data_6KC4
# 
_entry.id   6KC4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KC4         
WWPDB D_1300012711 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KC4 
_pdbx_database_status.recvd_initial_deposition_date   2019-06-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Matsuura, Y.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0002-1759-4816 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_id_ASTM           PRCIEI 
_citation.journal_id_CSD            0795 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            28 
_citation.language                  ? 
_citation.page_first                2011 
_citation.page_last                 2019 
_citation.title                     
;High-resolution structural analysis shows how different crystallographic environments can induce alternative modes of binding of a phosphotyrosine peptide to the SH2 domain of Fer tyrosine kinase.
;
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/pro.3713 
_citation.pdbx_database_id_PubMed   31441171 
_citation.unpublished_flag          ? 
# 
_citation_author.citation_id        primary 
_citation_author.name               'Matsuura, Y.' 
_citation_author.ordinal            1 
_citation_author.identifier_ORCID   0000-0002-1759-4816 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   96.960 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KC4 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     34.700 
_cell.length_a_esd                 ? 
_cell.length_b                     186.661 
_cell.length_b_esd                 ? 
_cell.length_c                     50.580 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KC4 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tyrosine-protein kinase Fer' 11743.345 6    2.7.10.2 ? ? ? 
2 polymer syn 'phosphopeptide (EDpYENVD)'   962.805   6    ?        ? ? ? 
3 water   nat water                         18.015    1075 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Feline encephalitis virus-related kinase FER,Fujinami poultry sarcoma/Feline sarcoma-related protein Fer,Proto-oncogene c-Fer,Tyrosine kinase 3,p94-Fer
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GSKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDH
HYTTKQVITKKSGVVLLNPIPK
;
;GSKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDH
HYTTKQVITKKSGVVLLNPIPK
;
A,C,E,G,I,K ? 
2 'polypeptide(L)' no yes 'DE(PTR)ENVD' DEYENVD B,D,F,H,J,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LYS n 
1 4   PRO n 
1 5   LEU n 
1 6   ALA n 
1 7   GLU n 
1 8   GLN n 
1 9   ASP n 
1 10  TRP n 
1 11  TYR n 
1 12  HIS n 
1 13  GLY n 
1 14  ALA n 
1 15  ILE n 
1 16  PRO n 
1 17  ARG n 
1 18  ILE n 
1 19  GLU n 
1 20  ALA n 
1 21  GLN n 
1 22  GLU n 
1 23  LEU n 
1 24  LEU n 
1 25  LYS n 
1 26  LYS n 
1 27  GLN n 
1 28  GLY n 
1 29  ASP n 
1 30  PHE n 
1 31  LEU n 
1 32  VAL n 
1 33  ARG n 
1 34  GLU n 
1 35  SER n 
1 36  HIS n 
1 37  GLY n 
1 38  LYS n 
1 39  PRO n 
1 40  GLY n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  LEU n 
1 45  SER n 
1 46  VAL n 
1 47  TYR n 
1 48  SER n 
1 49  ASP n 
1 50  GLY n 
1 51  GLN n 
1 52  ARG n 
1 53  ARG n 
1 54  HIS n 
1 55  PHE n 
1 56  ILE n 
1 57  ILE n 
1 58  GLN n 
1 59  TYR n 
1 60  VAL n 
1 61  ASP n 
1 62  ASN n 
1 63  MET n 
1 64  TYR n 
1 65  ARG n 
1 66  PHE n 
1 67  GLU n 
1 68  GLY n 
1 69  THR n 
1 70  GLY n 
1 71  PHE n 
1 72  SER n 
1 73  ASN n 
1 74  ILE n 
1 75  PRO n 
1 76  GLN n 
1 77  LEU n 
1 78  ILE n 
1 79  ASP n 
1 80  HIS n 
1 81  HIS n 
1 82  TYR n 
1 83  THR n 
1 84  THR n 
1 85  LYS n 
1 86  GLN n 
1 87  VAL n 
1 88  ILE n 
1 89  THR n 
1 90  LYS n 
1 91  LYS n 
1 92  SER n 
1 93  GLY n 
1 94  VAL n 
1 95  VAL n 
1 96  LEU n 
1 97  LEU n 
1 98  ASN n 
1 99  PRO n 
1 100 ILE n 
1 101 PRO n 
1 102 LYS n 
2 1   ASP n 
2 2   GLU n 
2 3   PTR n 
2 4   GLU n 
2 5   ASN n 
2 6   VAL n 
2 7   ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   102 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FER, TYK3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       7 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP FER_HUMAN P16591 ? 1 
;KPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHY
TTKQVITKKSGVVLLNPIPK
;
453 
2 PDB 6KC4      6KC4   ? 2 ?                                                                                                       
1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6KC4 A 3 ? 102 ? P16591 453 ? 552 ? 453 552 
2  2 6KC4 B 1 ? 7   ? 6KC4   1   ? 7   ? 1   7   
3  1 6KC4 C 3 ? 102 ? P16591 453 ? 552 ? 453 552 
4  2 6KC4 D 1 ? 7   ? 6KC4   1   ? 7   ? 1   7   
5  1 6KC4 E 3 ? 102 ? P16591 453 ? 552 ? 453 552 
6  2 6KC4 F 1 ? 7   ? 6KC4   1   ? 7   ? 1   7   
7  1 6KC4 G 3 ? 102 ? P16591 453 ? 552 ? 453 552 
8  2 6KC4 H 1 ? 7   ? 6KC4   1   ? 7   ? 1   7   
9  1 6KC4 I 3 ? 102 ? P16591 453 ? 552 ? 453 552 
10 2 6KC4 J 1 ? 7   ? 6KC4   1   ? 7   ? 1   7   
11 1 6KC4 K 3 ? 102 ? P16591 453 ? 552 ? 453 552 
12 2 6KC4 L 1 ? 7   ? 6KC4   1   ? 7   ? 1   7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6KC4 GLY A 1 ? UNP P16591 ? ? 'expression tag' 451 1  
1  6KC4 SER A 2 ? UNP P16591 ? ? 'expression tag' 452 2  
3  6KC4 GLY C 1 ? UNP P16591 ? ? 'expression tag' 451 3  
3  6KC4 SER C 2 ? UNP P16591 ? ? 'expression tag' 452 4  
5  6KC4 GLY E 1 ? UNP P16591 ? ? 'expression tag' 451 5  
5  6KC4 SER E 2 ? UNP P16591 ? ? 'expression tag' 452 6  
7  6KC4 GLY G 1 ? UNP P16591 ? ? 'expression tag' 451 7  
7  6KC4 SER G 2 ? UNP P16591 ? ? 'expression tag' 452 8  
9  6KC4 GLY I 1 ? UNP P16591 ? ? 'expression tag' 451 9  
9  6KC4 SER I 2 ? UNP P16591 ? ? 'expression tag' 452 10 
11 6KC4 GLY K 1 ? UNP P16591 ? ? 'expression tag' 451 11 
11 6KC4 SER K 2 ? UNP P16591 ? ? 'expression tag' 452 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KC4 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.15 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.77 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'HEPES, sodium chloride, PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     95 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-06-23 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6KC4 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.370 
_reflns.d_resolution_low                 25.870 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       130076 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.700 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.100 
_reflns.pdbx_Rmerge_I_obs                0.044 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             515 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.052 
_reflns.pdbx_Rpim_I_all                  0.028 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         409258 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.370 1.390  ? ? 16283 ? ? ? 5919 89.800 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 2.800 ? ? ? 6.500  0.143 0.082 ? 1 1 0.981 ? 
7.500 25.870 ? ? 2736  ? ? ? 813  97.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 3.400 ? ? ? 26.700 0.049 0.027 ? 2 1 0.986 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                68.740 
_refine.B_iso_mean                               20.8914 
_refine.B_iso_min                                5.760 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KC4 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.3700 
_refine.ls_d_res_low                             25.8670 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     129994 
_refine.ls_number_reflns_R_free                  6701 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.6400 
_refine.ls_percent_reflns_R_free                 5.1500 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1657 
_refine.ls_R_factor_R_free                       0.1855 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1646 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2KK6 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.9500 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.3700 
_refine_hist.d_res_low                        25.8670 
_refine_hist.number_atoms_solvent             1075 
_refine_hist.number_atoms_total               6365 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       641 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          30.33 
_refine_hist.pdbx_number_atoms_protein        5290 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.3700 1.3856  3951 . 194 3757 89.0000  . . . 0.2101 0.0000 0.1937 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.3856 1.4019  4106 . 196 3910 93.0000  . . . 0.2123 0.0000 0.1928 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.4019 1.4190  4172 . 206 3966 95.0000  . . . 0.2041 0.0000 0.1918 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.4190 1.4369  4264 . 207 4057 95.0000  . . . 0.2166 0.0000 0.1942 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.4369 1.4558  4220 . 236 3984 96.0000  . . . 0.2068 0.0000 0.1904 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.4558 1.4758  4272 . 212 4060 96.0000  . . . 0.2125 0.0000 0.1899 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.4758 1.4969  4303 . 217 4086 97.0000  . . . 0.2196 0.0000 0.1854 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.4969 1.5192  4317 . 223 4094 97.0000  . . . 0.2029 0.0000 0.1824 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.5192 1.5429  4284 . 225 4059 97.0000  . . . 0.2068 0.0000 0.1846 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.5429 1.5682  4366 . 179 4187 98.0000  . . . 0.2060 0.0000 0.1745 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.5682 1.5953  4263 . 234 4029 97.0000  . . . 0.2023 0.0000 0.1743 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.5953 1.6243  4313 . 254 4059 98.0000  . . . 0.1983 0.0000 0.1680 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6243 1.6555  4387 . 242 4145 98.0000  . . . 0.2121 0.0000 0.1703 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6555 1.6893  4241 . 259 3982 96.0000  . . . 0.1895 0.0000 0.1706 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6893 1.7260  4347 . 226 4121 98.0000  . . . 0.2051 0.0000 0.1792 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.7260 1.7661  4355 . 221 4134 99.0000  . . . 0.1801 0.0000 0.1635 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.7661 1.8103  4436 . 233 4203 99.0000  . . . 0.1951 0.0000 0.1714 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.8103 1.8592  4352 . 215 4137 99.0000  . . . 0.1901 0.0000 0.1756 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.8592 1.9139  4416 . 230 4186 99.0000  . . . 0.2189 0.0000 0.1773 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.9139 1.9757  4394 . 236 4158 99.0000  . . . 0.1858 0.0000 0.1662 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.9757 2.0463  4424 . 234 4190 99.0000  . . . 0.1801 0.0000 0.1653 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.0463 2.1282  4391 . 217 4174 99.0000  . . . 0.1707 0.0000 0.1582 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.1282 2.2250  4411 . 195 4216 100.0000 . . . 0.1924 0.0000 0.1615 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2250 2.3422  4362 . 235 4127 98.0000  . . . 0.1744 0.0000 0.1669 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3422 2.4888  4433 . 210 4223 99.0000  . . . 0.1857 0.0000 0.1699 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4888 2.6808  4449 . 224 4225 100.0000 . . . 0.1706 0.0000 0.1740 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6808 2.9503  4417 . 227 4190 100.0000 . . . 0.1895 0.0000 0.1762 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9503 3.3764  4457 . 249 4208 100.0000 . . . 0.1895 0.0000 0.1618 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3764 4.2508  4454 . 234 4220 100.0000 . . . 0.1519 0.0000 0.1364 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.2508 25.8717 4437 . 231 4206 99.0000  . . . 0.1855 0.0000 0.1467 . . . . . . 30 . . . 
# 
_struct.entry_id                     6KC4 
_struct.title                        'Crystal structure of human Fer SH2 domain bound to a phosphopeptide (DEpYENVD)' 
_struct.pdbx_descriptor              'Tyrosine-protein kinase Fer (E.C.2.7.10.2), phosphopeptide (EDpYENVD)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KC4 
_struct_keywords.text            'SH2 domain, SIGNALING PROTEIN, TRANSFERASE-SIGNALING PROTEIN complex' 
_struct_keywords.pdbx_keywords   'TRANSFERASE/SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 1 ? 
J N N 2 ? 
K N N 1 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
W N N 3 ? 
X N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 4  ? GLN A 8  ? PRO A 454 GLN A 458 5 ? 5  
HELX_P HELX_P2  AA2 PRO A 16 ? LEU A 24 ? PRO A 466 LEU A 474 1 ? 9  
HELX_P HELX_P3  AA3 ASN A 73 ? LYS A 85 ? ASN A 523 LYS A 535 1 ? 13 
HELX_P HELX_P4  AA4 PRO C 4  ? GLN C 8  ? PRO C 454 GLN C 458 5 ? 5  
HELX_P HELX_P5  AA5 PRO C 16 ? LEU C 24 ? PRO C 466 LEU C 474 1 ? 9  
HELX_P HELX_P6  AA6 ASN C 73 ? LYS C 85 ? ASN C 523 LYS C 535 1 ? 13 
HELX_P HELX_P7  AA7 PRO E 4  ? GLN E 8  ? PRO E 454 GLN E 458 5 ? 5  
HELX_P HELX_P8  AA8 PRO E 16 ? LEU E 24 ? PRO E 466 LEU E 474 1 ? 9  
HELX_P HELX_P9  AA9 ASN E 73 ? LYS E 85 ? ASN E 523 LYS E 535 1 ? 13 
HELX_P HELX_P10 AB1 PRO G 4  ? GLN G 8  ? PRO G 454 GLN G 458 5 ? 5  
HELX_P HELX_P11 AB2 PRO G 16 ? LEU G 24 ? PRO G 466 LEU G 474 1 ? 9  
HELX_P HELX_P12 AB3 ASN G 73 ? LYS G 85 ? ASN G 523 LYS G 535 1 ? 13 
HELX_P HELX_P13 AB4 PRO I 4  ? GLN I 8  ? PRO I 454 GLN I 458 5 ? 5  
HELX_P HELX_P14 AB5 PRO I 16 ? LEU I 24 ? PRO I 466 LEU I 474 1 ? 9  
HELX_P HELX_P15 AB6 ASN I 73 ? LYS I 85 ? ASN I 523 LYS I 535 1 ? 13 
HELX_P HELX_P16 AB7 PRO K 4  ? GLN K 8  ? PRO K 454 GLN K 458 5 ? 5  
HELX_P HELX_P17 AB8 PRO K 16 ? LEU K 24 ? PRO K 466 LEU K 474 1 ? 9  
HELX_P HELX_P18 AB9 ASN K 73 ? LYS K 85 ? ASN K 523 LYS K 535 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? B GLU 2 C ? ? ? 1_555 B PTR 3 N ? ? B GLU 2 B PTR 3 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2  covale both ? B PTR 3 C ? ? ? 1_555 B GLU 4 N ? ? B PTR 3 B GLU 4 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3  covale both ? D GLU 2 C ? ? ? 1_555 D PTR 3 N ? ? D GLU 2 D PTR 3 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale4  covale both ? D PTR 3 C ? ? ? 1_555 D GLU 4 N ? ? D PTR 3 D GLU 4 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale5  covale both ? F GLU 2 C ? ? ? 1_555 F PTR 3 N ? ? F GLU 2 F PTR 3 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale6  covale both ? F PTR 3 C ? ? ? 1_555 F GLU 4 N ? ? F PTR 3 F GLU 4 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale7  covale both ? H GLU 2 C ? ? ? 1_555 H PTR 3 N ? ? H GLU 2 H PTR 3 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8  covale both ? H PTR 3 C ? ? ? 1_555 H GLU 4 N ? ? H PTR 3 H GLU 4 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale9  covale both ? J GLU 2 C ? ? ? 1_555 J PTR 3 N ? ? J GLU 2 J PTR 3 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale10 covale both ? J PTR 3 C ? ? ? 1_555 J GLU 4 N ? ? J PTR 3 J GLU 4 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale11 covale both ? L GLU 2 C ? ? ? 1_555 L PTR 3 N ? ? L GLU 2 L PTR 3 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale12 covale both ? L PTR 3 C ? ? ? 1_555 L GLU 4 N ? ? L PTR 3 L GLU 4 1_555 ? ? ? ? ? ? ? 1.330 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 5 ? 
AA4 ? 5 ? 
AA5 ? 5 ? 
AA6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 63 ? ARG A 65 ? MET A 513 ARG A 515 
AA1 2 GLN A 51 ? VAL A 60 ? GLN A 501 VAL A 510 
AA1 3 TYR A 42 ? SER A 48 ? TYR A 492 SER A 498 
AA1 4 ASP A 29 ? GLU A 34 ? ASP A 479 GLU A 484 
AA1 5 ASN A 98 ? PRO A 99 ? ASN A 548 PRO A 549 
AA2 1 MET C 63 ? ARG C 65 ? MET C 513 ARG C 515 
AA2 2 GLN C 51 ? VAL C 60 ? GLN C 501 VAL C 510 
AA2 3 TYR C 42 ? SER C 48 ? TYR C 492 SER C 498 
AA2 4 ASP C 29 ? GLU C 34 ? ASP C 479 GLU C 484 
AA2 5 ASN C 98 ? PRO C 99 ? ASN C 548 PRO C 549 
AA3 1 MET E 63 ? ARG E 65 ? MET E 513 ARG E 515 
AA3 2 GLN E 51 ? VAL E 60 ? GLN E 501 VAL E 510 
AA3 3 TYR E 42 ? SER E 48 ? TYR E 492 SER E 498 
AA3 4 ASP E 29 ? GLU E 34 ? ASP E 479 GLU E 484 
AA3 5 ASN E 98 ? PRO E 99 ? ASN E 548 PRO E 549 
AA4 1 MET G 63 ? ARG G 65 ? MET G 513 ARG G 515 
AA4 2 GLN G 51 ? VAL G 60 ? GLN G 501 VAL G 510 
AA4 3 TYR G 42 ? SER G 48 ? TYR G 492 SER G 498 
AA4 4 ASP G 29 ? GLU G 34 ? ASP G 479 GLU G 484 
AA4 5 ASN G 98 ? PRO G 99 ? ASN G 548 PRO G 549 
AA5 1 MET I 63 ? ARG I 65 ? MET I 513 ARG I 515 
AA5 2 GLN I 51 ? VAL I 60 ? GLN I 501 VAL I 510 
AA5 3 TYR I 42 ? SER I 48 ? TYR I 492 SER I 498 
AA5 4 ASP I 29 ? GLU I 34 ? ASP I 479 GLU I 484 
AA5 5 ASN I 98 ? PRO I 99 ? ASN I 548 PRO I 549 
AA6 1 MET K 63 ? ARG K 65 ? MET K 513 ARG K 515 
AA6 2 GLN K 51 ? VAL K 60 ? GLN K 501 VAL K 510 
AA6 3 TYR K 42 ? SER K 48 ? TYR K 492 SER K 498 
AA6 4 ASP K 29 ? GLU K 34 ? ASP K 479 GLU K 484 
AA6 5 ASN K 98 ? PRO K 99 ? ASN K 548 PRO K 549 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O MET A 63 ? O MET A 513 N VAL A 60 ? N VAL A 510 
AA1 2 3 O GLN A 51 ? O GLN A 501 N SER A 48 ? N SER A 498 
AA1 3 4 O VAL A 43 ? O VAL A 493 N ARG A 33 ? N ARG A 483 
AA1 4 5 N PHE A 30 ? N PHE A 480 O ASN A 98 ? O ASN A 548 
AA2 1 2 O MET C 63 ? O MET C 513 N VAL C 60 ? N VAL C 510 
AA2 2 3 O ARG C 53 ? O ARG C 503 N VAL C 46 ? N VAL C 496 
AA2 3 4 O VAL C 43 ? O VAL C 493 N ARG C 33 ? N ARG C 483 
AA2 4 5 N PHE C 30 ? N PHE C 480 O ASN C 98 ? O ASN C 548 
AA3 1 2 O MET E 63 ? O MET E 513 N VAL E 60 ? N VAL E 510 
AA3 2 3 O ARG E 53 ? O ARG E 503 N VAL E 46 ? N VAL E 496 
AA3 3 4 O VAL E 43 ? O VAL E 493 N ARG E 33 ? N ARG E 483 
AA3 4 5 N PHE E 30 ? N PHE E 480 O ASN E 98 ? O ASN E 548 
AA4 1 2 O MET G 63 ? O MET G 513 N VAL G 60 ? N VAL G 510 
AA4 2 3 O ARG G 53 ? O ARG G 503 N VAL G 46 ? N VAL G 496 
AA4 3 4 O VAL G 43 ? O VAL G 493 N ARG G 33 ? N ARG G 483 
AA4 4 5 N PHE G 30 ? N PHE G 480 O ASN G 98 ? O ASN G 548 
AA5 1 2 O MET I 63 ? O MET I 513 N VAL I 60 ? N VAL I 510 
AA5 2 3 O ARG I 53 ? O ARG I 503 N VAL I 46 ? N VAL I 496 
AA5 3 4 O VAL I 43 ? O VAL I 493 N ARG I 33 ? N ARG I 483 
AA5 4 5 N PHE I 30 ? N PHE I 480 O ASN I 98 ? O ASN I 548 
AA6 1 2 O MET K 63 ? O MET K 513 N VAL K 60 ? N VAL K 510 
AA6 2 3 O ARG K 53 ? O ARG K 503 N VAL K 46 ? N VAL K 496 
AA6 3 4 O VAL K 43 ? O VAL K 493 N ARG K 33 ? N ARG K 483 
AA6 4 5 N PHE K 30 ? N PHE K 480 O ASN K 98 ? O ASN K 548 
# 
_atom_sites.entry_id                    6KC4 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.028818 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003518 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005357 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019918 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 2   ? -12.084 11.434  15.129 1.00 36.63 ? 452  SER A N   1 
ATOM   2    C CA  . SER A 1 2   ? -11.719 12.678  15.795 1.00 31.53 ? 452  SER A CA  1 
ATOM   3    C C   . SER A 1 2   ? -11.914 12.572  17.297 1.00 30.34 ? 452  SER A C   1 
ATOM   4    O O   . SER A 1 2   ? -11.881 13.584  18.003 1.00 33.11 ? 452  SER A O   1 
ATOM   5    C CB  . SER A 1 2   ? -12.540 13.845  15.234 1.00 33.10 ? 452  SER A CB  1 
ATOM   6    O OG  . SER A 1 2   ? -13.811 13.978  15.857 1.00 36.90 ? 452  SER A OG  1 
ATOM   7    N N   . LYS A 1 3   ? -12.106 11.339  17.779 1.00 44.35 ? 453  LYS A N   1 
ATOM   8    C CA  . LYS A 1 3   ? -12.262 11.113  19.211 1.00 39.69 ? 453  LYS A CA  1 
ATOM   9    C C   . LYS A 1 3   ? -10.891 11.128  19.899 1.00 33.11 ? 453  LYS A C   1 
ATOM   10   O O   . LYS A 1 3   ? -9.881  10.732  19.299 1.00 35.47 ? 453  LYS A O   1 
ATOM   11   C CB  . LYS A 1 3   ? -12.952 9.777   19.465 1.00 40.01 ? 453  LYS A CB  1 
ATOM   12   N N   . PRO A 1 4   ? -10.827 11.577  21.153 1.00 20.09 ? 454  PRO A N   1 
ATOM   13   C CA  . PRO A 1 4   ? -9.522  11.780  21.799 1.00 17.15 ? 454  PRO A CA  1 
ATOM   14   C C   . PRO A 1 4   ? -8.889  10.481  22.281 1.00 13.93 ? 454  PRO A C   1 
ATOM   15   O O   . PRO A 1 4   ? -9.574  9.536   22.689 1.00 15.10 ? 454  PRO A O   1 
ATOM   16   C CB  . PRO A 1 4   ? -9.852  12.689  22.987 1.00 19.45 ? 454  PRO A CB  1 
ATOM   17   C CG  . PRO A 1 4   ? -11.231 13.253  22.685 1.00 26.70 ? 454  PRO A CG  1 
ATOM   18   C CD  . PRO A 1 4   ? -11.923 12.179  21.930 1.00 25.88 ? 454  PRO A CD  1 
ATOM   19   N N   . LEU A 1 5   ? -7.550  10.465  22.265 1.00 13.70 ? 455  LEU A N   1 
ATOM   20   C CA  . LEU A 1 5   ? -6.795  9.305   22.737 1.00 11.47 ? 455  LEU A CA  1 
ATOM   21   C C   . LEU A 1 5   ? -7.143  8.957   24.170 1.00 12.03 ? 455  LEU A C   1 
ATOM   22   O O   . LEU A 1 5   ? -7.277  7.776   24.515 1.00 12.22 ? 455  LEU A O   1 
ATOM   23   C CB  . LEU A 1 5   ? -5.299  9.594   22.647 1.00 13.17 ? 455  LEU A CB  1 
ATOM   24   C CG  . LEU A 1 5   ? -4.666  9.395   21.278 1.00 12.03 ? 455  LEU A CG  1 
ATOM   25   C CD1 . LEU A 1 5   ? -3.305  10.075  21.227 1.00 14.18 ? 455  LEU A CD1 1 
ATOM   26   C CD2 . LEU A 1 5   ? -4.538  7.912   20.989 1.00 10.57 ? 455  LEU A CD2 1 
ATOM   27   N N   . ALA A 1 6   ? -7.287  9.974   25.026 1.00 13.66 ? 456  ALA A N   1 
ATOM   28   C CA  . ALA A 1 6   ? -7.524  9.738   26.446 1.00 16.10 ? 456  ALA A CA  1 
ATOM   29   C C   . ALA A 1 6   ? -8.843  9.035   26.712 1.00 22.28 ? 456  ALA A C   1 
ATOM   30   O O   . ALA A 1 6   ? -9.040  8.523   27.819 1.00 27.11 ? 456  ALA A O   1 
ATOM   31   C CB  . ALA A 1 6   ? -7.464  11.051  27.233 1.00 21.02 ? 456  ALA A CB  1 
ATOM   32   N N   . GLU A 1 7   ? -9.739  8.988   25.734 1.00 15.51 ? 457  GLU A N   1 
ATOM   33   C CA  . GLU A 1 7   ? -11.005 8.291   25.887 1.00 19.00 ? 457  GLU A CA  1 
ATOM   34   C C   . GLU A 1 7   ? -11.012 6.909   25.243 1.00 16.46 ? 457  GLU A C   1 
ATOM   35   O O   . GLU A 1 7   ? -12.054 6.249   25.247 1.00 19.04 ? 457  GLU A O   1 
ATOM   36   C CB  . GLU A 1 7   ? -12.150 9.154   25.350 1.00 24.12 ? 457  GLU A CB  1 
ATOM   37   C CG  . GLU A 1 7   ? -12.335 10.448  26.135 1.00 29.89 ? 457  GLU A CG  1 
ATOM   38   C CD  . GLU A 1 7   ? -13.353 11.384  25.513 1.00 39.97 ? 457  GLU A CD  1 
ATOM   39   O OE1 . GLU A 1 7   ? -13.462 12.535  25.986 1.00 44.92 ? 457  GLU A OE1 1 
ATOM   40   O OE2 . GLU A 1 7   ? -14.040 10.974  24.554 1.00 42.18 ? 457  GLU A OE2 1 
ATOM   41   N N   . GLN A 1 8   ? -9.883  6.450   24.701 1.00 12.87 ? 458  GLN A N   1 
ATOM   42   C CA  . GLN A 1 8   ? -9.796  5.118   24.111 1.00 11.45 ? 458  GLN A CA  1 
ATOM   43   C C   . GLN A 1 8   ? -9.336  4.104   25.152 1.00 10.84 ? 458  GLN A C   1 
ATOM   44   O O   . GLN A 1 8   ? -8.379  4.352   25.890 1.00 12.08 ? 458  GLN A O   1 
ATOM   45   C CB  . GLN A 1 8   ? -8.801  5.116   22.946 1.00 12.06 ? 458  GLN A CB  1 
ATOM   46   C CG  . GLN A 1 8   ? -9.063  6.184   21.889 1.00 13.65 ? 458  GLN A CG  1 
ATOM   47   C CD  . GLN A 1 8   ? -10.376 5.988   21.156 1.00 20.75 ? 458  GLN A CD  1 
ATOM   48   O OE1 . GLN A 1 8   ? -10.953 4.901   21.155 1.00 25.06 ? 458  GLN A OE1 1 
ATOM   49   N NE2 . GLN A 1 8   ? -10.853 7.047   20.522 1.00 21.52 ? 458  GLN A NE2 1 
ATOM   50   N N   . ASP A 1 9   ? -10.006 2.946   25.183 1.00 10.81 ? 459  ASP A N   1 
ATOM   51   C CA  . ASP A 1 9   ? -9.691  1.930   26.187 1.00 10.14 ? 459  ASP A CA  1 
ATOM   52   C C   . ASP A 1 9   ? -8.246  1.459   26.077 1.00 9.58  ? 459  ASP A C   1 
ATOM   53   O O   . ASP A 1 9   ? -7.618  1.128   27.095 1.00 9.49  ? 459  ASP A O   1 
ATOM   54   C CB  . ASP A 1 9   ? -10.611 0.715   26.040 1.00 10.96 ? 459  ASP A CB  1 
ATOM   55   C CG  . ASP A 1 9   ? -12.051 0.990   26.452 1.00 15.30 ? 459  ASP A CG  1 
ATOM   56   O OD1 . ASP A 1 9   ? -12.883 0.074   26.263 1.00 15.76 ? 459  ASP A OD1 1 
ATOM   57   O OD2 . ASP A 1 9   ? -12.353 2.089   26.946 1.00 15.89 ? 459  ASP A OD2 1 
ATOM   58   N N   . TRP A 1 10  ? -7.701  1.413   24.860 1.00 7.87  ? 460  TRP A N   1 
ATOM   59   C CA  . TRP A 1 10  ? -6.393  0.834   24.581 1.00 7.50  ? 460  TRP A CA  1 
ATOM   60   C C   . TRP A 1 10  ? -5.256  1.837   24.695 1.00 7.50  ? 460  TRP A C   1 
