.0918 -0.0551 0.0934  171  ALA A O   
1118 C CB  . ALA A 137 ? 1.9010 1.3751 1.7012 -0.0316 -0.1610 0.1354  171  ALA A CB  
1119 N N   . CYS A 138 ? 1.7537 1.1574 1.6075 -0.0626 0.0030  0.0254  172  CYS A N   
1120 C CA  . CYS A 138 ? 1.7861 1.1926 1.6817 -0.0512 0.0515  -0.0169 172  CYS A CA  
1121 C C   . CYS A 138 ? 1.9897 1.2789 1.7503 -0.1131 0.1040  -0.0181 172  CYS A C   
1122 O O   . CYS A 138 ? 2.2213 1.4895 1.9390 -0.1134 0.1065  -0.0174 172  CYS A O   
1123 C CB  . CYS A 138 ? 1.8093 1.2701 1.8479 -0.0238 0.0976  -0.0742 172  CYS A CB  
1124 S SG  . CYS A 138 ? 1.7952 1.4004 2.0047 0.0609  0.0375  -0.0837 172  CYS A SG  
1125 N N   . LEU A 139 ? 1.9966 1.2059 1.6867 -0.1650 0.1464  -0.0196 173  LEU A N   
1126 C CA  . LEU A 139 ? 2.1658 1.2587 1.7206 -0.2224 0.1980  -0.0211 173  LEU A CA  
1127 C C   . LEU A 139 ? 2.2972 1.3389 1.7178 -0.2434 0.1495  0.0260  173  LEU A C   
1128 O O   . LEU A 139 ? 2.4228 1.3969 1.7589 -0.2688 0.1762  0.0203  173  LEU A O   
1129 C CB  . LEU A 139 ? 2.1694 1.1868 1.6666 -0.2709 0.2456  -0.0233 173  LEU A CB  
1130 C CG  . LEU A 139 ? 2.2747 1.3214 1.8914 -0.2631 0.3089  -0.0730 173  LEU A CG  
1131 C CD1 . LEU A 139 ? 2.3528 1.3123 1.8935 -0.3159 0.3564  -0.0674 173  LEU A CD1 
1132 C CD2 . LEU A 139 ? 2.1598 1.2101 1.8270 -0.2528 0.3677  -0.1218 173  LEU A CD2 
1133 N N   . SER A 140 ? 2.2581 1.3313 1.6592 -0.2324 0.0770  0.0723  174  SER A N   
1134 C CA  . SER A 140 ? 2.3614 1.3933 1.6460 -0.2505 0.0270  0.1173  174  SER A CA  
1135 C C   . SER A 140 ? 2.2698 1.3604 1.6081 -0.2102 -0.0014 0.1163  174  SER A C   
1136 O O   . SER A 140 ? 2.3138 1.3540 1.5588 -0.2311 -0.0185 0.1375  174  SER A O   
1137 C CB  . SER A 140 ? 2.2742 1.3224 1.5220 -0.2512 -0.0406 0.1675  174  SER A CB  
1138 O OG  . SER A 140 ? 2.3499 1.3211 1.5142 -0.2968 -0.0145 0.1745  174  SER A OG  
1139 N N   . SER A 141 ? 2.1342 1.3284 1.6209 -0.1523 -0.0065 0.0914  175  SER A N   
1140 C CA  . SER A 141 ? 2.0025 1.2536 1.5486 -0.1095 -0.0257 0.0863  175  SER A CA  
1141 C C   . SER A 141 ? 1.9789 1.1989 1.5405 -0.1144 0.0418  0.0373  175  SER A C   
1142 O O   . SER A 141 ? 1.9231 1.1865 1.5369 -0.0782 0.0337  0.0278  175  SER A O   
1143 C CB  . SER A 141 ? 1.8983 1.2769 1.5936 -0.0386 -0.0661 0.0833  175  SER A CB  
1144 O OG  . SER A 141 ? 1.8631 1.2842 1.6734 -0.0137 -0.0181 0.0299  175  SER A OG  
1145 N N   . LEU A 142 ? 2.1242 1.2707 1.6427 -0.1561 0.1092  0.0067  176  LEU A N   
1146 C CA  . LEU A 142 ? 2.1748 1.2839 1.6952 -0.1637 0.1746  -0.0381 176  LEU A CA  
1147 C C   . LEU A 142 ? 2.2704 1.3210 1.6922 -0.1817 0.1645  -0.0224 176  LEU A C   
1148 O O   . LEU A 142 ? 2.3485 1.4157 1.8168 -0.1587 0.1908  -0.0533 176  LEU A O   
1149 C CB  . LEU A 142 ? 2.3019 1.3321 1.7754 -0.2103 0.2487  -0.0668 176  LEU A CB  
1150 C CG  . LEU A 142 ? 2.2602 1.3473 1.8548 -0.1915 0.2787  -0.0985 176  LEU A CG  
1151 C CD1 . LEU A 142 ? 2.3559 1.3641 1.9120 -0.2348 0.3640  -0.1326 176  LEU A CD1 
1152 C CD2 . LEU A 142 ? 2.1535 1.3561 1.9139 -0.1247 0.2703  -0.1320 176  LEU A CD2 
1153 N N   . PRO A 143 ? 2.2649 1.2450 1.5533 -0.2217 0.1291  0.0215  177  PRO A N   
1154 C CA  . PRO A 143 ? 2.3267 1.2617 1.5389 -0.2330 0.1129  0.0350  177  PRO A CA  
1155 C C   . PRO A 143 ? 2.1038 1.1327 1.4123 -0.1771 0.0663  0.0456  177  PRO A C   
1156 O O   . PRO A 143 ? 2.1060 1.1324 1.4317 -0.1627 0.0857  0.0244  177  PRO A O   
1157 C CB  . PRO A 143 ? 2.2997 1.1587 1.3689 -0.2803 0.0718  0.0833  177  PRO A CB  
1158 C CG  . PRO A 143 ? 2.4086 1.2296 1.4437 -0.3097 0.1012  0.0791  177  PRO A CG  
1159 C CD  . PRO A 143 ? 2.3367 1.2597 1.5263 -0.2640 0.1110  0.0553  177  PRO A CD  
1160 N N   . THR A 144 ? 2.0055 1.1167 1.3766 -0.1430 0.0061  0.0785  178  THR A N   
1161 C CA  . THR A 144 ? 1.8924 1.0995 1.3631 -0.0834 -0.0358 0.0891  178  THR A CA  
1162 C C   . THR A 144 ? 1.9146 1.1872 1.5146 -0.0349 0.0068  0.0368  178  THR A C   
1163 O O   . THR A 144 ? 1.7673 1.0894 1.4280 0.0073  -0.0047 0.0323  178  THR A O   
1164 C CB  . THR A 144 ? 2.0528 1.3369 1.5681 -0.0536 -0.1039 0.1318  178  THR A CB  
1165 O OG1 . THR A 144 ? 2.0638 1.2826 1.4562 -0.1022 -0.1389 0.1765  178  THR A OG1 
1166 C CG2 . THR A 144 ? 1.7004 1.0716 1.2946 0.0042  -0.1521 0.1533  178  THR A CG2 
1167 N N   . PHE A 145 ? 2.0427 1.3156 1.6874 -0.0397 0.0569  -0.0033 179  PHE A N   
1168 C CA  . PHE A 145 ? 2.0033 1.3352 1.7706 0.0041  0.0997  -0.0568 179  PHE A CA  
1169 C C   . PHE A 145 ? 1.9593 1.2285 1.6850 -0.0139 0.1543  -0.0899 179  PHE A C   
1170 O O   . PHE A 145 ? 1.8445 1.1649 1.6612 0.0298  0.1753  -0.1250 179  PHE A O   
1171 C CB  . PHE A 145 ? 2.0680 1.4188 1.9008 0.0022  0.1371  -0.0901 179  PHE A CB  
1172 C CG  . PHE A 145 ? 1.9824 1.3892 1.9410 0.0428  0.1844  -0.1490 179  PHE A CG  
1173 C CD1 . PHE A 145 ? 1.8865 1.4028 1.9751 0.1144  0.1529  -0.1598 179  PHE A CD1 
1174 C CD2 . PHE A 145 ? 2.0313 1.3818 1.9780 0.0115  0.2605  -0.1939 179  PHE A CD2 
1175 C CE1 . PHE A 145 ? 1.8890 1.4575 2.0939 0.1538  0.1943  -0.2159 179  PHE A CE1 
1176 C CE2 . PHE A 145 ? 2.0335 1.4377 2.0995 0.0491  0.3035  -0.2492 179  PHE A CE2 
1177 C CZ  . PHE A 145 ? 1.9646 1.4781 2.1602 0.1203  0.2693  -0.2611 179  PHE A CZ  
1178 N N   . TYR A 146 ? 1.9755 1.1336 1.5628 -0.0754 0.1767  -0.0801 180  TYR A N   
1179 C CA  . TYR A 146 ? 2.1591 1.2505 1.6993 -0.0945 0.2313  -0.1133 180  TYR A CA  
1180 C C   . TYR A 146 ? 2.1955 1.2607 1.6772 -0.0940 0.1985  -0.0886 180  TYR A C   
1181 O O   . TYR A 146 ? 2.2284 1.2709 1.7120 -0.0874 0.2345  -0.1191 180  TYR A O   
1182 C CB  . TYR A 146 ? 2.1916 1.1704 1.6134 -0.1595 0.2835  -0.1238 180  TYR A CB  
1183 C CG  . TYR A 146 ? 2.2814 1.1885 1.6533 -0.1787 0.3456  -0.1618 180  TYR A CG  
1184 C CD1 . TYR A 146 ? 2.2681 1.2008 1.7267 -0.1585 0.4098  -0.2168 180  TYR A CD1 
1185 C CD2 . TYR A 146 ? 2.4323 1.2459 1.6709 -0.2164 0.3389  -0.1437 180  TYR A CD2 
1186 C CE1 . TYR A 146 ? 2.5197 1.3871 1.9311 -0.1746 0.4672  -0.2515 180  TYR A CE1 
1187 C CE2 . TYR A 146 ? 2.5370 1.2826 1.7261 -0.2325 0.3946  -0.1789 180  TYR A CE2 
1188 C CZ  . TYR A 146 ? 2.6035 1.3764 1.8780 -0.2112 0.4593  -0.2321 180  TYR A CZ  
1189 O OH  . TYR A 146 ? 2.5384 1.2437 1.7618 -0.2258 0.5148  -0.2667 180  TYR A OH  
1190 N N   . PHE A 147 ? 2.2196 1.2890 1.6541 -0.0997 0.1313  -0.0348 181  PHE A N   
1191 C CA  . PHE A 147 ? 2.2119 1.2466 1.5841 -0.1070 0.1007  -0.0091 181  PHE A CA  
1192 C C   . PHE A 147 ? 2.1653 1.2940 1.6222 -0.0527 0.0410  0.0219  181  PHE A C   
1193 O O   . PHE A 147 ? 2.2919 1.4029 1.7237 -0.0495 0.0243  0.0355  181  PHE A O   
1194 C CB  . PHE A 147 ? 2.3033 1.2414 1.5243 -0.1688 0.0744  0.0296  181  PHE A CB  
1195 C CG  . PHE A 147 ? 2.5260 1.3504 1.6362 -0.2234 0.1335  0.0017  181  PHE A CG  
1196 C CD1 . PHE A 147 ? 2.6413 1.4060 1.7114 -0.2341 0.1745  -0.0287 181  PHE A CD1 
1197 C CD2 . PHE A 147 ? 2.6234 1.3985 1.6666 -0.2622 0.1486  0.0066  181  PHE A CD2 
1198 C CE1 . PHE A 147 ? 2.7702 1.4297 1.7352 -0.2811 0.2295  -0.0540 181  PHE A CE1 
1199 C CE2 . PHE A 147 ? 2.7633 1.4321 1.7009 -0.3096 0.2051  -0.0175 181  PHE A CE2 
1200 C CZ  . PHE A 147 ? 2.8192 1.4307 1.7172 -0.3184 0.2456  -0.0479 181  PHE A CZ  
1201 N N   . ARG A 148 ? 1.8659 1.0913 1.4209 -0.0092 0.0091  0.0339  182  ARG A N   
1202 C CA  . ARG A 148 ? 1.7599 1.0751 1.3921 0.0457  -0.0476 0.0664  182  ARG A CA  
1203 C C   . ARG A 148 ? 1.7022 1.0720 1.4354 0.1006  -0.0192 0.0285  182  ARG A C   
1204 O O   . ARG A 148 ? 1.6563 1.0973 1.4972 0.1453  0.0004  -0.0056 182  ARG A O   
1205 C CB  . ARG A 148 ? 1.6689 1.0667 1.3674 0.0765  -0.0909 0.0904  182  ARG A CB  
1206 C CG  . ARG A 148 ? 1.5561 1.0530 1.3393 0.1396  -0.1477 0.1240  182  ARG A CG  
1207 C CD  . ARG A 148 ? 1.5809 1.0496 1.2861 0.1173  -0.2012 0.1825  182  ARG A CD  
1208 N NE  . ARG A 148 ? 1.6409 1.0545 1.2469 0.0630  -0.2268 0.2151  182  ARG A NE  
1209 C CZ  . ARG A 148 ? 1.8780 1.2741 1.4190 0.0421  -0.2806 0.2689  182  ARG A CZ  
1210 N NH1 . ARG A 148 ? 1.9254 1.2702 1.3753 -0.0059 -0.3020 0.2947  182  ARG A NH1 
1211 N NH2 . ARG A 148 ? 1.6177 1.0481 1.1866 0.0701  -0.3129 0.2974  182  ARG A NH2 
1212 N N   . ASP A 149 ? 1.9092 1.2446 1.6084 0.0984  -0.0179 0.0334  183  ASP A N   
1213 C CA  . ASP A 149 ? 1.7735 1.1512 1.5564 0.1490  0.0088  -0.0003 183  ASP A CA  
1214 C C   . ASP A 149 ? 1.7187 1.1112 1.4990 0.1706  -0.0337 0.0392  183  ASP A C   
1215 O O   . ASP A 149 ? 1.7391 1.0964 1.4443 0.1380  -0.0773 0.0881  183  ASP A O   
1216 C CB  . ASP A 149 ? 1.8123 1.1132 1.5536 0.1191  0.0795  -0.0531 183  ASP A CB  
1217 C CG  . ASP A 149 ? 1.7692 1.1323 1.6249 0.1769  0.1191  -0.1044 183  ASP A CG  
1218 O OD1 . ASP A 149 ? 1.6628 1.1274 1.6287 0.2410  0.0916  -0.1003 183  ASP A OD1 
1219 O OD2 . ASP A 149 ? 1.8454 1.1559 1.6796 0.1601  0.1775  -0.1493 183  ASP A OD2 
1220 N N   . VAL A 150 ? 1.7770 1.2219 1.6422 0.2268  -0.0200 0.0176  184  VAL A N   
1221 C CA  . VAL A 150 ? 1.7606 1.2194 1.6330 0.2521  -0.0511 0.0504  184  VAL A CA  
1222 C C   . VAL A 150 ? 1.8619 1.2210 1.6491 0.2096  -0.0176 0.0338  184  VAL A C   
1223 O O   . VAL A 150 ? 1.7344 1.0632 1.5268 0.2082  0.0394  -0.0191 184  VAL A O   
1224 C CB  . VAL A 150 ? 1.6470 1.2102 1.6499 0.3380  -0.0535 0.0368  184  VAL A CB  
1225 C CG1 . VAL A 150 ? 1.5653 1.1238 1.5694 0.3603  -0.0659 0.0584  184  VAL A CG1 
1226 C CG2 . VAL A 150 ? 1.5836 1.2436 1.6591 0.3825  -0.1025 0.0679  184  VAL A CG2 
1227 N N   . ARG A 151 ? 1.9420 1.2504 1.6526 0.1755  -0.0538 0.0784  185  ARG A N   
1228 C CA  . ARG A 151 ? 2.0107 1.2239 1.6388 0.1366  -0.0322 0.0687  185  ARG A CA  
1229 C C   . ARG A 151 ? 2.1541 1.3869 1.8018 0.1601  -0.0720 0.1102  185  ARG A C   
1230 O O   . ARG A 151 ? 2.1743 1.4619 1.8503 0.1774  -0.1262 0.1615  185  ARG A O   
1231 C CB  . ARG A 151 ? 1.9626 1.0685 1.4547 0.0568  -0.0336 0.0781  185  ARG A CB  
1232 C CG  . ARG A 151 ? 2.0081 1.0799 1.4692 0.0288  0.0131  0.0371  185  ARG A CG  
1233 C CD  . ARG A 151 ? 2.0286 1.0879 1.5230 0.0465  0.0806  -0.0246 185  ARG A CD  
1234 N NE  . ARG A 151 ? 2.0640 1.1006 1.5430 0.0234  0.1271  -0.0622 185  ARG A NE  
1235 C CZ  . ARG A 151 ? 2.3220 1.3468 1.8279 0.0322  0.1909  -0.1184 185  ARG A CZ  
1236 N NH1 . ARG A 151 ? 2.4209 1.4534 1.9671 0.0648  0.2149  -0.1451 185  ARG A NH1 
1237 N NH2 . ARG A 151 ? 2.1202 1.1252 1.6135 0.0088  0.2314  -0.1473 185  ARG A NH2 
1238 N N   . THR A 152 ? 2.1556 1.3421 1.7886 0.1610  -0.0431 0.0880  186  THR A N   
1239 C CA  . THR A 152 ? 2.1656 1.3586 1.8139 0.1796  -0.0736 0.1239  186  THR A CA  
1240 C C   . THR A 152 ? 2.2489 1.3541 1.7870 0.1124  -0.1078 0.1615  186  THR A C   
1241 O O   . THR A 152 ? 2.4093 1.4129 1.8505 0.0587  -0.0818 0.1364  186  THR A O   
1242 C CB  . THR A 152 ? 2.3029 1.4792 1.9799 0.2084  -0.0285 0.0833  186  THR A CB  
1243 O OG1 . THR A 152 ? 2.2958 1.5618 2.0828 0.2768  -0.0027 0.0505  186  THR A OG1 
1244 C CG2 . THR A 152 ? 2.3654 1.5372 2.0512 0.2223  -0.0577 0.1216  186  THR A CG2 
1245 N N   . ILE A 153 ? 1.8999 1.0443 1.4522 0.1164  -0.1667 0.2207  187  ILE A N   
1246 C CA  . ILE A 153 ? 1.9759 1.0490 1.4400 0.0599  -0.2070 0.2610  187  ILE A CA  
1247 C C   . ILE A 153 ? 2.6418 1.7172 2.1403 0.0819  -0.2199 0.2832  187  ILE A C   
1248 O O   . ILE A 153 ? 2.3168 1.4764 1.8999 0.1307  -0.2509 0.3224  187  ILE A O   
1249 C CB  . ILE A 153 ? 1.9362 1.0488 1.3935 0.0473  -0.2642 0.3134  187  ILE A CB  
1250 C CG1 . ILE A 153 ? 2.1926 1.2982 1.6145 0.0255  -0.2484 0.2900  187  ILE A CG1 
1251 C CG2 . ILE A 153 ? 2.3369 1.3773 1.7082 -0.0096 -0.3074 0.3533  187  ILE A CG2 
1252 C CD1 . ILE A 153 ? 2.1389 1.2848 1.5545 0.0164  -0.3020 0.3377  187  ILE A CD1 
1253 N N   . GLU A 154 ? 1.3213 1.2689 1.8880 -0.1868 -0.1193 -0.0481 188  GLU A N   
1254 C CA  . GLU A 154 ? 1.1791 1.1648 1.8073 -0.1768 -0.1335 -0.0404 188  GLU A CA  
1255 C C   . GLU A 154 ? 1.1289 1.1070 1.7107 -0.1672 -0.1726 -0.0400 188  GLU A C   
1256 O O   . GLU A 154 ? 1.1506 1.1835 1.7882 -0.1592 -0.2009 -0.0234 188  GLU A O   
1257 C CB  . GLU A 154 ? 1.3336 1.2898 1.9840 -0.1731 -0.0951 -0.0500 188  GLU A CB  
1258 C CG  . GLU A 154 ? 1.4995 1.4893 2.2365 -0.1787 -0.0599 -0.0402 188  GLU A CG  
1259 C CD  . GLU A 154 ? 1.6145 1.6070 2.4110 -0.1695 -0.0368 -0.0414 188  GLU A CD  
1260 O OE1 . GLU A 154 ? 1.5812 1.5579 2.3630 -0.1599 -0.0558 -0.0486 188  GLU A OE1 
1261 O OE2 . GLU A 154 ? 1.6147 1.6246 2.4765 -0.1718 -0.0006 -0.0341 188  GLU A OE2 
1262 N N   . TYR A 155 ? 1.0066 0.9199 1.4902 -0.1672 -0.1747 -0.0548 189  TYR A N   
1263 C CA  . TYR A 155 ? 1.0252 0.9301 1.4709 -0.1586 -0.2122 -0.0517 189  TYR A CA  
1264 C C   . TYR A 155 ? 1.1164 1.0747 1.5736 -0.1540 -0.2486 -0.0325 189  TYR A C   
1265 O O   . TYR A 155 ? 1.1752 1.1634 1.6512 -0.1433 -0.2804 -0.0172 189  TYR A O   
1266 C CB  . TYR A 155 ? 0.9384 0.7640 1.2752 -0.1600 -0.2091 -0.0700 189  TYR A CB  
1267 C CG  . TYR A 155 ? 0.8993 0.7170 1.2054 -0.1524 -0.2498 -0.0639 189  TYR A CG  
1268 C CD1 . TYR A 155 ? 0.9261 0.7296 1.2532 -0.1467 -0.2607 -0.0673 189  TYR A CD1 
1269 C CD2 . TYR A 155 ? 0.8922 0.7169 1.1541 -0.1504 -0.2783 -0.0531 189  TYR A CD2 
1270 C CE1 . TYR A 155 ? 1.0973 0.8953 1.4063 -0.1410 -0.3005 -0.0579 189  TYR A CE1 
1271 C CE2 . TYR A 155 ? 0.9083 0.7293 1.1496 -0.1428 -0.3146 -0.0427 189  TYR A CE2 
1272 C CZ  . TYR A 155 ? 1.1439 0.9527 1.4114 -0.1391 -0.3264 -0.0439 189  TYR A CZ  
1273 O OH  . TYR A 155 ? 1.2207 1.0273 1.4767 -0.1330 -0.3649 -0.0299 189  TYR A OH  
1274 N N   . LEU A 156 ? 1.2476 1.2165 1.6930 -0.1602 -0.2450 -0.0324 190  LEU A N   
1275 C CA  . LEU A 156 ? 1.3048 1.3279 1.7669 -0.1527 -0.2774 -0.0165 190  LEU A CA  
1276 C C   . LEU A 156 ? 1.2660 1.3637 1.8268 -0.1502 -0.2802 -0.0016 190  LEU A C   
1277 O O   . LEU A 156 ? 1.2018 1.3528 1.7829 -0.1390 -0.3091 0.0138  190  LEU A O   
1278 C CB  . LEU A 156 ? 1.3303 1.3257 1.7302 -0.1595 -0.2787 -0.0253 190  LEU A CB  
1279 C CG  . LEU A 156 ? 1.3142 1.2382 1.6150 -0.1618 -0.2763 -0.0372 190  LEU A CG  
1280 C CD1 . LEU A 156 ? 1.3998 1.3020 1.6505 -0.1677 -0.2791 -0.0429 190  LEU A CD1 
1281 C CD2 . LEU A 156 ? 1.2194 1.1458 1.4938 -0.1481 -0.3069 -0.0267 190  LEU A CD2 
1282 N N   . GLY A 157 ? 1.2448 1.3483 1.8659 -0.1583 -0.2506 -0.0044 191  GLY A N   
1283 C CA  . GLY A 157 ? 1.2871 1.4608 2.0043 -0.1578 -0.2519 0.0108  191  GLY A CA  
1284 C C   . GLY A 157 ? 1.2226 1.4220 1.9368 -0.1618 -0.2676 0.0123  191  GLY A C   
1285 O O   . GLY A 157 ? 1.1230 1.3847 1.8765 -0.1517 -0.2951 0.0273  191  GLY A O   
1286 N N   . VAL A 158 ? 1.2657 1.4158 1.9320 -0.1753 -0.2515 -0.0032 192  VAL A N   
1287 C CA  . VAL A 158 ? 1.1457 1.3034 1.7927 -0.1795 -0.2716 -0.0062 192  VAL A CA  
1288 C C   . VAL A 158 ? 1.0801 1.2072 1.7405 -0.1996 -0.2425 -0.0145 192  VAL A C   
1289 O O   . VAL A 158 ? 1.1919 1.2622 1.8127 -0.2071 -0.2105 -0.0237 192  VAL A O   
1290 C CB  . VAL A 158 ? 1.0843 1.2058 1.6359 -0.1708 -0.2945 -0.0135 192  VAL A CB  
1291 C CG1 . VAL A 158 ? 1.1885 1.2868 1.7066 -0.1802 -0.3025 -0.0241 192  VAL A CG1 
1292 C CG2 . VAL A 158 ? 1.0566 1.2279 1.6108 -0.1488 -0.3301 0.0015  192  VAL A CG2 
1293 N N   . ASN A 159 ? 0.8863 1.0517 1.6037 -0.2074 -0.2543 -0.0095 193  ASN A N   
1294 C CA  . ASN A 159 ? 1.0802 1.2191 1.8148 -0.2273 -0.2339 -0.0136 193  ASN A CA  
1295 C C   . ASN A 159 ? 1.0901 1.1856 1.7474 -0.2303 -0.2534 -0.0262 193  ASN A C   
1296 O O   . ASN A 159 ? 1.0932 1.2107 1.7516 -0.2281 -0.2902 -0.0290 193  ASN A O   
1297 C CB  . ASN A 159 ? 1.1105 1.3069 1.9441 -0.2362 -0.2432 -0.0019 193  ASN A CB  
1298 C CG  . ASN A 159 ? 1.1276 1.3559 2.0450 -0.2378 -0.2116 0.0121  193  ASN A CG  
1299 O OD1 . ASN A 159 ? 1.2145 1.4068 2.1176 -0.2375 -0.1725 0.0099  193  ASN A OD1 
1300 N ND2 . ASN A 159 ? 1.0678 1.3627 2.0711 -0.2379 -0.2290 0.0263  193  ASN A ND2 
1301 N N   . ALA A 160 ? 1.0816 1.1134 1.6693 -0.2340 -0.2294 -0.0344 194  ALA A N   
1302 C CA  . ALA A 160 ? 1.1145 1.1015 1.6233 -0.2347 -0.2461 -0.0448 194  ALA A CA  
1303 C C   . ALA A 160 ? 1.3159 1.2691 1.8372 -0.2547 -0.2274 -0.0455 194  ALA A C   
1304 O O   . ALA A 160 ? 1.3628 1.3068 1.9248 -0.2659 -0.1879 -0.0378 194  ALA A O   
1305 C CB  . ALA A 160 ? 0.8163 0.7556 1.2358 -0.2249 -0.2372 -0.0507 194  ALA A CB  
1306 N N   . CYS A 161 ? 1.4079 1.3425 1.8960 -0.2575 -0.2560 -0.0532 195  CYS A N   
1307 C CA  . CYS A 161 ? 1.4195 1.3196 1.9197 -0.2766 -0.2458 -0.0526 195  CYS A CA  
1308 C C   . CYS A 161 ? 1.5056 1.3408 1.9209 -0.2767 -0.2213 -0.0554 195  CYS A C   
1309 O O   . CYS A 161 ? 1.5934 1.3996 1.9387 -0.2697 -0.2445 -0.0644 195  CYS A O   
1310 C CB  . CYS A 161 ? 1.3359 1.2470 1.8465 -0.2787 -0.2934 -0.0615 195  CYS A CB  
1311 S SG  . CYS A 161 ? 1.3119 1.1756 1.8362 -0.3017 -0.2926 -0.0618 195  CYS A SG  
1312 N N   . ILE A 162 ? 1.4725 1.2852 1.8919 -0.2825 -0.1734 -0.0467 196  ILE A N   
1313 C CA  . ILE A 162 ? 1.4607 1.2146 1.7941 -0.2794 -0.1473 -0.0483 196  ILE A CA  
1314 C C   . ILE A 162 ? 1.4657 1.1881 1.8185 -0.2948 -0.1091 -0.0354 196  ILE A C   
1315 O O   . ILE A 162 ? 1.3282 1.0744 1.7662 -0.3090 -0.1045 -0.0244 196  ILE A O   
1316 C CB  . ILE A 162 ? 1.4575 1.2054 1.7561 -0.2661 -0.1238 -0.0509 196  ILE A CB  
1317 C CG1 . ILE A 162 ? 1.3914 1.1529 1.7552 -0.2709 -0.0791 -0.0408 196  ILE A CG1 
1318 C CG2 . ILE A 162 ? 1.5096 1.2963 1.8084 -0.2515 -0.1595 -0.0573 196  ILE A CG2 
1319 C CD1 . ILE A 162 ? 1.4841 1.2300 1.8122 -0.2573 -0.0532 -0.0463 196  ILE A CD1 
1320 N N   . MET A 163 ? 1.5868 1.2570 1.8627 -0.2914 -0.0818 -0.0341 197  MET A N   
1321 C CA  . MET A 163 ? 1.6206 1.2614 1.9067 -0.3007 -0.0350 -0.0173 197  MET A CA  
1322 C C   . MET A 163 ? 1.5757 1.2208 1.8726 -0.2919 0.0120  -0.0123 197  MET A C   
1323 O O   . MET A 163 ? 1.3938 1.0147 1.6169 -0.2772 0.0218  -0.0232 197  MET A O   
1324 C CB  . MET A 163 ? 1.6436 1.2274 1.8378 -0.2990 -0.0292 -0.0168 197  MET A CB  
1325 C CG  . MET A 163 ? 1.5857 1.1593 1.7706 -0.3065 -0.0722 -0.0215 197  MET A CG  
1326 S SD  . MET A 163 ? 1.5797 1.1596 1.8631 -0.3300 -0.0715 -0.0039 197  MET A SD  
1327 C CE  . MET A 163 ? 1.5901 1.1231 1.8424 -0.3332 -0.0111 0.0213  197  MET A CE  
1328 N N   . ALA A 164 ? 1.7050 1.3797 2.0955 -0.3004 0.0394  0.0043  198  ALA A N   
1329 C CA  . ALA A 164 ? 1.7242 1.4112 2.1415 -0.2903 0.0822  0.0090  198  ALA A CA  
1330 C C   . ALA A 164 ? 1.7638 1.4099 2.1474 -0.2851 0.1422  0.0244  198  ALA A C   
1331 O O   . ALA A 164 ? 1.7844 1.4457 2.2399 -0.2892 0.1826  0.0470  198  ALA A O   
1332 C CB  . ALA A 164 ? 1.7257 1.4720 2.2666 -0.2998 0.0794  0.0210  198  ALA A CB  
1333 N N   . PHE A 165 ? 1.7414 1.3360 2.0125 -0.2741 0.1481  0.0139  199  PHE A N   
1334 C CA  . PHE A 165 ? 1.7811 1.3342 1.9999 -0.2634 0.2045  0.0261  199  PHE A CA  
1335 C C   . PHE A 165 ? 1.7866 1.3437 2.0128 -0.2458 0.2454  0.0222  199  PHE A C   
1336 O O   . PHE A 165 ? 1.8054 1.3872 2.0534 -0.2411 0.2237  0.0053  199  PHE A O   
1337 C CB  . PHE A 165 ? 1.8489 1.3469 1.9402 -0.2545 0.1952  0.0137  199  PHE A CB  
1338 C CG  . PHE A 165 ? 1.8947 1.3845 1.9716 -0.2689 0.1547  0.0157  199  PHE A CG  
1339 C CD1 . PHE A 165 ? 1.9148 1.4185 2.0654 -0.2866 0.1561  0.0375  199  PHE A CD1 
1340 C CD2 . PHE A 165 ? 1.8260 1.2926 1.8189 -0.2641 0.1143  -0.0034 199  PHE A CD2 
1341 C CE1 . PHE A 165 ? 1.8667 1.3578 2.0034 -0.2983 0.1179  0.0368  199  PHE A CE1 
1342 C CE2 . PHE A 165 ? 1.8077 1.2648 1.7866 -0.2746 0.0791  -0.0017 199  PHE A CE2 
1343 C CZ  . PHE A 165 ? 1.8413 1.3088 1.8898 -0.2912 0.0809  0.0167  199  PHE A CZ  
1344 N N   . PRO A 166 ? 1.6935 1.2276 1.9049 -0.2343 0.3058  0.0391  200  PRO A N   
1345 C CA  . PRO A 166 ? 1.7295 1.2567 1.9303 -0.2125 0.3476  0.0319  200  PRO A CA  
1346 C C   . PRO A 166 ? 1.7592 1.2492 1.8550 -0.1966 0.3247  -0.0027 200  PRO A C   
1347 O O   . PRO A 166 ? 1.8472 1.2868 1.8330 -0.1883 0.3240  -0.0117 200  PRO A O   
1348 C CB  . PRO A 166 ? 1.7915 1.2899 1.9657 -0.1996 0.4146  0.0570  200  PRO A CB  
1349 C CG  . PRO A 166 ? 1.7543 1.2730 1.9963 -0.2221 0.4102  0.0880  200  PRO A CG  
1350 C CD  . PRO A 166 ? 1.6710 1.1901 1.8906 -0.2399 0.3412  0.0697  200  PRO A CD  
1351 N N   . PRO A 167 ? 1.6143 1.1284 1.7450 -0.1923 0.3042  -0.0206 201  PRO A N   
1352 C CA  . PRO A 167 ? 1.5226 1.0055 1.5682 -0.1808 0.2714  -0.0518 201  PRO A CA  
1353 C C   . PRO A 167 ? 1.6452 1.0626 1.5769 -0.1573 0.3057  -0.0665 201  PRO A C   
1354 O O   . PRO A 167 ? 1.5760 0.9561 1.4186 -0.1509 0.2737  -0.0896 201  PRO A O   
1355 C CB  . PRO A 167 ? 1.4048 0.9316 1.5339 -0.1796 0.2560  -0.0601 201  PRO A CB  
1356 C CG  . PRO A 167 ? 1.3827 0.9708 1.6365 -0.1966 0.2595  -0.0349 201  PRO A CG  
1357 C CD  . PRO A 167 ? 1.5002 1.0734 1.7563 -0.1988 0.3069  -0.0103 201  PRO A CD  
1358 N N   . GLU A 168 ? 1.7458 1.1483 1.6770 -0.1425 0.3688  -0.0533 202  GLU A N   
1359 C CA  . GLU A 168 ? 1.9708 1.3077 1.7810 -0.1168 0.4028  -0.0673 202  GLU A CA  
1360 C C   . GLU A 168 ? 2.1234 1.4208 1.8327 -0.1205 0.3872  -0.0654 202  GLU A C   
1361 O O   . GLU A 168 ? 2.1756 1.4250 1.7776 -0.1104 0.3634  -0.0900 202  GLU A O   
1362 C CB  . GLU A 168 ? 2.2045 1.5385 2.0374 -0.0979 0.4783  -0.0468 202  GLU A CB  
1363 C CG  . GLU A 168 ? 2.4099 1.7755 2.3330 -0.0890 0.5014  -0.0490 202  GLU A CG  
1364 C CD  . GLU A 168 ? 2.4503 1.8903 2.5244 -0.1135 0.4924  -0.0215 202  GLU A CD  
1365 O OE1 . GLU A 168 ? 2.4071 1.8702 2.5136 -0.1366 0.4700  -0.0022 202  GLU A OE1 
1366 O OE2 . GLU A 168 ? 2.4692 1.9429 2.6296 -0.1094 0.5062  -0.0197 202  GLU A OE2 
1367 N N   . LYS A 169 ? 2.2115 1.5286 1.9587 -0.1360 0.3977  -0.0351 203  LYS A N   
1368 C CA  . LYS A 169 ? 2.1716 1.4575 1.8403 -0.1417 0.3849  -0.0272 203  LYS A CA  
1369 C C   . LYS A 169 ? 2.0451 1.3630 1.7639 -0.1690 0.3272  -0.0235 203  LYS A C   
1370 O O   . LYS A 169 ? 2.0876 1.4066 1.8142 -0.1819 0.3265  -0.0019 203  LYS A O   
1371 C CB  . LYS A 169 ? 2.3369 1.6141 2.0044 -0.1353 0.4450  0.0072  203  LYS A CB  
1372 C CG  . LYS A 169 ? 2.5608 1.8022 2.1627 -0.1027 0.5075  0.0059  203  LYS A CG  
1373 C CD  . LYS A 169 ? 2.7646 2.0035 2.3708 -0.0952 0.5683  0.0472  203  LYS A CD  
1374 C CE  . LYS A 169 ? 2.9490 2.1508 2.4780 -0.0571 0.6344  0.0471  203  LYS A CE  
1375 N NZ  . LYS A 169 ? 3.0108 2.2132 2.5430 -0.0466 0.6971  0.0929  203  LYS A NZ  
1376 N N   . TYR A 170 ? 1.8436 1.1885 1.5996 -0.1764 0.2790  -0.0433 204  TYR A N   
1377 C CA  . TYR A 170 ? 1.7619 1.1389 1.5629 -0.1976 0.2252  -0.0409 204  TYR A CA  
1378 C C   . TYR A 170 ? 1.8825 1.2209 1.5891 -0.2000 0.1979  -0.0435 204  TYR A C   
1379 O O   . TYR A 170 ? 1.9874 1.3284 1.7083 -0.2130 0.1938  -0.0255 204  TYR A O   
1380 C CB  . TYR A 170 ? 1.6191 1.0311 1.4658 -0.1995 0.1818  -0.0598 204  TYR A CB  
1381 C CG  . TYR A 170 ? 1.5170 0.9713 1.4231 -0.2174 0.1316  -0.0556 204  TYR A CG  
1382 C CD1 . TYR A 170 ? 1.4595 0.8991 1.3062 -0.2202 0.0858  -0.0637 204  TYR A CD1 
1383 C CD2 . TYR A 170 ? 1.4733 0.9820 1.4933 -0.2297 0.1295  -0.0433 204  TYR A CD2 
1384 C CE1 . TYR A 170 ? 1.4144 0.8906 1.3090 -0.2319 0.0422  -0.0609 204  TYR A CE1 
1385 C CE2 . TYR A 170 ? 1.4570 1.0014 1.5230 -0.2429 0.0824  -0.0421 204  TYR A CE2 
1386 C CZ  . TYR A 170 ? 1.4123 0.9396 1.4131 -0.2426 0.0402  -0.0517 204  TYR A CZ  
1387 O OH  . TYR A 170 ? 1.2519 0.8130 1.2931 -0.2514 -0.0045 -0.0515 204  TYR A OH  
1388 N N   . ALA A 171 ? 1.8946 1.1949 1.5061 -0.1875 0.1787  -0.0649 205  ALA A N   
1389 C CA  . ALA A 171 ? 1.8938 1.1612 1.4194 -0.1898 0.1458  -0.0674 205  ALA A CA  
1390 C C   . ALA A 171 ? 1.8786 1.1213 1.3695 -0.1927 0.1763  -0.0442 205  ALA A C   
1391 O O   . ALA A 171 ? 2.0245 1.2726 1.5244 -0.2061 0.1518  -0.0327 205  ALA A O   
1392 C CB  . ALA A 171 ? 2.0605 1.2827 1.4850 -0.1738 0.1320  -0.0905 205  ALA A CB  
1393 N N   . GLN A 172 ? 1.8842 1.1005 1.3386 -0.1785 0.2316  -0.0356 206  GLN A N   
1394 C CA  . GLN A 172 ? 1.9149 1.1126 1.3462 -0.1792 0.2678  -0.0075 206  GLN A CA  
1395 C C   . GLN A 172 ? 1.9021 1.1388 1.4363 -0.2021 0.2581  0.0156  206  GLN A C   
1396 O O   . GLN A 172 ? 1.9736 1.1999 1.4898 -0.2130 0.2346  0.0254  206  GLN A O   
1397 C CB  . GLN A 172 ? 2.0589 1.2423 1.4756 -0.1596 0.3358  0.0044  206  GLN A CB  
1398 C CG  . GLN A 172 ? 2.2985 1.4337 1.6005 -0.1335 0.3481  -0.0206 206  GLN A CG  
1399 C CD  . GLN A 172 ? 2.4067 1.5539 1.7382 -0.1267 0.3341  -0.0500 206  GLN A CD  
1400 O OE1 . GLN A 172 ? 2.3827 1.5756 1.8103 -0.1427 0.3042  -0.0539 206  GLN A OE1 
1401 N NE2 . GLN A 172 ? 2.5370 1.6419 1.7843 -0.1015 0.3551  -0.0709 206  GLN A NE2 
1402 N N   . TRP A 173 ? 1.7787 1.0598 1.4240 -0.2096 0.2718  0.0228  207  TRP A N   
1403 C CA  . TRP A 173 ? 1.7254 1.0432 1.4748 -0.2321 0.2570  0.0418  207  TRP A CA  
1404 C C   . TRP A 173 ? 1.6784 0.9984 1.4166 -0.2450 0.1943  0.0289  207  TRP A C   
1405 O O   . TRP A 173 ? 1.7601 1.0708 1.5045 -0.2567 0.1839  0.0441  207  TRP A O   
1406 C CB  . TRP A 173 ? 1.7215 1.0903 1.5879 -0.2385 0.2641  0.0437  207  TRP A CB  
1407 C CG  . TRP A 173 ? 1.8576 1.2349 1.7761 -0.2331 0.3274  0.0720  207  TRP A CG  
1408 C CD1 . TRP A 173 ? 1.9722 1.3398 1.8660 -0.2114 0.3765  0.0710  207  TRP A CD1 
1409 C CD2 . TRP A 173 ? 1.9144 1.3112 1.9216 -0.2481 0.3495  0.1078  207  TRP A CD2 
1410 N NE1 . TRP A 173 ? 2.0349 1.4180 1.9963 -0.2102 0.4313  0.1064  207  TRP A NE1 
1411 C CE2 . TRP A 173 ? 1.9979 1.4003 2.0337 -0.2338 0.4149  0.1310  207  TRP A CE2 
1412 C CE3 . TRP A 173 ? 1.8082 1.2167 1.8759 -0.2714 0.3193  0.1227  207  TRP A CE3 
1413 C CZ2 . TRP A 173 ? 1.9927 1.4165 2.1219 -0.2433 0.4514  0.1728  207  TRP A CZ2 
1414 C CZ3 . TRP A 173 ? 1.7823 1.2079 1.9423 -0.2824 0.3518  0.1610  207  TRP A CZ3 
1415 C CH2 . TRP A 173 ? 1.8492 1.2846 2.0424 -0.2690 0.4174  0.1878  207  TRP A CH2 
1416 N N   . ALA A 174 ? 1.7796 1.1099 1.4992 -0.2411 0.1534  0.0023  208  ALA A N   
1417 C CA  . ALA A 174 ? 1.7566 1.0904 1.4612 -0.2487 0.0967  -0.0080 208  ALA A CA  
1418 C C   . ALA A 174 ? 1.8884 1.1778 1.5104 -0.2482 0.0941  0.0014  208  ALA A C   
1419 O O   . ALA A 174 ? 2.0197 1.3098 1.6690 -0.2605 0.0783  0.0130  208  ALA A O   
1420 C CB  . ALA A 174 ? 1.7794 1.1226 1.4554 -0.2393 0.0606  -0.0325 208  ALA A CB  
1421 N N   . ALA A 175 ? 1.8994 1.1478 1.4212 -0.2337 0.1110  -0.0027 209  ALA A N   
1422 C CA  . ALA A 175 ? 1.9049 1.1113 1.3440 -0.2321 0.1107  0.0088  209  ALA A CA  
1423 C C   . ALA A 175 ? 1.9404 1.1467 1.4268 -0.2439 0.1361  0.0377  209  ALA A C   
1424 O O   . ALA A 175 ? 1.9408 1.1423 1.4350 -0.2544 0.1085  0.0448  209  ALA A O   
1425 C CB  . ALA A 175 ? 1.7642 0.9275 1.0970 -0.2138 0.1379  0.0045  209  ALA A CB  
1426 N N   . GLY A 176 ? 1.8767 1.0910 1.4065 -0.2422 0.1875  0.0555  210  GLY A N   
1427 C CA  . GLY A 176 ? 1.7796 0.9969 1.3679 -0.2538 0.2141  0.0880  210  GLY A CA  
1428 C C   . GLY A 176 ? 1.7684 1.0096 1.4410 -0.2747 0.1709  0.0878  210  GLY A C   
1429 O O   . GLY A 176 ? 1.9467 1.1681 1.6079 -0.2828 0.1551  0.0995  210  GLY A O   
1430 N N   . ILE A 177 ? 1.6214 0.9029 1.3726 -0.2818 0.1478  0.0723  211  ILE A N   
1431 C CA  . ILE A 177 ? 1.8358 1.1393 1.6669 -0.2998 0.1066  0.0706  211  ILE A CA  
1432 C C   . ILE A 177 ? 1.9257 1.2074 1.6945 -0.2987 0.0584  0.0557  211  ILE A C   
1433 O O   . ILE A 177 ? 2.0663 1.3368 1.8596 -0.3098 0.0383  0.0638  211  ILE A O   
1434 C CB  . ILE A 177 ? 1.5070 0.8590 1.4226 -0.3045 0.0885  0.0558  211  ILE A CB  
1435 C CG1 . ILE A 177 ? 1.5205 0.8941 1.5106 -0.3070 0.1388  0.0770  211  ILE A CG1 
1436 C CG2 . ILE A 177 ? 1.4834 0.8543 1.4624 -0.3192 0.0377  0.0476  211  ILE A CG2 
1437 C CD1 . ILE A 177 ? 1.5483 0.9187 1.6089 -0.3223 0.1611  0.1103  211  ILE A CD1 
1438 N N   . ALA A 178 ? 1.9463 1.2184 1.6332 -0.2845 0.0408  0.0361  212  ALA A N   
1439 C CA  . ALA A 178 ? 1.9695 1.2214 1.5956 -0.2811 -0.0008 0.0268  212  ALA A CA  
1440 C C   . ALA A 178 ? 2.1698 1.3817 1.7572 -0.2849 0.0127  0.0485  212  ALA A C   
1441 O O   . ALA A 178 ? 2.2402 1.4444 1.8474 -0.2927 -0.0151 0.0509  212  ALA A O   
1442 C CB  . ALA A 178 ? 1.8569 1.1005 1.4005 -0.2654 -0.0148 0.0100  212  ALA A CB  
1443 N N   . LEU A 179 ? 2.1903 1.3764 1.7256 -0.2783 0.0570  0.0656  213  LEU A N   
1444 C CA  . LEU A 179 ? 2.1075 1.2592 1.6111 -0.2813 0.0741  0.0914  213  LEU A CA  
1445 C C   . LEU A 179 ? 2.1447 1.3059 1.7477 -0.2992 0.0774  0.1106  213  LEU A C   
1446 O O   . LEU A 179 ? 2.2940 1.4344 1.8967 -0.3060 0.0580  0.1198  213  LEU A O   
1447 C CB  . LEU A 179 ? 2.1140 1.2422 1.5516 -0.2689 0.1263  0.1090  213  LEU A CB  
1448 C CG  . LEU A 179 ? 2.0744 1.1820 1.4026 -0.2514 0.1185  0.0898  213  LEU A CG  
1449 C CD1 . LEU A 179 ? 2.1443 1.2235 1.3981 -0.2365 0.1693  0.1059  213  LEU A CD1 
1450 C CD2 . LEU A 179 ? 2.0456 1.1330 1.3123 -0.2505 0.0718  0.0818  213  LEU A CD2 
1451 N N   . MET A 180 ? 2.0849 1.2771 1.7789 -0.3073 0.0985  0.1168  214  MET A N   
1452 C CA  . MET A 180 ? 2.0823 1.2846 1.8812 -0.3265 0.0931  0.1338  214  MET A CA  
1453 C C   . MET A 180 ? 2.0097 1.2132 1.8320 -0.3346 0.0319  0.1110  214  MET A C   
1454 O O   . MET A 180 ? 2.0138 1.1958 1.8602 -0.3447 0.0163  0.1220  214  MET A O   
1455 C CB  . MET A 180 ? 2.1433 1.3839 2.0412 -0.3339 0.1185  0.1423  214  MET A CB  
1456 C CG  . MET A 180 ? 2.4256 1.6638 2.3081 -0.3234 0.1847  0.1698  214  MET A CG  
1457 S SD  . MET A 180 ? 2.7438 1.9473 2.6100 -0.3250 0.2236  0.2154  214  MET A SD  
1458 C CE  . MET A 180 ? 2.7273 1.9502 2.7478 -0.3533 0.2051  0.2368  214  MET A CE  
1459 N N   . LYS A 181 ? 1.8348 1.0616 1.6462 -0.3279 -0.0030 0.0798  215  LYS A N   
1460 C CA  . LYS A 181 ? 1.9441 1.1716 1.7632 -0.3294 -0.0592 0.0578  215  LYS A CA  
1461 C C   . LYS A 181 ? 1.9989 1.1847 1.7437 -0.3236 -0.0743 0.0616  215  LYS A C   
1462 O O   . LYS A 181 ? 2.0241 1.1956 1.7918 -0.3289 -0.1074 0.0564  215  LYS A O   
1463 C CB  . LYS A 181 ? 2.0112 1.2705 1.8129 -0.3176 -0.0883 0.0291  215  LYS A CB  
1464 C CG  . LYS A 181 ? 2.0877 1.3926 1.9785 -0.3246 -0.0918 0.0210  215  LYS A CG  
1465 C CD  . LYS A 181 ? 2.1609 1.4965 2.0289 -0.3108 -0.1224 -0.0039 215  LYS A CD  
1466 C CE  . LYS A 181 ? 2.1348 1.5184 2.0833 -0.3153 -0.1191 -0.0092 215  LYS A CE  
1467 N NZ  . LYS A 181 ? 1.9710 1.3859 1.8965 -0.3003 -0.1427 -0.0284 215  LYS A NZ  
1468 N N   . ASN A 182 ? 2.0412 1.2053 1.6957 -0.3118 -0.0519 0.0701  216  ASN A N   
1469 C CA  . ASN A 182 ? 2.0650 1.1907 1.6507 -0.3066 -0.0640 0.0781  216  ASN A CA  
1470 C C   . ASN A 182 ? 2.1307 1.2299 1.7538 -0.3194 -0.0449 0.1066  216  ASN A C   
1471 O O   . ASN A 182 ? 2.2198 1.2941 1.8387 -0.3215 -0.0706 0.1082  216  ASN A O   
1472 C CB  . ASN A 182 ? 2.0658 1.1749 1.5483 -0.2920 -0.0462 0.0820  216  ASN A CB  
1473 C CG  . ASN A 182 ? 2.0224 1.1441 1.4565 -0.2788 -0.0826 0.0572  216  ASN A CG  
1474 O OD1 . ASN A 182 ? 1.9816 1.1091 1.4267 -0.2760 -0.1229 0.0442  216  ASN A OD1 
1475 N ND2 . ASN A 182 ? 2.0269 1.1526 1.4090 -0.2691 -0.0689 0.0514  216  ASN A ND2 
1476 N N   . ILE A 183 ? 2.0513 1.1561 1.7157 -0.3269 0.0008  0.1313  217  ILE A N   
1477 C CA  . ILE A 183 ? 2.0267 1.1078 1.7256 -0.3375 0.0245  0.1659  217  ILE A CA  
1478 C C   . ILE A 183 ? 2.0363 1.1230 1.8467 -0.3564 -0.0023 0.1652  217  ILE A C   
1479 O O   . ILE A 183 ? 2.1130 1.1716 1.9358 -0.3626 -0.0256 0.1702  217  ILE A O   
1480 C CB  . ILE A 183 ? 1.9578 1.0444 1.6576 -0.3349 0.0869  0.1974  217  ILE A CB  
1481 C CG1 . ILE A 183 ? 1.8668 0.9347 1.4425 -0.3151 0.1084  0.1983  217  ILE A CG1 
1482 C CG2 . ILE A 183 ? 1.9924 1.0648 1.7552 -0.3474 0.1129  0.2385  217  ILE A CG2 
1483 C CD1 . ILE A 183 ? 1.9720 1.0400 1.5301 -0.3067 0.1705  0.2276  217  ILE A CD1 
1484 N N   . LEU A 184 ? 1.9355 1.0571 1.8301 -0.3657 -0.0011 0.1587  218  LEU A N   
1485 C CA  . LEU A 184 ? 1.9244 1.0514 1.9289 -0.3849 -0.0305 0.1573  218  LEU A CA  
1486 C C   . LEU A 184 ? 1.8803 1.0032 1.8771 -0.3823 -0.0935 0.1181  218  LEU A C   
1487 O O   . LEU A 184 ? 1.8907 1.0051 1.9612 -0.3960 -0.1267 0.1125  218  LEU A O   
1488 C CB  . LEU A 184 ? 1.9167 1.0848 2.0155 -0.3955 -0.0109 0.1647  218  LEU A CB  
1489 C CG  . LEU A 184 ? 1.9452 1.1214 2.0724 -0.3971 0.0545  0.2076  218  LEU A CG  
1490 C CD1 . LEU A 184 ? 1.9781 1.1966 2.2122 -0.4082 0.0673  0.2149  218  LEU A CD1 
1491 C CD2 . LEU A 184 ? 1.9681 1.1144 2.1284 -0.4075 0.0703  0.2456  218  LEU A CD2 
1492 N N   . GLY A 185 ? 1.8792 1.0072 1.7900 -0.3640 -0.1115 0.0921  219  GLY A N   
1493 C CA  . GLY A 185 ? 1.8811 1.0119 1.7833 -0.3568 -0.1668 0.0573  219  GLY A CA  
1494 C C   . GLY A 185 ? 1.9300 1.0237 1.7549 -0.3438 -0.1895 0.0513  219  GLY A C   
1495 O O   . GLY A 185 ? 2.0353 1.1161 1.8691 -0.3403 -0.2331 0.0301  219  GLY A O   
1496 N N   . PHE A 186 ? 1.9689 1.0444 1.7147 -0.3349 -0.1613 0.0692  220  PHE A N   
1497 C CA  . PHE A 186 ? 2.0478 1.0893 1.7216 -0.3226 -0.1803 0.0684  220  PHE A CA  
1498 C C   . PHE A 186 ? 2.0768 1.0814 1.7331 -0.3288 -0.1504 0.1029  220  PHE A C   
1499 O O   . PHE A 186 ? 2.0432 1.0151 1.7101 -0.3312 -0.1695 0.1072  220  PHE A O   
1500 C CB  . PHE A 186 ? 2.0585 1.1133 1.6429 -0.3026 -0.1863 0.0562  220  PHE A CB  
1501 C CG  . PHE A 186 ? 2.1693 1.1991 1.6911 -0.2873 -0.2156 0.0510  220  PHE A CG  
1502 C CD1 . PHE A 186 ? 2.1724 1.2031 1.7105 -0.2783 -0.2587 0.0267  220  PHE A CD1 
1503 C CD2 . PHE A 186 ? 2.2102 1.2157 1.6553 -0.2801 -0.2000 0.0711  220  PHE A CD2 
1504 C CE1 . PHE A 186 ? 2.2137 1.2221 1.6953 -0.2611 -0.2824 0.0240  220  PHE A CE1 
1505 C CE2 . PHE A 186 ? 2.2333 1.2179 1.6262 -0.2656 -0.2261 0.0697  220  PHE A CE2 
1506 C CZ  . PHE A 186 ? 2.2871 1.2735 1.6998 -0.2555 -0.2657 0.0468  220  PHE A CZ  
1507 N N   . ILE A 187 ? 1.5822 0.9691 1.7874 -0.4509 -0.0617 0.0472  221  ILE A N   
1508 C CA  . ILE A 187 ? 1.6442 0.9894 1.8636 -0.4449 -0.0404 0.1134  221  ILE A CA  
1509 C C   . ILE A 187 ? 1.7097 0.9729 1.9474 -0.4461 0.0125  0.0865  221  ILE A C   
1510 O O   . ILE A 187 ? 1.6473 0.8848 1.9443 -0.4374 0.0183  0.1244  221  ILE A O   
1511 C CB  . ILE A 187 ? 1.5130 0.8794 1.6727 -0.4329 -0.0680 0.1498  221  ILE A CB  
1512 C CG1 . ILE A 187 ? 1.5370 0.9635 1.6091 -0.4412 -0.1413 0.1932  221  ILE A CG1 
1513 C CG2 . ILE A 187 ? 1.3845 0.7104 1.5647 -0.4200 -0.0333 0.2022  221  ILE A CG2 
1514 C CD1 . ILE A 187 ? 1.5686 1.0184 1.6580 -0.4497 -0.1544 0.2575  221  ILE A CD1 
1515 N N   . ILE A 188 ? 1.7423 0.9836 1.9292 -0.4469 0.0277  0.0346  222  ILE A N   
1516 C CA  . ILE A 188 ? 1.9086 1.0815 2.0980 -0.4465 0.0162  0.0366  222  ILE A CA  
1517 C C   . ILE A 188 ? 2.0468 1.2239 2.3384 -0.4279 0.0175  0.0097  222  ILE A C   
1518 O O   . ILE A 188 ? 2.0094 1.1695 2.4063 -0.4013 0.0510  0.0259  222  ILE A O   
1519 C CB  . ILE A 188 ? 1.8595 1.0360 1.9788 -0.4429 0.0007  0.0047  222  ILE A CB  
1520 C CG1 . ILE A 188 ? 1.7782 0.9855 1.8694 -0.4343 0.0473  0.0112  222  ILE A CG1 
1521 C CG2 . ILE A 188 ? 1.9657 1.0975 2.1638 -0.4305 0.0045  0.0005  222  ILE A CG2 
1522 C CD1 . ILE A 188 ? 1.7164 0.9251 1.7578 -0.4328 0.0487  -0.0181 222  ILE A CD1 
1523 N N   . PRO A 189 ? 2.1622 1.3639 2.4315 -0.4353 -0.0029 -0.0367 223  PRO A N   
1524 C CA  . PRO A 189 ? 2.1413 1.3512 2.5178 -0.4111 0.0212  -0.0718 223  PRO A CA  
1525 C C   . PRO A 189 ? 2.1062 1.3229 2.5837 -0.4012 0.0477  -0.0311 223  PRO A C   
1526 O O   . PRO A 189 ? 2.1184 1.3175 2.7039 -0.3714 0.0886  -0.0422 223  PRO A O   
1527 C CB  . PRO A 189 ? 2.1883 1.4331 2.4983 -0.4235 -0.0134 -0.1190 223  PRO A CB  
1528 C CG  . PRO A 189 ? 2.1795 1.4231 2.3609 -0.4400 -0.0546 -0.1142 223  PRO A CG  
1529 C CD  . PRO A 189 ? 2.1940 1.4340 2.3432 -0.4510 -0.0373 -0.0649 223  PRO A CD  
1530 N N   . LEU A 190 ? 2.0672 1.3119 2.5127 -0.4231 0.0265  0.0205  224  LEU A N   
1531 C CA  . LEU A 190 ? 1.9385 1.2015 2.4842 -0.4096 0.0440  0.0810  224  LEU A CA  
1532 C C   . LEU A 190 ? 1.8321 1.0592 2.4434 -0.3772 0.0822  0.1294  224  LEU A C   
1533 O O   . LEU A 190 ? 1.8089 1.0289 2.5310 -0.3473 0.1192  0.1491  224  LEU A O   
1534 C CB  . LEU A 190 ? 1.9077 1.2243 2.3948 -0.4362 0.0029  0.1440  224  LEU A CB  
1535 C CG  . LEU A 190 ? 1.9312 1.2846 2.4976 -0.4217 0.0075  0.2363  224  LEU A CG  
1536 C CD1 . LEU A 190 ? 1.9061 1.3060 2.5491 -0.4075 0.0193  0.2128  224  LEU A CD1 
1537 C CD2 . LEU A 190 ? 1.9099 1.3228 2.3778 -0.4406 -0.0421 0.3102  224  LEU A CD2 
1538 N N   . ILE A 191 ? 1.8166 1.0219 2.3583 -0.3816 0.0757  0.1478  225  ILE A N   
1539 C CA  . ILE A 191 ? 1.7173 0.8940 2.3111 -0.3538 0.1070  0.1893  225  ILE A CA  
1540 C C   . ILE A 191 ? 1.6953 0.8350 2.3783 -0.3269 0.1467  0.1396  225  ILE A C   
1541 O O   . ILE A 191 ? 1.7953 0.9191 2.5731 -0.2956 0.1836  0.1661  225  ILE A O   
1542 C CB  . ILE A 191 ? 1.6461 0.8100 2.1437 -0.3674 0.0907  0.2075  225  ILE A CB  
1543 C CG1 . ILE A 191 ? 1.6619 0.8630 2.0755 -0.3839 0.0623  0.2575  225  ILE A CG1 
1544 C CG2 . ILE A 191 ? 1.6171 0.7542 2.1688 -0.3417 0.1204  0.2406  225  ILE A CG2 
1545 C CD1 . ILE A 191 ? 1.4883 0.6776 1.8074 -0.3924 0.0560  0.2612  225  ILE A CD1 
1546 N N   . PHE A 192 ? 1.7074 0.8357 2.3553 -0.3364 0.1391  0.0688  226  PHE A N   
1547 C CA  . PHE A 192 ? 1.7574 0.8566 2.4770 -0.3124 0.1738  0.0203  226  PHE A CA  
1548 C C   . PHE A 192 ? 1.8494 0.9474 2.6692 -0.2874 0.2052  0.0035  226  PHE A C   
1549 O O   . PHE A 192 ? 2.0074 1.0745 2.9130 -0.2572 0.2444  0.0121  226  PHE A O   
1550 C CB  . PHE A 192 ? 1.7340 0.8381 2.3902 -0.3263 0.1539  -0.0462 226  PHE A CB  
1551 C CG  . PHE A 192 ? 1.7507 0.8372 2.3608 -0.3342 0.1468  -0.0409 226  PHE A CG  
1552 C CD1 . PHE A 192 ? 1.8344 0.8908 2.5046 -0.3175 0.1781  -0.0505 226  PHE A CD1 
1553 C CD2 . PHE A 192 ? 1.8008 0.9000 2.3066 -0.3595 0.1082  -0.0266 226  PHE A CD2 
1554 C CE1 . PHE A 192 ? 1.9179 0.9616 2.5523 -0.3273 0.1716  -0.0446 226  PHE A CE1 
1555 C CE2 . PHE A 192 ? 1.7553 0.8400 2.2259 -0.3659 0.1029  -0.0221 226  PHE A CE2 
1556 C CZ  . PHE A 192 ? 1.8331 0.8926 2.3715 -0.3504 0.1349  -0.0307 226  PHE A CZ  
1557 N N   . ILE A 193 ? 1.8168 0.9475 2.6250 -0.2995 0.1879  -0.0215 227  ILE A N   
1558 C CA  . ILE A 193 ? 1.8531 0.9849 2.7553 -0.2761 0.2172  -0.0469 227  ILE A CA  
1559 C C   . ILE A 193 ? 1.8904 1.0128 2.8800 -0.2501 0.2459  0.0280  227  ILE A C   
1560 O O   . ILE A 193 ? 2.0690 1.1633 3.1522 -0.2127 0.2870  0.0189  227  ILE A O   
1561 C CB  . ILE A 193 ? 1.8277 1.0061 2.6927 -0.3003 0.1868  -0.0860 227  ILE A CB  
1562 C CG1 . ILE A 193 ? 1.7975 0.9885 2.5710 -0.3160 0.1599  -0.1549 227  ILE A CG1 
1563 C CG2 . ILE A 193 ? 1.8330 1.0156 2.8003 -0.2762 0.2176  -0.1117 227  ILE A CG2 
1564 C CD1 . ILE A 193 ? 1.6969 0.9395 2.4058 -0.3422 0.1207  -0.1871 227  ILE A CD1 
1565 N N   . ALA A 194 ? 1.7905 0.9393 2.7429 -0.2656 0.2230  0.1074  228  ALA A N   
1566 C CA  . ALA A 194 ? 1.7902 0.9461 2.8126 -0.2380 0.2455  0.1937  228  ALA A CA  
1567 C C   . ALA A 194 ? 1.8819 0.9903 2.9531 -0.2022 0.2829  0.2107  228  ALA A C   
1568 O O   . ALA A 194 ? 1.9794 1.0677 3.1427 -0.1612 0.3216  0.2309  228  ALA A O   
1569 C CB  . ALA A 194 ? 1.8418 1.0508 2.7903 -0.2635 0.2047  0.2770  228  ALA A CB  
1570 N N   . THR A 195 ? 1.8613 0.9516 2.8707 -0.2166 0.2710  0.2038  229  THR A N   
1571 C CA  . THR A 195 ? 2.0036 1.0531 3.0574 -0.1902 0.3020  0.2186  229  THR A CA  
1572 C C   . THR A 195 ? 2.0359 1.0423 3.1646 -0.1643 0.3383  0.1551  229  THR A C   
1573 O O   . THR A 195 ? 2.0945 1.0702 3.2968 -0.1287 0.3728  0.1772  229  THR A O   
1574 C CB  . THR A 195 ? 1.9972 1.0382 2.9721 -0.2146 0.2809  0.2169  229  THR A CB  
1575 O OG1 . THR A 195 ? 2.0310 1.0695 2.9512 -0.2400 0.2618  0.1446  229  THR A OG1 
1576 C CG2 . THR A 195 ? 1.8800 0.9590 2.7777 -0.2335 0.2476  0.2821  229  THR A CG2 
1577 N N   . CYS A 196 ? 1.9860 0.9926 3.0895 -0.1804 0.3285  0.0762  230  CYS A N   
1578 C CA  . CYS A 196 ? 1.9668 0.9400 3.1275 -0.1571 0.3576  0.0131  230  CYS A CA  
1579 C C   . CYS A 196 ? 1.9821 0.9475 3.2316 -0.1174 0.3884  0.0214  230  CYS A C   
1580 O O   . CYS A 196 ? 2.0273 0.9524 3.3404 -0.0819 0.4215  0.0143  230  CYS A O   
1581 C CB  . CYS A 196 ? 1.9397 0.9307 3.0451 -0.1813 0.3359  -0.0668 230  CYS A CB  
1582 S SG  . CYS A 196 ? 1.9431 0.9261 2.9697 -0.2096 0.3147  -0.0881 230  CYS A SG  
1583 N N   . TYR A 197 ? 1.9510 0.9542 3.2040 -0.1220 0.3765  0.0394  231  TYR A N   
1584 C CA  . TYR A 197 ? 2.0367 1.0358 3.3774 -0.0784 0.4063  0.0549  231  TYR A CA  
1585 C C   . TYR A 197 ? 2.1330 1.1116 3.5290 -0.0377 0.4340  0.1364  231  TYR A C   
1586 O O   . TYR A 197 ? 2.1616 1.1092 3.6287 0.0134  0.4692  0.1290  231  TYR A O   
1587 C CB  . TYR A 197 ? 1.7665 0.8454 3.0764 -0.0936 0.3772  0.0757  231  TYR A CB  
1588 C CG  . TYR A 197 ? 1.7859 0.9463 3.1217 -0.0399 0.3871  0.1271  231  TYR A CG  
1589 C CD1 . TYR A 197 ? 2.0296 1.2048 3.4125 0.0073  0.4113  0.0753  231  TYR A CD1 
1590 C CD2 . TYR A 197 ? 1.7712 0.9947 3.0842 -0.0346 0.3725  0.2278  231  TYR A CD2 
1591 C CE1 . TYR A 197 ? 1.8413 1.0971 3.2481 0.0600  0.4211  0.1224  231  TYR A CE1 
1592 C CE2 . TYR A 197 ? 1.7891 1.0931 3.1272 0.0152  0.3819  0.2766  231  TYR A CE2 
1593 C CZ  . TYR A 197 ? 1.8238 1.1459 3.2090 0.0633  0.4066  0.2236  231  TYR A CZ  
1594 O OH  . TYR A 197 ? 1.8428 1.2518 3.2522 0.1160  0.4164  0.2722  231  TYR A OH  
1595 N N   . PHE A 198 ? 2.0854 1.0869 3.4408 -0.0568 0.4156  0.2136  232  PHE A N   
1596 C CA  . PHE A 198 ? 2.1214 1.1163 3.5190 -0.0200 0.4374  0.2942  232  PHE A CA  
1597 C C   . PHE A 198 ? 2.1450 1.0790 3.5770 0.0039  0.4661  0.2626  232  PHE A C   
1598 O O   . PHE A 198 ? 2.2850 1.1943 3.7840 0.0536  0.4981  0.2841  232  PHE A O   
1599 C CB  . PHE A 198 ? 2.0567 1.0949 3.3853 -0.0497 0.4061  0.3700  232  PHE A CB  
1600 C CG  . PHE A 198 ? 1.9324 1.0400 3.2466 -0.0540 0.3852  0.4457  232  PHE A CG  
1601 C CD1 . PHE A 198 ? 1.9666 1.1026 3.3321 -0.0108 0.4039  0.5286  232  PHE A CD1 
1602 C CD2 . PHE A 198 ? 1.8291 0.9817 3.0704 -0.1017 0.3431  0.4379  232  PHE A CD2 
1603 C CE1 . PHE A 198 ? 1.9115 1.1634 3.2238 -0.0142 0.3707  0.5887  232  PHE A CE1 
1604 C CE2 . PHE A 198 ? 1.7556 1.0110 2.9471 -0.1073 0.3098  0.5002  232  PHE A CE2 
1605 C CZ  . PHE A 198 ? 1.8042 1.1160 3.0279 -0.0641 0.3225  0.5746  232  PHE A CZ  
1606 N N   . GLY A 199 ? 2.1865 1.0980 3.5693 -0.0300 0.4529  0.2141  233  GLY A N   
1607 C CA  . GLY A 199 ? 2.4006 1.2561 3.8104 -0.0154 0.4748  0.1887  233  GLY A CA  
1608 C C   . GLY A 199 ? 2.5354 1.3536 4.0018 0.0196  0.5016  0.1296  233  GLY A C   
1609 O O   . GLY A 199 ? 2.2060 0.9821 3.7221 0.0571  0.5281  0.1423  233  GLY A O   
1610 N N   . ILE A 200 ? 2.3963 1.2312 3.8486 0.0086  0.4924  0.0625  234  ILE A N   
1611 C CA  . ILE A 200 ? 2.4763 1.2841 3.9702 0.0422  0.5134  -0.0005 234  ILE A CA  
1612 C C   . ILE A 200 ? 2.5575 1.3617 4.1224 0.1035  0.5422  0.0394  234  ILE A C   
1613 O O   . ILE A 200 ? 2.7425 1.5039 4.3463 0.1449  0.5660  0.0232  234  ILE A O   
1614 C CB  . ILE A 200 ? 2.4008 1.2430 3.8607 0.0188  0.4946  -0.0747 234  ILE A CB  
1615 C CG1 . ILE A 200 ? 2.4171 1.2602 3.8068 -0.0295 0.4693  -0.1183 234  ILE A CG1 
1616 C CG2 . ILE A 200 ? 2.4179 1.2464 3.9190 0.0599  0.5149  -0.1338 234  ILE A CG2 
1617 C CD1 . ILE A 200 ? 2.3642 1.2504 3.7068 -0.0555 0.4455  -0.1835 234  ILE A CD1 
1618 N N   . ARG A 201 ? 2.3903 1.2416 3.9682 0.1126  0.5380  0.0973  235  ARG A N   
1619 C CA  . ARG A 201 ? 2.3902 1.2535 4.0342 0.1789  0.5642  0.1478  235  ARG A CA  
1620 C C   . ARG A 201 ? 2.4890 1.3165 4.1588 0.2086  0.5838  0.2045  235  ARG A C   
1621 O O   . ARG A 201 ? 2.6401 1.4503 4.3589 0.2694  0.6101  0.2075  235  ARG A O   