ATOM   61   O O   . TRP A 1 10  ? -4.110  1.475   24.408 1.00 7.82  ? 460  TRP A O   1 
ATOM   62   C CB  . TRP A 1 10  ? -6.379  0.187   23.186 1.00 8.57  ? 460  TRP A CB  1 
ATOM   63   C CG  . TRP A 1 10  ? -7.077  1.016   22.112 1.00 8.41  ? 460  TRP A CG  1 
ATOM   64   C CD1 . TRP A 1 10  ? -8.319  0.792   21.593 1.00 9.47  ? 460  TRP A CD1 1 
ATOM   65   C CD2 . TRP A 1 10  ? -6.573  2.190   21.455 1.00 8.01  ? 460  TRP A CD2 1 
ATOM   66   N NE1 . TRP A 1 10  ? -8.618  1.750   20.659 1.00 9.92  ? 460  TRP A NE1 1 
ATOM   67   C CE2 . TRP A 1 10  ? -7.567  2.622   20.555 1.00 9.37  ? 460  TRP A CE2 1 
ATOM   68   C CE3 . TRP A 1 10  ? -5.380  2.916   21.538 1.00 8.97  ? 460  TRP A CE3 1 
ATOM   69   C CZ2 . TRP A 1 10  ? -7.407  3.745   19.745 1.00 10.38 ? 460  TRP A CZ2 1 
ATOM   70   C CZ3 . TRP A 1 10  ? -5.226  4.041   20.739 1.00 9.30  ? 460  TRP A CZ3 1 
ATOM   71   C CH2 . TRP A 1 10  ? -6.235  4.439   19.846 1.00 9.73  ? 460  TRP A CH2 1 
ATOM   72   N N   . TYR A 1 11  ? -5.528  3.079   25.093 1.00 7.51  ? 461  TYR A N   1 
ATOM   73   C CA  . TYR A 1 11  ? -4.479  4.084   25.213 1.00 7.60  ? 461  TYR A CA  1 
ATOM   74   C C   . TYR A 1 11  ? -4.018  4.144   26.664 1.00 8.10  ? 461  TYR A C   1 
ATOM   75   O O   . TYR A 1 11  ? -4.816  4.444   27.557 1.00 9.49  ? 461  TYR A O   1 
ATOM   76   C CB  . TYR A 1 11  ? -4.957  5.456   24.738 1.00 8.86  ? 461  TYR A CB  1 
ATOM   77   C CG  . TYR A 1 11  ? -3.922  6.532   24.966 1.00 10.49 ? 461  TYR A CG  1 
ATOM   78   C CD1 . TYR A 1 11  ? -2.752  6.575   24.211 1.00 11.28 ? 461  TYR A CD1 1 
ATOM   79   C CD2 . TYR A 1 11  ? -4.104  7.488   25.945 1.00 10.58 ? 461  TYR A CD2 1 
ATOM   80   C CE1 . TYR A 1 11  ? -1.797  7.557   24.436 1.00 12.93 ? 461  TYR A CE1 1 
ATOM   81   C CE2 . TYR A 1 11  ? -3.160  8.474   26.169 1.00 12.55 ? 461  TYR A CE2 1 
ATOM   82   C CZ  . TYR A 1 11  ? -2.017  8.498   25.410 1.00 12.73 ? 461  TYR A CZ  1 
ATOM   83   O OH  . TYR A 1 11  ? -1.085  9.485   25.647 1.00 23.44 ? 461  TYR A OH  1 
ATOM   84   N N   . HIS A 1 12  ? -2.736  3.867   26.898 1.00 7.75  ? 462  HIS A N   1 
ATOM   85   C CA  . HIS A 1 12  ? -2.190  3.758   28.248 1.00 7.87  ? 462  HIS A CA  1 
ATOM   86   C C   . HIS A 1 12  ? -1.280  4.911   28.640 1.00 9.28  ? 462  HIS A C   1 
ATOM   87   O O   . HIS A 1 12  ? -0.629  4.842   29.689 1.00 10.20 ? 462  HIS A O   1 
ATOM   88   C CB  . HIS A 1 12  ? -1.447  2.437   28.424 1.00 7.95  ? 462  HIS A CB  1 
ATOM   89   C CG  . HIS A 1 12  ? -2.335  1.236   28.417 1.00 8.42  ? 462  HIS A CG  1 
ATOM   90   N ND1 . HIS A 1 12  ? -2.361  0.330   29.458 1.00 10.77 ? 462  HIS A ND1 1 
ATOM   91   C CD2 . HIS A 1 12  ? -3.228  0.790   27.503 1.00 8.45  ? 462  HIS A CD2 1 
ATOM   92   C CE1 . HIS A 1 12  ? -3.227  -0.627  29.175 1.00 11.30 ? 462  HIS A CE1 1 
ATOM   93   N NE2 . HIS A 1 12  ? -3.772  -0.368  28.000 1.00 9.78  ? 462  HIS A NE2 1 
ATOM   94   N N   . GLY A 1 13  ? -1.205  5.964   27.833 1.00 9.20  ? 463  GLY A N   1 
ATOM   95   C CA  . GLY A 1 13  ? -0.423  7.116   28.259 1.00 9.96  ? 463  GLY A CA  1 
ATOM   96   C C   . GLY A 1 13  ? 1.059   6.799   28.318 1.00 9.35  ? 463  GLY A C   1 
ATOM   97   O O   . GLY A 1 13  ? 1.608   6.113   27.451 1.00 10.31 ? 463  GLY A O   1 
ATOM   98   N N   . ALA A 1 14  ? 1.724   7.281   29.368 1.00 11.38 ? 464  ALA A N   1 
ATOM   99   C CA  . ALA A 1 14  ? 3.181   7.225   29.444 1.00 10.45 ? 464  ALA A CA  1 
ATOM   100  C C   . ALA A 1 14  ? 3.720   5.990   30.167 1.00 11.65 ? 464  ALA A C   1 
ATOM   101  O O   . ALA A 1 14  ? 4.828   6.045   30.715 1.00 12.72 ? 464  ALA A O   1 
ATOM   102  C CB  . ALA A 1 14  ? 3.741   8.509   30.061 1.00 18.90 ? 464  ALA A CB  1 
ATOM   103  N N   . ILE A 1 15  ? 2.996   4.873   30.166 1.00 10.56 ? 465  ILE A N   1 
ATOM   104  C CA  . ILE A 1 15  ? 3.580   3.682   30.798 1.00 10.51 ? 465  ILE A CA  1 
ATOM   105  C C   . ILE A 1 15  ? 4.840   3.273   30.052 1.00 11.61 ? 465  ILE A C   1 
ATOM   106  O O   . ILE A 1 15  ? 4.887   3.358   28.808 1.00 11.43 ? 465  ILE A O   1 
ATOM   107  C CB  . ILE A 1 15  ? 2.587   2.508   30.881 1.00 10.42 ? 465  ILE A CB  1 
ATOM   108  C CG1 . ILE A 1 15  ? 2.140   2.053   29.487 1.00 12.15 ? 465  ILE A CG1 1 
ATOM   109  C CG2 . ILE A 1 15  ? 1.416   2.850   31.786 1.00 12.11 ? 465  ILE A CG2 1 
ATOM   110  C CD1 . ILE A 1 15  ? 1.567   0.638   29.453 1.00 14.17 ? 465  ILE A CD1 1 
ATOM   111  N N   . PRO A 1 16  ? 5.875   2.830   30.747 1.00 9.25  ? 466  PRO A N   1 
ATOM   112  C CA  . PRO A 1 16  ? 7.117   2.447   30.079 1.00 9.03  ? 466  PRO A CA  1 
ATOM   113  C C   . PRO A 1 16  ? 6.999   1.079   29.431 1.00 9.21  ? 466  PRO A C   1 
ATOM   114  O O   . PRO A 1 16  ? 6.104   0.282   29.733 1.00 8.27  ? 466  PRO A O   1 
ATOM   115  C CB  . PRO A 1 16  ? 8.121   2.386   31.236 1.00 10.07 ? 466  PRO A CB  1 
ATOM   116  C CG  . PRO A 1 16  ? 7.272   1.996   32.418 1.00 10.89 ? 466  PRO A CG  1 
ATOM   117  C CD  . PRO A 1 16  ? 5.991   2.771   32.215 1.00 10.18 ? 466  PRO A CD  1 
ATOM   118  N N   . ARG A 1 17  ? 7.959   0.820   28.542 1.00 8.82  ? 467  ARG A N   1 
ATOM   119  C CA  . ARG A 1 17  ? 8.033   -0.463  27.859 1.00 8.78  ? 467  ARG A CA  1 
ATOM   120  C C   . ARG A 1 17  ? 7.925   -1.631  28.834 1.00 8.36  ? 467  ARG A C   1 
ATOM   121  O O   . ARG A 1 17  ? 7.195   -2.593  28.580 1.00 8.86  ? 467  ARG A O   1 
ATOM   122  C CB  . ARG A 1 17  ? 9.331   -0.547  27.057 1.00 10.25 ? 467  ARG A CB  1 
ATOM   123  C CG  . ARG A 1 17  ? 9.504   -1.879  26.333 1.00 11.32 ? 467  ARG A CG  1 
ATOM   124  C CD  . ARG A 1 17  ? 10.836  -1.928  25.588 1.00 11.60 ? 467  ARG A CD  1 
ATOM   125  N NE  . ARG A 1 17  ? 10.810  -1.055  24.421 1.00 11.04 ? 467  ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 17  ? 11.202  -1.410  23.200 1.00 11.58 ? 467  ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 17  ? 11.688  -2.626  22.964 1.00 13.30 ? 467  ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 17  ? 11.131  -0.530  22.213 1.00 10.95 ? 467  ARG A NH2 1 
ATOM   129  N N   . ILE A 1 18  ? 8.648   -1.573  29.959 1.00 8.42  ? 468  ILE A N   1 
ATOM   130  C CA  . ILE A 1 18  ? 8.662   -2.714  30.878 1.00 8.56  ? 468  ILE A CA  1 
ATOM   131  C C   . ILE A 1 18  ? 7.270   -2.991  31.437 1.00 8.75  ? 468  ILE A C   1 
ATOM   132  O O   . ILE A 1 18  ? 6.922   -4.149  31.706 1.00 10.97 ? 468  ILE A O   1 
ATOM   133  C CB  . ILE A 1 18  ? 9.734   -2.541  31.979 1.00 8.64  ? 468  ILE A CB  1 
ATOM   134  C CG1 . ILE A 1 18  ? 9.906   -3.830  32.796 1.00 10.46 ? 468  ILE A CG1 1 
ATOM   135  C CG2 . ILE A 1 18  ? 9.388   -1.388  32.897 1.00 9.92  ? 468  ILE A CG2 1 
ATOM   136  C CD1 . ILE A 1 18  ? 10.389  -5.008  31.993 1.00 12.66 ? 468  ILE A CD1 1 
ATOM   137  N N   . GLU A 1 19  ? 6.447   -1.955  31.609 1.00 8.42  ? 469  GLU A N   1 
ATOM   138  C CA  . GLU A 1 19  ? 5.082   -2.172  32.083 1.00 10.13 ? 469  GLU A CA  1 
ATOM   139  C C   . GLU A 1 19  ? 4.182   -2.713  30.983 1.00 10.19 ? 469  GLU A C   1 
ATOM   140  O O   . GLU A 1 19  ? 3.305   -3.550  31.246 1.00 11.23 ? 469  GLU A O   1 
ATOM   141  C CB  . GLU A 1 19  ? 4.516   -0.885  32.677 1.00 10.69 ? 469  GLU A CB  1 
ATOM   142  C CG  . GLU A 1 19  ? 5.100   -0.591  34.043 1.00 13.21 ? 469  GLU A CG  1 
ATOM   143  C CD  . GLU A 1 19  ? 4.502   0.637   34.681 1.00 15.77 ? 469  GLU A CD  1 
ATOM   144  O OE1 . GLU A 1 19  ? 5.138   1.174   35.612 1.00 15.21 ? 469  GLU A OE1 1 
ATOM   145  O OE2 . GLU A 1 19  ? 3.407   1.064   34.257 1.00 14.23 ? 469  GLU A OE2 1 
ATOM   146  N N   . ALA A 1 20  ? 4.383   -2.248  29.750 1.00 9.37  ? 470  ALA A N   1 
ATOM   147  C CA  . ALA A 1 20  ? 3.641   -2.814  28.633 1.00 11.42 ? 470  ALA A CA  1 
ATOM   148  C C   . ALA A 1 20  ? 3.887   -4.311  28.521 1.00 16.11 ? 470  ALA A C   1 
ATOM   149  O O   . ALA A 1 20  ? 2.986   -5.063  28.128 1.00 13.51 ? 470  ALA A O   1 
ATOM   150  C CB  . ALA A 1 20  ? 4.037   -2.105  27.338 1.00 13.77 ? 470  ALA A CB  1 
ATOM   151  N N   . GLN A 1 21  ? 5.089   -4.766  28.890 1.00 16.13 ? 471  GLN A N   1 
ATOM   152  C CA  . GLN A 1 21  ? 5.406   -6.191  28.821 1.00 16.05 ? 471  GLN A CA  1 
ATOM   153  C C   . GLN A 1 21  ? 4.443   -7.020  29.658 1.00 19.12 ? 471  GLN A C   1 
ATOM   154  O O   . GLN A 1 21  ? 3.995   -8.091  29.226 1.00 22.76 ? 471  GLN A O   1 
ATOM   155  C CB  . GLN A 1 21  ? 6.844   -6.429  29.289 1.00 18.65 ? 471  GLN A CB  1 
ATOM   156  C CG  . GLN A 1 21  ? 7.194   -7.908  29.439 1.00 22.40 ? 471  GLN A CG  1 
ATOM   157  C CD  . GLN A 1 21  ? 8.625   -8.124  29.881 1.00 28.14 ? 471  GLN A CD  1 
ATOM   158  O OE1 . GLN A 1 21  ? 9.555   -7.591  29.279 1.00 27.68 ? 471  GLN A OE1 1 
ATOM   159  N NE2 . GLN A 1 21  ? 8.809   -8.903  30.943 1.00 34.28 ? 471  GLN A NE2 1 
ATOM   160  N N   . GLU A 1 22  ? 4.111   -6.546  30.857 1.00 15.42 ? 472  GLU A N   1 
ATOM   161  C CA  . GLU A 1 22  ? 3.215   -7.277  31.742 1.00 18.00 ? 472  GLU A CA  1 
ATOM   162  C C   . GLU A 1 22  ? 1.791   -7.327  31.211 1.00 20.39 ? 472  GLU A C   1 
ATOM   163  O O   . GLU A 1 22  ? 1.034   -8.235  31.572 1.00 19.88 ? 472  GLU A O   1 
ATOM   164  C CB  . GLU A 1 22  ? 3.208   -6.619  33.122 1.00 24.54 ? 472  GLU A CB  1 
ATOM   165  C CG  . GLU A 1 22  ? 2.549   -7.450  34.205 1.00 36.10 ? 472  GLU A CG  1 
ATOM   166  C CD  . GLU A 1 22  ? 3.322   -8.717  34.502 1.00 42.84 ? 472  GLU A CD  1 
ATOM   167  O OE1 . GLU A 1 22  ? 4.558   -8.631  34.655 1.00 43.61 ? 472  GLU A OE1 1 
ATOM   168  O OE2 . GLU A 1 22  ? 2.697   -9.798  34.567 1.00 45.88 ? 472  GLU A OE2 1 
ATOM   169  N N   . LEU A 1 23  ? 1.416   -6.383  30.356 1.00 12.12 ? 473  LEU A N   1 
ATOM   170  C CA  . LEU A 1 23  ? 0.043   -6.272  29.894 1.00 11.58 ? 473  LEU A CA  1 
ATOM   171  C C   . LEU A 1 23  ? -0.214  -7.012  28.591 1.00 11.76 ? 473  LEU A C   1 
ATOM   172  O O   . LEU A 1 23  ? -1.378  -7.209  28.228 1.00 13.61 ? 473  LEU A O   1 
ATOM   173  C CB  . LEU A 1 23  ? -0.292  -4.790  29.704 1.00 11.59 ? 473  LEU A CB  1 
ATOM   174  C CG  . LEU A 1 23  ? -0.340  -3.995  31.010 1.00 11.49 ? 473  LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 23  ? -0.330  -2.497  30.735 1.00 14.84 ? 473  LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 23  ? -1.573  -4.392  31.796 1.00 16.56 ? 473  LEU A CD2 1 
ATOM   177  N N   . LEU A 1 24  ? 0.831   -7.399  27.875 1.00 10.32 ? 474  LEU A N   1 
ATOM   178  C CA  . LEU A 1 24  ? 0.717   -8.003  26.553 1.00 11.11 ? 474  LEU A CA  1 
ATOM   179  C C   . LEU A 1 24  ? 1.145   -9.458  26.684 1.00 10.82 ? 474  LEU A C   1 
ATOM   180  O O   . LEU A 1 24  ? 2.322   -9.745  26.934 1.00 12.09 ? 474  LEU A O   1 
ATOM   181  C CB  . LEU A 1 24  ? 1.606   -7.241  25.573 1.00 10.56 ? 474  LEU A CB  1 
ATOM   182  C CG  . LEU A 1 24  ? 1.213   -5.772  25.379 1.00 9.00  ? 474  LEU A CG  1 
ATOM   183  C CD1 . LEU A 1 24  ? 2.294   -5.017  24.622 1.00 11.80 ? 474  LEU A CD1 1 
ATOM   184  C CD2 . LEU A 1 24  ? -0.110  -5.646  24.657 1.00 10.49 ? 474  LEU A CD2 1 
ATOM   185  N N   . LYS A 1 25  ? 0.190   -10.372 26.531 1.00 10.98 ? 475  LYS A N   1 
ATOM   186  C CA  . LYS A 1 25  ? 0.404   -11.768 26.889 1.00 12.35 ? 475  LYS A CA  1 
ATOM   187  C C   . LYS A 1 25  ? -0.044  -12.757 25.838 1.00 12.39 ? 475  LYS A C   1 
ATOM   188  O O   . LYS A 1 25  ? 0.474   -13.885 25.824 1.00 13.65 ? 475  LYS A O   1 
ATOM   189  C CB  . LYS A 1 25  ? -0.349  -12.115 28.183 1.00 14.41 ? 475  LYS A CB  1 
ATOM   190  C CG  . LYS A 1 25  ? 0.142   -11.432 29.438 1.00 20.41 ? 475  LYS A CG  1 
ATOM   191  C CD  . LYS A 1 25  ? -0.875  -11.622 30.555 1.00 31.36 ? 475  LYS A CD  1 
ATOM   192  C CE  . LYS A 1 25  ? -0.249  -11.482 31.931 1.00 39.40 ? 475  LYS A CE  1 
ATOM   193  N NZ  . LYS A 1 25  ? -1.300  -11.340 32.981 1.00 41.56 ? 475  LYS A NZ  1 
ATOM   194  N N   . LYS A 1 26  ? -0.980  -12.391 24.969 1.00 11.35 ? 476  LYS A N   1 
ATOM   195  C CA  . LYS A 1 26  ? -1.613  -13.324 24.054 1.00 11.61 ? 476  LYS A CA  1 
ATOM   196  C C   . LYS A 1 26  ? -1.633  -12.744 22.650 1.00 10.73 ? 476  LYS A C   1 
ATOM   197  O O   . LYS A 1 26  ? -1.691  -11.524 22.463 1.00 9.80  ? 476  LYS A O   1 
ATOM   198  C CB  . LYS A 1 26  ? -3.050  -13.635 24.490 1.00 13.67 ? 476  LYS A CB  1 
ATOM   199  C CG  . LYS A 1 26  ? -3.133  -14.463 25.766 1.00 19.42 ? 476  LYS A CG  1 
ATOM   200  C CD  . LYS A 1 26  ? -4.563  -14.541 26.291 1.00 22.96 ? 476  LYS A CD  1 
ATOM   201  C CE  . LYS A 1 26  ? -4.658  -15.432 27.525 1.00 23.54 ? 476  LYS A CE  1 
ATOM   202  N NZ  . LYS A 1 26  ? -4.456  -16.863 27.178 1.00 24.22 ? 476  LYS A NZ  1 
ATOM   203  N N   . GLN A 1 27  ? -1.621  -13.642 21.666 1.00 11.50 ? 477  GLN A N   1 
ATOM   204  C CA  . GLN A 1 27  ? -1.570  -13.270 20.259 1.00 12.07 ? 477  GLN A CA  1 
ATOM   205  C C   . GLN A 1 27  ? -2.574  -12.167 19.945 1.00 10.11 ? 477  GLN A C   1 
ATOM   206  O O   . GLN A 1 27  ? -3.771  -12.302 20.216 1.00 12.08 ? 477  GLN A O   1 
ATOM   207  C CB  . GLN A 1 27  ? -1.878  -14.512 19.420 1.00 13.60 ? 477  GLN A CB  1 
ATOM   208  C CG  . GLN A 1 27  ? -1.739  -14.305 17.925 1.00 15.88 ? 477  GLN A CG  1 
ATOM   209  C CD  . GLN A 1 27  ? -0.308  -14.419 17.463 1.00 18.15 ? 477  GLN A CD  1 
ATOM   210  O OE1 . GLN A 1 27  ? 0.616   -14.497 18.275 1.00 17.35 ? 477  GLN A OE1 1 
ATOM   211  N NE2 . GLN A 1 27  ? -0.111  -14.457 16.151 1.00 19.55 ? 477  GLN A NE2 1 
ATOM   212  N N   . GLY A 1 28  ? -2.075  -11.048 19.421 1.00 9.63  ? 478  GLY A N   1 
ATOM   213  C CA  . GLY A 1 28  ? -2.937  -9.958  18.995 1.00 9.74  ? 478  GLY A CA  1 
ATOM   214  C C   . GLY A 1 28  ? -3.349  -8.966  20.070 1.00 9.42  ? 478  GLY A C   1 
ATOM   215  O O   . GLY A 1 28  ? -4.094  -8.024  19.758 1.00 9.54  ? 478  GLY A O   1 
ATOM   216  N N   . ASP A 1 29  ? -2.910  -9.143  21.318 1.00 8.35  ? 479  ASP A N   1 
ATOM   217  C CA  . ASP A 1 29  ? -3.071  -8.105  22.337 1.00 7.96  ? 479  ASP A CA  1 
ATOM   218  C C   . ASP A 1 29  ? -2.351  -6.838  21.890 1.00 7.81  ? 479  ASP A C   1 
ATOM   219  O O   . ASP A 1 29  ? -1.243  -6.905  21.356 1.00 8.41  ? 479  ASP A O   1 
ATOM   220  C CB  . ASP A 1 29  ? -2.372  -8.537  23.632 1.00 8.65  ? 479  ASP A CB  1 
ATOM   221  C CG  . ASP A 1 29  ? -3.113  -9.618  24.416 1.00 10.89 ? 479  ASP A CG  1 
ATOM   222  O OD1 . ASP A 1 29  ? -4.231  -10.021 24.042 1.00 11.53 ? 479  ASP A OD1 1 
ATOM   223  O OD2 . ASP A 1 29  ? -2.536  -10.067 25.436 1.00 11.01 ? 479  ASP A OD2 1 
ATOM   224  N N   . PHE A 1 30  ? -2.947  -5.672  22.153 1.00 6.81  ? 480  PHE A N   1 
ATOM   225  C CA  . PHE A 1 30  ? -2.285  -4.431  21.767 1.00 7.60  ? 480  PHE A CA  1 
ATOM   226  C C   . PHE A 1 30  ? -2.674  -3.282  22.682 1.00 7.17  ? 480  PHE A C   1 
ATOM   227  O O   . PHE A 1 30  ? -3.730  -3.285  23.318 1.00 7.99  ? 480  PHE A O   1 
ATOM   228  C CB  . PHE A 1 30  ? -2.572  -4.045  20.310 1.00 7.00  ? 480  PHE A CB  1 
ATOM   229  C CG  . PHE A 1 30  ? -3.993  -3.626  20.050 1.00 6.87  ? 480  PHE A CG  1 
ATOM   230  C CD1 . PHE A 1 30  ? -4.968  -4.572  19.752 1.00 8.56  ? 480  PHE A CD1 1 
ATOM   231  C CD2 . PHE A 1 30  ? -4.348  -2.286  20.071 1.00 8.58  ? 480  PHE A CD2 1 
ATOM   232  C CE1 . PHE A 1 30  ? -6.271  -4.183  19.493 1.00 10.18 ? 480  PHE A CE1 1 
ATOM   233  C CE2 . PHE A 1 30  ? -5.651  -1.891  19.814 1.00 8.50  ? 480  PHE A CE2 1 
ATOM   234  C CZ  . PHE A 1 30  ? -6.611  -2.843  19.522 1.00 10.09 ? 480  PHE A CZ  1 
ATOM   235  N N   . LEU A 1 31  ? -1.795  -2.282  22.712 1.00 6.26  ? 481  LEU A N   1 
ATOM   236  C CA  . LEU A 1 31  ? -2.051  -1.026  23.402 1.00 6.55  ? 481  LEU A CA  1 
ATOM   237  C C   . LEU A 1 31  ? -1.216  0.052   22.731 1.00 5.76  ? 481  LEU A C   1 
ATOM   238  O O   . LEU A 1 31  ? -0.282  -0.245  21.976 1.00 6.94  ? 481  LEU A O   1 
ATOM   239  C CB  . LEU A 1 31  ? -1.740  -1.130  24.906 1.00 7.21  ? 481  LEU A CB  1 
ATOM   240  C CG  . LEU A 1 31  ? -0.314  -1.504  25.300 1.00 6.54  ? 481  LEU A CG  1 
ATOM   241  C CD1 . LEU A 1 31  ? 0.590   -0.279  25.339 1.00 8.32  ? 481  LEU A CD1 1 
ATOM   242  C CD2 . LEU A 1 31  ? -0.307  -2.187  26.665 1.00 10.08 ? 481  LEU A CD2 1 
ATOM   243  N N   . VAL A 1 32  ? -1.554  1.310   23.009 1.00 5.98  ? 482  VAL A N   1 
ATOM   244  C CA  . VAL A 1 32  ? -0.774  2.448   22.538 1.00 7.26  ? 482  VAL A CA  1 
ATOM   245  C C   . VAL A 1 32  ? -0.246  3.209   23.750 1.00 6.17  ? 482  VAL A C   1 
ATOM   246  O O   . VAL A 1 32  ? -0.944  3.347   24.766 1.00 6.75  ? 482  VAL A O   1 
ATOM   247  C CB  . VAL A 1 32  ? -1.607  3.351   21.601 1.00 6.66  ? 482  VAL A CB  1 
ATOM   248  C CG1 . VAL A 1 32  ? -0.881  4.671   21.283 1.00 9.35  ? 482  VAL A CG1 1 
ATOM   249  C CG2 . VAL A 1 32  ? -1.954  2.575   20.320 1.00 9.00  ? 482  VAL A CG2 1 
ATOM   250  N N   . ARG A 1 33  ? 0.988   3.710   23.635 1.00 6.66  ? 483  ARG A N   1 
ATOM   251  C CA  . ARG A 1 33  ? 1.648   4.423   24.723 1.00 6.41  ? 483  ARG A CA  1 
ATOM   252  C C   . ARG A 1 33  ? 2.555   5.502   24.139 1.00 8.35  ? 483  ARG A C   1 
ATOM   253  O O   . ARG A 1 33  ? 2.855   5.516   22.943 1.00 8.56  ? 483  ARG A O   1 
ATOM   254  C CB  . ARG A 1 33  ? 2.446   3.457   25.617 1.00 7.84  ? 483  ARG A CB  1 
ATOM   255  C CG  . ARG A 1 33  ? 3.552   2.731   24.876 1.00 7.52  ? 483  ARG A CG  1 
ATOM   256  C CD  . ARG A 1 33  ? 4.225   1.664   25.741 1.00 7.24  ? 483  ARG A CD  1 
ATOM   257  N NE  . ARG A 1 33  ? 5.182   0.900   24.946 1.00 8.00  ? 483  ARG A NE  1 
ATOM   258  C CZ  . ARG A 1 33  ? 6.444   1.266   24.725 1.00 8.63  ? 483  ARG A CZ  1 
ATOM   259  N NH1 . ARG A 1 33  ? 6.934   2.379   25.261 1.00 8.82  ? 483  ARG A NH1 1 
ATOM   260  N NH2 . ARG A 1 33  ? 7.230   0.517   23.967 1.00 8.93  ? 483  ARG A NH2 1 
ATOM   261  N N   . GLU A 1 34  ? 2.983   6.418   25.009 1.00 8.44  ? 484  GLU A N   1 
ATOM   262  C CA  . GLU A 1 34  ? 3.935   7.469   24.653 1.00 9.56  ? 484  GLU A CA  1 
ATOM   263  C C   . GLU A 1 34  ? 5.348   6.939   24.841 1.00 13.26 ? 484  GLU A C   1 
ATOM   264  O O   . GLU A 1 34  ? 5.681   6.429   25.915 1.00 15.76 ? 484  GLU A O   1 
ATOM   265  C CB  . GLU A 1 34  ? 3.773   8.681   25.574 1.00 12.87 ? 484  GLU A CB  1 
ATOM   266  C CG  . GLU A 1 34  ? 2.357   8.976   25.998 1.00 23.20 ? 484  GLU A CG  1 
ATOM   267  C CD  . GLU A 1 34  ? 2.267   10.121  26.993 1.00 31.44 ? 484  GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 34  ? 1.234   10.220  27.686 1.00 38.24 ? 484  GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 34  ? 3.223   10.920  27.077 1.00 38.81 ? 484  GLU A OE2 1 
ATOM   270  N N   . SER A 1 35  ? 6.184   7.092   23.819 1.00 8.61  ? 485  SER A N   1 
ATOM   271  C CA  . SER A 1 35  ? 7.540   6.550   23.845 1.00 8.17  ? 485  SER A CA  1 
ATOM   272  C C   . SER A 1 35  ? 8.424   7.259   24.868 1.00 7.34  ? 485  SER A C   1 
ATOM   273  O O   . SER A 1 35  ? 8.340   8.478   25.055 1.00 9.43  ? 485  SER A O   1 
ATOM   274  C CB  . SER A 1 35  ? 8.173   6.727   22.465 1.00 9.20  ? 485  SER A CB  1 
ATOM   275  O OG  . SER A 1 35  ? 9.489   6.204   22.418 1.00 8.70  ? 485  SER A OG  1 
ATOM   276  N N   . HIS A 1 36  ? 9.299   6.486   25.510 1.00 7.85  ? 486  HIS A N   1 
ATOM   277  C CA  . HIS A 1 36  ? 10.419  7.028   26.274 1.00 8.11  ? 486  HIS A CA  1 
ATOM   278  C C   . HIS A 1 36  ? 11.710  7.092   25.467 1.00 9.52  ? 486  HIS A C   1 
ATOM   279  O O   . HIS A 1 36  ? 12.427  8.096   25.541 1.00 10.19 ? 486  HIS A O   1 
ATOM   280  C CB  . HIS A 1 36  ? 10.630  6.244   27.580 1.00 10.01 ? 486  HIS A CB  1 
ATOM   281  C CG  . HIS A 1 36  ? 9.588   6.537   28.606 1.00 10.21 ? 486  HIS A CG  1 
ATOM   282  N ND1 . HIS A 1 36  ? 8.359   5.914   28.621 1.00 14.23 ? 486  HIS A ND1 1 
ATOM   283  C CD2 . HIS A 1 36  ? 9.572   7.431   29.623 1.00 13.24 ? 486  HIS A CD2 1 
ATOM   284  C CE1 . HIS A 1 36  ? 7.636   6.403   29.614 1.00 13.72 ? 486  HIS A CE1 1 
ATOM   285  N NE2 . HIS A 1 36  ? 8.349   7.324   30.237 1.00 15.27 ? 486  HIS A NE2 1 
ATOM   286  N N   . GLY A 1 37  ? 12.009  6.062   24.673 1.00 9.30  ? 487  GLY A N   1 
ATOM   287  C CA  . GLY A 1 37  ? 13.242  6.060   23.905 1.00 10.90 ? 487  GLY A CA  1 
ATOM   288  C C   . GLY A 1 37  ? 13.262  7.093   22.799 1.00 11.39 ? 487  GLY A C   1 
ATOM   289  O O   . GLY A 1 37  ? 14.332  7.569   22.409 1.00 12.59 ? 487  GLY A O   1 
ATOM   290  N N   . LYS A 1 38  ? 12.091  7.453   22.284 1.00 9.54  ? 488  LYS A N   1 
ATOM   291  C CA  . LYS A 1 38  ? 11.943  8.455   21.230 1.00 9.86  ? 488  LYS A CA  1 
ATOM   292  C C   . LYS A 1 38  ? 10.887  9.441   21.698 1.00 8.64  ? 488  LYS A C   1 
ATOM   293  O O   . LYS A 1 38  ? 9.721   9.364   21.290 1.00 8.62  ? 488  LYS A O   1 
ATOM   294  C CB  . LYS A 1 38  ? 11.564  7.799   19.902 1.00 11.53 ? 488  LYS A CB  1 
ATOM   295  C CG  . LYS A 1 38  ? 12.676  6.946   19.338 1.00 15.03 ? 488  LYS A CG  1 
ATOM   296  C CD  . LYS A 1 38  ? 12.252  6.134   18.141 1.00 21.46 ? 488  LYS A CD  1 
ATOM   297  C CE  . LYS A 1 38  ? 13.402  5.251   17.694 1.00 26.05 ? 488  LYS A CE  1 
ATOM   298  N NZ  . LYS A 1 38  ? 14.512  6.065   17.125 1.00 30.65 ? 488  LYS A NZ  1 
ATOM   299  N N   . PRO A 1 39  ? 11.267  10.385  22.559 1.00 9.11  ? 489  PRO A N   1 
ATOM   300  C CA  . PRO A 1 39  ? 10.278  11.281  23.171 1.00 9.99  ? 489  PRO A CA  1 
ATOM   301  C C   . PRO A 1 39  ? 9.479   12.038  22.123 1.00 9.61  ? 489  PRO A C   1 
ATOM   302  O O   . PRO A 1 39  ? 10.013  12.482  21.102 1.00 11.49 ? 489  PRO A O   1 
ATOM   303  C CB  . PRO A 1 39  ? 11.142  12.235  24.005 1.00 11.16 ? 489  PRO A CB  1 
ATOM   304  C CG  . PRO A 1 39  ? 12.363  11.432  24.330 1.00 11.79 ? 489  PRO A CG  1 
ATOM   305  C CD  . PRO A 1 39  ? 12.619  10.592  23.105 1.00 10.52 ? 489  PRO A CD  1 
ATOM   306  N N   . GLY A 1 40  ? 8.189   12.195  22.399 1.00 8.75  ? 490  GLY A N   1 
ATOM   307  C CA  . GLY A 1 40  ? 7.273   12.831  21.482 1.00 10.18 ? 490  GLY A CA  1 
ATOM   308  C C   . GLY A 1 40  ? 6.617   11.895  20.490 1.00 10.59 ? 490  GLY A C   1 
ATOM   309  O O   . GLY A 1 40  ? 5.629   12.287  19.860 1.00 11.10 ? 490  GLY A O   1 
ATOM   310  N N   . GLU A 1 41  ? 7.130   10.677  20.337 1.00 9.99  ? 491  GLU A N   1 
ATOM   311  C CA  . GLU A 1 41  ? 6.530   9.690   19.451 1.00 9.41  ? 491  GLU A CA  1 
ATOM   312  C C   . GLU A 1 41  ? 5.542   8.818   20.219 1.00 9.12  ? 491  GLU A C   1 
ATOM   313  O O   . GLU A 1 41  ? 5.636   8.643   21.436 1.00 9.33  ? 491  GLU A O   1 
ATOM   314  C CB  . GLU A 1 41  ? 7.602   8.795   18.821 1.00 10.86 ? 491  GLU A CB  1 
ATOM   315  C CG  . GLU A 1 41  ? 8.763   9.514   18.140 1.00 15.70 ? 491  GLU A CG  1 
ATOM   316  C CD  . GLU A 1 41  ? 8.391   10.118  16.810 1.00 17.40 ? 491  GLU A CD  1 
ATOM   317  O OE1 . GLU A 1 41  ? 9.207   10.894  16.266 1.00 20.97 ? 491  GLU A OE1 1 
ATOM   318  O OE2 . GLU A 1 41  ? 7.290   9.821   16.301 1.00 18.45 ? 491  GLU A OE2 1 
ATOM   319  N N   . TYR A 1 42  ? 4.603   8.242   19.481 1.00 7.82  ? 492  TYR A N   1 
ATOM   320  C CA  . TYR A 1 42  ? 3.684   7.249   20.015 1.00 7.48  ? 492  TYR A CA  1 
ATOM   321  C C   . TYR A 1 42  ? 4.076   5.853   19.545 1.00 8.04  ? 492  TYR A C   1 
ATOM   322  O O   . TYR A 1 42  ? 4.675   5.682   18.479 1.00 8.49  ? 492  TYR A O   1 
ATOM   323  C CB  . TYR A 1 42  ? 2.269   7.533   19.542 1.00 8.59  ? 492  TYR A CB  1 
ATOM   324  C CG  . TYR A 1 42  ? 1.648   8.773   20.120 1.00 8.45  ? 492  TYR A CG  1 
ATOM   325  C CD1 . TYR A 1 42  ? 1.794   10.012  19.501 1.00 9.67  ? 492  TYR A CD1 1 
ATOM   326  C CD2 . TYR A 1 42  ? 0.878   8.700   21.267 1.00 9.86  ? 492  TYR A CD2 1 
ATOM   327  C CE1 . TYR A 1 42  ? 1.198   11.146  20.028 1.00 10.84 ? 492  TYR A CE1 1 
ATOM   328  C CE2 . TYR A 1 42  ? 0.274   9.824   21.794 1.00 9.91  ? 492  TYR A CE2 1 
ATOM   329  C CZ  . TYR A 1 42  ? 0.439   11.040  21.173 1.00 10.92 ? 492  TYR A CZ  1 
ATOM   330  O OH  . TYR A 1 42  ? -0.168  12.161  21.704 1.00 15.38 ? 492  TYR A OH  1 
ATOM   331  N N   . VAL A 1 43  ? 3.712   4.849   20.341 1.00 7.37  ? 493  VAL A N   1 
ATOM   332  C CA  . VAL A 1 43  ? 4.091   3.461   20.105 1.00 7.66  ? 493  VAL A CA  1 