1622 C CB  . ARG A 201 ? 2.3352 1.2932 3.9566 0.1734  0.5422  0.2159  235  ARG A CB  
1623 C CG  . ARG A 201 ? 2.3838 1.4187 4.0311 0.2369  0.5542  0.2803  235  ARG A CG  
1624 C CD  . ARG A 201 ? 2.3772 1.5583 3.9621 0.2202  0.5170  0.3419  235  ARG A CD  
1625 N NE  . ARG A 201 ? 2.4108 1.5946 3.9619 0.1814  0.4975  0.4252  235  ARG A NE  
1626 C CZ  . ARG A 201 ? 2.4196 1.6122 3.9952 0.2099  0.5092  0.5144  235  ARG A CZ  
1627 N NH1 . ARG A 201 ? 2.3817 1.5758 3.9216 0.1716  0.4895  0.5862  235  ARG A NH1 
1628 N NH2 . ARG A 201 ? 2.5012 1.7003 4.1352 0.2785  0.5401  0.5312  235  ARG A NH2 
1629 N N   . LYS A 202 ? 2.4184 1.2393 4.0509 0.1683  0.5693  0.2472  236  LYS A N   
1630 C CA  . LYS A 202 ? 2.4823 1.2706 4.1354 0.1907  0.5850  0.2988  236  LYS A CA  
1631 C C   . LYS A 202 ? 2.5334 1.2482 4.2060 0.2094  0.6028  0.2389  236  LYS A C   
1632 O O   . LYS A 202 ? 2.4852 1.1710 4.2012 0.2628  0.6261  0.2557  236  LYS A O   
1633 C CB  . LYS A 202 ? 2.4426 1.2460 4.0430 0.1409  0.5618  0.3433  236  LYS A CB  
1634 C CG  . LYS A 202 ? 2.5595 1.3156 4.1641 0.1422  0.5711  0.3633  236  LYS A CG  
1635 C CD  . LYS A 202 ? 2.5565 1.3402 4.1011 0.0941  0.5445  0.3983  236  LYS A CD  
1636 C CE  . LYS A 202 ? 2.7406 1.4747 4.2843 0.0870  0.5505  0.4037  236  LYS A CE  
1637 N NZ  . LYS A 202 ? 2.7391 1.5036 4.2208 0.0446  0.5240  0.4324  236  LYS A NZ  
1638 N N   . HIS A 203 ? 2.5681 1.2550 4.2032 0.1672  0.5891  0.1702  237  HIS A N   
1639 C CA  . HIS A 203 ? 2.6811 1.2982 4.3246 0.1777  0.5998  0.1185  237  HIS A CA  
1640 C C   . HIS A 203 ? 2.7356 1.3350 4.4163 0.2329  0.6187  0.0767  237  HIS A C   
1641 O O   . HIS A 203 ? 2.8426 1.3884 4.5502 0.2738  0.6358  0.0798  237  HIS A O   
1642 C CB  . HIS A 203 ? 2.4666 1.0735 4.0593 0.1241  0.5787  0.0558  237  HIS A CB  
1643 C CG  . HIS A 203 ? 2.4818 1.1009 4.0336 0.0774  0.5604  0.0903  237  HIS A CG  
1644 N ND1 . HIS A 203 ? 2.5586 1.1427 4.1191 0.0789  0.5667  0.1377  237  HIS A ND1 
1645 C CD2 . HIS A 203 ? 2.4816 1.1449 3.9785 0.0307  0.5344  0.0823  237  HIS A CD2 
1646 C CE1 . HIS A 203 ? 2.5012 1.1103 4.0159 0.0361  0.5464  0.1569  237  HIS A CE1 
1647 N NE2 . HIS A 203 ? 2.4712 1.1275 3.9447 0.0077  0.5262  0.1243  237  HIS A NE2 
1648 N N   . LEU A 204 ? 2.6438 1.2882 4.3211 0.2358  0.6138  0.0347  238  LEU A N   
1649 C CA  . LEU A 204 ? 2.7343 1.3770 4.4426 0.2934  0.6304  -0.0058 238  LEU A CA  
1650 C C   . LEU A 204 ? 2.7802 1.4268 4.5383 0.3610  0.6542  0.0590  238  LEU A C   
1651 O O   . LEU A 204 ? 2.8361 1.4372 4.6127 0.4094  0.6695  0.0421  238  LEU A O   
1652 C CB  . LEU A 204 ? 2.6729 1.3813 4.3735 0.2874  0.6209  -0.0468 238  LEU A CB  
1653 C CG  . LEU A 204 ? 2.6338 1.3464 4.2813 0.2293  0.5968  -0.1224 238  LEU A CG  
1654 C CD1 . LEU A 204 ? 2.5498 1.3299 4.1930 0.2282  0.5877  -0.1590 238  LEU A CD1 
1655 C CD2 . LEU A 204 ? 2.7494 1.4030 4.3811 0.2343  0.5983  -0.1865 238  LEU A CD2 
1656 N N   . LEU A 205 ? 2.8204 1.5229 4.5943 0.3653  0.6544  0.1381  239  LEU A N   
1657 C CA  . LEU A 205 ? 2.7741 1.4995 4.5917 0.4303  0.6745  0.2108  239  LEU A CA  
1658 C C   . LEU A 205 ? 2.8234 1.4755 4.6490 0.4493  0.6864  0.2299  239  LEU A C   
1659 O O   . LEU A 205 ? 2.7497 1.3974 4.6071 0.5160  0.7052  0.2507  239  LEU A O   
1660 C CB  . LEU A 205 ? 2.5492 1.3436 4.3677 0.4159  0.6650  0.3035  239  LEU A CB  
1661 C CG  . LEU A 205 ? 2.6110 1.4488 4.4671 0.4771  0.6808  0.3954  239  LEU A CG  
1662 C CD1 . LEU A 205 ? 2.6974 1.5885 4.5951 0.5575  0.6995  0.3803  239  LEU A CD1 
1663 C CD2 . LEU A 205 ? 2.4216 1.3283 4.2612 0.4484  0.6626  0.4890  239  LEU A CD2 
1664 N N   . LYS A 206 ? 3.1398 1.7381 4.9353 0.3943  0.6744  0.2231  240  LYS A N   
1665 C CA  . LYS A 206 ? 3.7050 2.2274 5.5079 0.4109  0.6837  0.2343  240  LYS A CA  
1666 C C   . LYS A 206 ? 3.7389 2.1940 5.5411 0.4401  0.6896  0.1571  240  LYS A C   
1667 O O   . LYS A 206 ? 4.3035 2.7135 6.1258 0.4938  0.7035  0.1669  240  LYS A O   
1668 C CB  . LYS A 206 ? 2.7927 1.2852 4.5643 0.3475  0.6685  0.2502  240  LYS A CB  
1669 C CG  . LYS A 206 ? 3.1367 1.5402 4.9123 0.3582  0.6747  0.2452  240  LYS A CG  
1670 C CD  . LYS A 206 ? 3.1542 1.5419 4.9089 0.3097  0.6636  0.2841  240  LYS A CD  
1671 C CE  . LYS A 206 ? 3.0375 1.3351 4.8019 0.3276  0.6706  0.2862  240  LYS A CE  
1672 N NZ  . LYS A 206 ? 3.0402 1.3230 4.7868 0.2846  0.6607  0.3247  240  LYS A NZ  
1673 N N   . THR A 207 ? 3.9146 2.3630 5.6879 0.4061  0.6766  0.0806  241  THR A N   
1674 C CA  . THR A 207 ? 4.0508 2.4238 5.8082 0.4166  0.6749  0.0112  241  THR A CA  
1675 C C   . THR A 207 ? 4.1198 2.4883 5.8971 0.4926  0.6894  -0.0170 241  THR A C   
1676 O O   . THR A 207 ? 4.2234 2.5188 6.0023 0.5308  0.6953  -0.0278 241  THR A O   
1677 C CB  . THR A 207 ? 4.0452 2.4236 5.7614 0.3594  0.6549  -0.0583 241  THR A CB  
1678 O OG1 . THR A 207 ? 3.9720 2.4304 5.6867 0.3566  0.6512  -0.0799 241  THR A OG1 
1679 C CG2 . THR A 207 ? 4.0053 2.3782 5.6951 0.2919  0.6395  -0.0360 241  THR A CG2 
1680 N N   . ASN A 208 ? 4.0081 2.4556 5.7977 0.5177  0.6939  -0.0294 242  ASN A N   
1681 C CA  . ASN A 208 ? 4.6650 3.1205 6.4601 0.5823  0.7026  -0.0790 242  ASN A CA  
1682 C C   . ASN A 208 ? 3.0232 1.5535 4.8599 0.6551  0.7218  -0.0279 242  ASN A C   
1683 O O   . ASN A 208 ? 3.0225 1.6284 4.8673 0.6874  0.7256  -0.0555 242  ASN A O   
1684 C CB  . ASN A 208 ? 2.9740 1.4653 4.7404 0.5530  0.6889  -0.1567 242  ASN A CB  
1685 C CG  . ASN A 208 ? 3.0148 1.4332 4.7362 0.5000  0.6705  -0.2153 242  ASN A CG  
1686 O OD1 . ASN A 208 ? 3.1163 1.4489 4.8295 0.5032  0.6700  -0.2126 242  ASN A OD1 
1687 N ND2 . ASN A 208 ? 3.0043 1.4599 4.6951 0.4521  0.6539  -0.2664 242  ASN A ND2 
1688 N N   . SER A 209 ? 3.0614 1.5801 4.9231 0.6819  0.7331  0.0487  243  SER A N   
1689 C CA  . SER A 209 ? 3.0306 1.6390 4.9306 0.7420  0.7489  0.1167  243  SER A CA  
1690 C C   . SER A 209 ? 3.0969 1.7399 5.0091 0.8299  0.7621  0.0852  243  SER A C   
1691 O O   . SER A 209 ? 3.0376 1.7929 4.9759 0.8745  0.7715  0.1165  243  SER A O   
1692 C CB  . SER A 209 ? 3.0671 1.6506 4.9835 0.7479  0.7555  0.2042  243  SER A CB  
1693 O OG  . SER A 209 ? 3.0432 1.7195 4.9928 0.8080  0.7692  0.2755  243  SER A OG  
1694 N N   . TYR A 210 ? 3.2195 1.7766 5.1106 0.8584  0.7611  0.0269  244  TYR A N   
1695 C CA  . TYR A 210 ? 3.4401 2.0195 5.3388 0.9510  0.7730  0.0100  244  TYR A CA  
1696 C C   . TYR A 210 ? 3.4189 2.0102 5.2906 0.9678  0.7665  -0.0843 244  TYR A C   
1697 O O   . TYR A 210 ? 3.4371 1.9559 5.2725 0.9162  0.7509  -0.1480 244  TYR A O   
1698 C CB  . TYR A 210 ? 3.4557 1.9259 5.3469 0.9860  0.7750  0.0205  244  TYR A CB  
1699 C CG  . TYR A 210 ? 3.4992 2.0188 5.4213 1.0641  0.7914  0.0894  244  TYR A CG  
1700 C CD1 . TYR A 210 ? 3.3957 2.0443 5.3520 1.0796  0.8023  0.1617  244  TYR A CD1 
1701 C CD2 . TYR A 210 ? 3.7266 2.1665 5.6402 1.1233  0.7937  0.0836  244  TYR A CD2 
1702 C CE1 . TYR A 210 ? 3.4346 2.1392 5.4155 1.1500  0.8158  0.2283  244  TYR A CE1 
1703 C CE2 . TYR A 210 ? 3.7606 2.2493 5.6993 1.1952  0.8072  0.1454  244  TYR A CE2 
1704 C CZ  . TYR A 210 ? 3.6669 2.2915 5.6392 1.2077  0.8188  0.2181  244  TYR A CZ  
1705 O OH  . TYR A 210 ? 3.6237 2.3053 5.6176 1.2784  0.8309  0.2823  244  TYR A OH  
1706 N N   . GLY A 211 ? 2.8586 1.4873 4.0620 0.5242  1.1192  0.0736  245  GLY A N   
1707 C CA  . GLY A 211 ? 3.0759 1.6222 4.2429 0.4743  1.1738  0.0044  245  GLY A CA  
1708 C C   . GLY A 211 ? 3.2582 1.7947 4.3613 0.4109  1.1447  -0.0456 245  GLY A C   
1709 O O   . GLY A 211 ? 3.2134 1.8219 4.3173 0.4153  1.0901  -0.0311 245  GLY A O   
1710 N N   . LYS A 212 ? 3.4634 1.9099 4.5093 0.3483  1.1836  -0.1065 246  LYS A N   
1711 C CA  . LYS A 212 ? 3.5192 1.9505 4.4950 0.2780  1.1584  -0.1560 246  LYS A CA  
1712 C C   . LYS A 212 ? 3.7105 2.1749 4.6586 0.2648  1.0843  -0.1242 246  LYS A C   
1713 O O   . LYS A 212 ? 3.5573 2.0535 4.4729 0.2319  1.0424  -0.1384 246  LYS A O   
1714 C CB  . LYS A 212 ? 3.4931 1.8263 4.4078 0.2115  1.2104  -0.2211 246  LYS A CB  
1715 C CG  . LYS A 212 ? 3.4730 1.7612 4.4161 0.2283  1.2901  -0.2480 246  LYS A CG  
1716 C CD  . LYS A 212 ? 3.4734 1.6627 4.3554 0.1636  1.3404  -0.3084 246  LYS A CD  
1717 C CE  . LYS A 212 ? 3.5402 1.6819 4.4502 0.1806  1.4215  -0.3353 246  LYS A CE  
1718 N NZ  . LYS A 212 ? 3.6581 1.7037 4.5085 0.1171  1.4717  -0.3950 246  LYS A NZ  
1719 N N   . ASN A 213 ? 4.1222 2.5803 5.0836 0.2900  1.0686  -0.0802 247  ASN A N   
1720 C CA  . ASN A 213 ? 4.1026 2.6018 5.0453 0.2882  0.9977  -0.0416 247  ASN A CA  
1721 C C   . ASN A 213 ? 3.9694 2.5678 4.9446 0.3253  0.9450  -0.0070 247  ASN A C   
1722 O O   . ASN A 213 ? 3.9339 2.5623 4.8758 0.3000  0.8894  -0.0018 247  ASN A O   
1723 C CB  . ASN A 213 ? 4.1964 2.6879 5.1633 0.3234  0.9944  0.0063  247  ASN A CB  
1724 C CG  . ASN A 213 ? 4.3973 2.7915 5.3447 0.2942  1.0524  -0.0248 247  ASN A CG  
1725 O OD1 . ASN A 213 ? 4.5030 2.8772 5.4974 0.3340  1.0969  -0.0065 247  ASN A OD1 
1726 N ND2 . ASN A 213 ? 4.4350 2.7707 5.3123 0.2227  1.0519  -0.0711 247  ASN A ND2 
1727 N N   . ARG A 214 ? 3.7342 2.3867 4.7745 0.3845  0.9613  0.0183  248  ARG A N   
1728 C CA  . ARG A 214 ? 3.3401 2.0925 4.4137 0.4189  0.9131  0.0484  248  ARG A CA  
1729 C C   . ARG A 214 ? 3.1438 1.9000 4.1909 0.3762  0.9071  0.0018  248  ARG A C   
1730 O O   . ARG A 214 ? 3.1384 1.9543 4.1827 0.3744  0.8523  0.0164  248  ARG A O   
1731 C CB  . ARG A 214 ? 3.2922 2.1051 4.4394 0.4873  0.9344  0.0843  248  ARG A CB  
1732 C CG  . ARG A 214 ? 3.1413 2.0398 4.3228 0.5086  0.9138  0.0865  248  ARG A CG  
1733 C CD  . ARG A 214 ? 3.0554 2.0541 4.2999 0.5772  0.8913  0.1467  248  ARG A CD  
1734 N NE  . ARG A 214 ? 2.9673 2.0546 4.2438 0.5936  0.8668  0.1483  248  ARG A NE  
1735 C CZ  . ARG A 214 ? 2.9024 2.0964 4.2264 0.6438  0.8330  0.1962  248  ARG A CZ  
1736 N NH1 . ARG A 214 ? 2.7832 2.0575 4.1362 0.6531  0.8121  0.1931  248  ARG A NH1 
1737 N NH2 . ARG A 214 ? 2.9443 2.1682 4.2862 0.6821  0.8201  0.2463  248  ARG A NH2 
1738 N N   . ILE A 215 ? 3.0081 1.7022 4.0347 0.3396  0.9637  -0.0554 249  ILE A N   
1739 C CA  . ILE A 215 ? 2.9034 1.6019 3.9027 0.2948  0.9626  -0.1034 249  ILE A CA  
1740 C C   . ILE A 215 ? 2.9520 1.6280 3.8818 0.2302  0.9164  -0.1189 249  ILE A C   
1741 O O   . ILE A 215 ? 2.8788 1.6059 3.8067 0.2210  0.8689  -0.1110 249  ILE A O   
1742 C CB  . ILE A 215 ? 2.6688 1.3057 3.6525 0.2655  1.0356  -0.1637 249  ILE A CB  
1743 C CG1 . ILE A 215 ? 2.6141 1.2821 3.6707 0.3320  1.0786  -0.1422 249  ILE A CG1 
1744 C CG2 . ILE A 215 ? 2.5470 1.1893 3.4943 0.2116  1.0348  -0.2168 249  ILE A CG2 
1745 C CD1 . ILE A 215 ? 2.6968 1.3062 3.7412 0.3090  1.1528  -0.1980 249  ILE A CD1 
1746 N N   . THR A 216 ? 2.9955 1.5978 3.8685 0.1835  0.9289  -0.1389 250  THR A N   
1747 C CA  . THR A 216 ? 2.9658 1.5522 3.7691 0.1185  0.8842  -0.1496 250  THR A CA  
1748 C C   . THR A 216 ? 2.8823 1.5306 3.7020 0.1500  0.8137  -0.0894 250  THR A C   
1749 O O   . THR A 216 ? 2.9005 1.5742 3.6877 0.1136  0.7665  -0.0884 250  THR A O   
1750 C CB  . THR A 216 ? 2.9995 1.5073 3.7463 0.0702  0.9086  -0.1745 250  THR A CB  
1751 O OG1 . THR A 216 ? 3.1044 1.5571 3.8380 0.0452  0.9771  -0.2303 250  THR A OG1 
1752 C CG2 . THR A 216 ? 2.9360 1.4363 3.6055 -0.0051 0.8643  -0.1886 250  THR A CG2 
1753 N N   . ARG A 217 ? 2.8259 1.5041 3.6949 0.2160  0.8059  -0.0380 251  ARG A N   
1754 C CA  . ARG A 217 ? 2.6965 1.4409 3.5790 0.2489  0.7405  0.0186  251  ARG A CA  
1755 C C   . ARG A 217 ? 2.6359 1.4595 3.5501 0.2696  0.7041  0.0310  251  ARG A C   
1756 O O   . ARG A 217 ? 2.5086 1.3690 3.4030 0.2568  0.6473  0.0515  251  ARG A O   
1757 C CB  . ARG A 217 ? 2.6892 1.4579 3.6177 0.3133  0.7448  0.0674  251  ARG A CB  
1758 C CG  . ARG A 217 ? 2.6196 1.4693 3.5626 0.3518  0.6798  0.1244  251  ARG A CG  
1759 C CD  . ARG A 217 ? 2.6616 1.5394 3.6463 0.4098  0.6871  0.1696  251  ARG A CD  
1760 N NE  . ARG A 217 ? 2.7500 1.6704 3.7975 0.4601  0.7177  0.1798  251  ARG A NE  
1761 C CZ  . ARG A 217 ? 2.7383 1.7541 3.8239 0.5002  0.6849  0.2080  251  ARG A CZ  
1762 N NH1 . ARG A 217 ? 2.6851 1.7598 3.7524 0.4961  0.6220  0.2257  251  ARG A NH1 
1763 N NH2 . ARG A 217 ? 2.7228 1.7771 3.8641 0.5432  0.7150  0.2183  251  ARG A NH2 
1764 N N   . ASP A 218 ? 2.6526 1.5060 3.6182 0.3019  0.7362  0.0198  252  ASP A N   
1765 C CA  . ASP A 218 ? 2.5456 1.4763 3.5467 0.3194  0.7052  0.0271  252  ASP A CA  
1766 C C   . ASP A 218 ? 2.7518 1.6798 3.6914 0.2437  0.6817  -0.0133 252  ASP A C   
1767 O O   . ASP A 218 ? 2.6526 1.6656 3.5810 0.2332  0.6209  0.0028  252  ASP A O   
1768 C CB  . ASP A 218 ? 2.3142 1.2840 3.3795 0.3646  0.7471  0.0213  252  ASP A CB  
1769 C CG  . ASP A 218 ? 2.1887 1.2091 3.3049 0.4336  0.7482  0.0730  252  ASP A CG  
1770 O OD1 . ASP A 218 ? 2.0191 1.0719 3.1295 0.4536  0.7031  0.1171  252  ASP A OD1 
1771 O OD2 . ASP A 218 ? 2.1866 1.2165 3.3459 0.4658  0.7943  0.0700  252  ASP A OD2 
1772 N N   . GLN A 219 ? 3.0982 1.9498 3.9850 0.1829  0.7220  -0.0651 253  GLN A N   
1773 C CA  . GLN A 219 ? 3.1346 2.0076 3.9473 0.1014  0.6914  -0.0988 253  GLN A CA  
1774 C C   . GLN A 219 ? 3.0172 1.9036 3.7851 0.0730  0.6283  -0.0687 253  GLN A C   
1775 O O   . GLN A 219 ? 2.9991 1.9591 3.7433 0.0467  0.5743  -0.0603 253  GLN A O   
1776 C CB  . GLN A 219 ? 3.3252 2.1130 4.0874 0.0411  0.7487  -0.1589 253  GLN A CB  
1777 C CG  . GLN A 219 ? 3.4289 2.2531 4.1226 -0.0402 0.7264  -0.1961 253  GLN A CG  
1778 C CD  . GLN A 219 ? 3.4668 2.3832 4.1885 -0.0299 0.7159  -0.2033 253  GLN A CD  
1779 O OE1 . GLN A 219 ? 3.5618 2.4780 4.3295 0.0061  0.7633  -0.2197 253  GLN A OE1 
1780 N NE2 . GLN A 219 ? 3.3968 2.3926 4.0937 -0.0607 0.6552  -0.1890 253  GLN A NE2 
1781 N N   . VAL A 220 ? 2.7241 1.5390 3.4826 0.0793  0.6362  -0.0502 254  VAL A N   
1782 C CA  . VAL A 220 ? 2.4964 1.3222 3.2141 0.0552  0.5798  -0.0187 254  VAL A CA  
1783 C C   . VAL A 220 ? 2.5340 1.4501 3.2893 0.1071  0.5219  0.0317  254  VAL A C   
1784 O O   . VAL A 220 ? 2.5072 1.4712 3.2272 0.0795  0.4662  0.0479  254  VAL A O   
1785 C CB  . VAL A 220 ? 2.4272 1.1801 3.1268 0.0558  0.5967  -0.0062 254  VAL A CB  
1786 C CG1 . VAL A 220 ? 2.4182 1.1957 3.0811 0.0409  0.5362  0.0331  254  VAL A CG1 
1787 C CG2 . VAL A 220 ? 2.3871 1.0679 3.0342 -0.0077 0.6441  -0.0607 254  VAL A CG2 
1788 N N   . LEU A 221 ? 2.6007 1.5431 3.4281 0.1826  0.5356  0.0577  255  LEU A N   
1789 C CA  . LEU A 221 ? 2.5899 1.6253 3.4536 0.2306  0.4828  0.1012  255  LEU A CA  
1790 C C   . LEU A 221 ? 2.4944 1.6123 3.3420 0.1987  0.4458  0.0836  255  LEU A C   
1791 O O   . LEU A 221 ? 2.4496 1.6242 3.2808 0.1929  0.3887  0.1064  255  LEU A O   
1792 C CB  . LEU A 221 ? 2.7071 1.7652 3.6531 0.3132  0.5098  0.1292  255  LEU A CB  
1793 C CG  . LEU A 221 ? 2.6824 1.8483 3.6714 0.3639  0.4601  0.1698  255  LEU A CG  
1794 C CD1 . LEU A 221 ? 2.6876 1.8771 3.6362 0.3554  0.3999  0.2019  255  LEU A CD1 
1795 C CD2 . LEU A 221 ? 2.6522 1.8700 3.6918 0.4289  0.4765  0.1985  255  LEU A CD2 
1796 N N   . LYS A 222 ? 2.4479 1.5718 3.3004 0.1775  0.4797  0.0430  256  LYS A N   
1797 C CA  . LYS A 222 ? 2.2699 1.4674 3.1056 0.1407  0.4482  0.0250  256  LYS A CA  
1798 C C   . LYS A 222 ? 2.2490 1.4360 3.0101 0.0684  0.4145  0.0147  256  LYS A C   
1799 O O   . LYS A 222 ? 2.3005 1.5532 3.0480 0.0452  0.3714  0.0184  256  LYS A O   
1800 C CB  . LYS A 222 ? 2.1732 1.3748 3.0264 0.1300  0.4962  -0.0165 256  LYS A CB  
1801 C CG  . LYS A 222 ? 2.1375 1.3848 3.0719 0.2018  0.5180  -0.0000 256  LYS A CG  
1802 C CD  . LYS A 222 ? 2.0644 1.4112 3.0328 0.2362  0.4588  0.0386  256  LYS A CD  
1803 C CE  . LYS A 222 ? 2.0724 1.4462 3.1140 0.3184  0.4683  0.0794  256  LYS A CE  
1804 N NZ  . LYS A 222 ? 1.9932 1.4591 3.0568 0.3467  0.4067  0.1169  256  LYS A NZ  
1805 N N   . MET A 223 ? 2.2590 1.3665 2.9734 0.0316  0.4341  0.0036  257  MET A N   
1806 C CA  . MET A 223 ? 2.2983 1.4035 2.9446 -0.0350 0.4006  0.0014  257  MET A CA  
1807 C C   . MET A 223 ? 2.1887 1.3291 2.8322 -0.0147 0.3422  0.0494  257  MET A C   
1808 O O   . MET A 223 ? 2.1791 1.3704 2.7964 -0.0456 0.2997  0.0571  257  MET A O   
1809 C CB  . MET A 223 ? 2.4877 1.5041 3.0856 -0.0818 0.4365  -0.0224 257  MET A CB  
1810 C CG  . MET A 223 ? 2.6095 1.6036 3.1803 -0.1331 0.4819  -0.0779 257  MET A CG  
1811 S SD  . MET A 223 ? 2.6228 1.7067 3.1634 -0.1872 0.4466  -0.0922 257  MET A SD  
1812 C CE  . MET A 223 ? 2.6046 1.6970 3.0847 -0.2371 0.3924  -0.0608 257  MET A CE  
1813 N N   . ALA A 224 ? 2.2387 1.3526 2.9098 0.0379  0.3412  0.0832  258  ALA A N   
1814 C CA  . ALA A 224 ? 2.1472 1.2956 2.8151 0.0606  0.2880  0.1282  258  ALA A CA  
1815 C C   . ALA A 224 ? 2.0922 1.3307 2.7922 0.0893  0.2500  0.1404  258  ALA A C   
1816 O O   . ALA A 224 ? 1.9443 1.2236 2.6191 0.0699  0.2041  0.1550  258  ALA A O   
1817 C CB  . ALA A 224 ? 2.0071 1.1152 2.7034 0.1154  0.2981  0.1628  258  ALA A CB  
1818 N N   . ALA A 225 ? 2.2320 1.5031 2.9893 0.1347  0.2701  0.1346  259  ALA A N   
1819 C CA  . ALA A 225 ? 2.2457 1.6060 3.0349 0.1561  0.2366  0.1414  259  ALA A CA  
1820 C C   . ALA A 225 ? 2.3025 1.6952 3.0571 0.0953  0.2180  0.1155  259  ALA A C   
1821 O O   . ALA A 225 ? 2.3500 1.8026 3.1057 0.0935  0.1751  0.1271  259  ALA A O   
1822 C CB  . ALA A 225 ? 2.3024 1.6944 3.1584 0.2070  0.2676  0.1370  259  ALA A CB  
1823 N N   . ALA A 226 ? 2.1971 1.5506 2.9198 0.0437  0.2508  0.0806  260  ALA A N   
1824 C CA  . ALA A 226 ? 2.0506 1.4375 2.7403 -0.0158 0.2353  0.0596  260  ALA A CA  
1825 C C   . ALA A 226 ? 1.9176 1.3027 2.5569 -0.0526 0.1938  0.0811  260  ALA A C   
1826 O O   . ALA A 226 ? 1.8047 1.2387 2.4332 -0.0798 0.1630  0.0832  260  ALA A O   
1827 C CB  . ALA A 226 ? 2.1702 1.5199 2.8361 -0.0616 0.2828  0.0172  260  ALA A CB  
1828 N N   . VAL A 227 ? 1.8738 1.2032 2.4845 -0.0539 0.1943  0.0993  261  VAL A N   
1829 C CA  . VAL A 227 ? 1.7776 1.1091 2.3462 -0.0804 0.1549  0.1270  261  VAL A CA  
1830 C C   . VAL A 227 ? 1.6645 1.0512 2.2574 -0.0417 0.1098  0.1562  261  VAL A C   
1831 O O   . VAL A 227 ? 1.6723 1.0967 2.2479 -0.0687 0.0785  0.1631  261  VAL A O   
1832 C CB  . VAL A 227 ? 1.6456 0.9110 2.1873 -0.0808 0.1643  0.1449  261  VAL A CB  
1833 C CG1 . VAL A 227 ? 1.5184 0.7958 2.0321 -0.0853 0.1201  0.1845  261  VAL A CG1 
1834 C CG2 . VAL A 227 ? 1.7084 0.9231 2.2086 -0.1402 0.2006  0.1141  261  VAL A CG2 
1835 N N   . VAL A 228 ? 1.6426 1.0359 2.2768 0.0220  0.1077  0.1740  262  VAL A N   
1836 C CA  . VAL A 228 ? 1.6564 1.1040 2.3113 0.0591  0.0659  0.1989  262  VAL A CA  
1837 C C   . VAL A 228 ? 1.6680 1.1795 2.3425 0.0451  0.0513  0.1797  262  VAL A C   
1838 O O   . VAL A 228 ? 1.6921 1.2378 2.3554 0.0344  0.0150  0.1903  262  VAL A O   
1839 C CB  . VAL A 228 ? 1.7862 1.2403 2.4857 0.1293  0.0702  0.2201  262  VAL A CB  
1840 C CG1 . VAL A 228 ? 1.7084 1.2184 2.4200 0.1636  0.0254  0.2455  262  VAL A CG1 
1841 C CG2 . VAL A 228 ? 1.9524 1.3377 2.6369 0.1407  0.0911  0.2380  262  VAL A CG2 
1842 N N   . LEU A 229 ? 1.5939 1.1202 2.2982 0.0437  0.0815  0.1511  263  LEU A N   
1843 C CA  . LEU A 229 ? 1.6055 1.1959 2.3340 0.0314  0.0697  0.1337  263  LEU A CA  
1844 C C   . LEU A 229 ? 1.6771 1.2729 2.3655 -0.0315 0.0551  0.1250  263  LEU A C   
1845 O O   . LEU A 229 ? 1.6460 1.2906 2.3442 -0.0408 0.0269  0.1263  263  LEU A O   
1846 C CB  . LEU A 229 ? 1.4752 1.0782 2.2428 0.0417  0.1097  0.1068  263  LEU A CB  
1847 C CG  . LEU A 229 ? 1.4694 1.0962 2.2948 0.1090  0.1218  0.1184  263  LEU A CG  
1848 C CD1 . LEU A 229 ? 1.3922 1.0341 2.2568 0.1158  0.1642  0.0924  263  LEU A CD1 
1849 C CD2 . LEU A 229 ? 1.4628 1.1597 2.3159 0.1410  0.0777  0.1389  263  LEU A CD2 
1850 N N   . ALA A 230 ? 1.7950 1.3438 2.4395 -0.0767 0.0748  0.1168  264  ALA A N   
1851 C CA  . ALA A 230 ? 1.7443 1.3045 2.3513 -0.1363 0.0613  0.1153  264  ALA A CA  
1852 C C   . ALA A 230 ? 1.7144 1.2819 2.3025 -0.1346 0.0196  0.1487  264  ALA A C   
1853 O O   . ALA A 230 ? 1.7006 1.3065 2.2909 -0.1542 -0.0034 0.1526  264  ALA A O   
1854 C CB  . ALA A 230 ? 1.8093 1.3233 2.3708 -0.1851 0.0903  0.1022  264  ALA A CB  
1855 N N   . PHE A 231 ? 1.7383 1.2679 2.3095 -0.1104 0.0117  0.1736  265  PHE A N   
1856 C CA  . PHE A 231 ? 1.6926 1.2274 2.2461 -0.1036 -0.0251 0.2063  265  PHE A CA  
1857 C C   . PHE A 231 ? 1.5597 1.1445 2.1475 -0.0728 -0.0527 0.2078  265  PHE A C   
1858 O O   . PHE A 231 ? 1.4143 1.0200 1.9926 -0.0922 -0.0767 0.2173  265  PHE A O   
1859 C CB  . PHE A 231 ? 1.6326 1.1246 2.1715 -0.0724 -0.0269 0.2325  265  PHE A CB  
1860 C CG  . PHE A 231 ? 1.6010 1.0961 2.1203 -0.0617 -0.0613 0.2674  265  PHE A CG  
1861 C CD1 . PHE A 231 ? 1.5046 0.9880 1.9836 -0.1048 -0.0705 0.2864  265  PHE A CD1 
1862 C CD2 . PHE A 231 ? 1.6145 1.1280 2.1559 -0.0080 -0.0831 0.2824  265  PHE A CD2 
1863 C CE1 . PHE A 231 ? 1.4539 0.9389 1.9169 -0.0920 -0.0985 0.3201  265  PHE A CE1 
1864 C CE2 . PHE A 231 ? 1.5947 1.1091 2.1160 0.0028  -0.1117 0.3122  265  PHE A CE2 
1865 C CZ  . PHE A 231 ? 1.5191 1.0166 2.0022 -0.0379 -0.1182 0.3311  265  PHE A CZ  
1866 N N   . ILE A 232 ? 1.5598 1.1663 2.1894 -0.0262 -0.0480 0.1985  266  ILE A N   
1867 C CA  . ILE A 232 ? 1.5312 1.1913 2.1931 0.0018  -0.0749 0.1980  266  ILE A CA  
1868 C C   . ILE A 232 ? 1.4647 1.1646 2.1394 -0.0363 -0.0785 0.1764  266  ILE A C   
1869 O O   . ILE A 232 ? 1.4108 1.1370 2.0870 -0.0436 -0.1056 0.1805  266  ILE A O   
1870 C CB  . ILE A 232 ? 1.5989 1.2841 2.3058 0.0574  -0.0666 0.1954  266  ILE A CB  
1871 C CG1 . ILE A 232 ? 1.6374 1.2918 2.3349 0.1001  -0.0706 0.2241  266  ILE A CG1 
1872 C CG2 . ILE A 232 ? 1.5323 1.2862 2.2757 0.0758  -0.0913 0.1876  266  ILE A CG2 
1873 C CD1 . ILE A 232 ? 1.6548 1.3375 2.3988 0.1575  -0.0615 0.2290  266  ILE A CD1 
1874 N N   . ILE A 233 ? 1.4804 1.1840 2.1653 -0.0613 -0.0491 0.1527  267  ILE A N   
1875 C CA  . ILE A 233 ? 1.4921 1.2394 2.1954 -0.0947 -0.0497 0.1329  267  ILE A CA  
1876 C C   . ILE A 233 ? 1.5033 1.2441 2.1736 -0.1418 -0.0659 0.1446  267  ILE A C   
1877 O O   . ILE A 233 ? 1.5012 1.2773 2.1875 -0.1561 -0.0842 0.1420  267  ILE A O   
1878 C CB  . ILE A 233 ? 1.4432 1.1928 2.1590 -0.1123 -0.0111 0.1063  267  ILE A CB  
1879 C CG1 . ILE A 233 ? 1.5043 1.2829 2.2707 -0.0638 0.0028  0.0953  267  ILE A CG1 
1880 C CG2 . ILE A 233 ? 1.3015 1.0859 2.0202 -0.1615 -0.0091 0.0912  267  ILE A CG2 
1881 C CD1 . ILE A 233 ? 1.5437 1.3167 2.3230 -0.0734 0.0465  0.0699  267  ILE A CD1 
1882 N N   . CYS A 234 ? 1.5740 1.2713 2.2001 -0.1668 -0.0590 0.1600  268  CYS A N   
1883 C CA  . CYS A 234 ? 1.5506 1.2477 2.1482 -0.2135 -0.0694 0.1754  268  CYS A CA  
1884 C C   . CYS A 234 ? 1.4078 1.0862 1.9847 -0.2002 -0.0974 0.2080  268  CYS A C   
1885 O O   . CYS A 234 ? 1.3293 1.0034 1.8821 -0.2347 -0.1041 0.2284  268  CYS A O   
1886 C CB  . CYS A 234 ? 1.6872 1.3613 2.2483 -0.2583 -0.0444 0.1737  268  CYS A CB  
1887 S SG  . CYS A 234 ? 1.7240 1.4045 2.2995 -0.2700 -0.0035 0.1331  268  CYS A SG  
1888 N N   . TRP A 235 ? 1.4694 1.1396 2.0557 -0.1503 -0.1122 0.2157  269  TRP A N   
1889 C CA  . TRP A 235 ? 1.5234 1.1794 2.0913 -0.1349 -0.1378 0.2442  269  TRP A CA  
1890 C C   . TRP A 235 ? 1.5740 1.2562 2.1685 -0.0955 -0.1612 0.2385  269  TRP A C   
1891 O O   . TRP A 235 ? 1.4635 1.1399 2.0456 -0.0920 -0.1813 0.2550  269  TRP A O   
1892 C CB  . TRP A 235 ? 1.6019 1.2151 2.1385 -0.1172 -0.1350 0.2690  269  TRP A CB  
1893 C CG  . TRP A 235 ? 1.6155 1.2060 2.1139 -0.1627 -0.1269 0.2893  269  TRP A CG  
1894 C CD1 . TRP A 235 ? 1.6568 1.2215 2.1313 -0.1855 -0.1053 0.2894  269  TRP A CD1 
1895 C CD2 . TRP A 235 ? 1.5951 1.1910 2.0761 -0.1933 -0.1391 0.3135  269  TRP A CD2 
1896 N NE1 . TRP A 235 ? 1.6145 1.1753 2.0560 -0.2301 -0.1062 0.3131  269  TRP A NE1 
1897 C CE2 . TRP A 235 ? 1.5754 1.1562 2.0224 -0.2334 -0.1262 0.3309  269  TRP A CE2 
1898 C CE3 . TRP A 235 ? 1.4850 1.0965 1.9769 -0.1908 -0.1579 0.3228  269  TRP A CE3 
1899 C CZ2 . TRP A 235 ? 1.4822 1.0869 1.8926 -0.2578 -0.1277 0.3481  269  TRP A CZ2 
1900 C CZ3 . TRP A 235 ? 1.4118 1.0256 1.8811 -0.2215 -0.1600 0.3493  269  TRP A CZ3 
1901 C CH2 . TRP A 235 ? 1.4328 1.0565 1.8544 -0.2471 -0.1426 0.3558  269  TRP A CH2 
1902 N N   . LEU A 236 ? 1.5820 1.2951 2.2122 -0.0668 -0.1583 0.2164  270  LEU A N   
1903 C CA  . LEU A 236 ? 1.4776 1.2272 2.1328 -0.0351 -0.1819 0.2090  270  LEU A CA  
1904 C C   . LEU A 236 ? 1.4544 1.2267 2.1193 -0.0656 -0.1962 0.1982  270  LEU A C   
1905 O O   . LEU A 236 ? 1.4074 1.1815 2.0664 -0.0519 -0.2185 0.2034  270  LEU A O   
1906 C CB  . LEU A 236 ? 1.3088 1.0982 2.0052 -0.0031 -0.1736 0.1903  270  LEU A CB  
1907 C CG  . LEU A 236 ? 1.2916 1.1319 2.0158 0.0297  -0.1985 0.1825  270  LEU A CG  
1908 C CD1 . LEU A 236 ? 1.3248 1.1511 2.0289 0.0721  -0.2153 0.2054  270  LEU A CD1 
1909 C CD2 . LEU A 236 ? 1.2983 1.1920 2.0708 0.0500  -0.1878 0.1647  270  LEU A CD2 
1910 N N   . PRO A 237 ? 1.4677 1.2571 2.1476 -0.1065 -0.1835 0.1831  271  PRO A N   
1911 C CA  . PRO A 237 ? 1.3633 1.1725 2.0570 -0.1342 -0.1966 0.1749  271  PRO A CA  
1912 C C   . PRO A 237 ? 1.3654 1.1369 2.0277 -0.1481 -0.2068 0.2000  271  PRO A C   
1913 O O   . PRO A 237 ? 1.3784 1.1528 2.0457 -0.1428 -0.2246 0.1968  271  PRO A O   
1914 C CB  . PRO A 237 ? 1.2690 1.0991 1.9801 -0.1761 -0.1760 0.1613  271  PRO A CB  
1915 C CG  . PRO A 237 ? 1.2483 1.0859 1.9687 -0.1585 -0.1557 0.1499  271  PRO A CG  
1916 C CD  . PRO A 237 ? 1.3852 1.1797 2.0733 -0.1288 -0.1556 0.1703  271  PRO A CD  
1917 N N   . PHE A 238 ? 1.3573 1.0943 1.9873 -0.1667 -0.1946 0.2250  272  PHE A N   
1918 C CA  . PHE A 238 ? 1.3984 1.1038 2.0016 -0.1785 -0.2017 0.2551  272  PHE A CA  
1919 C C   . PHE A 238 ? 1.4015 1.0883 1.9909 -0.1358 -0.2207 0.2648  272  PHE A C   
1920 O O   . PHE A 238 ? 1.3325 1.0075 1.9184 -0.1366 -0.2315 0.2720  272  PHE A O   
1921 C CB  . PHE A 238 ? 1.4147 1.0956 1.9852 -0.2027 -0.1866 0.2831  272  PHE A CB  
1922 C CG  . PHE A 238 ? 1.3906 1.0435 1.9348 -0.2095 -0.1928 0.3214  272  PHE A CG  
1923 C CD1 . PHE A 238 ? 1.4195 1.0783 1.9678 -0.2454 -0.1884 0.3364  272  PHE A CD1 
1924 C CD2 . PHE A 238 ? 1.3813 1.0050 1.8983 -0.1777 -0.2008 0.3450  272  PHE A CD2 
1925 C CE1 . PHE A 238 ? 1.4596 1.1187 1.9653 -0.2346 -0.1840 0.3574  272  PHE A CE1 
1926 C CE2 . PHE A 238 ? 1.3906 1.0141 1.8691 -0.1735 -0.1981 0.3668  272  PHE A CE2 
1927 C CZ  . PHE A 238 ? 1.4352 1.0779 1.9080 -0.2001 -0.1887 0.3713  272  PHE A CZ  
1928 N N   . HIS A 239 ? 1.4585 1.1420 2.0404 -0.0976 -0.2230 0.2653  273  HIS A N   
1929 C CA  . HIS A 239 ? 1.3959 1.0646 1.9607 -0.0566 -0.2400 0.2788  273  HIS A CA  
1930 C C   . HIS A 239 ? 1.2784 0.9790 1.8653 -0.0349 -0.2583 0.2525  273  HIS A C   
1931 O O   . HIS A 239 ? 1.2389 0.9275 1.8100 -0.0151 -0.2728 0.2592  273  HIS A O   
1932 C CB  . HIS A 239 ? 1.3687 1.0249 1.9200 -0.0234 -0.2354 0.2925  273  HIS A CB  
1933 C CG  . HIS A 239 ? 1.4014 1.0182 1.9184 -0.0379 -0.2254 0.3264  273  HIS A CG  
1934 N ND1 . HIS A 239 ? 1.4377 1.0452 1.9483 -0.0699 -0.2052 0.3283  273  HIS A ND1 
1935 C CD2 . HIS A 239 ? 1.4094 0.9988 1.8955 -0.0276 -0.2321 0.3590  273  HIS A CD2 
1936 C CE1 . HIS A 239 ? 1.4962 1.0740 1.9742 -0.0805 -0.2022 0.3618  273  HIS A CE1 
1937 N NE2 . HIS A 239 ? 1.4646 1.0518 1.9155 -0.0525 -0.2113 0.3683  273  HIS A NE2 
1938 N N   . VAL A 240 ? 1.2629 1.0068 1.8854 -0.0390 -0.2574 0.2227  274  VAL A N   
1939 C CA  . VAL A 240 ? 1.3828 1.1647 2.0280 -0.0299 -0.2755 0.1960  274  VAL A CA  
1940 C C   . VAL A 240 ? 1.4438 1.2086 2.0869 -0.0635 -0.2796 0.1912  274  VAL A C   
1941 O O   . VAL A 240 ? 1.4425 1.2061 2.0793 -0.0526 -0.2952 0.1816  274  VAL A O   
1942 C CB  . VAL A 240 ? 1.2695 1.1071 1.9574 -0.0313 -0.2718 0.1691  274  VAL A CB  
1943 C CG1 . VAL A 240 ? 1.2612 1.1420 1.9749 -0.0392 -0.2898 0.1404  274  VAL A CG1 
1944 C CG2 . VAL A 240 ? 1.1410 0.9981 1.8358 0.0132  -0.2697 0.1750  274  VAL A CG2 
1945 N N   . LEU A 241 ? 1.5169 1.2673 2.1646 -0.1052 -0.2638 0.1986  275  LEU A N   
1946 C CA  . LEU A 241 ? 1.4766 1.2069 2.1262 -0.1366 -0.2635 0.2004  275  LEU A CA  
1947 C C   . LEU A 241 ? 1.4592 1.1411 2.0736 -0.1212 -0.2671 0.2276  275  LEU A C   
1948 O O   . LEU A 241 ? 1.5438 1.2102 2.1583 -0.1237 -0.2736 0.2194  275  LEU A O   
1949 C CB  . LEU A 241 ? 1.4015 1.1312 2.0623 -0.1818 -0.2444 0.2110  275  LEU A CB  
1950 C CG  . LEU A 241 ? 1.2773 1.0549 1.9777 -0.2052 -0.2389 0.1826  275  LEU A CG  
1951 C CD1 . LEU A 241 ? 1.2904 1.0673 1.9957 -0.2496 -0.2193 0.1976  275  LEU A CD1 
1952 C CD2 . LEU A 241 ? 1.1905 0.9924 1.9205 -0.2111 -0.2529 0.1530  275  LEU A CD2 
1953 N N   . THR A 242 ? 1.3540 1.0109 1.9387 -0.1059 -0.2613 0.2597  276  THR A N   
1954 C CA  . THR A 242 ? 1.3519 0.9673 1.9047 -0.0887 -0.2637 0.2894  276  THR A CA  
1955 C C   . THR A 242 ? 1.4910 1.1087 2.0324 -0.0465 -0.2814 0.2749  276  THR A C   
1956 O O   . THR A 242 ? 1.6035 1.1908 2.1262 -0.0358 -0.2841 0.2850  276  THR A O   
1957 C CB  . THR A 242 ? 1.2471 0.8418 1.7721 -0.0840 -0.2546 0.3281  276  THR A CB  
1958 O OG1 . THR A 242 ? 1.3716 0.9827 1.8942 -0.0550 -0.2586 0.3201  276  THR A OG1 
1959 C CG2 . THR A 242 ? 1.0240 0.6209 1.5545 -0.1296 -0.2373 0.3437  276  THR A CG2 
1960 N N   . PHE A 243 ? 1.4252 1.0810 1.9778 -0.0212 -0.2920 0.2531  277  PHE A N   
1961 C CA  . PHE A 243 ? 1.4619 1.1324 2.0045 0.0172  -0.3101 0.2392  277  PHE A CA  
1962 C C   . PHE A 243 ? 1.5789 1.2614 2.1353 0.0014  -0.3195 0.2043  277  PHE A C   
1963 O O   . PHE A 243 ? 1.6380 1.3023 2.1729 0.0168  -0.3274 0.1997  277  PHE A O   
1964 C CB  . PHE A 243 ? 1.4003 1.1166 1.9569 0.0482  -0.3177 0.2298  277  PHE A CB  
1965 C CG  . PHE A 243 ? 1.4063 1.1533 1.9559 0.0859  -0.3378 0.2158  277  PHE A CG  
1966 C CD1 . PHE A 243 ? 1.3777 1.1023 1.8926 0.1208  -0.3435 0.2394  277  PHE A CD1 
1967 C CD2 . PHE A 243 ? 1.3408 1.1450 1.9179 0.0853  -0.3513 0.1805  277  PHE A CD2 
1968 C CE1 . PHE A 243 ? 1.2912 1.0501 1.7970 0.1546  -0.3618 0.2267  277  PHE A CE1 
1969 C CE2 . PHE A 243 ? 1.2893 1.1309 1.8577 0.1172  -0.3709 0.1681  277  PHE A CE2 
1970 C CZ  . PHE A 243 ? 1.2811 1.0998 1.8126 0.1519  -0.3759 0.1906  277  PHE A CZ  
1971 N N   . LEU A 244 ? 1.6352 1.3478 2.2271 -0.0309 -0.3175 0.1781  278  LEU A N   
1972 C CA  . LEU A 244 ? 1.6124 1.3333 2.2201 -0.0535 -0.3247 0.1445  278  LEU A CA  
1973 C C   . LEU A 244 ? 1.5464 1.2064 2.1385 -0.0733 -0.3127 0.1583  278  LEU A C   
1974 O O   . LEU A 244 ? 1.4931 1.1369 2.0773 -0.0737 -0.3182 0.1374  278  LEU A O   
1975 C CB  . LEU A 244 ? 1.5983 1.3619 2.2497 -0.0876 -0.3220 0.1205  278  LEU A CB  
1976 C CG  . LEU A 244 ? 1.6076 1.4343 2.2819 -0.0684 -0.3293 0.1089  278  LEU A CG  
1977 C CD1 . LEU A 244 ? 1.6345 1.5057 2.3536 -0.1029 -0.3266 0.0838  278  LEU A CD1 
1978 C CD2 . LEU A 244 ? 1.6186 1.4820 2.2834 -0.0297 -0.3508 0.0945  278  LEU A CD2 
1979 N N   . ASP A 245 ? 1.5138 1.1408 2.1015 -0.0899 -0.2948 0.1943  279  ASP A N   
1980 C CA  . ASP A 245 ? 1.5015 1.0733 2.0767 -0.1032 -0.2807 0.2180  279  ASP A CA  
1981 C C   . ASP A 245 ? 1.4702 1.0087 2.0077 -0.0651 -0.2854 0.2299  279  ASP A C   
1982 O O   . ASP A 245 ? 1.4950 0.9968 2.0254 -0.0673 -0.2800 0.2231  279  ASP A O   
1983 C CB  . ASP A 245 ? 1.5057 1.0622 2.0808 -0.1245 -0.2627 0.2608  279  ASP A CB  
1984 C CG  . ASP A 245 ? 1.7233 1.2390 2.3050 -0.1508 -0.2449 0.2841  279  ASP A CG  
1985 O OD1 . ASP A 245 ? 1.8597 1.3403 2.4339 -0.1407 -0.2434 0.2770  279  ASP A OD1 
1986 O OD2 . ASP A 245 ? 1.8017 1.3215 2.3967 -0.1815 -0.2307 0.3103  279  ASP A OD2 
1987 N N   . ALA A 246 ? 1.4858 1.0358 1.9998 -0.0292 -0.2936 0.2472  280  ALA A N   
1988 C CA  . ALA A 246 ? 1.5140 1.0400 1.9921 0.0099  -0.2989 0.2593  280  ALA A CA  
1989 C C   . ALA A 246 ? 1.6138 1.1533 2.0879 0.0214  -0.3130 0.2149  280  ALA A C   
1990 O O   . ALA A 246 ? 1.6497 1.1530 2.0996 0.0349  -0.3094 0.2141  280  ALA A O   
1991 C CB  . ALA A 246 ? 1.4430 0.9871 1.9028 0.0451  -0.3062 0.2835  280  ALA A CB  
1992 N N   . LEU A 247 ? 1.5993 1.1936 2.0967 0.0154  -0.3280 0.1776  281  LEU A N   
1993 C CA  . LEU A 247 ? 1.6360 1.2540 2.1308 0.0189  -0.3432 0.1326  281  LEU A CA  
1994 C C   . LEU A 247 ? 1.7284 1.3038 2.2303 -0.0159 -0.3315 0.1104  281  LEU A C   
1995 O O   . LEU A 247 ? 1.8071 1.3665 2.2885 -0.0095 -0.3351 0.0838  281  LEU A O   
1996 C CB  . LEU A 247 ? 1.6295 1.3225 2.1549 0.0142  -0.3603 0.1023  281  LEU A CB  
1997 C CG  . LEU A 247 ? 1.5568 1.2943 2.0830 0.0499  -0.3691 0.1222  281  LEU A CG  
1998 C CD1 . LEU A 247 ? 1.5875 1.3969 2.1534 0.0400  -0.3800 0.0956  281  LEU A CD1 
1999 C CD2 . LEU A 247 ? 1.4997 1.2466 1.9905 0.0963  -0.3819 0.1297  281  LEU A CD2 
2000 N N   . ALA A 248 ? 1.7268 1.2837 2.2582 -0.0539 -0.3157 0.1204  282  ALA A N   
2001 C CA  . ALA A 248 ? 1.5935 1.1056 2.1378 -0.0875 -0.3006 0.1051  282  ALA A CA  
2002 C C   . ALA A 248 ? 1.6071 1.0487 2.1211 -0.0705 -0.2825 0.1326  282  ALA A C   
2003 O O   . ALA A 248 ? 1.7959 1.2006 2.3004 -0.0749 -0.2759 0.1065  282  ALA A O   
2004 C CB  . ALA A 248 ? 1.2027 0.7173 1.7872 -0.1292 -0.2869 0.1176  282  ALA A CB  
2005 N N   . TRP A 249 ? 1.5465 0.9693 2.0452 -0.0515 -0.2729 0.1850  283  TRP A N   
2006 C CA  . TRP A 249 ? 1.6298 0.9931 2.1009 -0.0304 -0.2555 0.2178  283  TRP A CA  
2007 C C   . TRP A 249 ? 1.8246 1.1803 2.2586 0.0050  -0.2653 0.1923  283  TRP A C   
2008 O O   . TRP A 249 ? 1.8296 1.1311 2.2462 0.0135  -0.2487 0.1933  283  TRP A O   
2009 C CB  . TRP A 249 ? 1.6897 1.0503 2.1481 -0.0138 -0.2493 0.2778  283  TRP A CB  
2010 C CG  . TRP A 249 ? 1.7052 1.0743 2.1925 -0.0487 -0.2378 0.3078  283  TRP A CG  
2011 C CD1 . TRP A 249 ? 1.6842 1.0955 2.1768 -0.0553 -0.2446 0.3214  283  TRP A CD1 
2012 C CD2 . TRP A 249 ? 1.6547 1.0136 2.1527 -0.0791 -0.2088 0.3181  283  TRP A CD2 
2013 N NE1 . TRP A 249 ? 1.6399 1.0743 2.1407 -0.0890 -0.2221 0.3343  283  TRP A NE1 
2014 C CE2 . TRP A 249 ? 1.5863 0.9936 2.0903 -0.1022 -0.2008 0.3342  283  TRP A CE2 
2015 C CE3 . TRP A 249 ? 1.7216 1.0384 2.2215 -0.0869 -0.1864 0.3133  283  TRP A CE3 
2016 C CZ2 . TRP A 249 ? 1.4609 0.8818 1.9714 -0.1299 -0.1750 0.3468  283  TRP A CZ2 
2017 C CZ3 . TRP A 249 ? 1.7313 1.0604 2.2388 -0.1137 -0.1584 0.3278  283  TRP A CZ3 
2018 C CH2 . TRP A 249 ? 1.5688 0.9524 2.0811 -0.1338 -0.1547 0.3450  283  TRP A CH2 
2019 N N   . MET A 250 ? 2.0542 1.4652 2.4760 0.0275  -0.2903 0.1713  284  MET A N   
2020 C CA  . MET A 250 ? 2.2544 1.6706 2.6404 0.0594  -0.3016 0.1454  284  MET A CA  
2021 C C   . MET A 250 ? 2.2582 1.6657 2.6477 0.0342  -0.3023 0.0870  284  MET A C   
2022 O O   . MET A 250 ? 2.3643 1.7452 2.7207 0.0511  -0.2989 0.0666  284  MET A O   
2023 C CB  . MET A 250 ? 2.3746 1.8611 2.7527 0.0885  -0.3279 0.1414  284  MET A CB  
2024 C CG  . MET A 250 ? 2.4150 1.9043 2.7815 0.1194  -0.3269 0.1958  284  MET A CG  
2025 S SD  . MET A 250 ? 2.5269 1.9893 2.8424 0.1712  -0.3244 0.2244  284  MET A SD  
2026 C CE  . MET A 250 ? 2.5463 1.9253 2.8572 0.1583  -0.2920 0.2615  284  MET A CE  
2027 N N   . GLY A 251 ? 2.8030 1.6549 2.9876 0.5359  -0.0282 -0.1553 285  GLY A N   
2028 C CA  . GLY A 251 ? 2.7872 1.5534 2.9397 0.5235  -0.0670 -0.2205 285  GLY A CA  
2029 C C   . GLY A 251 ? 2.6940 1.4897 2.8395 0.5281  -0.1313 -0.2929 285  GLY A C   
2030 O O   . GLY A 251 ? 2.7175 1.4471 2.8382 0.5140  -0.1702 -0.3560 285  GLY A O   
2031 N N   . VAL A 252 ? 2.6467 1.5397 2.8133 0.5465  -0.1423 -0.2866 286  VAL A N   
2032 C CA  . VAL A 252 ? 2.6658 1.6015 2.8334 0.5576  -0.2027 -0.3533 286  VAL A CA  
2033 C C   . VAL A 252 ? 2.6017 1.5435 2.8403 0.5125  -0.2566 -0.4135 286  VAL A C   
2034 O O   . VAL A 252 ? 2.7664 1.6824 2.9980 0.5038  -0.3074 -0.4872 286  VAL A O   
2035 C CB  . VAL A 252 ? 2.5008 1.5388 2.6821 0.5829  -0.1942 -0.3254 286  VAL A CB  
2036 C CG1 . VAL A 252 ? 2.5441 1.6316 2.7229 0.6040  -0.2535 -0.3913 286  VAL A CG1 
2037 C CG2 . VAL A 252 ? 2.4809 1.5185 2.6200 0.6119  -0.1389 -0.2660 286  VAL A CG2 
2038 N N   . ILE A 253 ? 2.3427 1.3243 2.6592 0.4781  -0.2462 -0.3851 287  ILE A N   
2039 C CA  . ILE A 253 ? 2.2992 1.2927 2.7095 0.4231  -0.2861 -0.4323 287  ILE A CA  
2040 C C   . ILE A 253 ? 2.4096 1.3216 2.8306 0.3803  -0.2542 -0.3986 287  ILE A C   
2041 O O   . ILE A 253 ? 2.3785 1.2907 2.7910 0.3880  -0.2054 -0.3271 287  ILE A O   
2042 C CB  . ILE A 253 ? 1.9467 1.0562 2.4508 0.4148  -0.2993 -0.4290 287  ILE A CB  
2043 C CG1 . ILE A 253 ? 1.8981 1.0395 2.3949 0.4263  -0.2461 -0.3454 287  ILE A CG1 
2044 C CG2 . ILE A 253 ? 1.9370 1.1224 2.4330 0.4550  -0.3364 -0.4744 287  ILE A CG2 
2045 C CD1 . ILE A 253 ? 1.8170 1.0588 2.4023 0.4113  -0.2539 -0.3395 287  ILE A CD1 
2046 N N   . ASN A 254 ? 2.5298 1.3735 2.9641 0.3329  -0.2804 -0.4499 288  ASN A N   
2047 C CA  . ASN A 254 ? 2.6080 1.3687 3.0510 0.2865  -0.2497 -0.4206 288  ASN A CA  
2048 C C   . ASN A 254 ? 2.5080 1.3128 3.0453 0.1998  -0.2735 -0.4511 288  ASN A C   
2049 O O   . ASN A 254 ? 2.5397 1.2720 3.0884 0.1534  -0.2501 -0.4313 288  ASN A O   
2050 C CB  . ASN A 254 ? 2.8440 1.4728 3.1759 0.2995  -0.2316 -0.4301 288  ASN A CB  
2051 C CG  . ASN A 254 ? 3.0250 1.6298 3.3226 0.2909  -0.2858 -0.5181 288  ASN A CG  
2052 O OD1 . ASN A 254 ? 3.0738 1.7432 3.4453 0.2474  -0.3387 -0.5793 288  ASN A OD1 
2053 N ND2 . ASN A 254 ? 3.1323 1.6529 3.3195 0.3307  -0.2717 -0.5258 288  ASN A ND2 
2054 N N   . SER A 255 ? 2.4448 1.3866 3.0381 0.1743  -0.3100 -0.4874 289  SER A N   
2055 C CA  . SER A 255 ? 2.4714 1.4934 3.1463 0.0871  -0.3263 -0.5075 289  SER A CA  
2056 C C   . SER A 255 ? 2.4483 1.4886 3.1876 0.0511  -0.2861 -0.4437 289  SER A C   
2057 O O   . SER A 255 ? 2.3894 1.4883 3.1534 0.0840  -0.2648 -0.3964 289  SER A O   
2058 C CB  . SER A 255 ? 2.3925 1.5767 3.1188 0.0832  -0.3656 -0.5441 289  SER A CB  
2059 O OG  . SER A 255 ? 2.3488 1.6272 3.1620 0.0016  -0.3778 -0.5560 289  SER A OG  
2060 N N   . CYS A 256 ? 2.4653 1.4524 3.2284 -0.0178 -0.2756 -0.4428 290  CYS A N   
2061 C CA  . CYS A 256 ? 2.4306 1.4370 3.2543 -0.0551 -0.2375 -0.3822 290  CYS A CA  
2062 C C   . CYS A 256 ? 2.3441 1.5224 3.2540 -0.0728 -0.2451 -0.3690 290  CYS A C   
2063 O O   . CYS A 256 ? 2.2909 1.5072 3.2292 -0.0591 -0.2147 -0.3118 290  CYS A O   
2064 C CB  . CYS A 256 ? 2.4964 1.4325 3.3383 -0.1339 -0.2305 -0.3925 290  CYS A CB  
2065 S SG  . CYS A 256 ? 2.4999 1.6000 3.4581 -0.2259 -0.2539 -0.4132 290  CYS A SG  
2066 N N   . GLU A 257 ? 2.3851 1.6713 3.3351 -0.1026 -0.2855 -0.4215 291  GLU A N   
2067 C CA  . GLU A 257 ? 2.3423 1.7914 3.3723 -0.1197 -0.2915 -0.4122 291  GLU A CA  
2068 C C   . GLU A 257 ? 2.2479 1.7437 3.2607 -0.0475 -0.2820 -0.3853 291  GLU A C   
2069 O O   . GLU A 257 ? 2.1710 1.7400 3.2288 -0.0514 -0.2609 -0.3447 291  GLU A O   
2070 C CB  . GLU A 257 ? 2.4077 1.9636 3.4767 -0.1551 -0.3376 -0.4745 291  GLU A CB  
2071 C CG  . GLU A 257 ? 2.3766 2.1057 3.5284 -0.1721 -0.3435 -0.4680 291  GLU A CG  
2072 C CD  . GLU A 257 ? 2.4412 2.2848 3.6331 -0.2031 -0.3890 -0.5265 291  GLU A CD  
2073 O OE1 . GLU A 257 ? 2.5649 2.3545 3.7174 -0.2122 -0.4193 -0.5748 291  GLU A OE1 
2074 O OE2 . GLU A 257 ? 2.3830 2.3738 3.6437 -0.2171 -0.3945 -0.5240 291  GLU A OE2 
2075 N N   . VAL A 258 ? 2.2467 1.6970 3.1911 0.0178  -0.2964 -0.4072 292  VAL A N   
2076 C CA  . VAL A 258 ? 2.1167 1.6059 3.0430 0.0841  -0.2878 -0.3842 292  VAL A CA  
2077 C C   . VAL A 258 ? 1.9266 1.3613 2.8444 0.1010  -0.2443 -0.3167 292  VAL A C   
2078 O O   . VAL A 258 ? 1.8881 1.3942 2.8359 0.1112  -0.2298 -0.2848 292  VAL A O   
2079 C CB  . VAL A 258 ? 2.2329 1.6774 3.0846 0.1509  -0.3097 -0.4189 292  VAL A CB  
2080 C CG1 . VAL A 258 ? 2.1678 1.6459 3.0014 0.2165  -0.2977 -0.3929 292  VAL A CG1 
2081 C CG2 . VAL A 258 ? 2.3042 1.8194 3.1668 0.1334  -0.3558 -0.4850 292  VAL A CG2 
2082 N N   . ILE A 259 ? 1.9441 1.2542 2.8197 0.1042  -0.2227 -0.2939 293  ILE A N   
2083 C CA  . ILE A 259 ? 1.8023 1.0690 2.6704 0.1240  -0.1816 -0.2259 293  ILE A CA  
2084 C C   . ILE A 259 ? 1.6648 1.0019 2.6050 0.0682  -0.1621 -0.1883 293  ILE A C   
2085 O O   . ILE A 259 ? 1.4609 0.8396 2.4186 0.0811  -0.1396 -0.1399 293  ILE A O   
2086 C CB  . ILE A 259 ? 1.8403 0.9573 2.6433 0.1462  -0.1609 -0.2092 293  ILE A CB  
2087 C CG1 . ILE A 259 ? 1.6759 0.7288 2.4030 0.2030  -0.1818 -0.2505 293  ILE A CG1 
2088 C CG2 . ILE A 259 ? 1.5879 0.6728 2.3833 0.1750  -0.1186 -0.1346 293  ILE A CG2 
2089 C CD1 . ILE A 259 ? 1.7811 0.6957 2.4228 0.2350  -0.1560 -0.2307 293  ILE A CD1 
2090 N N   . ALA A 260 ? 1.8082 1.1638 2.7910 0.0037  -0.1709 -0.2100 294  ALA A N   
2091 C CA  . ALA A 260 ? 1.7447 1.1759 2.7972 -0.0492 -0.1525 -0.1755 294  ALA A CA  
2092 C C   . ALA A 260 ? 1.6077 1.1784 2.7039 -0.0439 -0.1621 -0.1769 294  ALA A C   
2093 O O   . ALA A 260 ? 1.5787 1.2041 2.7077 -0.0554 -0.1392 -0.1323 294  ALA A O   
2094 C CB  . ALA A 260 ? 1.9130 1.3428 3.0048 -0.1207 -0.1621 -0.2029 294  ALA A CB  
2095 N N   . VAL A 261 ? 1.5607 1.1891 2.6533 -0.0241 -0.1952 -0.2280 295  VAL A N   
2096 C CA  . VAL A 261 ? 1.4762 1.2228 2.5979 -0.0086 -0.2020 -0.2316 295  VAL A CA  
2097 C C   . VAL A 261 ? 1.4789 1.2027 2.5631 0.0443  -0.1825 -0.1942 295  VAL A C   
2098 O O   . VAL A 261 ? 1.4305 1.2270 2.5397 0.0423  -0.1706 -0.1710 295  VAL A O   
2099 C CB  . VAL A 261 ? 1.3352 1.1435 2.4565 0.0075  -0.2402 -0.2925 295  VAL A CB  
2100 C CG1 . VAL A 261 ? 1.1580 1.0623 2.2894 0.0415  -0.2424 -0.2942 295  VAL A CG1 
2101 C CG2 . VAL A 261 ? 1.4226 1.2900 2.5994 -0.0560 -0.2600 -0.3254 295  VAL A CG2 
2102 N N   . ILE A 262 ? 1.5636 1.1868 2.5860 0.0908  -0.1785 -0.1878 296  ILE A N   
2103 C CA  . ILE A 262 ? 1.5006 1.1013 2.4902 0.1376  -0.1592 -0.1491 296  ILE A CA  
2104 C C   . ILE A 262 ? 1.4446 1.0558 2.4611 0.1116  -0.1276 -0.0884 296  ILE A C   
2105 O O   . ILE A 262 ? 1.3937 1.0644 2.4235 0.1158  -0.1179 -0.0643 296  ILE A O   
2106 C CB  . ILE A 262 ? 1.5769 1.0676 2.4977 0.1910  -0.1575 -0.1489 296  ILE A CB  
2107 C CG1 . ILE A 262 ? 1.6667 1.1621 2.5541 0.2289  -0.1886 -0.2046 296  ILE A CG1 
2108 C CG2 . ILE A 262 ? 1.4802 0.9452 2.3768 0.2286  -0.1308 -0.0952 296  ILE A CG2 
2109 C CD1 . ILE A 262 ? 1.7131 1.1012 2.5275 0.2834  -0.1880 -0.2086 296  ILE A CD1 
2110 N N   . ASP A 263 ? 1.5034 1.0545 2.5244 0.0850  -0.1106 -0.0629 297  ASP A N   
2111 C CA  . ASP A 263 ? 1.4645 1.0288 2.5091 0.0647  -0.0794 -0.0007 297  ASP A CA  
2112 C C   . ASP A 263 ? 1.2684 0.9447 2.3737 0.0165  -0.0792 0.0025  297  ASP A C   
2113 O O   . ASP A 263 ? 1.1562 0.8811 2.2775 0.0102  -0.0607 0.0463  297  ASP A O   
2114 C CB  . ASP A 263 ? 1.7358 1.2020 2.7663 0.0526  -0.0580 0.0269  297  ASP A CB  
2115 C CG  . ASP A 263 ? 1.9435 1.2992 2.9083 0.1083  -0.0490 0.0381  297  ASP A CG  
2116 O OD1 . ASP A 263 ? 1.9214 1.2888 2.8609 0.1536  -0.0504 0.0469  297  ASP A OD1 
2117 O OD2 . ASP A 263 ? 2.0729 1.3268 3.0089 0.1073  -0.0386 0.0390  297  ASP A OD2 
2118 N N   . LEU A 264 ? 1.3010 1.0257 2.4397 -0.0170 -0.0999 -0.0429 298  LEU A N   
2119 C CA  . LEU A 264 ? 1.2132 1.0500 2.4090 -0.0587 -0.0982 -0.0402 298  LEU A CA  
2120 C C   . LEU A 264 ? 1.1451 1.0609 2.3376 -0.0331 -0.1039 -0.0463 298  LEU A C   
2121 O O   . LEU A 264 ? 1.1003 1.0846 2.3170 -0.0516 -0.0893 -0.0179 298  LEU A O   
2122 C CB  . LEU A 264 ? 1.1088 0.9857 2.3435 -0.0982 -0.1195 -0.0870 298  LEU A CB  
2123 C CG  . LEU A 264 ? 1.1287 1.1377 2.4208 -0.1301 -0.1240 -0.0978 298  LEU A CG  
2124 C CD1 . LEU A 264 ? 1.0422 1.0859 2.3709 -0.1692 -0.0940 -0.0458 298  LEU A CD1 
2125 C CD2 . LEU A 264 ? 1.1707 1.2261 2.4998 -0.1615 -0.1501 -0.1480 298  LEU A CD2 
2126 N N   . ALA A 265 ? 1.2042 1.1065 2.3618 0.0104  -0.1237 -0.0829 299  ALA A N   