ATOM   333  C C   . VAL A 1 43  ? 2.844   2.593   20.121 1.00 6.57  ? 493  VAL A C   1 
ATOM   334  O O   . VAL A 1 43  ? 2.022   2.700   21.040 1.00 7.34  ? 493  VAL A O   1 
ATOM   335  C CB  . VAL A 1 43  ? 5.049   2.966   21.202 1.00 7.12  ? 493  VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 43  ? 5.522   1.553   20.906 1.00 9.39  ? 493  VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 43  ? 6.214   3.924   21.368 1.00 9.83  ? 493  VAL A CG2 1 
ATOM   338  N N   . LEU A 1 44  ? 2.717   1.717   19.128 1.00 6.35  ? 494  LEU A N   1 
ATOM   339  C CA  . LEU A 1 44  ? 1.783   0.604   19.185 1.00 6.52  ? 494  LEU A CA  1 
ATOM   340  C C   . LEU A 1 44  ? 2.566   -0.615  19.654 1.00 8.04  ? 494  LEU A C   1 
ATOM   341  O O   . LEU A 1 44  ? 3.502   -1.049  18.972 1.00 8.19  ? 494  LEU A O   1 
ATOM   342  C CB  . LEU A 1 44  ? 1.189   0.341   17.803 1.00 8.29  ? 494  LEU A CB  1 
ATOM   343  C CG  . LEU A 1 44  ? 0.354   -0.935  17.694 1.00 7.85  ? 494  LEU A CG  1 
ATOM   344  C CD1 . LEU A 1 44  ? -0.924  -0.837  18.506 1.00 10.26 ? 494  LEU A CD1 1 
ATOM   345  C CD2 . LEU A 1 44  ? 0.042   -1.240  16.231 1.00 11.37 ? 494  LEU A CD2 1 
ATOM   346  N N   . SER A 1 45  ? 2.209   -1.145  20.820 1.00 6.86  ? 495  SER A N   1 
ATOM   347  C CA  . SER A 1 45  ? 2.862   -2.326  21.378 1.00 7.07  ? 495  SER A CA  1 
ATOM   348  C C   . SER A 1 45  ? 1.905   -3.504  21.251 1.00 7.51  ? 495  SER A C   1 
ATOM   349  O O   . SER A 1 45  ? 0.737   -3.397  21.634 1.00 7.17  ? 495  SER A O   1 
ATOM   350  C CB  . SER A 1 45  ? 3.233   -2.101  22.846 1.00 7.79  ? 495  SER A CB  1 
ATOM   351  O OG  . SER A 1 45  ? 4.215   -1.081  22.974 1.00 9.02  ? 495  SER A OG  1 
ATOM   352  N N   . VAL A 1 46  ? 2.389   -4.619  20.694 1.00 8.77  ? 496  VAL A N   1 
ATOM   353  C CA  A VAL A 1 46  ? 1.557   -5.780  20.397 0.56 9.74  ? 496  VAL A CA  1 
ATOM   354  C CA  B VAL A 1 46  ? 1.560   -5.782  20.396 0.44 9.84  ? 496  VAL A CA  1 
ATOM   355  C C   . VAL A 1 46  ? 2.264   -7.042  20.875 1.00 12.49 ? 496  VAL A C   1 
ATOM   356  O O   . VAL A 1 46  ? 3.493   -7.095  20.964 1.00 18.44 ? 496  VAL A O   1 
ATOM   357  C CB  A VAL A 1 46  ? 1.230   -5.873  18.883 0.56 11.50 ? 496  VAL A CB  1 
ATOM   358  C CB  B VAL A 1 46  ? 1.271   -5.908  18.887 0.44 11.46 ? 496  VAL A CB  1 
ATOM   359  C CG1 A VAL A 1 46  ? 0.214   -6.979  18.584 0.56 12.93 ? 496  VAL A CG1 1 
ATOM   360  C CG1 B VAL A 1 46  ? 0.740   -4.606  18.313 0.44 12.46 ? 496  VAL A CG1 1 
ATOM   361  C CG2 A VAL A 1 46  ? 0.713   -4.551  18.359 0.56 13.61 ? 496  VAL A CG2 1 
ATOM   362  C CG2 B VAL A 1 46  ? 2.527   -6.344  18.164 0.44 9.98  ? 496  VAL A CG2 1 
ATOM   363  N N   . TYR A 1 47  ? 1.477   -8.063  21.195 1.00 9.62  ? 497  TYR A N   1 
ATOM   364  C CA  . TYR A 1 47  ? 2.011   -9.401  21.416 1.00 9.63  ? 497  TYR A CA  1 
ATOM   365  C C   . TYR A 1 47  ? 1.731   -10.217 20.162 1.00 10.62 ? 497  TYR A C   1 
ATOM   366  O O   . TYR A 1 47  ? 0.583   -10.303 19.719 1.00 11.94 ? 497  TYR A O   1 
ATOM   367  C CB  . TYR A 1 47  ? 1.343   -10.078 22.612 1.00 9.91  ? 497  TYR A CB  1 
ATOM   368  C CG  . TYR A 1 47  ? 2.085   -11.315 23.090 1.00 9.56  ? 497  TYR A CG  1 
ATOM   369  C CD1 . TYR A 1 47  ? 1.785   -12.585 22.595 1.00 11.17 ? 497  TYR A CD1 1 
ATOM   370  C CD2 . TYR A 1 47  ? 3.097   -11.204 24.031 1.00 10.62 ? 497  TYR A CD2 1 
ATOM   371  C CE1 . TYR A 1 47  ? 2.477   -13.709 23.038 1.00 11.01 ? 497  TYR A CE1 1 
ATOM   372  C CE2 . TYR A 1 47  ? 3.791   -12.313 24.475 1.00 10.52 ? 497  TYR A CE2 1 
ATOM   373  C CZ  . TYR A 1 47  ? 3.480   -13.562 23.976 1.00 10.86 ? 497  TYR A CZ  1 
ATOM   374  O OH  . TYR A 1 47  ? 4.176   -14.664 24.427 1.00 14.53 ? 497  TYR A OH  1 
ATOM   375  N N   . SER A 1 48  ? 2.773   -10.809 19.590 1.00 11.63 ? 498  SER A N   1 
ATOM   376  C CA  . SER A 1 48  ? 2.570   -11.593 18.379 1.00 13.63 ? 498  SER A CA  1 
ATOM   377  C C   . SER A 1 48  ? 3.663   -12.640 18.268 1.00 18.85 ? 498  SER A C   1 
ATOM   378  O O   . SER A 1 48  ? 4.844   -12.321 18.418 1.00 17.27 ? 498  SER A O   1 
ATOM   379  C CB  . SER A 1 48  ? 2.575   -10.696 17.138 1.00 15.09 ? 498  SER A CB  1 
ATOM   380  O OG  . SER A 1 48  ? 2.276   -11.450 15.974 1.00 21.11 ? 498  SER A OG  1 
ATOM   381  N N   . ASP A 1 49  ? 3.257   -13.877 17.992 1.00 20.27 ? 499  ASP A N   1 
ATOM   382  C CA  . ASP A 1 49  ? 4.181   -14.996 17.813 1.00 22.32 ? 499  ASP A CA  1 
ATOM   383  C C   . ASP A 1 49  ? 5.177   -15.089 18.970 1.00 22.91 ? 499  ASP A C   1 
ATOM   384  O O   . ASP A 1 49  ? 6.391   -15.190 18.780 1.00 27.35 ? 499  ASP A O   1 
ATOM   385  C CB  . ASP A 1 49  ? 4.877   -14.938 16.451 1.00 30.28 ? 499  ASP A CB  1 
ATOM   386  C CG  . ASP A 1 49  ? 3.893   -14.912 15.292 1.00 37.03 ? 499  ASP A CG  1 
ATOM   387  O OD1 . ASP A 1 49  ? 2.722   -15.300 15.490 1.00 39.98 ? 499  ASP A OD1 1 
ATOM   388  O OD2 . ASP A 1 49  ? 4.292   -14.506 14.181 1.00 41.32 ? 499  ASP A OD2 1 
ATOM   389  N N   . GLY A 1 50  ? 4.643   -15.028 20.189 1.00 15.87 ? 500  GLY A N   1 
ATOM   390  C CA  . GLY A 1 50  ? 5.448   -15.224 21.377 1.00 18.23 ? 500  GLY A CA  1 
ATOM   391  C C   . GLY A 1 50  ? 6.376   -14.092 21.737 1.00 16.57 ? 500  GLY A C   1 
ATOM   392  O O   . GLY A 1 50  ? 7.284   -14.285 22.548 1.00 21.28 ? 500  GLY A O   1 
ATOM   393  N N   . GLN A 1 51  ? 6.171   -12.905 21.166 1.00 16.26 ? 501  GLN A N   1 
ATOM   394  C CA  . GLN A 1 51  ? 7.063   -11.778 21.391 1.00 19.21 ? 501  GLN A CA  1 
ATOM   395  C C   . GLN A 1 51  ? 6.261   -10.489 21.512 1.00 14.87 ? 501  GLN A C   1 
ATOM   396  O O   . GLN A 1 51  ? 5.189   -10.345 20.917 1.00 16.11 ? 501  GLN A O   1 
ATOM   397  C CB  . GLN A 1 51  ? 8.065   -11.617 20.236 1.00 22.36 ? 501  GLN A CB  1 
ATOM   398  C CG  . GLN A 1 51  ? 9.010   -12.800 20.067 1.00 28.62 ? 501  GLN A CG  1 
ATOM   399  C CD  . GLN A 1 51  ? 9.788   -12.749 18.767 1.00 35.35 ? 501  GLN A CD  1 
ATOM   400  O OE1 . GLN A 1 51  ? 10.116  -13.785 18.189 1.00 40.47 ? 501  GLN A OE1 1 
ATOM   401  N NE2 . GLN A 1 51  ? 10.094  -11.543 18.304 1.00 37.31 ? 501  GLN A NE2 1 
ATOM   402  N N   . ARG A 1 52  ? 6.802   -9.541  22.272 1.00 15.39 ? 502  ARG A N   1 
ATOM   403  C CA  . ARG A 1 52  ? 6.278   -8.184  22.266 1.00 14.77 ? 502  ARG A CA  1 
ATOM   404  C C   . ARG A 1 52  ? 6.980   -7.391  21.175 1.00 14.93 ? 502  ARG A C   1 
ATOM   405  O O   . ARG A 1 52  ? 8.213   -7.397  21.085 1.00 19.56 ? 502  ARG A O   1 
ATOM   406  C CB  . ARG A 1 52  ? 6.491   -7.497  23.616 1.00 16.27 ? 502  ARG A CB  1 
ATOM   407  C CG  . ARG A 1 52  ? 5.563   -7.966  24.722 1.00 19.68 ? 502  ARG A CG  1 
ATOM   408  C CD  . ARG A 1 52  ? 6.200   -9.062  25.545 1.00 22.21 ? 502  ARG A CD  1 
ATOM   409  N NE  . ARG A 1 52  ? 5.295   -9.544  26.581 1.00 16.98 ? 502  ARG A NE  1 
ATOM   410  C CZ  . ARG A 1 52  ? 5.594   -10.508 27.440 1.00 18.69 ? 502  ARG A CZ  1 
ATOM   411  N NH1 . ARG A 1 52  ? 6.785   -11.094 27.395 1.00 25.63 ? 502  ARG A NH1 1 
ATOM   412  N NH2 . ARG A 1 52  ? 4.704   -10.884 28.341 1.00 19.22 ? 502  ARG A NH2 1 
ATOM   413  N N   . ARG A 1 53  ? 6.195   -6.722  20.343 1.00 12.01 ? 503  ARG A N   1 
ATOM   414  C CA  . ARG A 1 53  ? 6.721   -5.924  19.251 1.00 12.98 ? 503  ARG A CA  1 
ATOM   415  C C   . ARG A 1 53  ? 6.234   -4.498  19.417 1.00 10.02 ? 503  ARG A C   1 
ATOM   416  O O   . ARG A 1 53  ? 5.077   -4.269  19.783 1.00 10.73 ? 503  ARG A O   1 
ATOM   417  C CB  . ARG A 1 53  ? 6.260   -6.469  17.907 1.00 16.50 ? 503  ARG A CB  1 
ATOM   418  C CG  . ARG A 1 53  ? 6.553   -7.953  17.728 1.00 23.74 ? 503  ARG A CG  1 
ATOM   419  C CD  . ARG A 1 53  ? 5.988   -8.464  16.417 1.00 31.80 ? 503  ARG A CD  1 
ATOM   420  N NE  . ARG A 1 53  ? 6.817   -8.075  15.282 1.00 37.29 ? 503  ARG A NE  1 
ATOM   421  C CZ  . ARG A 1 53  ? 7.353   -8.938  14.426 1.00 40.39 ? 503  ARG A CZ  1 
ATOM   422  N NH1 . ARG A 1 53  ? 7.131   -10.236 14.572 1.00 41.75 ? 503  ARG A NH1 1 
ATOM   423  N NH2 . ARG A 1 53  ? 8.099   -8.503  13.419 1.00 44.09 ? 503  ARG A NH2 1 
ATOM   424  N N   . HIS A 1 54  ? 7.120   -3.547  19.145 1.00 8.60  ? 504  HIS A N   1 
ATOM   425  C CA  . HIS A 1 54  ? 6.870   -2.132  19.412 1.00 8.07  ? 504  HIS A CA  1 
ATOM   426  C C   . HIS A 1 54  ? 7.059   -1.347  18.126 1.00 8.55  ? 504  HIS A C   1 
ATOM   427  O O   . HIS A 1 54  ? 8.174   -1.271  17.597 1.00 10.39 ? 504  HIS A O   1 
ATOM   428  C CB  . HIS A 1 54  ? 7.803   -1.632  20.512 1.00 9.34  ? 504  HIS A CB  1 
ATOM   429  C CG  . HIS A 1 54  ? 7.712   -2.441  21.763 1.00 8.52  ? 504  HIS A CG  1 
ATOM   430  N ND1 . HIS A 1 54  ? 6.683   -2.292  22.667 1.00 8.58  ? 504  HIS A ND1 1 
ATOM   431  C CD2 . HIS A 1 54  ? 8.492   -3.443  22.234 1.00 9.91  ? 504  HIS A CD2 1 
ATOM   432  C CE1 . HIS A 1 54  ? 6.844   -3.158  23.652 1.00 10.17 ? 504  HIS A CE1 1 
ATOM   433  N NE2 . HIS A 1 54  ? 7.933   -3.869  23.411 1.00 10.33 ? 504  HIS A NE2 1 
ATOM   434  N N   . PHE A 1 55  ? 5.976   -0.765  17.621 1.00 8.95  ? 505  PHE A N   1 
ATOM   435  C CA  . PHE A 1 55  ? 5.989   -0.014  16.370 1.00 9.00  ? 505  PHE A CA  1 
ATOM   436  C C   . PHE A 1 55  ? 5.846   1.469   16.669 1.00 9.06  ? 505  PHE A C   1 
ATOM   437  O O   . PHE A 1 55  ? 4.892   1.876   17.337 1.00 9.90  ? 505  PHE A O   1 
ATOM   438  C CB  . PHE A 1 55  ? 4.805   -0.411  15.480 1.00 10.41 ? 505  PHE A CB  1 
ATOM   439  C CG  . PHE A 1 55  ? 4.786   -1.858  15.080 1.00 11.31 ? 505  PHE A CG  1 
ATOM   440  C CD1 . PHE A 1 55  ? 5.342   -2.265  13.876 1.00 11.59 ? 505  PHE A CD1 1 
ATOM   441  C CD2 . PHE A 1 55  ? 4.187   -2.807  15.896 1.00 13.00 ? 505  PHE A CD2 1 
ATOM   442  C CE1 . PHE A 1 55  ? 5.311   -3.606  13.496 1.00 13.78 ? 505  PHE A CE1 1 
ATOM   443  C CE2 . PHE A 1 55  ? 4.153   -4.140  15.527 1.00 16.13 ? 505  PHE A CE2 1 
ATOM   444  C CZ  . PHE A 1 55  ? 4.715   -4.541  14.328 1.00 16.74 ? 505  PHE A CZ  1 
ATOM   445  N N   . ILE A 1 56  ? 6.765   2.282   16.156 1.00 8.71  ? 506  ILE A N   1 
ATOM   446  C CA  . ILE A 1 56  ? 6.549   3.722   16.197 1.00 9.52  ? 506  ILE A CA  1 
ATOM   447  C C   . ILE A 1 56  ? 5.408   4.072   15.249 1.00 10.00 ? 506  ILE A C   1 
ATOM   448  O O   . ILE A 1 56  ? 5.362   3.598   14.103 1.00 12.33 ? 506  ILE A O   1 
ATOM   449  C CB  . ILE A 1 56  ? 7.840   4.473   15.833 1.00 10.62 ? 506  ILE A CB  1 
ATOM   450  C CG1 . ILE A 1 56  ? 8.913   4.260   16.905 1.00 13.10 ? 506  ILE A CG1 1 
ATOM   451  C CG2 . ILE A 1 56  ? 7.565   5.965   15.617 1.00 11.79 ? 506  ILE A CG2 1 
ATOM   452  C CD1 . ILE A 1 56  ? 8.600   4.914   18.225 1.00 13.23 ? 506  ILE A CD1 1 
ATOM   453  N N   . ILE A 1 57  ? 4.454   4.862   15.736 1.00 9.53  ? 507  ILE A N   1 
ATOM   454  C CA  . ILE A 1 57  ? 3.391   5.395   14.886 1.00 10.91 ? 507  ILE A CA  1 
ATOM   455  C C   . ILE A 1 57  ? 3.956   6.639   14.207 1.00 10.76 ? 507  ILE A C   1 
ATOM   456  O O   . ILE A 1 57  ? 4.076   7.693   14.833 1.00 13.42 ? 507  ILE A O   1 
ATOM   457  C CB  . ILE A 1 57  ? 2.124   5.701   15.683 1.00 9.34  ? 507  ILE A CB  1 
ATOM   458  C CG1 . ILE A 1 57  ? 1.687   4.456   16.459 1.00 11.28 ? 507  ILE A CG1 1 
ATOM   459  C CG2 . ILE A 1 57  ? 1.022   6.179   14.739 1.00 12.67 ? 507  ILE A CG2 1 
ATOM   460  C CD1 . ILE A 1 57  ? 0.471   4.651   17.340 1.00 11.40 ? 507  ILE A CD1 1 
ATOM   461  N N   . GLN A 1 58  ? 4.332   6.514   12.936 1.00 10.59 ? 508  GLN A N   1 
ATOM   462  C CA  . GLN A 1 58  ? 5.004   7.602   12.237 1.00 11.33 ? 508  GLN A CA  1 
ATOM   463  C C   . GLN A 1 58  ? 4.075   8.797   12.097 1.00 11.27 ? 508  GLN A C   1 
ATOM   464  O O   . GLN A 1 58  ? 2.891   8.652   11.789 1.00 12.23 ? 508  GLN A O   1 
ATOM   465  C CB  . GLN A 1 58  ? 5.419   7.155   10.837 1.00 14.98 ? 508  GLN A CB  1 
ATOM   466  C CG  . GLN A 1 58  ? 6.221   5.871   10.785 1.00 25.90 ? 508  GLN A CG  1 
ATOM   467  C CD  . GLN A 1 58  ? 7.653   6.066   11.215 1.00 32.92 ? 508  GLN A CD  1 
ATOM   468  O OE1 . GLN A 1 58  ? 8.183   5.282   11.991 1.00 37.53 ? 508  GLN A OE1 1 
ATOM   469  N NE2 . GLN A 1 58  ? 8.291   7.114   10.708 1.00 36.82 ? 508  GLN A NE2 1 
ATOM   470  N N   . TYR A 1 59  ? 4.616   9.987   12.321 1.00 11.93 ? 509  TYR A N   1 
ATOM   471  C CA  . TYR A 1 59  ? 3.875   11.231  12.145 1.00 10.33 ? 509  TYR A CA  1 
ATOM   472  C C   . TYR A 1 59  ? 4.645   12.091  11.151 1.00 13.10 ? 509  TYR A C   1 
ATOM   473  O O   . TYR A 1 59  ? 5.704   12.637  11.480 1.00 14.20 ? 509  TYR A O   1 
ATOM   474  C CB  . TYR A 1 59  ? 3.672   11.942  13.482 1.00 11.81 ? 509  TYR A CB  1 
ATOM   475  C CG  . TYR A 1 59  ? 2.991   13.273  13.330 1.00 11.55 ? 509  TYR A CG  1 
ATOM   476  C CD1 . TYR A 1 59  ? 1.651   13.351  12.969 1.00 12.73 ? 509  TYR A CD1 1 
ATOM   477  C CD2 . TYR A 1 59  ? 3.688   14.457  13.541 1.00 13.34 ? 509  TYR A CD2 1 
ATOM   478  C CE1 . TYR A 1 59  ? 1.023   14.573  12.818 1.00 12.57 ? 509  TYR A CE1 1 
ATOM   479  C CE2 . TYR A 1 59  ? 3.070   15.684  13.388 1.00 14.94 ? 509  TYR A CE2 1 
ATOM   480  C CZ  . TYR A 1 59  ? 1.737   15.735  13.026 1.00 13.65 ? 509  TYR A CZ  1 
ATOM   481  O OH  . TYR A 1 59  ? 1.107   16.950  12.872 1.00 15.66 ? 509  TYR A OH  1 
ATOM   482  N N   . VAL A 1 60  ? 4.121   12.190  9.931  1.00 14.05 ? 510  VAL A N   1 
ATOM   483  C CA  . VAL A 1 60  ? 4.801   12.837  8.815  1.00 17.23 ? 510  VAL A CA  1 
ATOM   484  C C   . VAL A 1 60  ? 3.757   13.626  8.045  1.00 17.97 ? 510  VAL A C   1 
ATOM   485  O O   . VAL A 1 60  ? 2.692   13.092  7.716  1.00 16.95 ? 510  VAL A O   1 
ATOM   486  C CB  . VAL A 1 60  ? 5.469   11.808  7.878  1.00 20.37 ? 510  VAL A CB  1 
ATOM   487  C CG1 . VAL A 1 60  ? 6.126   12.511  6.696  1.00 25.12 ? 510  VAL A CG1 1 
ATOM   488  C CG2 . VAL A 1 60  ? 6.489   10.958  8.628  1.00 23.20 ? 510  VAL A CG2 1 
ATOM   489  N N   . ASP A 1 61  ? 4.053   14.894  7.765  1.00 18.10 ? 511  ASP A N   1 
ATOM   490  C CA  . ASP A 1 61  ? 3.175   15.721  6.940  1.00 21.02 ? 511  ASP A CA  1 
ATOM   491  C C   . ASP A 1 61  ? 1.744   15.723  7.480  1.00 17.74 ? 511  ASP A C   1 
ATOM   492  O O   . ASP A 1 61  ? 0.772   15.585  6.734  1.00 19.61 ? 511  ASP A O   1 
ATOM   493  C CB  . ASP A 1 61  ? 3.230   15.271  5.476  1.00 28.18 ? 511  ASP A CB  1 
ATOM   494  C CG  . ASP A 1 61  ? 2.854   16.373  4.504  1.00 45.59 ? 511  ASP A CG  1 
ATOM   495  O OD1 . ASP A 1 61  ? 2.399   17.445  4.955  1.00 49.56 ? 511  ASP A OD1 1 
ATOM   496  O OD2 . ASP A 1 61  ? 3.022   16.163  3.284  1.00 52.86 ? 511  ASP A OD2 1 
ATOM   497  N N   . ASN A 1 62  ? 1.617   15.850  8.802  1.00 16.03 ? 512  ASN A N   1 
ATOM   498  C CA  . ASN A 1 62  ? 0.347   15.955  9.517  1.00 15.57 ? 512  ASN A CA  1 
ATOM   499  C C   . ASN A 1 62  ? -0.462  14.661  9.513  1.00 14.59 ? 512  ASN A C   1 
ATOM   500  O O   . ASN A 1 62  ? -1.653  14.684  9.844  1.00 15.62 ? 512  ASN A O   1 
ATOM   501  C CB  . ASN A 1 62  ? -0.507  17.147  9.056  1.00 19.24 ? 512  ASN A CB  1 
ATOM   502  C CG  . ASN A 1 62  ? 0.241   18.469  9.150  1.00 24.15 ? 512  ASN A CG  1 
ATOM   503  O OD1 . ASN A 1 62  ? 0.540   18.953  10.244 1.00 32.07 ? 512  ASN A OD1 1 
ATOM   504  N ND2 . ASN A 1 62  ? 0.548   19.058  8.000  1.00 29.94 ? 512  ASN A ND2 1 
ATOM   505  N N   . MET A 1 63  ? 0.153   13.531  9.172  1.00 13.81 ? 513  MET A N   1 
ATOM   506  C CA  . MET A 1 63  ? -0.538  12.253  9.094  1.00 13.54 ? 513  MET A CA  1 
ATOM   507  C C   . MET A 1 63  ? 0.165   11.224  9.960  1.00 12.11 ? 513  MET A C   1 
ATOM   508  O O   . MET A 1 63  ? 1.399   11.176  10.012 1.00 12.93 ? 513  MET A O   1 
ATOM   509  C CB  . MET A 1 63  ? -0.563  11.728  7.657  1.00 15.01 ? 513  MET A CB  1 
ATOM   510  C CG  . MET A 1 63  ? -1.382  12.565  6.708  1.00 17.36 ? 513  MET A CG  1 
ATOM   511  S SD  . MET A 1 63  ? -3.130  12.444  7.115  1.00 20.13 ? 513  MET A SD  1 
ATOM   512  C CE  . MET A 1 63  ? -3.854  13.014  5.577  1.00 23.56 ? 513  MET A CE  1 
ATOM   513  N N   . TYR A 1 64  ? -0.632  10.401  10.633 1.00 10.38 ? 514  TYR A N   1 
ATOM   514  C CA  . TYR A 1 64  ? -0.141  9.234   11.352 1.00 10.17 ? 514  TYR A CA  1 
ATOM   515  C C   . TYR A 1 64  ? -0.305  8.001   10.478 1.00 10.40 ? 514  TYR A C   1 
ATOM   516  O O   . TYR A 1 64  ? -1.339  7.825   9.821  1.00 11.03 ? 514  TYR A O   1 
ATOM   517  C CB  . TYR A 1 64  ? -0.925  9.033   12.645 1.00 9.78  ? 514  TYR A CB  1 
ATOM   518  C CG  . TYR A 1 64  ? -0.761  10.156  13.638 1.00 10.34 ? 514  TYR A CG  1 
ATOM   519  C CD1 . TYR A 1 64  ? 0.302   10.167  14.536 1.00 9.51  ? 514  TYR A CD1 1 
ATOM   520  C CD2 . TYR A 1 64  ? -1.680  11.192  13.693 1.00 9.62  ? 514  TYR A CD2 1 
ATOM   521  C CE1 . TYR A 1 64  ? 0.442   11.190  15.449 1.00 9.62  ? 514  TYR A CE1 1 
ATOM   522  C CE2 . TYR A 1 64  ? -1.546  12.206  14.601 1.00 8.93  ? 514  TYR A CE2 1 
ATOM   523  C CZ  . TYR A 1 64  ? -0.485  12.205  15.476 1.00 9.91  ? 514  TYR A CZ  1 
ATOM   524  O OH  . TYR A 1 64  ? -0.356  13.228  16.390 1.00 11.19 ? 514  TYR A OH  1 
ATOM   525  N N   . ARG A 1 65  ? 0.720   7.158   10.452 1.00 10.86 ? 515  ARG A N   1 
ATOM   526  C CA  . ARG A 1 65  ? 0.688   5.998   9.576  1.00 12.13 ? 515  ARG A CA  1 
ATOM   527  C C   . ARG A 1 65  ? 1.668   4.954   10.081 1.00 11.59 ? 515  ARG A C   1 
ATOM   528  O O   . ARG A 1 65  ? 2.528   5.227   10.927 1.00 11.77 ? 515  ARG A O   1 
ATOM   529  C CB  . ARG A 1 65  ? 1.037   6.373   8.133  1.00 16.72 ? 515  ARG A CB  1 
ATOM   530  C CG  . ARG A 1 65  ? 2.427   6.962   7.977  1.00 20.42 ? 515  ARG A CG  1 
ATOM   531  C CD  . ARG A 1 65  ? 2.845   6.963   6.509  1.00 27.28 ? 515  ARG A CD  1 
ATOM   532  N NE  . ARG A 1 65  ? 1.790   7.472   5.642  1.00 34.83 ? 515  ARG A NE  1 
ATOM   533  C CZ  . ARG A 1 65  ? 1.758   8.710   5.163  1.00 38.20 ? 515  ARG A CZ  1 
ATOM   534  N NH1 . ARG A 1 65  ? 2.730   9.558   5.463  1.00 42.17 ? 515  ARG A NH1 1 
ATOM   535  N NH2 . ARG A 1 65  ? 0.758   9.104   4.383  1.00 36.92 ? 515  ARG A NH2 1 
ATOM   536  N N   . PHE A 1 66  ? 1.511   3.743   9.553  1.00 12.18 ? 516  PHE A N   1 
ATOM   537  C CA  . PHE A 1 66  ? 2.560   2.735   9.628  1.00 13.14 ? 516  PHE A CA  1 
ATOM   538  C C   . PHE A 1 66  ? 3.243   2.643   8.268  1.00 19.63 ? 516  PHE A C   1 
ATOM   539  O O   . PHE A 1 66  ? 4.201   3.378   8.007  1.00 24.60 ? 516  PHE A O   1 
ATOM   540  C CB  . PHE A 1 66  ? 2.014   1.395   10.130 1.00 15.17 ? 516  PHE A CB  1 
ATOM   541  C CG  . PHE A 1 66  ? 1.508   1.448   11.545 1.00 13.00 ? 516  PHE A CG  1 
ATOM   542  C CD1 . PHE A 1 66  ? 2.385   1.678   12.603 1.00 13.38 ? 516  PHE A CD1 1 
ATOM   543  C CD2 . PHE A 1 66  ? 0.163   1.283   11.823 1.00 12.06 ? 516  PHE A CD2 1 
ATOM   544  C CE1 . PHE A 1 66  ? 1.922   1.740   13.896 1.00 14.35 ? 516  PHE A CE1 1 
ATOM   545  C CE2 . PHE A 1 66  ? -0.305  1.347   13.115 1.00 13.78 ? 516  PHE A CE2 1 
ATOM   546  C CZ  . PHE A 1 66  ? 0.576   1.574   14.154 1.00 13.23 ? 516  PHE A CZ  1 
ATOM   547  N N   . GLU A 1 67  ? 2.728   1.793   7.380  1.00 16.29 ? 517  GLU A N   1 
ATOM   548  C CA  . GLU A 1 67  ? 3.285   1.615   6.045  1.00 22.07 ? 517  GLU A CA  1 
ATOM   549  C C   . GLU A 1 67  ? 2.315   1.973   4.933  1.00 21.31 ? 517  GLU A C   1 
ATOM   550  O O   . GLU A 1 67  ? 2.674   1.856   3.754  1.00 23.53 ? 517  GLU A O   1 
ATOM   551  C CB  . GLU A 1 67  ? 3.710   0.157   5.824  1.00 25.28 ? 517  GLU A CB  1 
ATOM   552  C CG  . GLU A 1 67  ? 4.938   -0.282  6.573  1.00 28.59 ? 517  GLU A CG  1 
ATOM   553  C CD  . GLU A 1 67  ? 5.415   -1.640  6.105  1.00 22.08 ? 517  GLU A CD  1 
ATOM   554  O OE1 . GLU A 1 67  ? 4.602   -2.382  5.504  1.00 29.32 ? 517  GLU A OE1 1 
ATOM   555  O OE2 . GLU A 1 67  ? 6.598   -1.961  6.335  1.00 31.68 ? 517  GLU A OE2 1 
ATOM   556  N N   . GLY A 1 68  ? 1.094   2.371   5.260  1.00 17.54 ? 518  GLY A N   1 
ATOM   557  C CA  . GLY A 1 68  ? 0.108   2.588   4.226  1.00 17.96 ? 518  GLY A CA  1 
ATOM   558  C C   . GLY A 1 68  ? -0.606  3.910   4.371  1.00 17.14 ? 518  GLY A C   1 
ATOM   559  O O   . GLY A 1 68  ? 0.031   4.962   4.462  1.00 18.63 ? 518  GLY A O   1 
ATOM   560  N N   . THR A 1 69  ? -1.936  3.851   4.393  1.00 15.97 ? 519  THR A N   1 
ATOM   561  C CA  . THR A 1 69  ? -2.757  5.051   4.473  1.00 14.77 ? 519  THR A CA  1 
ATOM   562  C C   . THR A 1 69  ? -2.404  5.874   5.704  1.00 12.32 ? 519  THR A C   1 
ATOM   563  O O   . THR A 1 69  ? -2.170  5.336   6.793  1.00 12.97 ? 519  THR A O   1 
ATOM   564  C CB  . THR A 1 69  ? -4.224  4.646   4.548  1.00 13.22 ? 519  THR A CB  1 
ATOM   565  O OG1 . THR A 1 69  ? -4.574  3.940   3.352  1.00 15.43 ? 519  THR A OG1 1 
ATOM   566  C CG2 . THR A 1 69  ? -5.119  5.858   4.693  1.00 14.23 ? 519  THR A CG2 1 
ATOM   567  N N   . GLY A 1 70  ? -2.367  7.189   5.517  1.00 12.72 ? 520  GLY A N   1 
ATOM   568  C CA  . GLY A 1 70  ? -2.190  8.129   6.614  1.00 12.87 ? 520  GLY A CA  1 
ATOM   569  C C   . GLY A 1 70  ? -3.525  8.700   7.061  1.00 11.38 ? 520  GLY A C   1 
ATOM   570  O O   . GLY A 1 70  ? -4.417  8.932   6.243  1.00 12.44 ? 520  GLY A O   1 
ATOM   571  N N   . PHE A 1 71  ? -3.654  8.921   8.366  1.00 10.61 ? 521  PHE A N   1 
ATOM   572  C CA  . PHE A 1 71  ? -4.842  9.525   8.950  1.00 10.27 ? 521  PHE A CA  1 
ATOM   573  C C   . PHE A 1 71  ? -4.434  10.705  9.820  1.00 10.33 ? 521  PHE A C   1 
ATOM   574  O O   . PHE A 1 71  ? -3.323  10.754  10.349 1.00 11.76 ? 521  PHE A O   1 
ATOM   575  C CB  . PHE A 1 71  ? -5.637  8.515   9.796  1.00 13.06 ? 521  PHE A CB  1 
ATOM   576  C CG  . PHE A 1 71  ? -6.130  7.319   9.024  1.00 14.51 ? 521  PHE A CG  1 
ATOM   577  C CD1 . PHE A 1 71  ? -5.373  6.166   8.957  1.00 12.52 ? 521  PHE A CD1 1 
ATOM   578  C CD2 . PHE A 1 71  ? -7.356  7.349   8.379  1.00 19.18 ? 521  PHE A CD2 1 
ATOM   579  C CE1 . PHE A 1 71  ? -5.830  5.056   8.252  1.00 15.49 ? 521  PHE A CE1 1 
ATOM   580  C CE2 . PHE A 1 71  ? -7.818  6.246   7.682  1.00 17.82 ? 521  PHE A CE2 1 
ATOM   581  C CZ  . PHE A 1 71  ? -7.048  5.099   7.621  1.00 16.62 ? 521  PHE A CZ  1 
ATOM   582  N N   . SER A 1 72  ? -5.360  11.647  10.005 1.00 12.08 ? 522  SER A N   1 
ATOM   583  C CA  . SER A 1 72  ? -5.033  12.833  10.790 1.00 11.19 ? 522  SER A CA  1 
ATOM   584  C C   . SER A 1 72  ? -4.839  12.533  12.270 1.00 11.50 ? 522  SER A C   1 
ATOM   585  O O   . SER A 1 72  ? -4.268  13.358  12.981 1.00 11.39 ? 522  SER A O   1 
ATOM   586  C CB  . SER A 1 72  ? -6.129  13.885  10.647 1.00 15.11 ? 522  SER A CB  1 
ATOM   587  O OG  . SER A 1 72  ? -7.322  13.429  11.253 1.00 16.21 ? 522  SER A OG  1 
ATOM   588  N N   . ASN A 1 73  ? -5.305  11.384  12.755 1.00 10.59 ? 523  ASN A N   1 
ATOM   589  C CA  . ASN A 1 73  ? -5.276  11.117  14.186 1.00 10.09 ? 523  ASN A CA  1 
ATOM   590  C C   . ASN A 1 73  ? -5.065  9.629   14.437 1.00 8.97  ? 523  ASN A C   1 
ATOM   591  O O   . ASN A 1 73  ? -5.413  8.782   13.610 1.00 10.22 ? 523  ASN A O   1 
ATOM   592  C CB  . ASN A 1 73  ? -6.582  11.572  14.833 1.00 12.18 ? 523  ASN A CB  1 
ATOM   593  C CG  . ASN A 1 73  ? -7.764  10.810  14.298 1.00 15.24 ? 523  ASN A CG  1 
ATOM   594  O OD1 . ASN A 1 73  ? -8.216  9.857   14.913 1.00 14.14 ? 523  ASN A OD1 1 
ATOM   595  N ND2 . ASN A 1 73  ? -8.242  11.192  13.115 1.00 18.99 ? 523  ASN A ND2 1 
ATOM   596  N N   . ILE A 1 74  ? -4.498  9.324   15.597 1.00 8.34  ? 524  ILE A N   1 
ATOM   597  C CA  . ILE A 1 74  ? -4.156  7.953   15.967 1.00 8.54  ? 524  ILE A CA  1 
ATOM   598  C C   . ILE A 1 74  ? -5.382  7.061   16.145 1.00 8.48  ? 524  ILE A C   1 
ATOM   599  O O   . ILE A 1 74  ? -5.376  5.934   15.635 1.00 8.69  ? 524  ILE A O   1 
ATOM   600  C CB  . ILE A 1 74  ? -3.196  7.917   17.167 1.00 7.13  ? 524  ILE A CB  1 
ATOM   601  C CG1 . ILE A 1 74  ? -1.836  8.457   16.731 1.00 8.03  ? 524  ILE A CG1 1 
ATOM   602  C CG2 . ILE A 1 74  ? -3.057  6.496   17.712 1.00 8.34  ? 524  ILE A CG2 1 
ATOM   603  C CD1 . ILE A 1 74  ? -0.867  8.675   17.855 1.00 9.39  ? 524  ILE A CD1 1 
ATOM   604  N N   . PRO A 1 75  ? -6.452  7.494   16.820 1.00 8.27  ? 525  PRO A N   1 
ATOM   605  C CA  . PRO A 1 75  ? -7.611  6.599   16.950 1.00 9.84  ? 525  PRO A CA  1 
ATOM   606  C C   . PRO A 1 75  ? -8.157  6.125   15.617 1.00 9.91  ? 525  PRO A C   1 
ATOM   607  O O   . PRO A 1 75  ? -8.547  4.957   15.500 1.00 10.96 ? 525  PRO A O   1 
ATOM   608  C CB  . PRO A 1 75  ? -8.612  7.427   17.766 1.00 10.35 ? 525  PRO A CB  1 
ATOM   609  C CG  . PRO A 1 75  ? -7.723  8.329   18.587 1.00 10.93 ? 525  PRO A CG  1 
ATOM   610  C CD  . PRO A 1 75  ? -6.622  8.709   17.638 1.00 9.58  ? 525  PRO A CD  1 
ATOM   611  N N   . GLN A 1 76  ? -8.165  6.975   14.591 1.00 9.69  ? 526  GLN A N   1 
ATOM   612  C CA  . GLN A 1 76  ? -8.657  6.515   13.298 1.00 11.16 ? 526  GLN A CA  1 
ATOM   613  C C   . GLN A 1 76  ? -7.743  5.450   12.705 1.00 11.05 ? 526  GLN A C   1 
ATOM   614  O O   . GLN A 1 76  ? -8.222  4.480   12.114 1.00 11.31 ? 526  GLN A O   1 
ATOM   615  C CB  . GLN A 1 76  ? -8.834  7.690   12.342 1.00 13.13 ? 526  GLN A CB  1 
ATOM   616  C CG  . GLN A 1 76  ? -9.542  7.307   11.060 1.00 17.24 ? 526  GLN A CG  1 
ATOM   617  C CD  . GLN A 1 76  ? -9.837  8.501   10.179 1.00 19.43 ? 526  GLN A CD  1 
ATOM   618  O OE1 . GLN A 1 76  ? -9.358  9.608   10.433 1.00 20.31 ? 526  GLN A OE1 1 
ATOM   619  N NE2 . GLN A 1 76  ? -10.631 8.284   9.131  1.00 21.50 ? 526  GLN A NE2 1 
ATOM   620  N N   . LEU A 1 77  ? -6.427  5.607   12.863 1.00 9.77  ? 527  LEU A N   1 
ATOM   621  C CA  . LEU A 1 77  ? -5.493  4.614   12.341 1.00 9.94  ? 527  LEU A CA  1 
ATOM   622  C C   . LEU A 1 77  ? -5.641  3.277   13.066 1.00 10.20 ? 527  LEU A C   1 
ATOM   623  O O   . LEU A 1 77  ? -5.716  2.217   12.432 1.00 10.48 ? 527  LEU A O   1 
ATOM   624  C CB  . LEU A 1 77  ? -4.066  5.151   12.467 1.00 10.08 ? 527  LEU A CB  1 
ATOM   625  C CG  . LEU A 1 77  ? -2.932  4.186   12.123 1.00 9.30  ? 527  LEU A CG  1 
ATOM   626  C CD1 . LEU A 1 77  ? -2.949  3.836   10.639 1.00 12.93 ? 527  LEU A CD1 1 
ATOM   627  C CD2 . LEU A 1 77  ? -1.584  4.770   12.533 1.00 11.62 ? 527  LEU A CD2 1 
ATOM   628  N N   . ILE A 1 78  ? -5.693  3.310   14.400 1.00 9.00  ? 528  ILE A N   1 
ATOM   629  C CA  . ILE A 1 78  ? -5.814  2.080   15.177 1.00 9.42  ? 528  ILE A CA  1 
ATOM   630  C C   . ILE A 1 78  ? -7.154  1.405   14.910 1.00 10.99 ? 528  ILE A C   1 
ATOM   631  O O   . ILE A 1 78  ? -7.217  0.188   14.694 1.00 9.84  ? 528  ILE A O   1 
ATOM   632  C CB  . ILE A 1 78  ? -5.616  2.379   16.672 1.00 9.64  ? 528  ILE A CB  1 
ATOM   633  C CG1 . ILE A 1 78  ? -4.228  2.971   16.932 1.00 9.72  ? 528  ILE A CG1 1 
ATOM   634  C CG2 . ILE A 1 78  ? -5.871  1.121   17.500 1.00 11.35 ? 528  ILE A CG2 1 
ATOM   635  C CD1 . ILE A 1 78  ? -3.068  2.090   16.519 1.00 13.02 ? 528  ILE A CD1 1 
ATOM   636  N N   . ASP A 1 79  ? -8.243  2.183   14.915 1.00 10.49 ? 529  ASP A N   1 
ATOM   637  C CA  . ASP A 1 79  ? -9.562  1.629   14.618 1.00 11.98 ? 529  ASP A CA  1 
ATOM   638  C C   . ASP A 1 79  ? -9.587  0.988   13.239 1.00 12.36 ? 529  ASP A C   1 
ATOM   639  O O   . ASP A 1 79  ? -10.206 -0.065  13.045 1.00 13.15 ? 529  ASP A O   1 
ATOM   640  C CB  . ASP A 1 79  ? -10.624 2.726   14.694 1.00 15.28 ? 529  ASP A CB  1 
ATOM   641  C CG  . ASP A 1 79  ? -10.869 3.218   16.112 1.00 18.23 ? 529  ASP A CG  1 
ATOM   642  O OD1 . ASP A 1 79  ? -10.354 2.600   17.071 1.00 20.39 ? 529  ASP A OD1 1 
ATOM   643  O OD2 . ASP A 1 79  ? -11.582 4.235   16.264 1.00 21.01 ? 529  ASP A OD2 1 
ATOM   644  N N   . HIS A 1 80  ? -8.932  1.621   12.263 1.00 10.98 ? 530  HIS A N   1 
ATOM   645  C CA  . HIS A 1 80  ? -8.844  1.042   10.927 1.00 11.61 ? 530  HIS A CA  1 
ATOM   646  C C   . HIS A 1 80  ? -8.228  -0.353  10.974 1.00 12.15 ? 530  HIS A C   1 
ATOM   647  O O   . HIS A 1 80  ? -8.785  -1.309  10.421 1.00 12.75 ? 530  HIS A O   1 
ATOM   648  C CB  . HIS A 1 80  ? -8.037  1.969   10.018 1.00 14.08 ? 530  HIS A CB  1 
ATOM   649  C CG  . HIS A 1 80  ? -7.710  1.362   8.693  1.00 16.82 ? 530  HIS A CG  1 
ATOM   650  N ND1 . HIS A 1 80  ? -8.664  1.144   7.721  1.00 18.49 ? 530  HIS A ND1 1 
ATOM   651  C CD2 . HIS A 1 80  ? -6.542  0.897   8.189  1.00 19.39 ? 530  HIS A CD2 1 
ATOM   652  C CE1 . HIS A 1 80  ? -8.095  0.580   6.671  1.00 23.33 ? 530  HIS A CE1 1 
ATOM   653  N NE2 . HIS A 1 80  ? -6.809  0.424   6.926  1.00 21.14 ? 530  HIS A NE2 1 
ATOM   654  N N   . HIS A 1 81  ? -7.084  -0.495  11.644 1.00 10.68 ? 531  HIS A N   1 
ATOM   655  C CA  . HIS A 1 81  ? -6.451  -1.810  11.716 1.00 11.45 ? 531  HIS A CA  1 
ATOM   656  C C   . HIS A 1 81  ? -7.268  -2.794  12.543 1.00 10.57 ? 531  HIS A C   1 
ATOM   657  O O   . HIS A 1 81  ? -7.304  -3.992  12.234 1.00 11.67 ? 531  HIS A O   1 
ATOM   658  C CB  . HIS A 1 81  ? -5.026  -1.686  12.252 1.00 11.83 ? 531  HIS A CB  1 
ATOM   659  C CG  . HIS A 1 81  ? -4.057  -1.176  11.234 1.00 11.78 ? 531  HIS A CG  1 
ATOM   660  N ND1 . HIS A 1 81  ? -3.460  -1.999  10.304 1.00 13.94 ? 531  HIS A ND1 1 
ATOM   661  C CD2 . HIS A 1 81  ? -3.604  0.075   10.978 1.00 14.26 ? 531  HIS A CD2 1 
ATOM   662  C CE1 . HIS A 1 81  ? -2.672  -1.279  9.525  1.00 15.46 ? 531  HIS A CE1 1 
ATOM   663  N NE2 . HIS A 1 81  ? -2.741  -0.017  9.912  1.00 16.77 ? 531  HIS A NE2 1 
ATOM   664  N N   . TYR A 1 82  ? -7.922  -2.319  13.604 1.00 10.94 ? 532  TYR A N   1 
ATOM   665  C CA  . TYR A 1 82  ? -8.690  -3.229  14.445 1.00 10.93 ? 532  TYR A CA  1 
ATOM   666  C C   . TYR A 1 82  ? -9.924  -3.748  13.718 1.00 13.32 ? 532  TYR A C   1 
ATOM   667  O O   . TYR A 1 82  ? -10.295 -4.919  13.873 1.00 15.11 ? 532  TYR A O   1 
ATOM   668  C CB  . TYR A 1 82  ? -9.075  -2.540  15.751 1.00 13.85 ? 532  TYR A CB  1 
ATOM   669  C CG  . TYR A 1 82  ? -9.872  -3.422  16.678 1.00 13.46 ? 532  TYR A CG  1 
ATOM   670  C CD1 . TYR A 1 82  ? -9.300  -4.539  17.271 1.00 12.96 ? 532  TYR A CD1 1 
ATOM   671  C CD2 . TYR A 1 82  ? -11.198 -3.133  16.963 1.00 17.83 ? 532  TYR A CD2 1 
ATOM   672  C CE1 . TYR A 1 82  ? -10.031 -5.346  18.119 1.00 13.80 ? 532  TYR A CE1 1 
ATOM   673  C CE2 . TYR A 1 82  ? -11.934 -3.932  17.810 1.00 21.16 ? 532  TYR A CE2 1 
ATOM   674  C CZ  . TYR A 1 82  ? -11.343 -5.037  18.385 1.00 18.16 ? 532  TYR A CZ  1 
ATOM   675  O OH  . TYR A 1 82  ? -12.070 -5.844  19.234 1.00 26.40 ? 532  TYR A OH  1 
ATOM   676  N N   . THR A 1 83  ? -10.572 -2.907  12.913 1.00 13.60 ? 533  THR A N   1 
ATOM   677  C CA  . THR A 1 83  ? -11.789 -3.368  12.251 1.00 14.95 ? 533  THR A CA  1 
ATOM   678  C C   . THR A 1 83  ? -11.494 -4.131  10.966 1.00 16.73 ? 533  THR A C   1 
ATOM   679  O O   . THR A 1 83  ? -12.178 -5.115  10.663 1.00 18.82 ? 533  THR A O   1 
ATOM   680  C CB  . THR A 1 83  ? -12.745 -2.202  11.982 1.00 17.34 ? 533  THR A CB  1 
ATOM   681  O OG1 . THR A 1 83  ? -12.128 -1.259  11.100 1.00 22.04 ? 533  THR A OG1 1 
ATOM   682  C CG2 . THR A 1 83  ? -13.123 -1.508  13.278 1.00 19.53 ? 533  THR A CG2 1 
ATOM   683  N N   . THR A 1 84  ? -10.502 -3.701  10.186 1.00 15.66 ? 534  THR A N   1 
ATOM   684  C CA  . THR A 1 84  ? -10.254 -4.342  8.896  1.00 17.03 ? 534  THR A CA  1 
ATOM   685  C C   . THR A 1 84  ? -9.296  -5.518  8.993  1.00 14.78 ? 534  THR A C   1 
ATOM   686  O O   . THR A 1 84  ? -9.219  -6.318  8.054  1.00 15.49 ? 534  THR A O   1 
ATOM   687  C CB  . THR A 1 84  ? -9.683  -3.341  7.883  1.00 18.73 ? 534  THR A CB  1 
ATOM   688  O OG1 . THR A 1 84  ? -8.377  -2.923  8.308  1.00 17.36 ? 534  THR A OG1 1 
ATOM   689  C CG2 . THR A 1 84  ? -10.600 -2.119  7.728  1.00 20.04 ? 534  THR A CG2 1 
ATOM   690  N N   . LYS A 1 85  ? -8.561  -5.635  10.095 1.00 13.01 ? 535  LYS A N   1 
ATOM   691  C CA  . LYS A 1 85  ? -7.544  -6.665  10.274 1.00 12.25 ? 535  LYS A CA  1 
ATOM   692  C C   . LYS A 1 85  ? -6.395  -6.559  9.266  1.00 13.51 ? 535  LYS A C   1 
ATOM   693  O O   . LYS A 1 85  ? -5.672  -7.533  9.044  1.00 16.74 ? 535  LYS A O   1 
ATOM   694  C CB  . LYS A 1 85  ? -8.143  -8.078  10.314 1.00 13.71 ? 535  LYS A CB  1 
ATOM   695  C CG  . LYS A 1 85  ? -9.266  -8.250  11.335 1.00 12.96 ? 535  LYS A CG  1 
ATOM   696  C CD  . LYS A 1 85  ? -8.825  -7.821  12.731 1.00 12.78 ? 535  LYS A CD  1 
ATOM   697  C CE  . LYS A 1 85  ? -9.924  -8.047  13.747 1.00 11.98 ? 535  LYS A CE  1 
ATOM   698  N NZ  . LYS A 1 85  ? -9.635  -7.364  15.043 1.00 13.90 ? 535  LYS A NZ  1 
ATOM   699  N N   . GLN A 1 86  ? -6.198  -5.387  8.659  1.00 14.72 ? 536  GLN A N   1 
ATOM   700  C CA  . GLN A 1 86  ? -5.009  -5.158  7.848  1.00 15.40 ? 536  GLN A CA  1 
ATOM   701  C C   . GLN A 1 86  ? -3.763  -5.271  8.714  1.00 14.74 ? 536  GLN A C   1 
ATOM   702  O O   . GLN A 1 86  ? -3.743  -4.803  9.857  1.00 13.52 ? 536  GLN A O   1 
ATOM   703  C CB  . GLN A 1 86  ? -5.069  -3.765  7.217  1.00 16.85 ? 536  GLN A CB  1 
ATOM   704  C CG  . GLN A 1 86  ? -6.115  -3.655  6.136  1.00 24.93 ? 536  GLN A CG  1 
ATOM   705  C CD  . GLN A 1 86  ? -6.187  -2.280  5.514  1.00 26.80 ? 536  GLN A CD  1 
ATOM   706  O OE1 . GLN A 1 86  ? -5.267  -1.472  5.643  1.00 25.26 ? 536  GLN A OE1 1 
ATOM   707  N NE2 . GLN A 1 86  ? -7.295  -2.003  4.835  1.00 31.84 ? 536  GLN A NE2 1 
ATOM   708  N N   . VAL A 1 87  ? -2.720  -5.903  8.172  1.00 15.33 ? 537  VAL A N   1 
ATOM   709  C CA  . VAL A 1 87  ? -1.496  -6.089  8.941  1.00 14.17 ? 537  VAL A CA  1 
ATOM   710  C C   . VAL A 1 87  ? -0.845  -4.739  9.220  1.00 14.85 ? 537  VAL A C   1 
ATOM   711  O O   . VAL A 1 87  ? -0.967  -3.785  8.438  1.00 16.73 ? 537  VAL A O   1 
ATOM   712  C CB  . VAL A 1 87  ? -0.521  -7.054  8.241  1.00 18.03 ? 537  VAL A CB  1 
ATOM   713  C CG1 . VAL A 1 87  ? -1.222  -8.369  7.912  1.00 21.43 ? 537  VAL A CG1 1 
ATOM   714  C CG2 . VAL A 1 87  ? 0.075   -6.416  6.982  1.00 21.03 ? 537  VAL A CG2 1 
ATOM   715  N N   . ILE A 1 88  ? -0.155  -4.650  10.359 1.00 13.02 ? 538  ILE A N   1 
ATOM   716  C CA  . ILE A 1 88  ? 0.505   -3.402  10.731 1.00 13.36 ? 538  ILE A CA  1 
ATOM   717  C C   . ILE A 1 88  ? 1.613   -3.068  9.740  1.00 14.45 ? 538  ILE A C   1 
ATOM   718  O O   . ILE A 1 88  ? 1.718   -1.932  9.262  1.00 14.99 ? 538  ILE A O   1 
ATOM   719  C CB  . ILE A 1 88  ? 1.022   -3.467  12.182 1.00 12.81 ? 538  ILE A CB  1 
ATOM   720  C CG1 . ILE A 1 88  ? -0.134  -3.705  13.164 1.00 12.23 ? 538  ILE A CG1 1 
ATOM   721  C CG2 . ILE A 1 88  ? 1.781   -2.200  12.532 1.00 15.07 ? 538  ILE A CG2 1 
ATOM   722  C CD1 . ILE A 1 88  ? -1.207  -2.644  13.127 1.00 13.87 ? 538  ILE A CD1 1 
ATOM   723  N N   . THR A 1 89  ? 2.465   -4.048  9.432  1.00 14.66 ? 539  THR A N   1 
ATOM   724  C CA  . THR A 1 89  ? 3.475   -3.940  8.388  1.00 17.27 ? 539  THR A CA  1 
ATOM   725  C C   . THR A 1 89  ? 3.531   -5.269  7.653  1.00 19.05 ? 539  THR A C   1 
ATOM   726  O O   . THR A 1 89  ? 3.163   -6.315  8.194  1.00 17.36 ? 539  THR A O   1 
ATOM   727  C CB  . THR A 1 89  ? 4.879   -3.639  8.943  1.00 19.81 ? 539  THR A CB  1 
ATOM   728  O OG1 . THR A 1 89  ? 5.334   -4.744  9.731  1.00 19.93 ? 539  THR A OG1 1 
ATOM   729  C CG2 . THR A 1 89  ? 4.885   -2.369  9.795  1.00 18.75 ? 539  THR A CG2 1 
ATOM   730  N N   . LYS A 1 90  ? 4.000   -5.220  6.405  1.00 18.40 ? 540  LYS A N   1 
ATOM   731  C CA  . LYS A 1 90  ? 4.163   -6.443  5.622  1.00 21.49 ? 540  LYS A CA  1 
ATOM   732  C C   . LYS A 1 90  ? 5.150   -7.393  6.289  1.00 24.53 ? 540  LYS A C   1 
ATOM   733  O O   . LYS A 1 90  ? 4.889   -8.594  6.411  1.00 24.74 ? 540  LYS A O   1 
ATOM   734  C CB  . LYS A 1 90  ? 4.628   -6.091  4.208  1.00 25.35 ? 540  LYS A CB  1 
ATOM   735  C CG  . LYS A 1 90  ? 4.737   -7.284  3.269  1.00 30.96 ? 540  LYS A CG  1 
ATOM   736  C CD  . LYS A 1 90  ? 5.090   -6.829  1.858  1.00 34.74 ? 540  LYS A CD  1 
ATOM   737  C CE  . LYS A 1 90  ? 4.469   -7.725  0.793  1.00 40.74 ? 540  LYS A CE  1 
ATOM   738  N NZ  . LYS A 1 90  ? 5.007   -9.112  0.821  1.00 43.15 ? 540  LYS A NZ  1 
ATOM   739  N N   . LYS A 1 91  ? 6.291   -6.866  6.740  1.00 23.19 ? 541  LYS A N   1 
ATOM   740  C CA  . LYS A 1 91  ? 7.316   -7.716  7.340  1.00 26.46 ? 541  LYS A CA  1 
ATOM   741  C C   . LYS A 1 91  ? 6.808   -8.407  8.603  1.00 24.27 ? 541  LYS A C   1 
ATOM   742  O O   . LYS A 1 91  ? 7.081   -9.594  8.821  1.00 27.69 ? 541  LYS A O   1 
ATOM   743  C CB  . LYS A 1 91  ? 8.572   -6.895  7.639  1.00 30.78 ? 541  LYS A CB  1 
ATOM   744  C CG  . LYS A 1 91  ? 9.664   -7.667  8.373  1.00 34.84 ? 541  LYS A CG  1 
ATOM   745  C CD  . LYS A 1 91  ? 10.821  -6.759  8.771  1.00 37.96 ? 541  LYS A CD  1 
ATOM   746  C CE  . LYS A 1 91  ? 11.799  -7.477  9.692  1.00 38.99 ? 541  LYS A CE  1 
ATOM   747  N NZ  . LYS A 1 91  ? 12.841  -6.553  10.221 1.00 40.61 ? 541  LYS A NZ  1 
ATOM   748  N N   . SER A 1 92  ? 6.066   -7.685  9.447  1.00 21.16 ? 542  SER A N   1 
ATOM   749  C CA  . SER A 1 92  ? 5.625   -8.259  10.713 1.00 21.76 ? 542  SER A CA  1 
ATOM   750  C C   . SER A 1 92  ? 4.392   -9.143  10.560 1.00 22.47 ? 542  SER A C   1 
ATOM   751  O O   . SER A 1 92  ? 4.250   -10.126 11.295 1.00 23.46 ? 542  SER A O   1 
ATOM   752  C CB  . SER A 1 92  ? 5.351   -7.153  11.737 1.00 20.83 ? 542  SER A CB  1 
ATOM   753  O OG  . SER A 1 92  ? 4.170   -6.434  11.413 1.00 19.86 ? 542  SER A OG  1 
ATOM   754  N N   . GLY A 1 93  ? 3.494   -8.814  9.632  1.00 18.19 ? 543  GLY A N   1 
ATOM   755  C CA  . GLY A 1 93  ? 2.240   -9.532  9.506  1.00 18.51 ? 543  GLY A CA  1 
ATOM   756  C C   . GLY A 1 93  ? 1.321   -9.450  10.708 1.00 19.24 ? 543  GLY A C   1 
ATOM   757  O O   . GLY A 1 93  ? 0.409   -10.272 10.833 1.00 20.12 ? 543  GLY A O   1 
ATOM   758  N N   . VAL A 1 94  ? 1.510   -8.465  11.581 1.00 16.99 ? 544  VAL A N   1 
ATOM   759  C CA  . VAL A 1 94  ? 0.794   -8.408  12.852 1.00 14.96 ? 544  VAL A CA  1 
ATOM   760  C C   . VAL A 1 94  ? -0.644  -7.951  12.640 1.00 13.58 ? 544  VAL A C   1 
ATOM   761  O O   . VAL A 1 94  ? -0.904  -6.961  11.946 1.00 13.36 ? 544  VAL A O   1 
ATOM   762  C CB  . VAL A 1 94  ? 1.539   -7.484  13.830 1.00 16.83 ? 544  VAL A CB  1 
ATOM   763  C CG1 . VAL A 1 94  ? 0.639   -7.089  14.984 1.00 13.96 ? 544  VAL A CG1 1 
ATOM   764  C CG2 . VAL A 1 94  ? 2.807   -8.164  14.334 1.00 18.87 ? 544  VAL A CG2 1 
ATOM   765  N N   . VAL A 1 95  ? -1.581  -8.658  13.267 1.00 13.03 ? 545  VAL A N   1 
ATOM   766  C CA  . VAL A 1 95  ? -3.004  -8.351  13.209 1.00 12.00 ? 545  VAL A CA  1 
ATOM   767  C C   . VAL A 1 95  ? -3.481  -8.025  14.620 1.00 10.82 ? 545  VAL A C   1 
ATOM   768  O O   . VAL A 1 95  ? -3.216  -8.783  15.560 1.00 12.71 ? 545  VAL A O   1 
ATOM   769  C CB  . VAL A 1 95  ? -3.800  -9.531  12.623 1.00 13.02 ? 545  VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 95  ? -5.284  -9.257  12.733 1.00 15.51 ? 545  VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 95  ? -3.384  -9.785  11.176 1.00 16.16 ? 545  VAL A CG2 1 
ATOM   772  N N   . LEU A 1 96  ? -4.180  -6.903  14.768 1.00 10.77 ? 546  LEU A N   1 
ATOM   773  C CA  . LEU A 1 96  ? -4.702  -6.496  16.066 1.00 10.69 ? 546  LEU A CA  1 
ATOM   774  C C   . LEU A 1 96  ? -5.967  -7.281  16.396 1.00 12.36 ? 546  LEU A C   1 
ATOM   775  O O   . LEU A 1 96  ? -6.903  -7.324  15.587 1.00 13.98 ? 546  LEU A O   1 
ATOM   776  C CB  . LEU A 1 96  ? -5.017  -5.002  16.058 1.00 11.40 ? 546  LEU A CB  1 
ATOM   777  C CG  . LEU A 1 96  ? -3.891  -4.040  15.678 1.00 10.48 ? 546  LEU A CG  1 
ATOM   778  C CD1 . LEU A 1 96  ? -4.352  -2.599  15.890 1.00 10.80 ? 546  LEU A CD1 1 
ATOM   779  C CD2 . LEU A 1 96  ? -2.618  -4.335  16.484 1.00 10.20 ? 546  LEU A CD2 1 
ATOM   780  N N   . LEU A 1 97  ? -6.005  -7.887  17.589 1.00 10.80 ? 547  LEU A N   1 
ATOM   781  C CA  . LEU A 1 97  ? -7.141  -8.701  18.017 1.00 10.48 ? 547  LEU A CA  1 
ATOM   782  C C   . LEU A 1 97  ? -7.760  -8.270  19.337 1.00 10.54 ? 547  LEU A C   1 
ATOM   783  O O   . LEU A 1 97  ? -8.988  -8.273  19.463 1.00 13.30 ? 547  LEU A O   1 
ATOM   784  C CB  . LEU A 1 97  ? -6.736  -10.176 18.139 1.00 13.36 ? 547  LEU A CB  1 
ATOM   785  C CG  . LEU A 1 97  ? -6.292  -10.931 16.890 1.00 13.08 ? 547  LEU A CG  1 
ATOM   786  C CD1 . LEU A 1 97  ? -5.881  -12.341 17.275 1.00 15.73 ? 547  LEU A CD1 1 
ATOM   787  C CD2 . LEU A 1 97  ? -7.407  -10.956 15.855 1.00 16.53 ? 547  LEU A CD2 1 
ATOM   788  N N   . ASN A 1 98  ? -6.962  -7.943  20.349 1.00 10.53 ? 548  ASN A N   1 
ATOM   789  C CA  . ASN A 1 98  ? -7.485  -7.748  21.702 1.00 11.25 ? 548  ASN A CA  1 
ATOM   790  C C   . ASN A 1 98  ? -6.982  -6.421  22.253 1.00 10.28 ? 548  ASN A C   1 
ATOM   791  O O   . ASN A 1 98  ? -5.801  -6.329  22.647 1.00 9.75  ? 548  ASN A O   1 
ATOM   792  C CB  . ASN A 1 98  ? -7.059  -8.883  22.636 1.00 11.85 ? 548  ASN A CB  1 
ATOM   793  C CG  . ASN A 1 98  ? -7.121  -10.251 21.986 1.00 14.65 ? 548  ASN A CG  1 
ATOM   794  O OD1 . ASN A 1 98  ? -6.121  -10.986 21.956 1.00 17.46 ? 548  ASN A OD1 1 
ATOM   795  N ND2 . ASN A 1 98  ? -8.291  -10.616 21.489 1.00 14.94 ? 548  ASN A ND2 1 
ATOM   796  N N   . PRO A 1 99  ? -7.814  -5.383  22.320 1.00 9.86  ? 549  PRO A N   1 
ATOM   797  C CA  . PRO A 1 99  ? -7.359  -4.128  22.938 1.00 9.33  ? 549  PRO A CA  1 
ATOM   798  C C   . PRO A 1 99  ? -7.217  -4.328  24.439 1.00 10.03 ? 549  PRO A C   1 
ATOM   799  O O   . PRO A 1 99  ? -8.160  -4.741  25.119 1.00 11.35 ? 549  PRO A O   1 
ATOM   800  C CB  . PRO A 1 99  ? -8.482  -3.134  22.603 1.00 10.64 ? 549  PRO A CB  1 
ATOM   801  C CG  . PRO A 1 99  ? -9.696  -3.993  22.431 1.00 14.53 ? 549  PRO A CG  1 
ATOM   802  C CD  . PRO A 1 99  ? -9.210  -5.303  21.859 1.00 11.04 ? 549  PRO A CD  1 
ATOM   803  N N   . ILE A 1 100 ? -6.031  -4.058  24.968 1.00 8.23  ? 550  ILE A N   1 
ATOM   804  C CA  . ILE A 1 100 ? -5.761  -4.238  26.386 1.00 9.45  ? 550  ILE A CA  1 
ATOM   805  C C   . ILE A 1 100 ? -6.223  -2.982  27.113 1.00 10.31 ? 550  ILE A C   1 
ATOM   806  O O   . ILE A 1 100 ? -5.724  -1.884  26.798 1.00 9.86  ? 550  ILE A O   1 
ATOM   807  C CB  . ILE A 1 100 ? -4.286  -4.537  26.661 1.00 10.52 ? 550  ILE A CB  1 
ATOM   808  C CG1 . ILE A 1 100 ? -3.887  -5.855  25.990 1.00 14.36 ? 550  ILE A CG1 1 
ATOM   809  C CG2 . ILE A 1 100 ? -4.057  -4.593  28.165 1.00 12.17 ? 550  ILE A CG2 1 
ATOM   810  C CD1 . ILE A 1 100 ? -4.763  -7.031  26.371 1.00 18.20 ? 550  ILE A CD1 1 
ATOM   811  N N   . PRO A 1 101 ? -7.172  -3.075  28.033 1.00 9.33  ? 551  PRO A N   1 
ATOM   812  C CA  . PRO A 1 101 ? -7.726  -1.869  28.648 1.00 11.92 ? 551  PRO A CA  1 
ATOM   813  C C   . PRO A 1 101 ? -6.759  -1.226  29.626 1.00 11.90 ? 551  PRO A C   1 
ATOM   814  O O   . PRO A 1 101 ? -5.990  -1.891  30.327 1.00 13.92 ? 551  PRO A O   1 
ATOM   815  C CB  . PRO A 1 101 ? -8.973  -2.382  29.376 1.00 12.38 ? 551  PRO A CB  1 
ATOM   816  C CG  . PRO A 1 101 ? -8.648  -3.805  29.697 1.00 13.25 ? 551  PRO A CG  1 
ATOM   817  C CD  . PRO A 1 101 ? -7.818  -4.303  28.538 1.00 11.56 ? 551  PRO A CD  1 
ATOM   818  N N   . LYS A 1 102 ? -6.820  0.096   29.674 1.00 12.13 ? 552  LYS A N   1 
ATOM   819  C CA  . LYS A 1 102 ? -5.989  0.879   30.578 1.00 14.06 ? 552  LYS A CA  1 
ATOM   820  C C   . LYS A 1 102 ? -6.431  0.707   32.026 1.00 25.70 ? 552  LYS A C   1 
ATOM   821  O O   . LYS A 1 102 ? -7.558  0.293   32.298 1.00 27.25 ? 552  LYS A O   1 
ATOM   822  C CB  . LYS A 1 102 ? -6.041  2.354   30.190 1.00 14.77 ? 552  LYS A CB  1 
ATOM   823  C CG  . LYS A 1 102 ? -7.432  2.950   30.263 1.00 18.49 ? 552  LYS A CG  1 
ATOM   824  C CD  . LYS A 1 102 ? -7.446  4.343   29.681 1.00 22.59 ? 552  LYS A CD  1 
ATOM   825  C CE  . LYS A 1 102 ? -8.849  4.764   29.324 1.00 27.21 ? 552  LYS A CE  1 
ATOM   826  N NZ  . LYS A 1 102 ? -8.835  6.031   28.543 1.00 29.26 ? 552  LYS A NZ  1 
ATOM   827  O OXT . LYS A 1 102 ? -5.666  0.980   32.952 1.00 32.81 ? 552  LYS A OXT 1 
ATOM   828  N N   . ASP B 2 1   ? 16.411  0.861   23.065 1.00 24.69 ? 1    ASP B N   1 
ATOM   829  C CA  . ASP B 2 1   ? 15.654  -0.360  22.813 1.00 21.25 ? 1    ASP B CA  1 
ATOM   830  C C   . ASP B 2 1   ? 15.130  -0.363  21.387 1.00 22.43 ? 1    ASP B C   1 
ATOM   831  O O   . ASP B 2 1   ? 14.921  0.691   20.788 1.00 24.45 ? 1    ASP B O   1 
ATOM   832  C CB  . ASP B 2 1   ? 14.493  -0.488  23.796 1.00 16.15 ? 1    ASP B CB  1 
ATOM   833  C CG  . ASP B 2 1   ? 14.950  -0.521  25.237 1.00 17.78 ? 1    ASP B CG  1 
ATOM   834  O OD1 . ASP B 2 1   ? 16.157  -0.764  25.475 1.00 19.80 ? 1    ASP B OD1 1 
ATOM   835  O OD2 . ASP B 2 1   ? 14.096  -0.315  26.125 1.00 15.70 ? 1    ASP B OD2 1 
ATOM   836  N N   . GLU B 2 2   ? 14.909  -1.550  20.845 1.00 22.72 ? 2    GLU B N   1 
ATOM   837  C CA  . GLU B 2 2   ? 14.559  -1.647  19.439 1.00 24.95 ? 2    GLU B CA  1 
ATOM   838  C C   . GLU B 2 2   ? 13.072  -1.436  19.180 1.00 20.92 ? 2    GLU B C   1 
ATOM   839  O O   . GLU B 2 2   ? 12.206  -1.936  19.908 1.00 17.37 ? 2    GLU B O   1 
ATOM   840  C CB  . GLU B 2 2   ? 15.049  -2.968  18.842 1.00 36.62 ? 2    GLU B CB  1 
ATOM   841  C CG  . GLU B 2 2   ? 16.494  -3.315  19.207 1.00 48.71 ? 2    GLU B CG  1 
ATOM   842  C CD  . GLU B 2 2   ? 17.470  -2.164  18.985 1.00 58.64 ? 2    GLU B CD  1 
ATOM   843  O OE1 . GLU B 2 2   ? 17.273  -1.369  18.041 1.00 62.10 ? 2    GLU B OE1 1 
ATOM   844  O OE2 . GLU B 2 2   ? 18.443  -2.056  19.763 1.00 62.19 ? 2    GLU B OE2 1 
HETATM 845  N N   . PTR B 2 3   ? 12.800  -0.661  18.138 1.00 18.07 ? 3    PTR B N   1 
HETATM 846  C CA  . PTR B 2 3   ? 11.462  -0.524  17.600 1.00 14.49 ? 3    PTR B CA  1 
HETATM 847  C C   . PTR B 2 3   ? 11.465  -1.227  16.248 1.00 19.66 ? 3    PTR B C   1 
HETATM 848  O O   . PTR B 2 3   ? 12.477  -1.214  15.547 1.00 21.76 ? 3    PTR B O   1 
HETATM 849  C CB  . PTR B 2 3   ? 11.101  0.955   17.497 1.00 12.86 ? 3    PTR B CB  1 
HETATM 850  C CG  . PTR B 2 3   ? 10.790  1.619   18.824 1.00 11.92 ? 3    PTR B CG  1 
HETATM 851  C CD1 . PTR B 2 3   ? 9.589   1.378   19.478 1.00 9.69  ? 3    PTR B CD1 1 
HETATM 852  C CD2 . PTR B 2 3   ? 11.686  2.505   19.411 1.00 14.91 ? 3    PTR B CD2 1 
HETATM 853  C CE1 . PTR B 2 3   ? 9.289   1.992   20.683 1.00 9.71  ? 3    PTR B CE1 1 
HETATM 854  C CE2 . PTR B 2 3   ? 11.396  3.125   20.617 1.00 13.41 ? 3    PTR B CE2 1 
HETATM 855  C CZ  . PTR B 2 3   ? 10.198  2.858   21.259 1.00 9.37  ? 3    PTR B CZ  1 
HETATM 856  O OH  . PTR B 2 3   ? 9.916   3.468   22.396 1.00 8.50  ? 3    PTR B OH  1 
HETATM 857  P P   . PTR B 2 3   ? 10.271  2.871   23.856 1.00 9.25  ? 3    PTR B P   1 
HETATM 858  O O1P . PTR B 2 3   ? 9.819   1.465   23.872 1.00 9.01  ? 3    PTR B O1P 1 
HETATM 859  O O2P . PTR B 2 3   ? 9.494   3.713   24.871 1.00 10.06 ? 3    PTR B O2P 1 
HETATM 860  O O3P . PTR B 2 3   ? 11.792  3.030   24.024 1.00 12.90 ? 3    PTR B O3P 1 
ATOM   861  N N   . GLU B 2 4   ? 10.344  -1.844  15.895 1.00 20.42 ? 4    GLU B N   1 
ATOM   862  C CA  . GLU B 2 4   ? 10.259  -2.689  14.704 1.00 25.06 ? 4    GLU B CA  1 
ATOM   863  C C   . GLU B 2 4   ? 10.524  -1.925  13.417 1.00 29.50 ? 4    GLU B C   1 
ATOM   864  O O   . GLU B 2 4   ? 11.155  -2.438  12.491 1.00 32.86 ? 4    GLU B O   1 
ATOM   865  C CB  . GLU B 2 4   ? 8.868   -3.322  14.610 1.00 31.34 ? 4    GLU B CB  1 
ATOM   866  C CG  . GLU B 2 4   ? 8.473   -4.184  15.798 1.00 37.33 ? 4    GLU B CG  1 
ATOM   867  C CD  . GLU B 2 4   ? 9.264   -5.473  15.871 1.00 42.85 ? 4    GLU B CD  1 
ATOM   868  O OE1 . GLU B 2 4   ? 10.018  -5.663  16.850 1.00 45.64 ? 4    GLU B OE1 1 
ATOM   869  O OE2 . GLU B 2 4   ? 9.137   -6.295  14.942 1.00 46.22 ? 4    GLU B OE2 1 
ATOM   870  N N   . ASN B 2 5   ? 10.029  -0.691  13.366 1.00 30.43 ? 5    ASN B N   1 
ATOM   871  C CA  . ASN B 2 5   ? 9.976   0.081   12.132 1.00 38.75 ? 5    ASN B CA  1 
ATOM   872  C C   . ASN B 2 5   ? 10.787  1.368   12.202 1.00 49.18 ? 5    ASN B C   1 
ATOM   873  O O   . ASN B 2 5   ? 10.708  2.187   11.278 1.00 48.89 ? 5    ASN B O   1 
ATOM   874  C CB  . ASN B 2 5   ? 8.519   0.403   11.800 1.00 35.82 ? 5    ASN B CB  1 
ATOM   875  C CG  . ASN B 2 5   ? 7.808   1.082   12.951 1.00 31.28 ? 5    ASN B CG  1 
ATOM   876  O OD1 . ASN B 2 5   ? 8.280   1.044   14.096 1.00 25.92 ? 5    ASN B OD1 1 
ATOM   877  N ND2 . ASN B 2 5   ? 6.675   1.710   12.661 1.00 27.10 ? 5    ASN B ND2 1 