2127 C CA  . ALA A 265 ? 1.1247 1.0894 2.2737 0.0357  -0.1285 -0.0948 299  ALA A CA  
2128 C C   . ALA A 265 ? 1.0689 0.9960 2.1797 0.0668  -0.1129 -0.0588 299  ALA A C   
2129 O O   . ALA A 265 ? 1.0373 1.0123 2.1422 0.0757  -0.1109 -0.0598 299  ALA A O   
2130 C CB  . ALA A 265 ? 1.1632 1.1375 2.2938 0.0699  -0.1556 -0.1501 299  ALA A CB  
2131 N N   . LEU A 266 ? 0.9619 0.8049 2.0456 0.0830  -0.1011 -0.0270 300  LEU A N   
2132 C CA  . LEU A 266 ? 1.1934 1.0077 2.2439 0.1141  -0.0880 0.0073  300  LEU A CA  
2133 C C   . LEU A 266 ? 1.2097 1.0914 2.2802 0.0881  -0.0732 0.0435  300  LEU A C   
2134 O O   . LEU A 266 ? 1.3431 1.2432 2.3936 0.1043  -0.0742 0.0413  300  LEU A O   
2135 C CB  . LEU A 266 ? 1.1573 0.8790 2.1800 0.1365  -0.0743 0.0411  300  LEU A CB  
2136 C CG  . LEU A 266 ? 1.1598 0.8092 2.1314 0.1912  -0.0831 0.0210  300  LEU A CG  
2137 C CD1 . LEU A 266 ? 1.1028 0.6735 2.0453 0.2179  -0.0621 0.0675  300  LEU A CD1 
2138 C CD2 . LEU A 266 ? 1.2100 0.8902 2.1637 0.2174  -0.0890 0.0089  300  LEU A CD2 
2139 N N   . PRO A 267 ? 1.2130 1.1321 2.3185 0.0481  -0.0591 0.0764  301  PRO A N   
2140 C CA  . PRO A 267 ? 1.1248 1.1139 2.2422 0.0262  -0.0474 0.1089  301  PRO A CA  
2141 C C   . PRO A 267 ? 1.2235 1.2822 2.3432 0.0192  -0.0590 0.0706  301  PRO A C   
2142 O O   . PRO A 267 ? 1.3481 1.4382 2.4524 0.0174  -0.0551 0.0823  301  PRO A O   
2143 C CB  . PRO A 267 ? 1.1305 1.1468 2.2851 -0.0123 -0.0309 0.1457  301  PRO A CB  
2144 C CG  . PRO A 267 ? 1.1157 1.0481 2.2670 -0.0042 -0.0277 0.1471  301  PRO A CG  
2145 C CD  . PRO A 267 ? 1.2304 1.1269 2.3621 0.0206  -0.0515 0.0879  301  PRO A CD  
2146 N N   . PHE A 268 ? 1.1143 1.1982 2.2508 0.0154  -0.0727 0.0248  302  PHE A N   
2147 C CA  . PHE A 268 ? 1.0772 1.2242 2.2115 0.0180  -0.0809 -0.0120 302  PHE A CA  
2148 C C   . PHE A 268 ? 0.9961 1.1022 2.0824 0.0603  -0.0879 -0.0333 302  PHE A C   
2149 O O   . PHE A 268 ? 0.9869 1.1228 2.0541 0.0620  -0.0849 -0.0417 302  PHE A O   
2150 C CB  . PHE A 268 ? 1.1334 1.3219 2.2994 0.0101  -0.0941 -0.0529 302  PHE A CB  
2151 C CG  . PHE A 268 ? 1.2738 1.5057 2.4906 -0.0365 -0.0854 -0.0331 302  PHE A CG  
2152 C CD1 . PHE A 268 ? 1.2867 1.6076 2.5315 -0.0656 -0.0751 -0.0246 302  PHE A CD1 
2153 C CD2 . PHE A 268 ? 1.3938 1.5720 2.6265 -0.0505 -0.0855 -0.0231 302  PHE A CD2 
2154 C CE1 . PHE A 268 ? 1.2901 1.6509 2.5825 -0.1081 -0.0640 -0.0024 302  PHE A CE1 
2155 C CE2 . PHE A 268 ? 1.4033 1.6125 2.6817 -0.0957 -0.0744 -0.0031 302  PHE A CE2 
2156 C CZ  . PHE A 268 ? 1.3601 1.6633 2.6710 -0.1246 -0.0632 0.0091  302  PHE A CZ  
2157 N N   . ALA A 269 ? 1.0375 1.0702 2.0998 0.0951  -0.0955 -0.0421 303  ALA A N   
2158 C CA  . ALA A 269 ? 1.0834 1.0714 2.0995 0.1381  -0.0992 -0.0581 303  ALA A CA  
2159 C C   . ALA A 269 ? 1.0005 0.9668 1.9953 0.1345  -0.0849 -0.0177 303  ALA A C   
2160 O O   . ALA A 269 ? 1.0795 1.0406 2.0443 0.1470  -0.0831 -0.0283 303  ALA A O   
2161 C CB  . ALA A 269 ? 1.1561 1.0753 2.1506 0.1775  -0.1100 -0.0748 303  ALA A CB  
2162 N N   . ILE A 270 ? 0.8666 0.8193 1.8755 0.1178  -0.0739 0.0298  304  ILE A N   
2163 C CA  . ILE A 270 ? 1.0380 0.9957 2.0375 0.1062  -0.0614 0.0737  304  ILE A CA  
2164 C C   . ILE A 270 ? 1.0995 1.1264 2.1020 0.0733  -0.0605 0.0666  304  ILE A C   
2165 O O   . ILE A 270 ? 1.1668 1.1897 2.1417 0.0731  -0.0591 0.0662  304  ILE A O   
2166 C CB  . ILE A 270 ? 1.0212 0.9745 2.0428 0.0924  -0.0480 0.1288  304  ILE A CB  
2167 C CG1 . ILE A 270 ? 1.0080 0.8835 2.0189 0.1263  -0.0475 0.1298  304  ILE A CG1 
2168 C CG2 . ILE A 270 ? 0.9435 0.9110 1.9581 0.0852  -0.0370 0.1776  304  ILE A CG2 
2169 C CD1 . ILE A 270 ? 0.9673 0.8289 1.9969 0.1160  -0.0316 0.1783  304  ILE A CD1 
2170 N N   . LEU A 271 ? 1.0117 1.1003 2.0450 0.0440  -0.0606 0.0599  305  LEU A N   
2171 C CA  . LEU A 271 ? 1.0727 1.2279 2.1033 0.0169  -0.0591 0.0490  305  LEU A CA  
2172 C C   . LEU A 271 ? 1.0580 1.1974 2.0522 0.0408  -0.0659 -0.0009 305  LEU A C   
2173 O O   . LEU A 271 ? 1.0081 1.1672 1.9762 0.0274  -0.0629 -0.0085 305  LEU A O   
2174 C CB  . LEU A 271 ? 1.1081 1.3317 2.1788 -0.0120 -0.0560 0.0492  305  LEU A CB  
2175 C CG  . LEU A 271 ? 1.1078 1.4070 2.1742 -0.0388 -0.0517 0.0416  305  LEU A CG  
2176 C CD1 . LEU A 271 ? 1.0228 1.3485 2.0799 -0.0655 -0.0444 0.0856  305  LEU A CD1 
2177 C CD2 . LEU A 271 ? 1.1312 1.4961 2.2390 -0.0594 -0.0476 0.0369  305  LEU A CD2 
2178 N N   . LEU A 272 ? 1.0531 1.1540 2.0403 0.0778  -0.0745 -0.0348 306  LEU A N   
2179 C CA  . LEU A 272 ? 0.9996 1.0824 1.9495 0.1091  -0.0780 -0.0785 306  LEU A CA  
2180 C C   . LEU A 272 ? 1.0769 1.0950 1.9809 0.1243  -0.0726 -0.0704 306  LEU A C   
2181 O O   . LEU A 272 ? 1.0747 1.0854 1.9426 0.1265  -0.0681 -0.0919 306  LEU A O   
2182 C CB  . LEU A 272 ? 0.8354 0.9024 1.7905 0.1473  -0.0897 -0.1123 306  LEU A CB  
2183 C CG  . LEU A 272 ? 0.9637 1.0303 1.8863 0.1846  -0.0917 -0.1567 306  LEU A CG  
2184 C CD1 . LEU A 272 ? 0.9289 1.0659 1.8567 0.1625  -0.0848 -0.1711 306  LEU A CD1 
2185 C CD2 . LEU A 272 ? 1.0325 1.1040 1.9674 0.2194  -0.1064 -0.1862 306  LEU A CD2 
2186 N N   . GLY A 273 ? 1.1221 1.0900 2.0252 0.1348  -0.0711 -0.0388 307  GLY A N   
2187 C CA  . GLY A 273 ? 1.1856 1.1041 2.0545 0.1397  -0.0639 -0.0217 307  GLY A CA  
2188 C C   . GLY A 273 ? 1.2109 1.1706 2.0765 0.0922  -0.0588 -0.0034 307  GLY A C   
2189 O O   . GLY A 273 ? 1.1996 1.1327 2.0270 0.0875  -0.0551 -0.0177 307  GLY A O   
2190 N N   . PHE A 274 ? 1.3175 1.3412 2.2196 0.0558  -0.0584 0.0272  308  PHE A N   
2191 C CA  . PHE A 274 ? 1.4093 1.4848 2.3065 0.0103  -0.0562 0.0433  308  PHE A CA  
2192 C C   . PHE A 274 ? 1.5112 1.6050 2.3775 0.0017  -0.0570 -0.0032 308  PHE A C   
2193 O O   . PHE A 274 ? 1.6129 1.7116 2.4479 -0.0257 -0.0560 -0.0071 308  PHE A O   
2194 C CB  . PHE A 274 ? 1.4635 1.6090 2.4040 -0.0201 -0.0538 0.0857  308  PHE A CB  
2195 C CG  . PHE A 274 ? 1.4766 1.6070 2.4388 -0.0145 -0.0487 0.1393  308  PHE A CG  
2196 C CD1 . PHE A 274 ? 1.5216 1.6394 2.4704 -0.0215 -0.0467 0.1686  308  PHE A CD1 
2197 C CD2 . PHE A 274 ? 1.4360 1.5638 2.4309 -0.0023 -0.0442 0.1613  308  PHE A CD2 
2198 C CE1 . PHE A 274 ? 1.4998 1.6109 2.4690 -0.0107 -0.0393 0.2217  308  PHE A CE1 
2199 C CE2 . PHE A 274 ? 1.4683 1.5760 2.4765 0.0093  -0.0359 0.2115  308  PHE A CE2 
2200 C CZ  . PHE A 274 ? 1.4690 1.5722 2.4651 0.0081  -0.0328 0.2431  308  PHE A CZ  
2201 N N   . THR A 275 ? 1.5153 1.6207 2.3879 0.0248  -0.0585 -0.0390 309  THR A N   
2202 C CA  . THR A 275 ? 1.5237 1.6435 2.3631 0.0275  -0.0557 -0.0829 309  THR A CA  
2203 C C   . THR A 275 ? 1.6230 1.6608 2.4060 0.0576  -0.0519 -0.1137 309  THR A C   
2204 O O   . THR A 275 ? 1.6959 1.7247 2.4343 0.0532  -0.0459 -0.1436 309  THR A O   
2205 C CB  . THR A 275 ? 1.5142 1.6797 2.3813 0.0470  -0.0572 -0.1087 309  THR A CB  
2206 O OG1 . THR A 275 ? 1.5801 1.7021 2.4556 0.0896  -0.0632 -0.1219 309  THR A OG1 
2207 C CG2 . THR A 275 ? 1.4901 1.7334 2.4107 0.0130  -0.0571 -0.0785 309  THR A CG2 
2208 N N   . ASN A 276 ? 1.6052 1.5775 2.3841 0.0912  -0.0530 -0.1074 310  ASN A N   
2209 C CA  . ASN A 276 ? 1.5612 1.4491 2.2858 0.1147  -0.0457 -0.1253 310  ASN A CA  
2210 C C   . ASN A 276 ? 1.3462 1.2195 2.0472 0.0686  -0.0422 -0.1063 310  ASN A C   
2211 O O   . ASN A 276 ? 1.3026 1.1369 1.9518 0.0607  -0.0352 -0.1339 310  ASN A O   
2212 C CB  . ASN A 276 ? 1.6790 1.5060 2.4055 0.1584  -0.0464 -0.1142 310  ASN A CB  
2213 C CG  . ASN A 276 ? 1.8349 1.5761 2.5048 0.1987  -0.0362 -0.1400 310  ASN A CG  
2214 O OD1 . ASN A 276 ? 1.9375 1.6654 2.5694 0.2108  -0.0293 -0.1764 310  ASN A OD1 
2215 N ND2 . ASN A 276 ? 1.8873 1.5671 2.5484 0.2232  -0.0323 -0.1187 310  ASN A ND2 
2216 N N   . SER A 277 ? 1.3100 1.2156 2.0471 0.0371  -0.0466 -0.0587 311  SER A N   
2217 C CA  . SER A 277 ? 1.3219 1.2352 2.0448 -0.0127 -0.0468 -0.0370 311  SER A CA  
2218 C C   . SER A 277 ? 1.3100 1.2699 2.0085 -0.0519 -0.0490 -0.0615 311  SER A C   
2219 O O   . SER A 277 ? 1.3117 1.2527 1.9723 -0.0881 -0.0490 -0.0685 311  SER A O   
2220 C CB  . SER A 277 ? 1.2452 1.2090 2.0179 -0.0354 -0.0508 0.0225  311  SER A CB  
2221 O OG  . SER A 277 ? 1.1900 1.1060 1.9781 0.0049  -0.0468 0.0440  311  SER A OG  
2222 N N   . CYS A 278 ? 1.3956 1.4163 2.1131 -0.0471 -0.0504 -0.0751 312  CYS A N   
2223 C CA  . CYS A 278 ? 1.4791 1.5459 2.1689 -0.0771 -0.0500 -0.0992 312  CYS A CA  
2224 C C   . CYS A 278 ? 1.4486 1.4516 2.0745 -0.0505 -0.0406 -0.1554 312  CYS A C   
2225 O O   . CYS A 278 ? 1.5254 1.5264 2.1020 -0.0777 -0.0380 -0.1798 312  CYS A O   
2226 C CB  . CYS A 278 ? 1.5807 1.7395 2.3173 -0.0803 -0.0514 -0.0873 312  CYS A CB  
2227 S SG  . CYS A 278 ? 1.6536 1.8753 2.3579 -0.0991 -0.0465 -0.1205 312  CYS A SG  
2228 N N   . VAL A 279 ? 1.4046 1.3538 2.0258 0.0045  -0.0346 -0.1760 313  VAL A N   
2229 C CA  . VAL A 279 ? 1.5237 1.4183 2.0865 0.0413  -0.0222 -0.2258 313  VAL A CA  
2230 C C   . VAL A 279 ? 1.4987 1.2832 1.9981 0.0417  -0.0132 -0.2401 313  VAL A C   
2231 O O   . VAL A 279 ? 1.3363 1.0689 1.7696 0.0491  -0.0010 -0.2791 313  VAL A O   
2232 C CB  . VAL A 279 ? 1.4002 1.3008 1.9882 0.1022  -0.0206 -0.2396 313  VAL A CB  
2233 C CG1 . VAL A 279 ? 1.2192 1.0280 1.7478 0.1555  -0.0069 -0.2746 313  VAL A CG1 
2234 C CG2 . VAL A 279 ? 1.3642 1.3610 1.9826 0.1035  -0.0213 -0.2508 313  VAL A CG2 
2235 N N   . ASN A 280 ? 1.5884 1.3332 2.1043 0.0333  -0.0167 -0.2080 314  ASN A N   
2236 C CA  . ASN A 280 ? 1.5643 1.2029 2.0265 0.0309  -0.0063 -0.2159 314  ASN A CA  
2237 C C   . ASN A 280 ? 1.7523 1.3557 2.1504 -0.0153 -0.0015 -0.2439 314  ASN A C   
2238 O O   . ASN A 280 ? 1.9108 1.4095 2.2427 0.0037  0.0147  -0.2748 314  ASN A O   
2239 C CB  . ASN A 280 ? 1.5299 1.1622 2.0302 0.0106  -0.0122 -0.1667 314  ASN A CB  
2240 C CG  . ASN A 280 ? 1.7020 1.2763 2.2104 0.0707  -0.0048 -0.1570 314  ASN A CG  
2241 O OD1 . ASN A 280 ? 1.8094 1.3671 2.3409 0.0665  -0.0050 -0.1188 314  ASN A OD1 
2242 N ND2 . ASN A 280 ? 1.7213 1.2711 2.2098 0.1297  0.0020  -0.1900 314  ASN A ND2 
2243 N N   . PRO A 281 ? 1.7768 1.4551 2.1845 -0.0747 -0.0139 -0.2355 315  PRO A N   
2244 C CA  . PRO A 281 ? 1.9439 1.5804 2.2799 -0.1195 -0.0109 -0.2687 315  PRO A CA  
2245 C C   . PRO A 281 ? 2.0060 1.5855 2.2706 -0.0805 0.0068  -0.3246 315  PRO A C   
2246 O O   . PRO A 281 ? 2.1464 1.6224 2.3335 -0.0896 0.0195  -0.3581 315  PRO A O   
2247 C CB  . PRO A 281 ? 1.8663 1.6200 2.2344 -0.1784 -0.0295 -0.2463 315  PRO A CB  
2248 C CG  . PRO A 281 ? 1.7361 1.5606 2.1896 -0.1781 -0.0404 -0.1889 315  PRO A CG  
2249 C CD  . PRO A 281 ? 1.6800 1.4736 2.1588 -0.1079 -0.0307 -0.1907 315  PRO A CD  
2250 N N   . PHE A 282 ? 1.9471 1.5905 2.2348 -0.0373 0.0098  -0.3345 316  PHE A N   
2251 C CA  . PHE A 282 ? 1.9158 1.5115 2.1415 0.0134  0.0299  -0.3823 316  PHE A CA  
2252 C C   . PHE A 282 ? 1.9038 1.3742 2.0854 0.0661  0.0488  -0.3986 316  PHE A C   
2253 O O   . PHE A 282 ? 2.0960 1.4766 2.1955 0.0912  0.0697  -0.4390 316  PHE A O   
2254 C CB  . PHE A 282 ? 1.9034 1.6006 2.1804 0.0551  0.0292  -0.3803 316  PHE A CB  
2255 C CG  . PHE A 282 ? 1.9275 1.7237 2.2103 0.0216  0.0241  -0.3837 316  PHE A CG  
2256 C CD1 . PHE A 282 ? 1.9263 1.7080 2.1399 0.0376  0.0405  -0.4258 316  PHE A CD1 
2257 C CD2 . PHE A 282 ? 1.8793 1.7820 2.2337 -0.0206 0.0058  -0.3427 316  PHE A CD2 
2258 C CE1 . PHE A 282 ? 1.9423 1.8179 2.1581 0.0105  0.0376  -0.4273 316  PHE A CE1 
2259 C CE2 . PHE A 282 ? 1.8802 1.8754 2.2384 -0.0481 0.0034  -0.3421 316  PHE A CE2 
2260 C CZ  . PHE A 282 ? 1.9532 1.9374 2.2425 -0.0331 0.0187  -0.3846 316  PHE A CZ  
2261 N N   . LEU A 283 ? 1.9343 1.3939 2.1649 0.0872  0.0437  -0.3664 317  LEU A N   
2262 C CA  . LEU A 283 ? 2.0514 1.4074 2.2480 0.1482  0.0619  -0.3758 317  LEU A CA  
2263 C C   . LEU A 283 ? 2.0740 1.3029 2.2101 0.1199  0.0744  -0.3795 317  LEU A C   
2264 O O   . LEU A 283 ? 1.8488 0.9663 1.9211 0.1660  0.0983  -0.4024 317  LEU A O   
2265 C CB  . LEU A 283 ? 1.8656 1.2638 2.1347 0.1835  0.0512  -0.3407 317  LEU A CB  
2266 C CG  . LEU A 283 ? 1.9324 1.2441 2.1806 0.2495  0.0655  -0.3394 317  LEU A CG  
2267 C CD1 . LEU A 283 ? 2.0838 1.3590 2.2785 0.3191  0.0854  -0.3784 317  LEU A CD1 
2268 C CD2 . LEU A 283 ? 1.4920 0.8680 1.8151 0.2720  0.0489  -0.3057 317  LEU A CD2 
2269 N N   . TYR A 284 ? 2.2695 1.5140 2.4241 0.0449  0.0600  -0.3559 318  TYR A N   
2270 C CA  . TYR A 284 ? 2.3916 1.5268 2.5032 0.0092  0.0696  -0.3525 318  TYR A CA  
2271 C C   . TYR A 284 ? 2.4135 1.5055 2.4572 -0.0573 0.0702  -0.3853 318  TYR A C   
2272 O O   . TYR A 284 ? 2.5194 1.4789 2.4839 -0.0572 0.0913  -0.4143 318  TYR A O   
2273 C CB  . TYR A 284 ? 2.4788 1.6598 2.6627 -0.0264 0.0539  -0.2968 318  TYR A CB  
2274 C CG  . TYR A 284 ? 2.4902 1.6525 2.7105 0.0388  0.0610  -0.2686 318  TYR A CG  
2275 C CD1 . TYR A 284 ? 2.5848 1.6250 2.7615 0.0720  0.0838  -0.2693 318  TYR A CD1 
2276 C CD2 . TYR A 284 ? 2.3909 1.6532 2.6845 0.0670  0.0459  -0.2417 318  TYR A CD2 
2277 C CE1 . TYR A 284 ? 2.5746 1.6004 2.7787 0.1344  0.0901  -0.2436 318  TYR A CE1 
2278 C CE2 . TYR A 284 ? 2.3767 1.6195 2.6957 0.1260  0.0508  -0.2199 318  TYR A CE2 
2279 C CZ  . TYR A 284 ? 2.4248 1.5531 2.6984 0.1609  0.0722  -0.2208 318  TYR A CZ  
2280 O OH  . TYR A 284 ? 2.3550 1.4662 2.6482 0.2225  0.0770  -0.1992 318  TYR A OH  
2281 N N   . CYS A 285 ? 3.4074 1.4891 3.2704 0.1947  -0.8229 -0.3308 319  CYS A N   
2282 C CA  . CYS A 285 ? 3.5828 1.6133 3.3526 0.1887  -0.8053 -0.3124 319  CYS A CA  
2283 C C   . CYS A 285 ? 3.4032 1.3734 3.1604 0.1741  -0.7361 -0.3160 319  CYS A C   
2284 O O   . CYS A 285 ? 3.2683 1.2225 2.9639 0.1787  -0.7215 -0.3142 319  CYS A O   
2285 C CB  . CYS A 285 ? 2.9949 0.9777 2.7179 0.1750  -0.8192 -0.2853 319  CYS A CB  
2286 S SG  . CYS A 285 ? 3.0507 0.9683 2.6532 0.1646  -0.8065 -0.2591 319  CYS A SG  
2287 N N   . PHE A 286 ? 3.0425 0.9762 2.8552 0.1566  -0.6930 -0.3208 320  PHE A N   
2288 C CA  . PHE A 286 ? 3.4530 1.3218 3.2553 0.1418  -0.6233 -0.3213 320  PHE A CA  
2289 C C   . PHE A 286 ? 3.4589 1.3583 3.2913 0.1557  -0.5977 -0.3449 320  PHE A C   
2290 O O   . PHE A 286 ? 3.5811 1.4186 3.4036 0.1502  -0.5529 -0.3484 320  PHE A O   
2291 C CB  . PHE A 286 ? 3.1693 0.9795 3.0179 0.1184  -0.5951 -0.3153 320  PHE A CB  
2292 C CG  . PHE A 286 ? 3.2452 1.0053 3.0570 0.1014  -0.6047 -0.2883 320  PHE A CG  
2293 C CD1 . PHE A 286 ? 3.2031 0.9723 2.9442 0.1066  -0.6324 -0.2705 320  PHE A CD1 
2294 C CD2 . PHE A 286 ? 3.3056 1.0054 3.1525 0.0799  -0.5915 -0.2788 320  PHE A CD2 
2295 C CE1 . PHE A 286 ? 3.4122 1.1366 3.1206 0.0913  -0.6401 -0.2439 320  PHE A CE1 
2296 C CE2 . PHE A 286 ? 3.3437 0.9973 3.1582 0.0645  -0.5992 -0.2521 320  PHE A CE2 
2297 C CZ  . PHE A 286 ? 3.3203 0.9870 3.0658 0.0710  -0.6230 -0.2348 320  PHE A CZ  
2298 N N   . VAL A 287 ? 3.2714 1.2533 3.1372 0.1778  -0.6415 -0.3615 321  VAL A N   
2299 C CA  . VAL A 287 ? 3.3043 1.3205 3.2057 0.1918  -0.6198 -0.3832 321  VAL A CA  
2300 C C   . VAL A 287 ? 3.3433 1.3606 3.1762 0.2070  -0.6129 -0.3841 321  VAL A C   
2301 O O   . VAL A 287 ? 3.4225 1.4388 3.2685 0.2152  -0.5736 -0.3982 321  VAL A O   
2302 C CB  . VAL A 287 ? 3.2194 1.3276 3.1990 0.2077  -0.6700 -0.4009 321  VAL A CB  
2303 C CG1 . VAL A 287 ? 3.1259 1.2996 3.0758 0.2286  -0.7367 -0.3978 321  VAL A CG1 
2304 C CG2 . VAL A 287 ? 3.2082 1.3464 3.2414 0.2176  -0.6418 -0.4223 321  VAL A CG2 
2305 N N   . GLY A 288 ? 3.3796 1.3951 3.1372 0.2107  -0.6497 -0.3686 322  GLY A N   
2306 C CA  . GLY A 288 ? 3.2261 1.2426 2.9138 0.2241  -0.6504 -0.3688 322  GLY A CA  
2307 C C   . GLY A 288 ? 3.2048 1.1399 2.8481 0.2131  -0.5815 -0.3675 322  GLY A C   
2308 O O   . GLY A 288 ? 3.2681 1.1349 2.8984 0.1923  -0.5471 -0.3550 322  GLY A O   
2309 N N   . ASN A 289 ? 3.2415 1.1847 2.8636 0.2283  -0.5614 -0.3800 323  ASN A N   
2310 C CA  . ASN A 289 ? 3.3797 1.2485 2.9623 0.2221  -0.4955 -0.3813 323  ASN A CA  
2311 C C   . ASN A 289 ? 3.5436 1.3497 3.0206 0.2096  -0.5030 -0.3607 323  ASN A C   
2312 O O   . ASN A 289 ? 3.6783 1.3917 3.1031 0.2037  -0.4712 -0.3587 323  ASN A O   
2313 C CB  . ASN A 289 ? 3.2525 1.1472 2.8375 0.2440  -0.4747 -0.4001 323  ASN A CB  
2314 C CG  . ASN A 289 ? 3.3330 1.1386 2.8907 0.2470  -0.4178 -0.4082 323  ASN A CG  
2315 O OD1 . ASN A 289 ? 3.3441 1.0737 2.9091 0.2362  -0.3946 -0.4043 323  ASN A OD1 
2316 N ND2 . ASN A 289 ? 3.4142 1.2231 2.9366 0.2639  -0.3995 -0.4186 323  ASN A ND2 
2317 N N   . ARG A 290 ? 3.5727 1.4044 2.9942 0.2113  -0.5674 -0.3454 324  ARG A N   
2318 C CA  . ARG A 290 ? 3.6443 1.4167 2.9615 0.1969  -0.5828 -0.3217 324  ARG A CA  
2319 C C   . ARG A 290 ? 3.5561 1.2845 2.8858 0.1735  -0.5746 -0.3038 324  ARG A C   
2320 O O   . ARG A 290 ? 3.5716 1.2330 2.8130 0.1588  -0.5799 -0.2832 324  ARG A O   
2321 C CB  . ARG A 290 ? 3.7402 1.5567 2.9961 0.2079  -0.6557 -0.3090 324  ARG A CB  
2322 C CG  . ARG A 290 ? 3.7323 1.6129 2.9975 0.2331  -0.6769 -0.3247 324  ARG A CG  
2323 C CD  . ARG A 290 ? 3.7292 1.6617 2.9535 0.2442  -0.7533 -0.3097 324  ARG A CD  
2324 N NE  . ARG A 290 ? 3.6836 1.6863 2.9312 0.2689  -0.7774 -0.3234 324  ARG A NE  
2325 C CZ  . ARG A 290 ? 3.5747 1.6346 2.8020 0.2833  -0.8424 -0.3134 324  ARG A CZ  
2326 N NH1 . ARG A 290 ? 3.6047 1.6591 2.7864 0.2759  -0.8892 -0.2902 324  ARG A NH1 
2327 N NH2 . ARG A 290 ? 3.4060 1.5290 2.6604 0.3053  -0.8605 -0.3259 324  ARG A NH2 
2328 N N   . PHE A 291 ? 3.5021 1.2585 2.9289 0.1701  -0.5686 -0.3099 325  PHE A N   
2329 C CA  . PHE A 291 ? 3.5632 1.2774 2.9982 0.1499  -0.5734 -0.2911 325  PHE A CA  
2330 C C   . PHE A 291 ? 3.7414 1.3429 3.1381 0.1343  -0.5355 -0.2838 325  PHE A C   
2331 O O   . PHE A 291 ? 3.8715 1.4110 3.2077 0.1166  -0.5453 -0.2595 325  PHE A O   
2332 C CB  . PHE A 291 ? 3.3658 1.1348 2.9080 0.1504  -0.5803 -0.3002 325  PHE A CB  
2333 C CG  . PHE A 291 ? 3.3605 1.0661 2.9279 0.1296  -0.5682 -0.2875 325  PHE A CG  
2334 C CD1 . PHE A 291 ? 3.3413 1.0206 2.8680 0.1157  -0.5930 -0.2615 325  PHE A CD1 
2335 C CD2 . PHE A 291 ? 3.4073 1.0768 3.0383 0.1237  -0.5335 -0.2994 325  PHE A CD2 
2336 C CE1 . PHE A 291 ? 3.3636 0.9838 2.9142 0.0958  -0.5812 -0.2476 325  PHE A CE1 
2337 C CE2 . PHE A 291 ? 3.4737 1.0830 3.1285 0.1028  -0.5238 -0.2850 325  PHE A CE2 
2338 C CZ  . PHE A 291 ? 3.4294 1.0149 3.0447 0.0886  -0.5465 -0.2591 325  PHE A CZ  
2339 N N   . GLN A 292 ? 3.6839 1.2550 3.1131 0.1410  -0.4929 -0.3024 326  GLN A N   
2340 C CA  . GLN A 292 ? 3.7588 1.2201 3.1566 0.1279  -0.4562 -0.2937 326  GLN A CA  
2341 C C   . GLN A 292 ? 3.7269 1.1124 2.9890 0.1231  -0.4562 -0.2787 326  GLN A C   
2342 O O   . GLN A 292 ? 3.7695 1.0643 2.9710 0.1044  -0.4474 -0.2569 326  GLN A O   
2343 C CB  . GLN A 292 ? 3.8894 1.3354 3.3517 0.1404  -0.4121 -0.3161 326  GLN A CB  
2344 C CG  . GLN A 292 ? 3.9224 1.4232 3.5048 0.1401  -0.4136 -0.3276 326  GLN A CG  
2345 C CD  . GLN A 292 ? 4.0118 1.4716 3.6515 0.1474  -0.3706 -0.3417 326  GLN A CD  
2346 O OE1 . GLN A 292 ? 4.0984 1.4978 3.6944 0.1583  -0.3365 -0.3459 326  GLN A OE1 
2347 N NE2 . GLN A 292 ? 3.9541 1.4426 3.6876 0.1423  -0.3749 -0.3480 326  GLN A NE2 
2348 N N   . GLN A 293 ? 3.6751 1.0926 2.8800 0.1383  -0.4673 -0.2881 327  GLN A N   
2349 C CA  . GLN A 293 ? 3.7714 1.1154 2.8304 0.1322  -0.4739 -0.2733 327  GLN A CA  
2350 C C   . GLN A 293 ? 3.7629 1.0964 2.7575 0.1127  -0.5178 -0.2433 327  GLN A C   
2351 O O   . GLN A 293 ? 3.9704 1.2087 2.8546 0.0950  -0.5167 -0.2214 327  GLN A O   
2352 C CB  . GLN A 293 ? 3.7334 1.1197 2.7522 0.1523  -0.4789 -0.2894 327  GLN A CB  
2353 C CG  . GLN A 293 ? 3.8000 1.0989 2.6574 0.1477  -0.4789 -0.2783 327  GLN A CG  
2354 C CD  . GLN A 293 ? 3.7621 1.0928 2.5925 0.1692  -0.4715 -0.2976 327  GLN A CD  
2355 O OE1 . GLN A 293 ? 3.6617 1.0783 2.5986 0.1878  -0.4627 -0.3193 327  GLN A OE1 
2356 N NE2 . GLN A 293 ? 3.7917 1.0497 2.4738 0.1656  -0.4748 -0.2885 327  GLN A NE2 
2357 N N   . LYS A 294 ? 3.5689 0.9957 2.6252 0.1162  -0.5563 -0.2406 328  LYS A N   
2358 C CA  . LYS A 294 ? 3.5734 0.9945 2.5819 0.1004  -0.5982 -0.2117 328  LYS A CA  
2359 C C   . LYS A 294 ? 3.7760 1.1305 2.8009 0.0788  -0.5838 -0.1932 328  LYS A C   
2360 O O   . LYS A 294 ? 3.8564 1.1517 2.7956 0.0600  -0.6023 -0.1647 328  LYS A O   
2361 C CB  . LYS A 294 ? 3.4406 0.9747 2.5216 0.1126  -0.6380 -0.2142 328  LYS A CB  
2362 C CG  . LYS A 294 ? 3.4067 0.9695 2.4028 0.1165  -0.6856 -0.1996 328  LYS A CG  
2363 C CD  . LYS A 294 ? 3.5256 1.1834 2.5794 0.1362  -0.7366 -0.2060 328  LYS A CD  
2364 C CE  . LYS A 294 ? 3.4944 1.1661 2.4522 0.1419  -0.7971 -0.1892 328  LYS A CE  
2365 N NZ  . LYS A 294 ? 3.5206 1.2827 2.5318 0.1647  -0.8506 -0.1967 328  LYS A NZ  
2366 N N   . LEU A 295 ? 3.7936 1.1544 2.9259 0.0798  -0.5515 -0.2071 329  LEU A N   
2367 C CA  . LEU A 295 ? 3.9014 1.1964 3.0556 0.0584  -0.5351 -0.1881 329  LEU A CA  
2368 C C   . LEU A 295 ? 4.2062 1.3805 3.2531 0.0436  -0.5073 -0.1720 329  LEU A C   
2369 O O   . LEU A 295 ? 4.2861 1.3944 3.2823 0.0210  -0.5115 -0.1421 329  LEU A O   
2370 C CB  . LEU A 295 ? 3.7762 1.1009 3.0636 0.0622  -0.5080 -0.2068 329  LEU A CB  
2371 C CG  . LEU A 295 ? 3.8023 1.0611 3.1270 0.0395  -0.4886 -0.1874 329  LEU A CG  
2372 C CD1 . LEU A 295 ? 3.7539 1.0227 3.0713 0.0248  -0.5230 -0.1608 329  LEU A CD1 
2373 C CD2 . LEU A 295 ? 3.7340 1.0211 3.1822 0.0434  -0.4647 -0.2080 329  LEU A CD2 
2374 N N   . ARG A 296 ? 4.3740 1.5149 3.3795 0.0564  -0.4773 -0.1902 330  ARG A N   
2375 C CA  . ARG A 296 ? 4.5935 1.6121 3.4722 0.0447  -0.4500 -0.1750 330  ARG A CA  
2376 C C   . ARG A 296 ? 4.7031 1.6792 3.4299 0.0309  -0.4827 -0.1515 330  ARG A C   
2377 O O   . ARG A 296 ? 4.8542 1.7261 3.4705 0.0098  -0.4710 -0.1260 330  ARG A O   
2378 C CB  . ARG A 296 ? 4.6529 1.6459 3.5137 0.0661  -0.4100 -0.2014 330  ARG A CB  
2379 C CG  . ARG A 296 ? 4.6779 1.6423 3.3974 0.0748  -0.4167 -0.2061 330  ARG A CG  
2380 C CD  . ARG A 296 ? 4.8162 1.6383 3.3710 0.0607  -0.3874 -0.1873 330  ARG A CD  
2381 N NE  . ARG A 296 ? 4.8747 1.6638 3.2783 0.0635  -0.4005 -0.1882 330  ARG A NE  
2382 C CZ  . ARG A 296 ? 5.0114 1.6764 3.2410 0.0517  -0.3779 -0.1741 330  ARG A CZ  
2383 N NH1 . ARG A 296 ? 5.0066 1.6452 3.1013 0.0531  -0.3931 -0.1758 330  ARG A NH1 
2384 N NH2 . ARG A 296 ? 5.1412 1.7048 3.3259 0.0372  -0.3386 -0.1565 330  ARG A NH2 
2385 N N   . SER A 297 ? 4.5919 1.6436 3.3055 0.0412  -0.5238 -0.1572 331  SER A N   
2386 C CA  . SER A 297 ? 4.4110 1.4243 2.9826 0.0266  -0.5607 -0.1329 331  SER A CA  
2387 C C   . SER A 297 ? 4.3822 1.3822 2.9540 0.0033  -0.5874 -0.1001 331  SER A C   
2388 O O   . SER A 297 ? 4.4475 1.3620 2.8914 -0.0197 -0.5959 -0.0721 331  SER A O   
2389 C CB  . SER A 297 ? 4.2905 1.3910 2.8577 0.0440  -0.5998 -0.1445 331  SER A CB  
2390 O OG  . SER A 297 ? 4.0514 1.2601 2.7433 0.0531  -0.6283 -0.1475 331  SER A OG  
2391 N N   . VAL A 298 ? 4.3005 1.3825 3.0094 0.0087  -0.6002 -0.1027 332  VAL A N   
2392 C CA  . VAL A 298 ? 4.3112 1.3827 3.0333 -0.0109 -0.6210 -0.0721 332  VAL A CA  
2393 C C   . VAL A 298 ? 4.5024 1.4720 3.1985 -0.0340 -0.5841 -0.0516 332  VAL A C   
2394 O O   . VAL A 298 ? 4.1930 1.1057 2.8177 -0.0577 -0.5967 -0.0175 332  VAL A O   
2395 C CB  . VAL A 298 ? 3.8683 1.0430 2.7397 0.0021  -0.6360 -0.0828 332  VAL A CB  
2396 C CG1 . VAL A 298 ? 3.8929 1.0503 2.7865 -0.0165 -0.6498 -0.0522 332  VAL A CG1 
2397 C CG2 . VAL A 298 ? 3.7943 1.0637 2.6728 0.0226  -0.6766 -0.0953 332  VAL A CG2 
2398 N N   . PHE A 299 ? 4.5410 1.4844 3.2911 -0.0280 -0.5379 -0.0698 333  PHE A N   
2399 C CA  . PHE A 299 ? 4.7001 1.5445 3.4268 -0.0492 -0.5003 -0.0481 333  PHE A CA  
2400 C C   . PHE A 299 ? 4.7911 1.5225 3.3346 -0.0668 -0.4908 -0.0262 333  PHE A C   
2401 O O   . PHE A 299 ? 4.9050 1.5551 3.3950 -0.0923 -0.4758 0.0064  333  PHE A O   
2402 C CB  . PHE A 299 ? 4.7412 1.5811 3.5613 -0.0367 -0.4542 -0.0722 333  PHE A CB  
2403 C CG  . PHE A 299 ? 4.9082 1.6510 3.7196 -0.0578 -0.4146 -0.0473 333  PHE A CG  
2404 C CD1 . PHE A 299 ? 4.8737 1.6261 3.7824 -0.0749 -0.4156 -0.0270 333  PHE A CD1 
2405 C CD2 . PHE A 299 ? 5.0275 1.6663 3.7276 -0.0604 -0.3739 -0.0425 333  PHE A CD2 
2406 C CE1 . PHE A 299 ? 4.9915 1.6566 3.8949 -0.0962 -0.3795 0.0005  333  PHE A CE1 
2407 C CE2 . PHE A 299 ? 5.1600 1.7077 3.8462 -0.0800 -0.3346 -0.0150 333  PHE A CE2 
2408 C CZ  . PHE A 299 ? 5.1458 1.7091 3.9380 -0.0991 -0.3390 0.0079  333  PHE A CZ  
2409 N N   . ARG A 300 ? 4.8686 1.5906 3.3092 -0.0550 -0.4979 -0.0423 334  ARG A N   
2410 C CA  . ARG A 300 ? 4.9749 1.5839 3.2240 -0.0721 -0.4881 -0.0249 334  ARG A CA  
2411 C C   . ARG A 300 ? 4.9466 1.5532 3.0904 -0.0901 -0.5398 -0.0004 334  ARG A C   
2412 O O   . ARG A 300 ? 5.0596 1.5738 3.0321 -0.1075 -0.5383 0.0140  334  ARG A O   
2413 C CB  . ARG A 300 ? 4.9913 1.5753 3.1709 -0.0505 -0.4621 -0.0554 334  ARG A CB  
2414 C CG  . ARG A 300 ? 5.1622 1.6033 3.1541 -0.0654 -0.4245 -0.0426 334  ARG A CG  
2415 C CD  . ARG A 300 ? 5.2145 1.6301 3.1385 -0.0406 -0.3950 -0.0738 334  ARG A CD  
2416 N NE  . ARG A 300 ? 5.4401 1.7128 3.1598 -0.0553 -0.3604 -0.0611 334  ARG A NE  
2417 C CZ  . ARG A 300 ? 5.5577 1.7737 3.1816 -0.0366 -0.3225 -0.0830 334  ARG A CZ  
2418 N NH1 . ARG A 300 ? 5.7660 1.8445 3.1927 -0.0516 -0.2885 -0.0702 334  ARG A NH1 
2419 N NH2 . ARG A 300 ? 5.4435 1.7395 3.1662 -0.0027 -0.3162 -0.1173 334  ARG A NH2 
2420 N N   . VAL A 301 ? 4.7891 1.4904 3.0241 -0.0866 -0.5843 0.0049  335  VAL A N   
2421 C CA  . VAL A 301 ? 4.7001 1.4052 2.8472 -0.1025 -0.6361 0.0301  335  VAL A CA  
2422 C C   . VAL A 301 ? 4.7634 1.3654 2.7980 -0.1383 -0.6300 0.0702  335  VAL A C   
2423 O O   . VAL A 301 ? 4.8569 1.3921 2.7290 -0.1569 -0.6468 0.0845  335  VAL A O   
2424 C CB  . VAL A 301 ? 4.5041 1.3246 2.7805 -0.0905 -0.6771 0.0308  335  VAL A CB  
2425 C CG1 . VAL A 301 ? 4.5152 1.3236 2.7110 -0.1122 -0.7238 0.0658  335  VAL A CG1 
2426 C CG2 . VAL A 301 ? 4.4077 1.3253 2.7436 -0.0598 -0.6957 -0.0024 335  VAL A CG2 
2427 N N   . PRO A 302 ? 4.7269 1.3104 2.8356 -0.1512 -0.6067 0.0909  336  PRO A N   
2428 C CA  . PRO A 302 ? 4.8401 1.3308 2.8402 -0.1866 -0.6012 0.1333  336  PRO A CA  
2429 C C   . PRO A 302 ? 4.9193 1.2863 2.7662 -0.2015 -0.5581 0.1367  336  PRO A C   
2430 O O   . PRO A 302 ? 5.0378 1.3239 2.7444 -0.2319 -0.5617 0.1679  336  PRO A O   
2431 C CB  . PRO A 302 ? 4.7767 1.2904 2.9178 -0.1920 -0.5831 0.1517  336  PRO A CB  
2432 C CG  . PRO A 302 ? 4.6559 1.2200 2.9333 -0.1648 -0.5546 0.1151  336  PRO A CG  
2433 C CD  . PRO A 302 ? 4.6261 1.2658 2.9136 -0.1371 -0.5823 0.0787  336  PRO A CD  
2434 N N   . ILE A 303 ? 4.9288 1.2777 2.7949 -0.1809 -0.5156 0.1059  337  ILE A N   
2435 C CA  . ILE A 303 ? 5.0860 1.3117 2.7956 -0.1904 -0.4690 0.1066  337  ILE A CA  
2436 C C   . ILE A 303 ? 5.1453 1.3275 2.6770 -0.1965 -0.4947 0.1003  337  ILE A C   
2437 O O   . ILE A 303 ? 5.2982 1.3685 2.6544 -0.2223 -0.4790 0.1195  337  ILE A O   
2438 C CB  . ILE A 303 ? 5.0756 1.2988 2.8583 -0.1624 -0.4167 0.0742  337  ILE A CB  
2439 C CG1 . ILE A 303 ? 5.0185 1.2906 2.9858 -0.1590 -0.3984 0.0801  337  ILE A CG1 
2440 C CG2 . ILE A 303 ? 5.2516 1.3381 2.8684 -0.1697 -0.3591 0.0776  337  ILE A CG2 
2441 C CD1 . ILE A 303 ? 4.9948 1.2708 3.0488 -0.1329 -0.3504 0.0501  337  ILE A CD1 
2442 N N   . THR A 304 ? 5.0948 1.3630 2.6656 -0.1746 -0.5343 0.0744  338  THR A N   
2443 C CA  . THR A 304 ? 5.1720 1.4063 2.5820 -0.1823 -0.5664 0.0709  338  THR A CA  
2444 C C   . THR A 304 ? 5.1181 1.3341 2.4416 -0.2170 -0.6149 0.1071  338  THR A C   
2445 O O   . THR A 304 ? 5.2257 1.3648 2.3703 -0.2392 -0.6306 0.1149  338  THR A O   
2446 C CB  . THR A 304 ? 5.0559 1.3967 2.5443 -0.1503 -0.5976 0.0391  338  THR A CB  
2447 O OG1 . THR A 304 ? 4.9006 1.3626 2.5533 -0.1405 -0.6359 0.0429  338  THR A OG1 
2448 C CG2 . THR A 304 ? 5.0126 1.3649 2.5651 -0.1176 -0.5484 0.0024  338  THR A CG2 
2449 N N   . TRP A 305 ? 5.1984 1.4831 2.6455 -0.2227 -0.6387 0.1291  339  TRP A N   
2450 C CA  . TRP A 305 ? 5.2057 1.4784 2.5857 -0.2550 -0.6813 0.1658  339  TRP A CA  
2451 C C   . TRP A 305 ? 5.2488 1.3985 2.4883 -0.2919 -0.6507 0.1967  339  TRP A C   
2452 O O   . TRP A 305 ? 5.3243 1.4329 2.4403 -0.3239 -0.6819 0.2209  339  TRP A O   
2453 C CB  . TRP A 305 ? 4.9492 1.3233 2.5024 -0.2480 -0.7058 0.1816  339  TRP A CB  
2454 C CG  . TRP A 305 ? 5.0340 1.3946 2.5402 -0.2804 -0.7375 0.2239  339  TRP A CG  
2455 C CD1 . TRP A 305 ? 5.0333 1.4141 2.4670 -0.2954 -0.7929 0.2356  339  TRP A CD1 
2456 C CD2 . TRP A 305 ? 5.0726 1.4005 2.6070 -0.3025 -0.7151 0.2616  339  TRP A CD2 
2457 N NE1 . TRP A 305 ? 5.0757 1.4414 2.4944 -0.3249 -0.8051 0.2774  339  TRP A NE1 
2458 C CE2 . TRP A 305 ? 5.0753 1.4092 2.5541 -0.3290 -0.7577 0.2953  339  TRP A CE2 
2459 C CE3 . TRP A 305 ? 5.0899 1.3861 2.6946 -0.3033 -0.6632 0.2717  339  TRP A CE3 
2460 C CZ2 . TRP A 305 ? 5.1302 1.4434 2.6232 -0.3540 -0.7482 0.3394  339  TRP A CZ2 
2461 C CZ3 . TRP A 305 ? 5.1465 1.4186 2.7613 -0.3293 -0.6553 0.3160  339  TRP A CZ3 
2462 C CH2 . TRP A 305 ? 5.1651 1.4473 2.7249 -0.3534 -0.6968 0.3498  339  TRP A CH2 
2463 N N   . LEU A 306 ? 5.3165 1.4081 2.5722 -0.2893 -0.5896 0.1966  340  LEU A N   
2464 C CA  . LEU A 306 ? 5.4869 1.4604 2.6092 -0.3226 -0.5529 0.2272  340  LEU A CA  
2465 C C   . LEU A 306 ? 5.7238 1.5913 2.6223 -0.3392 -0.5491 0.2177  340  LEU A C   
2466 O O   . LEU A 306 ? 5.7645 1.6265 2.6209 -0.3168 -0.5455 0.1818  340  LEU A O   
2467 C CB  . LEU A 306 ? 5.5380 1.4731 2.7284 -0.3125 -0.4848 0.2270  340  LEU A CB  
2468 C CG  . LEU A 306 ? 5.4370 1.4531 2.8333 -0.3044 -0.4811 0.2413  340  LEU A CG  
2469 C CD1 . LEU A 306 ? 5.4812 1.4452 2.9231 -0.2986 -0.4130 0.2419  340  LEU A CD1 
2470 C CD2 . LEU A 306 ? 5.4324 1.4627 2.8368 -0.3347 -0.5108 0.2880  340  LEU A CD2 
2471 N N   . ASP B 1   ? 2.1899 1.8508 2.1645 -0.3867 -0.0046 -0.2456 1    ASP B N   
2472 C CA  . ASP B 1   ? 2.1894 1.9735 2.2545 -0.4027 0.0128  -0.2411 1    ASP B CA  
2473 C C   . ASP B 1   ? 2.1672 1.9309 2.2529 -0.3576 0.0251  -0.2004 1    ASP B C   
2474 O O   . ASP B 1   ? 2.3053 1.9634 2.3584 -0.3402 0.0664  -0.2022 1    ASP B O   
2475 C CB  . ASP B 1   ? 2.1928 2.1532 2.3266 -0.4241 -0.0280 -0.2391 1    ASP B CB  
2476 C CG  . ASP B 1   ? 2.2503 2.3361 2.4693 -0.4617 -0.0094 -0.2654 1    ASP B CG  
2477 O OD1 . ASP B 1   ? 2.2572 2.3912 2.5339 -0.4487 0.0093  -0.2464 1    ASP B OD1 
2478 O OD2 . ASP B 1   ? 2.2481 2.3840 2.4788 -0.5034 -0.0145 -0.3078 1    ASP B OD2 
2479 N N   . ARG B 2   ? 2.0174 1.8802 2.1540 -0.3355 -0.0100 -0.1628 2    ARG B N   
2480 C CA  . ARG B 2   ? 1.8381 1.6844 1.9942 -0.2884 -0.0069 -0.1225 2    ARG B CA  
2481 C C   . ARG B 2   ? 1.6857 1.4624 1.8015 -0.2470 -0.0452 -0.0896 2    ARG B C   
2482 O O   . ARG B 2   ? 1.6734 1.4951 1.7886 -0.2561 -0.0831 -0.0820 2    ARG B O   
2483 C CB  . ARG B 2   ? 1.6329 1.6447 1.8853 -0.2904 -0.0161 -0.1027 2    ARG B CB  
2484 C CG  . ARG B 2   ? 1.5619 1.5563 1.8380 -0.2459 -0.0010 -0.0700 2    ARG B CG  
2485 C CD  . ARG B 2   ? 1.5234 1.6811 1.8952 -0.2532 -0.0003 -0.0614 2    ARG B CD  
2486 N NE  . ARG B 2   ? 1.5864 1.8560 1.9969 -0.2390 -0.0493 -0.0289 2    ARG B NE  
2487 C CZ  . ARG B 2   ? 1.6451 1.9266 2.0748 -0.1925 -0.0691 0.0165  2    ARG B CZ  
2488 N NH1 . ARG B 2   ? 1.5693 1.9520 2.0326 -0.1809 -0.1104 0.0482  2    ARG B NH1 
2489 N NH2 . ARG B 2   ? 1.7301 1.9212 2.1438 -0.1549 -0.0470 0.0309  2    ARG B NH2 
2490 N N   . VAL B 3   ? 1.4866 1.1557 1.5723 -0.2002 -0.0352 -0.0706 3    VAL B N   
2491 C CA  . VAL B 3   ? 1.7064 1.2949 1.7599 -0.1588 -0.0706 -0.0439 3    VAL B CA  
2492 C C   . VAL B 3   ? 1.7159 1.2918 1.7985 -0.1084 -0.0720 -0.0084 3    VAL B C   
2493 O O   . VAL B 3   ? 1.7637 1.3726 1.8758 -0.1023 -0.0405 -0.0077 3    VAL B O   
2494 C CB  . VAL B 3   ? 1.7052 1.1283 1.6646 -0.1471 -0.0639 -0.0715 3    VAL B CB  
2495 C CG1 . VAL B 3   ? 1.5133 0.9495 1.4427 -0.1927 -0.0712 -0.1038 3    VAL B CG1 
2496 C CG2 . VAL B 3   ? 1.5919 0.9134 1.5064 -0.1296 -0.0144 -0.0916 3    VAL B CG2 
2497 N N   . TYR B 4   ? 1.5960 1.1253 1.6747 -0.0719 -0.1098 0.0208  4    TYR B N   
2498 C CA  . TYR B 4   ? 1.6854 1.1831 1.7858 -0.0183 -0.1178 0.0525  4    TYR B CA  
2499 C C   . TYR B 4   ? 1.6789 1.0070 1.7029 0.0210  -0.1020 0.0309  4    TYR B C   
2500 O O   . TYR B 4   ? 1.6522 0.8795 1.6359 0.0428  -0.1288 0.0273  4    TYR B O   
2501 C CB  . TYR B 4   ? 1.6709 1.2064 1.8152 0.0007  -0.1666 0.0956  4    TYR B CB  
2502 C CG  . TYR B 4   ? 1.6309 1.1767 1.8198 0.0490  -0.1773 0.1326  4    TYR B CG  
2503 C CD1 . TYR B 4   ? 1.6566 1.3422 1.9151 0.0451  -0.1771 0.1596  4    TYR B CD1 
2504 C CD2 . TYR B 4   ? 1.6628 1.0793 1.8241 0.1014  -0.1903 0.1375  4    TYR B CD2 
2505 C CE1 . TYR B 4   ? 1.7335 1.4279 2.0308 0.0915  -0.1879 0.1930  4    TYR B CE1 
2506 C CE2 . TYR B 4   ? 1.7459 1.1694 1.9478 0.1476  -0.2025 0.1691  4    TYR B CE2 
2507 C CZ  . TYR B 4   ? 1.7690 1.3309 2.0378 0.1420  -0.2004 0.1980  4    TYR B CZ  
2508 O OH  . TYR B 4   ? 1.8191 1.3889 2.1267 0.1896  -0.2131 0.2291  4    TYR B OH  
2509 N N   . ILE B 5   ? 1.7745 1.0733 1.7793 0.0322  -0.0570 0.0155  5    ILE B N   
2510 C CA  . ILE B 5   ? 1.8911 1.0330 1.8131 0.0715  -0.0343 -0.0077 5    ILE B CA  
2511 C C   . ILE B 5   ? 1.9085 0.9848 1.8289 0.1402  -0.0491 0.0129  5    ILE B C   
2512 O O   . ILE B 5   ? 1.9940 0.9369 1.8427 0.1844  -0.0371 -0.0059 5    ILE B O   
2513 C CB  . ILE B 5   ? 2.0773 1.2097 1.9732 0.0528  0.0276  -0.0326 5    ILE B CB  
2514 C CG1 . ILE B 5   ? 2.0975 1.3623 2.0469 -0.0167 0.0419  -0.0425 5    ILE B CG1 
2515 C CG2 . ILE B 5   ? 2.2217 1.2008 2.0155 0.0670  0.0490  -0.0661 5    ILE B CG2 
2516 C CD1 . ILE B 5   ? 2.1778 1.4306 2.1113 -0.0430 0.1032  -0.0688 5    ILE B CD1 
2517 N N   . HIS B 6   ? 1.8190 0.9846 1.8146 0.1544  -0.0762 0.0503  6    HIS B N   
2518 C CA  . HIS B 6   ? 1.8448 0.9667 1.8514 0.2186  -0.0901 0.0711  6    HIS B CA  
2519 C C   . HIS B 6   ? 1.9344 0.9634 1.9290 0.2544  -0.1422 0.0780  6    HIS B C   
2520 O O   . HIS B 6   ? 2.0005 1.0469 2.0099 0.2238  -0.1727 0.0827  6    HIS B O   
2521 C CB  . HIS B 6   ? 1.7733 1.0357 1.8676 0.2166  -0.0954 0.1072  6    HIS B CB  
2522 C CG  . HIS B 6   ? 1.7218 1.0866 1.8434 0.1817  -0.0475 0.0984  6    HIS B CG  
2523 N ND1 . HIS B 6   ? 1.7260 1.0515 1.8192 0.2042  0.0006  0.0839  6    HIS B ND1 
2524 C CD2 . HIS B 6   ? 1.6428 1.1494 1.8212 0.1267  -0.0405 0.1005  6    HIS B CD2 
2525 C CE1 . HIS B 6   ? 1.7047 1.1433 1.8435 0.1607  0.0364  0.0780  6    HIS B CE1 
2526 N NE2 . HIS B 6   ? 1.6705 1.2205 1.8617 0.1139  0.0100  0.0852  6    HIS B NE2 
2527 N N   . PRO B 7   ? 2.0253 0.9558 1.9961 0.3206  -0.1533 0.0772  7    PRO B N   
2528 C CA  . PRO B 7   ? 2.1210 0.9516 2.0836 0.3559  -0.2038 0.0757  7    PRO B CA  
2529 C C   . PRO B 7   ? 2.1467 1.0496 2.1968 0.3489  -0.2504 0.1183  7    PRO B C   
2530 O O   . PRO B 7   ? 2.1662 1.0701 2.2239 0.3325  -0.2687 0.1168  7    PRO B O   
2531 C CB  . PRO B 7   ? 2.1604 0.9729 2.1023 0.4025  -0.1729 0.0627  7    PRO B CB  
2532 C CG  . PRO B 7   ? 2.1996 1.0015 2.1387 0.4382  -0.1597 0.0765  7    PRO B CG  
2533 C CD  . PRO B 7   ? 2.0624 0.9589 2.0063 0.3679  -0.1186 0.0713  7    PRO B CD  
2534 N N   . PHE B 8   ? 2.1152 1.1278 2.2310 0.3491  -0.2485 0.1546  8    PHE B N   
2535 C CA  . PHE B 8   ? 2.1242 1.2071 2.3197 0.3424  -0.2892 0.1995  8    PHE B CA  
2536 C C   . PHE B 8   ? 2.0852 1.3269 2.3257 0.2843  -0.2757 0.2219  8    PHE B C   
2537 O O   . PHE B 8   ? 2.0722 1.3534 2.3286 0.2452  -0.2921 0.2317  8    PHE B O   
2538 C CB  . PHE B 8   ? 2.2071 1.2836 2.4460 0.3997  -0.3091 0.2275  8    PHE B CB  
2539 C CG  . PHE B 8   ? 2.1448 1.2660 2.4609 0.4007  -0.3519 0.2749  8    PHE B CG  
2540 C CD1 . PHE B 8   ? 2.1139 1.2436 2.4380 0.3629  -0.3670 0.2796  8    PHE B CD1 
2541 C CD2 . PHE B 8   ? 2.0985 1.2759 2.4667 0.4327  -0.3615 0.3102  8    PHE B CD2 
2542 C CE1 . PHE B 8   ? 2.0745 1.2625 2.4571 0.3572  -0.3884 0.3197  8    PHE B CE1 
2543 C CE2 . PHE B 8   ? 2.0922 1.3259 2.5117 0.4261  -0.3827 0.3483  8    PHE B CE2 
2544 C CZ  . PHE B 8   ? 2.0675 1.3044 2.4947 0.3882  -0.3950 0.3537  8    PHE B CZ  
2545 O OXT . PHE B 8   ? 2.1274 1.4633 2.3893 0.2775  -0.2485 0.2283  8    PHE B OXT 
2546 N N   . GLU C 8   ? 2.2953 4.0060 2.6448 0.0921  -0.4421 -0.4548 1008 GLU C N   
2547 C CA  . GLU C 8   ? 2.3580 3.8499 2.6091 0.1434  -0.3956 -0.4373 1008 GLU C CA  
2548 C C   . GLU C 8   ? 2.4167 3.6954 2.6628 0.1082  -0.3647 -0.4329 1008 GLU C C   
2549 O O   . GLU C 8   ? 2.3398 3.4499 2.5712 0.0908  -0.3266 -0.4060 1008 GLU C O   
2550 C CB  . GLU C 8   ? 2.5032 3.9675 2.5905 0.2842  -0.3973 -0.4638 1008 GLU C CB  
2551 C CG  . GLU C 8   ? 2.5412 4.2118 2.6352 0.3373  -0.4234 -0.4833 1008 GLU C CG  
2552 C CD  . GLU C 8   ? 2.7154 4.3429 2.6573 0.4872  -0.4420 -0.5183 1008 GLU C CD  
2553 O OE1 . GLU C 8   ? 2.8412 4.3025 2.6670 0.5399  -0.4442 -0.5224 1008 GLU C OE1 
2554 O OE2 . GLU C 8   ? 2.7344 4.4961 2.6727 0.5503  -0.4600 -0.5447 1008 GLU C OE2 
2555 N N   . THR C 9   ? 2.5299 3.8282 2.7891 0.0978  -0.3809 -0.4653 1009 THR C N   
2556 C CA  . THR C 9   ? 2.5452 3.6794 2.8183 0.0590  -0.3522 -0.4785 1009 THR C CA  
2557 C C   . THR C 9   ? 2.4681 3.5685 2.9106 -0.0518 -0.3548 -0.4569 1009 THR C C   
2558 O O   . THR C 9   ? 2.5284 3.4667 2.9837 -0.0756 -0.3167 -0.4550 1009 THR C O   
2559 C CB  . THR C 9   ? 2.4836 3.6712 2.7475 0.0656  -0.3753 -0.5257 1009 THR C CB  
2560 O OG1 . THR C 9   ? 2.5663 3.7696 2.6669 0.1679  -0.3804 -0.5419 1009 THR C OG1 
2561 C CG2 . THR C 9   ? 2.4788 3.5186 2.7612 0.0274  -0.3420 -0.5552 1009 THR C CG2 
2562 N N   . LEU C 10  ? 2.2955 3.5507 2.8697 -0.1259 -0.4058 -0.4400 1010 LEU C N   
2563 C CA  . LEU C 10  ? 2.2273 3.4442 2.9613 -0.2375 -0.4272 -0.4108 1010 LEU C CA  
2564 C C   . LEU C 10  ? 2.4200 3.5353 3.1379 -0.2436 -0.3897 -0.3653 1010 LEU C C   
2565 O O   . LEU C 10  ? 2.3892 3.3863 3.2036 -0.3100 -0.3864 -0.3483 1010 LEU C O   
2566 C CB  . LEU C 10  ? 2.0662 3.4755 2.9187 -0.3260 -0.5000 -0.3907 1010 LEU C CB  
2567 C CG  . LEU C 10  ? 1.9038 3.4251 2.7858 -0.3358 -0.5494 -0.4293 1010 LEU C CG  
2568 C CD1 . LEU C 10  ? 1.5040 3.2339 2.4786 -0.4285 -0.6215 -0.3981 1010 LEU C CD1 
2569 C CD2 . LEU C 10  ? 1.7049 3.0906 2.6704 -0.3714 -0.5628 -0.4678 1010 LEU C CD2 
2570 N N   . ASN C 11  ? 2.7947 3.9533 3.3966 -0.1725 -0.3669 -0.3498 1011 ASN C N   
2571 C CA  . ASN C 11  ? 2.8817 3.9358 3.4534 -0.1718 -0.3318 -0.3094 1011 ASN C CA  
2572 C C   . ASN C 11  ? 2.9861 3.8123 3.4824 -0.1351 -0.2775 -0.3140 1011 ASN C C   
2573 O O   . ASN C 11  ? 3.0390 3.7444 3.5813 -0.1820 -0.2557 -0.2822 1011 ASN C O   
2574 C CB  . ASN C 11  ? 2.9304 4.0868 3.3938 -0.0924 -0.3268 -0.3065 1011 ASN C CB  
2575 C CG  . ASN C 11  ? 2.8624 4.2710 3.4082 -0.1448 -0.3724 -0.3018 1011 ASN C CG  
2576 O OD1 . ASN C 11  ? 2.7917 4.2643 3.4735 -0.2649 -0.4073 -0.2738 1011 ASN C OD1 
2577 N ND2 . ASN C 11  ? 2.8655 4.4236 3.3300 -0.0586 -0.3786 -0.3311 1011 ASN C ND2 
2578 N N   . ASP C 12  ? 2.9882 3.7594 3.3645 -0.0588 -0.2572 -0.3516 1012 ASP C N   
2579 C CA  . ASP C 12  ? 2.7156 3.2895 3.0023 -0.0349 -0.2051 -0.3559 1012 ASP C CA  
2580 C C   . ASP C 12  ? 2.4833 2.9895 2.9089 -0.1168 -0.1944 -0.3759 1012 ASP C C   
2581 O O   . ASP C 12  ? 2.4576 2.8253 2.8907 -0.1411 -0.1553 -0.3618 1012 ASP C O   
2582 C CB  . ASP C 12  ? 2.6189 3.1634 2.7346 0.0521  -0.1957 -0.3882 1012 ASP C CB  
2583 C CG  . ASP C 12  ? 2.4857 3.0676 2.4615 0.1478  -0.2151 -0.3753 1012 ASP C CG  
2584 O OD1 . ASP C 12  ? 2.3373 2.9160 2.3138 0.1564  -0.2150 -0.3424 1012 ASP C OD1 
2585 O OD2 . ASP C 12  ? 2.4446 3.0585 2.3118 0.2164  -0.2350 -0.4028 1012 ASP C OD2 
2586 N N   . ASN C 13  ? 2.4774 3.0809 3.0182 -0.1577 -0.2334 -0.4140 1013 ASN C N   
2587 C CA  . ASN C 13  ? 2.4636 3.0116 3.1613 -0.2305 -0.2392 -0.4451 1013 ASN C CA  
2588 C C   . ASN C 13  ? 2.5668 3.0903 3.4189 -0.3136 -0.2673 -0.4001 1013 ASN C C   
2589 O O   . ASN C 13  ? 2.5398 2.9711 3.5093 -0.3621 -0.2638 -0.4186 1013 ASN C O   
2590 C CB  . ASN C 13  ? 2.3669 3.0191 3.1499 -0.2521 -0.2886 -0.4982 1013 ASN C CB  
2591 C CG  . ASN C 13  ? 2.3706 3.0371 3.0064 -0.1800 -0.2620 -0.5466 1013 ASN C CG  
2592 O OD1 . ASN C 13  ? 2.3888 3.1745 3.0142 -0.1650 -0.3018 -0.5661 1013 ASN C OD1 
2593 N ND2 . ASN C 13  ? 2.3419 2.8892 2.8582 -0.1433 -0.1980 -0.5627 1013 ASN C ND2 
2594 N N   . LEU C 14  ? 2.7385 3.3512 3.5957 -0.3338 -0.2981 -0.3457 1014 LEU C N   
2595 C CA  . LEU C 14  ? 2.6580 3.2370 3.6324 -0.4172 -0.3221 -0.2929 1014 LEU C CA  
2596 C C   . LEU C 14  ? 2.6376 3.0692 3.5328 -0.3904 -0.2604 -0.2618 1014 LEU C C   
2597 O O   . LEU C 14  ? 2.6179 2.9650 3.6182 -0.4568 -0.2676 -0.2321 1014 LEU C O   
2598 C CB  . LEU C 14  ? 2.5817 3.3255 3.5777 -0.4599 -0.3722 -0.2479 1014 LEU C CB  
2599 C CG  . LEU C 14  ? 2.4774 3.2131 3.5946 -0.5690 -0.4128 -0.1869 1014 LEU C CG  
2600 C CD1 . LEU C 14  ? 2.4124 3.0992 3.7172 -0.6656 -0.4813 -0.1951 1014 LEU C CD1 
2601 C CD2 . LEU C 14  ? 2.4100 3.3366 3.5085 -0.6062 -0.4466 -0.1478 1014 LEU C CD2 
2602 N N   . LYS C 15  ? 2.7240 3.1153 3.4337 -0.2969 -0.2082 -0.2653 1015 LYS C N   
2603 C CA  . LYS C 15  ? 2.6298 2.8579 3.2501 -0.2725 -0.1516 -0.2408 1015 LYS C CA  
2604 C C   . LYS C 15  ? 2.7246 2.8361 3.3985 -0.2969 -0.1177 -0.2779 1015 LYS C C   
2605 O O   . LYS C 15  ? 2.5634 2.5549 3.2559 -0.3242 -0.0865 -0.2541 1015 LYS C O   
2606 C CB  . LYS C 15  ? 2.4562 2.6523 2.8577 -0.1687 -0.1202 -0.2389 1015 LYS C CB  
2607 C CG  . LYS C 15  ? 2.3559 2.6693 2.6934 -0.1228 -0.1485 -0.2180 1015 LYS C CG  
2608 C CD  . LYS C 15  ? 2.3552 2.5985 2.4812 -0.0121 -0.1298 -0.2233 1015 LYS C CD  
2609 C CE  . LYS C 15  ? 2.2900 2.6590 2.3606 0.0501  -0.1612 -0.2208 1015 LYS C CE  
2610 N NZ  . LYS C 15  ? 2.4071 2.6802 2.2770 0.1637  -0.1597 -0.2281 1015 LYS C NZ  
2611 N N   . VAL C 16  ? 3.0488 3.2057 3.7510 -0.2885 -0.1231 -0.3415 1016 VAL C N   
2612 C CA  . VAL C 16  ? 3.1328 3.2065 3.8640 -0.2996 -0.0817 -0.3955 1016 VAL C CA  
2613 C C   . VAL C 16  ? 3.0408 3.0620 3.9748 -0.3769 -0.0987 -0.3979 1016 VAL C C   
2614 O O   . VAL C 16  ? 3.0965 3.0175 4.0353 -0.3886 -0.0513 -0.4063 1016 VAL C O   
2615 C CB  . VAL C 16  ? 3.1830 3.3368 3.9193 -0.2804 -0.0919 -0.4714 1016 VAL C CB  
2616 C CG1 . VAL C 16  ? 3.2221 3.3219 4.0228 -0.3028 -0.0519 -0.5434 1016 VAL C CG1 
2617 C CG2 . VAL C 16  ? 3.3246 3.5047 3.8451 -0.2024 -0.0731 -0.4683 1016 VAL C CG2 
2618 N N   . ILE C 17  ? 2.9285 3.0166 4.0326 -0.4354 -0.1735 -0.3890 1017 ILE C N   
2619 C CA  . ILE C 17  ? 2.7590 2.7892 4.0710 -0.5096 -0.2108 -0.3969 1017 ILE C CA  
2620 C C   . ILE C 17  ? 2.6877 2.6120 3.9870 -0.5338 -0.1819 -0.3315 1017 ILE C C   
2621 O O   . ILE C 17  ? 2.6591 2.4962 4.0589 -0.5619 -0.1662 -0.3525 1017 ILE C O   
2622 C CB  . ILE C 17  ? 2.4599 2.5702 3.9354 -0.5780 -0.3143 -0.3854 1017 ILE C CB  
2623 C CG1 . ILE C 17  ? 2.3662 2.5804 3.7468 -0.5811 -0.3390 -0.3162 1017 ILE C CG1 
2624 C CG2 . ILE C 17  ? 2.4504 2.6189 4.0061 -0.5700 -0.3501 -0.4718 1017 ILE C CG2 
2625 C CD1 . ILE C 17  ? 2.2355 2.4463 3.6736 -0.6588 -0.3881 -0.2340 1017 ILE C CD1 
2626 N N   . GLU C 18  ? 2.6209 2.5580 3.8015 -0.5217 -0.1758 -0.2578 1018 GLU C N   
2627 C CA  . GLU C 18  ? 2.4937 2.3238 3.6386 -0.5387 -0.1445 -0.1971 1018 GLU C CA  
2628 C C   . GLU C 18  ? 2.5386 2.2605 3.5548 -0.4888 -0.0616 -0.2160 1018 GLU C C   
2629 O O   . GLU C 18  ? 2.6457 2.2629 3.6953 -0.5192 -0.0359 -0.1927 1018 GLU C O   
2630 C CB  . GLU C 18  ? 2.4101 2.2895 3.4431 -0.5265 -0.1536 -0.1288 1018 GLU C CB  
2631 C CG  . GLU C 18  ? 2.2870 2.2809 3.4415 -0.6020 -0.2332 -0.0959 1018 GLU C CG  
2632 C CD  . GLU C 18  ? 2.2341 2.3088 3.2750 -0.5878 -0.2327 -0.0440 1018 GLU C CD  
2633 O OE1 . GLU C 18  ? 2.2710 2.2784 3.1579 -0.5211 -0.1779 -0.0288 1018 GLU C OE1 
2634 O OE2 . GLU C 18  ? 2.1826 2.3931 3.2870 -0.6458 -0.2909 -0.0221 1018 GLU C OE2 
2635 N N   . LYS C 19  ? 2.6808 2.4272 3.5461 -0.4207 -0.0238 -0.2546 1019 LYS C N   
2636 C CA  . LYS C 19  ? 2.6897 2.3416 3.4070 -0.3856 0.0482  -0.2682 1019 LYS C CA  
2637 C C   . LYS C 19  ? 2.7227 2.4003 3.5044 -0.3943 0.0746  -0.3574 1019 LYS C C   
2638 O O   . LYS C 19  ? 2.7659 2.4056 3.3992 -0.3678 0.1315  -0.3797 1019 LYS C O   
2639 C CB  . LYS C 19  ? 2.4753 2.1183 2.9505 -0.3080 0.0657  -0.2422 1019 LYS C CB  
2640 C CG  . LYS C 19  ? 2.2822 1.9442 2.7001 -0.2832 0.0324  -0.1785 1019 LYS C CG  
2641 C CD  . LYS C 19  ? 2.0872 1.6577 2.5540 -0.3298 0.0378  -0.1192 1019 LYS C CD  
2642 C CE  . LYS C 19  ? 1.9324 1.5756 2.4144 -0.3322 -0.0056 -0.0734 1019 LYS C CE  
2643 N NZ  . LYS C 19  ? 1.8119 1.3923 2.3962 -0.4043 -0.0134 -0.0216 1019 LYS C NZ  
2644 N N   . ALA C 20  ? 2.6610 2.4037 3.6574 -0.4347 0.0289  -0.4110 1020 ALA C N   
2645 C CA  . ALA C 20  ? 2.6841 2.4712 3.7607 -0.4373 0.0468  -0.5132 1020 ALA C CA  
2646 C C   . ALA C 20  ? 2.6884 2.4092 3.8177 -0.4662 0.1023  -0.5454 1020 ALA C C   
2647 O O   . ALA C 20  ? 2.6343 2.2916 3.8805 -0.5071 0.0874  -0.5102 1020 ALA C O   
2648 C CB  . ALA C 20  ? 2.6208 2.4841 3.9201 -0.4691 -0.0348 -0.5632 1020 ALA C CB  
2649 N N   . ASP C 21  ? 2.9190 2.6649 3.9596 -0.4508 0.1657  -0.6134 1021 ASP C N   
2650 C CA  . ASP C 21  ? 2.7243 2.4424 3.8135 -0.4833 0.2252  -0.6580 1021 ASP C CA  
2651 C C   . ASP C 21  ? 2.6338 2.4163 4.0020 -0.5104 0.1924  -0.7643 1021 ASP C C   
2652 O O   . ASP C 21  ? 2.5600 2.3091 4.0685 -0.5446 0.2010  -0.7810 1021 ASP C O   
2653 C CB  . ASP C 21  ? 2.4718 2.2073 3.3467 -0.4706 0.3045  -0.6896 1021 ASP C CB  
2654 C CG  . ASP C 21  ? 2.3495 1.9908 2.9476 -0.4441 0.3246  -0.5841 1021 ASP C CG  
2655 O OD1 . ASP C 21  ? 2.2670 1.8048 2.8246 -0.4572 0.3298  -0.5027 1021 ASP C OD1 
2656 O OD2 . ASP C 21  ? 2.3656 2.0310 2.7879 -0.4084 0.3282  -0.5851 1021 ASP C OD2 
2657 N N   . ASN C 22  ? 2.7238 2.5950 4.1807 -0.4932 0.1475  -0.8397 1022 ASN C N   
2658 C CA  . ASN C 22  ? 2.7247 2.6511 4.4485 -0.5095 0.1012  -0.9530 1022 ASN C CA  
2659 C C   . ASN C 22  ? 2.6979 2.6776 4.4982 -0.4929 0.0115  -0.9703 1022 ASN C C   
2660 O O   . ASN C 22  ? 2.7245 2.6986 4.4132 -0.4849 -0.0180 -0.8928 1022 ASN C O   
2661 C CB  . ASN C 22  ? 2.8168 2.8256 4.5453 -0.5059 0.1788  -1.0792 1022 ASN C CB  
2662 C CG  . ASN C 22  ? 2.9618 3.0355 4.4596 -0.4789 0.2361  -1.1010 1022 ASN C CG  
2663 O OD1 . ASN C 22  ? 2.9781 3.0751 4.4115 -0.4518 0.1931  -1.0821 1022 ASN C OD1 
2664 N ND2 . ASN C 22  ? 3.0486 3.1548 4.4154 -0.4935 0.3302  -1.1375 1022 ASN C ND2 
2665 N N   . ALA C 23  ? 4.2948 3.6670 3.4833 0.2783  -0.2259 -0.6931 1023 ALA C N   
2666 C CA  . ALA C 23  ? 4.1003 3.5190 3.2495 0.2999  -0.1801 -0.5858 1023 ALA C CA  
2667 C C   . ALA C 23  ? 3.9861 3.2544 3.1711 0.2507  -0.1896 -0.5172 1023 ALA C C   
2668 O O   . ALA C 23  ? 3.9628 3.2729 3.1515 0.2867  -0.1665 -0.4652 1023 ALA C O   
2669 C CB  . ALA C 23  ? 3.8938 3.3548 2.9721 0.2757  -0.1360 -0.5072 1023 ALA C CB  
2670 N N   . ALA C 24  ? 3.9833 3.0793 3.1956 0.1714  -0.2218 -0.5156 1024 ALA C N   
2671 C CA  . ALA C 24  ? 3.9292 2.8810 3.1659 0.1265  -0.2315 -0.4460 1024 ALA C CA  
2672 C C   . ALA C 24  ? 3.9054 2.8466 3.1998 0.1732  -0.2597 -0.4923 1024 ALA C C   
2673 O O   . ALA C 24  ? 3.9689 2.8616 3.2781 0.1712  -0.2559 -0.4317 1024 ALA C O   
2674 C CB  . ALA C 24  ? 3.9770 2.7498 3.2206 0.0362  -0.2563 -0.4316 1024 ALA C CB  
2675 N N   . GLN C 25  ? 4.3797 3.3691 3.7111 0.2171  -0.2896 -0.6030 1025 GLN C N   
2676 C CA  . GLN C 25  ? 3.4360 2.4375 2.8208 0.2718  -0.3148 -0.6529 1025 GLN C CA  
2677 C C   . GLN C 25  ? 4.3358 3.4978 3.7017 0.3487  -0.2775 -0.6228 1025 GLN C C   
2678 O O   . GLN C 25  ? 3.4115 2.5596 2.8104 0.3743  -0.2823 -0.6048 1025 GLN C O   
2679 C CB  . GLN C 25  ? 3.5045 2.5299 2.9373 0.3031  -0.3552 -0.7843 1025 GLN C CB  
2680 C CG  . GLN C 25  ? 3.5532 2.4086 3.0255 0.2301  -0.3920 -0.8206 1025 GLN C CG  
2681 C CD  . GLN C 25  ? 3.6246 2.5043 3.1617 0.2632  -0.4318 -0.9560 1025 GLN C CD  
2682 O OE1 . GLN C 25  ? 3.6326 2.6721 3.1752 0.3426  -0.4328 -1.0280 1025 GLN C OE1 
2683 N NE2 . GLN C 25  ? 3.6810 2.4027 3.2705 0.2045  -0.4637 -0.9920 1025 GLN C NE2 
2684 N N   . VAL C 26  ? 3.9302 3.2476 3.2446 0.3895  -0.2387 -0.6186 1026 VAL C N   
2685 C CA  . VAL C 26  ? 3.9009 3.3691 3.1916 0.4597  -0.1918 -0.5742 1026 VAL C CA  
2686 C C   . VAL C 26  ? 3.8682 3.2705 3.1564 0.4193  -0.1608 -0.4546 1026 VAL C C   
2687 O O   . VAL C 26  ? 3.9136 3.3601 3.2284 0.4590  -0.1438 -0.4255 1026 VAL C O   
2688 C CB  . VAL C 26  ? 3.8422 3.4747 3.0683 0.5065  -0.1527 -0.5809 1026 VAL C CB  
2689 C CG1 . VAL C 26  ? 3.8183 3.6051 3.0192 0.5825  -0.0971 -0.5284 1026 VAL C CG1 
2690 C CG2 . VAL C 26  ? 3.9078 3.6110 3.1430 0.5491  -0.1887 -0.7096 1026 VAL C CG2 
2691 N N   . LYS C 27  ? 3.7222 3.0198 2.9840 0.3404  -0.1540 -0.3876 1027 LYS C N   
2692 C CA  . LYS C 27  ? 3.6024 2.8319 2.8674 0.2986  -0.1295 -0.2802 1027 LYS C CA  
2693 C C   . LYS C 27  ? 3.7237 2.8437 3.0492 0.2881  -0.1651 -0.2818 1027 LYS C C   
2694 O O   . LYS C 27  ? 3.7163 2.8589 3.0666 0.3046  -0.1427 -0.2260 1027 LYS C O   
2695 C CB  . LYS C 27  ? 3.4602 2.5858 2.6881 0.2149  -0.1262 -0.2228 1027 LYS C CB  
2696 C CG  . LYS C 27  ? 3.2860 2.3355 2.5202 0.1685  -0.1066 -0.1182 1027 LYS C CG  
2697 C CD  . LYS C 27  ? 3.0869 2.0239 2.2856 0.0861  -0.1112 -0.0715 1027 LYS C CD  
2698 C CE  . LYS C 27  ? 3.0831 1.9604 2.2883 0.0456  -0.0911 0.0286  1027 LYS C CE  
2699 N NZ  . LYS C 27  ? 3.0731 1.8318 2.2444 -0.0337 -0.1015 0.0696  1027 LYS C NZ  
2700 N N   . ASP C 28  ? 3.9845 2.9856 3.3384 0.2624  -0.2195 -0.3462 1028 ASP C N   
2701 C CA  . ASP C 28  ? 4.0926 2.9813 3.4994 0.2556  -0.2566 -0.3500 1028 ASP C CA  
2702 C C   . ASP C 28  ? 4.1461 3.1451 3.5934 0.3370  -0.2542 -0.3896 1028 ASP C C   
2703 O O   . ASP C 28  ? 4.2144 3.1856 3.6973 0.3452  -0.2555 -0.3526 1028 ASP C O   
2704 C CB  . ASP C 28  ? 4.1577 2.9005 3.5859 0.2169  -0.3106 -0.4135 1028 ASP C CB  
2705 C CG  . ASP C 28  ? 4.1863 2.7678 3.6494 0.1866  -0.3460 -0.3871 1028 ASP C CG  
2706 O OD1 . ASP C 28  ? 4.1623 2.7669 3.6498 0.2154  -0.3401 -0.3526 1028 ASP C OD1 
2707 O OD2 . ASP C 28  ? 4.2282 2.6600 3.6957 0.1358  -0.3788 -0.4014 1028 ASP C OD2 
2708 N N   . ALA C 29  ? 3.9931 3.1229 3.4372 0.4004  -0.2515 -0.4681 1029 ALA C N   
2709 C CA  . ALA C 29  ? 3.8498 3.0943 3.3294 0.4828  -0.2483 -0.5103 1029 ALA C CA  
2710 C C   . ALA C 29  ? 3.7017 3.0655 3.1708 0.5166  -0.1875 -0.4297 1029 ALA C C   
2711 O O   . ALA C 29  ? 3.6957 3.0918 3.2090 0.5547  -0.1832 -0.4225 1029 ALA C O   
2712 C CB  . ALA C 29  ? 3.9061 3.2694 3.3802 0.5460  -0.2602 -0.6161 1029 ALA C CB  
2713 N N   . LEU C 30  ? 3.5907 3.0205 3.0065 0.5035  -0.1383 -0.3686 1030 LEU C N   
2714 C CA  . LEU C 30  ? 3.5420 3.0826 2.9531 0.5341  -0.0738 -0.2878 1030 LEU C CA  
2715 C C   . LEU C 30  ? 3.5931 3.0312 3.0437 0.4818  -0.0684 -0.2045 1030 LEU C C   
2716 O O   . LEU C 30  ? 3.5539 3.0646 3.0399 0.5142  -0.0303 -0.1601 1030 LEU C O   
2717 C CB  . LEU C 30  ? 3.3890 3.0203 2.7319 0.5352  -0.0232 -0.2449 1030 LEU C CB  
2718 C CG  . LEU C 30  ? 3.2288 2.9901 2.5286 0.6002  -0.0229 -0.3260 1030 LEU C CG  
2719 C CD1 . LEU C 30  ? 3.1925 3.0416 2.4210 0.6042  0.0282  -0.2770 1030 LEU C CD1 
2720 C CD2 . LEU C 30  ? 3.2776 3.1777 2.6017 0.6962  -0.0115 -0.3745 1030 LEU C CD2 
2721 N N   . THR C 31  ? 3.6916 2.9660 3.1395 0.4035  -0.1045 -0.1836 1031 THR C N   
2722 C CA  . THR C 31  ? 3.7206 2.8935 3.2079 0.3592  -0.1097 -0.1170 1031 THR C CA  
2723 C C   . THR C 31  ? 3.7817 2.9205 3.3335 0.3909  -0.1471 -0.1589 1031 THR C C   
2724 O O   . THR C 31  ? 3.8083 2.9448 3.4077 0.3928  -0.1347 -0.1129 1031 THR C O   
2725 C CB  . THR C 31  ? 3.6784 2.6875 3.1383 0.2743  -0.1405 -0.0875 1031 THR C CB  
2726 O OG1 . THR C 31  ? 3.7529 2.6757 3.2031 0.2621  -0.1931 -0.1646 1031 THR C OG1 
2727 C CG2 . THR C 31  ? 3.6185 2.6627 3.0223 0.2395  -0.0976 -0.0286 1031 THR C CG2 
2728 N N   . LYS C 32  ? 3.9159 3.0282 3.4753 0.4164  -0.1940 -0.2493 1032 LYS C N   
2729 C CA  . LYS C 32  ? 3.9603 3.0538 3.5798 0.4562  -0.2292 -0.2967 1032 LYS C CA  
2730 C C   . LYS C 32  ? 4.1530 3.4159 3.8044 0.5317  -0.1863 -0.2971 1032 LYS C C   
2731 O O   . LYS C 32  ? 4.0973 3.3581 3.8057 0.5510  -0.1907 -0.2858 1032 LYS C O   
2732 C CB  . LYS C 32  ? 3.8408 2.8793 3.4647 0.4706  -0.2846 -0.3974 1032 LYS C CB  
2733 C CG  . LYS C 32  ? 3.4364 2.2736 3.0693 0.4109  -0.3404 -0.4030 1032 LYS C CG  
2734 C CD  . LYS C 32  ? 3.5280 2.3191 3.1863 0.4358  -0.3917 -0.5061 1032 LYS C CD  
2735 C CE  . LYS C 32  ? 3.5774 2.1651 3.2514 0.3861  -0.4432 -0.5059 1032 LYS C CE  
2736 N NZ  . LYS C 32  ? 3.6602 2.2009 3.3717 0.4138  -0.4908 -0.6061 1032 LYS C NZ  
2737 N N   . MET C 33  ? 4.4629 3.8766 4.0780 0.5784  -0.1438 -0.3109 1033 MET C N   
2738 C CA  . MET C 33  ? 4.4664 4.0481 4.1048 0.6530  -0.0935 -0.3022 1033 MET C CA  
2739 C C   . MET C 33  ? 4.3404 3.9442 4.0057 0.6313  -0.0385 -0.1995 1033 MET C C   
2740 O O   . MET C 33  ? 4.3703 4.0498 4.0914 0.6730  -0.0122 -0.1855 1033 MET C O   
2741 C CB  . MET C 33  ? 4.4756 4.2112 4.0578 0.7099  -0.0580 -0.3334 1033 MET C CB  
2742 C CG  . MET C 33  ? 4.5469 4.2844 4.1142 0.7403  -0.1105 -0.4461 1033 MET C CG  
2743 S SD  . MET C 33  ? 4.5572 4.4960 4.0599 0.8219  -0.0717 -0.4914 1033 MET C SD  
2744 C CE  . MET C 33  ? 4.5974 4.7064 4.1367 0.9220  -0.0292 -0.4936 1033 MET C CE  
2745 N N   . ARG C 34  ? 4.0038 3.5450 3.6359 0.5663  -0.0198 -0.1295 1034 ARG C N   
2746 C CA  . ARG C 34  ? 3.7659 3.3154 3.4329 0.5389  0.0284  -0.0351 1034 ARG C CA  
2747 C C   . ARG C 34  ? 3.7952 3.2470 3.5369 0.5157  -0.0076 -0.0281 1034 ARG C C   
2748 O O   . ARG C 34  ? 3.7871 3.2990 3.5931 0.5335  0.0291  0.0121  1034 ARG C O   
2749 C CB  . ARG C 34  ? 3.4760 2.9640 3.0917 0.4716  0.0452  0.0285  1034 ARG C CB  
2750 C CG  . ARG C 34  ? 3.2642 2.7463 2.9204 0.4353  0.0900  0.1231  1034 ARG C CG  
2751 C CD  . ARG C 34  ? 3.1243 2.5517 2.7236 0.3734  0.1040  0.1779  1034 ARG C CD  
2752 N NE  . ARG C 34  ? 3.0194 2.4423 2.6613 0.3382  0.1467  0.2652  1034 ARG C NE  
2753 C CZ  . ARG C 34  ? 2.8672 2.2576 2.4726 0.2879  0.1691  0.3243  1034 ARG C CZ  
2754 N NH1 . ARG C 34  ? 2.8747 2.2361 2.3976 0.2669  0.1538  0.3063  1034 ARG C NH1 
2755 N NH2 . ARG C 34  ? 2.8346 2.2238 2.4914 0.2588  0.2066  0.3978  1034 ARG C NH2 
2756 N N   . ALA C 35  ? 3.8409 3.1423 3.5775 0.4776  -0.0780 -0.0671 1035 ALA C N   
2757 C CA  . ALA C 35  ? 3.8548 3.0613 3.6548 0.4641  -0.1186 -0.0675 1035 ALA C CA  
2758 C C   . ALA C 35  ? 3.8803 3.1700 3.7396 0.5354  -0.1247 -0.1219 1035 ALA C C   
2759 O O   . ALA C 35  ? 3.9058 3.1981 3.8355 0.5441  -0.1235 -0.1033 1035 ALA C O   
2760 C CB  . ALA C 35  ? 3.9007 2.9279 3.6724 0.4153  -0.1896 -0.0967 1035 ALA C CB  
2761 N N   . ALA C 36  ? 3.8854 3.2473 3.7207 0.5887  -0.1328 -0.1939 1036 ALA C N   
2762 C CA  . ALA C 36  ? 3.8287 3.2833 3.7166 0.6621  -0.1361 -0.2489 1036 ALA C CA  
2763 C C   . ALA C 36  ? 3.8032 3.4193 3.7295 0.7043  -0.0595 -0.1991 1036 ALA C C   
2764 O O   . ALA C 36  ? 3.7749 3.4424 3.7717 0.7433  -0.0547 -0.2106 1036 ALA C O   
2765 C CB  . ALA C 36  ? 3.6613 3.1626 3.5134 0.7108  -0.1623 -0.3407 1036 ALA C CB  
2766 N N   . ALA C 37  ? 3.8728 3.5697 3.7558 0.6981  0.0031  -0.1426 1037 ALA C N   
2767 C CA  . ALA C 37  ? 3.8845 3.7276 3.8047 0.7354  0.0845  -0.0847 1037 ALA C CA  
2768 C C   . ALA C 37  ? 3.8752 3.6703 3.8763 0.6933  0.1004  -0.0189 1037 ALA C C   
2769 O O   . ALA C 37  ? 3.8680 3.7579 3.9435 0.7304  0.1426  -0.0009 1037 ALA C O   
2770 C CB  . ALA C 37  ? 3.8446 3.7728 3.6941 0.7384  0.1464  -0.0366 1037 ALA C CB  
2771 N N   . LEU C 38  ? 3.9116 3.5645 3.9033 0.6176  0.0677  0.0149  1038 LEU C N   
2772 C CA  . LEU C 38  ? 3.8635 3.4642 3.9356 0.5789  0.0711  0.0652  1038 LEU C CA  
2773 C C   . LEU C 38  ? 4.0170 3.5784 4.1603 0.6024  0.0188  0.0122  1038 LEU C C   
2774 O O   . LEU C 38  ? 4.0240 3.6173 4.2582 0.6060  0.0392  0.0378  1038 LEU C O   
2775 C CB  . LEU C 38  ? 3.7455 3.2032 3.7816 0.4980  0.0419  0.1067  1038 LEU C CB  
2776 C CG  . LEU C 38  ? 3.6014 3.0886 3.5825 0.4646  0.0959  0.1725  1038 LEU C CG  
2777 C CD1 . LEU C 38  ? 3.5460 2.8856 3.4961 0.3861  0.0592  0.2063  1038 LEU C CD1 
2778 C CD2 . LEU C 38  ? 3.4927 3.1062 3.5372 0.4829  0.1817  0.2388  1038 LEU C CD2 
2779 N N   . ASP C 39  ? 3.3421 5.1552 4.4470 0.0994  0.2858  -1.4437 1039 ASP C N   
2780 C CA  . ASP C 39  ? 3.3970 5.3172 4.4734 0.1319  0.1971  -1.4828 1039 ASP C CA  
2781 C C   . ASP C 39  ? 3.4285 5.3566 4.5870 0.1659  0.2428  -1.4627 1039 ASP C C   
2782 O O   . ASP C 39  ? 3.4205 5.4731 4.7029 0.1565  0.2428  -1.5447 1039 ASP C O   
2783 C CB  . ASP C 39  ? 3.4262 5.3102 4.2755 0.1807  0.0729  -1.4163 1039 ASP C CB  
2784 C CG  . ASP C 39  ? 3.4502 5.4441 4.2597 0.2128  -0.0347 -1.4673 1039 ASP C CG  
2785 O OD1 . ASP C 39  ? 3.4455 5.5601 4.4083 0.1921  -0.0151 -1.5654 1039 ASP C OD1 
2786 O OD2 . ASP C 39  ? 3.4615 5.4190 4.0865 0.2584  -0.1430 -1.4094 1039 ASP C OD2 
2787 N N   . ILE C 47  ? 2.5330 3.2670 4.2635 -0.0167 1.2175  -0.9496 1067 ILE C N   
2788 C CA  . ILE C 47  ? 2.5814 3.1278 4.2090 0.0134  1.2455  -0.8474 1067 ILE C CA  
2789 C C   . ILE C 47  ? 2.5938 3.1104 4.0310 0.0725  1.1546  -0.8008 1067 ILE C C   
2790 O O   . ILE C 47  ? 2.5212 2.9227 3.8914 0.0799  1.1549  -0.7615 1067 ILE C O   
2791 C CB  . ILE C 47  ? 2.5931 3.0543 4.2052 0.0405  1.3072  -0.7535 1067 ILE C CB  
2792 C CG1 . ILE C 47  ? 2.6421 3.1394 4.4465 -0.0273 1.3989  -0.7957 1067 ILE C CG1 
2793 C CG2 . ILE C 47  ? 2.6219 2.8816 4.1230 0.0736  1.3317  -0.6479 1067 ILE C CG2 
2794 C CD1 . ILE C 47  ? 2.6899 3.1009 4.6087 -0.0949 1.4562  -0.8341 1067 ILE C CD1 
2795 N N   . LEU C 48  ? 2.6392 3.2618 3.9910 0.1137  1.0736  -0.8056 1068 LEU C N   
2796 C CA  . LEU C 48  ? 2.6840 3.2854 3.8520 0.1648  0.9775  -0.7601 1068 LEU C CA  
2797 C C   . LEU C 48  ? 2.7163 3.3593 3.8879 0.1287  0.9420  -0.8262 1068 LEU C C   
2798 O O   . LEU C 48  ? 2.6865 3.2601 3.7305 0.1530  0.8991  -0.7750 1068 LEU C O   
2799 C CB  . LEU C 48  ? 2.5845 3.2955 3.6712 0.2113  0.8919  -0.7635 1068 LEU C CB  
2800 C CG  . LEU C 48  ? 2.5394 3.2390 3.4325 0.2603  0.7783  -0.7185 1068 LEU C CG  
2801 C CD1 . LEU C 48  ? 2.5535 3.0786 3.3031 0.3117  0.7775  -0.5922 1068 LEU C CD1 
2802 C CD2 . LEU C 48  ? 2.5274 3.3443 3.3628 0.2995  0.6910  -0.7411 1068 LEU C CD2 
2803 N N   . VAL C 49  ? 2.7710 3.5313 4.0882 0.0707  0.9587  -0.9406 1069 VAL C N   
2804 C CA  . VAL C 49  ? 2.7772 3.5910 4.1019 0.0377  0.9258  -1.0137 1069 VAL C CA  
2805 C C   . VAL C 49  ? 2.8064 3.4873 4.1427 0.0227  0.9815  -0.9867 1069 VAL C C   
2806 O O   . VAL C 49  ? 2.8254 3.4953 4.0766 0.0297  0.9416  -0.9831 1069 VAL C O   
2807 C CB  . VAL C 49  ? 2.7956 3.7580 4.2813 -0.0190 0.9333  -1.1450 1069 VAL C CB  
2808 C CG1 . VAL C 49  ? 2.8269 3.8428 4.3203 -0.0508 0.9033  -1.2244 1069 VAL C CG1 
2809 C CG2 . VAL C 49  ? 2.7817 3.8799 4.2497 0.0011  0.8696  -1.1739 1069 VAL C CG2 
2810 N N   . GLY C 50  ? 3.0027 3.5829 4.4432 0.0017  1.0728  -0.9669 1070 GLY C N   
2811 C CA  . GLY C 50  ? 2.9973 3.4415 4.4524 -0.0096 1.1235  -0.9433 1070 GLY C CA  
2812 C C   . GLY C 50  ? 2.9650 3.2808 4.2520 0.0476  1.0996  -0.8263 1070 GLY C C   
2813 O O   . GLY C 50  ? 2.8063 3.0671 4.0494 0.0508  1.0923  -0.8191 1070 GLY C O   
2814 N N   . GLN C 51  ? 3.1408 3.4096 4.3336 0.0952  1.0861  -0.7348 1071 GLN C N   
2815 C CA  . GLN C 51  ? 3.1958 3.3405 4.2224 0.1525  1.0547  -0.6204 1071 GLN C CA  
2816 C C   . GLN C 51  ? 3.2337 3.4466 4.1300 0.1721  0.9584  -0.6207 1071 GLN C C   
2817 O O   . GLN C 51  ? 3.2497 3.3763 4.0483 0.1945  0.9394  -0.5606 1071 GLN C O   
2818 C CB  . GLN C 51  ? 3.1815 3.2749 4.1335 0.2024  1.0522  -0.5324 1071 GLN C CB  
2819 C CG  . GLN C 51  ? 3.2342 3.2565 4.2993 0.1839  1.1503  -0.5166 1071 GLN C CG  
2820 C CD  . GLN C 51  ? 3.2325 3.2393 4.2294 0.2345  1.1458  -0.4443 1071 GLN C CD  
2821 O OE1 . GLN C 51  ? 3.1989 3.2820 4.0955 0.2768  1.0663  -0.4333 1071 GLN C OE1 
2822 N NE2 . GLN C 51  ? 3.2847 3.1914 4.3324 0.2316  1.2291  -0.3953 1071 GLN C NE2 
2823 N N   . ILE C 52  ? 3.2916 3.6604 4.1836 0.1626  0.8950  -0.6859 1072 ILE C N   
2824 C CA  . ILE C 52  ? 3.0947 3.5373 3.8643 0.1727  0.8015  -0.6899 1072 ILE C CA  
2825 C C   . ILE C 52  ? 2.9609 3.4374 3.7852 0.1314  0.8184  -0.7582 1072 ILE C C   
2826 O O   . ILE C 52  ? 2.7688 3.2389 3.4851 0.1432  0.7718  -0.7251 1072 ILE C O   
2827 C CB  . ILE C 52  ? 2.3598 2.9549 3.1109 0.1733  0.7273  -0.7440 1072 ILE C CB  
2828 C CG1 . ILE C 52  ? 2.3589 2.9155 3.0207 0.2291  0.6928  -0.6660 1072 ILE C CG1 
2829 C CG2 . ILE C 52  ? 2.3367 3.0213 2.9799 0.1685  0.6351  -0.7647 1072 ILE C CG2 
2830 C CD1 . ILE C 52  ? 2.3420 3.0416 2.9901 0.2363  0.6186  -0.7203 1072 ILE C CD1 
2831 N N   . ASP C 53  ? 3.0558 3.5704 4.0487 0.0830  0.8839  -0.8545 1073 ASP C N   
2832 C CA  . ASP C 53  ? 3.0939 3.6375 4.1458 0.0487  0.9020  -0.9279 1073 ASP C CA  
2833 C C   . ASP C 53  ? 3.1429 3.5380 4.1619 0.0668  0.9428  -0.8611 1073 ASP C C   
2834 O O   . ASP C 53  ? 3.1265 3.5441 4.1337 0.0579  0.9343  -0.8936 1073 ASP C O   
2835 C CB  . ASP C 53  ? 3.1341 3.7359 4.3763 -0.0048 0.9593  -1.0445 1073 ASP C CB  
2836 C CG  . ASP C 53  ? 3.1071 3.8808 4.3871 -0.0282 0.9093  -1.1342 1073 ASP C CG  
2837 O OD1 . ASP C 53  ? 3.0600 3.9101 4.2137 -0.0043 0.8269  -1.1123 1073 ASP C OD1 
2838 O OD2 . ASP C 53  ? 3.1080 3.9366 4.5434 -0.0714 0.9487  -1.2261 1073 ASP C OD2 
2839 N N   . ASP C 54  ? 3.2033 3.4501 4.2073 0.0936  0.9868  -0.7705 1074 ASP C N   
2840 C CA  . ASP C 54  ? 3.2508 3.3471 4.2083 0.1174  1.0169  -0.6974 1074 ASP C CA  
2841 C C   . ASP C 54  ? 3.2178 3.2894 3.9916 0.1639  0.9442  -0.6002 1074 ASP C C   
2842 O O   . ASP C 54  ? 3.3031 3.3317 4.0285 0.1738  0.9383  -0.5751 1074 ASP C O   
2843 C CB  . ASP C 54  ? 3.2621 3.2025 4.2723 0.1261  1.0920  -0.6378 1074 ASP C CB  
2844 C CG  . ASP C 54  ? 3.2860 3.2294 4.4805 0.0734  1.1669  -0.7253 1074 ASP C CG  
2845 O OD1 . ASP C 54  ? 3.2578 3.3118 4.5410 0.0340  1.1612  -0.8347 1074 ASP C OD1 
2846 O OD2 . ASP C 54  ? 3.3017 3.1355 4.5500 0.0702  1.2296  -0.6833 1074 ASP C OD2 
2847 N N   . ALA C 55  ? 3.2516 3.3498 3.9232 0.1933  0.8856  -0.5451 1075 ALA C N   
2848 C CA  . ALA C 55  ? 3.0979 3.1774 3.5916 0.2331  0.8039  -0.4549 1075 ALA C CA  
2849 C C   . ALA C 55  ? 3.0990 3.3145 3.5465 0.2099  0.7413  -0.5061 1075 ALA C C   
2850 O O   . ALA C 55  ? 2.3634 2.5557 2.6914 0.2283  0.6935  -0.4409 1075 ALA C O   
2851 C CB  . ALA C 55  ? 2.3893 2.4704 2.7884 0.2705  0.7479  -0.3963 1075 ALA C CB  
2852 N N   . LEU C 56  ? 2.9133 3.2741 3.4519 0.1683  0.7396  -0.6207 1076 LEU C N   
2853 C CA  . LEU C 56  ? 2.9166 3.4110 3.4208 0.1427  0.6898  -0.6785 1076 LEU C CA  
2854 C C   . LEU C 56  ? 2.9781 3.4396 3.5226 0.1321  0.7360  -0.6968 1076 LEU C C   
2855 O O   . LEU C 56  ? 3.0339 3.5517 3.4911 0.1315  0.6915  -0.6818 1076 LEU C O   
2856 C CB  . LEU C 56  ? 2.9250 3.5728 3.5269 0.1025  0.6825  -0.8027 1076 LEU C CB  
2857 C CG  . LEU C 56  ? 2.8852 3.6849 3.4596 0.0728  0.6339  -0.8770 1076 LEU C CG  
2858 C CD1 . LEU C 56  ? 2.8140 3.6588 3.2047 0.0904  0.5320  -0.8037 1076 LEU C CD1 
2859 C CD2 . LEU C 56  ? 2.8731 3.8044 3.5648 0.0342  0.6380  -1.0058 1076 LEU C CD2 
2860 N N   . LYS C 57  ? 3.0541 3.4283 3.7313 0.1229  0.8232  -0.7306 1077 LYS C N   
2861 C CA  . LYS C 57  ? 3.0985 3.4168 3.8117 0.1228  0.8665  -0.7409 1077 LYS C CA  
2862 C C   . LYS C 57  ? 3.1391 3.3531 3.7188 0.1640  0.8413  -0.6177 1077 LYS C C   
2863 O O   . LYS C 57  ? 3.1035 3.3506 3.6414 0.1663  0.8260  -0.6155 1077 LYS C O   
2864 C CB  . LYS C 57  ? 3.0135 3.2243 3.8798 0.1097  0.9576  -0.7820 1077 LYS C CB  
2865 C CG  . LYS C 57  ? 2.9519 3.2576 3.9697 0.0636  0.9876  -0.9123 1077 LYS C CG  
2866 C CD  . LYS C 57  ? 2.9565 3.1346 4.1153 0.0486  1.0731  -0.9383 1077 LYS C CD  
2867 C CE  . LYS C 57  ? 2.9334 3.1961 4.2490 -0.0006 1.1006  -1.0656 1077 LYS C CE  
2868 N NZ  . LYS C 57  ? 2.9743 3.1018 4.4226 -0.0198 1.1787  -1.0835 1077 LYS C NZ  
2869 N N   . LEU C 58  ? 3.2126 3.3039 3.7254 0.1978  0.8362  -0.5152 1078 LEU C N   
2870 C CA  . LEU C 58  ? 3.2321 3.2091 3.6191 0.2391  0.8101  -0.3943 1078 LEU C CA  
2871 C C   . LEU C 58  ? 3.2057 3.2819 3.4473 0.2431  0.7158  -0.3533 1078 LEU C C   
2872 O O   . LEU C 58  ? 3.2174 3.2562 3.3795 0.2597  0.6938  -0.2888 1078 LEU C O   
2873 C CB  . LEU C 58  ? 3.2601 3.0908 3.6036 0.2763  0.8207  -0.3001 1078 LEU C CB  
2874 C CG  . LEU C 58  ? 3.3147 3.0176 3.7822 0.2738  0.9162  -0.3133 1078 LEU C CG  
2875 C CD1 . LEU C 58  ? 3.3060 2.8800 3.7191 0.3116  0.9250  -0.2191 1078 LEU C CD1 
2876 C CD2 . LEU C 58  ? 3.3511 2.9594 3.8525 0.2789  0.9598  -0.3066 1078 LEU C CD2 
2877 N N   . ALA C 59  ? 3.7759 3.9785 3.9805 0.2263  0.6566  -0.3881 1079 ALA C N   
2878 C CA  . ALA C 59  ? 2.3306 2.6361 2.3997 0.2207  0.5640  -0.3569 1079 ALA C CA  
2879 C C   . ALA C 59  ? 4.4263 4.8550 4.5299 0.1872  0.5724  -0.4292 1079 ALA C C   
2880 O O   . ALA C 59  ? 2.3195 2.7849 2.3192 0.1876  0.5236  -0.3763 1079 ALA C O   
2881 C CB  . ALA C 59  ? 2.3179 2.7225 2.3423 0.2114  0.4966  -0.3828 1079 ALA C CB  
2882 N N   . ASN C 60  ? 3.6281 4.1243 3.8773 0.1581  0.6329  -0.5504 1080 ASN C N   
2883 C CA  . ASN C 60  ? 3.6366 4.2549 3.9245 0.1314  0.6438  -0.6308 1080 ASN C CA  
2884 C C   . ASN C 60  ? 3.5787 4.1143 3.8761 0.1515  0.6858  -0.5928 1080 ASN C C   
2885 O O   . ASN C 60  ? 3.6242 4.2587 3.8917 0.1414  0.6706  -0.6124 1080 ASN C O   
2886 C CB  . ASN C 60  ? 3.6518 4.3490 4.0955 0.0996  0.6945  -0.7727 1080 ASN C CB  
2887 C CG  . ASN C 60  ? 3.6627 4.4870 4.0950 0.0742  0.6429  -0.8294 1080 ASN C CG  
2888 O OD1 . ASN C 60  ? 3.6309 4.5176 3.9312 0.0748  0.5622  -0.7783 1080 ASN C OD1 
2889 N ND2 . ASN C 60  ? 3.6804 4.5413 4.2519 0.0505  0.6854  -0.9361 1080 ASN C ND2 
2890 N N   . GLU C 61  ? 3.5222 3.8819 3.8606 0.1805  0.7381  -0.5400 1081 GLU C N   
2891 C CA  . GLU C 61  ? 3.1490 3.4182 3.4996 0.2034  0.7760  -0.5050 1081 GLU C CA  
2892 C C   . GLU C 61  ? 2.8888 3.1591 3.0890 0.2223  0.7129  -0.3951 1081 GLU C C   
2893 O O   . GLU C 61  ? 2.8533 3.1338 3.0529 0.2305  0.7254  -0.3885 1081 GLU C O   
2894 C CB  . GLU C 61  ? 3.1592 3.2291 3.5749 0.2295  0.8400  -0.4654 1081 GLU C CB  
2895 C CG  . GLU C 61  ? 3.1153 3.1682 3.6940 0.2063  0.9106  -0.5709 1081 GLU C CG  
2896 C CD  . GLU C 61  ? 3.0568 2.9148 3.6825 0.2262  0.9672  -0.5177 1081 GLU C CD  
2897 O OE1 . GLU C 61  ? 3.0238 2.7632 3.5500 0.2618  0.9494  -0.4007 1081 GLU C OE1 
2898 O OE2 . GLU C 61  ? 3.0590 2.8810 3.8185 0.2049  1.0275  -0.5914 1081 GLU C OE2 
2899 N N   . GLY C 62  ? 2.9572 3.2192 3.0316 0.2297  0.6420  -0.3099 1082 GLY C N   
2900 C CA  . GLY C 62  ? 2.9682 3.2164 2.8947 0.2449  0.5735  -0.1964 1082 GLY C CA  
2901 C C   . GLY C 62  ? 3.0051 3.0586 2.8633 0.2900  0.5663  -0.0734 1082 GLY C C   
2902 O O   . GLY C 62  ? 2.8725 2.8993 2.6017 0.3043  0.5013  0.0292  1082 GLY C O   
2903 N N   . LYS C 63  ? 3.1761 3.0928 3.1140 0.3114  0.6290  -0.0788 1083 LYS C N   
2904 C CA  . LYS C 63  ? 3.2286 2.9557 3.1012 0.3572  0.6261  0.0342  1083 LYS C CA  
2905 C C   . LYS C 63  ? 3.2049 2.9334 2.9743 0.3684  0.5559  0.0855  1083 LYS C C   
2906 O O   . LYS C 63  ? 3.2263 2.9285 3.0445 0.3726  0.5814  0.0563  1083 LYS C O   
2907 C CB  . LYS C 63  ? 3.2598 2.8500 3.2538 0.3712  0.7202  0.0068  1083 LYS C CB  
2908 C CG  . LYS C 63  ? 3.3120 2.8968 3.4128 0.3624  0.7843  -0.0546 1083 LYS C CG  
2909 C CD  . LYS C 63  ? 3.3725 2.8121 3.5902 0.3714  0.8715  -0.0806 1083 LYS C CD  
2910 C CE  . LYS C 63  ? 3.4261 2.8527 3.7447 0.3670  0.9253  -0.1445 1083 LYS C CE  
2911 N NZ  . LYS C 63  ? 3.4973 2.7703 3.9257 0.3720  1.0046  -0.1672 1083 LYS C NZ  
2912 N N   . VAL C 64  ? 3.1653 2.9265 2.7895 0.3733  0.4630  0.1633  1084 VAL C N   
2913 C CA  . VAL C 64  ? 3.0668 2.8528 2.5830 0.3810  0.3786  0.2013  1084 VAL C CA  
2914 C C   . VAL C 64  ? 3.3002 2.9175 2.7787 0.4325  0.3827  0.2743  1084 VAL C C   
2915 O O   . VAL C 64  ? 3.3245 2.9550 2.8185 0.4399  0.3789  0.2451  1084 VAL C O   
2916 C CB  . VAL C 64  ? 2.8575 2.7012 2.2216 0.3718  0.2735  0.2760  1084 VAL C CB  
2917 C CG1 . VAL C 64  ? 2.8270 2.7013 2.0794 0.3775  0.1773  0.3042  1084 VAL C CG1 
2918 C CG2 . VAL C 64  ? 2.7625 2.7763 2.1643 0.3217  0.2791  0.2076  1084 VAL C CG2 
2919 N N   . LYS C 65  ? 3.5611 3.0223 2.9887 0.4707  0.3896  0.3692  1085 LYS C N   
2920 C CA  . LYS C 65  ? 3.5935 2.8909 2.9669 0.5244  0.3876  0.4466  1085 LYS C CA  
2921 C C   . LYS C 65  ? 3.5701 2.8252 3.0776 0.5266  0.4865  0.3825  1085 LYS C C   
2922 O O   . LYS C 65  ? 3.6052 2.8178 3.0922 0.5540  0.4812  0.3982  1085 LYS C O   
2923 C CB  . LYS C 65  ? 3.5830 2.7212 2.8817 0.5627  0.3786  0.5554  1085 LYS C CB  
2924 C CG  . LYS C 65  ? 3.5445 2.7186 2.7109 0.5576  0.2788  0.6290  1085 LYS C CG  
2925 C CD  . LYS C 65  ? 3.5717 2.5925 2.6821 0.5927  0.2741  0.7291  1085 LYS C CD  
2926 C CE  . LYS C 65  ? 3.5464 2.6847 2.6130 0.5325  0.1567  0.7417  1085 LYS C CE  
2927 N NZ  . LYS C 65  ? 3.5142 2.6376 2.6573 0.4864  0.1200  0.7353  1085 LYS C NZ  
2928 N N   . GLU C 66  ? 3.3926 2.6606 3.0385 0.4978  0.5753  0.3099  1086 GLU C N   
2929 C CA  . GLU C 66  ? 3.1704 2.3986 2.9502 0.4905  0.6687  0.2488  1086 GLU C CA  
2930 C C   . GLU C 66  ? 2.9605 2.3362 2.8058 0.4582  0.6663  0.1557  1086 GLU C C   
2931 O O   . GLU C 66  ? 2.9888 2.3337 2.8954 0.4638  0.7114  0.1362  1086 GLU C O   
2932 C CB  . GLU C 66  ? 3.1262 2.3275 3.0328 0.4666  0.7524  0.1921  1086 GLU C CB  
2933 C CG  . GLU C 66  ? 3.0672 2.2010 3.1097 0.4554  0.8484  0.1410  1086 GLU C CG  
2934 C CD  . GLU C 66  ? 2.9801 2.0540 3.1297 0.4400  0.9196  0.0986  1086 GLU C CD  
2935 O OE1 . GLU C 66  ? 2.9081 2.0038 3.0286 0.4420  0.8959  0.1053  1086 GLU C OE1 
2936 O OE2 . GLU C 66  ? 2.9934 1.9990 3.2556 0.4259  0.9970  0.0592  1086 GLU C OE2 
2937 N N   . ALA C 67  ? 2.8081 2.3481 2.6420 0.4233  0.6145  0.0975  1087 ALA C N   
2938 C CA  . ALA C 67  ? 2.9445 2.6272 2.8290 0.3948  0.5999  0.0105  1087 ALA C CA  
2939 C C   . ALA C 67  ? 2.6938 2.3622 2.4685 0.4311  0.5284  0.0677  1087 ALA C C   
2940 O O   . ALA C 67  ? 2.7313 2.4523 2.5656 0.4272  0.5430  0.0155  1087 ALA C O   
2941 C CB  . ALA C 67  ? 2.3641 2.2197 2.2502 0.3506  0.5580  -0.0614 1087 ALA C CB  
2942 N N   . GLN C 68  ? 2.7681 2.3681 2.3837 0.4676  0.4469  0.1728  1088 GLN C N   
2943 C CA  . GLN C 68  ? 2.8584 2.4160 2.3602 0.5134  0.3754  0.2351  1088 GLN C CA  
2944 C C   . GLN C 68  ? 3.0856 2.5251 2.6347 0.5516  0.4432  0.2585  1088 GLN C C   
2945 O O   . GLN C 68  ? 3.0968 2.5689 2.6461 0.5710  0.4287  0.2404  1088 GLN C O   
2946 C CB  . GLN C 68  ? 2.6574 2.1358 1.9830 0.5462  0.2789  0.3505  1088 GLN C CB  
2947 C CG  . GLN C 68  ? 2.6128 2.2140 1.8677 0.5079  0.1971  0.3419  1088 GLN C CG  
2948 C CD  . GLN C 68  ? 2.6238 2.1364 1.7180 0.5329  0.1105  0.4622  1088 GLN C CD  
2949 O OE1 . GLN C 68  ? 2.4294 1.7840 1.4810 0.5766  0.1240  0.5464  1088 GLN C OE1 
2950 N NE2 . GLN C 68  ? 2.6583 2.2712 1.6605 0.5032  0.0185  0.4728  1088 GLN C NE2 
2951 N N   . ALA C 69  ? 3.3134 2.6176 2.9007 0.5636  0.5166  0.2993  1089 ALA C N   
2952 C CA  . ALA C 69  ? 3.3616 2.5489 2.9914 0.5955  0.5871  0.3261  1089 ALA C CA  
2953 C C   . ALA C 69  ? 3.3264 2.6061 3.1196 0.5563  0.6668  0.2216  1089 ALA C C   
2954 O O   . ALA C 69  ? 3.3719 2.6339 3.1856 0.5787  0.6929  0.2256  1089 ALA C O   
2955 C CB  . ALA C 69  ? 3.3884 2.4113 3.0270 0.6103  0.6473  0.3868  1089 ALA C CB  
2956 N N   . ALA C 70  ? 3.2197 2.6010 3.1324 0.4980  0.7059  0.1267  1090 ALA C N   
2957 C CA  . ALA C 70  ? 3.1409 2.6106 3.2152 0.4554  0.7768  0.0240  1090 ALA C CA  
2958 C C   . ALA C 70  ? 3.2530 2.8627 3.3173 0.4548  0.7221  -0.0232 1090 ALA C C   
2959 O O   . ALA C 70  ? 3.2169 2.8545 3.3645 0.4515  0.7673  -0.0580 1090 ALA C O   
2960 C CB  . ALA C 70  ? 2.9330 2.4772 3.1258 0.3979  0.8183  -0.0689 1090 ALA C CB  
2961 N N   . ALA C 71  ? 3.4384 3.1389 3.4010 0.4571  0.6231  -0.0241 1091 ALA C N   
2962 C CA  . ALA C 71  ? 3.4864 3.3179 3.4320 0.4583  0.5604  -0.0717 1091 ALA C CA  
2963 C C   . ALA C 71  ? 3.4931 3.2589 3.3391 0.5223  0.5186  0.0012  1091 ALA C C   
2964 O O   . ALA C 71  ? 3.5394 3.3988 3.4126 0.5290  0.4980  -0.0462 1091 ALA C O   
2965 C CB  . ALA C 71  ? 3.5444 3.4833 3.4010 0.4396  0.4624  -0.0900 1091 ALA C CB  
2966 N N   . GLU C 72  ? 3.4034 3.0131 3.1349 0.5724  0.5031  0.1122  1092 GLU C N   
2967 C CA  . GLU C 72  ? 3.2674 2.8021 2.9123 0.6388  0.4752  0.1789  1092 GLU C CA  
2968 C C   . GLU C 72  ? 3.2066 2.7330 2.9804 0.6378  0.5796  0.1468  1092 GLU C C   
2969 O O   . GLU C 72  ? 3.1260 2.6776 2.8787 0.6776  0.5632  0.1508  1092 GLU C O   
2970 C CB  . GLU C 72  ? 3.0862 2.4459 2.5858 0.6909  0.4401  0.3032  1092 GLU C CB  
2971 C CG  . GLU C 72  ? 3.0586 2.3216 2.4595 0.7670  0.4133  0.3774  1092 GLU C CG  
2972 C CD  . GLU C 72  ? 3.0105 2.3459 2.2978 0.8048  0.2930  0.3781  1092 GLU C CD  
2973 O OE1 . GLU C 72  ? 2.9789 2.4003 2.2188 0.7771  0.2113  0.3537  1092 GLU C OE1 
2974 O OE2 . GLU C 72  ? 3.0187 2.3247 2.2608 0.8636  0.2784  0.4027  1092 GLU C OE2 
2975 N N   . GLN C 73  ? 3.2625 2.7574 3.1701 0.5924  0.6845  0.1142  1093 GLN C N   
2976 C CA  . GLN C 73  ? 3.3171 2.8073 3.3593 0.5769  0.7885  0.0824  1093 GLN C CA  
2977 C C   . GLN C 73  ? 3.2982 2.9709 3.4653 0.5356  0.7983  -0.0296 1093 GLN C C   
2978 O O   . GLN C 73  ? 3.2980 3.0327 3.4590 0.5650  0.7815  -0.0376 1093 GLN C O   
2979 C CB  . GLN C 73  ? 3.3488 2.7433 3.4930 0.5359  0.8868  0.0791  1093 GLN C CB  
2980 C CG  . GLN C 73  ? 3.4136 2.8041 3.7081 0.5047  0.9958  0.0429  1093 GLN C CG  
2981 C CD  . GLN C 73  ? 3.5060 2.7921 3.8950 0.4631  1.0813  0.0375  1093 GLN C CD  
2982 O OE1 . GLN C 73  ? 3.5364 2.7616 3.8833 0.4612  1.0607  0.0553  1093 GLN C OE1 
2983 N NE2 . GLN C 73  ? 3.5573 2.8238 4.0753 0.4290  1.1756  0.0129  1093 GLN C NE2 
2984 N N   . ASP D 1   ? 1.9389 1.6863 1.9627 0.2616  0.1051  0.0976  1    ASP H N   
2985 C CA  . ASP D 1   ? 1.8171 1.6333 1.8409 0.2289  0.0987  0.1015  1    ASP H CA  
2986 C C   . ASP D 1   ? 1.6754 1.4379 1.6267 0.1918  0.0962  0.0605  1    ASP H C   
2987 O O   . ASP D 1   ? 1.6946 1.4236 1.5991 0.2028  0.1224  0.0203  1    ASP H O   
2988 C CB  . ASP D 1   ? 1.9399 1.8408 1.9938 0.2600  0.1346  0.1091  1    ASP H CB  
2989 C CG  . ASP D 1   ? 2.0896 2.0700 2.1565 0.2270  0.1266  0.1275  1    ASP H CG  
2990 O OD1 . ASP D 1   ? 2.1171 2.1683 2.2550 0.2148  0.1037  0.1746  1    ASP H OD1 
2991 O OD2 . ASP D 1   ? 2.1662 2.1359 2.1745 0.2117  0.1393  0.0963  1    ASP H OD2 
2992 N N   . VAL D 2   ? 1.3616 1.1181 1.3050 0.1497  0.0627  0.0699  2    VAL H N   
2993 C CA  . VAL D 2   ? 1.3723 1.0847 1.2600 0.1132  0.0558  0.0388  2    VAL H CA  
2994 C C   . VAL D 2   ? 1.5359 1.3167 1.4297 0.0872  0.0475  0.0469  2    VAL H C   
2995 O O   . VAL D 2   ? 1.5460 1.3848 1.4875 0.0788  0.0274  0.0827  2    VAL H O   
2996 C CB  . VAL D 2   ? 1.3670 1.0228 1.2397 0.0898  0.0290  0.0448  2    VAL H CB  
2997 C CG1 . VAL D 2   ? 1.3576 0.9864 1.1879 0.0522  0.0227  0.0196  2    VAL H CG1 
2998 C CG2 . VAL D 2   ? 1.2438 0.8286 1.1094 0.1137  0.0378  0.0430  2    VAL H CG2 
2999 N N   . GLN D 3   ? 1.7318 1.5036 1.5797 0.0728  0.0587  0.0151  3    GLN H N   
3000 C CA  . GLN D 3   ? 1.8039 1.6375 1.6538 0.0493  0.0511  0.0253  3    GLN H CA  
3001 C C   . GLN D 3   ? 1.7448 1.5394 1.5475 0.0164  0.0395  -0.0043 3    GLN H C   
3002 O O   . GLN D 3   ? 1.8224 1.5681 1.5800 0.0184  0.0519  -0.0428 3    GLN H O   
3003 C CB  . GLN D 3   ? 1.9135 1.8119 1.7619 0.0741  0.0818  0.0273  3    GLN H CB  
3004 C CG  . GLN D 3   ? 2.0158 1.9778 1.9278 0.1063  0.0962  0.0663  3    GLN H CG  
3005 C CD  . GLN D 3   ? 2.0438 2.0608 2.0260 0.0838  0.0652  0.1165  3    GLN H CD  
3006 O OE1 . GLN D 3   ? 2.0905 2.1071 2.0701 0.0477  0.0378  0.1224  3    GLN H OE1 
3007 N NE2 . GLN D 3   ? 2.0907 2.1538 2.1402 0.1058  0.0670  0.1523  3    GLN H NE2 
3008 N N   . LEU D 4   ? 1.5971 1.4122 1.4153 -0.0132 0.0135  0.0137  4    LEU H N   
3009 C CA  . LEU D 4   ? 1.4158 1.2121 1.2040 -0.0435 0.0010  -0.0057 4    LEU H CA  
3010 C C   . LEU D 4   ? 1.3664 1.2296 1.1668 -0.0577 -0.0076 0.0136  4    LEU H C   
3011 O O   . LEU D 4   ? 1.4538 1.3608 1.2993 -0.0584 -0.0194 0.0495  4    LEU H O   
3012 C CB  . LEU D 4   ? 1.2764 1.0307 1.0705 -0.0611 -0.0199 -0.0014 4    LEU H CB  
3013 C CG  . LEU D 4   ? 1.3870 1.0841 1.1778 -0.0460 -0.0149 -0.0032 4    LEU H CG  
3014 C CD1 . LEU D 4   ? 1.4373 1.1041 1.2246 -0.0615 -0.0328 0.0044  4    LEU H CD1 
3015 C CD2 . LEU D 4   ? 1.4105 1.0558 1.1702 -0.0388 0.0061  -0.0353 4    LEU H CD2 
3016 N N   . VAL D 5   ? 1.3151 1.1852 1.0782 -0.0702 -0.0051 -0.0080 5    VAL H N   
3017 C CA  . VAL D 5   ? 1.2245 1.1592 0.9921 -0.0810 -0.0114 0.0127  5    VAL H CA  
3018 C C   . VAL D 5   ? 1.2309 1.1525 0.9804 -0.1090 -0.0313 -0.0020 5    VAL H C   
3019 O O   . VAL D 5   ? 1.2197 1.1121 0.9278 -0.1152 -0.0285 -0.0380 5    VAL H O   
3020 C CB  . VAL D 5   ? 1.1116 1.0898 0.8456 -0.0595 0.0149  0.0067  5    VAL H CB  
3021 C CG1 . VAL D 5   ? 1.1081 1.1467 0.8320 -0.0738 0.0068  0.0262  5    VAL H CG1 
3022 C CG2 . VAL D 5   ? 1.2169 1.2332 0.9875 -0.0304 0.0364  0.0349  5    VAL H CG2 
3023 N N   . GLU D 6   ? 1.2659 1.2091 1.0509 -0.1255 -0.0533 0.0257  6    GLU H N   
3024 C CA  . GLU D 6   ? 1.0783 1.0221 0.8584 -0.1479 -0.0719 0.0196  6    GLU H CA  
3025 C C   . GLU D 6   ? 1.0872 1.0921 0.8566 -0.1528 -0.0758 0.0363  6    GLU H C   
3026 O O   . GLU D 6   ? 1.1813 1.2335 0.9621 -0.1420 -0.0670 0.0659  6    GLU H O   
3027 C CB  . GLU D 6   ? 1.0191 0.9486 0.8403 -0.1571 -0.0930 0.0382  6    GLU H CB  
3028 C CG  . GLU D 6   ? 1.0322 0.9054 0.8557 -0.1513 -0.0914 0.0257  6    GLU H CG  
3029 C CD  . GLU D 6   ? 1.0656 0.9362 0.9121 -0.1357 -0.0921 0.0445  6    GLU H CD  
3030 O OE1 . GLU D 6   ? 1.1276 1.0413 0.9926 -0.1286 -0.0877 0.0660  6    GLU H OE1 
3031 O OE2 . GLU D 6   ? 1.0384 0.8687 0.8858 -0.1303 -0.0975 0.0407  6    GLU H OE2 
3032 N N   . SER D 7   ? 1.0033 1.0124 0.7540 -0.1695 -0.0896 0.0218  7    SER H N   
3033 C CA  . SER D 7   ? 1.1111 1.1787 0.8468 -0.1747 -0.0984 0.0401  7    SER H CA  
3034 C C   . SER D 7   ? 1.1974 1.2651 0.9377 -0.1957 -0.1226 0.0310  7    SER H C   
3035 O O   . SER D 7   ? 1.2968 1.3222 1.0403 -0.2058 -0.1262 0.0030  7    SER H O   
3036 C CB  . SER D 7   ? 1.2868 1.3763 0.9596 -0.1604 -0.0795 0.0200  7    SER H CB  
3037 O OG  . SER D 7   ? 1.5476 1.5865 1.1783 -0.1634 -0.0774 -0.0325 7    SER H OG  
3038 N N   . GLY D 8   ? 1.2430 1.3633 0.9902 -0.2016 -0.1388 0.0608  8    GLY H N   
3039 C CA  . GLY D 8   ? 1.2614 1.3948 1.0186 -0.2189 -0.1637 0.0576  8    GLY H CA  
3040 C C   . GLY D 8   ? 1.1864 1.3345 1.0047 -0.2215 -0.1817 0.0965  8    GLY H C   
3041 O O   . GLY D 8   ? 1.1808 1.3401 1.0213 -0.2317 -0.2009 0.0971  8    GLY H O   
3042 N N   . GLY D 9   ? 1.1488 1.2963 0.9997 -0.2121 -0.1776 0.1292  9    GLY H N   
3043 C CA  . GLY D 9   ? 1.1026 1.2493 1.0118 -0.2125 -0.1969 0.1623  9    GLY H CA  
3044 C C   . GLY D 9   ? 1.1377 1.3400 1.0577 -0.2167 -0.2151 0.2026  9    GLY H C   
3045 O O   . GLY D 9   ? 1.1616 1.4093 1.0370 -0.2192 -0.2135 0.2059  9    GLY H O   
3046 N N   . GLY D 10  ? 1.3128 1.5082 1.2897 -0.2152 -0.2343 0.2335  10   GLY H N   
3047 C CA  . GLY D 10  ? 1.4121 1.6548 1.4108 -0.2174 -0.2538 0.2810  10   GLY H CA  
3048 C C   . GLY D 10  ? 1.3559 1.5781 1.4116 -0.2129 -0.2768 0.2910  10   GLY H C   
3049 O O   . GLY D 10  ? 1.3719 1.5418 1.4508 -0.2059 -0.2754 0.2648  10   GLY H O   
3050 N N   . LEU D 11  ? 1.3427 1.6090 1.4175 -0.2136 -0.2970 0.3306  11   LEU H N   
3051 C CA  . LEU D 11  ? 1.2633 1.5170 1.3980 -0.2043 -0.3194 0.3470  11   LEU H CA  
3052 C C   . LEU D 11  ? 1.2297 1.5177 1.3572 -0.2057 -0.3276 0.3263  11   LEU H C   
3053 O O   . LEU D 11  ? 1.2257 1.5700 1.3147 -0.2158 -0.3350 0.3333  11   LEU H O   
3054 C CB  . LEU D 11  ? 1.2543 1.5325 1.4299 -0.2029 -0.3401 0.4131  11   LEU H CB  
3055 C CG  . LEU D 11  ? 1.2854 1.5483 1.5280 -0.1886 -0.3653 0.4352  11   LEU H CG  
3056 C CD1 . LEU D 11  ? 1.2097 1.3907 1.4932 -0.1745 -0.3652 0.4083  11   LEU H CD1 
3057 C CD2 . LEU D 11  ? 1.3708 1.6662 1.6482 -0.1896 -0.3867 0.5076  11   LEU H CD2 
3058 N N   . VAL D 12  ? 1.2511 1.5083 1.4158 -0.1949 -0.3271 0.3015  12   VAL H N   
3059 C CA  . VAL D 12  ? 1.3450 1.6379 1.5227 -0.1967 -0.3337 0.2851  12   VAL H CA  
3060 C C   . VAL D 12  ? 1.3433 1.6289 1.5938 -0.1740 -0.3461 0.3035  12   VAL H C   
3061 O O   . VAL D 12  ? 1.2941 1.5206 1.5697 -0.1555 -0.3384 0.2963  12   VAL H O   
3062 C CB  . VAL D 12  ? 1.2768 1.5469 1.4268 -0.2052 -0.3105 0.2321  12   VAL H CB  
3063 C CG1 . VAL D 12  ? 1.2826 1.5964 1.4612 -0.2117 -0.3190 0.2213  12   VAL H CG1 
3064 C CG2 . VAL D 12  ? 1.3151 1.5827 1.3948 -0.2223 -0.2980 0.2111  12   VAL H CG2 
3065 N N   . GLN D 13  ? 1.5096 1.8546 1.7928 -0.1729 -0.3672 0.3261  13   GLN H N   
3066 C CA  . GLN D 13  ? 1.5833 1.9281 1.9411 -0.1463 -0.3761 0.3420  13   GLN H CA  
3067 C C   . GLN D 13  ? 1.5871 1.9108 1.9629 -0.1349 -0.3505 0.2995  13   GLN H C   
3068 O O   . GLN D 13  ? 1.6046 1.9360 1.9451 -0.1546 -0.3342 0.2662  13   GLN H O   
3069 C CB  . GLN D 13  ? 1.6107 2.0346 2.0036 -0.1478 -0.4063 0.3795  13   GLN H CB  
3070 C CG  . GLN D 13  ? 1.6624 2.1093 2.0450 -0.1515 -0.4314 0.4335  13   GLN H CG  
3071 C CD  . GLN D 13  ? 1.7512 2.2749 2.1724 -0.1477 -0.4652 0.4757  13   GLN H CD  
3072 O OE1 . GLN D 13  ? 1.7770 2.3431 2.2360 -0.1454 -0.4717 0.4626  13   GLN H OE1 
3073 N NE2 . GLN D 13  ? 1.8362 2.3834 2.2527 -0.1474 -0.4875 0.5316  13   GLN H NE2 
3074 N N   . PRO D 14  ? 1.5216 1.8158 1.9504 -0.1012 -0.3449 0.3007  14   PRO H N   
3075 C CA  . PRO D 14  ? 1.5123 1.7926 1.9543 -0.0850 -0.3149 0.2647  14   PRO H CA  
3076 C C   . PRO D 14  ? 1.4915 1.8501 1.9605 -0.1014 -0.3124 0.2623  14   PRO H C   
3077 O O   . PRO D 14  ? 1.5402 1.9653 2.0586 -0.1018 -0.3367 0.2929  14   PRO H O   
3078 C CB  . PRO D 14  ? 1.5151 1.7624 2.0124 -0.0398 -0.3153 0.2738  14   PRO H CB  
3079 C CG  . PRO D 14  ? 1.5764 1.7792 2.0706 -0.0383 -0.3416 0.3012  14   PRO H CG  
3080 C CD  . PRO D 14  ? 1.5754 1.8360 2.0480 -0.0741 -0.3632 0.3329  14   PRO H CD  
3081 N N   . GLY D 15  ? 1.4673 1.8180 1.9078 -0.1166 -0.2857 0.2285  15   GLY H N   
3082 C CA  . GLY D 15  ? 1.3562 1.7735 1.8259 -0.1396 -0.2840 0.2247  15   GLY H CA  
3083 C C   . GLY D 15  ? 1.3628 1.8019 1.7846 -0.1841 -0.3031 0.2153  15   GLY H C   
3084 O O   . GLY D 15  ? 1.3447 1.8373 1.7940 -0.2090 -0.3113 0.2115  15   GLY H O   
3085 N N   . GLY D 16  ? 1.3847 1.7850 1.7381 -0.1943 -0.3108 0.2108  16   GLY H N   
3086 C CA  . GLY D 16  ? 1.4004 1.8165 1.6972 -0.2290 -0.3263 0.1976  16   GLY H CA  
3087 C C   . GLY D 16  ? 1.3939 1.7662 1.6470 -0.2473 -0.3007 0.1570  16   GLY H C   
3088 O O   . GLY D 16  ? 1.3964 1.7346 1.6646 -0.2361 -0.2707 0.1429  16   GLY H O   
3089 N N   . SER D 17  ? 1.4797 1.8517 1.6734 -0.2733 -0.3127 0.1388  17   SER H N   
3090 C CA  . SER D 17  ? 1.5271 1.8532 1.6771 -0.2911 -0.2929 0.1007  17   SER H CA  
3091 C C   . SER D 17  ? 1.5783 1.8685 1.6491 -0.2902 -0.2889 0.0891  17   SER H C   
3092 O O   . SER D 17  ? 1.7461 2.0654 1.7899 -0.2876 -0.3081 0.1077  17   SER H O   
3093 C CB  . SER D 17  ? 1.6138 1.9719 1.7769 -0.3253 -0.3118 0.0816  17   SER H CB  
3094 O OG  . SER D 17  ? 1.6607 2.0655 1.9102 -0.3263 -0.3138 0.0993  17   SER H OG  
3095 N N   . ARG D 18  ? 1.4432 1.6748 1.4795 -0.2903 -0.2621 0.0623  18   ARG H N   
3096 C CA  . ARG D 18  ? 1.2777 1.4773 1.2490 -0.2842 -0.2523 0.0531  18   ARG H CA  
3097 C C   . ARG D 18  ? 1.3909 1.5328 1.3329 -0.2901 -0.2283 0.0185  18   ARG H C   
3098 O O   . ARG D 18  ? 1.5013 1.6108 1.4700 -0.2834 -0.2083 0.0164  18   ARG H O   
3099 C CB  . ARG D 18  ? 0.9540 1.1401 0.9357 -0.2593 -0.2441 0.0820  18   ARG H CB  
3100 C CG  . ARG D 18  ? 1.0140 1.1958 0.9460 -0.2535 -0.2393 0.0890  18   ARG H CG  
3101 C CD  . ARG D 18  ? 1.2577 1.4989 1.1767 -0.2565 -0.2626 0.1170  18   ARG H CD  
3102 N NE  . ARG D 18  ? 1.4123 1.6610 1.2943 -0.2473 -0.2532 0.1362  18   ARG H NE  
3103 C CZ  . ARG D 18  ? 1.6382 1.9397 1.5007 -0.2462 -0.2670 0.1688  18   ARG H CZ  
3104 N NH1 . ARG D 18  ? 1.7159 2.0637 1.5897 -0.2537 -0.2952 0.1837  18   ARG H NH1 
3105 N NH2 . ARG D 18  ? 1.7075 2.0216 1.5420 -0.2369 -0.2522 0.1911  18   ARG H NH2 
3106 N N   . LYS D 19  ? 1.4202 1.5478 1.3044 -0.2994 -0.2297 -0.0077 19   LYS H N   
3107 C CA  . LYS D 19  ? 1.3912 1.4585 1.2471 -0.3029 -0.2088 -0.0400 19   LYS H CA  
3108 C C   . LYS D 19  ? 1.3302 1.3711 1.1441 -0.2799 -0.1886 -0.0383 19   LYS H C   
3109 O O   . LYS D 19  ? 1.3578 1.4196 1.1263 -0.2739 -0.1926 -0.0403 19   LYS H O   
3110 C CB  . LYS D 19  ? 1.5259 1.5854 1.3515 -0.3277 -0.2257 -0.0766 19   LYS H CB  
3111 C CG  . LYS D 19  ? 1.5482 1.5361 1.3461 -0.3303 -0.2061 -0.1103 19   LYS H CG  
3112 C CD  . LYS D 19  ? 1.6656 1.6351 1.4694 -0.3634 -0.2269 -0.1425 19   LYS H CD  
3113 C CE  . LYS D 19  ? 1.7652 1.7617 1.5174 -0.3746 -0.2603 -0.1679 19   LYS H CE  
3114 N NZ  . LYS D 19  ? 1.8375 1.8115 1.6012 -0.4115 -0.2891 -0.2022 19   LYS H NZ  
3115 N N   . LEU D 20  ? 1.2733 1.2744 1.1029 -0.2659 -0.1670 -0.0324 20   LEU H N   
3116 C CA  . LEU D 20  ? 1.3146 1.2916 1.1173 -0.2457 -0.1492 -0.0295 20   LEU H CA  
3117 C C   . LEU D 20  ? 1.3845 1.3116 1.1512 -0.2454 -0.1329 -0.0627 20   LEU H C   
3118 O O   . LEU D 20  ? 1.4005 1.2932 1.1776 -0.2593 -0.1302 -0.0806 20   LEU H O   
3119 C CB  . LEU D 20  ? 1.3343 1.2918 1.1698 -0.2305 -0.1413 -0.0080 20   LEU H CB  
3120 C CG  . LEU D 20  ? 1.3148 1.3040 1.1916 -0.2276 -0.1576 0.0204  20   LEU H CG  
3121 C CD1 . LEU D 20  ? 1.2983 1.2528 1.1956 -0.2114 -0.1519 0.0296  20   LEU H CD1 
3122 C CD2 . LEU D 20  ? 1.2684 1.3031 1.1420 -0.2254 -0.1711 0.0459  20   LEU H CD2 
3123 N N   . SER D 21  ? 1.4014 1.3258 1.1310 -0.2285 -0.1208 -0.0677 21   SER H N   
3124 C CA  . SER D 21  ? 1.4802 1.3549 1.1744 -0.2211 -0.1044 -0.1001 21   SER H CA  
3125 C C   . SER D 21  ? 1.4550 1.3126 1.1527 -0.1948 -0.0829 -0.0857 21   SER H C   
3126 O O   . SER D 21  ? 1.4241 1.3192 1.1406 -0.1835 -0.0827 -0.0538 21   SER H O   
3127 C CB  . SER D 21  ? 1.6193 1.5069 1.2563 -0.2206 -0.1092 -0.1296 21   SER H CB  
3128 O OG  . SER D 21  ? 1.8008 1.7396 1.4149 -0.2005 -0.1014 -0.1090 21   SER H OG  
3129 N N   . CYS D 22  ? 1.4669 1.2671 1.1533 -0.1866 -0.0677 -0.1067 22   CYS H N   
3130 C CA  . CYS D 22  ? 1.4483 1.2300 1.1421 -0.1608 -0.0496 -0.0937 22   CYS H CA  
3131 C C   . CYS D 22  ? 1.4616 1.1994 1.1201 -0.1443 -0.0322 -0.1259 22   CYS H C   
3132 O O   . CYS D 22  ? 1.5511 1.2312 1.2016 -0.1554 -0.0328 -0.1518 22   CYS H O   
3133 C CB  . CYS D 22  ? 1.4691 1.2179 1.1948 -0.1629 -0.0504 -0.0771 22   CYS H CB  
3134 S SG  . CYS D 22  ? 1.5344 1.2513 1.2673 -0.1331 -0.0346 -0.0642 22   CYS H SG  
3135 N N   . ALA D 23  ? 1.4961 1.2612 1.1380 -0.1169 -0.0160 -0.1228 23   ALA H N   