ATOM   878  N N   . VAL B 2 6   ? 11.540  1.583   13.277 1.00 55.85 ? 6    VAL B N   1 
ATOM   879  C CA  . VAL B 2 6   ? 12.393  2.763   13.397 1.00 58.11 ? 6    VAL B CA  1 
ATOM   880  C C   . VAL B 2 6   ? 13.760  2.388   13.955 1.00 59.64 ? 6    VAL B C   1 
ATOM   881  O O   . VAL B 2 6   ? 13.938  1.301   14.504 1.00 60.35 ? 6    VAL B O   1 
ATOM   882  C CB  . VAL B 2 6   ? 11.741  3.871   14.241 1.00 58.75 ? 6    VAL B CB  1 
ATOM   883  C CG1 . VAL B 2 6   ? 12.677  5.050   14.357 1.00 59.25 ? 6    VAL B CG1 1 
ATOM   884  C CG2 . VAL B 2 6   ? 10.468  4.323   13.607 1.00 60.04 ? 6    VAL B CG2 1 
ATOM   885  N N   . LYS C 1 3   ? 3.872   -3.712  41.259 1.00 35.11 ? 453  LYS C N   1 
ATOM   886  C CA  . LYS C 1 3   ? 2.846   -2.739  40.900 1.00 28.69 ? 453  LYS C CA  1 
ATOM   887  C C   . LYS C 1 3   ? 3.400   -1.681  39.952 1.00 24.80 ? 453  LYS C C   1 
ATOM   888  O O   . LYS C 1 3   ? 4.552   -1.269  40.079 1.00 24.55 ? 453  LYS C O   1 
ATOM   889  C CB  . LYS C 1 3   ? 2.280   -2.053  42.145 1.00 32.13 ? 453  LYS C CB  1 
ATOM   890  C CG  . LYS C 1 3   ? 1.840   -2.993  43.253 1.00 37.54 ? 453  LYS C CG  1 
ATOM   891  C CD  . LYS C 1 3   ? 0.734   -2.367  44.097 1.00 40.23 ? 453  LYS C CD  1 
ATOM   892  C CE  . LYS C 1 3   ? 0.940   -0.867  44.292 1.00 41.72 ? 453  LYS C CE  1 
ATOM   893  N NZ  . LYS C 1 3   ? 2.138   -0.531  45.114 1.00 42.78 ? 453  LYS C NZ  1 
ATOM   894  N N   . PRO C 1 4   ? 2.576   -1.237  39.008 1.00 16.92 ? 454  PRO C N   1 
ATOM   895  C CA  . PRO C 1 4   ? 3.021   -0.203  38.067 1.00 15.42 ? 454  PRO C CA  1 
ATOM   896  C C   . PRO C 1 4   ? 3.368   1.099   38.775 1.00 14.57 ? 454  PRO C C   1 
ATOM   897  O O   . PRO C 1 4   ? 2.950   1.362   39.907 1.00 15.24 ? 454  PRO C O   1 
ATOM   898  C CB  . PRO C 1 4   ? 1.809   -0.014  37.146 1.00 18.61 ? 454  PRO C CB  1 
ATOM   899  C CG  . PRO C 1 4   ? 1.003   -1.269  37.296 1.00 23.68 ? 454  PRO C CG  1 
ATOM   900  C CD  . PRO C 1 4   ? 1.216   -1.721  38.706 1.00 20.51 ? 454  PRO C CD  1 
ATOM   901  N N   . LEU C 1 5   ? 4.141   1.929   38.071 1.00 13.56 ? 455  LEU C N   1 
ATOM   902  C CA  . LEU C 1 5   ? 4.530   3.232   38.609 1.00 13.52 ? 455  LEU C CA  1 
ATOM   903  C C   . LEU C 1 5   ? 3.323   4.059   39.020 1.00 15.34 ? 455  LEU C C   1 
ATOM   904  O O   . LEU C 1 5   ? 3.341   4.713   40.069 1.00 14.73 ? 455  LEU C O   1 
ATOM   905  C CB  . LEU C 1 5   ? 5.335   4.011   37.570 1.00 15.86 ? 455  LEU C CB  1 
ATOM   906  C CG  . LEU C 1 5   ? 6.822   3.686   37.467 1.00 13.26 ? 455  LEU C CG  1 
ATOM   907  C CD1 . LEU C 1 5   ? 7.392   4.260   36.181 1.00 16.24 ? 455  LEU C CD1 1 
ATOM   908  C CD2 . LEU C 1 5   ? 7.574   4.230   38.670 1.00 12.96 ? 455  LEU C CD2 1 
ATOM   909  N N   . ALA C 1 6   ? 2.267   4.050   38.202 1.00 15.76 ? 456  ALA C N   1 
ATOM   910  C CA  . ALA C 1 6   ? 1.091   4.870   38.477 1.00 20.55 ? 456  ALA C CA  1 
ATOM   911  C C   . ALA C 1 6   ? 0.444   4.538   39.814 1.00 22.60 ? 456  ALA C C   1 
ATOM   912  O O   . ALA C 1 6   ? -0.281  5.376   40.366 1.00 23.50 ? 456  ALA C O   1 
ATOM   913  C CB  . ALA C 1 6   ? 0.066   4.727   37.349 1.00 22.15 ? 456  ALA C CB  1 
ATOM   914  N N   . GLU C 1 7   ? 0.694   3.347   40.351 1.00 17.30 ? 457  GLU C N   1 
ATOM   915  C CA  . GLU C 1 7   ? 0.121   2.930   41.621 1.00 19.44 ? 457  GLU C CA  1 
ATOM   916  C C   . GLU C 1 7   ? 1.062   3.134   42.801 1.00 20.18 ? 457  GLU C C   1 
ATOM   917  O O   . GLU C 1 7   ? 0.682   2.831   43.936 1.00 24.12 ? 457  GLU C O   1 
ATOM   918  C CB  . GLU C 1 7   ? -0.328  1.467   41.543 1.00 21.94 ? 457  GLU C CB  1 
ATOM   919  C CG  . GLU C 1 7   ? -1.369  1.223   40.460 1.00 28.63 ? 457  GLU C CG  1 
ATOM   920  C CD  . GLU C 1 7   ? -1.759  -0.235  40.328 1.00 33.19 ? 457  GLU C CD  1 
ATOM   921  O OE1 . GLU C 1 7   ? -1.566  -0.991  41.302 1.00 35.19 ? 457  GLU C OE1 1 
ATOM   922  O OE2 . GLU C 1 7   ? -2.253  -0.626  39.248 1.00 33.57 ? 457  GLU C OE2 1 
ATOM   923  N N   . GLN C 1 8   ? 2.274   3.633   42.568 1.00 16.27 ? 458  GLN C N   1 
ATOM   924  C CA  . GLN C 1 8   ? 3.217   3.899   43.646 1.00 15.87 ? 458  GLN C CA  1 
ATOM   925  C C   . GLN C 1 8   ? 2.917   5.268   44.246 1.00 16.14 ? 458  GLN C C   1 
ATOM   926  O O   . GLN C 1 8   ? 2.767   6.250   43.514 1.00 15.60 ? 458  GLN C O   1 
ATOM   927  C CB  . GLN C 1 8   ? 4.654   3.875   43.121 1.00 14.85 ? 458  GLN C CB  1 
ATOM   928  C CG  . GLN C 1 8   ? 5.079   2.581   42.434 1.00 14.56 ? 458  GLN C CG  1 
ATOM   929  C CD  . GLN C 1 8   ? 5.154   1.404   43.383 1.00 16.26 ? 458  GLN C CD  1 
ATOM   930  O OE1 . GLN C 1 8   ? 5.289   1.574   44.594 1.00 20.10 ? 458  GLN C OE1 1 
ATOM   931  N NE2 . GLN C 1 8   ? 5.061   0.202   42.837 1.00 16.76 ? 458  GLN C NE2 1 
ATOM   932  N N   . ASP C 1 9   ? 2.851   5.331   45.581 1.00 17.23 ? 459  ASP C N   1 
ATOM   933  C CA  . ASP C 1 9   ? 2.507   6.585   46.246 1.00 17.85 ? 459  ASP C CA  1 
ATOM   934  C C   . ASP C 1 9   ? 3.489   7.692   45.886 1.00 16.29 ? 459  ASP C C   1 
ATOM   935  O O   . ASP C 1 9   ? 3.097   8.857   45.739 1.00 19.05 ? 459  ASP C O   1 
ATOM   936  C CB  . ASP C 1 9   ? 2.472   6.392   47.764 1.00 19.63 ? 459  ASP C CB  1 
ATOM   937  C CG  . ASP C 1 9   ? 1.423   5.389   48.208 1.00 30.90 ? 459  ASP C CG  1 
ATOM   938  O OD1 . ASP C 1 9   ? 1.606   4.783   49.285 1.00 35.83 ? 459  ASP C OD1 1 
ATOM   939  O OD2 . ASP C 1 9   ? 0.426   5.200   47.482 1.00 31.14 ? 459  ASP C OD2 1 
ATOM   940  N N   . TRP C 1 10  ? 4.765   7.345   45.716 1.00 15.52 ? 460  TRP C N   1 
ATOM   941  C CA  . TRP C 1 10  ? 5.819   8.326   45.493 1.00 15.69 ? 460  TRP C CA  1 
ATOM   942  C C   . TRP C 1 10  ? 5.982   8.733   44.031 1.00 15.33 ? 460  TRP C C   1 
ATOM   943  O O   . TRP C 1 10  ? 6.850   9.561   43.735 1.00 13.55 ? 460  TRP C O   1 
ATOM   944  C CB  . TRP C 1 10  ? 7.153   7.815   46.050 1.00 14.60 ? 460  TRP C CB  1 
ATOM   945  C CG  . TRP C 1 10  ? 7.424   6.366   45.745 1.00 14.08 ? 460  TRP C CG  1 
ATOM   946  C CD1 . TRP C 1 10  ? 7.312   5.316   46.610 1.00 15.35 ? 460  TRP C CD1 1 
ATOM   947  C CD2 . TRP C 1 10  ? 7.852   5.812   44.492 1.00 12.56 ? 460  TRP C CD2 1 
ATOM   948  N NE1 . TRP C 1 10  ? 7.641   4.145   45.975 1.00 15.18 ? 460  TRP C NE1 1 
ATOM   949  C CE2 . TRP C 1 10  ? 7.977   4.420   44.675 1.00 12.85 ? 460  TRP C CE2 1 
ATOM   950  C CE3 . TRP C 1 10  ? 8.137   6.356   43.235 1.00 12.25 ? 460  TRP C CE3 1 
ATOM   951  C CZ2 . TRP C 1 10  ? 8.374   3.562   43.647 1.00 12.69 ? 460  TRP C CZ2 1 
ATOM   952  C CZ3 . TRP C 1 10  ? 8.534   5.502   42.212 1.00 11.33 ? 460  TRP C CZ3 1 
ATOM   953  C CH2 . TRP C 1 10  ? 8.652   4.120   42.429 1.00 11.44 ? 460  TRP C CH2 1 
ATOM   954  N N   . TYR C 1 11  ? 5.189   8.188   43.110 1.00 12.76 ? 461  TYR C N   1 
ATOM   955  C CA  . TYR C 1 11  ? 5.304   8.536   41.696 1.00 12.04 ? 461  TYR C CA  1 
ATOM   956  C C   . TYR C 1 11  ? 4.319   9.650   41.353 1.00 13.61 ? 461  TYR C C   1 
ATOM   957  O O   . TYR C 1 11  ? 3.109   9.501   41.556 1.00 14.86 ? 461  TYR C O   1 
ATOM   958  C CB  . TYR C 1 11  ? 5.056   7.312   40.816 1.00 13.28 ? 461  TYR C CB  1 
ATOM   959  C CG  . TYR C 1 11  ? 5.111   7.643   39.348 1.00 12.41 ? 461  TYR C CG  1 
ATOM   960  C CD1 . TYR C 1 11  ? 6.326   7.911   38.729 1.00 15.38 ? 461  TYR C CD1 1 
ATOM   961  C CD2 . TYR C 1 11  ? 3.956   7.700   38.581 1.00 13.39 ? 461  TYR C CD2 1 
ATOM   962  C CE1 . TYR C 1 11  ? 6.387   8.224   37.388 1.00 17.28 ? 461  TYR C CE1 1 
ATOM   963  C CE2 . TYR C 1 11  ? 4.011   8.012   37.233 1.00 16.59 ? 461  TYR C CE2 1 
ATOM   964  C CZ  . TYR C 1 11  ? 5.232   8.272   36.649 1.00 16.76 ? 461  TYR C CZ  1 
ATOM   965  O OH  . TYR C 1 11  ? 5.295   8.583   35.311 1.00 25.87 ? 461  TYR C OH  1 
ATOM   966  N N   . HIS C 1 12  ? 4.834   10.754  40.809 1.00 12.39 ? 462  HIS C N   1 
ATOM   967  C CA  . HIS C 1 12  ? 4.028   11.947  40.567 1.00 12.68 ? 462  HIS C CA  1 
ATOM   968  C C   . HIS C 1 12  ? 3.857   12.270  39.091 1.00 14.04 ? 462  HIS C C   1 
ATOM   969  O O   . HIS C 1 12  ? 3.408   13.376  38.764 1.00 16.34 ? 462  HIS C O   1 
ATOM   970  C CB  . HIS C 1 12  ? 4.617   13.159  41.295 1.00 15.34 ? 462  HIS C CB  1 
ATOM   971  C CG  . HIS C 1 12  ? 4.420   13.124  42.776 1.00 14.35 ? 462  HIS C CG  1 
ATOM   972  N ND1 . HIS C 1 12  ? 3.727   14.104  43.455 1.00 17.53 ? 462  HIS C ND1 1 
ATOM   973  C CD2 . HIS C 1 12  ? 4.826   12.232  43.709 1.00 14.81 ? 462  HIS C CD2 1 
ATOM   974  C CE1 . HIS C 1 12  ? 3.716   13.816  44.744 1.00 18.65 ? 462  HIS C CE1 1 
ATOM   975  N NE2 . HIS C 1 12  ? 4.376   12.685  44.925 1.00 19.70 ? 462  HIS C NE2 1 
ATOM   976  N N   . GLY C 1 13  ? 4.210   11.355  38.191 1.00 13.34 ? 463  GLY C N   1 
ATOM   977  C CA  . GLY C 1 13  ? 3.972   11.617  36.781 1.00 13.53 ? 463  GLY C CA  1 
ATOM   978  C C   . GLY C 1 13  ? 4.792   12.788  36.269 1.00 15.22 ? 463  GLY C C   1 
ATOM   979  O O   . GLY C 1 13  ? 5.970   12.956  36.602 1.00 14.90 ? 463  GLY C O   1 
ATOM   980  N N   . ALA C 1 14  ? 4.155   13.624  35.449 1.00 15.05 ? 464  ALA C N   1 
ATOM   981  C CA  . ALA C 1 14  ? 4.855   14.670  34.714 1.00 17.08 ? 464  ALA C CA  1 
ATOM   982  C C   . ALA C 1 14  ? 4.876   16.016  35.435 1.00 17.46 ? 464  ALA C C   1 
ATOM   983  O O   . ALA C 1 14  ? 4.974   17.058  34.774 1.00 17.30 ? 464  ALA C O   1 
ATOM   984  C CB  . ALA C 1 14  ? 4.271   14.815  33.307 1.00 23.08 ? 464  ALA C CB  1 
ATOM   985  N N   . ILE C 1 15  ? 4.805   16.034  36.764 1.00 13.98 ? 465  ILE C N   1 
ATOM   986  C CA  . ILE C 1 15  ? 4.867   17.342  37.427 1.00 14.38 ? 465  ILE C CA  1 
ATOM   987  C C   . ILE C 1 15  ? 6.217   17.984  37.149 1.00 14.21 ? 465  ILE C C   1 
ATOM   988  O O   . ILE C 1 15  ? 7.248   17.278  37.101 1.00 15.80 ? 465  ILE C O   1 
ATOM   989  C CB  . ILE C 1 15  ? 4.607   17.231  38.940 1.00 13.95 ? 465  ILE C CB  1 
ATOM   990  C CG1 . ILE C 1 15  ? 5.676   16.379  39.637 1.00 16.18 ? 465  ILE C CG1 1 
ATOM   991  C CG2 . ILE C 1 15  ? 3.194   16.735  39.204 1.00 15.91 ? 465  ILE C CG2 1 
ATOM   992  C CD1 . ILE C 1 15  ? 5.752   16.612  41.139 1.00 17.84 ? 465  ILE C CD1 1 
ATOM   993  N N   . PRO C 1 16  ? 6.274   19.293  36.942 1.00 14.94 ? 466  PRO C N   1 
ATOM   994  C CA  . PRO C 1 16  ? 7.550   19.948  36.667 1.00 14.99 ? 466  PRO C CA  1 
ATOM   995  C C   . PRO C 1 16  ? 8.359   20.114  37.941 1.00 14.41 ? 466  PRO C C   1 
ATOM   996  O O   . PRO C 1 16  ? 7.842   20.037  39.058 1.00 13.91 ? 466  PRO C O   1 
ATOM   997  C CB  . PRO C 1 16  ? 7.120   21.321  36.137 1.00 15.99 ? 466  PRO C CB  1 
ATOM   998  C CG  . PRO C 1 16  ? 5.822   21.577  36.825 1.00 15.37 ? 466  PRO C CG  1 
ATOM   999  C CD  . PRO C 1 16  ? 5.141   20.231  36.856 1.00 14.72 ? 466  PRO C CD  1 
ATOM   1000 N N   . ARG C 1 17  ? 9.650   20.379  37.739 1.00 13.87 ? 467  ARG C N   1 
ATOM   1001 C CA  . ARG C 1 17  ? 10.560  20.617  38.855 1.00 13.49 ? 467  ARG C CA  1 
ATOM   1002 C C   . ARG C 1 17  ? 9.992   21.616  39.864 1.00 13.84 ? 467  ARG C C   1 
ATOM   1003 O O   . ARG C 1 17  ? 10.060  21.390  41.076 1.00 14.91 ? 467  ARG C O   1 
ATOM   1004 C CB  . ARG C 1 17  ? 11.915  21.080  38.323 1.00 14.45 ? 467  ARG C CB  1 
ATOM   1005 C CG  . ARG C 1 17  ? 12.910  21.478  39.399 1.00 18.06 ? 467  ARG C CG  1 
ATOM   1006 C CD  . ARG C 1 17  ? 14.192  21.990  38.763 1.00 20.38 ? 467  ARG C CD  1 
ATOM   1007 N NE  . ARG C 1 17  ? 14.944  20.899  38.149 1.00 19.06 ? 467  ARG C NE  1 
ATOM   1008 C CZ  . ARG C 1 17  ? 16.196  20.583  38.463 1.00 16.90 ? 467  ARG C CZ  1 
ATOM   1009 N NH1 . ARG C 1 17  ? 16.859  21.304  39.364 1.00 17.22 ? 467  ARG C NH1 1 
ATOM   1010 N NH2 . ARG C 1 17  ? 16.795  19.568  37.860 1.00 16.60 ? 467  ARG C NH2 1 
ATOM   1011 N N   . ILE C 1 18  ? 9.419   22.727  39.386 1.00 13.94 ? 468  ILE C N   1 
ATOM   1012 C CA  . ILE C 1 18  ? 8.933   23.760  40.304 1.00 15.34 ? 468  ILE C CA  1 
ATOM   1013 C C   . ILE C 1 18  ? 7.873   23.203  41.254 1.00 16.04 ? 468  ILE C C   1 
ATOM   1014 O O   . ILE C 1 18  ? 7.798   23.604  42.424 1.00 18.72 ? 468  ILE C O   1 
ATOM   1015 C CB  . ILE C 1 18  ? 8.452   25.011  39.534 1.00 14.85 ? 468  ILE C CB  1 
ATOM   1016 C CG1 . ILE C 1 18  ? 8.146   26.157  40.501 1.00 19.97 ? 468  ILE C CG1 1 
ATOM   1017 C CG2 . ILE C 1 18  ? 7.239   24.704  38.675 1.00 15.99 ? 468  ILE C CG2 1 
ATOM   1018 C CD1 . ILE C 1 18  ? 9.337   26.595  41.325 1.00 22.50 ? 468  ILE C CD1 1 
ATOM   1019 N N   . GLU C 1 19  ? 7.046   22.268  40.781 1.00 17.02 ? 469  GLU C N   1 
ATOM   1020 C CA  . GLU C 1 19  ? 6.035   21.673  41.652 1.00 17.03 ? 469  GLU C CA  1 
ATOM   1021 C C   . GLU C 1 19  ? 6.645   20.644  42.594 1.00 17.24 ? 469  GLU C C   1 
ATOM   1022 O O   . GLU C 1 19  ? 6.237   20.539  43.757 1.00 19.54 ? 469  GLU C O   1 
ATOM   1023 C CB  . GLU C 1 19  ? 4.911   21.054  40.820 1.00 18.41 ? 469  GLU C CB  1 
ATOM   1024 C CG  . GLU C 1 19  ? 4.044   22.077  40.106 1.00 19.30 ? 469  GLU C CG  1 
ATOM   1025 C CD  . GLU C 1 19  ? 2.903   21.446  39.343 1.00 22.40 ? 469  GLU C CD  1 
ATOM   1026 O OE1 . GLU C 1 19  ? 2.289   22.143  38.512 1.00 22.34 ? 469  GLU C OE1 1 
ATOM   1027 O OE2 . GLU C 1 19  ? 2.618   20.255  39.573 1.00 23.19 ? 469  GLU C OE2 1 
ATOM   1028 N N   . ALA C 1 20  ? 7.631   19.891  42.112 1.00 15.50 ? 470  ALA C N   1 
ATOM   1029 C CA  . ALA C 1 20  ? 8.298   18.926  42.976 1.00 17.22 ? 470  ALA C CA  1 
ATOM   1030 C C   . ALA C 1 20  ? 8.974   19.622  44.146 1.00 19.93 ? 470  ALA C C   1 
ATOM   1031 O O   . ALA C 1 20  ? 8.966   19.110  45.273 1.00 23.92 ? 470  ALA C O   1 
ATOM   1032 C CB  . ALA C 1 20  ? 9.317   18.126  42.169 1.00 19.76 ? 470  ALA C CB  1 
ATOM   1033 N N   . GLN C 1 21  ? 9.553   20.800  43.902 1.00 21.80 ? 471  GLN C N   1 
ATOM   1034 C CA  . GLN C 1 21  ? 10.256  21.517  44.960 1.00 25.15 ? 471  GLN C CA  1 
ATOM   1035 C C   . GLN C 1 21  ? 9.313   21.921  46.088 1.00 28.47 ? 471  GLN C C   1 
ATOM   1036 O O   . GLN C 1 21  ? 9.720   21.955  47.254 1.00 35.04 ? 471  GLN C O   1 
ATOM   1037 C CB  . GLN C 1 21  ? 10.979  22.729  44.374 1.00 28.85 ? 471  GLN C CB  1 
ATOM   1038 C CG  . GLN C 1 21  ? 12.035  22.367  43.330 1.00 31.19 ? 471  GLN C CG  1 
ATOM   1039 C CD  . GLN C 1 21  ? 13.412  22.908  43.669 1.00 34.63 ? 471  GLN C CD  1 
ATOM   1040 O OE1 . GLN C 1 21  ? 13.547  23.805  44.500 1.00 38.31 ? 471  GLN C OE1 1 
ATOM   1041 N NE2 . GLN C 1 21  ? 14.444  22.360  43.030 1.00 25.61 ? 471  GLN C NE2 1 
ATOM   1042 N N   . GLU C 1 22  ? 8.052   22.212  45.763 1.00 22.54 ? 472  GLU C N   1 
ATOM   1043 C CA  . GLU C 1 22  ? 7.061   22.545  46.782 1.00 24.53 ? 472  GLU C CA  1 
ATOM   1044 C C   . GLU C 1 22  ? 6.705   21.343  47.648 1.00 24.68 ? 472  GLU C C   1 
ATOM   1045 O O   . GLU C 1 22  ? 6.372   21.506  48.828 1.00 25.91 ? 472  GLU C O   1 
ATOM   1046 C CB  . GLU C 1 22  ? 5.795   23.065  46.105 1.00 32.63 ? 472  GLU C CB  1 
ATOM   1047 C CG  . GLU C 1 22  ? 4.809   23.732  47.042 1.00 42.17 ? 472  GLU C CG  1 
ATOM   1048 C CD  . GLU C 1 22  ? 5.176   25.172  47.329 1.00 49.39 ? 472  GLU C CD  1 
ATOM   1049 O OE1 . GLU C 1 22  ? 6.044   25.717  46.613 1.00 50.30 ? 472  GLU C OE1 1 
ATOM   1050 O OE2 . GLU C 1 22  ? 4.598   25.760  48.268 1.00 55.05 ? 472  GLU C OE2 1 
ATOM   1051 N N   . LEU C 1 23  ? 6.754   20.137  47.081 1.00 20.42 ? 473  LEU C N   1 
ATOM   1052 C CA  . LEU C 1 23  ? 6.316   18.933  47.777 1.00 20.55 ? 473  LEU C CA  1 
ATOM   1053 C C   . LEU C 1 23  ? 7.388   18.337  48.678 1.00 22.55 ? 473  LEU C C   1 
ATOM   1054 O O   . LEU C 1 23  ? 7.059   17.529  49.553 1.00 24.01 ? 473  LEU C O   1 
ATOM   1055 C CB  . LEU C 1 23  ? 5.874   17.884  46.754 1.00 19.13 ? 473  LEU C CB  1 
ATOM   1056 C CG  . LEU C 1 23  ? 4.590   18.202  45.990 1.00 19.99 ? 473  LEU C CG  1 
ATOM   1057 C CD1 . LEU C 1 23  ? 4.490   17.367  44.720 1.00 21.70 ? 473  LEU C CD1 1 
ATOM   1058 C CD2 . LEU C 1 23  ? 3.384   17.964  46.885 1.00 29.02 ? 473  LEU C CD2 1 
ATOM   1059 N N   . LEU C 1 24  ? 8.650   18.707  48.485 1.00 19.63 ? 474  LEU C N   1 
ATOM   1060 C CA  . LEU C 1 24  ? 9.763   18.147  49.243 1.00 22.66 ? 474  LEU C CA  1 
ATOM   1061 C C   . LEU C 1 24  ? 10.191  19.168  50.289 1.00 23.98 ? 474  LEU C C   1 
ATOM   1062 O O   . LEU C 1 24  ? 10.633  20.269  49.940 1.00 24.80 ? 474  LEU C O   1 
ATOM   1063 C CB  . LEU C 1 24  ? 10.920  17.815  48.301 1.00 23.97 ? 474  LEU C CB  1 
ATOM   1064 C CG  . LEU C 1 24  ? 10.562  16.851  47.166 1.00 20.67 ? 474  LEU C CG  1 
ATOM   1065 C CD1 . LEU C 1 24  ? 11.651  16.816  46.104 1.00 23.32 ? 474  LEU C CD1 1 
ATOM   1066 C CD2 . LEU C 1 24  ? 10.290  15.451  47.708 1.00 21.69 ? 474  LEU C CD2 1 
ATOM   1067 N N   . LYS C 1 25  ? 10.064  18.803  51.569 1.00 21.07 ? 475  LYS C N   1 
ATOM   1068 C CA  . LYS C 1 25  ? 10.187  19.774  52.655 1.00 22.79 ? 475  LYS C CA  1 
ATOM   1069 C C   . LYS C 1 25  ? 11.143  19.385  53.774 1.00 22.82 ? 475  LYS C C   1 
ATOM   1070 O O   . LYS C 1 25  ? 11.631  20.288  54.468 1.00 25.20 ? 475  LYS C O   1 
ATOM   1071 C CB  . LYS C 1 25  ? 8.811   20.082  53.266 1.00 28.27 ? 475  LYS C CB  1 
ATOM   1072 C CG  . LYS C 1 25  ? 7.858   20.771  52.308 1.00 35.40 ? 475  LYS C CG  1 
ATOM   1073 C CD  . LYS C 1 25  ? 6.427   20.743  52.821 1.00 41.61 ? 475  LYS C CD  1 
ATOM   1074 C CE  . LYS C 1 25  ? 5.457   20.456  51.686 1.00 44.74 ? 475  LYS C CE  1 
ATOM   1075 N NZ  . LYS C 1 25  ? 4.052   20.299  52.152 1.00 46.95 ? 475  LYS C NZ  1 
ATOM   1076 N N   . LYS C 1 26  ? 11.415  18.100  53.997 1.00 22.03 ? 476  LYS C N   1 
ATOM   1077 C CA  . LYS C 1 26  ? 12.274  17.695  55.102 1.00 23.81 ? 476  LYS C CA  1 
ATOM   1078 C C   . LYS C 1 26  ? 13.211  16.573  54.673 1.00 21.25 ? 476  LYS C C   1 
ATOM   1079 O O   . LYS C 1 26  ? 12.988  15.892  53.669 1.00 19.74 ? 476  LYS C O   1 
ATOM   1080 C CB  . LYS C 1 26  ? 11.473  17.290  56.349 1.00 31.35 ? 476  LYS C CB  1 
ATOM   1081 C CG  . LYS C 1 26  ? 10.677  16.004  56.209 1.00 33.85 ? 476  LYS C CG  1 
ATOM   1082 C CD  . LYS C 1 26  ? 9.929   15.680  57.498 1.00 38.10 ? 476  LYS C CD  1 
ATOM   1083 C CE  . LYS C 1 26  ? 9.243   14.322  57.425 1.00 41.38 ? 476  LYS C CE  1 
ATOM   1084 N NZ  . LYS C 1 26  ? 8.272   14.246  56.296 1.00 44.71 ? 476  LYS C NZ  1 
ATOM   1085 N N   . GLN C 1 27  ? 14.263  16.387  55.470 1.00 20.91 ? 477  GLN C N   1 
ATOM   1086 C CA  . GLN C 1 27  ? 15.337  15.446  55.174 1.00 19.10 ? 477  GLN C CA  1 
ATOM   1087 C C   . GLN C 1 27  ? 14.791  14.087  54.770 1.00 20.85 ? 477  GLN C C   1 
ATOM   1088 O O   . GLN C 1 27  ? 14.039  13.457  55.519 1.00 21.47 ? 477  GLN C O   1 
ATOM   1089 C CB  . GLN C 1 27  ? 16.214  15.291  56.420 1.00 19.82 ? 477  GLN C CB  1 
ATOM   1090 C CG  . GLN C 1 27  ? 17.371  14.326  56.262 1.00 21.07 ? 477  GLN C CG  1 
ATOM   1091 C CD  . GLN C 1 27  ? 18.515  14.907  55.455 1.00 25.42 ? 477  GLN C CD  1 
ATOM   1092 O OE1 . GLN C 1 27  ? 18.459  16.054  55.003 1.00 26.55 ? 477  GLN C OE1 1 
ATOM   1093 N NE2 . GLN C 1 27  ? 19.570  14.125  55.285 1.00 33.84 ? 477  GLN C NE2 1 
ATOM   1094 N N   . GLY C 1 28  ? 15.168  13.640  53.574 1.00 16.03 ? 478  GLY C N   1 
ATOM   1095 C CA  . GLY C 1 28  ? 14.811  12.314  53.111 1.00 15.69 ? 478  GLY C CA  1 
ATOM   1096 C C   . GLY C 1 28  ? 13.488  12.202  52.383 1.00 14.77 ? 478  GLY C C   1 
ATOM   1097 O O   . GLY C 1 28  ? 13.148  11.095  51.941 1.00 14.72 ? 478  GLY C O   1 
ATOM   1098 N N   . ASP C 1 29  ? 12.726  13.295  52.264 1.00 15.96 ? 479  ASP C N   1 
ATOM   1099 C CA  . ASP C 1 29  ? 11.524  13.301  51.434 1.00 16.86 ? 479  ASP C CA  1 
ATOM   1100 C C   . ASP C 1 29  ? 11.911  13.004  49.994 1.00 15.12 ? 479  ASP C C   1 
ATOM   1101 O O   . ASP C 1 29  ? 12.908  13.524  49.493 1.00 14.74 ? 479  ASP C O   1 
ATOM   1102 C CB  . ASP C 1 29  ? 10.883  14.694  51.441 1.00 16.20 ? 479  ASP C CB  1 
ATOM   1103 C CG  . ASP C 1 29  ? 10.145  15.014  52.731 1.00 18.87 ? 479  ASP C CG  1 
ATOM   1104 O OD1 . ASP C 1 29  ? 10.040  14.135  53.611 1.00 23.59 ? 479  ASP C OD1 1 
ATOM   1105 O OD2 . ASP C 1 29  ? 9.666   16.168  52.855 1.00 20.09 ? 479  ASP C OD2 1 
ATOM   1106 N N   . PHE C 1 30  ? 11.112  12.187  49.311 1.00 12.90 ? 480  PHE C N   1 
ATOM   1107 C CA  . PHE C 1 30  ? 11.436  11.889  47.922 1.00 11.52 ? 480  PHE C CA  1 
ATOM   1108 C C   . PHE C 1 30  ? 10.181  11.620  47.103 1.00 11.40 ? 480  PHE C C   1 
ATOM   1109 O O   . PHE C 1 30  ? 9.126   11.262  47.632 1.00 14.06 ? 480  PHE C O   1 
ATOM   1110 C CB  . PHE C 1 30  ? 12.431  10.729  47.798 1.00 12.55 ? 480  PHE C CB  1 
ATOM   1111 C CG  . PHE C 1 30  ? 11.856  9.383   48.154 1.00 11.16 ? 480  PHE C CG  1 
ATOM   1112 C CD1 . PHE C 1 30  ? 11.878  8.931   49.467 1.00 14.20 ? 480  PHE C CD1 1 
ATOM   1113 C CD2 . PHE C 1 30  ? 11.322  8.559   47.177 1.00 12.07 ? 480  PHE C CD2 1 
ATOM   1114 C CE1 . PHE C 1 30  ? 11.364  7.678   49.806 1.00 14.16 ? 480  PHE C CE1 1 
ATOM   1115 C CE2 . PHE C 1 30  ? 10.802  7.303   47.504 1.00 13.28 ? 480  PHE C CE2 1 
ATOM   1116 C CZ  . PHE C 1 30  ? 10.824  6.863   48.822 1.00 12.44 ? 480  PHE C CZ  1 
ATOM   1117 N N   . LEU C 1 31  ? 10.328  11.791  45.789 1.00 10.71 ? 481  LEU C N   1 
ATOM   1118 C CA  . LEU C 1 31  ? 9.313   11.432  44.810 1.00 11.76 ? 481  LEU C CA  1 
ATOM   1119 C C   . LEU C 1 31  ? 10.023  11.126  43.500 1.00 11.28 ? 481  LEU C C   1 
ATOM   1120 O O   . LEU C 1 31  ? 11.191  11.473  43.314 1.00 10.42 ? 481  LEU C O   1 
ATOM   1121 C CB  . LEU C 1 31  ? 8.267   12.547  44.645 1.00 13.08 ? 481  LEU C CB  1 
ATOM   1122 C CG  . LEU C 1 31  ? 8.723   13.937  44.181 1.00 13.58 ? 481  LEU C CG  1 
ATOM   1123 C CD1 . LEU C 1 31  ? 8.878   14.000  42.666 1.00 12.40 ? 481  LEU C CD1 1 
ATOM   1124 C CD2 . LEU C 1 31  ? 7.755   15.015  44.662 1.00 17.05 ? 481  LEU C CD2 1 
ATOM   1125 N N   . VAL C 1 32  ? 9.300   10.492  42.581 1.00 10.16 ? 482  VAL C N   1 
ATOM   1126 C CA  . VAL C 1 32  ? 9.789   10.246  41.228 1.00 9.60  ? 482  VAL C CA  1 
ATOM   1127 C C   . VAL C 1 32  ? 8.860   10.943  40.243 1.00 9.13  ? 482  VAL C C   1 
ATOM   1128 O O   . VAL C 1 32  ? 7.643   10.981  40.451 1.00 10.32 ? 482  VAL C O   1 
ATOM   1129 C CB  . VAL C 1 32  ? 9.908   8.736   40.936 1.00 9.84  ? 482  VAL C CB  1 
ATOM   1130 C CG1 . VAL C 1 32  ? 10.223  8.477   39.460 1.00 11.31 ? 482  VAL C CG1 1 
ATOM   1131 C CG2 . VAL C 1 32  ? 10.981  8.135   41.826 1.00 10.35 ? 482  VAL C CG2 1 
ATOM   1132 N N   . ARG C 1 33  ? 9.441   11.519  39.189 1.00 9.53  ? 483  ARG C N   1 
ATOM   1133 C CA  . ARG C 1 33  ? 8.673   12.243  38.182 1.00 9.78  ? 483  ARG C CA  1 
ATOM   1134 C C   . ARG C 1 33  ? 9.328   12.043  36.822 1.00 10.36 ? 483  ARG C C   1 
ATOM   1135 O O   . ARG C 1 33  ? 10.462  11.572  36.720 1.00 10.29 ? 483  ARG C O   1 
ATOM   1136 C CB  . ARG C 1 33  ? 8.579   13.738  38.518 1.00 10.17 ? 483  ARG C CB  1 
ATOM   1137 C CG  . ARG C 1 33  ? 9.940   14.410  38.622 1.00 10.74 ? 483  ARG C CG  1 
ATOM   1138 C CD  . ARG C 1 33  ? 9.846   15.861  39.101 1.00 11.47 ? 483  ARG C CD  1 
ATOM   1139 N NE  . ARG C 1 33  ? 11.176  16.437  39.315 1.00 11.36 ? 483  ARG C NE  1 
ATOM   1140 C CZ  . ARG C 1 33  ? 11.906  17.011  38.361 1.00 10.74 ? 483  ARG C CZ  1 
ATOM   1141 N NH1 . ARG C 1 33  ? 11.432  17.118  37.123 1.00 12.36 ? 483  ARG C NH1 1 
ATOM   1142 N NH2 . ARG C 1 33  ? 13.108  17.493  38.646 1.00 12.15 ? 483  ARG C NH2 1 
ATOM   1143 N N   . GLU C 1 34  ? 8.598   12.418  35.767 1.00 11.28 ? 484  GLU C N   1 
ATOM   1144 C CA  . GLU C 1 34  ? 9.116   12.379  34.404 1.00 12.75 ? 484  GLU C CA  1 
ATOM   1145 C C   . GLU C 1 34  ? 9.820   13.694  34.106 1.00 14.59 ? 484  GLU C C   1 
ATOM   1146 O O   . GLU C 1 34  ? 9.243   14.765  34.304 1.00 23.19 ? 484  GLU C O   1 
ATOM   1147 C CB  . GLU C 1 34  ? 7.979   12.226  33.393 1.00 16.91 ? 484  GLU C CB  1 
ATOM   1148 C CG  . GLU C 1 34  ? 6.773   11.470  33.873 1.00 26.26 ? 484  GLU C CG  1 
ATOM   1149 C CD  . GLU C 1 34  ? 5.706   11.380  32.799 1.00 30.59 ? 484  GLU C CD  1 
ATOM   1150 O OE1 . GLU C 1 34  ? 5.706   12.234  31.884 1.00 37.14 ? 484  GLU C OE1 1 
ATOM   1151 O OE2 . GLU C 1 34  ? 4.874   10.453  32.867 1.00 38.58 ? 484  GLU C OE2 1 
ATOM   1152 N N   . SER C 1 35  ? 11.036  13.611  33.582 1.00 10.97 ? 485  SER C N   1 
ATOM   1153 C CA  . SER C 1 35  ? 11.860  14.793  33.360 1.00 10.17 ? 485  SER C CA  1 
ATOM   1154 C C   . SER C 1 35  ? 11.334  15.656  32.213 1.00 10.53 ? 485  SER C C   1 
ATOM   1155 O O   . SER C 1 35  ? 10.809  15.158  31.214 1.00 11.30 ? 485  SER C O   1 
ATOM   1156 C CB  . SER C 1 35  ? 13.282  14.349  33.020 1.00 10.20 ? 485  SER C CB  1 
ATOM   1157 O OG  . SER C 1 35  ? 14.123  15.457  32.758 1.00 11.25 ? 485  SER C OG  1 
ATOM   1158 N N   . HIS C 1 36  ? 11.486  16.972  32.366 1.00 10.64 ? 486  HIS C N   1 
ATOM   1159 C CA  . HIS C 1 36  ? 11.309  17.917  31.269 1.00 10.70 ? 486  HIS C CA  1 
ATOM   1160 C C   . HIS C 1 36  ? 12.630  18.310  30.624 1.00 11.41 ? 486  HIS C C   1 
ATOM   1161 O O   . HIS C 1 36  ? 12.712  18.389  29.394 1.00 13.10 ? 486  HIS C O   1 
ATOM   1162 C CB  . HIS C 1 36  ? 10.543  19.162  31.739 1.00 13.52 ? 486  HIS C CB  1 
ATOM   1163 C CG  . HIS C 1 36  ? 9.081   18.916  31.936 1.00 13.91 ? 486  HIS C CG  1 
ATOM   1164 N ND1 . HIS C 1 36  ? 8.562   18.389  33.100 1.00 16.23 ? 486  HIS C ND1 1 
ATOM   1165 C CD2 . HIS C 1 36  ? 8.032   19.078  31.095 1.00 16.57 ? 486  HIS C CD2 1 
ATOM   1166 C CE1 . HIS C 1 36  ? 7.253   18.261  32.976 1.00 16.35 ? 486  HIS C CE1 1 
ATOM   1167 N NE2 . HIS C 1 36  ? 6.906   18.669  31.768 1.00 17.40 ? 486  HIS C NE2 1 
ATOM   1168 N N   . GLY C 1 37  ? 13.674  18.526  31.429 1.00 11.59 ? 487  GLY C N   1 
ATOM   1169 C CA  . GLY C 1 37  ? 14.968  18.875  30.866 1.00 12.44 ? 487  GLY C CA  1 
ATOM   1170 C C   . GLY C 1 37  ? 15.583  17.756  30.048 1.00 10.96 ? 487  GLY C C   1 
ATOM   1171 O O   . GLY C 1 37  ? 16.340  18.014  29.107 1.00 13.98 ? 487  GLY C O   1 
ATOM   1172 N N   . LYS C 1 38  ? 15.272  16.505  30.389 1.00 10.96 ? 488  LYS C N   1 
ATOM   1173 C CA  . LYS C 1 38  ? 15.796  15.327  29.701 1.00 10.45 ? 488  LYS C CA  1 
ATOM   1174 C C   . LYS C 1 38  ? 14.603  14.452  29.351 1.00 9.41  ? 488  LYS C C   1 
ATOM   1175 O O   . LYS C 1 38  ? 14.303  13.474  30.048 1.00 10.20 ? 488  LYS C O   1 
ATOM   1176 C CB  . LYS C 1 38  ? 16.837  14.601  30.556 1.00 12.54 ? 488  LYS C CB  1 
ATOM   1177 C CG  . LYS C 1 38  ? 18.091  15.446  30.778 1.00 16.19 ? 488  LYS C CG  1 
ATOM   1178 C CD  . LYS C 1 38  ? 19.208  14.671  31.451 1.00 23.48 ? 488  LYS C CD  1 
ATOM   1179 C CE  . LYS C 1 38  ? 20.464  15.531  31.584 1.00 27.00 ? 488  LYS C CE  1 
ATOM   1180 N NZ  . LYS C 1 38  ? 21.027  15.916  30.256 1.00 29.76 ? 488  LYS C NZ  1 
ATOM   1181 N N   . PRO C 1 39  ? 13.894  14.783  28.276 1.00 9.65  ? 489  PRO C N   1 
ATOM   1182 C CA  . PRO C 1 39  ? 12.652  14.071  27.955 1.00 10.89 ? 489  PRO C CA  1 
ATOM   1183 C C   . PRO C 1 39  ? 12.881  12.578  27.805 1.00 10.62 ? 489  PRO C C   1 
ATOM   1184 O O   . PRO C 1 39  ? 13.882  12.135  27.238 1.00 11.62 ? 489  PRO C O   1 
ATOM   1185 C CB  . PRO C 1 39  ? 12.221  14.694  26.622 1.00 11.77 ? 489  PRO C CB  1 
ATOM   1186 C CG  . PRO C 1 39  ? 12.860  16.038  26.622 1.00 11.87 ? 489  PRO C CG  1 
ATOM   1187 C CD  . PRO C 1 39  ? 14.169  15.882  27.338 1.00 10.44 ? 489  PRO C CD  1 
ATOM   1188 N N   . GLY C 1 40  ? 11.923  11.808  28.307 1.00 9.47  ? 490  GLY C N   1 
ATOM   1189 C CA  . GLY C 1 40  ? 11.998  10.369  28.279 1.00 9.98  ? 490  GLY C CA  1 
ATOM   1190 C C   . GLY C 1 40  ? 12.709  9.754   29.457 1.00 9.97  ? 490  GLY C C   1 
ATOM   1191 O O   . GLY C 1 40  ? 12.618  8.533   29.639 1.00 11.03 ? 490  GLY C O   1 
ATOM   1192 N N   . GLU C 1 41  ? 13.405  10.555  30.260 1.00 9.46  ? 491  GLU C N   1 
ATOM   1193 C CA  . GLU C 1 41  ? 14.090  10.074  31.449 1.00 9.36  ? 491  GLU C CA  1 
ATOM   1194 C C   . GLU C 1 41  ? 13.222  10.309  32.680 1.00 9.68  ? 491  GLU C C   1 
ATOM   1195 O O   . GLU C 1 41  ? 12.360  11.191  32.707 1.00 11.29 ? 491  GLU C O   1 
ATOM   1196 C CB  . GLU C 1 41  ? 15.447  10.769  31.631 1.00 10.61 ? 491  GLU C CB  1 
ATOM   1197 C CG  . GLU C 1 41  ? 16.347  10.804  30.392 1.00 16.11 ? 491  GLU C CG  1 
ATOM   1198 C CD  . GLU C 1 41  ? 17.157  9.546   30.195 1.00 26.37 ? 491  GLU C CD  1 
ATOM   1199 O OE1 . GLU C 1 41  ? 17.900  9.478   29.191 1.00 27.68 ? 491  GLU C OE1 1 
ATOM   1200 O OE2 . GLU C 1 41  ? 17.057  8.632   31.041 1.00 26.22 ? 491  GLU C OE2 1 
ATOM   1201 N N   . TYR C 1 42  ? 13.459  9.501   33.703 1.00 8.78  ? 492  TYR C N   1 
ATOM   1202 C CA  . TYR C 1 42  ? 12.814  9.668   34.994 1.00 8.92  ? 492  TYR C CA  1 
ATOM   1203 C C   . TYR C 1 42  ? 13.769  10.332  35.975 1.00 9.11  ? 492  TYR C C   1 
ATOM   1204 O O   . TYR C 1 42  ? 14.992  10.200  35.863 1.00 10.25 ? 492  TYR C O   1 
ATOM   1205 C CB  . TYR C 1 42  ? 12.393  8.318   35.557 1.00 10.31 ? 492  TYR C CB  1 
ATOM   1206 C CG  . TYR C 1 42  ? 11.278  7.651   34.797 1.00 9.65  ? 492  TYR C CG  1 
ATOM   1207 C CD1 . TYR C 1 42  ? 11.547  6.817   33.725 1.00 9.89  ? 492  TYR C CD1 1 
ATOM   1208 C CD2 . TYR C 1 42  ? 9.958   7.828   35.177 1.00 10.57 ? 492  TYR C CD2 1 
ATOM   1209 C CE1 . TYR C 1 42  ? 10.529  6.183   33.045 1.00 11.23 ? 492  TYR C CE1 1 
ATOM   1210 C CE2 . TYR C 1 42  ? 8.934   7.193   34.511 1.00 12.14 ? 492  TYR C CE2 1 
ATOM   1211 C CZ  . TYR C 1 42  ? 9.227   6.376   33.447 1.00 12.16 ? 492  TYR C CZ  1 
ATOM   1212 O OH  . TYR C 1 42  ? 8.208   5.731   32.769 1.00 15.85 ? 492  TYR C OH  1 
ATOM   1213 N N   . VAL C 1 43  ? 13.195  11.031  36.952 1.00 8.84  ? 493  VAL C N   1 
ATOM   1214 C CA  . VAL C 1 43  ? 13.952  11.792  37.943 1.00 9.70  ? 493  VAL C CA  1 
ATOM   1215 C C   . VAL C 1 43  ? 13.549  11.340  39.337 1.00 10.28 ? 493  VAL C C   1 
ATOM   1216 O O   . VAL C 1 43  ? 12.354  11.230  39.634 1.00 10.89 ? 493  VAL C O   1 
ATOM   1217 C CB  . VAL C 1 43  ? 13.681  13.301  37.826 1.00 11.08 ? 493  VAL C CB  1 
ATOM   1218 C CG1 . VAL C 1 43  ? 14.564  14.063  38.796 1.00 10.69 ? 493  VAL C CG1 1 
ATOM   1219 C CG2 . VAL C 1 43  ? 13.877  13.793  36.405 1.00 12.07 ? 493  VAL C CG2 1 
ATOM   1220 N N   . LEU C 1 44  ? 14.542  11.084  40.189 1.00 9.78  ? 494  LEU C N   1 
ATOM   1221 C CA  . LEU C 1 44  ? 14.333  10.957  41.624 1.00 10.42 ? 494  LEU C CA  1 
ATOM   1222 C C   . LEU C 1 44  ? 14.655  12.306  42.255 1.00 12.07 ? 494  LEU C C   1 
ATOM   1223 O O   . LEU C 1 44  ? 15.798  12.769  42.184 1.00 11.69 ? 494  LEU C O   1 
ATOM   1224 C CB  . LEU C 1 44  ? 15.244  9.873   42.206 1.00 12.50 ? 494  LEU C CB  1 
ATOM   1225 C CG  . LEU C 1 44  ? 15.321  9.777   43.730 1.00 11.89 ? 494  LEU C CG  1 
ATOM   1226 C CD1 . LEU C 1 44  ? 13.966  9.392   44.316 1.00 13.05 ? 494  LEU C CD1 1 
ATOM   1227 C CD2 . LEU C 1 44  ? 16.377  8.759   44.129 1.00 16.06 ? 494  LEU C CD2 1 
ATOM   1228 N N   . SER C 1 45  ? 13.649  12.940  42.844 1.00 10.64 ? 495  SER C N   1 
ATOM   1229 C CA  . SER C 1 45  ? 13.802  14.238  43.497 1.00 12.17 ? 495  SER C CA  1 
ATOM   1230 C C   . SER C 1 45  ? 13.742  14.044  45.005 1.00 12.94 ? 495  SER C C   1 
ATOM   1231 O O   . SER C 1 45  ? 12.821  13.395  45.511 1.00 13.04 ? 495  SER C O   1 
ATOM   1232 C CB  . SER C 1 45  ? 12.693  15.192  43.048 1.00 13.03 ? 495  SER C CB  1 
ATOM   1233 O OG  . SER C 1 45  ? 12.812  15.513  41.671 1.00 13.04 ? 495  SER C OG  1 
ATOM   1234 N N   . VAL C 1 46  ? 14.730  14.594  45.719 1.00 14.06 ? 496  VAL C N   1 
ATOM   1235 C CA  A VAL C 1 46  ? 14.886  14.351  47.152 0.73 14.61 ? 496  VAL C CA  1 
ATOM   1236 C CA  B VAL C 1 46  ? 14.896  14.350  47.149 0.27 14.90 ? 496  VAL C CA  1 
ATOM   1237 C C   . VAL C 1 46  ? 15.213  15.663  47.855 1.00 15.36 ? 496  VAL C C   1 
ATOM   1238 O O   . VAL C 1 46  ? 15.884  16.537  47.296 1.00 19.90 ? 496  VAL C O   1 
ATOM   1239 C CB  A VAL C 1 46  ? 15.980  13.292  47.449 0.73 17.11 ? 496  VAL C CB  1 
ATOM   1240 C CB  B VAL C 1 46  ? 16.019  13.325  47.433 0.27 16.74 ? 496  VAL C CB  1 
ATOM   1241 C CG1 A VAL C 1 46  ? 15.968  12.863  48.913 0.73 17.90 ? 496  VAL C CG1 1 
ATOM   1242 C CG1 B VAL C 1 46  ? 15.889  12.091  46.551 0.27 15.44 ? 496  VAL C CG1 1 
ATOM   1243 C CG2 A VAL C 1 46  ? 15.820  12.071  46.573 0.73 15.20 ? 496  VAL C CG2 1 
ATOM   1244 C CG2 B VAL C 1 46  ? 17.389  13.964  47.256 0.27 18.80 ? 496  VAL C CG2 1 
ATOM   1245 N N   . TYR C 1 47  ? 14.727  15.804  49.087 1.00 15.73 ? 497  TYR C N   1 
ATOM   1246 C CA  . TYR C 1 47  ? 15.145  16.892  49.963 1.00 16.90 ? 497  TYR C CA  1 
ATOM   1247 C C   . TYR C 1 47  ? 16.254  16.335  50.844 1.00 16.92 ? 497  TYR C C   1 
ATOM   1248 O O   . TYR C 1 47  ? 16.045  15.349  51.560 1.00 17.73 ? 497  TYR C O   1 
ATOM   1249 C CB  . TYR C 1 47  ? 13.984  17.385  50.827 1.00 18.30 ? 497  TYR C CB  1 
ATOM   1250 C CG  . TYR C 1 47  ? 14.275  18.676  51.581 1.00 18.98 ? 497  TYR C CG  1 
ATOM   1251 C CD1 . TYR C 1 47  ? 14.954  18.659  52.796 1.00 19.87 ? 497  TYR C CD1 1 
ATOM   1252 C CD2 . TYR C 1 47  ? 13.872  19.908  51.073 1.00 22.63 ? 497  TYR C CD2 1 
ATOM   1253 C CE1 . TYR C 1 47  ? 15.220  19.839  53.486 1.00 20.50 ? 497  TYR C CE1 1 
ATOM   1254 C CE2 . TYR C 1 47  ? 14.133  21.084  51.751 1.00 23.40 ? 497  TYR C CE2 1 
ATOM   1255 C CZ  . TYR C 1 47  ? 14.808  21.044  52.953 1.00 22.03 ? 497  TYR C CZ  1 
ATOM   1256 O OH  . TYR C 1 47  ? 15.067  22.217  53.630 1.00 28.18 ? 497  TYR C OH  1 
ATOM   1257 N N   . SER C 1 48  ? 17.438  16.931  50.762 1.00 17.11 ? 498  SER C N   1 
ATOM   1258 C CA  . SER C 1 48  ? 18.575  16.444  51.529 1.00 18.62 ? 498  SER C CA  1 
ATOM   1259 C C   . SER C 1 48  ? 19.486  17.622  51.834 1.00 23.39 ? 498  SER C C   1 
ATOM   1260 O O   . SER C 1 48  ? 19.786  18.420  50.941 1.00 22.26 ? 498  SER C O   1 
ATOM   1261 C CB  . SER C 1 48  ? 19.335  15.373  50.738 1.00 19.82 ? 498  SER C CB  1 
ATOM   1262 O OG  . SER C 1 48  ? 20.281  14.697  51.552 1.00 21.68 ? 498  SER C OG  1 
ATOM   1263 N N   . ASP C 1 49  ? 19.919  17.727  53.090 1.00 23.95 ? 499  ASP C N   1 
ATOM   1264 C CA  . ASP C 1 49  ? 20.850  18.773  53.517 1.00 29.26 ? 499  ASP C CA  1 
ATOM   1265 C C   . ASP C 1 49  ? 20.338  20.168  53.152 1.00 26.81 ? 499  ASP C C   1 
ATOM   1266 O O   . ASP C 1 49  ? 21.076  21.024  52.658 1.00 32.01 ? 499  ASP C O   1 
ATOM   1267 C CB  . ASP C 1 49  ? 22.259  18.522  52.975 1.00 36.40 ? 499  ASP C CB  1 
ATOM   1268 C CG  . ASP C 1 49  ? 22.802  17.160  53.371 1.00 43.44 ? 499  ASP C CG  1 
ATOM   1269 O OD1 . ASP C 1 49  ? 22.766  16.828  54.574 1.00 45.92 ? 499  ASP C OD1 1 
ATOM   1270 O OD2 . ASP C 1 49  ? 23.251  16.413  52.475 1.00 47.43 ? 499  ASP C OD2 1 
ATOM   1271 N N   . GLY C 1 50  ? 19.047  20.389  53.394 1.00 25.77 ? 500  GLY C N   1 
ATOM   1272 C CA  . GLY C 1 50  ? 18.453  21.698  53.213 1.00 26.43 ? 500  GLY C CA  1 
ATOM   1273 C C   . GLY C 1 50  ? 18.208  22.117  51.782 1.00 26.21 ? 500  GLY C C   1 
ATOM   1274 O O   . GLY C 1 50  ? 17.867  23.282  51.547 1.00 29.58 ? 500  GLY C O   1 
ATOM   1275 N N   . GLN C 1 51  ? 18.362  21.213  50.816 1.00 20.65 ? 501  GLN C N   1 
ATOM   1276 C CA  . GLN C 1 51  ? 18.172  21.553  49.415 1.00 21.65 ? 501  GLN C CA  1 
ATOM   1277 C C   . GLN C 1 51  ? 17.418  20.435  48.711 1.00 21.94 ? 501  GLN C C   1 
ATOM   1278 O O   . GLN C 1 51  ? 17.433  19.278  49.137 1.00 21.35 ? 501  GLN C O   1 
ATOM   1279 C CB  . GLN C 1 51  ? 19.510  21.779  48.699 1.00 27.98 ? 501  GLN C CB  1 
ATOM   1280 C CG  . GLN C 1 51  ? 20.254  23.030  49.142 1.00 32.26 ? 501  GLN C CG  1 
ATOM   1281 C CD  . GLN C 1 51  ? 19.545  24.309  48.728 1.00 37.26 ? 501  GLN C CD  1 
ATOM   1282 O OE1 . GLN C 1 51  ? 19.706  24.787  47.605 1.00 41.92 ? 501  GLN C OE1 1 
ATOM   1283 N NE2 . GLN C 1 51  ? 18.756  24.871  49.638 1.00 44.17 ? 501  GLN C NE2 1 
ATOM   1284 N N   . ARG C 1 52  ? 16.759  20.792  47.614 1.00 19.75 ? 502  ARG C N   1 
ATOM   1285 C CA  . ARG C 1 52  ? 16.153  19.807  46.732 1.00 20.27 ? 502  ARG C CA  1 
ATOM   1286 C C   . ARG C 1 52  ? 17.196  19.365  45.717 1.00 21.31 ? 502  ARG C C   1 
ATOM   1287 O O   . ARG C 1 52  ? 17.856  20.202  45.092 1.00 25.62 ? 502  ARG C O   1 
ATOM   1288 C CB  . ARG C 1 52  ? 14.940  20.392  46.007 1.00 22.16 ? 502  ARG C CB  1 
ATOM   1289 C CG  . ARG C 1 52  ? 13.698  20.570  46.870 1.00 25.85 ? 502  ARG C CG  1 
ATOM   1290 C CD  . ARG C 1 52  ? 13.717  21.867  47.666 1.00 30.03 ? 502  ARG C CD  1 
ATOM   1291 N NE  . ARG C 1 52  ? 12.446  22.079  48.349 1.00 30.07 ? 502  ARG C NE  1 
ATOM   1292 C CZ  . ARG C 1 52  ? 12.221  23.036  49.243 1.00 33.44 ? 502  ARG C CZ  1 
ATOM   1293 N NH1 . ARG C 1 52  ? 13.191  23.879  49.576 1.00 33.78 ? 502  ARG C NH1 1 
ATOM   1294 N NH2 . ARG C 1 52  ? 11.026  23.145  49.809 1.00 34.11 ? 502  ARG C NH2 1 
ATOM   1295 N N   . ARG C 1 53  ? 17.354  18.054  45.572 1.00 17.59 ? 503  ARG C N   1 
ATOM   1296 C CA  . ARG C 1 53  ? 18.350  17.487  44.677 1.00 17.39 ? 503  ARG C CA  1 
ATOM   1297 C C   . ARG C 1 53  ? 17.676  16.501  43.734 1.00 14.04 ? 503  ARG C C   1 
ATOM   1298 O O   . ARG C 1 53  ? 16.790  15.744  44.142 1.00 16.23 ? 503  ARG C O   1 
ATOM   1299 C CB  . ARG C 1 53  ? 19.476  16.826  45.475 1.00 22.26 ? 503  ARG C CB  1 
ATOM   1300 C CG  . ARG C 1 53  ? 20.143  17.820  46.434 1.00 26.48 ? 503  ARG C CG  1 
ATOM   1301 C CD  . ARG C 1 53  ? 21.276  17.211  47.234 1.00 30.21 ? 503  ARG C CD  1 
ATOM   1302 N NE  . ARG C 1 53  ? 22.447  16.941  46.410 1.00 34.49 ? 503  ARG C NE  1 
ATOM   1303 C CZ  . ARG C 1 53  ? 23.592  16.460  46.882 1.00 37.06 ? 503  ARG C CZ  1 
ATOM   1304 N NH1 . ARG C 1 53  ? 23.719  16.200  48.177 1.00 37.59 ? 503  ARG C NH1 1 
ATOM   1305 N NH2 . ARG C 1 53  ? 24.609  16.238  46.061 1.00 37.39 ? 503  ARG C NH2 1 
ATOM   1306 N N   . HIS C 1 54  ? 18.103  16.517  42.474 1.00 13.23 ? 504  HIS C N   1 
ATOM   1307 C CA  . HIS C 1 54  ? 17.412  15.810  41.400 1.00 12.29 ? 504  HIS C CA  1 
ATOM   1308 C C   . HIS C 1 54  ? 18.390  14.885  40.695 1.00 11.91 ? 504  HIS C C   1 
ATOM   1309 O O   . HIS C 1 54  ? 19.414  15.339  40.172 1.00 13.73 ? 504  HIS C O   1 
ATOM   1310 C CB  . HIS C 1 54  ? 16.801  16.817  40.424 1.00 13.11 ? 504  HIS C CB  1 
ATOM   1311 C CG  . HIS C 1 54  ? 15.926  17.827  41.094 1.00 13.56 ? 504  HIS C CG  1 
ATOM   1312 N ND1 . HIS C 1 54  ? 14.611  17.574  41.423 1.00 14.52 ? 504  HIS C ND1 1 
ATOM   1313 C CD2 . HIS C 1 54  ? 16.193  19.076  41.549 1.00 16.32 ? 504  HIS C CD2 1 
ATOM   1314 C CE1 . HIS C 1 54  ? 14.096  18.634  42.020 1.00 16.20 ? 504  HIS C CE1 1 
ATOM   1315 N NE2 . HIS C 1 54  ? 15.037  19.555  42.116 1.00 16.18 ? 504  HIS C NE2 1 
ATOM   1316 N N   . PHE C 1 55  ? 18.070  13.596  40.667 1.00 11.03 ? 505  PHE C N   1 
ATOM   1317 C CA  . PHE C 1 55  ? 18.922  12.586  40.057 1.00 10.77 ? 505  PHE C CA  1 
ATOM   1318 C C   . PHE C 1 55  ? 18.199  11.965  38.876 1.00 10.14 ? 505  PHE C C   1 
ATOM   1319 O O   . PHE C 1 55  ? 17.076  11.472  39.025 1.00 11.59 ? 505  PHE C O   1 
ATOM   1320 C CB  . PHE C 1 55  ? 19.208  11.447  41.035 1.00 11.27 ? 505  PHE C CB  1 
ATOM   1321 C CG  . PHE C 1 55  ? 19.913  11.865  42.282 1.00 12.03 ? 505  PHE C CG  1 
ATOM   1322 C CD1 . PHE C 1 55  ? 21.293  11.764  42.380 1.00 12.81 ? 505  PHE C CD1 1 
ATOM   1323 C CD2 . PHE C 1 55  ? 19.197  12.346  43.367 1.00 13.46 ? 505  PHE C CD2 1 
ATOM   1324 C CE1 . PHE C 1 55  ? 21.950  12.138  43.548 1.00 14.65 ? 505  PHE C CE1 1 
ATOM   1325 C CE2 . PHE C 1 55  ? 19.850  12.718  44.541 1.00 17.79 ? 505  PHE C CE2 1 
ATOM   1326 C CZ  . PHE C 1 55  ? 21.225  12.615  44.627 1.00 16.67 ? 505  PHE C CZ  1 
ATOM   1327 N N   . ILE C 1 56  ? 18.867  11.928  37.724 1.00 10.48 ? 506  ILE C N   1 
ATOM   1328 C CA  . ILE C 1 56  ? 18.358  11.143  36.607 1.00 9.46  ? 506  ILE C CA  1 
ATOM   1329 C C   . ILE C 1 56  ? 18.525  9.662   36.914 1.00 9.52  ? 506  ILE C C   1 
ATOM   1330 O O   . ILE C 1 56  ? 19.602  9.208   37.339 1.00 10.85 ? 506  ILE C O   1 
ATOM   1331 C CB  . ILE C 1 56  ? 19.075  11.516  35.300 1.00 9.94  ? 506  ILE C CB  1 
ATOM   1332 C CG1 . ILE C 1 56  ? 18.773  12.967  34.904 1.00 11.58 ? 506  ILE C CG1 1 
ATOM   1333 C CG2 . ILE C 1 56  ? 18.693  10.545  34.180 1.00 12.45 ? 506  ILE C CG2 1 
ATOM   1334 C CD1 . ILE C 1 56  ? 17.334  13.203  34.514 1.00 13.30 ? 506  ILE C CD1 1 
ATOM   1335 N N   . ILE C 1 57  ? 17.449  8.906   36.727 1.00 8.43  ? 507  ILE C N   1 
ATOM   1336 C CA  . ILE C 1 57  ? 17.491  7.454   36.831 1.00 8.35  ? 507  ILE C CA  1 
ATOM   1337 C C   . ILE C 1 57  ? 18.035  6.942   35.501 1.00 9.42  ? 507  ILE C C   1 
ATOM   1338 O O   . ILE C 1 57  ? 17.409  7.122   34.453 1.00 10.53 ? 507  ILE C O   1 
ATOM   1339 C CB  . ILE C 1 57  ? 16.099  6.887   37.131 1.00 8.47  ? 507  ILE C CB  1 
ATOM   1340 C CG1 . ILE C 1 57  ? 15.599  7.429   38.476 1.00 11.64 ? 507  ILE C CG1 1 
ATOM   1341 C CG2 . ILE C 1 57  ? 16.131  5.363   37.129 1.00 10.39 ? 507  ILE C CG2 1 
ATOM   1342 C CD1 . ILE C 1 57  ? 14.177  7.051   38.844 1.00 11.91 ? 507  ILE C CD1 1 
ATOM   1343 N N   . GLN C 1 58  ? 19.229  6.366   35.526 1.00 9.92  ? 508  GLN C N   1 
ATOM   1344 C CA  . GLN C 1 58  ? 19.849  5.886   34.302 1.00 9.93  ? 508  GLN C CA  1 
ATOM   1345 C C   . GLN C 1 58  ? 19.125  4.643   33.805 1.00 9.69  ? 508  GLN C C   1 
ATOM   1346 O O   . GLN C 1 58  ? 18.647  3.824   34.593 1.00 9.70  ? 508  GLN C O   1 
ATOM   1347 C CB  . GLN C 1 58  ? 21.308  5.519   34.571 1.00 11.31 ? 508  GLN C CB  1 
ATOM   1348 C CG  . GLN C 1 58  ? 22.100  6.588   35.296 1.00 15.38 ? 508  GLN C CG  1 
ATOM   1349 C CD  . GLN C 1 58  ? 22.206  7.858   34.497 1.00 16.96 ? 508  GLN C CD  1 
ATOM   1350 O OE1 . GLN C 1 58  ? 22.694  7.855   33.367 1.00 24.03 ? 508  GLN C OE1 1 
ATOM   1351 N NE2 . GLN C 1 58  ? 21.739  8.960   35.071 1.00 19.43 ? 508  GLN C NE2 1 
ATOM   1352 N N   . TYR C 1 59  ? 19.051  4.503   32.484 1.00 8.56  ? 509  TYR C N   1 
ATOM   1353 C CA  . TYR C 1 59  ? 18.438  3.346   31.835 1.00 8.04  ? 509  TYR C CA  1 
ATOM   1354 C C   . TYR C 1 59  ? 19.416  2.839   30.783 1.00 8.42  ? 509  TYR C C   1 
ATOM   1355 O O   . TYR C 1 59  ? 19.624  3.496   29.754 1.00 9.07  ? 509  TYR C O   1 
ATOM   1356 C CB  . TYR C 1 59  ? 17.088  3.717   31.213 1.00 8.57  ? 509  TYR C CB  1 
ATOM   1357 C CG  . TYR C 1 59  ? 16.424  2.562   30.514 1.00 7.94  ? 509  TYR C CG  1 
ATOM   1358 C CD1 . TYR C 1 59  ? 15.930  1.477   31.235 1.00 9.03  ? 509  TYR C CD1 1 
ATOM   1359 C CD2 . TYR C 1 59  ? 16.288  2.548   29.126 1.00 10.13 ? 509  TYR C CD2 1 
ATOM   1360 C CE1 . TYR C 1 59  ? 15.324  0.416   30.596 1.00 9.76  ? 509  TYR C CE1 1 
ATOM   1361 C CE2 . TYR C 1 59  ? 15.687  1.492   28.479 1.00 10.48 ? 509  TYR C CE2 1 
ATOM   1362 C CZ  . TYR C 1 59  ? 15.206  0.431   29.218 1.00 9.55  ? 509  TYR C CZ  1 
ATOM   1363 O OH  . TYR C 1 59  ? 14.612  -0.625  28.572 1.00 11.58 ? 509  TYR C OH  1 
ATOM   1364 N N   . VAL C 1 60  ? 20.037  1.693   31.062 1.00 8.20  ? 510  VAL C N   1 
ATOM   1365 C CA  . VAL C 1 60  ? 21.128  1.146   30.261 1.00 10.50 ? 510  VAL C CA  1 
ATOM   1366 C C   . VAL C 1 60  ? 20.899  -0.352  30.118 1.00 9.87  ? 510  VAL C C   1 
ATOM   1367 O O   . VAL C 1 60  ? 20.726  -1.050  31.120 1.00 11.12 ? 510  VAL C O   1 
ATOM   1368 C CB  . VAL C 1 60  ? 22.494  1.392   30.935 1.00 11.49 ? 510  VAL C CB  1 
ATOM   1369 C CG1 . VAL C 1 60  ? 23.617  0.725   30.142 1.00 12.96 ? 510  VAL C CG1 1 
ATOM   1370 C CG2 . VAL C 1 60  ? 22.751  2.885   31.091 1.00 11.02 ? 510  VAL C CG2 1 
ATOM   1371 N N   . ASP C 1 61  ? 20.900  -0.846  28.879 1.00 11.29 ? 511  ASP C N   1 
ATOM   1372 C CA  . ASP C 1 61  ? 20.755  -2.278  28.607 1.00 12.39 ? 511  ASP C CA  1 
ATOM   1373 C C   . ASP C 1 61  ? 19.592  -2.890  29.391 1.00 11.42 ? 511  ASP C C   1 
ATOM   1374 O O   . ASP C 1 61  ? 19.724  -3.913  30.070 1.00 12.61 ? 511  ASP C O   1 
ATOM   1375 C CB  . ASP C 1 61  ? 22.070  -3.029  28.830 1.00 16.12 ? 511  ASP C CB  1 
ATOM   1376 C CG  . ASP C 1 61  ? 21.999  -4.481  28.393 1.00 23.67 ? 511  ASP C CG  1 
ATOM   1377 O OD1 . ASP C 1 61  ? 21.408  -4.756  27.325 1.00 22.28 ? 511  ASP C OD1 1 
ATOM   1378 O OD2 . ASP C 1 61  ? 22.536  -5.343  29.123 1.00 27.36 ? 511  ASP C OD2 1 
ATOM   1379 N N   . ASN C 1 62  ? 18.440  -2.226  29.306 1.00 11.21 ? 512  ASN C N   1 
ATOM   1380 C CA  . ASN C 1 62  ? 17.171  -2.676  29.872 1.00 14.82 ? 512  ASN C CA  1 
ATOM   1381 C C   . ASN C 1 62  ? 17.123  -2.617  31.391 1.00 11.80 ? 512  ASN C C   1 
ATOM   1382 O O   . ASN C 1 62  ? 16.198  -3.175  31.988 1.00 12.81 ? 512  ASN C O   1 
ATOM   1383 C CB  . ASN C 1 62  ? 16.760  -4.074  29.394 1.00 19.15 ? 512  ASN C CB  1 
ATOM   1384 C CG  . ASN C 1 62  ? 16.712  -4.182  27.887 1.00 22.36 ? 512  ASN C CG  1 
ATOM   1385 O OD1 . ASN C 1 62  ? 16.043  -3.398  27.216 1.00 26.82 ? 512  ASN C OD1 1 
ATOM   1386 N ND2 . ASN C 1 62  ? 17.437  -5.153  27.342 1.00 28.37 ? 512  ASN C ND2 1 
ATOM   1387 N N   . MET C 1 63  ? 18.075  -1.944  32.033 1.00 9.96  ? 513  MET C N   1 
ATOM   1388 C CA  . MET C 1 63  ? 18.143  -1.858  33.484 1.00 10.52 ? 513  MET C CA  1 
ATOM   1389 C C   . MET C 1 63  ? 18.129  -0.404  33.929 1.00 9.31  ? 513  MET C C   1 
ATOM   1390 O O   . MET C 1 63  ? 18.810  0.449   33.344 1.00 10.19 ? 513  MET C O   1 
ATOM   1391 C CB  . MET C 1 63  ? 19.421  -2.519  34.004 1.00 14.21 ? 513  MET C CB  1 
ATOM   1392 C CG  . MET C 1 63  ? 19.493  -4.009  33.732 1.00 19.56 ? 513  MET C CG  1 
ATOM   1393 S SD  . MET C 1 63  ? 18.191  -4.900  34.625 1.00 24.17 ? 513  MET C SD  1 
ATOM   1394 C CE  . MET C 1 63  ? 19.123  -5.830  35.828 1.00 31.84 ? 513  MET C CE  1 
ATOM   1395 N N   . TYR C 1 64  ? 17.351  -0.127  34.970 1.00 8.03  ? 514  TYR C N   1 
ATOM   1396 C CA  . TYR C 1 64  ? 17.378  1.166   35.640 1.00 8.24  ? 514  TYR C CA  1 
ATOM   1397 C C   . TYR C 1 64  ? 18.363  1.126   36.799 1.00 9.30  ? 514  TYR C C   1 
ATOM   1398 O O   . TYR C 1 64  ? 18.436  0.134   37.531 1.00 10.65 ? 514  TYR C O   1 
ATOM   1399 C CB  . TYR C 1 64  ? 15.990  1.500   36.185 1.00 8.37  ? 514  TYR C CB  1 
ATOM   1400 C CG  . TYR C 1 64  ? 14.924  1.655   35.124 1.00 7.39  ? 514  TYR C CG  1 
ATOM   1401 C CD1 . TYR C 1 64  ? 14.718  2.877   34.497 1.00 8.62  ? 514  TYR C CD1 1 
ATOM   1402 C CD2 . TYR C 1 64  ? 14.118  0.584   34.757 1.00 9.85  ? 514  TYR C CD2 1 
ATOM   1403 C CE1 . TYR C 1 64  ? 13.742  3.025   33.526 1.00 8.11  ? 514  TYR C CE1 1 
ATOM   1404 C CE2 . TYR C 1 64  ? 13.135  0.721   33.786 1.00 8.07  ? 514  TYR C CE2 1 
ATOM   1405 C CZ  . TYR C 1 64  ? 12.961  1.945   33.177 1.00 7.79  ? 514  TYR C CZ  1 
ATOM   1406 O OH  . TYR C 1 64  ? 11.983  2.094   32.230 1.00 9.03  ? 514  TYR C OH  1 
ATOM   1407 N N   . ARG C 1 65  ? 19.110  2.211   36.982 1.00 8.49  ? 515  ARG C N   1 
ATOM   1408 C CA  . ARG C 1 65  ? 20.135  2.216   38.016 1.00 9.54  ? 515  ARG C CA  1 
ATOM   1409 C C   . ARG C 1 65  ? 20.573  3.643   38.304 1.00 10.49 ? 515  ARG C C   1 
ATOM   1410 O O   . ARG C 1 65  ? 20.278  4.580   37.561 1.00 10.16 ? 515  ARG C O   1 
ATOM   1411 C CB  . ARG C 1 65  ? 21.345  1.408   37.558 1.00 12.36 ? 515  ARG C CB  1 
ATOM   1412 C CG  . ARG C 1 65  ? 21.978  2.032   36.329 1.00 16.98 ? 515  ARG C CG  1 
ATOM   1413 C CD  . ARG C 1 65  ? 23.146  1.245   35.801 1.00 27.26 ? 515  ARG C CD  1 
ATOM   1414 N NE  . ARG C 1 65  ? 24.050  2.136   35.085 1.00 27.56 ? 515  ARG C NE  1 
ATOM   1415 C CZ  . ARG C 1 65  ? 24.968  1.736   34.217 1.00 28.58 ? 515  ARG C CZ  1 
ATOM   1416 N NH1 . ARG C 1 65  ? 25.107  0.447   33.941 1.00 33.46 ? 515  ARG C NH1 1 
ATOM   1417 N NH2 . ARG C 1 65  ? 25.739  2.634   33.620 1.00 25.56 ? 515  ARG C NH2 1 
ATOM   1418 N N   . PHE C 1 66  ? 21.289  3.787   39.415 1.00 11.12 ? 516  PHE C N   1 
ATOM   1419 C CA  . PHE C 1 66  ? 22.137  4.946   39.648 1.00 11.47 ? 516  PHE C CA  1 
ATOM   1420 C C   . PHE C 1 66  ? 23.585  4.509   39.414 1.00 14.62 ? 516  PHE C C   1 
ATOM   1421 O O   . PHE C 1 66  ? 23.990  4.315   38.261 1.00 18.15 ? 516  PHE C O   1 
ATOM   1422 C CB  . PHE C 1 66  ? 21.862  5.552   41.034 1.00 13.01 ? 516  PHE C CB  1 
ATOM   1423 C CG  . PHE C 1 66  ? 20.439  6.046   41.214 1.00 10.61 ? 516  PHE C CG  1 