3136 C CA  . ALA D 23  ? 1.5807 1.3060 1.1886 -0.0914 0.0045  -0.1541 23   ALA H CA  
3137 C C   . ALA D 23  ? 1.5556 1.2610 1.1952 -0.0651 0.0209  -0.1335 23   ALA H C   
3138 O O   . ALA D 23  ? 1.5432 1.2964 1.2194 -0.0567 0.0211  -0.0947 23   ALA H O   
3139 C CB  . ALA D 23  ? 1.7166 1.4913 1.2804 -0.0710 0.0172  -0.1649 23   ALA H CB  
3140 N N   . ALA D 24  ? 1.5605 1.1939 1.1898 -0.0532 0.0309  -0.1580 24   ALA H N   
3141 C CA  . ALA D 24  ? 1.5645 1.1718 1.2239 -0.0281 0.0429  -0.1379 24   ALA H CA  
3142 C C   . ALA D 24  ? 1.6959 1.2780 1.3340 0.0123  0.0685  -0.1621 24   ALA H C   
3143 O O   . ALA D 24  ? 1.7911 1.3299 1.3845 0.0148  0.0730  -0.2073 24   ALA H O   
3144 C CB  . ALA D 24  ? 1.3542 0.8942 1.0280 -0.0464 0.0331  -0.1351 24   ALA H CB  
3145 N N   . SER D 25  ? 1.6994 1.3085 1.3710 0.0454  0.0834  -0.1333 25   SER H N   
3146 C CA  . SER D 25  ? 1.7430 1.3280 1.4051 0.0913  0.1111  -0.1516 25   SER H CA  
3147 C C   . SER D 25  ? 1.7962 1.3846 1.5131 0.1167  0.1155  -0.1128 25   SER H C   
3148 O O   . SER D 25  ? 1.7976 1.4265 1.5553 0.1015  0.0974  -0.0715 25   SER H O   
3149 C CB  . SER D 25  ? 1.8832 1.5381 1.5213 0.1189  0.1351  -0.1591 25   SER H CB  
3150 O OG  . SER D 25  ? 1.9102 1.6520 1.6034 0.1346  0.1435  -0.1077 25   SER H OG  
3151 N N   . GLY D 26  ? 1.9321 1.4756 1.6485 0.1578  0.1371  -0.1282 26   GLY H N   
3152 C CA  . GLY D 26  ? 1.8493 1.3947 1.6185 0.1874  0.1407  -0.0917 26   GLY H CA  
3153 C C   . GLY D 26  ? 1.6953 1.1528 1.4708 0.1785  0.1259  -0.0865 26   GLY H C   
3154 O O   . GLY D 26  ? 1.5447 1.0052 1.3620 0.2004  0.1227  -0.0508 26   GLY H O   
3155 N N   . PHE D 27  ? 1.8185 1.2024 1.5573 0.1464  0.1159  -0.1164 27   PHE H N   
3156 C CA  . PHE D 27  ? 1.8886 1.1907 1.6349 0.1346  0.1051  -0.1053 27   PHE H CA  
3157 C C   . PHE D 27  ? 1.9698 1.1914 1.6806 0.1050  0.1013  -0.1482 27   PHE H C   
3158 O O   . PHE D 27  ? 2.0564 1.2955 1.7350 0.0859  0.0988  -0.1833 27   PHE H O   
3159 C CB  . PHE D 27  ? 1.7174 1.0527 1.4832 0.1065  0.0820  -0.0610 27   PHE H CB  
3160 C CG  . PHE D 27  ? 1.6605 1.0302 1.4078 0.0617  0.0670  -0.0688 27   PHE H CG  
3161 C CD1 . PHE D 27  ? 1.5925 1.0465 1.3449 0.0562  0.0621  -0.0633 27   PHE H CD1 
3162 C CD2 . PHE D 27  ? 1.7171 1.0376 1.4494 0.0256  0.0583  -0.0766 27   PHE H CD2 
3163 C CE1 . PHE D 27  ? 1.5966 1.0795 1.3362 0.0187  0.0475  -0.0680 27   PHE H CE1 
3164 C CE2 . PHE D 27  ? 1.6624 1.0197 1.3852 -0.0113 0.0455  -0.0814 27   PHE H CE2 
3165 C CZ  . PHE D 27  ? 1.6067 1.0426 1.3315 -0.0132 0.0394  -0.0783 27   PHE H CZ  
3166 N N   . THR D 28  ? 1.9376 1.0721 1.6581 0.1001  0.0982  -0.1414 28   THR H N   
3167 C CA  . THR D 28  ? 1.9464 1.0021 1.6499 0.0636  0.0892  -0.1724 28   THR H CA  
3168 C C   . THR D 28  ? 1.8656 0.9643 1.5700 0.0119  0.0715  -0.1563 28   THR H C   
3169 O O   . THR D 28  ? 1.8139 0.9253 1.5381 0.0000  0.0663  -0.1121 28   THR H O   
3170 C CB  . THR D 28  ? 1.9198 0.8749 1.6450 0.0706  0.0914  -0.1571 28   THR H CB  
3171 O OG1 . THR D 28  ? 1.9893 0.8966 1.7159 0.1231  0.1083  -0.1762 28   THR H OG1 
3172 C CG2 . THR D 28  ? 1.8944 0.7726 1.6158 0.0244  0.0785  -0.1818 28   THR H CG2 
3173 N N   . PHE D 29  ? 1.9467 1.0693 1.6274 -0.0158 0.0621  -0.1917 29   PHE H N   
3174 C CA  . PHE D 29  ? 1.8779 1.0619 1.5644 -0.0558 0.0472  -0.1742 29   PHE H CA  
3175 C C   . PHE D 29  ? 1.8800 1.0167 1.5885 -0.0949 0.0389  -0.1591 29   PHE H C   
3176 O O   . PHE D 29  ? 1.8652 1.0401 1.5900 -0.1118 0.0360  -0.1220 29   PHE H O   
3177 C CB  . PHE D 29  ? 1.8987 1.1282 1.5562 -0.0712 0.0378  -0.2115 29   PHE H CB  
3178 C CG  . PHE D 29  ? 1.8666 1.1602 1.5352 -0.1082 0.0220  -0.1937 29   PHE H CG  
3179 C CD1 . PHE D 29  ? 1.9480 1.3163 1.6287 -0.1006 0.0217  -0.1591 29   PHE H CD1 
3180 C CD2 . PHE D 29  ? 1.8632 1.1417 1.5359 -0.1501 0.0053  -0.2114 29   PHE H CD2 
3181 C CE1 . PHE D 29  ? 1.7982 1.2184 1.4901 -0.1295 0.0077  -0.1448 29   PHE H CE1 
3182 C CE2 . PHE D 29  ? 1.8096 1.1507 1.4989 -0.1789 -0.0073 -0.1931 29   PHE H CE2 
3183 C CZ  . PHE D 29  ? 1.7248 1.1337 1.4213 -0.1662 -0.0047 -0.1610 29   PHE H CZ  
3184 N N   . SER D 30  ? 1.8974 0.9500 1.6079 -0.1086 0.0354  -0.1871 30   SER H N   
3185 C CA  . SER D 30  ? 1.8898 0.8992 1.6315 -0.1519 0.0271  -0.1718 30   SER H CA  
3186 C C   . SER D 30  ? 1.9302 0.8909 1.6980 -0.1413 0.0403  -0.1233 30   SER H C   
3187 O O   . SER D 30  ? 2.2995 1.1790 2.0918 -0.1584 0.0394  -0.1186 30   SER H O   
3188 C CB  . SER D 30  ? 2.0426 0.9804 1.7816 -0.1775 0.0109  -0.2224 30   SER H CB  
3189 O OG  . SER D 30  ? 2.1830 1.0269 1.9127 -0.1472 0.0175  -0.2466 30   SER H OG  
3190 N N   . GLY D 31  ? 1.7546 0.7660 1.5169 -0.1136 0.0498  -0.0851 31   GLY H N   
3191 C CA  . GLY D 31  ? 1.8629 0.8460 1.6403 -0.1031 0.0596  -0.0322 31   GLY H CA  
3192 C C   . GLY D 31  ? 1.9452 1.0024 1.7146 -0.1028 0.0608  0.0095  31   GLY H C   
3193 O O   . GLY D 31  ? 2.0498 1.0900 1.8219 -0.0963 0.0682  0.0551  31   GLY H O   
3194 N N   . PHE D 32  ? 1.8982 1.0331 1.6549 -0.1090 0.0526  -0.0047 32   PHE H N   
3195 C CA  . PHE D 32  ? 1.7498 0.9476 1.4935 -0.1016 0.0501  0.0264  32   PHE H CA  
3196 C C   . PHE D 32  ? 1.7273 0.9814 1.4742 -0.1321 0.0446  0.0160  32   PHE H C   
3197 O O   . PHE D 32  ? 1.6632 0.9248 1.4191 -0.1534 0.0382  -0.0173 32   PHE H O   
3198 C CB  . PHE D 32  ? 1.6493 0.8870 1.3809 -0.0660 0.0417  0.0257  32   PHE H CB  
3199 C CG  . PHE D 32  ? 1.6135 0.8069 1.3508 -0.0311 0.0468  0.0350  32   PHE H CG  
3200 C CD1 . PHE D 32  ? 1.6469 0.8228 1.3799 -0.0112 0.0464  0.0773  32   PHE H CD1 
3201 C CD2 . PHE D 32  ? 1.6376 0.8086 1.3818 -0.0144 0.0523  0.0019  32   PHE H CD2 
3202 C CE1 . PHE D 32  ? 1.7572 0.8953 1.5020 0.0235  0.0494  0.0900  32   PHE H CE1 
3203 C CE2 . PHE D 32  ? 1.6984 0.8299 1.4534 0.0233  0.0593  0.0111  32   PHE H CE2 
3204 C CZ  . PHE D 32  ? 1.7285 0.8444 1.4885 0.0417  0.0569  0.0568  32   PHE H CZ  
3205 N N   . GLY D 33  ? 1.9155 1.2092 1.6521 -0.1311 0.0458  0.0437  33   GLY H N   
3206 C CA  . GLY D 33  ? 1.9086 1.2576 1.6514 -0.1524 0.0421  0.0369  33   GLY H CA  
3207 C C   . GLY D 33  ? 1.8912 1.2944 1.6226 -0.1392 0.0255  0.0203  33   GLY H C   
3208 O O   . GLY D 33  ? 1.9762 1.3848 1.6931 -0.1127 0.0174  0.0264  33   GLY H O   
3209 N N   . MET D 34  ? 1.6711 1.1166 1.4158 -0.1595 0.0184  0.0034  34   MET H N   
3210 C CA  . MET D 34  ? 1.6008 1.0968 1.3421 -0.1519 0.0022  -0.0084 34   MET H CA  
3211 C C   . MET D 34  ? 1.5382 1.0759 1.2844 -0.1582 -0.0016 0.0008  34   MET H C   
3212 O O   . MET D 34  ? 1.5588 1.1043 1.3225 -0.1776 0.0080  0.0050  34   MET H O   
3213 C CB  . MET D 34  ? 1.6390 1.1485 1.3879 -0.1647 -0.0050 -0.0379 34   MET H CB  
3214 C CG  . MET D 34  ? 1.6611 1.1220 1.4015 -0.1563 0.0021  -0.0554 34   MET H CG  
3215 S SD  . MET D 34  ? 1.6872 1.1467 1.4175 -0.1158 0.0042  -0.0447 34   MET H SD  
3216 C CE  . MET D 34  ? 1.7792 1.3142 1.5129 -0.1127 -0.0089 -0.0499 34   MET H CE  
3217 N N   . HIS D 35  ? 1.4246 0.9889 1.1610 -0.1412 -0.0161 0.0045  35   HIS H N   
3218 C CA  . HIS D 35  ? 1.3730 0.9700 1.1120 -0.1405 -0.0223 0.0081  35   HIS H CA  
3219 C C   . HIS D 35  ? 1.3653 1.0021 1.1232 -0.1458 -0.0418 -0.0027 35   HIS H C   
3220 O O   . HIS D 35  ? 1.2880 0.9310 1.0478 -0.1409 -0.0523 -0.0060 35   HIS H O   
3221 C CB  . HIS D 35  ? 1.2991 0.8838 1.0066 -0.1152 -0.0282 0.0205  35   HIS H CB  
3222 C CG  . HIS D 35  ? 1.3530 0.9004 1.0332 -0.1046 -0.0116 0.0380  35   HIS H CG  
3223 N ND1 . HIS D 35  ? 1.4203 0.9648 1.0752 -0.0952 0.0043  0.0525  35   HIS H ND1 
3224 C CD2 . HIS D 35  ? 1.4504 0.9634 1.1241 -0.0988 -0.0071 0.0469  35   HIS H CD2 
3225 C CE1 . HIS D 35  ? 1.4797 0.9907 1.1119 -0.0867 0.0169  0.0730  35   HIS H CE1 
3226 N NE2 . HIS D 35  ? 1.5170 1.0056 1.1629 -0.0889 0.0088  0.0699  35   HIS H NE2 
3227 N N   . TRP D 36  ? 1.3605 1.0284 1.1362 -0.1542 -0.0445 -0.0038 36   TRP H N   
3228 C CA  . TRP D 36  ? 1.2309 0.9344 1.0245 -0.1544 -0.0649 -0.0056 36   TRP H CA  
3229 C C   . TRP D 36  ? 1.2096 0.9078 0.9943 -0.1344 -0.0753 -0.0006 36   TRP H C   
3230 O O   . TRP D 36  ? 1.2236 0.9167 0.9990 -0.1257 -0.0621 0.0009  36   TRP H O   
3231 C CB  . TRP D 36  ? 1.3014 1.0427 1.1243 -0.1743 -0.0656 -0.0095 36   TRP H CB  
3232 C CG  . TRP D 36  ? 1.3625 1.1130 1.1877 -0.1932 -0.0677 -0.0210 36   TRP H CG  
3233 C CD1 . TRP D 36  ? 1.4381 1.1790 1.2683 -0.2133 -0.0589 -0.0317 36   TRP H CD1 
3234 C CD2 . TRP D 36  ? 1.3049 1.0752 1.1244 -0.1928 -0.0802 -0.0239 36   TRP H CD2 
3235 N NE1 . TRP D 36  ? 1.4488 1.1961 1.2680 -0.2233 -0.0677 -0.0482 36   TRP H NE1 
3236 C CE2 . TRP D 36  ? 1.3300 1.0995 1.1398 -0.2089 -0.0774 -0.0420 36   TRP H CE2 
3237 C CE3 . TRP D 36  ? 1.2636 1.0530 1.0871 -0.1808 -0.0934 -0.0112 36   TRP H CE3 
3238 C CZ2 . TRP D 36  ? 1.2806 1.0706 1.0732 -0.2079 -0.0834 -0.0498 36   TRP H CZ2 
3239 C CZ3 . TRP D 36  ? 1.2684 1.0844 1.0859 -0.1831 -0.0971 -0.0112 36   TRP H CZ3 
3240 C CH2 . TRP D 36  ? 1.2901 1.1078 1.0869 -0.1938 -0.0901 -0.0313 36   TRP H CH2 
3241 N N   . VAL D 37  ? 1.2975 0.9970 1.0859 -0.1266 -0.0990 0.0021  37   VAL H N   
3242 C CA  . VAL D 37  ? 1.3782 1.0611 1.1565 -0.1085 -0.1182 0.0011  37   VAL H CA  
3243 C C   . VAL D 37  ? 1.3327 1.0368 1.1465 -0.1142 -0.1449 0.0069  37   VAL H C   
3244 O O   . VAL D 37  ? 1.2305 0.9511 1.0632 -0.1235 -0.1546 0.0175  37   VAL H O   
3245 C CB  . VAL D 37  ? 1.4431 1.0920 1.1896 -0.0940 -0.1276 0.0025  37   VAL H CB  
3246 C CG1 . VAL D 37  ? 1.4904 1.1180 1.2252 -0.0783 -0.1582 -0.0040 37   VAL H CG1 
3247 C CG2 . VAL D 37  ? 1.4964 1.1226 1.2060 -0.0861 -0.1009 0.0037  37   VAL H CG2 
3248 N N   . ARG D 38  ? 1.2771 0.9816 1.1027 -0.1064 -0.1549 0.0032  38   ARG H N   
3249 C CA  . ARG D 38  ? 1.1259 0.8447 0.9906 -0.1116 -0.1813 0.0135  38   ARG H CA  
3250 C C   . ARG D 38  ? 1.2027 0.8801 1.0626 -0.0966 -0.2121 0.0066  38   ARG H C   
3251 O O   . ARG D 38  ? 1.3766 1.0169 1.1944 -0.0774 -0.2115 -0.0113 38   ARG H O   
3252 C CB  . ARG D 38  ? 1.0498 0.7980 0.9418 -0.1134 -0.1752 0.0162  38   ARG H CB  
3253 C CG  . ARG D 38  ? 1.1190 0.8472 1.0002 -0.0894 -0.1685 0.0016  38   ARG H CG  
3254 C CD  . ARG D 38  ? 1.1717 0.9425 1.0903 -0.0921 -0.1583 0.0092  38   ARG H CD  
3255 N NE  . ARG D 38  ? 1.2465 1.0092 1.1628 -0.0645 -0.1456 -0.0020 38   ARG H NE  
3256 C CZ  . ARG D 38  ? 1.3270 1.1314 1.2816 -0.0610 -0.1335 0.0056  38   ARG H CZ  
3257 N NH1 . ARG D 38  ? 1.4345 1.2879 1.4271 -0.0865 -0.1380 0.0228  38   ARG H NH1 
3258 N NH2 . ARG D 38  ? 1.3258 1.1264 1.2796 -0.0299 -0.1172 -0.0038 38   ARG H NH2 
3259 N N   . GLN D 39  ? 1.1960 0.8793 1.0986 -0.1061 -0.2409 0.0222  39   GLN H N   
3260 C CA  . GLN D 39  ? 1.3045 0.9441 1.2162 -0.0983 -0.2793 0.0165  39   GLN H CA  
3261 C C   . GLN D 39  ? 1.2395 0.8835 1.2017 -0.1025 -0.2989 0.0307  39   GLN H C   
3262 O O   . GLN D 39  ? 0.9554 0.6412 0.9613 -0.1223 -0.3011 0.0616  39   GLN H O   
3263 C CB  . GLN D 39  ? 0.9884 0.6263 0.9160 -0.1113 -0.3031 0.0305  39   GLN H CB  
3264 C CG  . GLN D 39  ? 1.0372 0.6264 0.9787 -0.1088 -0.3510 0.0231  39   GLN H CG  
3265 C CD  . GLN D 39  ? 1.1170 0.7175 1.0881 -0.1250 -0.3755 0.0427  39   GLN H CD  
3266 O OE1 . GLN D 39  ? 1.2365 0.8905 1.2399 -0.1398 -0.3580 0.0717  39   GLN H OE1 
3267 N NE2 . GLN D 39  ? 1.2358 0.7886 1.1952 -0.1203 -0.4167 0.0261  39   GLN H NE2 
3268 N N   . ALA D 40  ? 1.3336 0.9340 1.2876 -0.0808 -0.3122 0.0095  40   ALA H N   
3269 C CA  . ALA D 40  ? 1.2662 0.8621 1.2709 -0.0800 -0.3316 0.0231  40   ALA H CA  
3270 C C   . ALA D 40  ? 1.4043 0.9802 1.4590 -0.0998 -0.3749 0.0459  40   ALA H C   
3271 O O   . ALA D 40  ? 1.5053 1.0544 1.5496 -0.1064 -0.3971 0.0387  40   ALA H O   
3272 C CB  . ALA D 40  ? 1.4124 0.9597 1.3940 -0.0450 -0.3334 -0.0097 40   ALA H CB  
3273 N N   . PRO D 41  ? 1.3886 0.9810 1.5035 -0.1110 -0.3891 0.0785  41   PRO H N   
3274 C CA  . PRO D 41  ? 1.2854 0.8616 1.4605 -0.1334 -0.4298 0.1090  41   PRO H CA  
3275 C C   . PRO D 41  ? 1.3538 0.8418 1.5245 -0.1224 -0.4738 0.0771  41   PRO H C   
3276 O O   . PRO D 41  ? 1.2359 0.6693 1.3899 -0.0950 -0.4822 0.0463  41   PRO H O   
3277 C CB  . PRO D 41  ? 1.2209 0.8249 1.4526 -0.1397 -0.4327 0.1486  41   PRO H CB  
3278 C CG  . PRO D 41  ? 1.2503 0.9136 1.4516 -0.1317 -0.3903 0.1475  41   PRO H CG  
3279 C CD  . PRO D 41  ? 1.3481 0.9838 1.4846 -0.1071 -0.3690 0.0968  41   PRO H CD  
3280 N N   . GLU D 42  ? 1.5559 1.0317 1.7418 -0.1424 -0.5029 0.0831  42   GLU H N   
3281 C CA  . GLU D 42  ? 1.6800 1.0733 1.8620 -0.1392 -0.5548 0.0524  42   GLU H CA  
3282 C C   . GLU D 42  ? 1.7499 1.0912 1.8374 -0.1023 -0.5472 -0.0093 42   GLU H C   
3283 O O   . GLU D 42  ? 1.9402 1.2004 2.0049 -0.0876 -0.5880 -0.0478 42   GLU H O   
3284 C CB  . GLU D 42  ? 1.7742 1.1111 2.0202 -0.1442 -0.5973 0.0634  42   GLU H CB  
3285 C CG  . GLU D 42  ? 1.7351 1.1245 2.0765 -0.1807 -0.6049 0.1327  42   GLU H CG  
3286 C CD  . GLU D 42  ? 1.8450 1.1758 2.2511 -0.1834 -0.6432 0.1484  42   GLU H CD  
3287 O OE1 . GLU D 42  ? 1.9136 1.1547 2.2892 -0.1561 -0.6682 0.0981  42   GLU H OE1 
3288 O OE2 . GLU D 42  ? 1.9309 1.3035 2.4156 -0.2101 -0.6470 0.2114  42   GLU H OE2 
3289 N N   . LYS D 43  ? 1.6638 1.0495 1.6943 -0.0869 -0.4960 -0.0188 43   LYS H N   
3290 C CA  . LYS D 43  ? 1.6761 1.0278 1.6165 -0.0517 -0.4786 -0.0669 43   LYS H CA  
3291 C C   . LYS D 43  ? 1.6893 1.0819 1.5867 -0.0575 -0.4525 -0.0629 43   LYS H C   
3292 O O   . LYS D 43  ? 1.5691 1.0126 1.5072 -0.0852 -0.4480 -0.0277 43   LYS H O   
3293 C CB  . LYS D 43  ? 1.5861 0.9485 1.5077 -0.0224 -0.4380 -0.0790 43   LYS H CB  
3294 C CG  . LYS D 43  ? 1.6055 0.9224 1.5696 -0.0090 -0.4630 -0.0840 43   LYS H CG  
3295 C CD  . LYS D 43  ? 1.7641 1.1023 1.7158 0.0237  -0.4208 -0.0934 43   LYS H CD  
3296 C CE  . LYS D 43  ? 2.0239 1.3103 2.0178 0.0444  -0.4462 -0.1003 43   LYS H CE  
3297 N NZ  . LYS D 43  ? 2.0934 1.4091 2.0879 0.0795  -0.4053 -0.1052 43   LYS H NZ  
3298 N N   . GLY D 44  ? 1.7762 1.1466 1.5903 -0.0279 -0.4329 -0.0971 44   GLY H N   
3299 C CA  . GLY D 44  ? 1.6396 1.0327 1.4070 -0.0288 -0.4147 -0.0950 44   GLY H CA  
3300 C C   . GLY D 44  ? 1.5212 0.9776 1.2900 -0.0342 -0.3577 -0.0729 44   GLY H C   
3301 O O   . GLY D 44  ? 1.4863 0.9779 1.2948 -0.0412 -0.3344 -0.0574 44   GLY H O   
3302 N N   . LEU D 45  ? 1.4988 0.9666 1.2234 -0.0310 -0.3389 -0.0715 45   LEU H N   
3303 C CA  . LEU D 45  ? 1.3277 0.8438 1.0524 -0.0384 -0.2902 -0.0530 45   LEU H CA  
3304 C C   . LEU D 45  ? 1.3696 0.8867 1.0516 -0.0158 -0.2495 -0.0671 45   LEU H C   
3305 O O   . LEU D 45  ? 1.5232 1.0042 1.1550 0.0129  -0.2529 -0.0923 45   LEU H O   
3306 C CB  . LEU D 45  ? 1.2587 0.7810 0.9613 -0.0427 -0.2877 -0.0420 45   LEU H CB  
3307 C CG  . LEU D 45  ? 1.2862 0.8308 1.0452 -0.0656 -0.3143 -0.0184 45   LEU H CG  
3308 C CD1 . LEU D 45  ? 1.3074 0.8498 1.0407 -0.0606 -0.3188 -0.0113 45   LEU H CD1 
3309 C CD2 . LEU D 45  ? 1.3620 0.9585 1.1739 -0.0857 -0.2876 0.0051  45   LEU H CD2 
3310 N N   . GLU D 46  ? 1.2365 0.7976 0.9397 -0.0285 -0.2109 -0.0503 46   GLU H N   
3311 C CA  . GLU D 46  ? 1.3393 0.9160 1.0229 -0.0139 -0.1705 -0.0546 46   GLU H CA  
3312 C C   . GLU D 46  ? 1.2862 0.8980 0.9824 -0.0343 -0.1370 -0.0356 46   GLU H C   
3313 O O   . GLU D 46  ? 1.2198 0.8614 0.9615 -0.0591 -0.1383 -0.0231 46   GLU H O   
3314 C CB  . GLU D 46  ? 1.3812 0.9749 1.1059 -0.0084 -0.1691 -0.0577 46   GLU H CB  
3315 C CG  . GLU D 46  ? 1.4769 1.1042 1.2020 0.0030  -0.1256 -0.0548 46   GLU H CG  
3316 C CD  . GLU D 46  ? 1.5566 1.2094 1.3331 0.0095  -0.1257 -0.0533 46   GLU H CD  
3317 O OE1 . GLU D 46  ? 1.6092 1.2484 1.4183 0.0046  -0.1596 -0.0532 46   GLU H OE1 
3318 O OE2 . GLU D 46  ? 1.5602 1.2497 1.3509 0.0193  -0.0922 -0.0478 46   GLU H OE2 
3319 N N   . TRP D 47  ? 1.3332 0.9390 0.9870 -0.0233 -0.1079 -0.0332 47   TRP H N   
3320 C CA  . TRP D 47  ? 1.3410 0.9698 1.0104 -0.0435 -0.0776 -0.0160 47   TRP H CA  
3321 C C   . TRP D 47  ? 1.3178 0.9890 1.0332 -0.0554 -0.0557 -0.0108 47   TRP H C   
3322 O O   . TRP D 47  ? 1.3091 0.9927 1.0254 -0.0366 -0.0439 -0.0152 47   TRP H O   
3323 C CB  . TRP D 47  ? 1.3923 1.0009 1.0089 -0.0292 -0.0539 -0.0074 47   TRP H CB  
3324 C CG  . TRP D 47  ? 1.2860 0.9079 0.9233 -0.0506 -0.0240 0.0115  47   TRP H CG  
3325 C CD1 . TRP D 47  ? 1.3086 0.9175 0.9560 -0.0678 -0.0271 0.0193  47   TRP H CD1 
3326 C CD2 . TRP D 47  ? 1.2457 0.8941 0.9019 -0.0571 0.0122  0.0252  47   TRP H CD2 
3327 N NE1 . TRP D 47  ? 1.2506 0.8660 0.9181 -0.0857 0.0018  0.0332  47   TRP H NE1 
3328 C CE2 . TRP D 47  ? 1.2409 0.8835 0.9184 -0.0826 0.0252  0.0395  47   TRP H CE2 
3329 C CE3 . TRP D 47  ? 1.2764 0.9545 0.9392 -0.0428 0.0354  0.0278  47   TRP H CE3 
3330 C CZ2 . TRP D 47  ? 1.2846 0.9478 0.9938 -0.1000 0.0559  0.0577  47   TRP H CZ2 
3331 C CZ3 . TRP D 47  ? 1.3066 1.0166 1.0044 -0.0582 0.0699  0.0497  47   TRP H CZ3 
3332 C CH2 . TRP D 47  ? 1.3210 1.0223 1.0438 -0.0896 0.0778  0.0652  47   TRP H CH2 
3333 N N   . VAL D 48  ? 1.2018 0.8969 0.9559 -0.0847 -0.0520 -0.0026 48   VAL H N   
3334 C CA  . VAL D 48  ? 1.2370 0.9767 1.0399 -0.1008 -0.0409 0.0024  48   VAL H CA  
3335 C C   . VAL D 48  ? 1.2843 1.0361 1.0990 -0.1184 -0.0113 0.0140  48   VAL H C   
3336 O O   . VAL D 48  ? 1.1942 0.9756 1.0312 -0.1153 0.0112  0.0236  48   VAL H O   
3337 C CB  . VAL D 48  ? 1.2046 0.9673 1.0427 -0.1228 -0.0644 0.0015  48   VAL H CB  
3338 C CG1 . VAL D 48  ? 1.1630 0.9733 1.0473 -0.1424 -0.0571 0.0072  48   VAL H CG1 
3339 C CG2 . VAL D 48  ? 1.2665 1.0233 1.1099 -0.1094 -0.0933 -0.0014 48   VAL H CG2 
3340 N N   . ALA D 49  ? 1.4196 1.1499 1.2271 -0.1372 -0.0115 0.0146  49   ALA H N   
3341 C CA  . ALA D 49  ? 1.2876 1.0177 1.1121 -0.1584 0.0114  0.0254  49   ALA H CA  
3342 C C   . ALA D 49  ? 1.1661 0.8480 0.9612 -0.1613 0.0129  0.0259  49   ALA H C   
3343 O O   . ALA D 49  ? 1.0343 0.6933 0.8016 -0.1478 -0.0035 0.0184  49   ALA H O   
3344 C CB  . ALA D 49  ? 1.0625 0.8289 0.9390 -0.1904 0.0036  0.0212  49   ALA H CB  
3345 N N   . TYR D 50  ? 1.3404 1.0079 1.1497 -0.1793 0.0324  0.0379  50   TYR H N   
3346 C CA  . TYR D 50  ? 1.3973 1.0135 1.1866 -0.1814 0.0367  0.0415  50   TYR H CA  
3347 C C   . TYR D 50  ? 1.3044 0.9085 1.1325 -0.2144 0.0473  0.0465  50   TYR H C   
3348 O O   . TYR D 50  ? 1.1422 0.7741 1.0055 -0.2295 0.0636  0.0642  50   TYR H O   
3349 C CB  . TYR D 50  ? 1.4256 1.0148 1.1715 -0.1550 0.0521  0.0633  50   TYR H CB  
3350 C CG  . TYR D 50  ? 1.4030 0.9417 1.1417 -0.1598 0.0626  0.0782  50   TYR H CG  
3351 C CD1 . TYR D 50  ? 1.3646 0.8683 1.0894 -0.1520 0.0470  0.0661  50   TYR H CD1 
3352 C CD2 . TYR D 50  ? 1.4552 0.9828 1.2074 -0.1710 0.0896  0.1082  50   TYR H CD2 
3353 C CE1 . TYR D 50  ? 1.3496 0.8024 1.0713 -0.1517 0.0560  0.0798  50   TYR H CE1 
3354 C CE2 . TYR D 50  ? 1.3482 0.8220 1.0984 -0.1751 0.0974  0.1255  50   TYR H CE2 
3355 C CZ  . TYR D 50  ? 1.3621 0.7957 1.0958 -0.1639 0.0796  0.1091  50   TYR H CZ  
3356 O OH  . TYR D 50  ? 1.4998 0.8755 1.2345 -0.1631 0.0866  0.1257  50   TYR H OH  
3357 N N   . ILE D 51  ? 1.5407 1.1019 1.3650 -0.2240 0.0382  0.0315  51   ILE H N   
3358 C CA  . ILE D 51  ? 1.6239 1.1539 1.4811 -0.2556 0.0414  0.0295  51   ILE H CA  
3359 C C   . ILE D 51  ? 1.5905 1.0504 1.4244 -0.2442 0.0472  0.0329  51   ILE H C   
3360 O O   . ILE D 51  ? 1.5357 0.9797 1.3356 -0.2180 0.0393  0.0214  51   ILE H O   
3361 C CB  . ILE D 51  ? 1.4864 1.0327 1.3635 -0.2804 0.0171  -0.0047 51   ILE H CB  
3362 C CG1 . ILE D 51  ? 1.5845 1.0983 1.5010 -0.3184 0.0138  -0.0098 51   ILE H CG1 
3363 C CG2 . ILE D 51  ? 1.4424 0.9701 1.2803 -0.2614 0.0024  -0.0333 51   ILE H CG2 
3364 C CD1 . ILE D 51  ? 1.6400 1.1719 1.5693 -0.3438 -0.0149 -0.0455 51   ILE H CD1 
3365 N N   . SER D 52  ? 1.5527 0.9727 1.4127 -0.2638 0.0606  0.0526  52   SER H N   
3366 C CA  . SER D 52  ? 1.7185 1.0664 1.5631 -0.2515 0.0671  0.0621  52   SER H CA  
3367 C C   . SER D 52  ? 1.9198 1.2188 1.7669 -0.2601 0.0491  0.0205  52   SER H C   
3368 O O   . SER D 52  ? 1.9128 1.2387 1.7617 -0.2723 0.0311  -0.0153 52   SER H O   
3369 C CB  . SER D 52  ? 1.6075 0.9292 1.4816 -0.2686 0.0894  0.1062  52   SER H CB  
3370 O OG  . SER D 52  ? 1.6656 0.9994 1.5983 -0.3127 0.0859  0.1037  52   SER H OG  
3371 N N   . SER D 53  ? 1.9502 1.1748 1.7932 -0.2503 0.0542  0.0249  53   SER H N   
3372 C CA  . SER D 53  ? 1.9359 1.1061 1.7719 -0.2482 0.0403  -0.0190 53   SER H CA  
3373 C C   . SER D 53  ? 1.9135 1.0586 1.7846 -0.2929 0.0249  -0.0459 53   SER H C   
3374 O O   . SER D 53  ? 1.9924 1.1426 1.8488 -0.2991 0.0055  -0.0932 53   SER H O   
3375 C CB  . SER D 53  ? 1.9738 1.0671 1.8015 -0.2215 0.0503  -0.0053 53   SER H CB  
3376 O OG  . SER D 53  ? 2.0438 1.0958 1.9034 -0.2407 0.0628  0.0370  53   SER H OG  
3377 N N   . GLY D 54  ? 1.7888 0.9074 1.7068 -0.3249 0.0314  -0.0149 54   GLY H N   
3378 C CA  . GLY D 54  ? 1.7823 0.8815 1.7448 -0.3733 0.0106  -0.0376 54   GLY H CA  
3379 C C   . GLY D 54  ? 1.7367 0.9254 1.7362 -0.4041 0.0057  -0.0245 54   GLY H C   
3380 O O   . GLY D 54  ? 1.6002 0.7852 1.6572 -0.4503 -0.0086 -0.0236 54   GLY H O   
3381 N N   . SER D 55  ? 1.6286 0.8968 1.6022 -0.3789 0.0159  -0.0128 55   SER H N   
3382 C CA  . SER D 55  ? 1.4714 0.8293 1.4765 -0.3979 0.0117  -0.0037 55   SER H CA  
3383 C C   . SER D 55  ? 1.5525 0.9350 1.6250 -0.4279 0.0299  0.0458  55   SER H C   
3384 O O   . SER D 55  ? 1.5255 0.9690 1.6505 -0.4578 0.0208  0.0507  55   SER H O   
3385 C CB  . SER D 55  ? 1.4717 0.8480 1.4831 -0.4231 -0.0239 -0.0511 55   SER H CB  
3386 O OG  . SER D 55  ? 1.4858 0.8504 1.4332 -0.3928 -0.0351 -0.0913 55   SER H OG  
3387 N N   . SER D 56  ? 1.6713 1.0137 1.7462 -0.4189 0.0571  0.0878  56   SER H N   
3388 C CA  . SER D 56  ? 1.6161 0.9868 1.7533 -0.4438 0.0819  0.1443  56   SER H CA  
3389 C C   . SER D 56  ? 1.5961 1.0473 1.7152 -0.4133 0.1138  0.1809  56   SER H C   
3390 O O   . SER D 56  ? 1.7037 1.2164 1.8799 -0.4323 0.1330  0.2184  56   SER H O   
3391 C CB  . SER D 56  ? 1.6451 0.9329 1.7940 -0.4495 0.0971  0.1789  56   SER H CB  
3392 O OG  . SER D 56  ? 1.6381 0.9027 1.7178 -0.4005 0.1165  0.1949  56   SER H OG  
3393 N N   . LEU D 57  ? 1.5108 0.9637 1.5542 -0.3657 0.1192  0.1705  57   LEU H N   
3394 C CA  . LEU D 57  ? 1.5545 1.0703 1.5665 -0.3317 0.1442  0.1950  57   LEU H CA  
3395 C C   . LEU D 57  ? 1.7298 1.2857 1.7086 -0.3102 0.1228  0.1535  57   LEU H C   
3396 O O   . LEU D 57  ? 1.7557 1.2775 1.6880 -0.2912 0.1028  0.1218  57   LEU H O   
3397 C CB  . LEU D 57  ? 1.4041 0.8832 1.3547 -0.2948 0.1654  0.2249  57   LEU H CB  
3398 C CG  . LEU D 57  ? 1.3966 0.9326 1.3097 -0.2608 0.1949  0.2548  57   LEU H CG  
3399 C CD1 . LEU D 57  ? 1.4185 1.0102 1.3941 -0.2830 0.2280  0.2997  57   LEU H CD1 
3400 C CD2 . LEU D 57  ? 1.4406 0.9357 1.2829 -0.2249 0.2064  0.2793  57   LEU H CD2 
3401 N N   . ILE D 58  ? 1.7632 1.3938 1.7719 -0.3119 0.1284  0.1580  58   ILE H N   
3402 C CA  . ILE D 58  ? 1.7310 1.4020 1.7203 -0.2941 0.1081  0.1256  58   ILE H CA  
3403 C C   . ILE D 58  ? 1.6931 1.4156 1.6639 -0.2596 0.1322  0.1447  58   ILE H C   
3404 O O   . ILE D 58  ? 1.6537 1.4231 1.6666 -0.2650 0.1602  0.1771  58   ILE H O   
3405 C CB  . ILE D 58  ? 1.7820 1.4918 1.8307 -0.3295 0.0823  0.1047  58   ILE H CB  
3406 C CG1 . ILE D 58  ? 1.8280 1.4804 1.8722 -0.3549 0.0529  0.0715  58   ILE H CG1 
3407 C CG2 . ILE D 58  ? 1.7365 1.4994 1.7745 -0.3083 0.0678  0.0862  58   ILE H CG2 
3408 C CD1 . ILE D 58  ? 1.8559 1.5427 1.9434 -0.3887 0.0209  0.0462  58   ILE H CD1 
3409 N N   . TYR D 59  ? 1.6404 1.3548 1.5513 -0.2237 0.1211  0.1244  59   TYR H N   
3410 C CA  . TYR D 59  ? 1.6029 1.3526 1.4848 -0.1863 0.1368  0.1306  59   TYR H CA  
3411 C C   . TYR D 59  ? 1.6951 1.4705 1.5803 -0.1763 0.1088  0.0997  59   TYR H C   
3412 O O   . TYR D 59  ? 1.7488 1.4991 1.6202 -0.1822 0.0783  0.0748  59   TYR H O   
3413 C CB  . TYR D 59  ? 1.4334 1.1411 1.2354 -0.1502 0.1451  0.1370  59   TYR H CB  
3414 C CG  . TYR D 59  ? 1.5102 1.2063 1.3018 -0.1494 0.1805  0.1786  59   TYR H CG  
3415 C CD1 . TYR D 59  ? 1.6031 1.3508 1.4200 -0.1449 0.2191  0.2113  59   TYR H CD1 
3416 C CD2 . TYR D 59  ? 1.5925 1.2298 1.3520 -0.1504 0.1774  0.1904  59   TYR H CD2 
3417 C CE1 . TYR D 59  ? 1.5679 1.3105 1.3767 -0.1444 0.2550  0.2578  59   TYR H CE1 
3418 C CE2 . TYR D 59  ? 1.5490 1.1746 1.2997 -0.1494 0.2096  0.2357  59   TYR H CE2 
3419 C CZ  . TYR D 59  ? 1.5130 1.1921 1.2873 -0.1476 0.2488  0.2708  59   TYR H CZ  
3420 O OH  . TYR D 59  ? 1.6262 1.2995 1.3934 -0.1470 0.2840  0.3236  59   TYR H OH  
3421 N N   . TYR D 60  ? 1.7167 1.5438 1.6229 -0.1590 0.1215  0.1050  60   TYR H N   
3422 C CA  . TYR D 60  ? 1.5489 1.3987 1.4620 -0.1447 0.0971  0.0821  60   TYR H CA  
3423 C C   . TYR D 60  ? 1.5545 1.4011 1.4187 -0.0969 0.1088  0.0771  60   TYR H C   
3424 O O   . TYR D 60  ? 1.4767 1.3330 1.3189 -0.0752 0.1441  0.0955  60   TYR H O   
3425 C CB  . TYR D 60  ? 1.5063 1.4216 1.5003 -0.1663 0.0945  0.0891  60   TYR H CB  
3426 C CG  . TYR D 60  ? 1.4350 1.3529 1.4729 -0.2140 0.0730  0.0854  60   TYR H CG  
3427 C CD1 . TYR D 60  ? 1.3556 1.2504 1.3756 -0.2259 0.0372  0.0597  60   TYR H CD1 
3428 C CD2 . TYR D 60  ? 1.4488 1.3931 1.5461 -0.2469 0.0879  0.1077  60   TYR H CD2 
3429 C CE1 . TYR D 60  ? 1.4166 1.3102 1.4636 -0.2648 0.0169  0.0499  60   TYR H CE1 
3430 C CE2 . TYR D 60  ? 1.4972 1.4355 1.6300 -0.2909 0.0621  0.0975  60   TYR H CE2 
3431 C CZ  . TYR D 60  ? 1.5078 1.4186 1.6088 -0.2976 0.0267  0.0654  60   TYR H CZ  
3432 O OH  . TYR D 60  ? 1.4972 1.3982 1.6209 -0.3372 0.0006  0.0494  60   TYR H OH  
3433 N N   . ALA D 61  ? 1.6016 1.4326 1.4467 -0.0802 0.0784  0.0523  61   ALA H N   
3434 C CA  . ALA D 61  ? 1.6194 1.4419 1.4249 -0.0356 0.0812  0.0393  61   ALA H CA  
3435 C C   . ALA D 61  ? 1.6453 1.5267 1.5032 -0.0205 0.1021  0.0475  61   ALA H C   
3436 O O   . ALA D 61  ? 1.6197 1.5473 1.5502 -0.0463 0.0953  0.0568  61   ALA H O   
3437 C CB  . ALA D 61  ? 1.5969 1.3814 1.3805 -0.0278 0.0379  0.0136  61   ALA H CB  
3438 N N   . ASP D 62  ? 1.7471 1.6286 1.5658 0.0248  0.1270  0.0433  62   ASP H N   
3439 C CA  . ASP D 62  ? 1.7510 1.6941 1.6209 0.0476  0.1556  0.0539  62   ASP H CA  
3440 C C   . ASP D 62  ? 1.5974 1.5570 1.5233 0.0476  0.1237  0.0411  62   ASP H C   
3441 O O   . ASP D 62  ? 1.5203 1.5462 1.5234 0.0448  0.1366  0.0590  62   ASP H O   
3442 C CB  . ASP D 62  ? 2.0117 1.9436 1.8132 0.1051  0.1880  0.0446  62   ASP H CB  
3443 C CG  . ASP D 62  ? 2.1751 2.1133 1.9331 0.1072  0.2296  0.0709  62   ASP H CG  
3444 O OD1 . ASP D 62  ? 2.1758 2.1263 1.9707 0.0620  0.2334  0.0981  62   ASP H OD1 
3445 O OD2 . ASP D 62  ? 2.3014 2.2295 1.9859 0.1549  0.2577  0.0647  62   ASP H OD2 
3446 N N   . THR D 63  ? 1.6310 1.5351 1.5254 0.0498  0.0809  0.0155  63   THR H N   
3447 C CA  . THR D 63  ? 1.5517 1.4668 1.4989 0.0462  0.0474  0.0102  63   THR H CA  
3448 C C   . THR D 63  ? 1.4438 1.3965 1.4502 -0.0044 0.0276  0.0277  63   THR H C   
3449 O O   . THR D 63  ? 1.4043 1.3781 1.4575 -0.0109 0.0010  0.0312  63   THR H O   
3450 C CB  . THR D 63  ? 1.3741 1.2178 1.2747 0.0607  0.0075  -0.0167 63   THR H CB  
3451 O OG1 . THR D 63  ? 1.1960 1.0072 1.0680 0.0270  -0.0151 -0.0174 63   THR H OG1 
3452 C CG2 . THR D 63  ? 1.6192 1.4154 1.4476 0.1103  0.0199  -0.0421 63   THR H CG2 
3453 N N   . VAL D 64  ? 1.4444 1.4028 1.4464 -0.0385 0.0387  0.0386  64   VAL H N   
3454 C CA  . VAL D 64  ? 1.2802 1.2584 1.3186 -0.0848 0.0160  0.0455  64   VAL H CA  
3455 C C   . VAL D 64  ? 1.2974 1.3284 1.3890 -0.1121 0.0395  0.0669  64   VAL H C   
3456 O O   . VAL D 64  ? 1.3064 1.3761 1.4499 -0.1459 0.0203  0.0736  64   VAL H O   
3457 C CB  . VAL D 64  ? 1.2685 1.1890 1.2513 -0.1017 -0.0015 0.0327  64   VAL H CB  
3458 C CG1 . VAL D 64  ? 1.4721 1.4074 1.4784 -0.1449 -0.0140 0.0360  64   VAL H CG1 
3459 C CG2 . VAL D 64  ? 1.2146 1.0997 1.1724 -0.0862 -0.0335 0.0186  64   VAL H CG2 
3460 N N   . LYS D 65  ? 1.3023 1.3384 1.3832 -0.0975 0.0795  0.0798  65   LYS H N   
3461 C CA  . LYS D 65  ? 1.3267 1.4065 1.4613 -0.1279 0.1036  0.1062  65   LYS H CA  
3462 C C   . LYS D 65  ? 1.3996 1.5611 1.6297 -0.1420 0.0977  0.1229  65   LYS H C   
3463 O O   . LYS D 65  ? 1.3500 1.5476 1.6060 -0.1083 0.1020  0.1249  65   LYS H O   
3464 C CB  . LYS D 65  ? 1.3350 1.4167 1.4429 -0.1011 0.1529  0.1252  65   LYS H CB  
3465 C CG  . LYS D 65  ? 1.2684 1.3947 1.4380 -0.1336 0.1824  0.1617  65   LYS H CG  
3466 C CD  . LYS D 65  ? 1.2725 1.4053 1.4078 -0.1017 0.2356  0.1870  65   LYS H CD  
3467 C CE  . LYS D 65  ? 1.2978 1.4786 1.5065 -0.1376 0.2664  0.2325  65   LYS H CE  
3468 N NZ  . LYS D 65  ? 1.3579 1.5562 1.5341 -0.1048 0.3238  0.2659  65   LYS H NZ  
3469 N N   . GLY D 66  ? 1.5866 1.7747 1.8709 -0.1916 0.0841  0.1338  66   GLY H N   
3470 C CA  . GLY D 66  ? 1.5624 1.8320 1.9429 -0.2132 0.0710  0.1516  66   GLY H CA  
3471 C C   . GLY D 66  ? 1.5173 1.7961 1.9074 -0.2275 0.0205  0.1347  66   GLY H C   
3472 O O   . GLY D 66  ? 1.5466 1.8786 2.0033 -0.2630 -0.0046 0.1441  66   GLY H O   
3473 N N   . ARG D 67  ? 1.3659 1.5963 1.6920 -0.2022 0.0030  0.1129  67   ARG H N   
3474 C CA  . ARG D 67  ? 1.2636 1.5033 1.5921 -0.2122 -0.0414 0.1036  67   ARG H CA  
3475 C C   . ARG D 67  ? 1.1849 1.3742 1.4569 -0.2429 -0.0676 0.0815  67   ARG H C   
3476 O O   . ARG D 67  ? 1.1110 1.3252 1.3956 -0.2680 -0.1026 0.0776  67   ARG H O   
3477 C CB  . ARG D 67  ? 1.2932 1.5148 1.5984 -0.1674 -0.0465 0.0993  67   ARG H CB  
3478 C CG  . ARG D 67  ? 1.2886 1.5548 1.6448 -0.1281 -0.0212 0.1155  67   ARG H CG  
3479 C CD  . ARG D 67  ? 1.1504 1.3967 1.4972 -0.0888 -0.0380 0.1102  67   ARG H CD  
3480 N NE  . ARG D 67  ? 1.1107 1.2725 1.3760 -0.0670 -0.0374 0.0866  67   ARG H NE  
3481 C CZ  . ARG D 67  ? 1.1434 1.2603 1.3682 -0.0803 -0.0691 0.0765  67   ARG H CZ  
3482 N NH1 . ARG D 67  ? 1.0665 1.2133 1.3132 -0.1120 -0.1002 0.0864  67   ARG H NH1 
3483 N NH2 . ARG D 67  ? 1.2610 1.3076 1.4237 -0.0616 -0.0704 0.0579  67   ARG H NH2 
3484 N N   . PHE D 68  ? 1.3426 1.4645 1.5504 -0.2379 -0.0517 0.0673  68   PHE H N   
3485 C CA  . PHE D 68  ? 1.3946 1.4685 1.5495 -0.2592 -0.0708 0.0463  68   PHE H CA  
3486 C C   . PHE D 68  ? 1.4561 1.5073 1.6146 -0.2916 -0.0605 0.0419  68   PHE H C   
3487 O O   . PHE D 68  ? 1.5070 1.5715 1.7016 -0.2960 -0.0339 0.0595  68   PHE H O   
3488 C CB  . PHE D 68  ? 1.4540 1.4681 1.5418 -0.2311 -0.0656 0.0352  68   PHE H CB  
3489 C CG  . PHE D 68  ? 1.5049 1.5275 1.5890 -0.2066 -0.0843 0.0379  68   PHE H CG  
3490 C CD1 . PHE D 68  ? 1.5314 1.6098 1.6667 -0.2049 -0.1008 0.0515  68   PHE H CD1 
3491 C CD2 . PHE D 68  ? 1.5075 1.4818 1.5436 -0.1867 -0.0884 0.0301  68   PHE H CD2 
3492 C CE1 . PHE D 68  ? 1.5641 1.6432 1.7008 -0.1829 -0.1190 0.0581  68   PHE H CE1 
3493 C CE2 . PHE D 68  ? 1.5143 1.4907 1.5555 -0.1684 -0.1082 0.0358  68   PHE H CE2 
3494 C CZ  . PHE D 68  ? 1.5835 1.6088 1.6739 -0.1661 -0.1228 0.0502  68   PHE H CZ  
3495 N N   . THR D 69  ? 1.3426 1.3573 1.4634 -0.3127 -0.0805 0.0195  69   THR H N   
3496 C CA  . THR D 69  ? 1.3067 1.2839 1.4271 -0.3436 -0.0773 0.0093  69   THR H CA  
3497 C C   . THR D 69  ? 1.2214 1.1318 1.2707 -0.3369 -0.0811 -0.0157 69   THR H C   
3498 O O   . THR D 69  ? 1.2773 1.1890 1.2975 -0.3417 -0.1060 -0.0361 69   THR H O   
3499 C CB  . THR D 69  ? 1.3079 1.3226 1.4772 -0.3852 -0.1072 0.0027  69   THR H CB  
3500 O OG1 . THR D 69  ? 1.3400 1.4270 1.5884 -0.3902 -0.1024 0.0314  69   THR H OG1 
3501 C CG2 . THR D 69  ? 1.4362 1.3984 1.6075 -0.4182 -0.1074 -0.0107 69   THR H CG2 
3502 N N   . ILE D 70  ? 1.1959 1.0532 1.2180 -0.3237 -0.0554 -0.0115 70   ILE H N   
3503 C CA  . ILE D 70  ? 1.1947 0.9903 1.1603 -0.3149 -0.0556 -0.0312 70   ILE H CA  
3504 C C   . ILE D 70  ? 1.2689 1.0222 1.2414 -0.3460 -0.0612 -0.0481 70   ILE H C   
3505 O O   . ILE D 70  ? 1.3629 1.1145 1.3811 -0.3696 -0.0523 -0.0333 70   ILE H O   
3506 C CB  . ILE D 70  ? 1.2217 0.9811 1.1555 -0.2837 -0.0305 -0.0166 70   ILE H CB  
3507 C CG1 . ILE D 70  ? 1.2164 0.9243 1.1008 -0.2700 -0.0331 -0.0333 70   ILE H CG1 
3508 C CG2 . ILE D 70  ? 1.2402 0.9832 1.1966 -0.2908 -0.0040 0.0061  70   ILE H CG2 
3509 C CD1 . ILE D 70  ? 1.2258 0.9018 1.0804 -0.2408 -0.0160 -0.0181 70   ILE H CD1 
3510 N N   . SER D 71  ? 1.2390 0.9580 1.1687 -0.3456 -0.0761 -0.0788 71   SER H N   
3511 C CA  . SER D 71  ? 1.2564 0.9237 1.1845 -0.3718 -0.0869 -0.1049 71   SER H CA  
3512 C C   . SER D 71  ? 1.3611 0.9714 1.2288 -0.3475 -0.0821 -0.1300 71   SER H C   
3513 O O   . SER D 71  ? 1.1993 0.8232 1.0344 -0.3155 -0.0736 -0.1243 71   SER H O   
3514 C CB  . SER D 71  ? 1.2880 0.9902 1.2352 -0.4047 -0.1218 -0.1268 71   SER H CB  
3515 O OG  . SER D 71  ? 1.3348 1.0783 1.2431 -0.3888 -0.1384 -0.1395 71   SER H OG  
3516 N N   . ARG D 72  ? 1.6149 1.1611 1.4733 -0.3627 -0.0888 -0.1576 72   ARG H N   
3517 C CA  . ARG D 72  ? 1.6799 1.1630 1.4902 -0.3354 -0.0779 -0.1788 72   ARG H CA  
3518 C C   . ARG D 72  ? 1.7845 1.2187 1.5683 -0.3506 -0.0998 -0.2287 72   ARG H C   
3519 O O   . ARG D 72  ? 1.8566 1.2727 1.6732 -0.3898 -0.1209 -0.2411 72   ARG H O   
3520 C CB  . ARG D 72  ? 1.6557 1.0835 1.4821 -0.3254 -0.0525 -0.1520 72   ARG H CB  
3521 C CG  . ARG D 72  ? 1.6657 1.0450 1.4517 -0.2869 -0.0371 -0.1599 72   ARG H CG  
3522 C CD  . ARG D 72  ? 1.6837 1.0329 1.4847 -0.2725 -0.0142 -0.1204 72   ARG H CD  
3523 N NE  . ARG D 72  ? 1.7382 1.0460 1.5091 -0.2345 -0.0024 -0.1240 72   ARG H NE  
3524 C CZ  . ARG D 72  ? 1.7634 1.0637 1.5325 -0.2094 0.0130  -0.0898 72   ARG H CZ  
3525 N NH1 . ARG D 72  ? 1.7747 1.1025 1.5593 -0.2163 0.0204  -0.0530 72   ARG H NH1 
3526 N NH2 . ARG D 72  ? 1.7876 1.0566 1.5375 -0.1748 0.0206  -0.0925 72   ARG H NH2 
3527 N N   . ASP D 73  ? 1.8298 1.2455 1.5549 -0.3188 -0.0956 -0.2578 73   ASP H N   
3528 C CA  . ASP D 73  ? 1.8934 1.2528 1.5740 -0.3203 -0.1118 -0.3130 73   ASP H CA  
3529 C C   . ASP D 73  ? 1.8856 1.1795 1.5372 -0.2794 -0.0853 -0.3223 73   ASP H C   
3530 O O   . ASP D 73  ? 1.9082 1.2280 1.5178 -0.2402 -0.0698 -0.3277 73   ASP H O   
3531 C CB  . ASP D 73  ? 2.0056 1.4233 1.6350 -0.3151 -0.1308 -0.3399 73   ASP H CB  
3532 C CG  . ASP D 73  ? 2.1474 1.5079 1.7211 -0.3190 -0.1531 -0.4036 73   ASP H CG  
3533 O OD1 . ASP D 73  ? 2.2275 1.4954 1.8072 -0.3259 -0.1551 -0.4296 73   ASP H OD1 
3534 O OD2 . ASP D 73  ? 2.1431 1.5489 1.6635 -0.3139 -0.1699 -0.4279 73   ASP H OD2 
3535 N N   . ASN D 74  ? 1.7451 0.9587 1.4264 -0.2882 -0.0794 -0.3187 74   ASN H N   
3536 C CA  . ASN D 74  ? 1.8465 0.9914 1.5141 -0.2501 -0.0554 -0.3202 74   ASN H CA  
3537 C C   . ASN D 74  ? 1.9792 1.0727 1.5866 -0.2220 -0.0577 -0.3798 74   ASN H C   
3538 O O   . ASN D 74  ? 1.9691 1.0663 1.5484 -0.1734 -0.0330 -0.3798 74   ASN H O   
3539 C CB  . ASN D 74  ? 1.9780 1.0476 1.6968 -0.2717 -0.0521 -0.2967 74   ASN H CB  
3540 C CG  . ASN D 74  ? 1.9158 1.0356 1.6801 -0.2820 -0.0376 -0.2335 74   ASN H CG  
3541 O OD1 . ASN D 74  ? 1.8930 1.0715 1.6456 -0.2542 -0.0223 -0.2062 74   ASN H OD1 
3542 N ND2 . ASN D 74  ? 1.8880 0.9857 1.7047 -0.3219 -0.0428 -0.2100 74   ASN H ND2 
3543 N N   . PRO D 75  ? 2.0061 1.0552 1.5911 -0.2482 -0.0871 -0.4321 75   PRO H N   
3544 C CA  . PRO D 75  ? 2.0590 1.0578 1.5717 -0.2142 -0.0878 -0.4956 75   PRO H CA  
3545 C C   . PRO D 75  ? 2.0545 1.1396 1.5088 -0.1744 -0.0712 -0.5004 75   PRO H C   
3546 O O   . PRO D 75  ? 2.2129 1.2701 1.6120 -0.1280 -0.0532 -0.5363 75   PRO H O   
3547 C CB  . PRO D 75  ? 2.1567 1.1095 1.6565 -0.2599 -0.1328 -0.5478 75   PRO H CB  
3548 C CG  . PRO D 75  ? 2.1395 1.0768 1.7260 -0.3131 -0.1472 -0.5078 75   PRO H CG  
3549 C CD  . PRO D 75  ? 2.0249 1.0585 1.6508 -0.3082 -0.1222 -0.4385 75   PRO H CD  
3550 N N   . LYS D 76  ? 2.0109 1.2002 1.4788 -0.1890 -0.0748 -0.4627 76   LYS H N   
3551 C CA  . LYS D 76  ? 2.0311 1.3078 1.4538 -0.1563 -0.0596 -0.4563 76   LYS H CA  
3552 C C   . LYS D 76  ? 1.9111 1.2515 1.3750 -0.1341 -0.0316 -0.3944 76   LYS H C   
3553 O O   . LYS D 76  ? 1.7951 1.2145 1.2384 -0.1119 -0.0193 -0.3772 76   LYS H O   
3554 C CB  . LYS D 76  ? 2.0313 1.3779 1.4322 -0.1878 -0.0906 -0.4629 76   LYS H CB  
3555 C CG  . LYS D 76  ? 2.2309 1.5249 1.5772 -0.2071 -0.1252 -0.5298 76   LYS H CG  
3556 C CD  . LYS D 76  ? 2.2333 1.6072 1.5522 -0.2326 -0.1576 -0.5326 76   LYS H CD  
3557 C CE  . LYS D 76  ? 2.3802 1.6992 1.6440 -0.2556 -0.2006 -0.6018 76   LYS H CE  
3558 N NZ  . LYS D 76  ? 2.3957 1.7979 1.6305 -0.2791 -0.2364 -0.6017 76   LYS H NZ  
3559 N N   . ASN D 77  ? 1.9350 1.2430 1.4557 -0.1404 -0.0233 -0.3595 77   ASN H N   
3560 C CA  . ASN D 77  ? 1.7943 1.1512 1.3519 -0.1207 -0.0034 -0.3051 77   ASN H CA  
3561 C C   . ASN D 77  ? 1.6841 1.1365 1.2552 -0.1370 -0.0134 -0.2725 77   ASN H C   
3562 O O   . ASN D 77  ? 1.6692 1.1848 1.2381 -0.1132 -0.0015 -0.2490 77   ASN H O   
3563 C CB  . ASN D 77  ? 1.8138 1.1735 1.3533 -0.0674 0.0253  -0.3057 77   ASN H CB  
3564 C CG  . ASN D 77  ? 1.8805 1.1413 1.4155 -0.0447 0.0369  -0.3321 77   ASN H CG  
3565 O OD1 . ASN D 77  ? 2.0127 1.1956 1.5433 -0.0693 0.0210  -0.3633 77   ASN H OD1 
3566 N ND2 . ASN D 77  ? 1.8508 1.1140 1.3943 0.0020  0.0629  -0.3171 77   ASN H ND2 
3567 N N   . THR D 78  ? 1.5872 1.0496 1.1804 -0.1781 -0.0359 -0.2681 78   THR H N   
3568 C CA  . THR D 78  ? 1.5872 1.1319 1.1957 -0.1934 -0.0484 -0.2408 78   THR H CA  
3569 C C   . THR D 78  ? 1.6238 1.1715 1.2854 -0.2200 -0.0548 -0.2094 78   THR H C   
3570 O O   . THR D 78  ? 1.5714 1.0682 1.2546 -0.2419 -0.0582 -0.2159 78   THR H O   
3571 C CB  . THR D 78  ? 1.6659 1.2427 1.2393 -0.2116 -0.0717 -0.2701 78   THR H CB  
3572 O OG1 . THR D 78  ? 1.8624 1.4207 1.3738 -0.1844 -0.0630 -0.3087 78   THR H OG1 
3573 C CG2 . THR D 78  ? 1.5657 1.2317 1.1498 -0.2148 -0.0802 -0.2369 78   THR H CG2 
3574 N N   . LEU D 79  ? 1.5934 1.2007 1.2770 -0.2162 -0.0552 -0.1740 79   LEU H N   
3575 C CA  . LEU D 79  ? 1.4591 1.0815 1.1852 -0.2336 -0.0587 -0.1452 79   LEU H CA  
3576 C C   . LEU D 79  ? 1.4565 1.1473 1.1957 -0.2481 -0.0774 -0.1358 79   LEU H C   
3577 O O   . LEU D 79  ? 1.4095 1.1451 1.1382 -0.2330 -0.0804 -0.1238 79   LEU H O   
3578 C CB  . LEU D 79  ? 1.3614 0.9807 1.0992 -0.2098 -0.0443 -0.1140 79   LEU H CB  
3579 C CG  . LEU D 79  ? 1.3141 0.9539 1.0822 -0.2175 -0.0455 -0.0863 79   LEU H CG  
3580 C CD1 . LEU D 79  ? 1.4198 1.0251 1.2086 -0.2378 -0.0376 -0.0835 79   LEU H CD1 
3581 C CD2 . LEU D 79  ? 1.2889 0.9285 1.0541 -0.1910 -0.0397 -0.0631 79   LEU H CD2 
3582 N N   . PHE D 80  ? 1.5907 1.2924 1.3594 -0.2774 -0.0905 -0.1370 80   PHE H N   
3583 C CA  . PHE D 80  ? 1.6746 1.4418 1.4626 -0.2909 -0.1107 -0.1269 80   PHE H CA  
3584 C C   . PHE D 80  ? 1.7223 1.5159 1.5581 -0.2910 -0.1050 -0.0947 80   PHE H C   
3585 O O   . PHE D 80  ? 1.8234 1.5876 1.6805 -0.2939 -0.0890 -0.0852 80   PHE H O   
3586 C CB  . PHE D 80  ? 1.7278 1.5010 1.5191 -0.3232 -0.1353 -0.1527 80   PHE H CB  
3587 C CG  . PHE D 80  ? 1.8467 1.6022 1.5776 -0.3193 -0.1460 -0.1905 80   PHE H CG  
3588 C CD1 . PHE D 80  ? 2.0276 1.8371 1.7239 -0.3097 -0.1591 -0.1904 80   PHE H CD1 
3589 C CD2 . PHE D 80  ? 1.8717 1.5552 1.5778 -0.3226 -0.1420 -0.2252 80   PHE H CD2 
3590 C CE1 . PHE D 80  ? 2.0778 1.8754 1.7077 -0.3009 -0.1650 -0.2259 80   PHE H CE1 
3591 C CE2 . PHE D 80  ? 1.9650 1.6282 1.6073 -0.3129 -0.1499 -0.2659 80   PHE H CE2 
3592 C CZ  . PHE D 80  ? 2.0703 1.7935 1.6705 -0.3008 -0.1601 -0.2672 80   PHE H CZ  
3593 N N   . LEU D 81  ? 1.6503 1.4988 1.5002 -0.2848 -0.1169 -0.0766 81   LEU H N   
3594 C CA  . LEU D 81  ? 1.5449 1.4222 1.4390 -0.2808 -0.1140 -0.0511 81   LEU H CA  
3595 C C   . LEU D 81  ? 1.4584 1.3984 1.3799 -0.2924 -0.1384 -0.0430 81   LEU H C   
3596 O O   . LEU D 81  ? 1.3667 1.3352 1.2767 -0.2810 -0.1510 -0.0327 81   LEU H O   
3597 C CB  . LEU D 81  ? 1.5005 1.3670 1.3860 -0.2513 -0.1039 -0.0340 81   LEU H CB  
3598 C CG  . LEU D 81  ? 1.3280 1.2176 1.2489 -0.2397 -0.1018 -0.0143 81   LEU H CG  
3599 C CD1 . LEU D 81  ? 1.3398 1.2218 1.2844 -0.2470 -0.0822 -0.0110 81   LEU H CD1 
3600 C CD2 . LEU D 81  ? 1.3163 1.1837 1.2210 -0.2123 -0.0997 -0.0052 81   LEU H CD2 
3601 N N   . GLN D 82  ? 1.4211 1.3854 1.3845 -0.3158 -0.1459 -0.0427 82   GLN H N   
3602 C CA  . GLN D 82  ? 1.3431 1.3732 1.3440 -0.3265 -0.1711 -0.0306 82   GLN H CA  
3603 C C   . GLN D 82  ? 1.3007 1.3602 1.3485 -0.3053 -0.1602 -0.0019 82   GLN H C   
3604 O O   . GLN D 82  ? 1.2154 1.2678 1.2941 -0.3021 -0.1375 0.0062  82   GLN H O   
3605 C CB  . GLN D 82  ? 1.4836 1.5316 1.5181 -0.3631 -0.1885 -0.0424 82   GLN H CB  
3606 C CG  . GLN D 82  ? 1.5141 1.6369 1.5911 -0.3759 -0.2204 -0.0287 82   GLN H CG  
3607 C CD  . GLN D 82  ? 1.5330 1.6745 1.5567 -0.3763 -0.2500 -0.0401 82   GLN H CD  
3608 O OE1 . GLN D 82  ? 1.5310 1.6357 1.4949 -0.3849 -0.2564 -0.0714 82   GLN H OE1 
3609 N NE2 . GLN D 82  ? 1.5519 1.7502 1.5948 -0.3637 -0.2665 -0.0132 82   GLN H NE2 
3610 N N   . MET D 83  ? 1.3045 1.3961 1.3566 -0.2889 -0.1753 0.0145  83   MET H N   
3611 C CA  . MET D 83  ? 1.1397 1.2526 1.2337 -0.2639 -0.1695 0.0377  83   MET H CA  
3612 C C   . MET D 83  ? 1.2474 1.4304 1.3970 -0.2723 -0.1933 0.0556  83   MET H C   
3613 O O   . MET D 83  ? 1.3684 1.5818 1.5056 -0.2843 -0.2220 0.0589  83   MET H O   
3614 C CB  . MET D 83  ? 1.1037 1.1913 1.1705 -0.2381 -0.1721 0.0463  83   MET H CB  
3615 C CG  . MET D 83  ? 1.1926 1.2201 1.2088 -0.2308 -0.1553 0.0315  83   MET H CG  
3616 S SD  . MET D 83  ? 1.2408 1.2432 1.2414 -0.2064 -0.1641 0.0454  83   MET H SD  
3617 C CE  . MET D 83  ? 1.2339 1.2850 1.2316 -0.2195 -0.1898 0.0630  83   MET H CE  
3618 N N   . THR D 84  ? 1.2443 1.4578 1.4543 -0.2635 -0.1804 0.0694  84   THR H N   
3619 C CA  . THR D 84  ? 1.4221 1.7099 1.7000 -0.2686 -0.2013 0.0905  84   THR H CA  
3620 C C   . THR D 84  ? 1.5834 1.8870 1.9072 -0.2291 -0.1860 0.1111  84   THR H C   
3621 O O   . THR D 84  ? 1.6861 1.9539 2.0010 -0.2054 -0.1529 0.1054  84   THR H O   
3622 C CB  . THR D 84  ? 1.4745 1.8000 1.8008 -0.3022 -0.2023 0.0884  84   THR H CB  
3623 O OG1 . THR D 84  ? 1.6836 1.9724 1.9591 -0.3352 -0.2139 0.0611  84   THR H OG1 
3624 C CG2 . THR D 84  ? 1.4888 1.8994 1.8856 -0.3135 -0.2348 0.1103  84   THR H CG2 
3625 N N   . SER D 85  ? 1.4223 1.7776 1.7912 -0.2193 -0.2114 0.1344  85   SER H N   
3626 C CA  . SER D 85  ? 1.2241 1.5920 1.6405 -0.1772 -0.2016 0.1532  85   SER H CA  
3627 C C   . SER D 85  ? 1.0689 1.3584 1.4333 -0.1460 -0.1876 0.1411  85   SER H C   
3628 O O   . SER D 85  ? 1.0348 1.2923 1.3941 -0.1177 -0.1570 0.1304  85   SER H O   
3629 C CB  . SER D 85  ? 1.2879 1.6990 1.7700 -0.1658 -0.1713 0.1606  85   SER H CB  
3630 O OG  . SER D 85  ? 1.3386 1.8293 1.8854 -0.1973 -0.1907 0.1763  85   SER H OG  
3631 N N   . LEU D 86  ? 1.1574 1.4192 1.4820 -0.1522 -0.2120 0.1442  86   LEU H N   
3632 C CA  . LEU D 86  ? 1.2730 1.4622 1.5542 -0.1316 -0.2071 0.1347  86   LEU H CA  
3633 C C   . LEU D 86  ? 1.3102 1.4829 1.6297 -0.0907 -0.2100 0.1459  86   LEU H C   
3634 O O   . LEU D 86  ? 1.3933 1.6129 1.7712 -0.0792 -0.2246 0.1700  86   LEU H O   
3635 C CB  . LEU D 86  ? 1.3301 1.5064 1.5707 -0.1516 -0.2305 0.1424  86   LEU H CB  
3636 C CG  . LEU D 86  ? 1.2626 1.4360 1.4514 -0.1835 -0.2245 0.1231  86   LEU H CG  
3637 C CD1 . LEU D 86  ? 1.3668 1.5419 1.5194 -0.1962 -0.2436 0.1352  86   LEU H CD1 
3638 C CD2 . LEU D 86  ? 1.2181 1.3334 1.3698 -0.1773 -0.1962 0.0969  86   LEU H CD2 
3639 N N   . ARG D 87  ? 1.2345 1.3367 1.5201 -0.0671 -0.1987 0.1267  87   ARG H N   
3640 C CA  . ARG D 87  ? 1.3743 1.4403 1.6840 -0.0247 -0.2014 0.1258  87   ARG H CA  