ATOM   1424 C CD1 . PHE C 1 66  ? 19.962  7.123   40.476 1.00 11.85 ? 516  PHE C CD1 1 
ATOM   1425 C CD2 . PHE C 1 66  ? 19.578  5.435   42.122 1.00 10.25 ? 516  PHE C CD2 1 
ATOM   1426 C CE1 . PHE C 1 66  ? 18.663  7.567   40.636 1.00 11.71 ? 516  PHE C CE1 1 
ATOM   1427 C CE2 . PHE C 1 66  ? 18.271  5.874   42.286 1.00 11.24 ? 516  PHE C CE2 1 
ATOM   1428 C CZ  . PHE C 1 66  ? 17.814  6.946   41.540 1.00 12.34 ? 516  PHE C CZ  1 
ATOM   1429 N N   . GLU C 1 67  ? 24.365  4.292   40.469 1.00 13.66 ? 517  GLU C N   1 
ATOM   1430 C CA  . GLU C 1 67  ? 25.778  3.947   40.327 1.00 17.55 ? 517  GLU C CA  1 
ATOM   1431 C C   . GLU C 1 67  ? 26.086  2.504   40.698 1.00 16.60 ? 517  GLU C C   1 
ATOM   1432 O O   . GLU C 1 67  ? 27.264  2.139   40.810 1.00 19.36 ? 517  GLU C O   1 
ATOM   1433 C CB  . GLU C 1 67  ? 26.648  4.865   41.186 1.00 17.07 ? 517  GLU C CB  1 
ATOM   1434 C CG  . GLU C 1 67  ? 26.645  6.318   40.763 1.00 18.59 ? 517  GLU C CG  1 
ATOM   1435 C CD  . GLU C 1 67  ? 27.526  7.181   41.654 1.00 22.57 ? 517  GLU C CD  1 
ATOM   1436 O OE1 . GLU C 1 67  ? 27.926  6.716   42.741 1.00 31.66 ? 517  GLU C OE1 1 
ATOM   1437 O OE2 . GLU C 1 67  ? 27.817  8.328   41.262 1.00 30.47 ? 517  GLU C OE2 1 
ATOM   1438 N N   . GLY C 1 68  ? 25.071  1.687   40.925 1.00 14.71 ? 518  GLY C N   1 
ATOM   1439 C CA  . GLY C 1 68  ? 25.319  0.327   41.347 1.00 14.41 ? 518  GLY C CA  1 
ATOM   1440 C C   . GLY C 1 68  ? 24.668  -0.683  40.432 1.00 15.71 ? 518  GLY C C   1 
ATOM   1441 O O   . GLY C 1 68  ? 24.735  -0.571  39.204 1.00 17.37 ? 518  GLY C O   1 
ATOM   1442 N N   . THR C 1 69  ? 24.027  -1.672  41.041 1.00 16.37 ? 519  THR C N   1 
ATOM   1443 C CA  . THR C 1 69  ? 23.388  -2.752  40.308 1.00 15.64 ? 519  THR C CA  1 
ATOM   1444 C C   . THR C 1 69  ? 22.143  -2.234  39.583 1.00 14.22 ? 519  THR C C   1 
ATOM   1445 O O   . THR C 1 69  ? 21.585  -1.188  39.921 1.00 14.05 ? 519  THR C O   1 
ATOM   1446 C CB  . THR C 1 69  ? 23.047  -3.890  41.276 1.00 22.17 ? 519  THR C CB  1 
ATOM   1447 O OG1 . THR C 1 69  ? 22.541  -5.015  40.552 1.00 31.42 ? 519  THR C OG1 1 
ATOM   1448 C CG2 . THR C 1 69  ? 22.015  -3.444  42.289 1.00 23.68 ? 519  THR C CG2 1 
ATOM   1449 N N   . GLY C 1 70  ? 21.716  -2.980  38.565 1.00 13.39 ? 520  GLY C N   1 
ATOM   1450 C CA  . GLY C 1 70  ? 20.583  -2.591  37.753 1.00 14.85 ? 520  GLY C CA  1 
ATOM   1451 C C   . GLY C 1 70  ? 19.305  -3.329  38.118 1.00 12.03 ? 520  GLY C C   1 
ATOM   1452 O O   . GLY C 1 70  ? 19.327  -4.437  38.656 1.00 12.90 ? 520  GLY C O   1 
ATOM   1453 N N   . PHE C 1 71  ? 18.172  -2.706  37.801 1.00 9.90  ? 521  PHE C N   1 
ATOM   1454 C CA  . PHE C 1 71  ? 16.862  -3.248  38.139 1.00 9.92  ? 521  PHE C CA  1 
ATOM   1455 C C   . PHE C 1 71  ? 15.969  -3.196  36.909 1.00 8.96  ? 521  PHE C C   1 
ATOM   1456 O O   . PHE C 1 71  ? 16.047  -2.252  36.117 1.00 9.52  ? 521  PHE C O   1 
ATOM   1457 C CB  . PHE C 1 71  ? 16.221  -2.427  39.257 1.00 11.94 ? 521  PHE C CB  1 
ATOM   1458 C CG  . PHE C 1 71  ? 17.000  -2.464  40.539 1.00 11.11 ? 521  PHE C CG  1 
ATOM   1459 C CD1 . PHE C 1 71  ? 18.088  -1.630  40.728 1.00 11.50 ? 521  PHE C CD1 1 
ATOM   1460 C CD2 . PHE C 1 71  ? 16.659  -3.353  41.538 1.00 12.47 ? 521  PHE C CD2 1 
ATOM   1461 C CE1 . PHE C 1 71  ? 18.820  -1.682  41.914 1.00 11.10 ? 521  PHE C CE1 1 
ATOM   1462 C CE2 . PHE C 1 71  ? 17.383  -3.406  42.726 1.00 12.73 ? 521  PHE C CE2 1 
ATOM   1463 C CZ  . PHE C 1 71  ? 18.461  -2.572  42.907 1.00 12.76 ? 521  PHE C CZ  1 
ATOM   1464 N N   . SER C 1 72  ? 15.111  -4.202  36.738 1.00 8.95  ? 522  SER C N   1 
ATOM   1465 C CA  A SER C 1 72  ? 14.235  -4.220  35.573 0.57 9.72  ? 522  SER C CA  1 
ATOM   1466 C CA  B SER C 1 72  ? 14.233  -4.222  35.574 0.43 10.14 ? 522  SER C CA  1 
ATOM   1467 C C   . SER C 1 72  ? 13.187  -3.116  35.616 1.00 9.33  ? 522  SER C C   1 
ATOM   1468 O O   . SER C 1 72  ? 12.665  -2.728  34.563 1.00 9.34  ? 522  SER C O   1 
ATOM   1469 C CB  A SER C 1 72  ? 13.543  -5.576  35.456 0.57 14.12 ? 522  SER C CB  1 
ATOM   1470 C CB  B SER C 1 72  ? 13.552  -5.587  35.451 0.43 13.85 ? 522  SER C CB  1 
ATOM   1471 O OG  A SER C 1 72  ? 12.633  -5.763  36.522 0.57 13.59 ? 522  SER C OG  1 
ATOM   1472 O OG  B SER C 1 72  ? 14.506  -6.615  35.241 0.43 16.31 ? 522  SER C OG  1 
ATOM   1473 N N   . ASN C 1 73  ? 12.861  -2.603  36.797 1.00 8.68  ? 523  ASN C N   1 
ATOM   1474 C CA  . ASN C 1 73  ? 11.847  -1.567  36.895 1.00 8.93  ? 523  ASN C CA  1 
ATOM   1475 C C   . ASN C 1 73  ? 12.217  -0.589  37.998 1.00 8.98  ? 523  ASN C C   1 
ATOM   1476 O O   . ASN C 1 73  ? 12.977  -0.899  38.921 1.00 9.41  ? 523  ASN C O   1 
ATOM   1477 C CB  . ASN C 1 73  ? 10.450  -2.153  37.112 1.00 11.05 ? 523  ASN C CB  1 
ATOM   1478 C CG  . ASN C 1 73  ? 10.365  -2.989  38.352 1.00 12.34 ? 523  ASN C CG  1 
ATOM   1479 O OD1 . ASN C 1 73  ? 10.383  -2.468  39.460 1.00 12.56 ? 523  ASN C OD1 1 
ATOM   1480 N ND2 . ASN C 1 73  ? 10.249  -4.298  38.179 1.00 18.19 ? 523  ASN C ND2 1 
ATOM   1481 N N   . ILE C 1 74  ? 11.666  0.608   37.889 1.00 8.56  ? 524  ILE C N   1 
ATOM   1482 C CA  . ILE C 1 74  ? 11.960  1.680   38.834 1.00 8.16  ? 524  ILE C CA  1 
ATOM   1483 C C   . ILE C 1 74  ? 11.474  1.376   40.251 1.00 8.24  ? 524  ILE C C   1 
ATOM   1484 O O   . ILE C 1 74  ? 12.215  1.643   41.210 1.00 8.30  ? 524  ILE C O   1 
ATOM   1485 C CB  . ILE C 1 74  ? 11.483  3.034   38.288 1.00 7.24  ? 524  ILE C CB  1 
ATOM   1486 C CG1 . ILE C 1 74  ? 12.340  3.407   37.075 1.00 8.31  ? 524  ILE C CG1 1 
ATOM   1487 C CG2 . ILE C 1 74  ? 11.539  4.111   39.379 1.00 8.37  ? 524  ILE C CG2 1 
ATOM   1488 C CD1 . ILE C 1 74  ? 11.903  4.662   36.364 1.00 9.75  ? 524  ILE C CD1 1 
ATOM   1489 N N   . PRO C 1 75  ? 10.273  0.816   40.458 1.00 7.88  ? 525  PRO C N   1 
ATOM   1490 C CA  . PRO C 1 75  ? 9.863   0.525   41.843 1.00 9.35  ? 525  PRO C CA  1 
ATOM   1491 C C   . PRO C 1 75  ? 10.861  -0.336  42.606 1.00 8.79  ? 525  PRO C C   1 
ATOM   1492 O O   . PRO C 1 75  ? 11.094  -0.092  43.799 1.00 8.50  ? 525  PRO C O   1 
ATOM   1493 C CB  . PRO C 1 75  ? 8.480   -0.117  41.667 1.00 10.02 ? 525  PRO C CB  1 
ATOM   1494 C CG  . PRO C 1 75  ? 7.951   0.539   40.413 1.00 9.85  ? 525  PRO C CG  1 
ATOM   1495 C CD  . PRO C 1 75  ? 9.162   0.584   39.513 1.00 8.87  ? 525  PRO C CD  1 
ATOM   1496 N N   . GLN C 1 76  ? 11.500  -1.306  41.941 1.00 8.19  ? 526  GLN C N   1 
ATOM   1497 C CA  . GLN C 1 76  ? 12.483  -2.139  42.629 1.00 8.74  ? 526  GLN C CA  1 
ATOM   1498 C C   . GLN C 1 76  ? 13.755  -1.365  42.952 1.00 8.72  ? 526  GLN C C   1 
ATOM   1499 O O   . GLN C 1 76  ? 14.347  -1.562  44.017 1.00 8.48  ? 526  GLN C O   1 
ATOM   1500 C CB  . GLN C 1 76  ? 12.774  -3.406  41.821 1.00 9.19  ? 526  GLN C CB  1 
ATOM   1501 C CG  . GLN C 1 76  ? 11.695  -4.491  41.984 1.00 12.20 ? 526  GLN C CG  1 
ATOM   1502 C CD  . GLN C 1 76  ? 11.521  -4.930  43.432 1.00 16.07 ? 526  GLN C CD  1 
ATOM   1503 O OE1 . GLN C 1 76  ? 10.626  -4.460  44.135 1.00 17.39 ? 526  GLN C OE1 1 
ATOM   1504 N NE2 . GLN C 1 76  ? 12.383  -5.834  43.883 1.00 14.76 ? 526  GLN C NE2 1 
ATOM   1505 N N   . LEU C 1 77  ? 14.183  -0.472  42.061 1.00 7.43  ? 527  LEU C N   1 
ATOM   1506 C CA  . LEU C 1 77  ? 15.335  0.377   42.359 1.00 8.85  ? 527  LEU C CA  1 
ATOM   1507 C C   . LEU C 1 77  ? 15.058  1.266   43.569 1.00 8.20  ? 527  LEU C C   1 
ATOM   1508 O O   . LEU C 1 77  ? 15.873  1.359   44.497 1.00 8.76  ? 527  LEU C O   1 
ATOM   1509 C CB  . LEU C 1 77  ? 15.674  1.224   41.129 1.00 9.48  ? 527  LEU C CB  1 
ATOM   1510 C CG  . LEU C 1 77  ? 16.693  2.349   41.342 1.00 7.82  ? 527  LEU C CG  1 
ATOM   1511 C CD1 . LEU C 1 77  ? 18.069  1.797   41.668 1.00 9.96  ? 527  LEU C CD1 1 
ATOM   1512 C CD2 . LEU C 1 77  ? 16.749  3.230   40.104 1.00 9.88  ? 527  LEU C CD2 1 
ATOM   1513 N N   . ILE C 1 78  ? 13.895  1.915   43.577 1.00 8.21  ? 528  ILE C N   1 
ATOM   1514 C CA  . ILE C 1 78  ? 13.539  2.790   44.688 1.00 9.13  ? 528  ILE C CA  1 
ATOM   1515 C C   . ILE C 1 78  ? 13.426  1.995   45.980 1.00 10.16 ? 528  ILE C C   1 
ATOM   1516 O O   . ILE C 1 78  ? 13.931  2.412   47.031 1.00 9.13  ? 528  ILE C O   1 
ATOM   1517 C CB  . ILE C 1 78  ? 12.239  3.547   44.361 1.00 9.70  ? 528  ILE C CB  1 
ATOM   1518 C CG1 . ILE C 1 78  ? 12.414  4.425   43.112 1.00 10.10 ? 528  ILE C CG1 1 
ATOM   1519 C CG2 . ILE C 1 78  ? 11.784  4.356   45.575 1.00 11.06 ? 528  ILE C CG2 1 
ATOM   1520 C CD1 . ILE C 1 78  ? 13.495  5.488   43.234 1.00 14.20 ? 528  ILE C CD1 1 
ATOM   1521 N N   . ASP C 1 79  ? 12.789  0.824   45.922 1.00 8.84  ? 529  ASP C N   1 
ATOM   1522 C CA  . ASP C 1 79  ? 12.596  0.049   47.143 1.00 10.13 ? 529  ASP C CA  1 
ATOM   1523 C C   . ASP C 1 79  ? 13.913  -0.488  47.690 1.00 10.09 ? 529  ASP C C   1 
ATOM   1524 O O   . ASP C 1 79  ? 14.069  -0.606  48.913 1.00 9.85  ? 529  ASP C O   1 
ATOM   1525 C CB  . ASP C 1 79  ? 11.573  -1.069  46.931 1.00 10.72 ? 529  ASP C CB  1 
ATOM   1526 C CG  . ASP C 1 79  ? 11.022  -1.598  48.242 1.00 14.15 ? 529  ASP C CG  1 
ATOM   1527 O OD1 . ASP C 1 79  ? 10.617  -0.780  49.097 1.00 15.76 ? 529  ASP C OD1 1 
ATOM   1528 O OD2 . ASP C 1 79  ? 10.999  -2.829  48.421 1.00 16.62 ? 529  ASP C OD2 1 
ATOM   1529 N N   . HIS C 1 80  ? 14.879  -0.794  46.821 1.00 8.62  ? 530  HIS C N   1 
ATOM   1530 C CA  . HIS C 1 80  ? 16.204  -1.164  47.306 1.00 10.01 ? 530  HIS C CA  1 
ATOM   1531 C C   . HIS C 1 80  ? 16.796  -0.044  48.147 1.00 9.93  ? 530  HIS C C   1 
ATOM   1532 O O   . HIS C 1 80  ? 17.273  -0.271  49.260 1.00 9.43  ? 530  HIS C O   1 
ATOM   1533 C CB  . HIS C 1 80  ? 17.141  -1.513  46.145 1.00 10.31 ? 530  HIS C CB  1 
ATOM   1534 C CG  . HIS C 1 80  ? 18.593  -1.493  46.528 1.00 10.16 ? 530  HIS C CG  1 
ATOM   1535 N ND1 . HIS C 1 80  ? 19.164  -2.449  47.340 1.00 10.84 ? 530  HIS C ND1 1 
ATOM   1536 C CD2 . HIS C 1 80  ? 19.582  -0.616  46.229 1.00 11.38 ? 530  HIS C CD2 1 
ATOM   1537 C CE1 . HIS C 1 80  ? 20.444  -2.167  47.517 1.00 12.35 ? 530  HIS C CE1 1 
ATOM   1538 N NE2 . HIS C 1 80  ? 20.723  -1.059  46.851 1.00 12.27 ? 530  HIS C NE2 1 
ATOM   1539 N N   . HIS C 1 81  ? 16.758  1.185   47.637 1.00 8.75  ? 531  HIS C N   1 
ATOM   1540 C CA  . HIS C 1 81  ? 17.336  2.292   48.389 1.00 9.08  ? 531  HIS C CA  1 
ATOM   1541 C C   . HIS C 1 81  ? 16.522  2.613   49.636 1.00 9.53  ? 531  HIS C C   1 
ATOM   1542 O O   . HIS C 1 81  ? 17.090  2.936   50.688 1.00 10.75 ? 531  HIS C O   1 
ATOM   1543 C CB  . HIS C 1 81  ? 17.502  3.504   47.476 1.00 9.08  ? 531  HIS C CB  1 
ATOM   1544 C CG  . HIS C 1 81  ? 18.645  3.358   46.525 1.00 9.71  ? 531  HIS C CG  1 
ATOM   1545 N ND1 . HIS C 1 81  ? 19.953  3.524   46.919 1.00 10.65 ? 531  HIS C ND1 1 
ATOM   1546 C CD2 . HIS C 1 81  ? 18.688  2.985   45.225 1.00 9.45  ? 531  HIS C CD2 1 
ATOM   1547 C CE1 . HIS C 1 81  ? 20.754  3.292   45.894 1.00 11.60 ? 531  HIS C CE1 1 
ATOM   1548 N NE2 . HIS C 1 81  ? 20.011  2.954   44.856 1.00 10.41 ? 531  HIS C NE2 1 
ATOM   1549 N N   . TYR C 1 82  ? 15.198  2.485   49.556 1.00 10.18 ? 532  TYR C N   1 
ATOM   1550 C CA  . TYR C 1 82  ? 14.363  2.759   50.716 1.00 11.22 ? 532  TYR C CA  1 
ATOM   1551 C C   . TYR C 1 82  ? 14.562  1.711   51.805 1.00 12.08 ? 532  TYR C C   1 
ATOM   1552 O O   . TYR C 1 82  ? 14.564  2.041   52.998 1.00 12.28 ? 532  TYR C O   1 
ATOM   1553 C CB  . TYR C 1 82  ? 12.899  2.818   50.298 1.00 11.89 ? 532  TYR C CB  1 
ATOM   1554 C CG  . TYR C 1 82  ? 11.985  3.159   51.444 1.00 13.91 ? 532  TYR C CG  1 
ATOM   1555 C CD1 . TYR C 1 82  ? 11.930  4.452   51.946 1.00 16.33 ? 532  TYR C CD1 1 
ATOM   1556 C CD2 . TYR C 1 82  ? 11.190  2.188   52.032 1.00 20.93 ? 532  TYR C CD2 1 
ATOM   1557 C CE1 . TYR C 1 82  ? 11.101  4.769   53.003 1.00 20.86 ? 532  TYR C CE1 1 
ATOM   1558 C CE2 . TYR C 1 82  ? 10.355  2.498   53.088 1.00 24.85 ? 532  TYR C CE2 1 
ATOM   1559 C CZ  . TYR C 1 82  ? 10.313  3.791   53.567 1.00 24.93 ? 532  TYR C CZ  1 
ATOM   1560 O OH  . TYR C 1 82  ? 9.484   4.105   54.620 1.00 32.18 ? 532  TYR C OH  1 
ATOM   1561 N N   . THR C 1 83  ? 14.734  0.445   51.419 1.00 11.31 ? 533  THR C N   1 
ATOM   1562 C CA  . THR C 1 83  ? 14.832  -0.634  52.399 1.00 10.39 ? 533  THR C CA  1 
ATOM   1563 C C   . THR C 1 83  ? 16.223  -0.719  53.018 1.00 11.29 ? 533  THR C C   1 
ATOM   1564 O O   . THR C 1 83  ? 16.349  -0.909  54.236 1.00 13.44 ? 533  THR C O   1 
ATOM   1565 C CB  . THR C 1 83  ? 14.446  -1.962  51.742 1.00 11.77 ? 533  THR C CB  1 
ATOM   1566 O OG1 . THR C 1 83  ? 13.109  -1.873  51.244 1.00 12.82 ? 533  THR C OG1 1 
ATOM   1567 C CG2 . THR C 1 83  ? 14.515  -3.101  52.748 1.00 11.55 ? 533  THR C CG2 1 
ATOM   1568 N N   . THR C 1 84  ? 17.278  -0.576  52.211 1.00 11.72 ? 534  THR C N   1 
ATOM   1569 C CA  . THR C 1 84  ? 18.642  -0.755  52.699 1.00 12.18 ? 534  THR C CA  1 
ATOM   1570 C C   . THR C 1 84  ? 19.290  0.536   53.169 1.00 11.26 ? 534  THR C C   1 
ATOM   1571 O O   . THR C 1 84  ? 20.331  0.480   53.838 1.00 12.28 ? 534  THR C O   1 
ATOM   1572 C CB  . THR C 1 84  ? 19.551  -1.336  51.610 1.00 11.52 ? 534  THR C CB  1 
ATOM   1573 O OG1 . THR C 1 84  ? 19.717  -0.363  50.562 1.00 11.76 ? 534  THR C OG1 1 
ATOM   1574 C CG2 . THR C 1 84  ? 18.996  -2.655  51.062 1.00 13.62 ? 534  THR C CG2 1 
ATOM   1575 N N   . LYS C 1 85  ? 18.728  1.688   52.805 1.00 10.79 ? 535  LYS C N   1 
ATOM   1576 C CA  . LYS C 1 85  ? 19.320  3.000   53.076 1.00 11.24 ? 535  LYS C CA  1 
ATOM   1577 C C   . LYS C 1 85  ? 20.672  3.188   52.401 1.00 12.22 ? 535  LYS C C   1 
ATOM   1578 O O   . LYS C 1 85  ? 21.444  4.065   52.797 1.00 13.68 ? 535  LYS C O   1 
ATOM   1579 C CB  . LYS C 1 85  ? 19.405  3.331   54.576 1.00 11.72 ? 535  LYS C CB  1 
ATOM   1580 C CG  . LYS C 1 85  ? 18.088  3.215   55.300 1.00 12.45 ? 535  LYS C CG  1 
ATOM   1581 C CD  . LYS C 1 85  ? 16.977  3.944   54.579 1.00 14.88 ? 535  LYS C CD  1 
ATOM   1582 C CE  . LYS C 1 85  ? 15.687  3.912   55.385 1.00 16.82 ? 535  LYS C CE  1 
ATOM   1583 N NZ  . LYS C 1 85  ? 14.513  4.329   54.566 1.00 13.78 ? 535  LYS C NZ  1 
ATOM   1584 N N   . GLN C 1 86  ? 20.982  2.399   51.379 1.00 12.85 ? 536  GLN C N   1 
ATOM   1585 C CA  . GLN C 1 86  ? 22.187  2.660   50.608 1.00 12.86 ? 536  GLN C CA  1 
ATOM   1586 C C   . GLN C 1 86  ? 22.056  3.994   49.886 1.00 12.28 ? 536  GLN C C   1 
ATOM   1587 O O   . GLN C 1 86  ? 20.975  4.367   49.419 1.00 11.91 ? 536  GLN C O   1 
ATOM   1588 C CB  . GLN C 1 86  ? 22.464  1.508   49.643 1.00 16.60 ? 536  GLN C CB  1 
ATOM   1589 C CG  . GLN C 1 86  ? 22.996  0.282   50.389 1.00 21.04 ? 536  GLN C CG  1 
ATOM   1590 C CD  . GLN C 1 86  ? 23.095  -0.961  49.529 1.00 31.32 ? 536  GLN C CD  1 
ATOM   1591 O OE1 . GLN C 1 86  ? 23.315  -0.883  48.321 1.00 34.38 ? 536  GLN C OE1 1 
ATOM   1592 N NE2 . GLN C 1 86  ? 22.935  -2.124  50.156 1.00 36.26 ? 536  GLN C NE2 1 
ATOM   1593 N N   . VAL C 1 87  ? 23.164  4.735   49.830 1.00 12.79 ? 537  VAL C N   1 
ATOM   1594 C CA  . VAL C 1 87  ? 23.130  6.078   49.272 1.00 12.22 ? 537  VAL C CA  1 
ATOM   1595 C C   . VAL C 1 87  ? 22.818  6.031   47.779 1.00 12.37 ? 537  VAL C C   1 
ATOM   1596 O O   . VAL C 1 87  ? 23.168  5.077   47.073 1.00 12.59 ? 537  VAL C O   1 
ATOM   1597 C CB  . VAL C 1 87  ? 24.447  6.827   49.554 1.00 13.16 ? 537  VAL C CB  1 
ATOM   1598 C CG1 . VAL C 1 87  ? 24.662  6.977   51.058 1.00 14.61 ? 537  VAL C CG1 1 
ATOM   1599 C CG2 . VAL C 1 87  ? 25.624  6.114   48.904 1.00 15.43 ? 537  VAL C CG2 1 
ATOM   1600 N N   . ILE C 1 88  ? 22.151  7.082   47.293 1.00 11.90 ? 538  ILE C N   1 
ATOM   1601 C CA  . ILE C 1 88  ? 21.827  7.177   45.869 1.00 11.87 ? 538  ILE C CA  1 
ATOM   1602 C C   . ILE C 1 88  ? 23.107  7.222   45.044 1.00 12.71 ? 538  ILE C C   1 
ATOM   1603 O O   . ILE C 1 88  ? 23.256  6.498   44.054 1.00 12.73 ? 538  ILE C O   1 
ATOM   1604 C CB  . ILE C 1 88  ? 20.929  8.400   45.598 1.00 12.47 ? 538  ILE C CB  1 
ATOM   1605 C CG1 . ILE C 1 88  ? 19.607  8.301   46.362 1.00 11.77 ? 538  ILE C CG1 1 
ATOM   1606 C CG2 . ILE C 1 88  ? 20.664  8.553   44.102 1.00 12.73 ? 538  ILE C CG2 1 
ATOM   1607 C CD1 . ILE C 1 88  ? 18.838  7.023   46.139 1.00 13.03 ? 538  ILE C CD1 1 
ATOM   1608 N N   . THR C 1 89  ? 24.053  8.074   45.444 1.00 13.57 ? 539  THR C N   1 
ATOM   1609 C CA  . THR C 1 89  ? 25.397  8.076   44.883 1.00 14.67 ? 539  THR C CA  1 
ATOM   1610 C C   . THR C 1 89  ? 26.378  8.293   46.026 1.00 16.58 ? 539  THR C C   1 
ATOM   1611 O O   . THR C 1 89  ? 26.026  8.862   47.062 1.00 14.46 ? 539  THR C O   1 
ATOM   1612 C CB  . THR C 1 89  ? 25.614  9.202   43.858 1.00 15.53 ? 539  THR C CB  1 
ATOM   1613 O OG1 . THR C 1 89  ? 25.521  10.471  44.513 1.00 16.69 ? 539  THR C OG1 1 
ATOM   1614 C CG2 . THR C 1 89  ? 24.586  9.137   42.721 1.00 15.23 ? 539  THR C CG2 1 
ATOM   1615 N N   . LYS C 1 90  ? 27.623  7.848   45.820 1.00 20.32 ? 540  LYS C N   1 
ATOM   1616 C CA  . LYS C 1 90  ? 28.674  8.071   46.813 1.00 20.61 ? 540  LYS C CA  1 
ATOM   1617 C C   . LYS C 1 90  ? 28.880  9.555   47.074 1.00 20.39 ? 540  LYS C C   1 
ATOM   1618 O O   . LYS C 1 90  ? 29.002  9.984   48.227 1.00 20.95 ? 540  LYS C O   1 
ATOM   1619 C CB  . LYS C 1 90  ? 29.994  7.474   46.328 1.00 29.87 ? 540  LYS C CB  1 
ATOM   1620 C CG  . LYS C 1 90  ? 30.028  5.969   46.260 1.00 33.69 ? 540  LYS C CG  1 
ATOM   1621 C CD  . LYS C 1 90  ? 29.520  5.336   47.546 1.00 35.59 ? 540  LYS C CD  1 
ATOM   1622 C CE  . LYS C 1 90  ? 29.346  3.841   47.381 1.00 35.40 ? 540  LYS C CE  1 
ATOM   1623 N NZ  . LYS C 1 90  ? 30.647  3.132   47.394 1.00 38.13 ? 540  LYS C NZ  1 
ATOM   1624 N N   . LYS C 1 91  ? 28.969  10.347  46.003 1.00 20.24 ? 541  LYS C N   1 
ATOM   1625 C CA  . LYS C 1 91  ? 29.260  11.769  46.152 1.00 22.56 ? 541  LYS C CA  1 
ATOM   1626 C C   . LYS C 1 91  ? 28.149  12.484  46.907 1.00 18.94 ? 541  LYS C C   1 
ATOM   1627 O O   . LYS C 1 91  ? 28.422  13.322  47.776 1.00 20.86 ? 541  LYS C O   1 
ATOM   1628 C CB  . LYS C 1 91  ? 29.470  12.417  44.783 1.00 27.09 ? 541  LYS C CB  1 
ATOM   1629 C CG  . LYS C 1 91  ? 29.787  13.904  44.879 1.00 31.62 ? 541  LYS C CG  1 
ATOM   1630 C CD  . LYS C 1 91  ? 29.729  14.612  43.538 1.00 38.27 ? 541  LYS C CD  1 
ATOM   1631 C CE  . LYS C 1 91  ? 29.939  16.109  43.727 1.00 42.88 ? 541  LYS C CE  1 
ATOM   1632 N NZ  . LYS C 1 91  ? 29.751  16.887  42.472 1.00 46.91 ? 541  LYS C NZ  1 
ATOM   1633 N N   . SER C 1 92  ? 26.887  12.162  46.599 1.00 17.95 ? 542  SER C N   1 
ATOM   1634 C CA  . SER C 1 92  ? 25.782  12.886  47.220 1.00 17.66 ? 542  SER C CA  1 
ATOM   1635 C C   . SER C 1 92  ? 25.503  12.414  48.640 1.00 18.55 ? 542  SER C C   1 
ATOM   1636 O O   . SER C 1 92  ? 25.112  13.224  49.486 1.00 18.91 ? 542  SER C O   1 
ATOM   1637 C CB  . SER C 1 92  ? 24.513  12.772  46.374 1.00 16.10 ? 542  SER C CB  1 
ATOM   1638 O OG  . SER C 1 92  ? 23.959  11.472  46.478 1.00 14.42 ? 542  SER C OG  1 
ATOM   1639 N N   . GLY C 1 93  ? 25.677  11.122  48.914 1.00 15.07 ? 543  GLY C N   1 
ATOM   1640 C CA  . GLY C 1 93  ? 25.324  10.571  50.212 1.00 16.21 ? 543  GLY C CA  1 
ATOM   1641 C C   . GLY C 1 93  ? 23.843  10.584  50.524 1.00 15.37 ? 543  GLY C C   1 
ATOM   1642 O O   . GLY C 1 93  ? 23.468  10.401  51.685 1.00 16.15 ? 543  GLY C O   1 
ATOM   1643 N N   . VAL C 1 94  ? 22.985  10.772  49.525 1.00 13.23 ? 544  VAL C N   1 
ATOM   1644 C CA  . VAL C 1 94  ? 21.563  10.972  49.774 1.00 12.82 ? 544  VAL C CA  1 
ATOM   1645 C C   . VAL C 1 94  ? 20.888  9.657   50.147 1.00 12.68 ? 544  VAL C C   1 
ATOM   1646 O O   . VAL C 1 94  ? 21.131  8.613   49.527 1.00 13.38 ? 544  VAL C O   1 
ATOM   1647 C CB  . VAL C 1 94  ? 20.914  11.624  48.546 1.00 14.45 ? 544  VAL C CB  1 
ATOM   1648 C CG1 . VAL C 1 94  ? 19.407  11.552  48.651 1.00 16.93 ? 544  VAL C CG1 1 
ATOM   1649 C CG2 . VAL C 1 94  ? 21.398  13.061  48.420 1.00 17.61 ? 544  VAL C CG2 1 
ATOM   1650 N N   . VAL C 1 95  ? 20.019  9.713   51.160 1.00 14.15 ? 545  VAL C N   1 
ATOM   1651 C CA  . VAL C 1 95  ? 19.313  8.552   51.695 1.00 14.81 ? 545  VAL C CA  1 
ATOM   1652 C C   . VAL C 1 95  ? 17.812  8.809   51.607 1.00 14.32 ? 545  VAL C C   1 
ATOM   1653 O O   . VAL C 1 95  ? 17.345  9.899   51.961 1.00 14.38 ? 545  VAL C O   1 
ATOM   1654 C CB  . VAL C 1 95  ? 19.732  8.288   53.151 1.00 17.94 ? 545  VAL C CB  1 
ATOM   1655 C CG1 . VAL C 1 95  ? 18.865  7.196   53.783 1.00 17.88 ? 545  VAL C CG1 1 
ATOM   1656 C CG2 . VAL C 1 95  ? 21.191  7.919   53.189 1.00 16.98 ? 545  VAL C CG2 1 
ATOM   1657 N N   . LEU C 1 96  ? 17.059  7.812   51.131 1.00 13.50 ? 546  LEU C N   1 
ATOM   1658 C CA  . LEU C 1 96  ? 15.610  7.937   51.021 1.00 12.91 ? 546  LEU C CA  1 
ATOM   1659 C C   . LEU C 1 96  ? 14.957  7.582   52.350 1.00 12.90 ? 546  LEU C C   1 
ATOM   1660 O O   . LEU C 1 96  ? 15.207  6.505   52.900 1.00 15.16 ? 546  LEU C O   1 
ATOM   1661 C CB  . LEU C 1 96  ? 15.087  7.002   49.930 1.00 12.87 ? 546  LEU C CB  1 
ATOM   1662 C CG  . LEU C 1 96  ? 15.704  7.197   48.545 1.00 10.86 ? 546  LEU C CG  1 
ATOM   1663 C CD1 . LEU C 1 96  ? 14.975  6.348   47.533 1.00 12.42 ? 546  LEU C CD1 1 
ATOM   1664 C CD2 . LEU C 1 96  ? 15.668  8.667   48.125 1.00 13.02 ? 546  LEU C CD2 1 
ATOM   1665 N N   . LEU C 1 97  ? 14.102  8.473   52.858 1.00 14.24 ? 547  LEU C N   1 
ATOM   1666 C CA  . LEU C 1 97  ? 13.436  8.244   54.139 1.00 16.43 ? 547  LEU C CA  1 
ATOM   1667 C C   . LEU C 1 97  ? 11.918  8.294   54.072 1.00 17.20 ? 547  LEU C C   1 
ATOM   1668 O O   . LEU C 1 97  ? 11.257  7.471   54.711 1.00 20.18 ? 547  LEU C O   1 
ATOM   1669 C CB  . LEU C 1 97  ? 13.925  9.233   55.215 1.00 17.83 ? 547  LEU C CB  1 
ATOM   1670 C CG  . LEU C 1 97  ? 15.392  9.215   55.644 1.00 16.08 ? 547  LEU C CG  1 
ATOM   1671 C CD1 . LEU C 1 97  ? 15.642  10.281  56.707 1.00 18.24 ? 547  LEU C CD1 1 
ATOM   1672 C CD2 . LEU C 1 97  ? 15.796  7.848   56.170 1.00 18.61 ? 547  LEU C CD2 1 
ATOM   1673 N N   . ASN C 1 98  ? 11.340  9.244   53.342 1.00 17.03 ? 548  ASN C N   1 
ATOM   1674 C CA  . ASN C 1 98  ? 9.897   9.491   53.379 1.00 18.80 ? 548  ASN C CA  1 
ATOM   1675 C C   . ASN C 1 98  ? 9.344   9.622   51.968 1.00 17.36 ? 548  ASN C C   1 
ATOM   1676 O O   . ASN C 1 98  ? 9.587   10.654  51.310 1.00 16.61 ? 548  ASN C O   1 
ATOM   1677 C CB  . ASN C 1 98  ? 9.586   10.770  54.154 1.00 22.76 ? 548  ASN C CB  1 
ATOM   1678 C CG  . ASN C 1 98  ? 10.498  10.976  55.344 1.00 31.31 ? 548  ASN C CG  1 
ATOM   1679 O OD1 . ASN C 1 98  ? 11.287  11.923  55.380 1.00 33.28 ? 548  ASN C OD1 1 
ATOM   1680 N ND2 . ASN C 1 98  ? 10.388  10.097  56.330 1.00 30.46 ? 548  ASN C ND2 1 
ATOM   1681 N N   . PRO C 1 99  ? 8.576   8.651   51.476 1.00 15.64 ? 549  PRO C N   1 
ATOM   1682 C CA  . PRO C 1 99  ? 7.926   8.821   50.167 1.00 14.94 ? 549  PRO C CA  1 
ATOM   1683 C C   . PRO C 1 99  ? 6.808   9.849   50.269 1.00 18.37 ? 549  PRO C C   1 
ATOM   1684 O O   . PRO C 1 99  ? 5.924   9.740   51.122 1.00 21.60 ? 549  PRO C O   1 
ATOM   1685 C CB  . PRO C 1 99  ? 7.371   7.425   49.865 1.00 16.08 ? 549  PRO C CB  1 
ATOM   1686 C CG  . PRO C 1 99  ? 7.145   6.820   51.230 1.00 19.07 ? 549  PRO C CG  1 
ATOM   1687 C CD  . PRO C 1 99  ? 8.248   7.358   52.101 1.00 18.26 ? 549  PRO C CD  1 
ATOM   1688 N N   . ILE C 1 100 ? 6.848   10.851  49.397 1.00 17.85 ? 550  ILE C N   1 
ATOM   1689 C CA  . ILE C 1 100 ? 5.869   11.930  49.398 1.00 20.47 ? 550  ILE C CA  1 
ATOM   1690 C C   . ILE C 1 100 ? 4.699   11.512  48.513 1.00 21.70 ? 550  ILE C C   1 
ATOM   1691 O O   . ILE C 1 100 ? 4.900   11.298  47.306 1.00 21.26 ? 550  ILE C O   1 
ATOM   1692 C CB  . ILE C 1 100 ? 6.484   13.247  48.912 1.00 20.72 ? 550  ILE C CB  1 
ATOM   1693 C CG1 . ILE C 1 100 ? 7.584   13.689  49.873 1.00 21.26 ? 550  ILE C CG1 1 
ATOM   1694 C CG2 . ILE C 1 100 ? 5.414   14.324  48.805 1.00 23.32 ? 550  ILE C CG2 1 
ATOM   1695 C CD1 . ILE C 1 100 ? 7.097   13.853  51.302 1.00 23.50 ? 550  ILE C CD1 1 
ATOM   1696 N N   . PRO C 1 101 ? 3.490   11.390  49.050 1.00 23.52 ? 551  PRO C N   1 