3641 C C   . ARG D 87  ? 1.3722 1.3676 1.6532 -0.0230 -0.2257 0.1240  87   ARG H C   
3642 O O   . ARG D 87  ? 1.2982 1.2775 1.5397 -0.0509 -0.2329 0.1227  87   ARG H O   
3643 C CB  . ARG D 87  ? 1.4879 1.5335 1.7831 0.0081  -0.1646 0.0990  87   ARG H CB  
3644 C CG  . ARG D 87  ? 1.5596 1.6815 1.8965 0.0056  -0.1366 0.1075  87   ARG H CG  
3645 C CD  . ARG D 87  ? 1.6377 1.7430 1.9466 0.0334  -0.0932 0.0858  87   ARG H CD  
3646 N NE  . ARG D 87  ? 1.6694 1.8558 2.0329 0.0292  -0.0645 0.1022  87   ARG H NE  
3647 C CZ  . ARG D 87  ? 1.7334 1.9304 2.0859 0.0480  -0.0205 0.0956  87   ARG H CZ  
3648 N NH1 . ARG D 87  ? 1.8367 1.9653 2.1140 0.0750  -0.0019 0.0691  87   ARG H NH1 
3649 N NH2 . ARG D 87  ? 1.7097 1.9894 2.1277 0.0390  0.0036  0.1184  87   ARG H NH2 
3650 N N   . SER D 88  ? 1.5158 1.4688 1.8233 0.0110  -0.2392 0.1248  88   SER H N   
3651 C CA  . SER D 88  ? 1.4688 1.3516 1.7637 0.0099  -0.2681 0.1261  88   SER H CA  
3652 C C   . SER D 88  ? 1.4689 1.2929 1.6983 0.0063  -0.2597 0.0917  88   SER H C   
3653 O O   . SER D 88  ? 1.5163 1.3102 1.7297 -0.0160 -0.2804 0.0982  88   SER H O   
3654 C CB  . SER D 88  ? 1.5494 1.3854 1.8865 0.0496  -0.2857 0.1274  88   SER H CB  
3655 O OG  . SER D 88  ? 1.5180 1.4117 1.9208 0.0559  -0.2949 0.1640  88   SER H OG  
3656 N N   . GLU D 89  ? 1.4228 1.2365 1.6163 0.0282  -0.2289 0.0594  89   GLU H N   
3657 C CA  . GLU D 89  ? 1.4844 1.2433 1.6113 0.0288  -0.2230 0.0286  89   GLU H CA  
3658 C C   . GLU D 89  ? 1.3920 1.1778 1.4897 -0.0109 -0.2155 0.0358  89   GLU H C   
3659 O O   . GLU D 89  ? 1.4230 1.1658 1.4760 -0.0169 -0.2210 0.0204  89   GLU H O   
3660 C CB  . GLU D 89  ? 1.7527 1.4996 1.8435 0.0663  -0.1885 -0.0022 89   GLU H CB  
3661 C CG  . GLU D 89  ? 2.0306 1.7319 2.1314 0.1161  -0.1938 -0.0218 89   GLU H CG  
3662 C CD  . GLU D 89  ? 2.1134 1.8702 2.2886 0.1331  -0.1864 0.0021  89   GLU H CD  
3663 O OE1 . GLU D 89  ? 2.0632 1.9001 2.2764 0.1060  -0.1746 0.0310  89   GLU H OE1 
3664 O OE2 . GLU D 89  ? 2.1888 1.9074 2.3853 0.1746  -0.1951 -0.0092 89   GLU H OE2 
3665 N N   . ASP D 90  ? 1.2362 1.0899 1.3581 -0.0363 -0.2058 0.0574  90   ASP H N   
3666 C CA  . ASP D 90  ? 1.1227 0.9972 1.2158 -0.0702 -0.1985 0.0601  90   ASP H CA  
3667 C C   . ASP D 90  ? 1.1501 1.0155 1.2430 -0.0917 -0.2246 0.0779  90   ASP H C   
3668 O O   . ASP D 90  ? 1.1654 1.0371 1.2288 -0.1125 -0.2177 0.0762  90   ASP H O   
3669 C CB  . ASP D 90  ? 1.0697 1.0137 1.1861 -0.0902 -0.1851 0.0720  90   ASP H CB  
3670 C CG  . ASP D 90  ? 1.1772 1.1407 1.3006 -0.0760 -0.1539 0.0604  90   ASP H CG  
3671 O OD1 . ASP D 90  ? 1.2989 1.2219 1.3948 -0.0485 -0.1373 0.0418  90   ASP H OD1 
3672 O OD2 . ASP D 90  ? 1.1252 1.1472 1.2817 -0.0926 -0.1467 0.0712  90   ASP H OD2 
3673 N N   . THR D 91  ? 1.2259 1.0779 1.3553 -0.0859 -0.2525 0.0978  91   THR H N   
3674 C CA  . THR D 91  ? 1.2652 1.1149 1.4043 -0.1065 -0.2750 0.1232  91   THR H CA  
3675 C C   . THR D 91  ? 1.3698 1.1727 1.4750 -0.1098 -0.2775 0.1056  91   THR H C   
3676 O O   . THR D 91  ? 1.5535 1.2968 1.6521 -0.0917 -0.2912 0.0858  91   THR H O   
3677 C CB  . THR D 91  ? 1.2706 1.1028 1.4625 -0.0984 -0.3058 0.1505  91   THR H CB  
3678 O OG1 . THR D 91  ? 1.2508 1.1348 1.4771 -0.0950 -0.3057 0.1730  91   THR H OG1 
3679 C CG2 . THR D 91  ? 1.2684 1.1030 1.4786 -0.1220 -0.3268 0.1846  91   THR H CG2 
3680 N N   . ALA D 92  ? 1.2193 1.0476 1.3017 -0.1304 -0.2665 0.1109  92   ALA H N   
3681 C CA  . ALA D 92  ? 1.2221 1.0141 1.2757 -0.1314 -0.2675 0.0958  92   ALA H CA  
3682 C C   . ALA D 92  ? 1.2360 1.0676 1.2793 -0.1515 -0.2553 0.1110  92   ALA H C   
3683 O O   . ALA D 92  ? 1.2532 1.1354 1.2994 -0.1633 -0.2449 0.1267  92   ALA H O   
3684 C CB  . ALA D 92  ? 1.2561 1.0156 1.2635 -0.1134 -0.2478 0.0593  92   ALA H CB  
3685 N N   . MET D 93  ? 1.2351 1.0434 1.2640 -0.1523 -0.2580 0.1048  93   MET H N   
3686 C CA  . MET D 93  ? 1.2279 1.0677 1.2452 -0.1631 -0.2422 0.1142  93   MET H CA  
3687 C C   . MET D 93  ? 1.2052 1.0280 1.1738 -0.1557 -0.2164 0.0839  93   MET H C   
3688 O O   . MET D 93  ? 1.2273 1.0072 1.1747 -0.1438 -0.2202 0.0658  93   MET H O   
3689 C CB  . MET D 93  ? 1.2653 1.0985 1.3128 -0.1686 -0.2631 0.1344  93   MET H CB  
3690 C CG  . MET D 93  ? 1.2124 1.0830 1.2540 -0.1731 -0.2432 0.1460  93   MET H CG  
3691 S SD  . MET D 93  ? 1.2139 1.1598 1.2846 -0.1859 -0.2327 0.1893  93   MET H SD  
3692 C CE  . MET D 93  ? 1.2709 1.2135 1.4179 -0.1989 -0.2719 0.2321  93   MET H CE  
3693 N N   . TYR D 94  ? 1.3111 1.1646 1.2600 -0.1628 -0.1927 0.0793  94   TYR H N   
3694 C CA  . TYR D 94  ? 1.3099 1.1447 1.2208 -0.1596 -0.1687 0.0540  94   TYR H CA  
3695 C C   . TYR D 94  ? 1.2990 1.1318 1.1934 -0.1578 -0.1563 0.0532  94   TYR H C   
3696 O O   . TYR D 94  ? 1.3764 1.2439 1.2809 -0.1619 -0.1541 0.0685  94   TYR H O   
3697 C CB  . TYR D 94  ? 1.3164 1.1777 1.2208 -0.1704 -0.1556 0.0452  94   TYR H CB  
3698 C CG  . TYR D 94  ? 1.3682 1.2341 1.2937 -0.1675 -0.1629 0.0453  94   TYR H CG  
3699 C CD1 . TYR D 94  ? 1.3585 1.2465 1.3179 -0.1672 -0.1836 0.0657  94   TYR H CD1 
3700 C CD2 . TYR D 94  ? 1.4970 1.3476 1.4135 -0.1629 -0.1471 0.0293  94   TYR H CD2 
3701 C CE1 . TYR D 94  ? 1.4341 1.3261 1.4176 -0.1589 -0.1892 0.0662  94   TYR H CE1 
3702 C CE2 . TYR D 94  ? 1.5171 1.3797 1.4584 -0.1551 -0.1493 0.0312  94   TYR H CE2 
3703 C CZ  . TYR D 94  ? 1.4905 1.3724 1.4652 -0.1514 -0.1707 0.0477  94   TYR H CZ  
3704 O OH  . TYR D 94  ? 1.4919 1.3857 1.4959 -0.1383 -0.1719 0.0498  94   TYR H OH  
3705 N N   . PHE D 95  ? 1.0954 0.8901 0.9640 -0.1484 -0.1460 0.0380  95   PHE H N   
3706 C CA  . PHE D 95  ? 1.0455 0.8311 0.9004 -0.1416 -0.1335 0.0368  95   PHE H CA  
3707 C C   . PHE D 95  ? 1.2250 0.9818 1.0483 -0.1413 -0.1100 0.0169  95   PHE H C   
3708 O O   . PHE D 95  ? 1.3511 1.0863 1.1629 -0.1416 -0.1059 0.0091  95   PHE H O   
3709 C CB  . PHE D 95  ? 0.9693 0.7313 0.8291 -0.1293 -0.1504 0.0449  95   PHE H CB  
3710 C CG  . PHE D 95  ? 0.9929 0.7728 0.8923 -0.1333 -0.1798 0.0651  95   PHE H CG  
3711 C CD1 . PHE D 95  ? 1.0998 0.8579 1.0054 -0.1334 -0.2036 0.0614  95   PHE H CD1 
3712 C CD2 . PHE D 95  ? 1.1100 0.9268 1.0445 -0.1356 -0.1836 0.0889  95   PHE H CD2 
3713 C CE1 . PHE D 95  ? 1.1231 0.8871 1.0710 -0.1397 -0.2355 0.0799  95   PHE H CE1 
3714 C CE2 . PHE D 95  ? 1.1773 1.0110 1.1598 -0.1440 -0.2127 0.1136  95   PHE H CE2 
3715 C CZ  . PHE D 95  ? 1.1838 0.9864 1.1738 -0.1480 -0.2413 0.1083  95   PHE H CZ  
3716 N N   . CYS D 96  ? 1.2049 0.9607 1.0168 -0.1393 -0.0936 0.0104  96   CYS H N   
3717 C CA  . CYS D 96  ? 1.3300 1.0443 1.1181 -0.1367 -0.0748 -0.0042 96   CYS H CA  
3718 C C   . CYS D 96  ? 1.3564 1.0463 1.1409 -0.1169 -0.0746 0.0061  96   CYS H C   
3719 O O   . CYS D 96  ? 1.4351 1.1458 1.2341 -0.1060 -0.0762 0.0155  96   CYS H O   
3720 C CB  . CYS D 96  ? 1.4790 1.1937 1.2541 -0.1441 -0.0601 -0.0235 96   CYS H CB  
3721 S SG  . CYS D 96  ? 1.5496 1.2989 1.3230 -0.1295 -0.0534 -0.0221 96   CYS H SG  
3722 N N   . ALA D 97  ? 1.2850 0.9379 1.0523 -0.1109 -0.0726 0.0083  97   ALA H N   
3723 C CA  . ALA D 97  ? 1.1807 0.8106 0.9406 -0.0914 -0.0767 0.0208  97   ALA H CA  
3724 C C   . ALA D 97  ? 1.2096 0.7928 0.9454 -0.0875 -0.0570 0.0200  97   ALA H C   
3725 O O   . ALA D 97  ? 1.2152 0.7852 0.9405 -0.1004 -0.0453 0.0150  97   ALA H O   
3726 C CB  . ALA D 97  ? 1.1094 0.7414 0.8661 -0.0841 -0.1034 0.0311  97   ALA H CB  
3727 N N   . THR D 98  ? 1.2669 0.8282 1.0012 -0.0696 -0.0530 0.0294  98   THR H N   
3728 C CA  . THR D 98  ? 1.3479 0.8596 1.0638 -0.0635 -0.0362 0.0363  98   THR H CA  
3729 C C   . THR D 98  ? 1.3439 0.8428 1.0504 -0.0387 -0.0485 0.0593  98   THR H C   
3730 O O   . THR D 98  ? 1.3039 0.8312 1.0304 -0.0261 -0.0667 0.0663  98   THR H O   
3731 C CB  . THR D 98  ? 1.4054 0.8892 1.1306 -0.0654 -0.0163 0.0214  98   THR H CB  
3732 O OG1 . THR D 98  ? 1.4181 0.8470 1.1333 -0.0570 -0.0036 0.0350  98   THR H OG1 
3733 C CG2 . THR D 98  ? 1.4477 0.9560 1.1919 -0.0472 -0.0177 0.0164  98   THR H CG2 
3734 N N   . SER D 99  ? 1.4697 0.9306 1.1486 -0.0328 -0.0399 0.0754  99   SER H N   
3735 C CA  . SER D 99  ? 1.5561 1.0003 1.2221 -0.0076 -0.0512 0.1005  99   SER H CA  
3736 C C   . SER D 99  ? 1.4395 0.8595 1.1312 0.0085  -0.0396 0.1066  99   SER H C   
3737 O O   . SER D 99  ? 1.3866 0.8044 1.0821 0.0328  -0.0527 0.1287  99   SER H O   
3738 C CB  . SER D 99  ? 1.5983 1.0122 1.2202 -0.0041 -0.0428 0.1211  99   SER H CB  
3739 O OG  . SER D 99  ? 1.4901 0.8701 1.1181 -0.0191 -0.0125 0.1233  99   SER H OG  
3740 N N   . LEU D 100 ? 1.4794 0.8802 1.1879 -0.0026 -0.0176 0.0859  100  LEU H N   
3741 C CA  . LEU D 100 ? 1.5832 0.9472 1.3108 0.0156  -0.0027 0.0839  100  LEU H CA  
3742 C C   . LEU D 100 ? 1.5780 0.8892 1.2944 0.0316  0.0021  0.1154  100  LEU H C   
3743 O O   . LEU D 100 ? 1.4794 0.7681 1.2137 0.0596  0.0045  0.1276  100  LEU H O   
3744 C CB  . LEU D 100 ? 1.6570 1.0630 1.4151 0.0398  -0.0101 0.0823  100  LEU H CB  
3745 C CG  . LEU D 100 ? 1.7823 1.1638 1.5564 0.0541  0.0128  0.0588  100  LEU H CG  
3746 C CD1 . LEU D 100 ? 1.6577 1.0423 1.4189 0.0265  0.0224  0.0217  100  LEU H CD1 
3747 C CD2 . LEU D 100 ? 1.9438 1.3720 1.7531 0.0867  0.0126  0.0664  100  LEU H CD2 
3748 N N   . TYR D 101 ? 1.5701 0.8654 1.2580 0.0163  0.0051  0.1326  101  TYR H N   
3749 C CA  . TYR D 101 ? 1.4748 0.7248 1.1458 0.0291  0.0113  0.1708  101  TYR H CA  
3750 C C   . TYR D 101 ? 1.5863 0.8164 1.2423 0.0001  0.0305  0.1783  101  TYR H C   
3751 O O   . TYR D 101 ? 1.6336 0.8937 1.2573 -0.0055 0.0282  0.1894  101  TYR H O   
3752 C CB  . TYR D 101 ? 1.4754 0.7535 1.1185 0.0530  -0.0133 0.1994  101  TYR H CB  
3753 C CG  . TYR D 101 ? 1.6073 0.8455 1.2267 0.0715  -0.0101 0.2447  101  TYR H CG  
3754 C CD1 . TYR D 101 ? 1.8392 1.0512 1.4826 0.1007  -0.0149 0.2666  101  TYR H CD1 
3755 C CD2 . TYR D 101 ? 1.6766 0.9074 1.2500 0.0630  -0.0004 0.2697  101  TYR H CD2 
3756 C CE1 . TYR D 101 ? 1.9034 1.0786 1.5256 0.1189  -0.0137 0.3142  101  TYR H CE1 
3757 C CE2 . TYR D 101 ? 1.7904 0.9886 1.3375 0.0807  0.0040  0.3179  101  TYR H CE2 
3758 C CZ  . TYR D 101 ? 1.8795 1.0482 1.4512 0.1076  -0.0045 0.3410  101  TYR H CZ  
3759 O OH  . TYR D 101 ? 2.0917 1.2277 1.6379 0.1265  -0.0019 0.3946  101  TYR H OH  
3760 N N   . TYR D 102 ? 1.6945 0.8749 1.3773 -0.0176 0.0489  0.1706  102  TYR H N   
3761 C CA  . TYR D 102 ? 1.8350 0.9928 1.5230 -0.0483 0.0681  0.1851  102  TYR H CA  
3762 C C   . TYR D 102 ? 1.8600 1.0735 1.5435 -0.0742 0.0694  0.1674  102  TYR H C   
3763 O O   . TYR D 102 ? 2.0326 1.2458 1.7245 -0.0979 0.0865  0.1853  102  TYR H O   
3764 C CB  . TYR D 102 ? 1.9282 1.0640 1.5921 -0.0367 0.0788  0.2412  102  TYR H CB  
3765 C CG  . TYR D 102 ? 1.9947 1.0674 1.6701 -0.0130 0.0794  0.2691  102  TYR H CG  
3766 C CD1 . TYR D 102 ? 1.9640 0.9946 1.6738 -0.0035 0.0753  0.2403  102  TYR H CD1 
3767 C CD2 . TYR D 102 ? 2.1471 1.2022 1.7961 0.0035  0.0854  0.3257  102  TYR H CD2 
3768 C CE1 . TYR D 102 ? 2.1993 1.1689 1.9241 0.0230  0.0767  0.2662  102  TYR H CE1 
3769 C CE2 . TYR D 102 ? 2.2587 1.2551 1.9223 0.0272  0.0846  0.3566  102  TYR H CE2 
3770 C CZ  . TYR D 102 ? 2.2947 1.2467 2.0000 0.0374  0.0801  0.3262  102  TYR H CZ  
3771 O OH  . TYR D 102 ? 2.3005 1.1908 2.0245 0.0658  0.0800  0.3574  102  TYR H OH  
3772 N N   . GLY D 103 ? 1.8441 1.1078 1.5212 -0.0698 0.0528  0.1370  103  GLY H N   
3773 C CA  . GLY D 103 ? 1.8921 1.2075 1.5649 -0.0879 0.0523  0.1247  103  GLY H CA  
3774 C C   . GLY D 103 ? 1.8981 1.2371 1.5304 -0.0743 0.0560  0.1527  103  GLY H C   
3775 O O   . GLY D 103 ? 1.8935 1.2511 1.5259 -0.0891 0.0738  0.1636  103  GLY H O   
3776 N N   . THR D 104 ? 1.8729 1.2140 1.4698 -0.0446 0.0388  0.1641  104  THR H N   
3777 C CA  . THR D 104 ? 1.7622 1.1232 1.3054 -0.0263 0.0354  0.1820  104  THR H CA  
3778 C C   . THR D 104 ? 1.6766 1.0817 1.2100 -0.0262 0.0169  0.1511  104  THR H C   
3779 O O   . THR D 104 ? 1.6475 1.0692 1.2127 -0.0337 -0.0010 0.1242  104  THR H O   
3780 C CB  . THR D 104 ? 1.7524 1.0960 1.2608 0.0043  0.0159  0.2049  104  THR H CB  
3781 O OG1 . THR D 104 ? 1.7480 1.0994 1.2856 0.0115  -0.0109 0.1847  104  THR H OG1 
3782 C CG2 . THR D 104 ? 1.8087 1.1061 1.3193 0.0086  0.0362  0.2453  104  THR H CG2 
3783 N N   . PRO D 105 ? 1.7026 1.1258 1.1907 -0.0149 0.0220  0.1560  105  PRO H N   
3784 C CA  . PRO D 105 ? 1.6882 1.1447 1.1721 -0.0146 0.0075  0.1256  105  PRO H CA  
3785 C C   . PRO D 105 ? 1.6059 1.0660 1.0729 0.0009  -0.0357 0.1067  105  PRO H C   
3786 O O   . PRO D 105 ? 1.6401 1.1057 1.0626 0.0177  -0.0520 0.0946  105  PRO H O   
3787 C CB  . PRO D 105 ? 1.7089 1.1772 1.1446 -0.0004 0.0320  0.1386  105  PRO H CB  
3788 C CG  . PRO D 105 ? 1.6882 1.1307 1.0790 0.0162  0.0437  0.1764  105  PRO H CG  
3789 C CD  . PRO D 105 ? 1.6466 1.0606 1.0877 -0.0016 0.0474  0.1915  105  PRO H CD  
3790 N N   . TRP D 106 ? 1.4456 0.9032 0.9509 -0.0044 -0.0548 0.1034  106  TRP H N   
3791 C CA  . TRP D 106 ? 1.2754 0.7470 0.7896 0.0020  -0.0959 0.0893  106  TRP H CA  
3792 C C   . TRP D 106 ? 1.2938 0.7837 0.8731 -0.0143 -0.0975 0.0809  106  TRP H C   
3793 O O   . TRP D 106 ? 1.2431 0.7286 0.8487 -0.0282 -0.0704 0.0797  106  TRP H O   
3794 C CB  . TRP D 106 ? 1.3177 0.7746 0.7953 0.0254  -0.1234 0.1066  106  TRP H CB  
3795 C CG  . TRP D 106 ? 1.4252 0.8686 0.9263 0.0322  -0.1174 0.1317  106  TRP H CG  
3796 C CD1 . TRP D 106 ? 1.4362 0.8939 0.9946 0.0302  -0.1276 0.1321  106  TRP H CD1 
3797 C CD2 . TRP D 106 ? 1.6106 1.0239 1.0797 0.0464  -0.0990 0.1631  106  TRP H CD2 
3798 N NE1 . TRP D 106 ? 1.5393 0.9742 1.1045 0.0448  -0.1167 0.1576  106  TRP H NE1 
3799 C CE2 . TRP D 106 ? 1.5698 0.9745 1.0822 0.0533  -0.1010 0.1783  106  TRP H CE2 
3800 C CE3 . TRP D 106 ? 1.7245 1.1196 1.1342 0.0559  -0.0784 0.1835  106  TRP H CE3 
3801 C CZ2 . TRP D 106 ? 1.6124 0.9834 1.1133 0.0684  -0.0868 0.2123  106  TRP H CZ2 
3802 C CZ3 . TRP D 106 ? 1.7337 1.1002 1.1310 0.0680  -0.0635 0.2218  106  TRP H CZ3 
3803 C CH2 . TRP D 106 ? 1.5984 0.9493 1.0424 0.0736  -0.0695 0.2355  106  TRP H CH2 
3804 N N   . PHE D 107 ? 1.4708 0.9826 1.0758 -0.0132 -0.1304 0.0750  107  PHE H N   
3805 C CA  . PHE D 107 ? 1.4620 1.0034 1.1246 -0.0268 -0.1300 0.0686  107  PHE H CA  
3806 C C   . PHE D 107 ? 1.5607 1.1198 1.2552 -0.0153 -0.1548 0.0836  107  PHE H C   
3807 O O   . PHE D 107 ? 1.4894 1.0682 1.1995 -0.0166 -0.1906 0.0846  107  PHE H O   
3808 C CB  . PHE D 107 ? 1.3676 0.9337 1.0470 -0.0425 -0.1410 0.0519  107  PHE H CB  
3809 C CG  . PHE D 107 ? 1.3924 0.9464 1.0393 -0.0459 -0.1257 0.0403  107  PHE H CG  
3810 C CD1 . PHE D 107 ? 1.4588 1.0138 1.1129 -0.0592 -0.0927 0.0370  107  PHE H CD1 
3811 C CD2 . PHE D 107 ? 1.4009 0.9433 1.0117 -0.0345 -0.1453 0.0320  107  PHE H CD2 
3812 C CE1 . PHE D 107 ? 1.4931 1.0484 1.1296 -0.0617 -0.0767 0.0318  107  PHE H CE1 
3813 C CE2 . PHE D 107 ? 1.3969 0.9348 0.9805 -0.0315 -0.1257 0.0228  107  PHE H CE2 
3814 C CZ  . PHE D 107 ? 1.3881 0.9375 0.9897 -0.0454 -0.0900 0.0259  107  PHE H CZ  
3815 N N   . ALA D 108 ? 1.6207 1.1726 1.3315 -0.0041 -0.1367 0.0959  108  ALA H N   
3816 C CA  . ALA D 108 ? 1.6235 1.2019 1.3763 0.0104  -0.1545 0.1138  108  ALA H CA  
3817 C C   . ALA D 108 ? 1.5041 1.1293 1.3128 0.0024  -0.1471 0.1103  108  ALA H C   
3818 O O   . ALA D 108 ? 1.6273 1.2953 1.4816 0.0036  -0.1719 0.1252  108  ALA H O   
3819 C CB  . ALA D 108 ? 1.7168 1.2664 1.4651 0.0330  -0.1373 0.1310  108  ALA H CB  
3820 N N   . TYR D 109 ? 1.3464 0.9671 1.1524 -0.0065 -0.1147 0.0928  109  TYR H N   
3821 C CA  . TYR D 109 ? 1.2971 0.9620 1.1407 -0.0104 -0.1017 0.0887  109  TYR H CA  
3822 C C   . TYR D 109 ? 1.1763 0.8558 1.0121 -0.0360 -0.1036 0.0735  109  TYR H C   
3823 O O   . TYR D 109 ? 1.1881 0.8377 0.9910 -0.0475 -0.0894 0.0551  109  TYR H O   
3824 C CB  . TYR D 109 ? 1.4330 1.0783 1.2725 0.0046  -0.0662 0.0771  109  TYR H CB  
3825 C CG  . TYR D 109 ? 1.3898 1.0244 1.2478 0.0353  -0.0633 0.0957  109  TYR H CG  
3826 C CD1 . TYR D 109 ? 1.4074 1.0953 1.3166 0.0552  -0.0624 0.1135  109  TYR H CD1 
3827 C CD2 . TYR D 109 ? 1.3294 0.9064 1.1594 0.0458  -0.0610 0.1012  109  TYR H CD2 
3828 C CE1 . TYR D 109 ? 1.4598 1.1438 1.3943 0.0868  -0.0607 0.1334  109  TYR H CE1 
3829 C CE2 . TYR D 109 ? 1.4350 1.0024 1.2852 0.0764  -0.0609 0.1225  109  TYR H CE2 
3830 C CZ  . TYR D 109 ? 1.4856 1.1069 1.3894 0.0978  -0.0615 0.1372  109  TYR H CZ  
3831 O OH  . TYR D 109 ? 1.5411 1.1587 1.4733 0.1315  -0.0617 0.1609  109  TYR H OH  
3832 N N   . TRP D 110 ? 1.2421 0.9686 1.1147 -0.0454 -0.1231 0.0855  110  TRP H N   
3833 C CA  . TRP D 110 ? 1.2805 1.0229 1.1531 -0.0671 -0.1289 0.0774  110  TRP H CA  
3834 C C   . TRP D 110 ? 1.2953 1.0849 1.1895 -0.0710 -0.1095 0.0804  110  TRP H C   
3835 O O   . TRP D 110 ? 1.3828 1.2106 1.3093 -0.0581 -0.1008 0.0973  110  TRP H O   
3836 C CB  . TRP D 110 ? 1.1488 0.9016 1.0457 -0.0768 -0.1684 0.0900  110  TRP H CB  
3837 C CG  . TRP D 110 ? 1.1392 0.8436 0.9951 -0.0736 -0.1874 0.0778  110  TRP H CG  
3838 C CD1 . TRP D 110 ? 1.2704 0.9493 1.1066 -0.0585 -0.2021 0.0824  110  TRP H CD1 
3839 C CD2 . TRP D 110 ? 1.1689 0.8491 0.9950 -0.0813 -0.1920 0.0602  110  TRP H CD2 
3840 N NE1 . TRP D 110 ? 1.3319 0.9715 1.1189 -0.0559 -0.2142 0.0674  110  TRP H NE1 
3841 C CE2 . TRP D 110 ? 1.2688 0.9090 1.0515 -0.0684 -0.2062 0.0530  110  TRP H CE2 
3842 C CE3 . TRP D 110 ? 1.1377 0.8296 0.9696 -0.0950 -0.1852 0.0517  110  TRP H CE3 
3843 C CZ2 . TRP D 110 ? 1.2937 0.9062 1.0370 -0.0658 -0.2090 0.0354  110  TRP H CZ2 
3844 C CZ3 . TRP D 110 ? 1.1329 0.7976 0.9354 -0.0934 -0.1901 0.0360  110  TRP H CZ3 
3845 C CH2 . TRP D 110 ? 1.1934 0.8192 0.9513 -0.0776 -0.1996 0.0269  110  TRP H CH2 
3846 N N   . GLY D 111 ? 1.2905 1.0824 1.1659 -0.0868 -0.1022 0.0657  111  GLY H N   
3847 C CA  . GLY D 111 ? 1.2836 1.1225 1.1679 -0.0915 -0.0883 0.0692  111  GLY H CA  
3848 C C   . GLY D 111 ? 1.2548 1.1429 1.1859 -0.1023 -0.1095 0.1002  111  GLY H C   
3849 O O   . GLY D 111 ? 1.3149 1.1964 1.2758 -0.1067 -0.1382 0.1155  111  GLY H O   
3850 N N   . GLN D 112 ? 1.4217 1.3579 1.3575 -0.1070 -0.0970 0.1103  112  GLN H N   
3851 C CA  . GLN D 112 ? 1.4890 1.4752 1.4756 -0.1189 -0.1144 0.1482  112  GLN H CA  
3852 C C   . GLN D 112 ? 1.3403 1.3098 1.3287 -0.1386 -0.1393 0.1476  112  GLN H C   
3853 O O   . GLN D 112 ? 1.2700 1.2459 1.3047 -0.1497 -0.1676 0.1728  112  GLN H O   
3854 C CB  . GLN D 112 ? 1.7447 1.7971 1.7342 -0.1119 -0.0875 0.1675  112  GLN H CB  
3855 C CG  . GLN D 112 ? 2.0472 2.1268 2.0488 -0.0864 -0.0611 0.1748  112  GLN H CG  
3856 C CD  . GLN D 112 ? 2.1728 2.2695 2.2452 -0.0862 -0.0819 0.2085  112  GLN H CD  
3857 O OE1 . GLN D 112 ? 2.1889 2.3063 2.3139 -0.1066 -0.1108 0.2406  112  GLN H OE1 
3858 N NE2 . GLN D 112 ? 2.2436 2.3294 2.3211 -0.0637 -0.0709 0.2019  112  GLN H NE2 
3859 N N   . GLY D 113 ? 1.2873 1.2342 1.2323 -0.1427 -0.1312 0.1196  113  GLY H N   
3860 C CA  . GLY D 113 ? 1.1541 1.0883 1.1041 -0.1560 -0.1514 0.1184  113  GLY H CA  
3861 C C   . GLY D 113 ? 1.1416 1.1239 1.0942 -0.1656 -0.1490 0.1353  113  GLY H C   
3862 O O   . GLY D 113 ? 1.2063 1.2392 1.1679 -0.1637 -0.1374 0.1598  113  GLY H O   
3863 N N   . THR D 114 ? 1.1895 1.1614 1.1342 -0.1737 -0.1590 0.1251  114  THR H N   
3864 C CA  . THR D 114 ? 1.2549 1.2715 1.2030 -0.1828 -0.1636 0.1438  114  THR H CA  
3865 C C   . THR D 114 ? 1.4613 1.4614 1.4409 -0.1880 -0.1889 0.1523  114  THR H C   
3866 O O   . THR D 114 ? 1.6810 1.6394 1.6544 -0.1838 -0.1922 0.1269  114  THR H O   
3867 C CB  . THR D 114 ? 1.2244 1.2545 1.1223 -0.1850 -0.1473 0.1164  114  THR H CB  
3868 O OG1 . THR D 114 ? 1.3502 1.4251 1.2492 -0.1936 -0.1584 0.1356  114  THR H OG1 
3869 C CG2 . THR D 114 ? 1.2208 1.2044 1.1020 -0.1873 -0.1451 0.0798  114  THR H CG2 
3870 N N   . LEU D 115 ? 1.4734 1.5071 1.4875 -0.1943 -0.2045 0.1906  115  LEU H N   
3871 C CA  . LEU D 115 ? 1.3785 1.3919 1.4310 -0.1952 -0.2304 0.2027  115  LEU H CA  
3872 C C   . LEU D 115 ? 1.3171 1.3534 1.3585 -0.1967 -0.2316 0.1974  115  LEU H C   
3873 O O   . LEU D 115 ? 1.4097 1.4963 1.4297 -0.2030 -0.2250 0.2092  115  LEU H O   
3874 C CB  . LEU D 115 ? 1.4501 1.4824 1.5570 -0.2027 -0.2504 0.2529  115  LEU H CB  
3875 C CG  . LEU D 115 ? 1.4496 1.4496 1.6028 -0.2015 -0.2809 0.2670  115  LEU H CG  
3876 C CD1 . LEU D 115 ? 1.3869 1.3150 1.5375 -0.1898 -0.2923 0.2282  115  LEU H CD1 
3877 C CD2 . LEU D 115 ? 1.5563 1.5731 1.7693 -0.2136 -0.3010 0.3221  115  LEU H CD2 
3878 N N   . VAL D 116 ? 1.2173 1.2201 1.2728 -0.1889 -0.2409 0.1798  116  VAL H N   
3879 C CA  . VAL D 116 ? 1.0939 1.1224 1.1562 -0.1886 -0.2453 0.1790  116  VAL H CA  
3880 C C   . VAL D 116 ? 1.2056 1.2111 1.3176 -0.1765 -0.2676 0.1957  116  VAL H C   
3881 O O   . VAL D 116 ? 1.3409 1.2930 1.4597 -0.1622 -0.2700 0.1746  116  VAL H O   
3882 C CB  . VAL D 116 ? 1.1110 1.1294 1.1463 -0.1875 -0.2274 0.1395  116  VAL H CB  
3883 C CG1 . VAL D 116 ? 1.0528 1.1066 1.1121 -0.1881 -0.2357 0.1443  116  VAL H CG1 
3884 C CG2 . VAL D 116 ? 1.1888 1.2184 1.1768 -0.1988 -0.2086 0.1204  116  VAL H CG2 
3885 N N   . THR D 117 ? 1.2732 1.3164 1.4158 -0.1794 -0.2844 0.2327  117  THR H N   
3886 C CA  . THR D 117 ? 1.1757 1.1968 1.3716 -0.1658 -0.3075 0.2533  117  THR H CA  
3887 C C   . THR D 117 ? 1.2641 1.3208 1.4762 -0.1573 -0.3095 0.2531  117  THR H C   
3888 O O   . THR D 117 ? 1.3070 1.4237 1.5024 -0.1700 -0.3081 0.2638  117  THR H O   
3889 C CB  . THR D 117 ? 1.1907 1.2269 1.4231 -0.1751 -0.3282 0.3075  117  THR H CB  
3890 O OG1 . THR D 117 ? 1.1971 1.2180 1.4220 -0.1867 -0.3241 0.3128  117  THR H OG1 
3891 C CG2 . THR D 117 ? 1.2565 1.2493 1.5490 -0.1601 -0.3552 0.3262  117  THR H CG2 
3892 N N   . VAL D 118 ? 1.2023 1.2241 1.4468 -0.1340 -0.3141 0.2402  118  VAL H N   
3893 C CA  . VAL D 118 ? 1.1669 1.2264 1.4406 -0.1211 -0.3141 0.2415  118  VAL H CA  
3894 C C   . VAL D 118 ? 1.2735 1.3164 1.6074 -0.1004 -0.3391 0.2737  118  VAL H C   
3895 O O   . VAL D 118 ? 1.2930 1.2749 1.6470 -0.0741 -0.3414 0.2561  118  VAL H O   
3896 C CB  . VAL D 118 ? 1.0637 1.1063 1.3258 -0.1056 -0.2888 0.1987  118  VAL H CB  
3897 C CG1 . VAL D 118 ? 1.0974 1.1977 1.4005 -0.0967 -0.2869 0.2062  118  VAL H CG1 
3898 C CG2 . VAL D 118 ? 0.8682 0.9094 1.0739 -0.1257 -0.2664 0.1702  118  VAL H CG2 
3899 N N   . SER D 119 ? 1.1541 1.4038 1.4535 0.0008  -0.1343 0.3212  119  SER H N   
3900 C CA  . SER D 119 ? 1.2144 1.4916 1.5662 0.0094  -0.0997 0.3336  119  SER H CA  
3901 C C   . SER D 119 ? 1.2080 1.5209 1.6175 0.0085  -0.1375 0.3579  119  SER H C   
3902 O O   . SER D 119 ? 1.2003 1.5145 1.5683 0.0069  -0.1849 0.3463  119  SER H O   
3903 C CB  . SER D 119 ? 1.2381 1.5065 1.5313 0.0217  -0.0816 0.3048  119  SER H CB  
3904 O OG  . SER D 119 ? 1.2899 1.5799 1.6358 0.0291  -0.0503 0.3181  119  SER H OG  
3905 N N   . ALA D 120 ? 1.1760 1.5153 1.6819 0.0078  -0.1165 0.3909  120  ALA H N   
3906 C CA  . ALA D 120 ? 1.1303 1.5011 1.6980 0.0028  -0.1572 0.4219  120  ALA H CA  
3907 C C   . ALA D 120 ? 1.0927 1.4745 1.6356 0.0097  -0.1660 0.4165  120  ALA H C   
3908 O O   . ALA D 120 ? 1.1568 1.5599 1.7382 0.0010  -0.2039 0.4443  120  ALA H O   
3909 C CB  . ALA D 120 ? 1.1141 1.5113 1.8127 -0.0003 -0.1354 0.4631  120  ALA H CB  
3910 N N   . ALA D 121 ? 1.0476 1.4135 1.5257 0.0212  -0.1353 0.3843  121  ALA H N   
3911 C CA  . ALA D 121 ? 1.1316 1.5075 1.5845 0.0254  -0.1397 0.3790  121  ALA H CA  
3912 C C   . ALA D 121 ? 1.2584 1.6379 1.6414 0.0151  -0.1916 0.3660  121  ALA H C   
3913 O O   . ALA D 121 ? 1.3546 1.7202 1.6880 0.0112  -0.2153 0.3449  121  ALA H O   
3914 C CB  . ALA D 121 ? 1.0412 1.3974 1.4413 0.0377  -0.0952 0.3466  121  ALA H CB  
3915 N N   . LYS D 122 ? 1.2464 1.6418 1.6248 0.0086  -0.2079 0.3779  122  LYS H N   
3916 C CA  . LYS D 122 ? 1.2780 1.6758 1.5828 -0.0064 -0.2500 0.3639  122  LYS H CA  
3917 C C   . LYS D 122 ? 1.2217 1.6069 1.4381 0.0031  -0.2352 0.3115  122  LYS H C   
3918 O O   . LYS D 122 ? 1.2802 1.6553 1.4894 0.0190  -0.1977 0.2916  122  LYS H O   
3919 C CB  . LYS D 122 ? 1.4000 1.8143 1.7120 -0.0207 -0.2675 0.3912  122  LYS H CB  
3920 C CG  . LYS D 122 ? 1.4233 1.8513 1.8360 -0.0307 -0.2904 0.4479  122  LYS H CG  
3921 C CD  . LYS D 122 ? 1.4703 1.9082 1.8834 -0.0470 -0.3119 0.4767  122  LYS H CD  
3922 C CE  . LYS D 122 ? 1.5112 1.9623 2.0421 -0.0553 -0.3390 0.5373  122  LYS H CE  
3923 N NZ  . LYS D 122 ? 1.5762 2.0289 2.1048 -0.0746 -0.3644 0.5678  122  LYS H NZ  
3924 N N   . THR D 123 ? 1.1624 1.5467 1.3130 -0.0088 -0.2658 0.2885  123  THR H N   
3925 C CA  . THR D 123 ? 1.1297 1.5078 1.2100 -0.0002 -0.2547 0.2376  123  THR H CA  
3926 C C   . THR D 123 ? 1.1158 1.5126 1.1590 -0.0095 -0.2455 0.2322  123  THR H C   
3927 O O   . THR D 123 ? 1.3202 1.7232 1.3179 -0.0304 -0.2692 0.2284  123  THR H O   
3928 C CB  . THR D 123 ? 1.1283 1.4916 1.1663 -0.0063 -0.2868 0.2094  123  THR H CB  
3929 O OG1 . THR D 123 ? 1.1816 1.5262 1.2575 -0.0011 -0.2978 0.2209  123  THR H OG1 
3930 C CG2 . THR D 123 ? 1.0393 1.3987 1.0257 0.0062  -0.2729 0.1554  123  THR H CG2 
3931 N N   . THR D 124 ? 0.9845 1.3869 1.0423 0.0022  -0.2106 0.2325  124  THR H N   
3932 C CA  . THR D 124 ? 0.9724 1.3921 1.0018 -0.0086 -0.2009 0.2331  124  THR H CA  
3933 C C   . THR D 124 ? 0.8268 1.2528 0.7988 -0.0030 -0.1850 0.1826  124  THR H C   
3934 O O   . THR D 124 ? 0.7731 1.1891 0.7506 0.0168  -0.1671 0.1573  124  THR H O   
3935 C CB  . THR D 124 ? 1.1290 1.5493 1.2089 -0.0006 -0.1730 0.2603  124  THR H CB  
3936 O OG1 . THR D 124 ? 1.2170 1.6352 1.3688 -0.0035 -0.1853 0.3061  124  THR H OG1 
3937 C CG2 . THR D 124 ? 1.2328 1.6682 1.2843 -0.0146 -0.1665 0.2648  124  THR H CG2 
3938 N N   . PRO D 125 ? 0.8637 1.3050 0.7817 -0.0222 -0.1918 0.1667  125  PRO H N   
3939 C CA  . PRO D 125 ? 0.8358 1.2904 0.7164 -0.0163 -0.1694 0.1189  125  PRO H CA  
3940 C C   . PRO D 125 ? 0.9370 1.4028 0.8322 -0.0105 -0.1394 0.1244  125  PRO H C   
3941 O O   . PRO D 125 ? 1.0774 1.5423 0.9964 -0.0180 -0.1369 0.1642  125  PRO H O   
3942 C CB  . PRO D 125 ? 1.0759 1.5432 0.8929 -0.0452 -0.1802 0.1047  125  PRO H CB  
3943 C CG  . PRO D 125 ? 1.3141 1.7768 1.1324 -0.0704 -0.2065 0.1578  125  PRO H CG  
3944 C CD  . PRO D 125 ? 1.1650 1.6106 1.0522 -0.0536 -0.2210 0.1913  125  PRO H CD  
3945 N N   . PRO D 126 ? 1.0158 1.4907 0.9044 0.0026  -0.1185 0.0864  126  PRO H N   
3946 C CA  . PRO D 126 ? 1.0708 1.5515 0.9737 0.0072  -0.0930 0.0910  126  PRO H CA  
3947 C C   . PRO D 126 ? 1.1565 1.6628 1.0310 -0.0165 -0.0816 0.0980  126  PRO H C   
3948 O O   . PRO D 126 ? 1.2901 1.8139 1.1226 -0.0369 -0.0868 0.0859  126  PRO H O   
3949 C CB  . PRO D 126 ? 1.0734 1.5555 0.9816 0.0260  -0.0839 0.0483  126  PRO H CB  
3950 C CG  . PRO D 126 ? 1.1803 1.6735 1.0680 0.0247  -0.0960 0.0134  126  PRO H CG  
3951 C CD  . PRO D 126 ? 1.1588 1.6360 1.0360 0.0147  -0.1207 0.0378  126  PRO H CD  
3952 N N   . SER D 127 ? 0.9920 1.4960 0.8852 -0.0166 -0.0649 0.1176  127  SER H N   
3953 C CA  . SER D 127 ? 0.8512 1.3772 0.7218 -0.0383 -0.0514 0.1234  127  SER H CA  
3954 C C   . SER D 127 ? 0.8149 1.3551 0.6910 -0.0283 -0.0283 0.0893  127  SER H C   
3955 O O   . SER D 127 ? 0.8844 1.4037 0.7886 -0.0100 -0.0218 0.0880  127  SER H O   
3956 C CB  . SER D 127 ? 0.7851 1.2951 0.6800 -0.0474 -0.0536 0.1723  127  SER H CB  
3957 O OG  . SER D 127 ? 0.7854 1.2815 0.6964 -0.0523 -0.0792 0.2068  127  SER H OG  
3958 N N   . VAL D 128 ? 0.7746 1.3494 0.6243 -0.0428 -0.0156 0.0612  128  VAL H N   
3959 C CA  . VAL D 128 ? 0.7668 1.3628 0.6350 -0.0329 0.0029  0.0250  128  VAL H CA  
3960 C C   . VAL D 128 ? 0.8397 1.4575 0.6990 -0.0557 0.0220  0.0368  128  VAL H C   
3961 O O   . VAL D 128 ? 0.9027 1.5429 0.7244 -0.0845 0.0294  0.0429  128  VAL H O   
3962 C CB  . VAL D 128 ? 0.8769 1.4998 0.7411 -0.0280 0.0079  -0.0236 128  VAL H CB  
3963 C CG1 . VAL D 128 ? 0.8420 1.4877 0.7471 -0.0147 0.0222  -0.0571 128  VAL H CG1 
3964 C CG2 . VAL D 128 ? 1.0098 1.6058 0.8796 -0.0088 -0.0155 -0.0316 128  VAL H CG2 
3965 N N   . TYR D 129 ? 0.7832 1.3905 0.6710 -0.0468 0.0287  0.0408  129  TYR H N   
3966 C CA  . TYR D 129 ? 0.6824 1.3038 0.5680 -0.0674 0.0439  0.0542  129  TYR H CA  
3967 C C   . TYR D 129 ? 0.7187 1.3684 0.6331 -0.0621 0.0571  0.0196  129  TYR H C   
3968 O O   . TYR D 129 ? 0.7309 1.3613 0.6741 -0.0397 0.0475  0.0057  129  TYR H O   
3969 C CB  . TYR D 129 ? 0.6735 1.2515 0.5708 -0.0651 0.0390  0.0922  129  TYR H CB  
3970 C CG  . TYR D 129 ? 0.7635 1.3164 0.6543 -0.0687 0.0246  0.1299  129  TYR H CG  
3971 C CD1 . TYR D 129 ? 0.7563 1.3242 0.6189 -0.0974 0.0181  0.1554  129  TYR H CD1 
3972 C CD2 . TYR D 129 ? 0.6778 1.1921 0.5926 -0.0467 0.0162  0.1417  129  TYR H CD2 
3973 C CE1 . TYR D 129 ? 0.7804 1.3255 0.6474 -0.1020 -0.0027 0.1943  129  TYR H CE1 
3974 C CE2 . TYR D 129 ? 0.8272 1.3236 0.7534 -0.0491 0.0024  0.1775  129  TYR H CE2 
3975 C CZ  . TYR D 129 ? 1.0237 1.5357 0.9303 -0.0758 -0.0102 0.2048  129  TYR H CZ  
3976 O OH  . TYR D 129 ? 1.2313 1.7249 1.1601 -0.0787 -0.0310 0.2442  129  TYR H OH  
3977 N N   . PRO D 130 ? 0.7146 1.4095 0.6241 -0.0847 0.0775  0.0067  130  PRO H N   
3978 C CA  . PRO D 130 ? 0.7741 1.5021 0.7273 -0.0805 0.0894  -0.0242 130  PRO H CA  
3979 C C   . PRO D 130 ? 0.9468 1.6503 0.9177 -0.0830 0.0839  -0.0031 130  PRO H C   
3980 O O   . PRO D 130 ? 1.0058 1.6792 0.9527 -0.0962 0.0818  0.0330  130  PRO H O   
3981 C CB  . PRO D 130 ? 0.7228 1.5064 0.6610 -0.1101 0.1190  -0.0395 130  PRO H CB  
3982 C CG  . PRO D 130 ? 0.8893 1.6552 0.7672 -0.1388 0.1170  0.0016  130  PRO H CG  
3983 C CD  . PRO D 130 ? 0.7526 1.4697 0.6160 -0.1194 0.0897  0.0224  130  PRO H CD  
3984 N N   . LEU D 131 ? 0.8687 1.5827 0.8855 -0.0711 0.0788  -0.0264 131  LEU H N   
3985 C CA  . LEU D 131 ? 0.7367 1.4252 0.7666 -0.0770 0.0706  -0.0115 131  LEU H CA  
3986 C C   . LEU D 131 ? 0.8506 1.5921 0.9333 -0.0863 0.0787  -0.0352 131  LEU H C   
3987 O O   . LEU D 131 ? 0.8615 1.6131 0.9926 -0.0691 0.0637  -0.0600 131  LEU H O   
3988 C CB  . LEU D 131 ? 0.6386 1.2676 0.6658 -0.0556 0.0456  -0.0083 131  LEU H CB  
3989 C CG  . LEU D 131 ? 0.6793 1.2581 0.6677 -0.0454 0.0414  0.0139  131  LEU H CG  
3990 C CD1 . LEU D 131 ? 0.7118 1.2393 0.6964 -0.0269 0.0215  0.0093  131  LEU H CD1 
3991 C CD2 . LEU D 131 ? 0.6538 1.2040 0.6171 -0.0619 0.0521  0.0486  131  LEU H CD2 
3992 N N   . ALA D 132 ? 0.9668 1.7420 1.0457 -0.1154 0.1004  -0.0247 132  ALA H N   
3993 C CA  . ALA D 132 ? 1.1058 1.9351 1.2416 -0.1286 0.1116  -0.0430 132  ALA H CA  
3994 C C   . ALA D 132 ? 1.2031 2.0088 1.3354 -0.1507 0.1042  -0.0152 132  ALA H C   
3995 O O   . ALA D 132 ? 1.3517 2.1112 1.4330 -0.1618 0.1019  0.0173  132  ALA H O   
3996 C CB  . ALA D 132 ? 1.2637 2.1616 1.4019 -0.1501 0.1499  -0.0601 132  ALA H CB  
3997 N N   . PRO D 133 ? 1.0661 1.8997 1.2576 -0.1573 0.0977  -0.0268 133  PRO H N   
3998 C CA  . PRO D 133 ? 1.1050 1.9155 1.2919 -0.1826 0.0896  -0.0014 133  PRO H CA  
3999 C C   . PRO D 133 ? 1.3610 2.1977 1.5202 -0.2168 0.1180  0.0200  133  PRO H C   
4000 O O   . PRO D 133 ? 1.3482 2.2532 1.5280 -0.2320 0.1478  0.0054  133  PRO H O   
4001 C CB  . PRO D 133 ? 1.0351 1.8864 1.3047 -0.1842 0.0763  -0.0215 133  PRO H CB  
4002 C CG  . PRO D 133 ? 0.9682 1.8358 1.2802 -0.1515 0.0646  -0.0526 133  PRO H CG  
4003 C CD  . PRO D 133 ? 0.9951 1.8781 1.2688 -0.1414 0.0925  -0.0623 133  PRO H CD  
4004 N N   . GLY D 134 ? 1.5962 2.3750 1.7078 -0.2309 0.1095  0.0545  134  GLY H N   
4005 C CA  . GLY D 134 ? 1.8890 2.6801 1.9724 -0.2663 0.1275  0.0827  134  GLY H CA  
4006 C C   . GLY D 134 ? 2.1531 2.9898 2.2797 -0.2981 0.1363  0.0833  134  GLY H C   
4007 O O   . GLY D 134 ? 2.1650 3.0257 2.3510 -0.2923 0.1264  0.0625  134  GLY H O   
4008 N N   . CYS D 135 ? 2.4074 3.2560 2.5062 -0.3353 0.1521  0.1111  135  CYS H N   
4009 C CA  . CYS D 135 ? 2.4542 3.3452 2.5905 -0.3716 0.1623  0.1173  135  CYS H CA  
4010 C C   . CYS D 135 ? 2.3109 3.1470 2.4652 -0.3724 0.1307  0.1292  135  CYS H C   
4011 O O   . CYS D 135 ? 2.3431 3.0972 2.4560 -0.3605 0.1093  0.1470  135  CYS H O   
4012 C CB  . CYS D 135 ? 2.6381 3.5404 2.7278 -0.4155 0.1812  0.1510  135  CYS H CB  
4013 S SG  . CYS D 135 ? 2.7628 3.7158 2.8941 -0.4672 0.1955  0.1645  135  CYS H SG  
4014 N N   . GLY D 136 ? 2.2201 3.1006 2.4389 -0.3879 0.1288  0.1176  136  GLY H N   
4015 C CA  . GLY D 136 ? 2.2537 3.0845 2.4887 -0.3942 0.0954  0.1263  136  GLY H CA  
4016 C C   . GLY D 136 ? 2.2142 3.0277 2.4837 -0.3637 0.0657  0.1001  136  GLY H C   
4017 O O   . GLY D 136 ? 2.1884 2.9579 2.4655 -0.3733 0.0339  0.1058  136  GLY H O   
4018 N N   . ASP D 137 ? 2.1791 3.0204 2.4652 -0.3306 0.0716  0.0731  137  ASP H N   
4019 C CA  . ASP D 137 ? 2.2085 3.0356 2.5305 -0.3034 0.0396  0.0508  137  ASP H CA  
4020 C C   . ASP D 137 ? 2.1796 3.0991 2.6103 -0.3060 0.0436  0.0272  137  ASP H C   
4021 O O   . ASP D 137 ? 2.2163 3.2102 2.6835 -0.3011 0.0806  0.0076  137  ASP H O   
4022 C CB  . ASP D 137 ? 2.2464 3.0446 2.5298 -0.2655 0.0396  0.0367  137  ASP H CB  
4023 C CG  . ASP D 137 ? 2.3528 3.0604 2.5465 -0.2598 0.0348  0.0580  137  ASP H CG  
4024 O OD1 . ASP D 137 ? 2.4255 3.0722 2.5888 -0.2774 0.0188  0.0761  137  ASP H OD1 
4025 O OD2 . ASP D 137 ? 2.3718 3.0683 2.5300 -0.2381 0.0475  0.0556  137  ASP H OD2 
4026 N N   . THR D 138 ? 1.8645 2.7774 2.3486 -0.3151 0.0059  0.0283  138  THR H N   
4027 C CA  . THR D 138 ? 1.5973 2.5982 2.2053 -0.3165 0.0045  0.0083  138  THR H CA  
4028 C C   . THR D 138 ? 1.5646 2.5860 2.2217 -0.2760 -0.0055 -0.0221 138  THR H C   
4029 O O   . THR D 138 ? 1.5091 2.4625 2.1047 -0.2513 -0.0292 -0.0229 138  THR H O   
4030 C CB  . THR D 138 ? 1.4194 2.4029 2.0743 -0.3409 -0.0424 0.0233  138  THR H CB  
4031 O OG1 . THR D 138 ? 1.2633 2.3396 2.0588 -0.3408 -0.0450 0.0053  138  THR H OG1 
4032 C CG2 . THR D 138 ? 1.4623 2.3465 2.0596 -0.3280 -0.0984 0.0294  138  THR H CG2 
4033 N N   . THR D 139 ? 1.5924 2.7090 2.3668 -0.2701 0.0147  -0.0481 139  THR H N   
4034 C CA  . THR D 139 ? 1.5890 2.7345 2.4330 -0.2319 0.0077  -0.0803 139  THR H CA  
4035 C C   . THR D 139 ? 1.4823 2.6438 2.4429 -0.2293 -0.0459 -0.0814 139  THR H C   
4036 O O   . THR D 139 ? 1.4792 2.7084 2.5423 -0.2507 -0.0405 -0.0814 139  THR H O   
4037 C CB  . THR D 139 ? 1.6167 2.8547 2.5160 -0.2247 0.0723  -0.1144 139  THR H CB  
4038 O OG1 . THR D 139 ? 1.6718 2.9930 2.6614 -0.2548 0.1016  -0.1170 139  THR H OG1 
4039 C CG2 . THR D 139 ? 1.5997 2.8124 2.3742 -0.2297 0.1147  -0.1095 139  THR H CG2 
4040 N N   . GLY D 140 ? 1.3989 2.4972 2.3443 -0.2067 -0.1001 -0.0794 140  GLY H N   
4041 C CA  . GLY D 140 ? 1.3603 2.4640 2.4114 -0.2038 -0.1619 -0.0770 140  GLY H CA  
4042 C C   . GLY D 140 ? 1.2591 2.4286 2.4391 -0.1676 -0.1580 -0.1113 140  GLY H C   
4043 O O   . GLY D 140 ? 1.2606 2.4940 2.4714 -0.1513 -0.0963 -0.1425 140  GLY H O   
4044 N N   . SER D 141 ? 1.1833 2.3308 2.4369 -0.1567 -0.2273 -0.1055 141  SER H N   
4045 C CA  . SER D 141 ? 1.0242 2.2246 2.4131 -0.1198 -0.2338 -0.1363 141  SER H CA  
4046 C C   . SER D 141 ? 0.8107 1.9763 2.1233 -0.0859 -0.2116 -0.1573 141  SER H C   
4047 O O   . SER D 141 ? 0.7156 1.9301 2.1303 -0.0535 -0.1976 -0.1911 141  SER H O   
4048 C CB  . SER D 141 ? 1.0732 2.2474 2.5543 -0.1199 -0.3249 -0.1170 141  SER H CB  
4049 O OG  . SER D 141 ? 1.2229 2.2811 2.5631 -0.1381 -0.3846 -0.0820 141  SER H OG  
4050 N N   . SER D 142 ? 0.7565 1.8393 1.9000 -0.0927 -0.2074 -0.1391 142  SER H N   
4051 C CA  . SER D 142 ? 0.8691 1.9214 1.9360 -0.0648 -0.1829 -0.1560 142  SER H CA  
4052 C C   . SER D 142 ? 0.9044 1.9112 1.8145 -0.0815 -0.1438 -0.1399 142  SER H C   
4053 O O   . SER D 142 ? 1.0828 2.0531 1.9271 -0.1116 -0.1520 -0.1116 142  SER H O   
4054 C CB  . SER D 142 ? 0.9908 1.9684 2.0381 -0.0461 -0.2490 -0.1462 142  SER H CB  
4055 O OG  . SER D 142 ? 1.1174 2.1366 2.3211 -0.0284 -0.2893 -0.1596 142  SER H OG  
4056 N N   . VAL D 143 ? 0.7252 1.7327 1.5817 -0.0620 -0.1035 -0.1582 143  VAL H N   
4057 C CA  . VAL D 143 ? 0.6351 1.6064 1.3595 -0.0738 -0.0665 -0.1438 143  VAL H CA  
4058 C C   . VAL D 143 ? 0.7723 1.6783 1.4177 -0.0503 -0.0805 -0.1431 143  VAL H C   
4059 O O   . VAL D 143 ? 0.7644 1.6878 1.4582 -0.0226 -0.0835 -0.1688 143  VAL H O   
4060 C CB  . VAL D 143 ? 0.7877 1.8335 1.5219 -0.0824 0.0023  -0.1640 143  VAL H CB  
4061 C CG1 . VAL D 143 ? 0.6343 1.6385 1.2376 -0.0973 0.0301  -0.1422 143  VAL H CG1 
4062 C CG2 . VAL D 143 ? 0.9726 2.0902 1.7951 -0.1076 0.0201  -0.1660 143  VAL H CG2 
4063 N N   . THR D 144 ? 0.7488 1.5797 1.2785 -0.0615 -0.0874 -0.1147 144  THR H N   
4064 C CA  . THR D 144 ? 0.7164 1.4858 1.1679 -0.0434 -0.0953 -0.1103 144  THR H CA  
4065 C C   . THR D 144 ? 0.7208 1.4985 1.1051 -0.0450 -0.0468 -0.1086 144  THR H C   
4066 O O   . THR D 144 ? 0.7312 1.5117 1.0764 -0.0680 -0.0222 -0.0912 144  THR H O   
4067 C CB  . THR D 144 ? 0.7582 1.4355 1.1301 -0.0551 -0.1327 -0.0819 144  THR H CB  
4068 O OG1 . THR D 144 ? 1.1450 1.7983 1.4525 -0.0800 -0.1106 -0.0606 144  THR H OG1 
4069 C CG2 . THR D 144 ? 0.7519 1.4150 1.1787 -0.0625 -0.1876 -0.0780 144  THR H CG2 
4070 N N   . LEU D 145 ? 0.7101 1.4874 1.0815 -0.0228 -0.0383 -0.1240 145  LEU H N   
4071 C CA  . LEU D 145 ? 0.6535 1.4370 0.9640 -0.0250 -0.0006 -0.1217 145  LEU H CA  
4072 C C   . LEU D 145 ? 0.7423 1.4623 0.9894 -0.0091 -0.0169 -0.1099 145  LEU H C   
4073 O O   . LEU D 145 ? 0.7984 1.4806 1.0555 0.0060  -0.0520 -0.1117 145  LEU H O   
4074 C CB  . LEU D 145 ? 0.6964 1.5517 1.0552 -0.0189 0.0333  -0.1572 145  LEU H CB  
4075 C CG  . LEU D 145 ? 0.7945 1.7224 1.2319 -0.0340 0.0560  -0.1744 145  LEU H CG  
4076 C CD1 . LEU D 145 ? 0.7712 1.7636 1.2743 -0.0210 0.0868  -0.2202 145  LEU H CD1 
4077 C CD2 . LEU D 145 ? 0.9127 1.8541 1.3005 -0.0685 0.0861  -0.1504 145  LEU H CD2 
4078 N N   . GLY D 146 ? 0.6809 1.3894 0.8654 -0.0152 0.0067  -0.0953 146  GLY H N   
4079 C CA  . GLY D 146 ? 0.6718 1.3217 0.8007 -0.0039 -0.0053 -0.0786 146  GLY H CA  
4080 C C   . GLY D 146 ? 0.7551 1.4211 0.8547 -0.0014 0.0150  -0.0807 146  GLY H C   
4081 O O   . GLY D 146 ? 0.8473 1.5567 0.9416 -0.0172 0.0421  -0.0845 146  GLY H O   
4082 N N   . CYS D 147 ? 0.7587 1.3865 0.8349 0.0146  -0.0004 -0.0765 147  CYS H N   
4083 C CA  . CYS D 147 ? 0.7872 1.4163 0.8296 0.0154  0.0095  -0.0717 147  CYS H CA  
4084 C C   . CYS D 147 ? 0.8105 1.3800 0.8166 0.0206  -0.0029 -0.0413 147  CYS H C   
4085 O O   . CYS D 147 ? 0.8964 1.4294 0.9066 0.0346  -0.0241 -0.0435 147  CYS H O   
4086 C CB  . CYS D 147 ? 1.1282 1.7804 1.1975 0.0320  0.0038  -0.1071 147  CYS H CB  
4087 S SG  . CYS D 147 ? 1.2319 1.9122 1.2647 0.0218  0.0244  -0.1191 147  CYS H SG  
4088 N N   . LEU D 148 ? 0.8792 1.4381 0.8541 0.0075  0.0103  -0.0119 148  LEU H N   
4089 C CA  . LEU D 148 ? 0.7671 1.2747 0.7219 0.0118  0.0062  0.0170  148  LEU H CA  
4090 C C   . LEU D 148 ? 0.8067 1.3147 0.7514 0.0166  0.0001  0.0255  148  LEU H C   
4091 O O   . LEU D 148 ? 0.9715 1.5071 0.9037 0.0031  0.0059  0.0327  148  LEU H O   
4092 C CB  . LEU D 148 ? 0.7904 1.2818 0.7344 -0.0037 0.0216  0.0459  148  LEU H CB  
4093 C CG  . LEU D 148 ? 0.8106 1.2552 0.7482 0.0008  0.0253  0.0753  148  LEU H CG  
4094 C CD1 . LEU D 148 ? 0.8655 1.2617 0.7964 0.0127  0.0216  0.0682  148  LEU H CD1 
4095 C CD2 . LEU D 148 ? 0.7313 1.1635 0.6698 -0.0140 0.0398  0.1013  148  LEU H CD2 
4096 N N   . VAL D 149 ? 0.8271 1.3023 0.7731 0.0315  -0.0137 0.0266  149  VAL H N   
4097 C CA  . VAL D 149 ? 0.8384 1.3094 0.7801 0.0360  -0.0243 0.0359  149  VAL H CA  
4098 C C   . VAL D 149 ? 0.9416 1.3762 0.8861 0.0358  -0.0183 0.0712  149  VAL H C   
4099 O O   . VAL D 149 ? 1.1451 1.5421 1.0902 0.0423  -0.0136 0.0743  149  VAL H O   
4100 C CB  . VAL D 149 ? 0.6924 1.1545 0.6421 0.0519  -0.0448 0.0115  149  VAL H CB  
4101 C CG1 . VAL D 149 ? 0.7312 1.1888 0.6756 0.0533  -0.0576 0.0212  149  VAL H CG1 
4102 C CG2 . VAL D 149 ? 0.6119 1.1096 0.5777 0.0558  -0.0475 -0.0271 149  VAL H CG2 
4103 N N   . LYS D 150 ? 0.7910 1.2349 0.7389 0.0263  -0.0186 0.0977  150  LYS H N   
4104 C CA  . LYS D 150 ? 0.7465 1.1632 0.7166 0.0260  -0.0094 0.1326  150  LYS H CA  
4105 C C   . LYS D 150 ? 0.8714 1.2899 0.8589 0.0255  -0.0261 0.1556  150  LYS H C   
4106 O O   . LYS D 150 ? 0.8596 1.3039 0.8311 0.0141  -0.0436 0.1566  150  LYS H O   
4107 C CB  . LYS D 150 ? 0.7796 1.2028 0.7536 0.0117  0.0029  0.1524  150  LYS H CB  
4108 C CG  . LYS D 150 ? 0.9628 1.3478 0.9649 0.0162  0.0222  0.1737  150  LYS H CG  
4109 C CD  . LYS D 150 ? 1.2222 1.6115 1.2290 0.0013  0.0296  0.1915  150  LYS H CD  
4110 C CE  . LYS D 150 ? 1.4134 1.7604 1.4548 0.0069  0.0510  0.2094  150  LYS H CE  
4111 N NZ  . LYS D 150 ? 1.6014 1.9500 1.6527 -0.0087 0.0523  0.2309  150  LYS H NZ  
4112 N N   . GLY D 151 ? 1.1098 1.4998 1.1287 0.0352  -0.0196 0.1731  151  GLY H N   
4113 C CA  . GLY D 151 ? 1.1021 1.4941 1.1559 0.0335  -0.0346 0.2030  151  GLY H CA  
4114 C C   . GLY D 151 ? 1.1414 1.5468 1.1777 0.0317  -0.0632 0.1926  151  GLY H C   
4115 O O   . GLY D 151 ? 1.3710 1.7956 1.3999 0.0173  -0.0859 0.2065  151  GLY H O   
4116 N N   . TYR D 152 ? 1.0386 1.4287 1.0638 0.0433  -0.0650 0.1690  152  TYR H N   
4117 C CA  . TYR D 152 ? 0.9624 1.3573 0.9749 0.0435  -0.0926 0.1564  152  TYR H CA  
4118 C C   . TYR D 152 ? 1.1229 1.4906 1.1590 0.0521  -0.0943 0.1647  152  TYR H C   
4119 O O   . TYR D 152 ? 1.3551 1.6987 1.4018 0.0579  -0.0704 0.1684  152  TYR H O   
4120 C CB  . TYR D 152 ? 0.9073 1.3125 0.8824 0.0477  -0.0991 0.1131  152  TYR H CB  
4121 C CG  . TYR D 152 ? 0.9095 1.2928 0.8806 0.0607  -0.0908 0.0911  152  TYR H CG  
4122 C CD1 . TYR D 152 ? 1.0144 1.3982 0.9777 0.0611  -0.0714 0.0818  152  TYR H CD1 
4123 C CD2 . TYR D 152 ? 0.8871 1.2461 0.8593 0.0688  -0.1077 0.0818  152  TYR H CD2 
4124 C CE1 . TYR D 152 ? 1.0639 1.4236 1.0187 0.0679  -0.0715 0.0649  152  TYR H CE1 
4125 C CE2 . TYR D 152 ? 0.9061 1.2401 0.8690 0.0754  -0.1077 0.0664  152  TYR H CE2 
4126 C CZ  . TYR D 152 ? 0.9036 1.2376 0.8567 0.0744  -0.0909 0.0583  152  TYR H CZ  
4127 O OH  . TYR D 152 ? 0.7542 1.0589 0.6937 0.0763  -0.0983 0.0462  152  TYR H OH  
4128 N N   . PHE D 153 ? 1.1444 1.5134 1.1823 0.0493  -0.1222 0.1659  153  PHE H N   
4129 C CA  . PHE D 153 ? 1.1665 1.5120 1.2251 0.0532  -0.1286 0.1748  153  PHE H CA  
4130 C C   . PHE D 153 ? 1.2604 1.6080 1.3067 0.0487  -0.1659 0.1653  153  PHE H C   
4131 O O   . PHE D 153 ? 1.3376 1.7042 1.3749 0.0374  -0.1848 0.1702  153  PHE H O   
4132 C CB  . PHE D 153 ? 1.1069 1.4502 1.2230 0.0502  -0.1126 0.2148  153  PHE H CB  
4133 C CG  . PHE D 153 ? 1.0355 1.3552 1.1744 0.0516  -0.1061 0.2238  153  PHE H CG  
4134 C CD1 . PHE D 153 ? 1.0299 1.3209 1.1540 0.0553  -0.0744 0.2141  153  PHE H CD1 
4135 C CD2 . PHE D 153 ? 1.0609 1.3845 1.2311 0.0449  -0.1320 0.2433  153  PHE H CD2 
4136 C CE1 . PHE D 153 ? 1.1415 1.4088 1.2775 0.0509  -0.0648 0.2232  153  PHE H CE1 
4137 C CE2 . PHE D 153 ? 1.1818 1.4855 1.3742 0.0428  -0.1236 0.2534  153  PHE H CE2 
4138 C CZ  . PHE D 153 ? 1.1870 1.4628 1.3603 0.0451  -0.0880 0.2432  153  PHE H CZ  
4139 N N   . PRO D 154 ? 1.2856 1.6092 1.3261 0.0540  -0.1796 0.1521  154  PRO H N   
4140 C CA  . PRO D 154 ? 1.2574 1.5515 1.2929 0.0606  -0.1644 0.1466  154  PRO H CA  
4141 C C   . PRO D 154 ? 1.2489 1.5377 1.2510 0.0692  -0.1604 0.1130  154  PRO H C   
4142 O O   . PRO D 154 ? 1.2791 1.5939 1.2698 0.0715  -0.1584 0.0946  154  PRO H O   
4143 C CB  . PRO D 154 ? 1.2424 1.5135 1.2813 0.0580  -0.1932 0.1477  154  PRO H CB  
4144 C CG  . PRO D 154 ? 1.2701 1.5591 1.3298 0.0494  -0.2162 0.1639  154  PRO H CG  
4145 C CD  . PRO D 154 ? 1.3536 1.6714 1.3944 0.0479  -0.2155 0.1514  154  PRO H CD  
4146 N N   . GLU D 155 ? 1.1406 1.3956 1.1285 0.0706  -0.1624 0.1072  155  GLU H N   
4147 C CA  . GLU D 155 ? 1.2447 1.4876 1.2083 0.0758  -0.1635 0.0829  155  GLU H CA  
4148 C C   . GLU D 155 ? 1.4662 1.7234 1.4329 0.0865  -0.1938 0.0487  155  GLU H C   
4149 O O   . GLU D 155 ? 1.5302 1.8063 1.5061 0.0883  -0.2075 0.0401  155  GLU H O   
4150 C CB  . GLU D 155 ? 1.2524 1.4477 1.1938 0.0673  -0.1636 0.0931  155  GLU H CB  
4151 C CG  . GLU D 155 ? 1.2882 1.4610 1.1994 0.0655  -0.1662 0.0778  155  GLU H CG  
4152 C CD  . GLU D 155 ? 1.2435 1.4387 1.1519 0.0670  -0.1379 0.0718  155  GLU H CD  
4153 O OE1 . GLU D 155 ? 1.3759 1.5793 1.2916 0.0631  -0.1043 0.0894  155  GLU H OE1 
4154 O OE2 . GLU D 155 ? 1.1677 1.3727 1.0742 0.0719  -0.1504 0.0505  155  GLU H OE2 
4155 N N   . SER D 156 ? 1.5873 1.8336 1.5485 0.0923  -0.2038 0.0279  156  SER H N   
4156 C CA  . SER D 156 ? 1.5975 1.8547 1.5780 0.1053  -0.2296 -0.0075 156  SER H CA  
4157 C C   . SER D 156 ? 1.4371 1.7430 1.4285 0.1105  -0.2142 -0.0325 156  SER H C   
4158 O O   . SER D 156 ? 1.4972 1.8135 1.4965 0.1148  -0.2265 -0.0526 156  SER H O   
4159 C CB  . SER D 156 ? 1.7831 2.0158 1.7746 0.1091  -0.2644 -0.0126 156  SER H CB  
4160 O OG  . SER D 156 ? 1.8596 2.1084 1.8500 0.1050  -0.2606 -0.0067 156  SER H OG  
4161 N N   . VAL D 157 ? 1.2923 1.6246 1.2784 0.1065  -0.1867 -0.0317 157  VAL H N   
4162 C CA  . VAL D 157 ? 1.1358 1.5132 1.1313 0.1087  -0.1720 -0.0603 157  VAL H CA  
4163 C C   . VAL D 157 ? 0.9867 1.3718 1.0140 0.1197  -0.1800 -0.0885 157  VAL H C   
4164 O O   . VAL D 157 ? 0.9840 1.3443 1.0115 0.1186  -0.1885 -0.0755 157  VAL H O   
4165 C CB  . VAL D 157 ? 1.2067 1.6098 1.1833 0.0952  -0.1404 -0.0411 157  VAL H CB  
4166 C CG1 . VAL D 157 ? 1.3020 1.7041 1.2614 0.0838  -0.1379 -0.0131 157  VAL H CG1 
4167 C CG2 . VAL D 157 ? 1.1804 1.5648 1.1523 0.0918  -0.1284 -0.0210 157  VAL H CG2 
4168 N N   . THR D 158 ? 1.0730 1.4917 1.1287 0.1282  -0.1766 -0.1273 158  THR H N   
4169 C CA  . THR D 158 ? 1.1030 1.5370 1.2105 0.1406  -0.1846 -0.1560 158  THR H CA  
4170 C C   . THR D 158 ? 1.0160 1.5048 1.1353 0.1349  -0.1492 -0.1763 158  THR H C   
4171 O O   . THR D 158 ? 1.1432 1.6616 1.2515 0.1303  -0.1271 -0.1986 158  THR H O   
4172 C CB  . THR D 158 ? 1.1551 1.5798 1.3084 0.1590  -0.2112 -0.1899 158  THR H CB  
4173 O OG1 . THR D 158 ? 1.3851 1.8386 1.5339 0.1592  -0.1894 -0.2224 158  THR H OG1 
4174 C CG2 . THR D 158 ? 1.0951 1.4646 1.2303 0.1599  -0.2465 -0.1662 158  THR H CG2 
4175 N N   . VAL D 159 ? 0.9539 1.4534 1.0899 0.1312  -0.1443 -0.1682 159  VAL H N   
4176 C CA  . VAL D 159 ? 0.8938 1.4451 1.0438 0.1224  -0.1112 -0.1826 159  VAL H CA  
4177 C C   . VAL D 159 ? 0.9182 1.4999 1.1500 0.1381  -0.1181 -0.2219 159  VAL H C   
4178 O O   . VAL D 159 ? 1.0822 1.6517 1.3548 0.1438  -0.1442 -0.2158 159  VAL H O   
4179 C CB  . VAL D 159 ? 0.7965 1.3408 0.9191 0.1065  -0.1013 -0.1491 159  VAL H CB  
4180 C CG1 . VAL D 159 ? 0.7511 1.3493 0.8895 0.0943  -0.0688 -0.1620 159  VAL H CG1 
4181 C CG2 . VAL D 159 ? 0.7251 1.2373 0.7852 0.0949  -0.0946 -0.1115 159  VAL H CG2 
4182 N N   . THR D 160 ? 0.9679 1.5874 1.2259 0.1436  -0.0951 -0.2629 160  THR H N   
4183 C CA  . THR D 160 ? 1.0290 1.6819 1.3811 0.1618  -0.0952 -0.3067 160  THR H CA  
4184 C C   . THR D 160 ? 0.9972 1.7133 1.3762 0.1492  -0.0523 -0.3241 160  THR H C   
4185 O O   . THR D 160 ? 1.1287 1.8714 1.4553 0.1300  -0.0119 -0.3306 160  THR H O   
4186 C CB  . THR D 160 ? 1.1060 1.7568 1.4775 0.1769  -0.0920 -0.3492 160  THR H CB  
4187 O OG1 . THR D 160 ? 1.2250 1.8159 1.5676 0.1848  -0.1330 -0.3287 160  THR H OG1 
4188 C CG2 . THR D 160 ? 1.1266 1.8085 1.6148 0.2003  -0.0931 -0.3959 160  THR H CG2 
4189 N N   . TRP D 161 ? 0.8393 1.5774 1.2981 0.1562  -0.0644 -0.3277 161  TRP H N   
4190 C CA  . TRP D 161 ? 0.8521 1.6550 1.3569 0.1450  -0.0260 -0.3457 161  TRP H CA  
4191 C C   . TRP D 161 ? 1.0690 1.9167 1.6830 0.1661  -0.0099 -0.4027 161  TRP H C   
4192 O O   . TRP D 161 ? 0.9996 1.8681 1.7222 0.1812  -0.0303 -0.4136 161  TRP H O   
4193 C CB  . TRP D 161 ? 0.7930 1.5921 1.3204 0.1362  -0.0503 -0.3121 161  TRP H CB  
4194 C CG  . TRP D 161 ? 0.7999 1.5576 1.2245 0.1150  -0.0543 -0.2640 161  TRP H CG  
4195 C CD1 . TRP D 161 ? 0.8434 1.5351 1.2062 0.1166  -0.0864 -0.2318 161  TRP H CD1 
4196 C CD2 . TRP D 161 ? 0.7965 1.5752 1.1739 0.0885  -0.0226 -0.2438 161  TRP H CD2 
4197 N NE1 . TRP D 161 ? 0.7902 1.4617 1.0772 0.0953  -0.0735 -0.1958 161  TRP H NE1 
4198 C CE2 . TRP D 161 ? 0.7230 1.4448 1.0178 0.0784  -0.0377 -0.2013 161  TRP H CE2 
4199 C CE3 . TRP D 161 ? 0.7762 1.6155 1.1765 0.0709  0.0178  -0.2572 161  TRP H CE3 
4200 C CZ2 . TRP D 161 ? 0.6387 1.3596 0.8797 0.0545  -0.0168 -0.1727 161  TRP H CZ2 
4201 C CZ3 . TRP D 161 ? 0.7698 1.6069 1.1080 0.0439  0.0354  -0.2252 161  TRP H CZ3 
4202 C CH2 . TRP D 161 ? 0.6909 1.4679 0.9531 0.0374  0.0166  -0.1836 161  TRP H CH2 
4203 N N   . ASN D 162 ? 1.4479 2.3082 2.0346 0.1659  0.0270  -0.4403 162  ASN H N   
4204 C CA  . ASN D 162 ? 1.5753 2.4633 2.2610 0.1899  0.0428  -0.5005 162  ASN H CA  
4205 C C   . ASN D 162 ? 1.7231 2.6899 2.4938 0.1844  0.0946  -0.5376 162  ASN H C   
4206 O O   . ASN D 162 ? 1.7500 2.7473 2.6549 0.2096  0.0935  -0.5752 162  ASN H O   
4207 C CB  . ASN D 162 ? 1.5909 2.4565 2.2077 0.1882  0.0651  -0.5314 162  ASN H CB  
4208 C CG  . ASN D 162 ? 1.5592 2.4199 2.2729 0.2208  0.0591  -0.5861 162  ASN H CG  
4209 O OD1 . ASN D 162 ? 1.5170 2.3647 2.3328 0.2482  0.0136  -0.5833 162  ASN H OD1 
4210 N ND2 . ASN D 162 ? 1.5843 2.4507 2.2647 0.2157  0.1029  -0.6359 162  ASN H ND2 
4211 N N   . SER D 163 ? 1.7708 2.7717 2.4724 0.1508  0.1397  -0.5266 163  SER H N   
4212 C CA  . SER D 163 ? 1.7839 2.8622 2.5500 0.1378  0.1988  -0.5621 163  SER H CA  
4213 C C   . SER D 163 ? 1.6389 2.7460 2.4686 0.1315  0.1798  -0.5277 163  SER H C   
4214 O O   . SER D 163 ? 1.5257 2.6086 2.2723 0.1091  0.1624  -0.4757 163  SER H O   
4215 C CB  . SER D 163 ? 1.8214 2.9178 2.4682 0.0979  0.2580  -0.5686 163  SER H CB  
4216 O OG  . SER D 163 ? 1.8690 2.9424 2.4607 0.0992  0.2793  -0.6080 163  SER H OG  
4217 N N   . GLY D 164 ? 1.8007 2.9575 2.7826 0.1508  0.1821  -0.5573 164  GLY H N   
4218 C CA  . GLY D 164 ? 1.9332 3.1274 2.9887 0.1408  0.1689  -0.5311 164  GLY H CA  
4219 C C   . GLY D 164 ? 2.0678 3.2243 3.1954 0.1619  0.0892  -0.4981 164  GLY H C   
4220 O O   . GLY D 164 ? 1.9912 3.1899 3.2509 0.1687  0.0740  -0.5017 164  GLY H O   
4221 N N   . SER D 165 ? 2.1930 3.2697 3.2350 0.1689  0.0367  -0.4640 165  SER H N   
4222 C CA  . SER D 165 ? 2.3433 3.3715 3.4223 0.1798  -0.0408 -0.4267 165  SER H CA  
4223 C C   . SER D 165 ? 2.5775 3.5598 3.6989 0.2119  -0.0858 -0.4405 165  SER H C   
4224 O O   . SER D 165 ? 2.6177 3.6064 3.8687 0.2322  -0.1289 -0.4471 165  SER H O   
4225 C CB  . SER D 165 ? 2.1973 3.1654 3.1381 0.1543  -0.0662 -0.3691 165  SER H CB  
4226 O OG  . SER D 165 ? 2.0812 3.0069 2.8974 0.1506  -0.0501 -0.3625 165  SER H OG  
4227 N N   . LEU D 166 ? 2.8190 3.7545 3.8405 0.2158  -0.0804 -0.4429 166  LEU H N   
4228 C CA  . LEU D 166 ? 2.8312 3.7132 3.8749 0.2421  -0.1261 -0.4499 166  LEU H CA  
4229 C C   . LEU D 166 ? 2.8023 3.6293 3.8660 0.2437  -0.2069 -0.4040 166  LEU H C   
4230 O O   . LEU D 166 ? 2.8284 3.6537 4.0138 0.2644  -0.2526 -0.4123 166  LEU H O   
4231 C CB  . LEU D 166 ? 2.8191 3.7421 3.9970 0.2721  -0.1046 -0.5125 166  LEU H CB  
4232 C CG  . LEU D 166 ? 2.8326 3.6999 4.0192 0.2979  -0.1386 -0.5288 166  LEU H CG  
4233 C CD1 . LEU D 166 ? 2.8062 3.6282 3.8342 0.2831  -0.1210 -0.5181 166  LEU H CD1 
4234 C CD2 . LEU D 166 ? 2.8579 3.7674 4.1838 0.3278  -0.1084 -0.5976 166  LEU H CD2 
4235 N N   . SER D 167 ? 2.5244 3.3041 3.4649 0.2187  -0.2235 -0.3545 167  SER H N   
4236 C CA  . SER D 167 ? 2.1971 2.9106 3.1126 0.2100  -0.2940 -0.3077 167  SER H CA  
4237 C C   . SER D 167 ? 2.1093 2.8475 3.1303 0.2057  -0.3311 -0.2975 167  SER H C   
4238 O O   . SER D 167 ? 2.0744 2.7770 3.1569 0.2122  -0.3988 -0.2816 167  SER H O   
4239 C CB  . SER D 167 ? 1.9566 2.6099 2.8765 0.2282  -0.3430 -0.3055 167  SER H CB  
4240 O OG  . SER D 167 ? 1.8743 2.4590 2.7531 0.2127  -0.4091 -0.2583 167  SER H OG  
4241 N N   . SER D 168 ? 2.1323 2.9306 3.1745 0.1912  -0.2899 -0.3036 168  SER H N   
4242 C CA  . SER D 168 ? 2.0118 2.8317 3.1404 0.1798  -0.3258 -0.2866 168  SER H CA  
4243 C C   . SER D 168 ? 1.9086 2.6530 2.9307 0.1500  -0.3764 -0.2325 168  SER H C   
4244 O O   . SER D 168 ? 1.9750 2.6757 3.0320 0.1459  -0.4485 -0.2079 168  SER H O   
4245 C CB  . SER D 168 ? 1.9609 2.8657 3.1360 0.1687  -0.2642 -0.3072 168  SER H CB  
4246 O OG  . SER D 168 ? 1.9683 2.9436 3.2498 0.1929  -0.2150 -0.3616 168  SER H OG  
4247 N N   . SER D 169 ? 1.6569 2.3812 2.5470 0.1268  -0.3396 -0.2138 169  SER H N   
4248 C CA  . SER D 169 ? 1.4332 2.0771 2.2027 0.0988  -0.3740 -0.1693 169  SER H CA  
4249 C C   . SER D 169 ? 1.1058 1.7247 1.7435 0.0930  -0.3234 -0.1639 169  SER H C   
4250 O O   . SER D 169 ? 1.1577 1.8038 1.7534 0.0789  -0.2761 -0.1626 169  SER H O   
4251 C CB  . SER D 169 ? 1.5307 2.1822 2.3098 0.0704  -0.3892 -0.1483 169  SER H CB  
4252 O OG  . SER D 169 ? 1.6181 2.1840 2.2754 0.0412  -0.4208 -0.1104 169  SER H OG  
4253 N N   . VAL D 170 ? 0.9882 1.8348 1.0062 0.1418  -0.1853 0.0385  170  VAL H N   
4254 C CA  . VAL D 170 ? 0.9082 1.6739 0.8964 0.1324  -0.1733 0.0199  170  VAL H CA  
4255 C C   . VAL D 170 ? 0.9027 1.6351 0.8604 0.1094  -0.1769 0.0408  170  VAL H C   
4256 O O   . VAL D 170 ? 1.0959 1.8276 1.0700 0.1189  -0.1905 0.0702  170  VAL H O   
4257 C CB  . VAL D 170 ? 0.9384 1.6520 0.9599 0.1688  -0.1726 0.0072  170  VAL H CB  
4258 C CG1 . VAL D 170 ? 0.9204 1.5653 0.9154 0.1556  -0.1644 -0.0096 170  VAL H CG1 
4259 C CG2 . VAL D 170 ? 0.8242 1.5706 0.8694 0.1915  -0.1644 -0.0173 170  VAL H CG2 
4260 N N   . HIS D 171 ? 0.8227 1.5261 0.7330 0.0810  -0.1634 0.0265  171  HIS H N   
4261 C CA  . HIS D 171 ? 0.8761 1.5462 0.7558 0.0612  -0.1600 0.0397  171  HIS H CA  
4262 C C   . HIS D 171 ? 0.8660 1.4799 0.7439 0.0683  -0.1489 0.0202  171  HIS H C   
4263 O O   . HIS D 171 ? 0.8688 1.4671 0.7200 0.0630  -0.1374 -0.0038 171  HIS H O   
4264 C CB  . HIS D 171 ? 0.9217 1.6101 0.7437 0.0235  -0.1524 0.0398  171  HIS H CB  
4265 C CG  . HIS D 171 ? 1.0125 1.7702 0.8365 0.0105  -0.1662 0.0562  171  HIS H CG  
4266 N ND1 . HIS D 171 ? 1.1023 1.8889 0.9351 0.0092  -0.1831 0.0891  171  HIS H ND1 
4267 C CD2 . HIS D 171 ? 1.1057 1.9164 0.9246 -0.0037 -0.1667 0.0458  171  HIS H CD2 
4268 C CE1 . HIS D 171 ? 1.1388 1.9990 0.9754 -0.0026 -0.1961 0.0984  171  HIS H CE1 
4269 N NE2 . HIS D 171 ? 1.1246 2.0040 0.9553 -0.0124 -0.1854 0.0715  171  HIS H NE2 
4270 N N   . THR D 172 ? 1.0584 1.6434 0.9639 0.0793  -0.1537 0.0317  172  THR H N   
4271 C CA  . THR D 172 ? 1.0453 1.5910 0.9566 0.0823  -0.1464 0.0160  172  THR H CA  
4272 C C   . THR D 172 ? 1.0408 1.5792 0.9272 0.0615  -0.1355 0.0270  172  THR H C   
4273 O O   . THR D 172 ? 1.2230 1.7598 1.1176 0.0533  -0.1388 0.0517  172  THR H O   
4274 C CB  . THR D 172 ? 0.9362 1.4548 0.8915 0.1008  -0.1567 0.0182  172  THR H CB  
4275 O OG1 . THR D 172 ? 0.8950 1.4193 0.8692 0.1237  -0.1623 0.0036  172  THR H OG1 
4276 C CG2 . THR D 172 ? 0.9922 1.4828 0.9555 0.0971  -0.1519 0.0018  172  THR H CG2 
4277 N N   . PHE D 173 ? 0.8253 1.3564 0.6775 0.0545  -0.1209 0.0094  173  PHE H N   
4278 C CA  . PHE D 173 ? 0.8404 1.3669 0.6664 0.0393  -0.1056 0.0160  173  PHE H CA  
4279 C C   . PHE D 173 ? 0.8358 1.3552 0.6981 0.0455  -0.1024 0.0146  173  PHE H C   
4280 O O   . PHE D 173 ? 0.8209 1.3326 0.7069 0.0608  -0.1072 -0.0034 173  PHE H O   
4281 C CB  . PHE D 173 ? 1.0754 1.5881 0.8467 0.0340  -0.0892 -0.0024 173  PHE H CB  
4282 C CG  . PHE D 173 ? 0.9725 1.4935 0.7064 0.0198  -0.0921 -0.0047 173  PHE H CG  
4283 C CD1 . PHE D 173 ? 0.8864 1.4227 0.5839 -0.0060 -0.0901 0.0095  173  PHE H CD1 
4284 C CD2 . PHE D 173 ? 1.0267 1.5459 0.7608 0.0281  -0.0970 -0.0212 173  PHE H CD2 
4285 C CE1 . PHE D 173 ? 0.8979 1.4530 0.5644 -0.0251 -0.0947 0.0070  173  PHE H CE1 
4286 C CE2 . PHE D 173 ? 1.0386 1.5758 0.7422 0.0095  -0.0982 -0.0234 173  PHE H CE2 
4287 C CZ  . PHE D 173 ? 1.1145 1.6725 0.7867 -0.0181 -0.0980 -0.0094 173  PHE H CZ  
4288 N N   . PRO D 174 ? 0.8529 1.3795 0.7189 0.0304  -0.0948 0.0334  174  PRO H N   
4289 C CA  . PRO D 174 ? 0.8525 1.3835 0.7577 0.0288  -0.0910 0.0338  174  PRO H CA  
4290 C C   . PRO D 174 ? 0.8709 1.4121 0.7787 0.0420  -0.0788 0.0104  174  PRO H C   
4291 O O   . PRO D 174 ? 1.0153 1.5507 0.8825 0.0500  -0.0660 -0.0015 174  PRO H O   
4292 C CB  . PRO D 174 ? 0.8815 1.4225 0.7738 0.0049  -0.0792 0.0592  174  PRO H CB  
4293 C CG  . PRO D 174 ? 0.9264 1.4617 0.7886 -0.0020 -0.0900 0.0788  174  PRO H CG  
4294 C CD  . PRO D 174 ? 0.8791 1.4141 0.7156 0.0103  -0.0928 0.0585  174  PRO H CD  
4295 N N   . ALA D 175 ? 0.8325 1.3874 0.7866 0.0441  -0.0838 0.0046  175  ALA H N   
4296 C CA  . ALA D 175 ? 0.9812 1.5560 0.9465 0.0619  -0.0781 -0.0154 175  ALA H CA  
4297 C C   . ALA D 175 ? 1.0791 1.6841 1.0387 0.0602  -0.0523 -0.0117 175  ALA H C   
4298 O O   . ALA D 175 ? 1.1050 1.7271 1.0734 0.0375  -0.0410 0.0056  175  ALA H O   
4299 C CB  . ALA D 175 ? 0.8130 1.4030 0.8307 0.0613  -0.0953 -0.0242 175  ALA H CB  
4300 N N   . LEU D 176 ? 0.9805 1.5877 0.9202 0.0861  -0.0414 -0.0279 176  LEU H N   
4301 C CA  . LEU D 176 ? 0.9067 1.5426 0.8428 0.0962  -0.0142 -0.0301 176  LEU H CA  
4302 C C   . LEU D 176 ? 0.8527 1.5315 0.8356 0.1231  -0.0190 -0.0428 176  LEU H C   
4303 O O   . LEU D 176 ? 0.8441 1.5064 0.8246 0.1438  -0.0382 -0.0545 176  LEU H O   
4304 C CB  . LEU D 176 ? 0.9900 1.5823 0.8524 0.1087  0.0057  -0.0378 176  LEU H CB  
4305 C CG  . LEU D 176 ? 1.0325 1.5887 0.8418 0.0809  0.0070  -0.0273 176  LEU H CG  
4306 C CD1 . LEU D 176 ? 1.1334 1.6460 0.8657 0.0877  0.0295  -0.0391 176  LEU H CD1 
4307 C CD2 . LEU D 176 ? 1.0557 1.6401 0.8824 0.0502  0.0132  -0.0058 176  LEU H CD2 
4308 N N   . LEU D 177 ? 0.9084 1.6486 0.9334 0.1218  -0.0019 -0.0395 177  LEU H N   
4309 C CA  . LEU D 177 ? 0.9811 1.7857 1.0645 0.1443  -0.0084 -0.0486 177  LEU H CA  
4310 C C   . LEU D 177 ? 1.2818 2.0886 1.3399 0.1912  0.0131  -0.0594 177  LEU H C   
4311 O O   . LEU D 177 ? 1.3518 2.1730 1.3962 0.1960  0.0464  -0.0584 177  LEU H O   
4312 C CB  . LEU D 177 ? 0.8929 1.7743 1.0429 0.1138  -0.0012 -0.0389 177  LEU H CB  
4313 C CG  . LEU D 177 ? 0.9452 1.9118 1.1694 0.1242  -0.0149 -0.0466 177  LEU H CG  
4314 C CD1 . LEU D 177 ? 0.9830 1.9257 1.2163 0.1207  -0.0545 -0.0545 177  LEU H CD1 
4315 C CD2 . LEU D 177 ? 0.9790 2.0244 1.2644 0.0844  -0.0024 -0.0364 177  LEU H CD2 
4316 N N   . GLN D 178 ? 1.3946 2.1804 1.4401 0.2269  -0.0046 -0.0697 178  GLN H N   
4317 C CA  . GLN D 178 ? 1.5514 2.3284 1.5709 0.2790  0.0117  -0.0784 178  GLN H CA  
4318 C C   . GLN D 178 ? 1.5543 2.3931 1.6295 0.3120  -0.0126 -0.0818 178  GLN H C   
4319 O O   . GLN D 178 ? 1.4919 2.3247 1.5771 0.3021  -0.0465 -0.0831 178  GLN H O   
4320 C CB  . GLN D 178 ? 1.7613 2.4307 1.6863 0.2921  0.0147  -0.0843 178  GLN H CB  
4321 C CG  . GLN D 178 ? 1.8529 2.4784 1.7579 0.2775  -0.0182 -0.0852 178  GLN H CG  
4322 C CD  . GLN D 178 ? 1.9742 2.5035 1.7885 0.2915  -0.0137 -0.0912 178  GLN H CD  
4323 O OE1 . GLN D 178 ? 2.1045 2.5921 1.8691 0.3187  0.0108  -0.0958 178  GLN H OE1 
4324 N NE2 . GLN D 178 ? 1.9085 2.3995 1.6978 0.2715  -0.0351 -0.0924 178  GLN H NE2 
4325 N N   . SER D 179 ? 1.7121 2.6154 1.8237 0.3521  0.0050  -0.0836 179  SER H N   
4326 C CA  . SER D 179 ? 1.7595 2.7377 1.9283 0.3907  -0.0184 -0.0846 179  SER H CA  
4327 C C   . SER D 179 ? 1.6250 2.6813 1.8682 0.3491  -0.0517 -0.0822 179  SER H C   
4328 O O   . SER D 179 ? 1.6519 2.7422 1.9208 0.3648  -0.0856 -0.0840 179  SER H O   
4329 C CB  . SER D 179 ? 1.8753 2.7759 1.9811 0.4347  -0.0372 -0.0871 179  SER H CB  
4330 O OG  . SER D 179 ? 1.8915 2.7248 1.9565 0.4004  -0.0636 -0.0881 179  SER H OG  
4331 N N   . GLY D 180 ? 1.2919 2.3712 1.5634 0.2938  -0.0426 -0.0778 180  GLY H N   
4332 C CA  . GLY D 180 ? 1.1292 2.2670 1.4622 0.2476  -0.0700 -0.0767 180  GLY H CA  
4333 C C   . GLY D 180 ? 1.0316 2.0928 1.3284 0.2191  -0.1009 -0.0804 180  GLY H C   
4334 O O   . GLY D 180 ? 1.0766 2.1739 1.4154 0.1851  -0.1268 -0.0836 180  GLY H O   
4335 N N   . LEU D 181 ? 0.9501 1.9084 1.1696 0.2299  -0.0975 -0.0817 181  LEU H N   
4336 C CA  . LEU D 181 ? 0.8609 1.7509 1.0463 0.2070  -0.1219 -0.0865 181  LEU H CA  
4337 C C   . LEU D 181 ? 0.8405 1.6488 0.9674 0.1910  -0.1035 -0.0809 181  LEU H C   
4338 O O   . LEU D 181 ? 1.0214 1.8032 1.1088 0.2082  -0.0772 -0.0774 181  LEU H O   
4339 C CB  . LEU D 181 ? 0.9585 1.8191 1.1090 0.2411  -0.1459 -0.0955 181  LEU H CB  
4340 C CG  . LEU D 181 ? 0.9144 1.8552 1.1165 0.2559  -0.1741 -0.1002 181  LEU H CG  
4341 C CD1 . LEU D 181 ? 1.0228 1.9202 1.1724 0.2924  -0.1954 -0.1048 181  LEU H CD1 
4342 C CD2 . LEU D 181 ? 0.8832 1.8580 1.1318 0.2056  -0.1963 -0.1063 181  LEU H CD2 
4343 N N   . TYR D 182 ? 0.8044 1.5735 0.9244 0.1591  -0.1180 -0.0811 182  TYR H N   
4344 C CA  . TYR D 182 ? 0.9236 1.6322 1.0004 0.1417  -0.1054 -0.0729 182  TYR H CA  
4345 C C   . TYR D 182 ? 0.9419 1.5858 0.9545 0.1604  -0.1091 -0.0804 182  TYR H C   
4346 O O   . TYR D 182 ? 0.9358 1.5682 0.9375 0.1763  -0.1276 -0.0919 182  TYR H O   
4347 C CB  . TYR D 182 ? 0.9469 1.6432 1.0481 0.1041  -0.1177 -0.0672 182  TYR H CB  
4348 C CG  . TYR D 182 ? 0.9347 1.6765 1.0818 0.0740  -0.1069 -0.0539 182  TYR H CG  
4349 C CD1 . TYR D 182 ? 0.9048 1.6450 1.0356 0.0624  -0.0816 -0.0372 182  TYR H CD1 
4350 C CD2 . TYR D 182 ? 0.9386 1.7254 1.1402 0.0521  -0.1215 -0.0582 182  TYR H CD2 
4351 C CE1 . TYR D 182 ? 0.8563 1.6372 1.0230 0.0312  -0.0691 -0.0235 182  TYR H CE1 
4352 C CE2 . TYR D 182 ? 0.9694 1.7982 1.2101 0.0178  -0.1094 -0.0453 182  TYR H CE2 
4353 C CZ  . TYR D 182 ? 0.9271 1.7522 1.1497 0.0081  -0.0823 -0.0271 182  TYR H CZ  
4354 O OH  . TYR D 182 ? 1.0086 1.8745 1.2645 -0.0296 -0.0680 -0.0127 182  TYR H OH  
4355 N N   . THR D 183 ? 1.0165 1.6209 0.9828 0.1545  -0.0910 -0.0734 183  THR H N   
4356 C CA  . THR D 183 ? 1.1009 1.6478 1.0043 0.1615  -0.0910 -0.0791 183  THR H CA  
4357 C C   . THR D 183 ? 1.1320 1.6585 1.0187 0.1344  -0.0864 -0.0687 183  THR H C   
4358 O O   . THR D 183 ? 1.1737 1.7127 1.0628 0.1195  -0.0716 -0.0560 183  THR H O   
4359 C CB  . THR D 183 ? 1.2206 1.7392 1.0703 0.1863  -0.0715 -0.0830 183  THR H CB  
4360 O OG1 . THR D 183 ? 1.3807 1.9236 1.2500 0.2193  -0.0780 -0.0890 183  THR H OG1 
4361 C CG2 . THR D 183 ? 1.0664 1.5214 0.8449 0.1838  -0.0704 -0.0886 183  THR H CG2 
4362 N N   . MET D 184 ? 1.1697 1.6707 1.0400 0.1291  -0.0991 -0.0733 184  MET H N   
4363 C CA  . MET D 184 ? 1.1221 1.6132 0.9798 0.1095  -0.0981 -0.0626 184  MET H CA  
4364 C C   . MET D 184 ? 1.1182 1.5835 0.9343 0.1111  -0.1012 -0.0727 184  MET H C   
4365 O O   . MET D 184 ? 1.2421 1.6887 1.0342 0.1252  -0.1035 -0.0866 184  MET H O   
4366 C CB  . MET D 184 ? 1.0470 1.5513 0.9549 0.0988  -0.1121 -0.0539 184  MET H CB  
4367 C CG  . MET D 184 ? 1.0048 1.5011 0.9325 0.1088  -0.1296 -0.0704 184  MET H CG  
4368 S SD  . MET D 184 ? 1.0656 1.5478 1.0184 0.1034  -0.1422 -0.0655 184  MET H SD  
4369 C CE  . MET D 184 ? 1.0556 1.5394 0.9708 0.1024  -0.1348 -0.0572 184  MET H CE  
4370 N N   . SER D 185 ? 1.1245 1.5936 0.9324 0.0958  -0.1020 -0.0639 185  SER H N   
4371 C CA  . SER D 185 ? 1.0320 1.4918 0.8070 0.0915  -0.1030 -0.0726 185  SER H CA  
4372 C C   . SER D 185 ? 0.9857 1.4727 0.7873 0.0831  -0.1117 -0.0612 185  SER H C   
4373 O O   . SER D 185 ? 0.9556 1.4578 0.7806 0.0767  -0.1146 -0.0425 185  SER H O   
4374 C CB  . SER D 185 ? 1.0473 1.4814 0.7541 0.0791  -0.0867 -0.0755 185  SER H CB  
4375 O OG  . SER D 185 ? 1.0095 1.4478 0.7020 0.0648  -0.0759 -0.0627 185  SER H OG  
4376 N N   . SER D 186 ? 0.8787 1.3740 0.6763 0.0850  -0.1152 -0.0714 186  SER H N   
4377 C CA  . SER D 186 ? 0.9484 1.4782 0.7770 0.0857  -0.1233 -0.0620 186  SER H CA  
4378 C C   . SER D 186 ? 0.9463 1.4996 0.7418 0.0700  -0.1168 -0.0680 186  SER H C   
4379 O O   . SER D 186 ? 1.0897 1.6298 0.8589 0.0696  -0.1105 -0.0866 186  SER H O   
4380 C CB  . SER D 186 ? 1.0995 1.6254 0.9736 0.1088  -0.1333 -0.0715 186  SER H CB  
4381 O OG  . SER D 186 ? 1.1222 1.6771 1.0302 0.1187  -0.1402 -0.0605 186  SER H OG  
4382 N N   . SER D 187 ? 0.9898 1.5797 0.7823 0.0530  -0.1189 -0.0513 187  SER H N   
4383 C CA  . SER D 187 ? 1.1330 1.7608 0.9007 0.0308  -0.1145 -0.0552 187  SER H CA  
4384 C C   . SER D 187 ? 1.1111 1.8019 0.9353 0.0473  -0.1255 -0.0478 187  SER H C   
4385 O O   . SER D 187 ? 1.1869 1.8876 1.0562 0.0690  -0.1379 -0.0307 187  SER H O   
4386 C CB  . SER D 187 ? 1.2916 1.9245 1.0108 -0.0046 -0.1103 -0.0441 187  SER H CB  
4387 O OG  . SER D 187 ? 1.2308 1.9045 0.9787 -0.0058 -0.1237 -0.0192 187  SER H OG  
4388 N N   . VAL D 188 ? 1.0746 1.8059 0.8955 0.0388  -0.1193 -0.0607 188  VAL H N   
4389 C CA  . VAL D 188 ? 1.1045 1.9066 0.9825 0.0596  -0.1259 -0.0569 188  VAL H CA  
4390 C C   . VAL D 188 ? 1.0394 1.9128 0.9012 0.0263  -0.1199 -0.0597 188  VAL H C   
4391 O O   . VAL D 188 ? 0.9816 1.8407 0.7993 0.0015  -0.1042 -0.0792 188  VAL H O   
4392 C CB  . VAL D 188 ? 1.0462 1.8313 0.9544 0.0943  -0.1206 -0.0777 188  VAL H CB  
4393 C CG1 . VAL D 188 ? 0.9828 1.8455 0.9450 0.1173  -0.1214 -0.0776 188  VAL H CG1 
4394 C CG2 . VAL D 188 ? 1.2007 1.9266 1.1318 0.1222  -0.1297 -0.0732 188  VAL H CG2 
4395 N N   . THR D 189 ? 0.8087 1.7610 0.7051 0.0242  -0.1333 -0.0391 189  THR H N   
4396 C CA  . THR D 189 ? 0.8176 1.8593 0.7104 -0.0104 -0.1310 -0.0398 189  THR H CA  
4397 C C   . THR D 189 ? 1.1291 2.2558 1.0933 0.0244  -0.1300 -0.0448 189  THR H C   
4398 O O   . THR D 189 ? 0.9995 2.1557 1.0253 0.0702  -0.1445 -0.0282 189  THR H O   
4399 C CB  . THR D 189 ? 1.1048 2.1934 0.9894 -0.0377 -0.1489 -0.0137 189  THR H CB  
4400 O OG1 . THR D 189 ? 1.1965 2.1977 1.0171 -0.0606 -0.1463 -0.0110 189  THR H OG1 
4401 C CG2 . THR D 189 ? 0.8883 2.0686 0.7581 -0.0875 -0.1470 -0.0172 189  THR H CG2 
4402 N N   . VAL D 190 ? 1.0548 2.2167 1.0068 0.0037  -0.1110 -0.0673 190  VAL H N   
4403 C CA  . VAL D 190 ? 1.0887 2.3333 1.1037 0.0357  -0.1022 -0.0785 190  VAL H CA  
4404 C C   . VAL D 190 ? 1.1189 2.4749 1.1335 -0.0112 -0.0934 -0.0826 190  VAL H C   
4405 O O   . VAL D 190 ? 1.2536 2.5814 1.1964 -0.0719 -0.0844 -0.0894 190  VAL H O   
4406 C CB  . VAL D 190 ? 1.1599 2.3353 1.1603 0.0589  -0.0822 -0.1073 190  VAL H CB  
4407 C CG1 . VAL D 190 ? 1.2962 2.5483 1.3623 0.1006  -0.0709 -0.1206 190  VAL H CG1 
4408 C CG2 . VAL D 190 ? 1.1578 2.2234 1.1488 0.0902  -0.0916 -0.1050 190  VAL H CG2 
4409 N N   . PRO D 191 ? 0.8932 2.3759 0.9842 0.0133  -0.0949 -0.0786 191  PRO H N   
4410 C CA  . PRO D 191 ? 0.9761 2.5791 1.0719 -0.0367 -0.0843 -0.0846 191  PRO H CA  
4411 C C   . PRO D 191 ? 1.0440 2.6086 1.0803 -0.0762 -0.0523 -0.1148 191  PRO H C   
4412 O O   . PRO D 191 ? 1.1367 2.6063 1.1468 -0.0507 -0.0379 -0.1330 191  PRO H O   
4413 C CB  . PRO D 191 ? 0.9755 2.7157 1.1776 0.0182  -0.0882 -0.0782 191  PRO H CB  
4414 C CG  . PRO D 191 ? 0.9491 2.6461 1.1898 0.0804  -0.1142 -0.0534 191  PRO H CG  
4415 C CD  . PRO D 191 ? 0.8236 2.3518 1.0002 0.0850  -0.1100 -0.0628 191  PRO H CD  
4416 N N   . SER D 192 ? 1.0009 2.6409 1.0108 -0.1439 -0.0422 -0.1190 192  SER H N   
4417 C CA  . SER D 192 ? 1.0626 2.6706 1.0069 -0.1923 -0.0113 -0.1434 192  SER H CA  
4418 C C   . SER D 192 ? 1.2346 2.8978 1.2272 -0.1539 0.0140  -0.1649 192  SER H C   
4419 O O   . SER D 192 ? 1.3760 2.9906 1.3081 -0.1832 0.0406  -0.1854 192  SER H O   
4420 C CB  . SER D 192 ? 1.0907 2.7765 0.9994 -0.2791 -0.0065 -0.1415 192  SER H CB  
4421 O OG  . SER D 192 ? 1.0443 2.9156 1.0462 -0.2758 -0.0089 -0.1364 192  SER H OG  
4422 N N   . SER D 193 ? 1.1934 2.9510 1.2874 -0.0879 0.0077  -0.1607 193  SER H N   
4423 C CA  . SER D 193 ? 1.1422 2.9472 1.2802 -0.0456 0.0353  -0.1849 193  SER H CA  
4424 C C   . SER D 193 ? 1.1464 2.8023 1.2390 -0.0080 0.0439  -0.2030 193  SER H C   
4425 O O   . SER D 193 ? 1.4363 3.0764 1.4998 -0.0120 0.0729  -0.2291 193  SER H O   
4426 C CB  . SER D 193 ? 1.0964 3.0304 1.3525 0.0233  0.0261  -0.1752 193  SER H CB  
4427 O OG  . SER D 193 ? 1.0936 3.1777 1.3966 -0.0101 0.0123  -0.1556 193  SER H OG  
4428 N N   . THR D 194 ? 0.8772 2.4277 0.9611 0.0251  0.0189  -0.1894 194  THR H N   
4429 C CA  . THR D 194 ? 0.9648 2.3868 1.0176 0.0630  0.0220  -0.2050 194  THR H CA  
4430 C C   . THR D 194 ? 1.0319 2.3354 0.9806 0.0158  0.0280  -0.2134 194  THR H C   
4431 O O   . THR D 194 ? 0.9583 2.1687 0.8745 0.0388  0.0324  -0.2294 194  THR H O   
4432 C CB  . THR D 194 ? 0.9341 2.2985 1.0227 0.1131  -0.0067 -0.1857 194  THR H CB  
4433 O OG1 . THR D 194 ? 0.8772 2.3519 1.0521 0.1480  -0.0190 -0.1670 194  THR H OG1 
4434 C CG2 . THR D 194 ? 1.0626 2.3312 1.1485 0.1633  -0.0021 -0.2053 194  THR H CG2 
4435 N N   . TRP D 195 ? 1.1586 2.4598 1.0510 -0.0485 0.0273  -0.2029 195  TRP H N   
4436 C CA  . TRP D 195 ? 1.2003 2.3833 0.9906 -0.0871 0.0339  -0.2088 195  TRP H CA  
4437 C C   . TRP D 195 ? 1.3567 2.5708 1.0872 -0.1626 0.0505  -0.2090 195  TRP H C   
4438 O O   . TRP D 195 ? 1.4007 2.6935 1.1523 -0.1968 0.0434  -0.1955 195  TRP H O   
4439 C CB  . TRP D 195 ? 1.0825 2.1621 0.8420 -0.0807 0.0097  -0.1919 195  TRP H CB  
4440 C CG  . TRP D 195 ? 1.0812 2.0331 0.7599 -0.0853 0.0128  -0.2000 195  TRP H CG  
4441 C CD1 . TRP D 195 ? 1.0461 1.9349 0.7255 -0.0432 0.0098  -0.2119 195  TRP H CD1 
4442 C CD2 . TRP D 195 ? 1.2052 2.0753 0.7880 -0.1333 0.0177  -0.1958 195  TRP H CD2 
4443 N NE1 . TRP D 195 ? 1.1144 1.8987 0.7106 -0.0595 0.0098  -0.2132 195  TRP H NE1 
4444 C CE2 . TRP D 195 ? 1.1846 1.9504 0.7195 -0.1112 0.0157  -0.2029 195  TRP H CE2 
4445 C CE3 . TRP D 195 ? 1.3538 2.2246 0.8829 -0.1932 0.0232  -0.1872 195  TRP H CE3 
4446 C CZ2 . TRP D 195 ? 1.2643 1.9278 0.7035 -0.1388 0.0189  -0.1990 195  TRP H CZ2 
4447 C CZ3 . TRP D 195 ? 1.4367 2.1925 0.8637 -0.2240 0.0291  -0.1861 195  TRP H CZ3 
4448 C CH2 . TRP D 195 ? 1.3802 2.0340 0.7649 -0.1928 0.0269  -0.1907 195  TRP H CH2 
4449 N N   . PRO D 196 ? 1.4610 2.6096 1.1099 -0.1937 0.0714  -0.2229 196  PRO H N   
4450 C CA  . PRO D 196 ? 1.3858 2.4473 1.0040 -0.1573 0.0769  -0.2383 196  PRO H CA  
4451 C C   . PRO D 196 ? 1.3116 2.4526 0.9744 -0.1320 0.0999  -0.2610 196  PRO H C   
4452 O O   . PRO D 196 ? 1.2886 2.3679 0.9088 -0.1177 0.1107  -0.2779 196  PRO H O   
4453 C CB  . PRO D 196 ? 1.5427 2.4990 1.0419 -0.2086 0.0869  -0.2374 196  PRO H CB  
4454 C CG  . PRO D 196 ? 1.6288 2.6552 1.1057 -0.2780 0.1034  -0.2335 196  PRO H CG  
4455 C CD  . PRO D 196 ? 1.5599 2.6920 1.1239 -0.2721 0.0870  -0.2212 196  PRO H CD  
4456 N N   . SER D 197 ? 1.2620 2.5422 1.0097 -0.1246 0.1070  -0.2615 197  SER H N   
4457 C CA  . SER D 197 ? 1.2266 2.5974 1.0209 -0.1001 0.1346  -0.2850 197  SER H CA  
4458 C C   . SER D 197 ? 1.2517 2.5656 1.0724 -0.0286 0.1308  -0.3016 197  SER H C   
4459 O O   . SER D 197 ? 1.2377 2.5459 1.0372 -0.0171 0.1553  -0.3274 197  SER H O   
4460 C CB  . SER D 197 ? 1.0045 2.5425 0.8984 -0.0940 0.1379  -0.2787 197  SER H CB  
4461 O OG  . SER D 197 ? 1.1778 2.7635 1.0489 -0.1633 0.1329  -0.2610 197  SER H OG  
4462 N N   . GLN D 198 ? 1.2218 2.4902 1.0826 0.0153  0.1014  -0.2881 198  GLN H N   
4463 C CA  . GLN D 198 ? 1.1974 2.4064 1.0844 0.0785  0.0949  -0.3023 198  GLN H CA  
4464 C C   . GLN D 198 ? 1.2488 2.3187 1.0743 0.0758  0.0715  -0.2955 198  GLN H C   
4465 O O   . GLN D 198 ? 1.2445 2.2648 1.0114 0.0333  0.0617  -0.2793 198  GLN H O   
4466 C CB  . GLN D 198 ? 1.1115 2.3854 1.0997 0.1342  0.0816  -0.2916 198  GLN H CB  
4467 C CG  . GLN D 198 ? 0.9563 2.3820 1.0171 0.1482  0.1044  -0.2989 198  GLN H CG  
4468 C CD  . GLN D 198 ? 1.0597 2.5428 1.2185 0.2135  0.0895  -0.2856 198  GLN H CD  
4469 O OE1 . GLN D 198 ? 1.0447 2.4656 1.2149 0.2334  0.0592  -0.2632 198  GLN H OE1 
4470 N NE2 . GLN D 198 ? 0.9497 2.5522 1.1785 0.2489  0.1118  -0.2984 198  GLN H NE2 
4471 N N   . THR D 199 ? 1.4573 2.4646 1.2954 0.1217  0.0638  -0.3094 199  THR H N   
4472 C CA  . THR D 199 ? 1.5780 2.4686 1.3676 0.1224  0.0420  -0.3060 199  THR H CA  
4473 C C   . THR D 199 ? 1.6362 2.5050 1.4756 0.1462  0.0142  -0.2827 199  THR H C   
4474 O O   . THR D 199 ? 1.7636 2.6584 1.6693 0.1886  0.0107  -0.2832 199  THR H O   
4475 C CB  . THR D 199 ? 1.6236 2.4579 1.3897 0.1487  0.0484  -0.3364 199  THR H CB  
4476 O OG1 . THR D 199 ? 1.7561 2.6059 1.4640 0.1222  0.0749  -0.3565 199  THR H OG1 
4477 C CG2 . THR D 199 ? 1.6195 2.3502 1.3464 0.1489  0.0219  -0.3313 199  THR H CG2 
4478 N N   . VAL D 200 ? 1.5570 2.3744 1.3610 0.1206  -0.0036 -0.2618 200  VAL H N   
4479 C CA  . VAL D 200 ? 1.4290 2.2178 1.2685 0.1374  -0.0280 -0.2398 200  VAL H CA  
4480 C C   . VAL D 200 ? 1.4286 2.1221 1.2228 0.1346  -0.0424 -0.2413 200  VAL H C   
4481 O O   . VAL D 200 ? 1.4793 2.1359 1.2093 0.1056  -0.0408 -0.2396 200  VAL H O   
4482 C CB  . VAL D 200 ? 1.3757 2.2096 1.2240 0.1104  -0.0348 -0.2122 200  VAL H CB  
4483 C CG1 . VAL D 200 ? 1.3372 2.2833 1.2337 0.1105  -0.0226 -0.2110 200  VAL H CG1 
4484 C CG2 . VAL D 200 ? 1.4547 2.2482 1.2256 0.0635  -0.0314 -0.2070 200  VAL H CG2 
4485 N N   . THR D 201 ? 1.3975 2.0513 1.2233 0.1651  -0.0560 -0.2452 201  THR H N   
4486 C CA  . THR D 201 ? 1.3609 1.9412 1.1562 0.1631  -0.0717 -0.2472 201  THR H CA  
4487 C C   . THR D 201 ? 1.2905 1.8512 1.1254 0.1725  -0.0904 -0.2256 201  THR H C   
4488 O O   . THR D 201 ? 1.1311 1.7173 1.0178 0.1906  -0.0930 -0.2145 201  THR H O   
4489 C CB  . THR D 201 ? 1.2603 1.8042 1.0440 0.1800  -0.0708 -0.2769 201  THR H CB  
4490 O OG1 . THR D 201 ? 1.4106 1.9566 1.2497 0.2115  -0.0714 -0.2842 201  THR H OG1 
4491 C CG2 . THR D 201 ? 1.2598 1.8242 0.9990 0.1695  -0.0494 -0.2988 201  THR H CG2 
4492 N N   . CYS D 202 ? 1.4299 1.9471 1.2391 0.1612  -0.1029 -0.2182 202  CYS H N   
4493 C CA  . CYS D 202 ? 1.4310 1.9270 1.2733 0.1668  -0.1185 -0.2014 202  CYS H CA  
4494 C C   . CYS D 202 ? 1.4571 1.9088 1.2961 0.1728  -0.1310 -0.2174 202  CYS H C   
4495 O O   . CYS D 202 ? 1.4746 1.9076 1.2713 0.1650  -0.1343 -0.2281 202  CYS H O   
4496 C CB  . CYS D 202 ? 1.4907 1.9863 1.3135 0.1479  -0.1208 -0.1786 202  CYS H CB  
4497 S SG  . CYS D 202 ? 1.6145 2.0780 1.3644 0.1317  -0.1174 -0.1839 202  CYS H SG  
4498 N N   . SER D 203 ? 1.2704 1.7041 1.1505 0.1853  -0.1390 -0.2182 203  SER H N   
4499 C CA  . SER D 203 ? 1.2278 1.6211 1.1091 0.1842  -0.1524 -0.2340 203  SER H CA  
4500 C C   . SER D 203 ? 0.9723 1.3582 0.8804 0.1734  -0.1649 -0.2120 203  SER H C   
4501 O O   . SER D 203 ? 0.9343 1.3147 0.8770 0.1774  -0.1657 -0.1953 203  SER H O   
4502 C CB  . SER D 203 ? 1.4381 1.8038 1.3368 0.2017  -0.1490 -0.2552 203  SER H CB  
4503 O OG  . SER D 203 ? 1.6037 1.9816 1.4759 0.2115  -0.1339 -0.2794 203  SER H OG  
4504 N N   . VAL D 204 ? 0.9812 1.3695 0.8727 0.1612  -0.1741 -0.2106 204  VAL H N   
4505 C CA  . VAL D 204 ? 0.9435 1.3357 0.8626 0.1498  -0.1835 -0.1931 204  VAL H CA  
4506 C C   . VAL D 204 ? 1.1391 1.5077 1.0750 0.1406  -0.1982 -0.2098 204  VAL H C   
4507 O O   . VAL D 204 ? 1.1394 1.5058 1.0534 0.1371  -0.2088 -0.2301 204  VAL H O   
4508 C CB  . VAL D 204 ? 0.8836 1.2972 0.7813 0.1465  -0.1841 -0.1831 204  VAL H CB  
4509 C CG1 . VAL D 204 ? 0.9285 1.3577 0.8608 0.1365  -0.1899 -0.1672 204  VAL H CG1 
4510 C CG2 . VAL D 204 ? 0.8783 1.3021 0.7488 0.1489  -0.1683 -0.1701 204  VAL H CG2 
4511 N N   . ALA D 205 ? 1.0635 1.4110 1.0327 0.1337  -0.1999 -0.2004 205  ALA H N   
4512 C CA  . ALA D 205 ? 1.0884 1.4037 1.0712 0.1167  -0.2125 -0.2151 205  ALA H CA  
4513 C C   . ALA D 205 ? 1.0089 1.3489 1.0217 0.0928  -0.2198 -0.1962 205  ALA H C   
4514 O O   . ALA D 205 ? 0.9737 1.3210 1.0060 0.0897  -0.2117 -0.1691 205  ALA H O   
4515 C CB  . ALA D 205 ? 1.0240 1.2837 1.0157 0.1251  -0.2070 -0.2187 205  ALA H CB  
4516 N N   . HIS D 206 ? 1.1235 1.4843 1.1397 0.0752  -0.2350 -0.2102 206  HIS H N   
4517 C CA  . HIS D 206 ? 1.1376 1.5360 1.1892 0.0498  -0.2420 -0.1967 206  HIS H CA  
4518 C C   . HIS D 206 ? 1.4389 1.8062 1.5004 0.0175  -0.2561 -0.2150 206  HIS H C   
4519 O O   . HIS D 206 ? 1.4690 1.8512 1.5210 0.0061  -0.2735 -0.2386 206  HIS H O   
4520 C CB  . HIS D 206 ? 1.1024 1.5658 1.1549 0.0576  -0.2495 -0.1958 206  HIS H CB  
4521 C CG  . HIS D 206 ? 1.0463 1.5670 1.1423 0.0403  -0.2501 -0.1786 206  HIS H CG  
4522 N ND1 . HIS D 206 ? 1.0159 1.6024 1.1265 0.0457  -0.2613 -0.1802 206  HIS H ND1 
4523 C CD2 . HIS D 206 ? 1.0465 1.5732 1.1742 0.0192  -0.2394 -0.1586 206  HIS H CD2 
4524 C CE1 . HIS D 206 ? 1.0025 1.6403 1.1579 0.0295  -0.2554 -0.1642 206  HIS H CE1 
4525 N NE2 . HIS D 206 ? 1.0227 1.6235 1.1862 0.0103  -0.2413 -0.1509 206  HIS H NE2 
4526 N N   . PRO D 207 ? 1.4665 1.7848 1.5407 -0.0005 -0.2503 -0.2049 207  PRO H N   
4527 C CA  . PRO D 207 ? 1.1333 1.4061 1.2070 -0.0368 -0.2625 -0.2244 207  PRO H CA  
4528 C C   . PRO D 207 ? 1.1318 1.4689 1.2375 -0.0772 -0.2769 -0.2246 207  PRO H C   
4529 O O   . PRO D 207 ? 1.3265 1.6506 1.4252 -0.1087 -0.2937 -0.2502 207  PRO H O   
4530 C CB  . PRO D 207 ? 1.1784 1.3774 1.2533 -0.0421 -0.2502 -0.2052 207  PRO H CB  
4531 C CG  . PRO D 207 ? 1.4313 1.6732 1.5247 -0.0259 -0.2366 -0.1688 207  PRO H CG  
4532 C CD  . PRO D 207 ? 1.4781 1.7750 1.5612 0.0087  -0.2341 -0.1740 207  PRO H CD  
4533 N N   . ALA D 208 ? 1.0772 1.4883 1.2178 -0.0777 -0.2702 -0.1986 208  ALA H N   
4534 C CA  . ALA D 208 ? 1.2972 1.7861 1.4786 -0.1135 -0.2816 -0.1976 208  ALA H CA  
4535 C C   . ALA D 208 ? 1.3064 1.8502 1.4846 -0.1085 -0.3051 -0.2220 208  ALA H C   
4536 O O   . ALA D 208 ? 1.0989 1.6873 1.3007 -0.1469 -0.3240 -0.2343 208  ALA H O   
4537 C CB  . ALA D 208 ? 1.0200 1.5802 1.2365 -0.1055 -0.2648 -0.1670 208  ALA H CB  
4538 N N   . SER D 209 ? 1.4588 2.0031 1.6057 -0.0642 -0.3053 -0.2276 209  SER H N   
4539 C CA  . SER D 209 ? 1.4275 2.0049 1.5546 -0.0549 -0.3284 -0.2492 209  SER H CA  
4540 C C   . SER D 209 ? 1.3801 1.8778 1.4527 -0.0547 -0.3344 -0.2793 209  SER H C   
4541 O O   . SER D 209 ? 1.3638 1.8784 1.4084 -0.0521 -0.3544 -0.2997 209  SER H O   
4542 C CB  . SER D 209 ? 1.3561 1.9794 1.4739 -0.0082 -0.3240 -0.2351 209  SER H CB  
4543 O OG  . SER D 209 ? 1.3078 1.8727 1.3875 0.0228  -0.3031 -0.2293 209  SER H OG  
4544 N N   . SER D 210 ? 1.4468 1.8593 1.5023 -0.0550 -0.3171 -0.2818 210  SER H N   
4545 C CA  . SER D 210 ? 1.4965 1.8287 1.5022 -0.0498 -0.3162 -0.3120 210  SER H CA  
4546 C C   . SER D 210 ? 1.4770 1.8206 1.4417 -0.0124 -0.3151 -0.3219 210  SER H C   
4547 O O   . SER D 210 ? 1.3668 1.6937 1.2902 -0.0171 -0.3275 -0.3514 210  SER H O   
4548 C CB  . SER D 210 ? 1.5576 1.8649 1.5501 -0.0954 -0.3370 -0.3430 210  SER H CB  
4549 O OG  . SER D 210 ? 1.6415 2.0280 1.6363 -0.1071 -0.3635 -0.3520 210  SER H OG  
4550 N N   . THR D 211 ? 1.4812 1.8505 1.4512 0.0207  -0.2994 -0.2972 211  THR H N   
4551 C CA  . THR D 211 ? 1.0782 1.4545 1.0065 0.0520  -0.2945 -0.3012 211  THR H CA  
4552 C C   . THR D 211 ? 1.2829 1.6227 1.2005 0.0776  -0.2680 -0.2930 211  THR H C   
4553 O O   . THR D 211 ? 1.0424 1.3706 0.9908 0.0786  -0.2554 -0.2735 211  THR H O   
4554 C CB  . THR D 211 ? 1.0572 1.5001 0.9932 0.0667  -0.3014 -0.2798 211  THR H CB  
4555 O OG1 . THR D 211 ? 1.2417 1.7027 1.2119 0.0753  -0.2841 -0.2504 211  THR H OG1 
4556 C CG2 . THR D 211 ? 1.0473 1.5451 1.0059 0.0456  -0.3293 -0.2844 211  THR H CG2 
4557 N N   . THR D 212 ? 1.2930 1.6205 1.1657 0.0966  -0.2602 -0.3071 212  THR H N   
4558 C CA  . THR D 212 ? 1.3246 1.6369 1.1894 0.1198  -0.2358 -0.3002 212  THR H CA  
4559 C C   . THR D 212 ? 1.4096 1.7403 1.2273 0.1332  -0.2302 -0.3026 212  THR H C   
4560 O O   . THR D 212 ? 1.4994 1.8178 1.2737 0.1311  -0.2357 -0.3269 212  THR H O   
4561 C CB  . THR D 212 ? 1.3619 1.6215 1.2221 0.1260  -0.2246 -0.3229 212  THR H CB  
4562 O OG1 . THR D 212 ? 1.4687 1.6959 1.3644 0.1119  -0.2294 -0.3173 212  THR H OG1 
4563 C CG2 . THR D 212 ? 1.3340 1.5986 1.1948 0.1527  -0.2007 -0.3143 212  THR H CG2 
4564 N N   . VAL D 213 ? 1.2877 1.6421 1.1067 0.1434  -0.2186 -0.2777 213  VAL H N   
4565 C CA  . VAL D 213 ? 1.0706 1.4336 0.8395 0.1512  -0.2119 -0.2749 213  VAL H CA  
4566 C C   . VAL D 213 ? 1.1490 1.5134 0.9125 0.1588  -0.1872 -0.2701 213  VAL H C   
4567 O O   . VAL D 213 ? 0.9455 1.3221 0.7441 0.1608  -0.1789 -0.2507 213  VAL H O   
4568 C CB  . VAL D 213 ? 0.9946 1.3793 0.7609 0.1540  -0.2197 -0.2511 213  VAL H CB  
4569 C CG1 . VAL D 213 ? 1.1610 1.5360 0.8627 0.1611  -0.2142 -0.2479 213  VAL H CG1 
4570 C CG2 . VAL D 213 ? 1.0004 1.4050 0.7922 0.1475  -0.2448 -0.2530 213  VAL H CG2 
4571 N N   . ASP D 214 ? 1.2462 1.6049 0.9657 0.1608  -0.1756 -0.2872 214  ASP H N   
4572 C CA  . ASP D 214 ? 1.4141 1.7897 1.1309 0.1648  -0.1516 -0.2847 214  ASP H CA  
4573 C C   . ASP D 214 ? 1.4793 1.8603 1.1420 0.1551  -0.1427 -0.2735 214  ASP H C   
4574 O O   . ASP D 214 ? 1.6499 2.0118 1.2581 0.1505  -0.1492 -0.2808 214  ASP H O   
4575 C CB  . ASP D 214 ? 1.4482 1.8190 1.1587 0.1730  -0.1383 -0.3142 214  ASP H CB  
4576 C CG  . ASP D 214 ? 1.4625 1.8116 1.2189 0.1844  -0.1435 -0.3258 214  ASP H CG  
4577 O OD1 . ASP D 214 ? 1.4683 1.8087 1.2604 0.1806  -0.1583 -0.3091 214  ASP H OD1 
4578 O OD2 . ASP D 214 ? 1.5091 1.8457 1.2621 0.1967  -0.1308 -0.3519 214  ASP H OD2 
4579 N N   . LYS D 215 ? 1.3553 1.7578 1.0271 0.1497  -0.1289 -0.2552 215  LYS H N   
4580 C CA  . LYS D 215 ? 1.3973 1.7965 1.0122 0.1340  -0.1165 -0.2458 215  LYS H CA  
4581 C C   . LYS D 215 ? 1.4660 1.9047 1.0867 0.1246  -0.0938 -0.2499 215  LYS H C   
4582 O O   . LYS D 215 ? 1.4962 1.9707 1.1733 0.1317  -0.0905 -0.2437 215  LYS H O   
4583 C CB  . LYS D 215 ? 1.4540 1.8409 1.0635 0.1292  -0.1207 -0.2209 215  LYS H CB  
4584 C CG  . LYS D 215 ? 1.5435 1.9031 1.1447 0.1410  -0.1404 -0.2160 215  LYS H CG  
4585 C CD  . LYS D 215 ? 1.7073 2.0384 1.2459 0.1422  -0.1472 -0.2267 215  LYS H CD  
4586 C CE  . LYS D 215 ? 1.7863 2.1060 1.3264 0.1580  -0.1714 -0.2211 215  LYS H CE  
4587 N NZ  . LYS D 215 ? 1.8615 2.1588 1.3424 0.1608  -0.1840 -0.2304 215  LYS H NZ  
4588 N N   . LYS D 216 ? 1.4767 1.9132 1.0390 0.1080  -0.0788 -0.2585 216  LYS H N   
4589 C CA  . LYS D 216 ? 1.5661 2.0543 1.1368 0.0978  -0.0553 -0.2679 216  LYS H CA  
4590 C C   . LYS D 216 ? 1.6320 2.1465 1.1891 0.0696  -0.0431 -0.2494 216  LYS H C   
4591 O O   . LYS D 216 ? 1.7573 2.3347 1.3383 0.0597  -0.0259 -0.2535 216  LYS H O   
4592 C CB  . LYS D 216 ? 1.6697 2.1493 1.1833 0.0891  -0.0414 -0.2899 216  LYS H CB  
4593 C CG  . LYS D 216 ? 1.7118 2.2571 1.2498 0.0879  -0.0147 -0.3077 216  LYS H CG  
4594 C CD  . LYS D 216 ? 1.9010 2.4336 1.3763 0.0786  0.0007  -0.3316 216  LYS H CD  
4595 C CE  . LYS D 216 ? 1.9819 2.5899 1.4794 0.0758  0.0332  -0.3502 216  LYS H CE  
4596 N NZ  . LYS D 216 ? 2.0338 2.6300 1.4629 0.0634  0.0524  -0.3744 216  LYS H NZ  
4597 N N   . LEU D 217 ? 1.4593 1.9298 0.9785 0.0561  -0.0508 -0.2307 217  LEU H N   
4598 C CA  . LEU D 217 ? 1.4279 1.9110 0.9259 0.0247  -0.0403 -0.2151 217  LEU H CA  
4599 C C   . LEU D 217 ? 1.4329 1.9340 0.8778 -0.0113 -0.0173 -0.2226 217  LEU H C   
4600 O O   . LEU D 217 ? 1.3287 1.9025 0.8037 -0.0298 -0.0037 -0.2243 217  LEU H O   
4601 C CB  . LEU D 217 ? 1.1999 1.7461 0.7730 0.0304  -0.0438 -0.2052 217  LEU H CB  
4602 C CG  . LEU D 217 ? 1.1544 1.6773 0.7603 0.0484  -0.0618 -0.1896 217  LEU H CG  
4603 C CD1 . LEU D 217 ? 1.1852 1.7700 0.8436 0.0440  -0.0629 -0.1765 217  LEU H CD1 
4604 C CD2 . LEU D 217 ? 1.2050 1.6626 0.7482 0.0345  -0.0630 -0.1786 217  LEU H CD2 
4605 N N   . GLU D 218 ? 1.6470 2.0846 1.0127 -0.0213 -0.0139 -0.2257 218  GLU H N   
4606 C CA  . GLU D 218 ? 1.7090 2.1500 1.0098 -0.0628 0.0094  -0.2298 218  GLU H CA  
4607 C C   . GLU D 218 ? 1.7154 2.1272 0.9657 -0.1042 0.0173  -0.2132 218  GLU H C   
4608 O O   . GLU D 218 ? 1.6016 1.9537 0.8334 -0.0957 0.0049  -0.1995 218  GLU H O   
4609 C CB  . GLU D 218 ? 1.7038 2.0782 0.9247 -0.0618 0.0098  -0.2357 218  GLU H CB  
4610 C CG  . GLU D 218 ? 1.7000 2.1042 0.9550 -0.0321 0.0065  -0.2576 218  GLU H CG  
4611 C CD  . GLU D 218 ? 1.8236 2.3183 1.1210 -0.0423 0.0314  -0.2764 218  GLU H CD  
4612 O OE1 . GLU D 218 ? 1.8737 2.4036 1.1481 -0.0826 0.0535  -0.2726 218  GLU H OE1 
4613 O OE2 . GLU D 218 ? 1.8802 2.4118 1.2339 -0.0102 0.0300  -0.2956 218  GLU H OE2 
4614 N N   . PRO D 219 ? 1.6963 2.1445 0.9338 -0.1487 0.0388  -0.2128 219  PRO H N   
4615 C CA  . PRO D 219 ? 1.7407 2.1412 0.9337 -0.1922 0.0463  -0.1957 219  PRO H CA  
4616 C C   . PRO D 219 ? 1.8792 2.1458 0.9752 -0.1983 0.0480  -0.1834 219  PRO H C   
4617 O O   . PRO D 219 ? 1.9675 2.1908 1.0257 -0.1807 0.0468  -0.1861 219  PRO H O   
4618 C CB  . PRO D 219 ? 1.7111 2.1995 0.9256 -0.2383 0.0679  -0.2010 219  PRO H CB  
4619 C CG  . PRO D 219 ? 1.6077 2.2117 0.8963 -0.2083 0.0703  -0.2209 219  PRO H CG  
4620 C CD  . PRO D 219 ? 1.6438 2.1910 0.9204 -0.1597 0.0575  -0.2294 219  PRO H CD  
4621 N N   . SER D 220 ? 2.0138 2.2156 1.0659 -0.2223 0.0505  -0.1703 220  SER H N   
4622 C CA  . SER D 220 ? 2.0812 2.1558 1.0385 -0.2254 0.0533  -0.1580 220  SER H CA  
4623 C C   . SER D 220 ? 2.0420 2.0815 0.9510 -0.2864 0.0728  -0.1510 220  SER H C   
4624 O O   . SER D 220 ? 2.0999 2.1075 0.9596 -0.3151 0.0866  -0.1480 220  SER H O   
4625 C CB  . SER D 220 ? 2.1429 2.1505 1.0802 -0.1877 0.0378  -0.1515 220  SER H CB  
4626 O OG  . SER D 220 ? 2.0988 2.1344 1.0686 -0.2033 0.0383  -0.1507 220  SER H OG  
4627 N N   . ASP E 1   ? 1.5768 2.5654 1.8140 0.1677  -0.1423 0.5407  1    ASP L N   
4628 C CA  . ASP E 1   ? 1.6358 2.6143 1.9650 0.2064  -0.0611 0.5323  1    ASP L CA  
4629 C C   . ASP E 1   ? 1.6544 2.4707 1.8957 0.1927  -0.0173 0.4775  1    ASP L C   
4630 O O   . ASP E 1   ? 1.7122 2.4830 1.9992 0.2150  0.0585  0.4598  1    ASP L O   
4631 C CB  . ASP E 1   ? 1.7009 2.7717 2.0861 0.1828  -0.0280 0.5217  1    ASP L CB  
4632 C CG  . ASP E 1   ? 1.8275 2.9337 2.3520 0.2409  0.0555  0.5362  1    ASP L CG  
4633 O OD1 . ASP E 1   ? 1.8754 2.9404 2.4563 0.3032  0.0840  0.5617  1    ASP L OD1 
4634 O OD2 . ASP E 1   ? 1.8778 3.0487 2.4539 0.2249  0.0973  0.5222  1    ASP L OD2 
4635 N N   . ILE E 2   ? 1.6145 2.3450 1.7283 0.1542  -0.0633 0.4525  2    ILE L N   
4636 C CA  . ILE E 2   ? 1.5901 2.1806 1.6118 0.1315  -0.0353 0.4050  2    ILE L CA  
4637 C C   . ILE E 2   ? 1.6486 2.1861 1.6902 0.1757  -0.0322 0.4259  2    ILE L C   
4638 O O   . ILE E 2   ? 1.7043 2.2662 1.7387 0.1909  -0.0888 0.4582  2    ILE L O   
4639 C CB  . ILE E 2   ? 1.4579 1.9923 1.3379 0.0692  -0.0859 0.3722  2    ILE L CB  
4640 C CG1 . ILE E 2   ? 1.4507 2.0089 1.2954 0.0196  -0.0739 0.3427  2    ILE L CG1 
4641 C CG2 . ILE E 2   ? 1.4923 1.9013 1.2829 0.0485  -0.0734 0.3366  2    ILE L CG2 
4642 C CD1 . ILE E 2   ? 1.4695 1.9557 1.1687 -0.0393 -0.1132 0.3102  2    ILE L CD1 
4643 N N   . VAL E 3   ? 1.6378 2.0949 1.6967 0.1921  0.0386  0.4056  3    VAL L N   
4644 C CA  . VAL E 3   ? 1.5082 1.9042 1.5850 0.2318  0.0555  0.4226  3    VAL L CA  
4645 C C   . VAL E 3   ? 1.4042 1.6877 1.3565 0.1841  0.0415  0.3817  3    VAL L C   
4646 O O   . VAL E 3   ? 1.4559 1.6709 1.3312 0.1329  0.0690  0.3330  3    VAL L O   
4647 C CB  . VAL E 3   ? 1.4853 1.8492 1.6490 0.2779  0.1487  0.4267  3    VAL L CB  
4648 C CG1 . VAL E 3   ? 1.5912 1.8957 1.7764 0.3236  0.1651  0.4525  3    VAL L CG1 
4649 C CG2 . VAL E 3   ? 1.5195 2.0117 1.8140 0.3213  0.1651  0.4667  3    VAL L CG2 
4650 N N   . LEU E 4   ? 1.3249 1.5944 1.2577 0.1981  -0.0014 0.4032  4    LEU L N   
4651 C CA  . LEU E 4   ? 1.3960 1.5807 1.2257 0.1568  -0.0207 0.3733  4    LEU L CA  
4652 C C   . LEU E 4   ? 1.5025 1.6079 1.3446 0.1785  0.0279  0.3734  4    LEU L C   
4653 O O   . LEU E 4   ? 1.5519 1.6810 1.4603 0.2307  0.0254  0.4146  4    LEU L O   
4654 C CB  . LEU E 4   ? 1.4146 1.6406 1.2038 0.1499  -0.1041 0.3942  4    LEU L CB  
4655 C CG  . LEU E 4   ? 1.3702 1.6038 1.0726 0.0996  -0.1497 0.3716  4    LEU L CG  
4656 C CD1 . LEU E 4   ? 1.3785 1.6584 1.1014 0.0876  -0.1334 0.3629  4    LEU L CD1 
4657 C CD2 . LEU E 4   ? 1.3371 1.6099 1.0138 0.1059  -0.2202 0.3996  4    LEU L CD2 
4658 N N   . THR E 5   ? 1.5196 1.5264 1.2885 0.1331  0.0725  0.3275  5    THR L N   
4659 C CA  . THR E 5   ? 1.5420 1.4534 1.2978 0.1373  0.1271  0.3178  5    THR L CA  
4660 C C   . THR E 5   ? 1.4377 1.3011 1.0907 0.0791  0.0907  0.2922  5    THR L C   
4661 O O   . THR E 5   ? 1.4671 1.3026 1.0364 0.0163  0.0835  0.2543  5    THR L O   
4662 C CB  . THR E 5   ? 1.6592 1.4864 1.4129 0.1270  0.2255  0.2842  5    THR L CB  
4663 O OG1 . THR E 5   ? 1.5989 1.4909 1.4585 0.1811  0.2571  0.3100  5    THR L OG1 
4664 C CG2 . THR E 5   ? 1.7273 1.4446 1.4666 0.1360  0.2914  0.2778  5    THR L CG2 
4665 N N   . GLN E 6   ? 1.4174 1.2757 1.0774 0.0983  0.0679  0.3150  6    GLN L N   
4666 C CA  . GLN E 6   ? 1.5554 1.3872 1.1340 0.0473  0.0318  0.2971  6    GLN L CA  
4667 C C   . GLN E 6   ? 1.7042 1.4263 1.2347 0.0147  0.0983  0.2679  6    GLN L C   
4668 O O   . GLN E 6   ? 1.6816 1.3448 1.2526 0.0506  0.1669  0.2741  6    GLN L O   
4669 C CB  . GLN E 6   ? 1.5240 1.4181 1.1304 0.0787  -0.0339 0.3361  6    GLN L CB  
4670 C CG  . GLN E 6   ? 1.4108 1.4002 1.0615 0.1128  -0.0905 0.3682  6    GLN L CG  
4671 C CD  . GLN E 6   ? 1.4051 1.4399 1.0576 0.1289  -0.1523 0.3983  6    GLN L CD  
4672 O OE1 . GLN E 6   ? 1.3803 1.4734 1.0820 0.1698  -0.1819 0.4350  6    GLN L OE1 
4673 N NE2 . GLN E 6   ? 1.4215 1.4326 1.0189 0.0930  -0.1704 0.3834  6    GLN L NE2 
4674 N N   . SER E 7   ? 1.6829 1.3776 1.1232 -0.0559 0.0783  0.2381  7    SER L N   
4675 C CA  . SER E 7   ? 1.7755 1.3645 1.1475 -0.1079 0.1391  0.2038  7    SER L CA  
4676 C C   . SER E 7   ? 1.7234 1.3372 1.0378 -0.1594 0.0840  0.2002  7    SER L C   
4677 O O   . SER E 7   ? 1.7403 1.4246 1.0267 -0.1880 0.0167  0.2013  7    SER L O   
4678 C CB  . SER E 7   ? 2.0241 1.5381 1.3244 -0.1680 0.1960  0.1562  7    SER L CB  
4679 O OG  . SER E 7   ? 2.0842 1.5830 1.4455 -0.1199 0.2517  0.1592  7    SER L OG  
4680 N N   . PRO E 8   ? 1.7438 1.3045 1.0417 -0.1708 0.1117  0.1985  8    PRO L N   
4681 C CA  . PRO E 8   ? 1.9044 1.3777 1.2370 -0.1263 0.1898  0.2051  8    PRO L CA  
4682 C C   . PRO E 8   ? 1.8321 1.3636 1.2594 -0.0411 0.1588  0.2574  8    PRO L C   
4683 O O   . PRO E 8   ? 1.7426 1.3753 1.2009 -0.0228 0.0804  0.2837  8    PRO L O   
4684 C CB  . PRO E 8   ? 2.0894 1.4719 1.3354 -0.1960 0.2301  0.1742  8    PRO L CB  
4685 C CG  . PRO E 8   ? 1.9240 1.4001 1.1449 -0.2389 0.1442  0.1798  8    PRO L CG  
4686 C CD  . PRO E 8   ? 1.7344 1.3066 0.9690 -0.2365 0.0783  0.1867  8    PRO L CD  
4687 N N   . ALA E 9   ? 1.7968 1.2583 1.2636 0.0094  0.2226  0.2741  9    ALA L N   
4688 C CA  . ALA E 9   ? 1.6852 1.1952 1.2306 0.0833  0.1930  0.3263  9    ALA L CA  
4689 C C   . ALA E 9   ? 1.6727 1.1846 1.1831 0.0570  0.1591  0.3305  9    ALA L C   
4690 O O   . ALA E 9   ? 1.5743 1.1714 1.1244 0.0865  0.0930  0.3637  9    ALA L O   
4691 C CB  . ALA E 9   ? 1.7610 1.1977 1.3604 0.1488  0.2704  0.3496  9    ALA L CB  
4692 N N   . ILE E 10  ? 1.8178 1.2349 1.2496 -0.0035 0.2068  0.2958  10   ILE L N   
4693 C CA  . ILE E 10  ? 1.7819 1.1990 1.1762 -0.0394 0.1831  0.2947  10   ILE L CA  
4694 C C   . ILE E 10  ? 1.8298 1.2402 1.1328 -0.1405 0.1763  0.2482  10   ILE L C   
4695 O O   . ILE E 10  ? 1.9245 1.2620 1.1672 -0.1893 0.2278  0.2102  10   ILE L O   
4696 C CB  . ILE E 10  ? 1.8843 1.1870 1.2673 -0.0179 0.2523  0.3036  10   ILE L CB  
4697 C CG1 . ILE E 10  ? 1.8919 1.1676 1.3538 0.0763  0.2899  0.3436  10   ILE L CG1 
4698 C CG2 . ILE E 10  ? 1.8443 1.1818 1.2264 -0.0228 0.2105  0.3225  10   ILE L CG2 
4699 C CD1 . ILE E 10  ? 2.3190 1.4566 1.7604 0.0998  0.3748  0.3514  10   ILE L CD1 
4700 N N   . MET E 11  ? 1.7907 1.2793 1.0831 -0.1740 0.1144  0.2529  11   MET L N   
4701 C CA  . MET E 11  ? 1.8597 1.3645 1.0737 -0.2713 0.0987  0.2178  11   MET L CA  
4702 C C   . MET E 11  ? 1.9437 1.5168 1.1649 -0.2909 0.0530  0.2321  11   MET L C   
4703 O O   . MET E 11  ? 2.0234 1.6823 1.3130 -0.2342 -0.0016 0.2686  11   MET L O   
4704 C CB  . MET E 11  ? 1.8345 1.4201 1.0418 -0.2936 0.0464  0.2105  11   MET L CB  
4705 C CG  . MET E 11  ? 1.7809 1.4900 1.0627 -0.2335 -0.0342 0.2497  11   MET L CG  
4706 S SD  . MET E 11  ? 1.8260 1.5973 1.0851 -0.2580 -0.0798 0.2396  11   MET L SD  
4707 C CE  . MET E 11  ? 1.9101 1.6953 1.0764 -0.3718 -0.0945 0.2085  11   MET L CE  
4708 N N   . SER E 12  ? 2.0604 1.5922 1.2081 -0.3743 0.0799  0.2025  12   SER L N   
4709 C CA  . SER E 12  ? 2.0500 1.6569 1.2022 -0.4068 0.0397  0.2118  12   SER L CA  
4710 C C   . SER E 12  ? 2.0561 1.7805 1.1894 -0.4715 -0.0246 0.2048  12   SER L C   
4711 O O   . SER E 12  ? 2.2141 1.9178 1.2873 -0.5285 -0.0156 0.1777  12   SER L O   
4712 C CB  . SER E 12  ? 2.2973 1.7978 1.3803 -0.4647 0.1063  0.1863  12   SER L CB  
4713 O OG  . SER E 12  ? 2.5597 1.9782 1.5418 -0.5560 0.1559  0.1406  12   SER L OG  
4714 N N   . ALA E 13  ? 1.9221 1.7701 1.1078 -0.4600 -0.0883 0.2325  13   ALA L N   
4715 C CA  . ALA E 13  ? 1.6718 1.6472 0.8556 -0.5078 -0.1543 0.2377  13   ALA L CA  
4716 C C   . ALA E 13  ? 1.9193 1.9972 1.1409 -0.5240 -0.1900 0.2569  13   ALA L C   
4717 O O   . ALA E 13  ? 1.5492 1.6637 0.8409 -0.4534 -0.2082 0.2871  13   ALA L O   
4718 C CB  . ALA E 13  ? 1.6433 1.6876 0.8770 -0.4443 -0.2080 0.2640  13   ALA L CB  
4719 N N   . SER E 14  ? 1.8961 2.0231 1.0697 -0.6210 -0.1987 0.2397  14   SER L N   
4720 C CA  . SER E 14  ? 1.8849 2.1283 1.0999 -0.6451 -0.2327 0.2581  14   SER L CA  
4721 C C   . SER E 14  ? 1.7295 2.1294 1.0249 -0.5982 -0.3114 0.3007  14   SER L C   
4722 O O   . SER E 14  ? 1.7090 2.1329 1.0001 -0.5828 -0.3437 0.3087  14   SER L O   
4723 C CB  . SER E 14  ? 2.1265 2.3857 1.2642 -0.7715 -0.2197 0.2283  14   SER L CB  
4724 O OG  . SER E 14  ? 2.3712 2.4685 1.4238 -0.8164 -0.1377 0.1876  14   SER L OG  
4725 N N   . PRO E 15  ? 1.6809 2.1818 1.0476 -0.5735 -0.3384 0.3289  15   PRO L N   
4726 C CA  . PRO E 15  ? 1.5492 2.1874 0.9988 -0.5208 -0.4010 0.3701  15   PRO L CA  
4727 C C   . PRO E 15  ? 1.5864 2.2992 1.0525 -0.5687 -0.4203 0.3626  15   PRO L C   
4728 O O   . PRO E 15  ? 1.8127 2.5705 1.2358 -0.6653 -0.4210 0.3506  15   PRO L O   
4729 C CB  . PRO E 15  ? 1.5622 2.2794 1.0773 -0.5031 -0.4062 0.3926  15   PRO L CB  
4730 C CG  . PRO E 15  ? 1.5908 2.1783 1.0695 -0.5068 -0.3441 0.3664  15   PRO L CG  
4731 C CD  . PRO E 15  ? 1.6964 2.1750 1.0768 -0.5810 -0.3034 0.3241  15   PRO L CD  
4732 N N   . GLY E 16  ? 1.4675 2.1840 0.9868 -0.5036 -0.4320 0.3692  16   GLY L N   
4733 C CA  . GLY E 16  ? 1.5211 2.2931 1.0487 -0.5356 -0.4496 0.3700  16   GLY L CA  
4734 C C   . GLY E 16  ? 1.4612 2.1543 0.9045 -0.5792 -0.4420 0.3448  16   GLY L C   
4735 O O   . GLY E 16  ? 1.6625 2.3843 1.1157 -0.5840 -0.4570 0.3488  16   GLY L O   
4736 N N   . GLU E 17  ? 1.6249 2.2130 0.9770 -0.6118 -0.4162 0.3200  17   GLU L N   
4737 C CA  . GLU E 17  ? 1.8068 2.3083 1.0683 -0.6569 -0.4005 0.2924  17   GLU L CA  
4738 C C   . GLU E 17  ? 1.8820 2.3514 1.1878 -0.5667 -0.4065 0.2990  17   GLU L C   
4739 O O   . GLU E 17  ? 1.4114 1.8919 0.7960 -0.4719 -0.4121 0.3170  17   GLU L O   
4740 C CB  . GLU E 17  ? 2.0686 2.4439 1.1984 -0.7168 -0.3570 0.2608  17   GLU L CB  
4741 C CG  . GLU E 17  ? 2.2923 2.6570 1.3540 -0.8203 -0.3295 0.2358  17   GLU L CG  
4742 C CD  . GLU E 17  ? 2.4017 2.5836 1.3882 -0.8452 -0.2383 0.1889  17   GLU L CD  
4743 O OE1 . GLU E 17  ? 2.3660 2.4462 1.3523 -0.7841 -0.2037 0.1805  17   GLU L OE1 
4744 O OE2 . GLU E 17  ? 2.5003 2.6404 1.4278 -0.9260 -0.1984 0.1618  17   GLU L OE2 
4745 N N   . LYS E 18  ? 1.8251 2.2466 1.0713 -0.6036 -0.4002 0.2796  18   LYS L N   
4746 C CA  . LYS E 18  ? 1.8130 2.1974 1.0829 -0.5350 -0.4019 0.2797  18   LYS L CA  
4747 C C   . LYS E 18  ? 1.7801 2.0567 0.9801 -0.5290 -0.3702 0.2633  18   LYS L C   
4748 O O   . LYS E 18  ? 1.9190 2.1145 1.0031 -0.6094 -0.3383 0.2353  18   LYS L O   
4749 C CB  . LYS E 18  ? 1.8421 2.2339 1.0826 -0.5782 -0.4116 0.2713  18   LYS L CB  
4750 C CG  . LYS E 18  ? 1.7989 2.1541 1.0557 -0.5165 -0.4129 0.2689  18   LYS L CG  
4751 C CD  . LYS E 18  ? 1.9677 2.3459 1.2044 -0.5557 -0.4287 0.2692  18   LYS L CD  
4752 C CE  . LYS E 18  ? 1.9611 2.2909 1.1924 -0.5113 -0.4256 0.2614  18   LYS L CE  
4753 N NZ  . LYS E 18  ? 1.9841 2.2182 1.1324 -0.5489 -0.3936 0.2326  18   LYS L NZ  
4754 N N   . VAL E 19  ? 2.0765 1.7315 1.0144 -0.3868 -0.2551 0.0311  19   VAL L N   
4755 C CA  . VAL E 19  ? 2.1425 1.6800 1.0839 -0.3575 -0.2193 0.0216  19   VAL L CA  
4756 C C   . VAL E 19  ? 2.1163 1.6355 1.0763 -0.3115 -0.2092 0.0343  19   VAL L C   
4757 O O   . VAL E 19  ? 2.1010 1.6914 1.1076 -0.2794 -0.2328 0.0620  19   VAL L O   
4758 C CB  . VAL E 19  ? 2.1210 1.6543 1.1241 -0.3279 -0.2229 0.0337  19   VAL L CB  
4759 C CG1 . VAL E 19  ? 2.1056 1.5256 1.1110 -0.2992 -0.1900 0.0281  19   VAL L CG1 
4760 C CG2 . VAL E 19  ? 2.1725 1.7395 1.1566 -0.3794 -0.2342 0.0244  19   VAL L CG2 
4761 N N   . THR E 20  ? 2.1427 1.5648 1.0688 -0.3087 -0.1714 0.0133  20   THR L N   
4762 C CA  . THR E 20  ? 2.1338 1.5383 1.0743 -0.2717 -0.1555 0.0208  20   THR L CA  
4763 C C   . THR E 20  ? 2.1261 1.4307 1.0786 -0.2443 -0.1155 0.0022  20   THR L C   
4764 O O   . THR E 20  ? 2.2703 1.4973 1.1700 -0.2725 -0.0849 -0.0299 20   THR L O   
4765 C CB  . THR E 20  ? 2.0743 1.4966 0.9426 -0.3096 -0.1512 0.0117  20   THR L CB  
4766 O OG1 . THR E 20  ? 2.0356 1.5631 0.9011 -0.3277 -0.1940 0.0373  20   THR L OG1 
4767 C CG2 . THR E 20  ? 1.9742 1.3754 0.8526 -0.2770 -0.1300 0.0191  20   THR L CG2 
4768 N N   . MET E 21  ? 2.0221 1.3308 1.0464 -0.1898 -0.1144 0.0206  21   MET L N   
4769 C CA  . MET E 21  ? 1.9884 1.2237 1.0392 -0.1554 -0.0810 0.0086  21   MET L CA  
4770 C C   . MET E 21  ? 1.9867 1.2346 1.0659 -0.1243 -0.0648 0.0122  21   MET L C   
4771 O O   . MET E 21  ? 2.0287 1.3401 1.1338 -0.1140 -0.0855 0.0353  21   MET L O   
4772 C CB  . MET E 21  ? 1.8566 1.0932 0.9691 -0.1228 -0.0938 0.0263  21   MET L CB  
4773 C CG  . MET E 21  ? 1.8310 1.1548 1.0065 -0.0979 -0.1253 0.0531  21   MET L CG  
4774 S SD  . MET E 21  ? 1.8139 1.1635 1.0341 -0.0874 -0.1480 0.0694  21   MET L SD  
4775 C CE  . MET E 21  ? 1.9162 1.2658 1.0712 -0.1476 -0.1610 0.0610  21   MET L CE  
4776 N N   . THR E 22  ? 2.0284 1.2138 1.1064 -0.1089 -0.0252 -0.0109 22   THR L N   
4777 C CA  . THR E 22  ? 1.8889 1.0855 0.9860 -0.0886 -0.0018 -0.0146 22   THR L CA  
4778 C C   . THR E 22  ? 1.8906 1.0842 1.0703 -0.0354 0.0101  -0.0096 22   THR L C   
4779 O O   . THR E 22  ? 1.9137 1.0759 1.1239 -0.0133 0.0095  -0.0083 22   THR L O   
4780 C CB  . THR E 22  ? 1.9943 1.1404 1.0241 -0.1179 0.0397  -0.0522 22   THR L CB  
4781 O OG1 . THR E 22  ? 2.2370 1.3007 1.2648 -0.1095 0.0699  -0.0812 22   THR L OG1 
4782 C CG2 . THR E 22  ? 2.0970 1.2641 1.0413 -0.1762 0.0243  -0.0561 22   THR L CG2 
4783 N N   . CYS E 23  ? 1.9409 1.1721 1.1548 -0.0181 0.0201  -0.0041 23   CYS L N   
4784 C CA  . CYS E 23  ? 1.8875 1.1386 1.1828 0.0265  0.0312  -0.0011 23   CYS L CA  
4785 C C   . CYS E 23  ? 1.9462 1.2025 1.2401 0.0257  0.0688  -0.0187 23   CYS L C   
4786 O O   . CYS E 23  ? 1.9829 1.2690 1.2521 0.0036  0.0649  -0.0073 23   CYS L O   
4787 C CB  . CYS E 23  ? 1.8104 1.1257 1.1634 0.0423  -0.0040 0.0280  23   CYS L CB  
4788 S SG  . CYS E 23  ? 1.8443 1.2057 1.2968 0.0870  0.0044  0.0303  23   CYS L SG  
4789 N N   . SER E 24  ? 1.9926 1.2204 1.3131 0.0497  0.1062  -0.0448 24   SER L N   
4790 C CA  . SER E 24  ? 2.0219 1.2567 1.3407 0.0463  0.1498  -0.0698 24   SER L CA  
4791 C C   . SER E 24  ? 2.1070 1.3885 1.5224 0.0900  0.1626  -0.0700 24   SER L C   
4792 O O   . SER E 24  ? 2.0912 1.3674 1.5639 0.1300  0.1586  -0.0684 24   SER L O   
4793 C CB  . SER E 24  ? 2.1323 1.3000 1.3998 0.0335  0.1925  -0.1117 24   SER L CB  
4794 O OG  . SER E 24  ? 2.2585 1.4417 1.5276 0.0294  0.2390  -0.1402 24   SER L OG  
4795 N N   . ALA E 25  ? 2.1289 1.4589 1.5608 0.0798  0.1778  -0.0699 25   ALA L N   
4796 C CA  . ALA E 25  ? 2.1013 1.4908 1.6239 0.1113  0.1922  -0.0740 25   ALA L CA  
4797 C C   . ALA E 25  ? 2.0875 1.4813 1.6158 0.1114  0.2486  -0.1117 25   ALA L C   
4798 O O   . ALA E 25  ? 2.1652 1.5285 1.6179 0.0743  0.2754  -0.1296 25   ALA L O   
4799 C CB  . ALA E 25  ? 2.0643 1.5087 1.6111 0.0961  0.1713  -0.0490 25   ALA L CB  
4800 N N   . SER E 26  ? 1.8839 1.3261 1.5043 0.1523  0.2666  -0.1244 26   SER L N   
4801 C CA  . SER E 26  ? 1.8282 1.2879 1.4720 0.1591  0.3235  -0.1645 26   SER L CA  
4802 C C   . SER E 26  ? 1.8257 1.3325 1.4502 0.1161  0.3480  -0.1698 26   SER L C   
4803 O O   . SER E 26  ? 1.8892 1.3951 1.4872 0.0975  0.3982  -0.2043 26   SER L O   
4804 C CB  . SER E 26  ? 1.8075 1.3206 1.5666 0.2195  0.3316  -0.1723 26   SER L CB  
4805 O OG  . SER E 26  ? 1.5942 1.1912 1.4219 0.2278  0.3007  -0.1468 26   SER L OG  
4806 N N   . SER E 27  ? 1.7501 1.2941 1.3851 0.0976  0.3169  -0.1374 27   SER L N   
4807 C CA  . SER E 27  ? 1.8538 1.4328 1.4720 0.0554  0.3383  -0.1349 27   SER L CA  
4808 C C   . SER E 27  ? 2.0106 1.5539 1.5584 0.0185  0.3018  -0.0945 27   SER L C   
4809 O O   . SER E 27  ? 1.8831 1.3905 1.4078 0.0279  0.2596  -0.0724 27   SER L O   
4810 C CB  . SER E 27  ? 1.7810 1.4485 1.5021 0.0701  0.3457  -0.1392 27   SER L CB  
4811 O OG  . SER E 27  ? 1.7815 1.4957 1.5794 0.1110  0.3764  -0.1730 27   SER L OG  
4812 N N   . SER E 28  ? 2.2819 1.8361 1.7974 -0.0233 0.3194  -0.0834 28   SER L N   
4813 C CA  . SER E 28  ? 2.3423 1.8633 1.8015 -0.0526 0.2864  -0.0395 28   SER L CA  
4814 C C   . SER E 28  ? 2.2451 1.7862 1.7747 -0.0309 0.2482  -0.0185 28   SER L C   
4815 O O   . SER E 28  ? 2.2514 1.8433 1.8553 -0.0264 0.2609  -0.0292 28   SER L O   
4816 C CB  . SER E 28  ? 2.4459 1.9680 1.8562 -0.1016 0.3173  -0.0277 28   SER L CB  
4817 O OG  . SER E 28  ? 2.5896 2.0988 1.9248 -0.1284 0.3538  -0.0496 28   SER L OG  
4818 N N   . VAL E 29  ? 2.0968 1.6053 1.6033 -0.0211 0.2034  0.0072  29   VAL L N   
4819 C CA  . VAL E 29  ? 1.9028 1.4291 1.4696 -0.0009 0.1674  0.0215  29   VAL L CA  
4820 C C   . VAL E 29  ? 1.8296 1.3243 1.3641 -0.0228 0.1465  0.0588  29   VAL L C   
4821 O O   . VAL E 29  ? 1.9809 1.4368 1.4394 -0.0401 0.1365  0.0828  29   VAL L O   
4822 C CB  . VAL E 29  ? 1.7597 1.2800 1.3363 0.0310  0.1348  0.0188  29   VAL L CB  
4823 C CG1 . VAL E 29  ? 1.7705 1.3051 1.3865 0.0422  0.0960  0.0363  29   VAL L CG1 
4824 C CG2 . VAL E 29  ? 1.7823 1.3355 1.4140 0.0617  0.1526  -0.0107 29   VAL L CG2 
4825 N N   . THR E 30  ? 1.6499 1.1630 1.2443 -0.0219 0.1403  0.0633  30   THR L N   
4826 C CA  . THR E 30  ? 1.7600 1.2343 1.3367 -0.0372 0.1254  0.0979  30   THR L CA  
4827 C C   . THR E 30  ? 1.6693 1.1256 1.2337 -0.0166 0.0808  0.1183  30   THR L C   
4828 O O   . THR E 30  ? 1.7844 1.2045 1.2934 -0.0247 0.0645  0.1525  30   THR L O   
4829 C CB  . THR E 30  ? 1.4724 0.9652 1.1192 -0.0460 0.1382  0.0880  30   THR L CB  
4830 O OG1 . THR E 30  ? 1.4868 1.0181 1.1582 -0.0646 0.1791  0.0618  30   THR L OG1 
4831 C CG2 . THR E 30  ? 1.5275 0.9616 1.1509 -0.0651 0.1360  0.1246  30   THR L CG2 
4832 N N   . TYR E 31  ? 1.6861 1.1753 1.3019 0.0088  0.0599  0.0996  31   TYR L N   
4833 C CA  . TYR E 31  ? 1.7504 1.2344 1.3651 0.0253  0.0211  0.1139  31   TYR L CA  
4834 C C   . TYR E 31  ? 1.7118 1.2226 1.3335 0.0445  0.0050  0.0951  31   TYR L C   
4835 O O   . TYR E 31  ? 1.7516 1.2938 1.4097 0.0545  0.0183  0.0713  31   TYR L O   
4836 C CB  . TYR E 31  ? 1.8283 1.3200 1.5042 0.0310  0.0114  0.1135  31   TYR L CB  
4837 C CG  . TYR E 31  ? 1.8769 1.3200 1.5406 0.0184  0.0175  0.1435  31   TYR L CG  
4838 C CD1 . TYR E 31  ? 1.9003 1.3140 1.5288 0.0266  -0.0083 0.1796  31   TYR L CD1 
4839 C CD2 . TYR E 31  ? 1.8954 1.3234 1.5849 -0.0021 0.0487  0.1383  31   TYR L CD2 
4840 C CE1 . TYR E 31  ? 1.9429 1.3075 1.5630 0.0212  -0.0052 0.2153  31   TYR L CE1 
4841 C CE2 . TYR E 31  ? 2.0047 1.3741 1.6805 -0.0137 0.0557  0.1712  31   TYR L CE2 
4842 C CZ  . TYR E 31  ? 2.0362 1.3711 1.6777 0.0012  0.0277  0.2124  31   TYR L CZ  
4843 O OH  . TYR E 31  ? 2.1984 1.4707 1.8290 -0.0043 0.0323  0.2533  31   TYR L OH  
4844 N N   . MET E 32  ? 1.7342 1.2348 1.3228 0.0494  -0.0244 0.1089  32   MET L N   
4845 C CA  . MET E 32  ? 1.6308 1.1436 1.2134 0.0612  -0.0404 0.0970  32   MET L CA  
4846 C C   . MET E 32  ? 1.5486 1.0833 1.1532 0.0693  -0.0737 0.1043  32   MET L C   
4847 O O   . MET E 32  ? 1.5326 1.0612 1.1279 0.0659  -0.0889 0.1238  32   MET L O   
4848 C CB  . MET E 32  ? 1.5720 1.0506 1.0783 0.0477  -0.0364 0.0992  32   MET L CB  
4849 C CG  . MET E 32  ? 1.4970 0.9693 0.9896 0.0548  -0.0458 0.0861  32   MET L CG  
4850 S SD  . MET E 32  ? 1.4429 0.9222 0.9827 0.0801  -0.0232 0.0619  32   MET L SD  
4851 C CE  . MET E 32  ? 1.4072 0.8724 0.9348 0.0727  0.0225  0.0459  32   MET L CE  
4852 N N   . TYR E 33  ? 1.5543 1.1185 1.1896 0.0809  -0.0844 0.0902  33   TYR L N   
4853 C CA  . TYR E 33  ? 1.4910 1.0869 1.1499 0.0850  -0.1112 0.0908  33   TYR L CA  
4854 C C   . TYR E 33  ? 1.4299 1.0257 1.0583 0.0838  -0.1261 0.0900  33   TYR L C   
4855 O O   . TYR E 33  ? 1.3824 0.9618 0.9994 0.0892  -0.1149 0.0843  33   TYR L O   
4856 C CB  . TYR E 33  ? 1.4509 1.0919 1.1782 0.0918  -0.1089 0.0736  33   TYR L CB  
4857 C CG  . TYR E 33  ? 1.4092 1.0424 1.1677 0.0873  -0.0862 0.0688  33   TYR L CG  
4858 C CD1 . TYR E 33  ? 1.4831 1.0994 1.2565 0.0847  -0.0870 0.0764  33   TYR L CD1 
4859 C CD2 . TYR E 33  ? 1.3836 1.0255 1.1598 0.0856  -0.0623 0.0571  33   TYR L CD2 
4860 C CE1 . TYR E 33  ? 1.4466 1.0424 1.2445 0.0761  -0.0633 0.0740  33   TYR L CE1 
4861 C CE2 . TYR E 33  ? 1.5015 1.1370 1.3038 0.0736  -0.0386 0.0513  33   TYR L CE2 
4862 C CZ  . TYR E 33  ? 1.4906 1.0967 1.2999 0.0667  -0.0387 0.0605  33   TYR L CZ  
4863 O OH  . TYR E 33  ? 1.5408 1.1271 1.3722 0.0508  -0.0127 0.0570  33   TYR L OH  
4864 N N   . TRP E 34  ? 1.3702 0.9830 0.9880 0.0768  -0.1495 0.0962  34   TRP L N   
4865 C CA  . TRP E 34  ? 1.3141 0.9223 0.8948 0.0663  -0.1632 0.0974  34   TRP L CA  
4866 C C   . TRP E 34  ? 1.2351 0.8957 0.8500 0.0659  -0.1818 0.0923  34   TRP L C   
4867 O O   . TRP E 34  ? 1.2060 0.9035 0.8515 0.0667  -0.1917 0.0899  34   TRP L O   
4868 C CB  . TRP E 34  ? 1.3842 0.9741 0.9086 0.0469  -0.1730 0.1077  34   TRP L CB  
4869 C CG  . TRP E 34  ? 1.4644 1.0059 0.9398 0.0384  -0.1541 0.1093  34   TRP L CG  
4870 C CD1 . TRP E 34  ? 1.5425 1.0746 1.0086 0.0376  -0.1450 0.1196  34   TRP L CD1 
4871 C CD2 . TRP E 34  ? 1.6338 1.1268 1.0586 0.0267  -0.1385 0.0989  34   TRP L CD2 
4872 N NE1 . TRP E 34  ? 1.7162 1.2064 1.1256 0.0226  -0.1247 0.1139  34   TRP L NE1 
4873 C CE2 . TRP E 34  ? 1.7952 1.2590 1.1813 0.0170  -0.1187 0.0978  34   TRP L CE2 
4874 C CE3 . TRP E 34  ? 1.6279 1.0938 1.0351 0.0224  -0.1371 0.0907  34   TRP L CE3 
4875 C CZ2 . TRP E 34  ? 1.8357 1.2485 1.1693 0.0032  -0.0948 0.0810  34   TRP L CZ2 
4876 C CZ3 . TRP E 34  ? 1.7631 1.1674 1.1216 0.0124  -0.1139 0.0777  34   TRP L CZ3 
4877 C CH2 . TRP E 34  ? 1.8387 1.2191 1.1623 0.0028  -0.0917 0.0692  34   TRP L CH2 
4878 N N   . TYR E 35  ? 1.2844 0.9470 0.8929 0.0648  -0.1851 0.0916  35   TYR L N   
4879 C CA  . TYR E 35  ? 1.3019 1.0170 0.9319 0.0585  -0.2010 0.0882  35   TYR L CA  
4880 C C   . TYR E 35  ? 1.2656 0.9600 0.8446 0.0385  -0.2115 0.0984  35   TYR L C   
4881 O O   . TYR E 35  ? 1.3464 0.9794 0.8847 0.0374  -0.2026 0.1062  35   TYR L O   
4882 C CB  . TYR E 35  ? 1.2626 1.0095 0.9328 0.0722  -0.1975 0.0841  35   TYR L CB  
4883 C CG  . TYR E 35  ? 1.2932 1.0601 1.0132 0.0846  -0.1833 0.0701  35   TYR L CG  
4884 C CD1 . TYR E 35  ? 1.3045 1.0347 1.0254 0.0969  -0.1640 0.0717  35   TYR L CD1 
4885 C CD2 . TYR E 35  ? 1.2995 1.1219 1.0657 0.0798  -0.1853 0.0514  35   TYR L CD2 
4886 C CE1 . TYR E 35  ? 1.3434 1.0923 1.1079 0.1012  -0.1486 0.0585  35   TYR L CE1 
4887 C CE2 . TYR E 35  ? 1.2503 1.0831 1.0599 0.0847  -0.1691 0.0359  35   TYR L CE2 
4888 C CZ  . TYR E 35  ? 1.2675 1.0639 1.0752 0.0939  -0.1516 0.0414  35   TYR L CZ  
4889 O OH  . TYR E 35  ? 1.3532 1.1600 1.2020 0.0920  -0.1331 0.0257  35   TYR L OH  
4890 N N   . GLN E 36  ? 1.3066 1.0505 0.8889 0.0204  -0.2268 0.0952  36   GLN L N   
4891 C CA  . GLN E 36  ? 1.1555 0.8884 0.6919 -0.0060 -0.2359 0.1047  36   GLN L CA  
4892 C C   . GLN E 36  ? 1.2219 0.9970 0.7736 -0.0091 -0.2437 0.1098  36   GLN L C   
4893 O O   . GLN E 36  ? 1.4635 1.3097 1.0594 -0.0073 -0.2477 0.0951  36   GLN L O   
4894 C CB  . GLN E 36  ? 1.1528 0.9224 0.6764 -0.0319 -0.2470 0.0978  36   GLN L CB  
4895 C CG  . GLN E 36  ? 1.1820 0.9636 0.6680 -0.0677 -0.2556 0.1028  36   GLN L CG  
4896 C CD  . GLN E 36  ? 1.3453 1.1917 0.8358 -0.0926 -0.2665 0.0913  36   GLN L CD  
4897 O OE1 . GLN E 36  ? 1.5015 1.3865 1.0302 -0.0762 -0.2702 0.0824  36   GLN L OE1 
4898 N NE2 . GLN E 36  ? 1.4930 1.3532 0.9472 -0.1319 -0.2715 0.0934  36   GLN L NE2 
4899 N N   . GLN E 37  ? 1.2585 0.9880 0.7719 -0.0151 -0.2448 0.1309  37   GLN L N   
4900 C CA  . GLN E 37  ? 1.3481 1.1147 0.8635 -0.0210 -0.2557 0.1464  37   GLN L CA  
4901 C C   . GLN E 37  ? 1.3896 1.1194 0.8447 -0.0547 -0.2611 0.1660  37   GLN L C   
4902 O O   . GLN E 37  ? 1.4246 1.0637 0.8379 -0.0559 -0.2524 0.1796  37   GLN L O   
4903 C CB  . GLN E 37  ? 1.2131 0.9625 0.7501 0.0128  -0.2537 0.1638  37   GLN L CB  
4904 C CG  . GLN E 37  ? 1.2145 1.0271 0.7598 0.0077  -0.2701 0.1816  37   GLN L CG  
4905 C CD  . GLN E 37  ? 1.2280 1.0399 0.8022 0.0439  -0.2723 0.2020  37   GLN L CD  
4906 O OE1 . GLN E 37  ? 1.2853 1.0310 0.8650 0.0728  -0.2589 0.2072  37   GLN L OE1 
4907 N NE2 . GLN E 37  ? 1.2150 1.1101 0.8099 0.0416  -0.2887 0.2119  37   GLN L NE2 
4908 N N   . LYS E 38  ? 1.3494 1.1478 0.7989 -0.0859 -0.2718 0.1641  38   LYS L N   
4909 C CA  . LYS E 38  ? 1.4325 1.2036 0.8232 -0.1253 -0.2759 0.1849  38   LYS L CA  
4910 C C   . LYS E 38  ? 1.4287 1.1978 0.8041 -0.1217 -0.2859 0.2215  38   LYS L C   
4911 O O   . LYS E 38  ? 1.3870 1.2198 0.8028 -0.1001 -0.2936 0.2215  38   LYS L O   
4912 C CB  . LYS E 38  ? 1.5163 1.3709 0.9069 -0.1667 -0.2797 0.1622  38   LYS L CB  
4913 C CG  . LYS E 38  ? 1.5999 1.4716 1.0124 -0.1663 -0.2752 0.1321  38   LYS L CG  
4914 C CD  . LYS E 38  ? 1.8142 1.7691 1.2288 -0.2063 -0.2786 0.1123  38   LYS L CD  
4915 C CE  . LYS E 38  ? 2.1727 2.0887 1.5179 -0.2578 -0.2778 0.1293  38   LYS L CE  
4916 N NZ  . LYS E 38  ? 2.2831 2.2906 1.6326 -0.3015 -0.2794 0.1078  38   LYS L NZ  
4917 N N   . PRO E 39  ? 1.6338 1.3280 0.9507 -0.1426 -0.2861 0.2557  39   PRO L N   
4918 C CA  . PRO E 39  ? 1.6019 1.2905 0.9019 -0.1354 -0.2991 0.3017  39   PRO L CA  
4919 C C   . PRO E 39  ? 1.4694 1.2808 0.7760 -0.1635 -0.3137 0.2989  39   PRO L C   
4920 O O   . PRO E 39  ? 1.4731 1.3273 0.7517 -0.2126 -0.3120 0.2861  39   PRO L O   
4921 C CB  . PRO E 39  ? 1.6606 1.2369 0.8896 -0.1639 -0.2925 0.3347  39   PRO L CB  
4922 C CG  . PRO E 39  ? 1.8863 1.3876 1.1063 -0.1660 -0.2727 0.3041  39   PRO L CG  
4923 C CD  . PRO E 39  ? 1.8505 1.4507 1.1132 -0.1713 -0.2734 0.2564  39   PRO L CD  
4924 N N   . GLY E 40  ? 1.4394 1.3164 0.7850 -0.1353 -0.3261 0.3064  40   GLY L N   
4925 C CA  . GLY E 40  ? 1.5237 1.5195 0.8716 -0.1626 -0.3391 0.3033  40   GLY L CA  
4926 C C   . GLY E 40  ? 1.4684 1.5656 0.8791 -0.1580 -0.3327 0.2462  40   GLY L C   
4927 O O   . GLY E 40  ? 1.6412 1.8378 1.0671 -0.1692 -0.3418 0.2381  40   GLY L O   
4928 N N   . SER E 41  ? 1.2672 1.3401 0.7120 -0.1439 -0.3168 0.2072  41   SER L N   
4929 C CA  . SER E 41  ? 1.5318 1.6812 1.0377 -0.1371 -0.3074 0.1551  41   SER L CA  
4930 C C   . SER E 41  ? 1.4655 1.5835 1.0199 -0.0903 -0.3023 0.1477  41   SER L C   
4931 O O   . SER E 41  ? 1.3450 1.3815 0.8882 -0.0623 -0.3027 0.1763  41   SER L O   
4932 C CB  . SER E 41  ? 1.6113 1.7691 1.1266 -0.1547 -0.2946 0.1197  41   SER L CB  
4933 O OG  . SER E 41  ? 1.6353 1.7025 1.1419 -0.1362 -0.2890 0.1267  41   SER L OG  
4934 N N   . SER E 42  ? 1.3553 1.5388 0.9647 -0.0845 -0.2940 0.1064  42   SER L N   
4935 C CA  . SER E 42  ? 1.1809 1.3412 0.8376 -0.0485 -0.2851 0.0943  42   SER L CA  
4936 C C   . SER E 42  ? 1.0557 1.1390 0.7170 -0.0313 -0.2717 0.0858  42   SER L C   
4937 O O   . SER E 42  ? 1.1032 1.1779 0.7469 -0.0483 -0.2697 0.0778  42   SER L O   
4938 C CB  . SER E 42  ? 1.1867 1.4327 0.8963 -0.0556 -0.2770 0.0505  42   SER L CB  
4939 O OG  . SER E 42  ? 1.2625 1.5908 0.9627 -0.0762 -0.2910 0.0574  42   SER L OG  
4940 N N   . PRO E 43  ? 1.0489 1.0836 0.7321 -0.0004 -0.2629 0.0884  43   PRO L N   
4941 C CA  . PRO E 43  ? 1.1622 1.1309 0.8432 0.0119  -0.2508 0.0822  43   PRO L CA  
4942 C C   . PRO E 43  ? 1.2346 1.2388 0.9540 0.0076  -0.2425 0.0486  43   PRO L C   
4943 O O   . PRO E 43  ? 1.3540 1.4236 1.1125 0.0005  -0.2389 0.0217  43   PRO L O   
4944 C CB  . PRO E 43  ? 1.0489 0.9764 0.7491 0.0419  -0.2403 0.0890  43   PRO L CB  
4945 C CG  . PRO E 43  ? 1.0650 1.0225 0.7697 0.0498  -0.2507 0.1088  43   PRO L CG  
4946 C CD  . PRO E 43  ? 1.0518 1.0947 0.7592 0.0229  -0.2642 0.1005  43   PRO L CD  
4947 N N   . ARG E 44  ? 1.1271 1.0869 0.8360 0.0126  -0.2387 0.0500  44   ARG L N   
4948 C CA  . ARG E 44  ? 1.3026 1.2839 1.0531 0.0189  -0.2316 0.0270  44   ARG L CA  
4949 C C   . ARG E 44  ? 1.4896 1.4063 1.2376 0.0390  -0.2236 0.0379  44   ARG L C   
4950 O O   . ARG E 44  ? 1.4318 1.2950 1.1332 0.0382  -0.2258 0.0587  44   ARG L O   
4951 C CB  . ARG E 44  ? 1.1682 1.1914 0.9141 0.0010  -0.2401 0.0192  44   ARG L CB  
4952 C CG  . ARG E 44  ? 1.2093 1.1953 0.9157 -0.0042 -0.2483 0.0382  44   ARG L CG  
4953 C CD  . ARG E 44  ? 1.2784 1.3258 1.0133 -0.0106 -0.2537 0.0231  44   ARG L CD  
4954 N NE  . ARG E 44  ? 1.5190 1.5489 1.2184 -0.0201 -0.2648 0.0401  44   ARG L NE  
4955 C CZ  . ARG E 44  ? 1.6242 1.7101 1.3484 -0.0221 -0.2734 0.0338  44   ARG L CZ  
4956 N NH1 . ARG E 44  ? 1.5686 1.7242 1.3580 -0.0107 -0.2687 0.0090  44   ARG L NH1 
4957 N NH2 . ARG E 44  ? 1.6835 1.7611 1.3701 -0.0360 -0.2858 0.0499  44   ARG L NH2 
4958 N N   . LEU E 45  ? 1.5155 1.4340 1.3104 0.0537  -0.2115 0.0230  45   LEU L N   
4959 C CA  . LEU E 45  ? 1.4234 1.2831 1.2132 0.0691  -0.2027 0.0369  45   LEU L CA  
4960 C C   . LEU E 45  ? 1.4079 1.2564 1.1751 0.0694  -0.2146 0.0528  45   LEU L C   
4961 O O   . LEU E 45  ? 1.4385 1.3265 1.2396 0.0737  -0.2205 0.0438  45   LEU L O   
4962 C CB  . LEU E 45  ? 1.4757 1.3341 1.3201 0.0804  -0.1853 0.0195  45   LEU L CB  
4963 C CG  . LEU E 45  ? 1.4854 1.2830 1.3241 0.0930  -0.1748 0.0378  45   LEU L CG  
4964 C CD1 . LEU E 45  ? 1.5371 1.2951 1.3366 0.0907  -0.1666 0.0519  45   LEU L CD1 
4965 C CD2 . LEU E 45  ? 1.4566 1.2459 1.3512 0.1002  -0.1559 0.0203  45   LEU L CD2 
4966 N N   . LEU E 46  ? 1.3950 1.1966 1.1072 0.0643  -0.2175 0.0739  46   LEU L N   
4967 C CA  . LEU E 46  ? 1.3333 1.1304 1.0171 0.0599  -0.2304 0.0906  46   LEU L CA  
4968 C C   . LEU E 46  ? 1.2308 0.9938 0.9206 0.0760  -0.2243 0.1073  46   LEU L C   
4969 O O   . LEU E 46  ? 1.1412 0.9264 0.8572 0.0881  -0.2349 0.1177  46   LEU L O   
4970 C CB  . LEU E 46  ? 1.4062 1.1717 1.0190 0.0369  -0.2349 0.1001  46   LEU L CB  
4971 C CG  . LEU E 46  ? 1.5053 1.2929 1.0975 0.0144  -0.2430 0.0929  46   LEU L CG  
4972 C CD1 . LEU E 46  ? 1.6401 1.3782 1.1605 -0.0101 -0.2427 0.1009  46   LEU L CD1 
4973 C CD2 . LEU E 46  ? 1.4614 1.3241 1.0848 0.0065  -0.2582 0.0846  46   LEU L CD2 
4974 N N   . ILE E 47  ? 1.2887 1.0003 0.9563 0.0770  -0.2067 0.1122  47   ILE L N   
4975 C CA  . ILE E 47  ? 1.3338 1.0073 0.9906 0.0839  -0.1986 0.1322  47   ILE L CA  
4976 C C   . ILE E 47  ? 1.4185 1.0664 1.1075 0.0916  -0.1731 0.1218  47   ILE L C   
4977 O O   . ILE E 47  ? 1.3913 1.0353 1.0775 0.0873  -0.1603 0.1066  47   ILE L O   
4978 C CB  . ILE E 47  ? 1.2105 0.8504 0.7909 0.0657  -0.1986 0.1474  47   ILE L CB  
4979 C CG1 . ILE E 47  ? 1.2774 0.9499 0.8238 0.0507  -0.2245 0.1571  47   ILE L CG1 
4980 C CG2 . ILE E 47  ? 1.2550 0.8576 0.8172 0.0676  -0.1865 0.1689  47   ILE L CG2 
4981 C CD1 . ILE E 47  ? 1.2295 0.9416 0.8094 0.0660  -0.2454 0.1784  47   ILE L CD1 
4982 N N   . TYR E 48  ? 1.5387 1.1695 1.2603 0.1027  -0.1654 0.1315  48   TYR L N   
4983 C CA  . TYR E 48  ? 1.4695 1.0719 1.2160 0.1017  -0.1383 0.1229  48   TYR L CA  
4984 C C   . TYR E 48  ? 1.5011 1.0523 1.2144 0.0982  -0.1283 0.1541  48   TYR L C   
4985 O O   . TYR E 48  ? 1.4812 1.0234 1.1754 0.1048  -0.1454 0.1848  48   TYR L O   
4986 C CB  . TYR E 48  ? 1.4242 1.0434 1.2427 0.1100  -0.1299 0.0997  48   TYR L CB  
4987 C CG  . TYR E 48  ? 1.4894 1.0911 1.3388 0.1273  -0.1357 0.1159  48   TYR L CG  
4988 C CD1 . TYR E 48  ? 1.5830 1.2249 1.4503 0.1413  -0.1583 0.1166  48   TYR L CD1 
4989 C CD2 . TYR E 48  ? 1.4572 1.0025 1.3223 0.1308  -0.1170 0.1315  48   TYR L CD2 
4990 C CE1 . TYR E 48  ? 1.6895 1.3207 1.5968 0.1651  -0.1636 0.1323  48   TYR L CE1 
4991 C CE2 . TYR E 48  ? 1.4534 0.9743 1.3523 0.1534  -0.1223 0.1515  48   TYR L CE2 
4992 C CZ  . TYR E 48  ? 1.6454 1.2119 1.5691 0.1741  -0.1463 0.1515  48   TYR L CZ  
4993 O OH  . TYR E 48  ? 1.8070 1.3552 1.7754 0.2043  -0.1518 0.1721  48   TYR L OH  
4994 N N   . ASP E 49  ? 1.5685 1.0944 1.2754 0.0862  -0.1010 0.1477  49   ASP L N   
4995 C CA  . ASP E 49  ? 1.6150 1.0931 1.2851 0.0749  -0.0848 0.1754  49   ASP L CA  
4996 C C   . ASP E 49  ? 1.6701 1.1393 1.2628 0.0654  -0.0986 0.2025  49   ASP L C   
4997 O O   . ASP E 49  ? 1.8323 1.2738 1.3902 0.0605  -0.1024 0.2395  49   ASP L O   
4998 C CB  . ASP E 49  ? 1.7869 1.2299 1.4920 0.0838  -0.0819 0.1966  49   ASP L CB  
4999 C CG  . ASP E 49  ? 1.7719 1.2157 1.5459 0.0821  -0.0596 0.1630  49   ASP L CG  
5000 O OD1 . ASP E 49  ? 1.6893 1.1542 1.4730 0.0668  -0.0397 0.1341  49   ASP L OD1 
5001 O OD2 . ASP E 49  ? 1.7535 1.1811 1.5749 0.0960  -0.0614 0.1634  49   ASP L OD2 
5002 N N   . THR E 50  ? 1.5632 1.0559 1.1275 0.0608  -0.1068 0.1848  50   THR L N   
5003 C CA  . THR E 50  ? 1.5724 1.0558 1.0590 0.0420  -0.1086 0.1922  50   THR L CA  
5004 C C   . THR E 50  ? 1.5394 1.0376 0.9868 0.0379  -0.1408 0.2225  50   THR L C   
5005 O O   . THR E 50  ? 1.6457 1.1509 1.0332 0.0186  -0.1487 0.2192  50   THR L O   
5006 C CB  . THR E 50  ? 1.6409 1.0914 1.0883 0.0231  -0.0770 0.1977  50   THR L CB  
5007 O OG1 . THR E 50  ? 1.6167 1.0682 1.1125 0.0275  -0.0478 0.1700  50   THR L OG1 
5008 C CG2 . THR E 50  ? 1.7990 1.2410 1.1677 -0.0001 -0.0693 0.1907  50   THR L CG2 
5009 N N   . SER E 51  ? 1.4152 0.9227 0.9009 0.0564  -0.1598 0.2489  51   SER L N   
5010 C CA  . SER E 51  ? 1.5575 1.0977 1.0201 0.0582  -0.1948 0.2790  51   SER L CA  
5011 C C   . SER E 51  ? 1.6022 1.1739 1.1401 0.0899  -0.2164 0.2866  51   SER L C   
5012 O O   . SER E 51  ? 1.5934 1.2056 1.1265 0.0969  -0.2472 0.3123  51   SER L O   
5013 C CB  . SER E 51  ? 1.5339 1.0539 0.9359 0.0448  -0.1984 0.3243  51   SER L CB  
5014 O OG  . SER E 51  ? 1.7340 1.2106 1.1686 0.0591  -0.1836 0.3488  51   SER L OG  
5015 N N   . ASN E 52  ? 1.6478 1.2103 1.2564 0.1078  -0.2006 0.2620  52   ASN L N   
5016 C CA  . ASN E 52  ? 1.6232 1.2066 1.3076 0.1384  -0.2123 0.2643  52   ASN L CA  
5017 C C   . ASN E 52  ? 1.4708 1.1140 1.1870 0.1396  -0.2233 0.2279  52   ASN L C   
5018 O O   . ASN E 52  ? 1.4202 1.0661 1.1444 0.1284  -0.2075 0.1922  52   ASN L O   
5019 C CB  . ASN E 52  ? 1.6722 1.2066 1.4118 0.1504  -0.1840 0.2552  52   ASN L CB  
5020 C CG  . ASN E 52  ? 1.7865 1.2564 1.4928 0.1447  -0.1706 0.2950  52   ASN L CG  
5021 O OD1 . ASN E 52  ? 1.8821 1.3491 1.5394 0.1438  -0.1898 0.3404  52   ASN L OD1 
5022 N ND2 . ASN E 52  ? 1.8947 1.3180 1.6248 0.1362  -0.1375 0.2788  52   ASN L ND2 
5023 N N   . LEU E 53  ? 1.3595 1.0568 1.0943 0.1523  -0.2509 0.2398  53   LEU L N   
5024 C CA  . LEU E 53  ? 1.3098 1.0710 1.0737 0.1492  -0.2607 0.2076  53   LEU L CA  
5025 C C   . LEU E 53  ? 1.3219 1.0877 1.1631 0.1663  -0.2418 0.1732  53   LEU L C   
5026 O O   . LEU E 53  ? 1.3762 1.1269 1.2758 0.1947  -0.2358 0.1799  53   LEU L O   
5027 C CB  . LEU E 53  ? 1.3181 1.1473 1.0928 0.1586  -0.2928 0.2282  53   LEU L CB  
5028 C CG  . LEU E 53  ? 1.3555 1.2587 1.1310 0.1394  -0.3061 0.2012  53   LEU L CG  
5029 C CD1 . LEU E 53  ? 1.2976 1.1806 0.9897 0.0973  -0.3032 0.1910  53   LEU L CD1 
5030 C CD2 . LEU E 53  ? 1.2567 1.2404 1.0578 0.1517  -0.3372 0.2223  53   LEU L CD2 
5031 N N   . ALA E 54  ? 1.3585 1.1434 1.1982 0.1477  -0.2318 0.1368  54   ALA L N   
5032 C CA  . ALA E 54  ? 1.3666 1.1674 1.2690 0.1541  -0.2136 0.0989  54   ALA L CA  
5033 C C   . ALA E 54  ? 1.4824 1.3484 1.4434 0.1697  -0.2228 0.0824  54   ALA L C   
5034 O O   . ALA E 54  ? 1.4056 1.3225 1.3537 0.1672  -0.2454 0.0939  54   ALA L O   
5035 C CB  . ALA E 54  ? 1.2568 1.0708 1.1350 0.1288  -0.2054 0.0721  54   ALA L CB  
5036 N N   . SER E 55  ? 1.6213 1.4896 1.6496 0.1832  -0.2022 0.0508  55   SER L N   
5037 C CA  . SER E 55  ? 1.6084 1.5362 1.7047 0.2027  -0.2030 0.0282  55   SER L CA  
5038 C C   . SER E 55  ? 1.5252 1.5364 1.6057 0.1761  -0.2132 0.0031  55   SER L C   
5039 O O   . SER E 55  ? 1.4931 1.5170 1.5531 0.1484  -0.2032 -0.0238 55   SER L O   
5040 C CB  . SER E 55  ? 1.6409 1.5456 1.8072 0.2155  -0.1713 -0.0108 55   SER L CB  
5041 O OG  . SER E 55  ? 1.7216 1.5400 1.9025 0.2370  -0.1593 0.0149  55   SER L OG  
5042 N N   . GLY E 56  ? 1.5088 1.5808 1.5971 0.1823  -0.2342 0.0151  56   GLY L N   
5043 C CA  . GLY E 56  ? 1.4063 1.5581 1.4773 0.1524  -0.2431 -0.0053 56   GLY L CA  
5044 C C   . GLY E 56  ? 1.3539 1.5058 1.3428 0.1218  -0.2657 0.0234  56   GLY L C   
5045 O O   . GLY E 56  ? 1.3442 1.5618 1.3177 0.0949  -0.2750 0.0125  56   GLY L O   
5046 N N   . VAL E 57  ? 1.4073 1.4869 1.3421 0.1213  -0.2714 0.0563  57   VAL L N   
5047 C CA  . VAL E 57  ? 1.3053 1.3709 1.1582 0.0901  -0.2870 0.0777  57   VAL L CA  
5048 C C   . VAL E 57  ? 1.3169 1.4341 1.1698 0.0932  -0.3122 0.1008  57   VAL L C   
5049 O O   . VAL E 57  ? 1.4310 1.5489 1.3228 0.1275  -0.3200 0.1231  57   VAL L O   
5050 C CB  . VAL E 57  ? 1.2805 1.2559 1.0795 0.0876  -0.2782 0.0967  57   VAL L CB  
5051 C CG1 . VAL E 57  ? 1.3194 1.2736 1.0353 0.0547  -0.2882 0.1109  57   VAL L CG1 
5052 C CG2 . VAL E 57  ? 1.2421 1.1850 1.0520 0.0866  -0.2560 0.0746  57   VAL L CG2 
5053 N N   . PRO E 58  ? 1.2526 1.4159 1.0633 0.0566  -0.3262 0.0984  58   PRO L N   
5054 C CA  . PRO E 58  ? 1.4075 1.6383 1.2183 0.0530  -0.3527 0.1180  58   PRO L CA  
5055 C C   . PRO E 58  ? 1.4576 1.6400 1.2211 0.0588  -0.3653 0.1559  58   PRO L C   
5056 O O   . PRO E 58  ? 1.4612 1.5551 1.1747 0.0536  -0.3512 0.1630  58   PRO L O   
5057 C CB  . PRO E 58  ? 1.4592 1.7276 1.2159 -0.0019 -0.3580 0.1024  58   PRO L CB  
5058 C CG  . PRO E 58  ? 1.3610 1.6120 1.1228 -0.0140 -0.3360 0.0735  58   PRO L CG  
5059 C CD  . PRO E 58  ? 1.2921 1.4585 1.0614 0.0157  -0.3183 0.0765  58   PRO L CD  
5060 N N   . VAL E 59  ? 1.6186 1.8704 1.4005 0.0694  -0.3925 0.1810  59   VAL L N   
5061 C CA  . VAL E 59  ? 1.6913 1.9143 1.4285 0.0742  -0.4086 0.2224  59   VAL L CA  
5062 C C   . VAL E 59  ? 1.8278 2.0139 1.4575 0.0192  -0.4084 0.2201  59   VAL L C   
5063 O O   . VAL E 59  ? 1.8556 1.9961 1.4298 0.0141  -0.4113 0.2459  59   VAL L O   
5064 C CB  . VAL E 59  ? 1.7104 2.0349 1.4979 0.0997  -0.4430 0.2535  59   VAL L CB  
5065 C CG1 . VAL E 59  ? 1.8146 2.1057 1.5689 0.1170  -0.4598 0.3057  59   VAL L CG1 
5066 C CG2 . VAL E 59  ? 1.6873 2.0597 1.5912 0.1509  -0.4380 0.2416  59   VAL L CG2 
5067 N N   . ARG E 60  ? 1.7589 1.9600 1.3557 -0.0246 -0.4021 0.1887  60   ARG L N   
5068 C CA  . ARG E 60  ? 1.7421 1.9005 1.2397 -0.0784 -0.3978 0.1812  60   ARG L CA  
5069 C C   . ARG E 60  ? 1.6989 1.7386 1.1490 -0.0754 -0.3698 0.1792  60   ARG L C   
5070 O O   . ARG E 60  ? 1.8223 1.8182 1.1951 -0.1054 -0.3648 0.1816  60   ARG L O   
5071 C CB  . ARG E 60  ? 1.5899 1.7728 1.0673 -0.1242 -0.3923 0.1494  60   ARG L CB  
5072 C CG  . ARG E 60  ? 1.4819 1.7942 1.0132 -0.1314 -0.4152 0.1446  60   ARG L CG  
5073 C CD  . ARG E 60  ? 1.4645 1.7923 0.9667 -0.1851 -0.4053 0.1141  60   ARG L CD  
5074 N NE  . ARG E 60  ? 1.4705 1.7268 0.9786 -0.1770 -0.3786 0.0982  60   ARG L NE  
5075 C CZ  . ARG E 60  ? 1.3796 1.6842 0.9545 -0.1578 -0.3727 0.0844  60   ARG L CZ  
5076 N NH1 . ARG E 60  ? 1.4685 1.8887 1.1180 -0.1403 -0.3877 0.0808  60   ARG L NH1 
5077 N NH2 . ARG E 60  ? 1.2128 1.4561 0.7814 -0.1560 -0.3515 0.0734  60   ARG L NH2 
5078 N N   . PHE E 61  ? 2.0393 1.3821 1.0849 0.3782  -0.5413 0.0235  61   PHE L N   
5079 C CA  . PHE E 61  ? 2.0116 1.3318 1.0331 0.3534  -0.5153 0.0331  61   PHE L CA  
5080 C C   . PHE E 61  ? 2.0841 1.3458 1.0440 0.3420  -0.5295 0.0688  61   PHE L C   
5081 O O   . PHE E 61  ? 2.3469 1.5755 1.2972 0.3588  -0.5578 0.0829  61   PHE L O   
5082 C CB  . PHE E 61  ? 2.1101 1.4348 1.1729 0.3577  -0.4999 0.0114  61   PHE L CB  
5083 C CG  . PHE E 61  ? 2.1599 1.5416 1.2792 0.3670  -0.4828 -0.0193 61   PHE L CG  
5084 C CD1 . PHE E 61  ? 2.2045 1.6040 1.3586 0.3927  -0.4970 -0.0432 61   PHE L CD1 
5085 C CD2 . PHE E 61  ? 2.1593 1.5774 1.2968 0.3507  -0.4520 -0.0215 61   PHE L CD2 
5086 C CE1 . PHE E 61  ? 2.1716 1.6214 1.3727 0.4006  -0.4793 -0.0694 61   PHE L CE1 
5087 C CE2 . PHE E 61  ? 2.1022 1.5719 1.2898 0.3596  -0.4362 -0.0443 61   PHE L CE2 
5088 C CZ  . PHE E 61  ? 2.0967 1.5811 1.3142 0.3839  -0.4491 -0.0684 61   PHE L CZ  
5089 N N   . SER E 62  ? 2.1012 1.3491 1.0188 0.3139  -0.5081 0.0860  62   SER L N   
5090 C CA  . SER E 62  ? 2.3308 1.5204 1.1814 0.2992  -0.5157 0.1215  62   SER L CA  
5091 C C   . SER E 62  ? 2.4432 1.6218 1.2658 0.2694  -0.4803 0.1289  62   SER L C   
5092 O O   . SER E 62  ? 2.5454 1.7566 1.3638 0.2537  -0.4575 0.1223  62   SER L O   
5093 C CB  . SER E 62  ? 2.2658 1.4522 1.0660 0.2960  -0.5407 0.1482  62   SER L CB  
5094 O OG  . SER E 62  ? 2.1218 1.3473 0.9050 0.2758  -0.5242 0.1422  62   SER L OG  
5095 N N   . GLY E 63  ? 2.4482 1.5812 1.2522 0.2616  -0.4746 0.1438  63   GLY L N   
5096 C CA  . GLY E 63  ? 2.4299 1.5500 1.2062 0.2336  -0.4414 0.1560  63   GLY L CA  
5097 C C   . GLY E 63  ? 2.5344 1.5790 1.2105 0.2144  -0.4435 0.1888  63   GLY L C   
5098 O O   . GLY E 63  ? 2.6966 1.7000 1.3383 0.2233  -0.4717 0.2101  63   GLY L O   
5099 N N   . SER E 64  ? 2.4248 1.4471 1.0490 0.1876  -0.4120 0.1949  64   SER L N   
5100 C CA  . SER E 64  ? 2.4791 1.4217 0.9950 0.1620  -0.4058 0.2242  64   SER L CA  
5101 C C   . SER E 64  ? 2.4175 1.3111 0.8835 0.1349  -0.3632 0.2259  64   SER L C   
5102 O O   . SER E 64  ? 2.3680 1.3009 0.8877 0.1394  -0.3428 0.2078  64   SER L O   
5103 C CB  . SER E 64  ? 2.5913 1.5713 1.0761 0.1514  -0.4126 0.2316  64   SER L CB  
5104 O OG  . SER E 64  ? 2.8145 1.7178 1.1861 0.1224  -0.4057 0.2603  64   SER L OG  
5105 N N   . GLY E 65  ? 2.6739 1.4805 1.0347 0.1056  -0.3477 0.2510  65   GLY L N   
5106 C CA  . GLY E 65  ? 2.7994 1.5491 1.0985 0.0733  -0.2979 0.2553  65   GLY L CA  
5107 C C   . GLY E 65  ? 2.8889 1.5324 1.1180 0.0535  -0.2875 0.2817  65   GLY L C   
5108 O O   . GLY E 65  ? 2.7415 1.3520 0.9748 0.0683  -0.3211 0.2952  65   GLY L O   
5109 N N   . SER E 66  ? 3.0686 1.6531 1.2308 0.0169  -0.2335 0.2893  66   SER L N   
5110 C CA  . SER E 66  ? 3.1980 1.6813 1.2954 -0.0116 -0.2071 0.3141  66   SER L CA  
5111 C C   . SER E 66  ? 3.2006 1.6555 1.2671 -0.0469 -0.1344 0.3131  66   SER L C   
5112 O O   . SER E 66  ? 3.2609 1.7627 1.3424 -0.0483 -0.1064 0.2945  66   SER L O   
5113 C CB  . SER E 66  ? 3.4805 1.8873 1.4817 -0.0327 -0.2172 0.3410  66   SER L CB  
5114 O OG  . SER E 66  ? 3.5953 1.9881 1.5185 -0.0662 -0.1842 0.3400  66   SER L OG  
5115 N N   . GLY E 67  ? 3.0919 1.4673 1.1205 -0.0768 -0.0976 0.3341  67   GLY L N   
5116 C CA  . GLY E 67  ? 3.1282 1.4705 1.1346 -0.1160 -0.0150 0.3379  67   GLY L CA  
5117 C C   . GLY E 67  ? 2.8146 1.2324 0.9096 -0.0972 0.0072  0.3265  67   GLY L C   
5118 O O   . GLY E 67  ? 2.7887 1.2368 0.9571 -0.0791 -0.0121 0.3350  67   GLY L O   
5119 N N   . THR E 68  ? 2.7962 1.2418 0.8831 -0.1030 0.0489  0.3091  68   THR L N   
5120 C CA  . THR E 68  ? 2.8318 1.3461 1.0014 -0.0825 0.0763  0.3033  68   THR L CA  
5121 C C   . THR E 68  ? 2.6603 1.2562 0.8645 -0.0459 0.0342  0.2759  68   THR L C   
5122 O O   . THR E 68  ? 2.5251 1.1750 0.7889 -0.0279 0.0600  0.2706  68   THR L O   
5123 C CB  . THR E 68  ? 2.7461 1.2223 0.9040 -0.1226 0.1872  0.3074  68   THR L CB  
5124 O OG1 . THR E 68  ? 2.8901 1.3305 0.9626 -0.1500 0.2196  0.2833  68   THR L OG1 
5125 C CG2 . THR E 68  ? 2.8314 1.2422 0.9852 -0.1628 0.2373  0.3329  68   THR L CG2 
5126 N N   . SER E 69  ? 2.6259 1.2353 0.8050 -0.0349 -0.0255 0.2624  69   SER L N   
5127 C CA  . SER E 69  ? 2.6282 1.3182 0.8500 -0.0083 -0.0587 0.2369  69   SER L CA  
5128 C C   . SER E 69  ? 2.6344 1.3828 0.9187 0.0276  -0.1400 0.2323  69   SER L C   
5129 O O   . SER E 69  ? 2.7831 1.4891 1.0245 0.0211  -0.1697 0.2451  69   SER L O   
5130 C CB  . SER E 69  ? 2.7948 1.4523 0.9309 -0.0414 -0.0301 0.2242  69   SER L CB  
5131 O OG  . SER E 69  ? 3.0392 1.6439 1.1287 -0.0768 0.0595  0.2204  69   SER L OG  
5132 N N   . TYR E 70  ? 2.5890 1.4329 0.9765 0.0640  -0.1689 0.2150  70   TYR L N   
5133 C CA  . TYR E 70  ? 2.5574 1.4626 1.0192 0.0952  -0.2305 0.2054  70   TYR L CA  
5134 C C   . TYR E 70  ? 2.4148 1.4185 0.9522 0.1158  -0.2425 0.1807  70   TYR L C   
5135 O O   . TYR E 70  ? 2.4067 1.4333 0.9499 0.1123  -0.2086 0.1713  70   TYR L O   
5136 C CB  . TYR E 70  ? 2.5295 1.4472 1.0530 0.1138  -0.2527 0.2094  70   TYR L CB  
5137 C CG  . TYR E 70  ? 2.5642 1.3834 1.0172 0.0894  -0.2352 0.2357  70   TYR L CG  
5138 C CD1 . TYR E 70  ? 2.6355 1.4251 1.0697 0.0700  -0.1872 0.2518  70   TYR L CD1 
5139 C CD2 . TYR E 70  ? 2.5475 1.2997 0.9544 0.0841  -0.2614 0.2488  70   TYR L CD2 
5140 C CE1 . TYR E 70  ? 2.7122 1.4126 1.0897 0.0409  -0.1633 0.2782  70   TYR L CE1 
5141 C CE2 . TYR E 70  ? 2.7142 1.3710 1.0569 0.0572  -0.2413 0.2739  70   TYR L CE2 
5142 C CZ  . TYR E 70  ? 2.7879 1.4212 1.1184 0.0330  -0.1910 0.2873  70   TYR L CZ  
5143 O OH  . TYR E 70  ? 3.0432 1.5837 1.3197 -0.0007 -0.1621 0.3138  70   TYR L OH  
5144 N N   . SER E 71  ? 2.3535 1.4090 0.9464 0.1361  -0.2857 0.1718  71   SER L N   
5145 C CA  . SER E 71  ? 2.1758 1.3201 0.8351 0.1491  -0.2943 0.1511  71   SER L CA  
5146 C C   . SER E 71  ? 2.1919 1.3956 0.9406 0.1762  -0.3317 0.1405  71   SER L C   
5147 O O   . SER E 71  ? 2.4150 1.5809 1.1496 0.1837  -0.3584 0.1510  71   SER L O   
5148 C CB  . SER E 71  ? 2.1586 1.2944 0.7523 0.1292  -0.2940 0.1537  71   SER L CB  
5149 O OG  . SER E 71  ? 2.2268 1.3370 0.7895 0.1308  -0.3291 0.1711  71   SER L OG  
5150 N N   . LEU E 72  ? 2.0857 1.3651 0.9123 0.1905  -0.3308 0.1190  72   LEU L N   
5151 C CA  . LEU E 72  ? 1.9538 1.2556 0.8341 0.2187  -0.3629 0.1000  72   LEU L CA  
5152 C C   . LEU E 72  ? 1.9436 1.2698 0.8194 0.2238  -0.3731 0.0875  72   LEU L C   
5153 O O   . LEU E 72  ? 1.8939 1.2507 0.7712 0.2131  -0.3492 0.0802  72   LEU L O   
5154 C CB  . LEU E 72  ? 1.7622 1.1141 0.7233 0.2327  -0.3551 0.0834