ATOM   1697 C CA  . PRO C 1 101 ? 2.353   10.946  48.242 1.00 27.45 ? 551  PRO C CA  1 
ATOM   1698 C C   . PRO C 1 101 ? 1.838   12.058  47.342 1.00 27.15 ? 551  PRO C C   1 
ATOM   1699 O O   . PRO C 1 101 ? 2.152   13.238  47.510 1.00 31.27 ? 551  PRO C O   1 
ATOM   1700 C CB  . PRO C 1 101 ? 1.307   10.576  49.299 1.00 32.37 ? 551  PRO C CB  1 
ATOM   1701 C CG  . PRO C 1 101 ? 1.616   11.485  50.441 1.00 34.02 ? 551  PRO C CG  1 
ATOM   1702 C CD  . PRO C 1 101 ? 3.109   11.667  50.447 1.00 30.69 ? 551  PRO C CD  1 
ATOM   1703 N N   . LYS C 1 102 ? 1.032   11.652  46.369 1.00 36.91 ? 552  LYS C N   1 
ATOM   1704 C CA  . LYS C 1 102 ? 0.479   12.581  45.396 1.00 40.86 ? 552  LYS C CA  1 
ATOM   1705 C C   . LYS C 1 102 ? -0.501  13.564  46.037 1.00 43.21 ? 552  LYS C C   1 
ATOM   1706 O O   . LYS C 1 102 ? -1.474  13.165  46.677 1.00 43.64 ? 552  LYS C O   1 
ATOM   1707 C CB  . LYS C 1 102 ? -0.221  11.806  44.275 1.00 45.33 ? 552  LYS C CB  1 
ATOM   1708 C CG  . LYS C 1 102 ? 0.719   10.934  43.440 1.00 45.41 ? 552  LYS C CG  1 
ATOM   1709 C CD  . LYS C 1 102 ? -0.073  10.020  42.504 1.00 46.16 ? 552  LYS C CD  1 
ATOM   1710 C CE  . LYS C 1 102 ? 0.003   8.566   42.949 1.00 43.27 ? 552  LYS C CE  1 
ATOM   1711 N NZ  . LYS C 1 102 ? 0.874   7.764   42.046 1.00 42.55 ? 552  LYS C NZ  1 
ATOM   1712 N N   . ASP D 2 1   ? 18.224  23.491  34.208 1.00 53.11 ? 1    ASP D N   1 
ATOM   1713 C CA  . ASP D 2 1   ? 18.144  23.072  35.603 1.00 51.68 ? 1    ASP D CA  1 
ATOM   1714 C C   . ASP D 2 1   ? 19.161  21.974  35.901 1.00 46.15 ? 1    ASP D C   1 
ATOM   1715 O O   . ASP D 2 1   ? 19.437  21.125  35.053 1.00 49.17 ? 1    ASP D O   1 
ATOM   1716 C CB  . ASP D 2 1   ? 16.734  22.591  35.935 1.00 54.82 ? 1    ASP D CB  1 
ATOM   1717 C CG  . ASP D 2 1   ? 15.698  23.687  35.809 1.00 57.59 ? 1    ASP D CG  1 
ATOM   1718 O OD1 . ASP D 2 1   ? 16.084  24.874  35.803 1.00 59.64 ? 1    ASP D OD1 1 
ATOM   1719 O OD2 . ASP D 2 1   ? 14.497  23.358  35.723 1.00 59.80 ? 1    ASP D OD2 1 
ATOM   1720 N N   . GLU D 2 2   ? 19.708  21.988  37.112 1.00 34.85 ? 2    GLU D N   1 
ATOM   1721 C CA  . GLU D 2 2   ? 20.795  21.082  37.465 1.00 27.03 ? 2    GLU D CA  1 
ATOM   1722 C C   . GLU D 2 2   ? 20.337  19.696  37.935 1.00 19.78 ? 2    GLU D C   1 
ATOM   1723 O O   . GLU D 2 2   ? 19.449  19.560  38.779 1.00 17.39 ? 2    GLU D O   1 
ATOM   1724 C CB  . GLU D 2 2   ? 21.715  21.714  38.514 1.00 34.06 ? 2    GLU D CB  1 
ATOM   1725 C CG  . GLU D 2 2   ? 22.848  20.808  38.963 1.00 47.28 ? 2    GLU D CG  1 
ATOM   1726 C CD  . GLU D 2 2   ? 23.789  21.489  39.933 1.00 59.17 ? 2    GLU D CD  1 
ATOM   1727 O OE1 . GLU D 2 2   ? 23.524  22.653  40.299 1.00 63.11 ? 2    GLU D OE1 1 
ATOM   1728 O OE2 . GLU D 2 2   ? 24.794  20.861  40.329 1.00 62.48 ? 2    GLU D OE2 1 
HETATM 1729 N N   . PTR D 2 3   ? 20.962  18.677  37.361 1.00 14.15 ? 3    PTR D N   1 
HETATM 1730 C CA  . PTR D 2 3   ? 20.788  17.305  37.817 1.00 14.50 ? 3    PTR D CA  1 
HETATM 1731 C C   . PTR D 2 3   ? 22.104  16.826  38.428 1.00 17.25 ? 3    PTR D C   1 
HETATM 1732 O O   . PTR D 2 3   ? 23.173  17.114  37.887 1.00 19.16 ? 3    PTR D O   1 
HETATM 1733 C CB  . PTR D 2 3   ? 20.357  16.418  36.646 1.00 15.45 ? 3    PTR D CB  1 
HETATM 1734 C CG  . PTR D 2 3   ? 18.926  16.620  36.176 1.00 13.16 ? 3    PTR D CG  1 
HETATM 1735 C CD1 . PTR D 2 3   ? 17.853  16.170  36.931 1.00 13.12 ? 3    PTR D CD1 1 
HETATM 1736 C CD2 . PTR D 2 3   ? 18.650  17.244  34.961 1.00 13.88 ? 3    PTR D CD2 1 
HETATM 1737 C CE1 . PTR D 2 3   ? 16.548  16.334  36.505 1.00 12.38 ? 3    PTR D CE1 1 
HETATM 1738 C CE2 . PTR D 2 3   ? 17.343  17.410  34.520 1.00 16.18 ? 3    PTR D CE2 1 
HETATM 1739 C CZ  . PTR D 2 3   ? 16.293  16.958  35.299 1.00 12.98 ? 3    PTR D CZ  1 
HETATM 1740 O OH  . PTR D 2 3   ? 15.048  17.094  34.890 1.00 12.53 ? 3    PTR D OH  1 
HETATM 1741 P P   . PTR D 2 3   ? 14.192  18.455  35.082 1.00 12.08 ? 3    PTR D P   1 
HETATM 1742 O O1P . PTR D 2 3   ? 14.757  19.520  34.142 1.00 15.75 ? 3    PTR D O1P 1 
HETATM 1743 O O2P . PTR D 2 3   ? 12.748  18.095  34.683 1.00 13.25 ? 3    PTR D O2P 1 
HETATM 1744 O O3P . PTR D 2 3   ? 14.287  18.858  36.512 1.00 13.11 ? 3    PTR D O3P 1 
ATOM   1745 N N   . GLU D 2 4   ? 22.019  16.113  39.551 1.00 16.11 ? 4    GLU D N   1 
ATOM   1746 C CA  . GLU D 2 4   ? 23.194  15.609  40.265 1.00 18.60 ? 4    GLU D CA  1 
ATOM   1747 C C   . GLU D 2 4   ? 23.984  14.630  39.416 1.00 20.71 ? 4    GLU D C   1 
ATOM   1748 O O   . GLU D 2 4   ? 23.406  13.856  38.654 1.00 20.57 ? 4    GLU D O   1 
ATOM   1749 C CB  . GLU D 2 4   ? 22.767  14.892  41.544 1.00 21.64 ? 4    GLU D CB  1 
ATOM   1750 C CG  . GLU D 2 4   ? 21.928  15.721  42.499 1.00 26.69 ? 4    GLU D CG  1 
ATOM   1751 C CD  . GLU D 2 4   ? 22.715  16.837  43.150 1.00 33.48 ? 4    GLU D CD  1 
ATOM   1752 O OE1 . GLU D 2 4   ? 22.337  18.014  42.976 1.00 35.72 ? 4    GLU D OE1 1 
ATOM   1753 O OE2 . GLU D 2 4   ? 23.716  16.535  43.833 1.00 35.03 ? 4    GLU D OE2 1 
ATOM   1754 N N   . ASN D 2 5   ? 25.308  14.628  39.562 1.00 18.46 ? 5    ASN D N   1 
ATOM   1755 C CA  . ASN D 2 5   ? 26.121  13.708  38.777 1.00 25.44 ? 5    ASN D CA  1 
ATOM   1756 C C   . ASN D 2 5   ? 25.890  12.268  39.217 1.00 29.89 ? 5    ASN D C   1 
ATOM   1757 O O   . ASN D 2 5   ? 25.942  11.951  40.410 1.00 29.73 ? 5    ASN D O   1 
ATOM   1758 C CB  . ASN D 2 5   ? 27.605  14.043  38.895 1.00 34.86 ? 5    ASN D CB  1 
ATOM   1759 C CG  . ASN D 2 5   ? 28.476  13.068  38.120 1.00 45.06 ? 5    ASN D CG  1 
ATOM   1760 O OD1 . ASN D 2 5   ? 28.639  13.196  36.906 1.00 51.63 ? 5    ASN D OD1 1 
ATOM   1761 N ND2 . ASN D 2 5   ? 29.025  12.078  38.816 1.00 45.63 ? 5    ASN D ND2 1 
ATOM   1762 N N   . VAL D 2 6   ? 25.640  11.397  38.246 1.00 25.25 ? 6    VAL D N   1 
ATOM   1763 C CA  . VAL D 2 6   ? 25.550  9.960   38.466 1.00 23.72 ? 6    VAL D CA  1 
ATOM   1764 C C   . VAL D 2 6   ? 26.657  9.320   37.639 1.00 31.96 ? 6    VAL D C   1 
ATOM   1765 O O   . VAL D 2 6   ? 26.597  9.324   36.402 1.00 31.15 ? 6    VAL D O   1 
ATOM   1766 C CB  . VAL D 2 6   ? 24.173  9.408   38.077 1.00 20.10 ? 6    VAL D CB  1 
ATOM   1767 C CG1 . VAL D 2 6   ? 24.124  7.907   38.309 1.00 18.08 ? 6    VAL D CG1 1 
ATOM   1768 C CG2 . VAL D 2 6   ? 23.080  10.119  38.863 1.00 17.95 ? 6    VAL D CG2 1 
ATOM   1769 N N   . ASP D 2 7   ? 27.675  8.790   38.314 1.00 40.81 ? 7    ASP D N   1 
ATOM   1770 C CA  . ASP D 2 7   ? 28.811  8.170   37.633 1.00 47.75 ? 7    ASP D CA  1 
ATOM   1771 C C   . ASP D 2 7   ? 28.374  6.973   36.797 1.00 50.97 ? 7    ASP D C   1 
ATOM   1772 O O   . ASP D 2 7   ? 27.494  6.211   37.198 1.00 52.03 ? 7    ASP D O   1 
ATOM   1773 C CB  . ASP D 2 7   ? 29.879  7.733   38.639 1.00 49.56 ? 7    ASP D CB  1 
ATOM   1774 C CG  . ASP D 2 7   ? 30.627  8.904   39.245 1.00 52.41 ? 7    ASP D CG  1 
ATOM   1775 O OD1 . ASP D 2 7   ? 30.577  10.009  38.665 1.00 54.45 ? 7    ASP D OD1 1 
ATOM   1776 O OD2 . ASP D 2 7   ? 31.274  8.715   40.297 1.00 52.65 ? 7    ASP D OD2 1 
ATOM   1777 O OXT . ASP D 2 7   ? 28.894  6.741   35.705 1.00 51.92 ? 7    ASP D OXT 1 
ATOM   1778 N N   . SER E 1 2   ? -0.584  29.467  43.470 1.00 46.99 ? 452  SER E N   1 
ATOM   1779 C CA  . SER E 1 2   ? -1.274  28.786  42.380 1.00 44.39 ? 452  SER E CA  1 
ATOM   1780 C C   . SER E 1 2   ? -1.456  27.302  42.664 1.00 42.28 ? 452  SER E C   1 
ATOM   1781 O O   . SER E 1 2   ? -0.573  26.653  43.229 1.00 44.04 ? 452  SER E O   1 
ATOM   1782 C CB  . SER E 1 2   ? -0.508  28.958  41.065 1.00 45.00 ? 452  SER E CB  1 
ATOM   1783 O OG  . SER E 1 2   ? -0.640  30.273  40.556 1.00 47.00 ? 452  SER E OG  1 
ATOM   1784 N N   . LYS E 1 3   ? -2.612  26.769  42.267 1.00 37.95 ? 453  LYS E N   1 
ATOM   1785 C CA  . LYS E 1 3   ? -2.808  25.332  42.276 1.00 32.03 ? 453  LYS E CA  1 
ATOM   1786 C C   . LYS E 1 3   ? -1.829  24.692  41.295 1.00 25.91 ? 453  LYS E C   1 
ATOM   1787 O O   . LYS E 1 3   ? -1.325  25.356  40.385 1.00 25.72 ? 453  LYS E O   1 
ATOM   1788 C CB  . LYS E 1 3   ? -4.238  24.999  41.856 1.00 32.83 ? 453  LYS E CB  1 
ATOM   1789 C CG  . LYS E 1 3   ? -5.301  25.564  42.775 1.00 36.96 ? 453  LYS E CG  1 
ATOM   1790 C CD  . LYS E 1 3   ? -6.694  25.288  42.241 1.00 40.81 ? 453  LYS E CD  1 
ATOM   1791 C CE  . LYS E 1 3   ? -7.679  26.309  42.779 1.00 48.41 ? 453  LYS E CE  1 
ATOM   1792 N NZ  . LYS E 1 3   ? -7.423  26.603  44.218 1.00 54.36 ? 453  LYS E NZ  1 
ATOM   1793 N N   . PRO E 1 4   ? -1.529  23.406  41.466 1.00 25.03 ? 454  PRO E N   1 
ATOM   1794 C CA  . PRO E 1 4   ? -0.666  22.723  40.497 1.00 22.08 ? 454  PRO E CA  1 
ATOM   1795 C C   . PRO E 1 4   ? -1.256  22.766  39.094 1.00 20.54 ? 454  PRO E C   1 
ATOM   1796 O O   . PRO E 1 4   ? -2.464  22.926  38.898 1.00 19.51 ? 454  PRO E O   1 
ATOM   1797 C CB  . PRO E 1 4   ? -0.602  21.286  41.027 1.00 27.05 ? 454  PRO E CB  1 
ATOM   1798 C CG  . PRO E 1 4   ? -0.871  21.421  42.497 1.00 31.86 ? 454  PRO E CG  1 
ATOM   1799 C CD  . PRO E 1 4   ? -1.859  22.545  42.617 1.00 27.85 ? 454  PRO E CD  1 
ATOM   1800 N N   . LEU E 1 5   ? -0.366  22.617  38.108 1.00 18.88 ? 455  LEU E N   1 
ATOM   1801 C CA  . LEU E 1 5   ? -0.776  22.651  36.707 1.00 20.48 ? 455  LEU E CA  1 
ATOM   1802 C C   . LEU E 1 5   ? -1.908  21.674  36.433 1.00 21.56 ? 455  LEU E C   1 
ATOM   1803 O O   . LEU E 1 5   ? -2.871  22.008  35.732 1.00 21.13 ? 455  LEU E O   1 
ATOM   1804 C CB  . LEU E 1 5   ? 0.413   22.290  35.821 1.00 25.48 ? 455  LEU E CB  1 
ATOM   1805 C CG  . LEU E 1 5   ? 1.082   23.364  34.973 1.00 24.67 ? 455  LEU E CG  1 
ATOM   1806 C CD1 . LEU E 1 5   ? 2.153   22.699  34.125 1.00 21.07 ? 455  LEU E CD1 1 
ATOM   1807 C CD2 . LEU E 1 5   ? 0.065   24.119  34.109 1.00 16.72 ? 455  LEU E CD2 1 
ATOM   1808 N N   . ALA E 1 6   ? -1.808  20.461  36.981 1.00 18.36 ? 456  ALA E N   1 
ATOM   1809 C CA  . ALA E 1 6   ? -2.776  19.406  36.699 1.00 24.27 ? 456  ALA E CA  1 
ATOM   1810 C C   . ALA E 1 6   ? -4.182  19.739  37.177 1.00 26.01 ? 456  ALA E C   1 
ATOM   1811 O O   . ALA E 1 6   ? -5.127  19.034  36.805 1.00 28.57 ? 456  ALA E O   1 
ATOM   1812 C CB  . ALA E 1 6   ? -2.317  18.085  37.323 1.00 25.35 ? 456  ALA E CB  1 
ATOM   1813 N N   . GLU E 1 7   ? -4.349  20.780  37.987 1.00 22.71 ? 457  GLU E N   1 
ATOM   1814 C CA  . GLU E 1 7   ? -5.655  21.186  38.483 1.00 24.51 ? 457  GLU E CA  1 
ATOM   1815 C C   . GLU E 1 7   ? -6.225  22.390  37.743 1.00 21.42 ? 457  GLU E C   1 
ATOM   1816 O O   . GLU E 1 7   ? -7.360  22.791  38.019 1.00 25.93 ? 457  GLU E O   1 
ATOM   1817 C CB  . GLU E 1 7   ? -5.581  21.465  39.989 1.00 27.78 ? 457  GLU E CB  1 
ATOM   1818 C CG  . GLU E 1 7   ? -5.260  20.222  40.804 1.00 33.36 ? 457  GLU E CG  1 
ATOM   1819 C CD  . GLU E 1 7   ? -5.125  20.493  42.289 1.00 38.42 ? 457  GLU E CD  1 
ATOM   1820 O OE1 . GLU E 1 7   ? -5.382  21.637  42.721 1.00 40.41 ? 457  GLU E OE1 1 
ATOM   1821 O OE2 . GLU E 1 7   ? -4.761  19.554  43.027 1.00 40.76 ? 457  GLU E OE2 1 
ATOM   1822 N N   . GLN E 1 8   ? -5.476  22.969  36.808 1.00 17.13 ? 458  GLN E N   1 
ATOM   1823 C CA  . GLN E 1 8   ? -5.950  24.128  36.065 1.00 17.72 ? 458  GLN E CA  1 
ATOM   1824 C C   . GLN E 1 8   ? -6.897  23.679  34.963 1.00 19.58 ? 458  GLN E C   1 
ATOM   1825 O O   . GLN E 1 8   ? -6.600  22.740  34.224 1.00 17.80 ? 458  GLN E O   1 
ATOM   1826 C CB  . GLN E 1 8   ? -4.766  24.863  35.435 1.00 17.91 ? 458  GLN E CB  1 
ATOM   1827 C CG  . GLN E 1 8   ? -3.696  25.279  36.426 1.00 17.96 ? 458  GLN E CG  1 
ATOM   1828 C CD  . GLN E 1 8   ? -4.181  26.343  37.387 1.00 21.89 ? 458  GLN E CD  1 
ATOM   1829 O OE1 . GLN E 1 8   ? -5.112  27.088  37.087 1.00 24.37 ? 458  GLN E OE1 1 
ATOM   1830 N NE2 . GLN E 1 8   ? -3.555  26.414  38.555 1.00 22.85 ? 458  GLN E NE2 1 
ATOM   1831 N N   . ASP E 1 9   ? -8.036  24.368  34.843 1.00 21.08 ? 459  ASP E N   1 
ATOM   1832 C CA  . ASP E 1 9   ? -9.045  23.953  33.872 1.00 24.91 ? 459  ASP E CA  1 
ATOM   1833 C C   . ASP E 1 9   ? -8.494  23.924  32.452 1.00 22.04 ? 459  ASP E C   1 
ATOM   1834 O O   . ASP E 1 9   ? -8.903  23.082  31.642 1.00 20.95 ? 459  ASP E O   1 
ATOM   1835 C CB  . ASP E 1 9   ? -10.262 24.879  33.936 1.00 30.62 ? 459  ASP E CB  1 
ATOM   1836 C CG  . ASP E 1 9   ? -10.862 24.970  35.328 1.00 40.99 ? 459  ASP E CG  1 
ATOM   1837 O OD1 . ASP E 1 9   ? -11.430 26.031  35.664 1.00 45.13 ? 459  ASP E OD1 1 
ATOM   1838 O OD2 . ASP E 1 9   ? -10.756 23.987  36.090 1.00 43.79 ? 459  ASP E OD2 1 
ATOM   1839 N N   . TRP E 1 10  ? -7.566  24.819  32.133 1.00 15.94 ? 460  TRP E N   1 
ATOM   1840 C CA  . TRP E 1 10  ? -7.045  24.955  30.782 1.00 15.01 ? 460  TRP E CA  1 
ATOM   1841 C C   . TRP E 1 10  ? -5.847  24.061  30.501 1.00 13.07 ? 460  TRP E C   1 
ATOM   1842 O O   . TRP E 1 10  ? -5.299  24.124  29.398 1.00 14.44 ? 460  TRP E O   1 
ATOM   1843 C CB  . TRP E 1 10  ? -6.675  26.417  30.497 1.00 16.41 ? 460  TRP E CB  1 
ATOM   1844 C CG  . TRP E 1 10  ? -6.010  27.106  31.659 1.00 15.29 ? 460  TRP E CG  1 
ATOM   1845 C CD1 . TRP E 1 10  ? -6.591  27.992  32.520 1.00 20.27 ? 460  TRP E CD1 1 
ATOM   1846 C CD2 . TRP E 1 10  ? -4.650  26.964  32.087 1.00 15.84 ? 460  TRP E CD2 1 
ATOM   1847 N NE1 . TRP E 1 10  ? -5.678  28.410  33.455 1.00 19.50 ? 460  TRP E NE1 1 
ATOM   1848 C CE2 . TRP E 1 10  ? -4.479  27.795  33.213 1.00 16.73 ? 460  TRP E CE2 1 
ATOM   1849 C CE3 . TRP E 1 10  ? -3.561  26.214  31.633 1.00 14.69 ? 460  TRP E CE3 1 
ATOM   1850 C CZ2 . TRP E 1 10  ? -3.268  27.898  33.888 1.00 17.47 ? 460  TRP E CZ2 1 
ATOM   1851 C CZ3 . TRP E 1 10  ? -2.359  26.317  32.305 1.00 13.65 ? 460  TRP E CZ3 1 
ATOM   1852 C CH2 . TRP E 1 10  ? -2.221  27.154  33.421 1.00 15.77 ? 460  TRP E CH2 1 
ATOM   1853 N N   . TYR E 1 11  ? -5.413  23.244  31.455 1.00 14.10 ? 461  TYR E N   1 
ATOM   1854 C CA  . TYR E 1 11  ? -4.264  22.373  31.234 1.00 12.84 ? 461  TYR E CA  1 
ATOM   1855 C C   . TYR E 1 11  ? -4.729  20.994  30.779 1.00 14.22 ? 461  TYR E C   1 
ATOM   1856 O O   . TYR E 1 11  ? -5.476  20.319  31.495 1.00 15.15 ? 461  TYR E O   1 
ATOM   1857 C CB  . TYR E 1 11  ? -3.409  22.264  32.494 1.00 16.01 ? 461  TYR E CB  1 
ATOM   1858 C CG  . TYR E 1 11  ? -2.240  21.332  32.316 1.00 14.07 ? 461  TYR E CG  1 
ATOM   1859 C CD1 . TYR E 1 11  ? -1.169  21.685  31.509 1.00 15.14 ? 461  TYR E CD1 1 
ATOM   1860 C CD2 . TYR E 1 11  ? -2.213  20.090  32.940 1.00 16.24 ? 461  TYR E CD2 1 
ATOM   1861 C CE1 . TYR E 1 11  ? -0.103  20.831  31.329 1.00 17.94 ? 461  TYR E CE1 1 
ATOM   1862 C CE2 . TYR E 1 11  ? -1.142  19.227  32.767 1.00 17.08 ? 461  TYR E CE2 1 
ATOM   1863 C CZ  . TYR E 1 11  ? -0.092  19.608  31.961 1.00 16.42 ? 461  TYR E CZ  1 
ATOM   1864 O OH  . TYR E 1 11  ? 0.975   18.755  31.787 1.00 25.70 ? 461  TYR E OH  1 
ATOM   1865 N N   . HIS E 1 12  ? -4.284  20.578  29.594 1.00 11.53 ? 462  HIS E N   1 
ATOM   1866 C CA  . HIS E 1 12  ? -4.731  19.330  28.981 1.00 11.28 ? 462  HIS E CA  1 
ATOM   1867 C C   . HIS E 1 12  ? -3.648  18.268  28.911 1.00 11.92 ? 462  HIS E C   1 
ATOM   1868 O O   . HIS E 1 12  ? -3.826  17.273  28.204 1.00 13.00 ? 462  HIS E O   1 
ATOM   1869 C CB  . HIS E 1 12  ? -5.291  19.577  27.580 1.00 12.47 ? 462  HIS E CB  1 
ATOM   1870 C CG  . HIS E 1 12  ? -6.592  20.310  27.568 1.00 14.18 ? 462  HIS E CG  1 
ATOM   1871 N ND1 . HIS E 1 12  ? -7.737  19.784  27.007 1.00 15.76 ? 462  HIS E ND1 1 
ATOM   1872 C CD2 . HIS E 1 12  ? -6.931  21.529  28.049 1.00 13.69 ? 462  HIS E CD2 1 
ATOM   1873 C CE1 . HIS E 1 12  ? -8.725  20.652  27.141 1.00 16.88 ? 462  HIS E CE1 1 
ATOM   1874 N NE2 . HIS E 1 12  ? -8.262  21.719  27.767 1.00 14.13 ? 462  HIS E NE2 1 
ATOM   1875 N N   . GLY E 1 13  ? -2.527  18.455  29.596 1.00 11.49 ? 463  GLY E N   1 
ATOM   1876 C CA  . GLY E 1 13  ? -1.526  17.398  29.613 1.00 10.71 ? 463  GLY E CA  1 
ATOM   1877 C C   . GLY E 1 13  ? -0.958  17.139  28.231 1.00 11.45 ? 463  GLY E C   1 
ATOM   1878 O O   . GLY E 1 13  ? -0.715  18.060  27.450 1.00 12.30 ? 463  GLY E O   1 
ATOM   1879 N N   . ALA E 1 14  ? -0.772  15.863  27.899 1.00 11.28 ? 464  ALA E N   1 
ATOM   1880 C CA  . ALA E 1 14  ? -0.036  15.484  26.700 1.00 12.96 ? 464  ALA E CA  1 
ATOM   1881 C C   . ALA E 1 14  ? -0.924  15.308  25.472 1.00 12.53 ? 464  ALA E C   1 
ATOM   1882 O O   . ALA E 1 14  ? -0.577  14.520  24.582 1.00 13.39 ? 464  ALA E O   1 
ATOM   1883 C CB  . ALA E 1 14  ? 0.794   14.225  26.957 1.00 19.42 ? 464  ALA E CB  1 
ATOM   1884 N N   . ILE E 1 15  ? -2.048  16.013  25.386 1.00 12.03 ? 465  ILE E N   1 
ATOM   1885 C CA  . ILE E 1 15  ? -2.852  15.856  24.167 1.00 11.62 ? 465  ILE E CA  1 
ATOM   1886 C C   . ILE E 1 15  ? -2.043  16.319  22.965 1.00 11.66 ? 465  ILE E C   1 
ATOM   1887 O O   . ILE E 1 15  ? -1.284  17.309  23.068 1.00 13.12 ? 465  ILE E O   1 
ATOM   1888 C CB  . ILE E 1 15  ? -4.194  16.606  24.253 1.00 12.21 ? 465  ILE E CB  1 
ATOM   1889 C CG1 . ILE E 1 15  ? -3.996  18.127  24.344 1.00 12.73 ? 465  ILE E CG1 1 
ATOM   1890 C CG2 . ILE E 1 15  ? -5.058  16.048  25.384 1.00 14.04 ? 465  ILE E CG2 1 
ATOM   1891 C CD1 . ILE E 1 15  ? -5.262  18.903  23.984 1.00 13.93 ? 465  ILE E CD1 1 
ATOM   1892 N N   . PRO E 1 16  ? -2.140  15.649  21.823 1.00 12.29 ? 466  PRO E N   1 
ATOM   1893 C CA  . PRO E 1 16  ? -1.381  16.072  20.645 1.00 11.99 ? 466  PRO E CA  1 
ATOM   1894 C C   . PRO E 1 16  ? -2.016  17.278  19.970 1.00 12.07 ? 466  PRO E C   1 
ATOM   1895 O O   . PRO E 1 16  ? -3.173  17.630  20.210 1.00 10.75 ? 466  PRO E O   1 
ATOM   1896 C CB  . PRO E 1 16  ? -1.456  14.846  19.728 1.00 12.36 ? 466  PRO E CB  1 
ATOM   1897 C CG  . PRO E 1 16  ? -2.765  14.206  20.089 1.00 15.09 ? 466  PRO E CG  1 
ATOM   1898 C CD  . PRO E 1 16  ? -2.904  14.410  21.579 1.00 11.84 ? 466  PRO E CD  1 
ATOM   1899 N N   . ARG E 1 17  ? -1.218  17.900  19.102 1.00 11.15 ? 467  ARG E N   1 
ATOM   1900 C CA  . ARG E 1 17  ? -1.668  19.077  18.364 1.00 12.00 ? 467  ARG E CA  1 
ATOM   1901 C C   . ARG E 1 17  ? -3.032  18.869  17.714 1.00 11.20 ? 467  ARG E C   1 
ATOM   1902 O O   . ARG E 1 17  ? -3.892  19.755  17.770 1.00 12.03 ? 467  ARG E O   1 
ATOM   1903 C CB  . ARG E 1 17  ? -0.632  19.446  17.303 1.00 13.44 ? 467  ARG E CB  1 
ATOM   1904 C CG  . ARG E 1 17  ? -1.083  20.582  16.401 1.00 15.27 ? 467  ARG E CG  1 
ATOM   1905 C CD  . ARG E 1 17  ? -0.022  20.984  15.401 1.00 14.44 ? 467  ARG E CD  1 
ATOM   1906 N NE  . ARG E 1 17  ? 1.109   21.616  16.064 1.00 14.31 ? 467  ARG E NE  1 
ATOM   1907 C CZ  . ARG E 1 17  ? 1.725   22.703  15.610 1.00 13.46 ? 467  ARG E CZ  1 
ATOM   1908 N NH1 . ARG E 1 17  ? 1.318   23.300  14.493 1.00 15.22 ? 467  ARG E NH1 1 
ATOM   1909 N NH2 . ARG E 1 17  ? 2.749   23.193  16.289 1.00 14.34 ? 467  ARG E NH2 1 
ATOM   1910 N N   . ILE E 1 18  ? -3.255  17.702  17.100 1.00 10.98 ? 468  ILE E N   1 
ATOM   1911 C CA  . ILE E 1 18  ? -4.493  17.488  16.349 1.00 11.03 ? 468  ILE E CA  1 
ATOM   1912 C C   . ILE E 1 18  ? -5.704  17.549  17.272 1.00 11.88 ? 468  ILE E C   1 
ATOM   1913 O O   . ILE E 1 18  ? -6.779  18.020  16.878 1.00 13.72 ? 468  ILE E O   1 
ATOM   1914 C CB  . ILE E 1 18  ? -4.436  16.172  15.543 1.00 12.56 ? 468  ILE E CB  1 
ATOM   1915 C CG1 . ILE E 1 18  ? -5.667  16.044  14.638 1.00 14.88 ? 468  ILE E CG1 1 
ATOM   1916 C CG2 . ILE E 1 18  ? -4.327  14.940  16.462 1.00 12.84 ? 468  ILE E CG2 1 
ATOM   1917 C CD1 . ILE E 1 18  ? -5.833  17.170  13.632 1.00 17.98 ? 468  ILE E CD1 1 
ATOM   1918 N N   . GLU E 1 19  ? -5.556  17.065  18.510 1.00 11.19 ? 469  GLU E N   1 
ATOM   1919 C CA  . GLU E 1 19  ? -6.652  17.149  19.471 1.00 12.05 ? 469  GLU E CA  1 
ATOM   1920 C C   . GLU E 1 19  ? -6.867  18.580  19.942 1.00 14.19 ? 469  GLU E C   1 
ATOM   1921 O O   . GLU E 1 19  ? -8.011  19.010  20.136 1.00 14.30 ? 469  GLU E O   1 
ATOM   1922 C CB  . GLU E 1 19  ? -6.395  16.222  20.655 1.00 11.54 ? 469  GLU E CB  1 
ATOM   1923 C CG  . GLU E 1 19  ? -6.623  14.760  20.317 1.00 13.12 ? 469  GLU E CG  1 
ATOM   1924 C CD  . GLU E 1 19  ? -6.408  13.836  21.494 1.00 14.55 ? 469  GLU E CD  1 
ATOM   1925 O OE1 . GLU E 1 19  ? -6.089  12.659  21.251 1.00 15.03 ? 469  GLU E OE1 1 
ATOM   1926 O OE2 . GLU E 1 19  ? -6.557  14.274  22.654 1.00 14.92 ? 469  GLU E OE2 1 
ATOM   1927 N N   . ALA E 1 20  ? -5.783  19.338  20.128 1.00 13.03 ? 470  ALA E N   1 
ATOM   1928 C CA  . ALA E 1 20  ? -5.937  20.747  20.465 1.00 14.60 ? 470  ALA E CA  1 
ATOM   1929 C C   . ALA E 1 20  ? -6.659  21.483  19.349 1.00 18.35 ? 470  ALA E C   1 
ATOM   1930 O O   . ALA E 1 20  ? -7.501  22.350  19.610 1.00 18.31 ? 470  ALA E O   1 
ATOM   1931 C CB  . ALA E 1 20  ? -4.569  21.377  20.729 1.00 17.33 ? 470  ALA E CB  1 
ATOM   1932 N N   . GLN E 1 21  ? -6.359  21.128  18.096 1.00 22.76 ? 471  GLN E N   1 
ATOM   1933 C CA  . GLN E 1 21  ? -7.004  21.775  16.957 1.00 22.92 ? 471  GLN E CA  1 
ATOM   1934 C C   . GLN E 1 21  ? -8.514  21.651  17.034 1.00 23.97 ? 471  GLN E C   1 
ATOM   1935 O O   . GLN E 1 21  ? -9.238  22.616  16.766 1.00 26.97 ? 471  GLN E O   1 
ATOM   1936 C CB  . GLN E 1 21  ? -6.491  21.169  15.651 1.00 26.32 ? 471  GLN E CB  1 
ATOM   1937 C CG  . GLN E 1 21  ? -7.163  21.733  14.405 1.00 34.45 ? 471  GLN E CG  1 
ATOM   1938 C CD  . GLN E 1 21  ? -7.002  20.832  13.194 1.00 40.59 ? 471  GLN E CD  1 
ATOM   1939 O OE1 . GLN E 1 21  ? -5.885  20.535  12.768 1.00 46.57 ? 471  GLN E OE1 1 
ATOM   1940 N NE2 . GLN E 1 21  ? -8.122  20.384  12.637 1.00 45.05 ? 471  GLN E NE2 1 
ATOM   1941 N N   . GLU E 1 22  ? -9.015  20.478  17.401 1.00 27.28 ? 472  GLU E N   1 
ATOM   1942 C CA  . GLU E 1 22  ? -10.459 20.313  17.413 1.00 27.70 ? 472  GLU E CA  1 
ATOM   1943 C C   . GLU E 1 22  ? -11.114 20.943  18.630 1.00 29.24 ? 472  GLU E C   1 
ATOM   1944 O O   . GLU E 1 22  ? -12.326 21.170  18.613 1.00 33.87 ? 472  GLU E O   1 
ATOM   1945 C CB  . GLU E 1 22  ? -10.827 18.848  17.277 1.00 41.64 ? 472  GLU E CB  1 
ATOM   1946 C CG  . GLU E 1 22  ? -10.361 18.281  15.982 1.00 49.87 ? 472  GLU E CG  1 
ATOM   1947 C CD  . GLU E 1 22  ? -10.190 16.811  16.069 1.00 56.78 ? 472  GLU E CD  1 
ATOM   1948 O OE1 . GLU E 1 22  ? -11.095 16.142  16.587 1.00 60.21 ? 472  GLU E OE1 1 
ATOM   1949 O OE2 . GLU E 1 22  ? -9.134  16.341  15.635 1.00 60.86 ? 472  GLU E OE2 1 
ATOM   1950 N N   . LEU E 1 23  ? -10.348 21.244  19.675 1.00 22.77 ? 473  LEU E N   1 
ATOM   1951 C CA  . LEU E 1 23  ? -10.897 21.928  20.839 1.00 20.30 ? 473  LEU E CA  1 
ATOM   1952 C C   . LEU E 1 23  ? -10.906 23.446  20.703 1.00 22.91 ? 473  LEU E C   1 
ATOM   1953 O O   . LEU E 1 23  ? -11.629 24.116  21.448 1.00 24.21 ? 473  LEU E O   1 
ATOM   1954 C CB  . LEU E 1 23  ? -10.099 21.560  22.090 1.00 20.00 ? 473  LEU E CB  1 
ATOM   1955 C CG  . LEU E 1 23  ? -10.302 20.136  22.605 1.00 20.81 ? 473  LEU E CG  1 
ATOM   1956 C CD1 . LEU E 1 23  ? -9.232  19.794  23.621 1.00 21.19 ? 473  LEU E CD1 1 
ATOM   1957 C CD2 . LEU E 1 23  ? -11.691 19.979  23.217 1.00 23.61 ? 473  LEU E CD2 1 
ATOM   1958 N N   . LEU E 1 24  ? -10.130 24.005  19.783 1.00 20.02 ? 474  LEU E N   1 
ATOM   1959 C CA  . LEU E 1 24  ? -9.985  25.451  19.644 1.00 20.02 ? 474  LEU E CA  1 
ATOM   1960 C C   . LEU E 1 24  ? -10.789 25.902  18.430 1.00 20.82 ? 474  LEU E C   1 
ATOM   1961 O O   . LEU E 1 24  ? -10.444 25.569  17.292 1.00 23.82 ? 474  LEU E O   1 
ATOM   1962 C CB  . LEU E 1 24  ? -8.508  25.810  19.504 1.00 22.24 ? 474  LEU E CB  1 
ATOM   1963 C CG  . LEU E 1 24  ? -7.629  25.373  20.677 1.00 23.99 ? 474  LEU E CG  1 
ATOM   1964 C CD1 . LEU E 1 24  ? -6.158  25.452  20.306 1.00 24.33 ? 474  LEU E CD1 1 
ATOM   1965 C CD2 . LEU E 1 24  ? -7.916  26.198  21.923 1.00 22.00 ? 474  LEU E CD2 1 
ATOM   1966 N N   . LYS E 1 25  ? -11.842 26.688  18.673 1.00 21.12 ? 475  LYS E N   1 
ATOM   1967 C CA  . LYS E 1 25  ? -12.846 26.948  17.644 1.00 22.15 ? 475  LYS E CA  1 
ATOM   1968 C C   . LYS E 1 25  ? -13.239 28.415  17.505 1.00 26.44 ? 475  LYS E C   1 
ATOM   1969 O O   . LYS E 1 25  ? -13.671 28.834  16.426 1.00 24.90 ? 475  LYS E O   1 
ATOM   1970 C CB  . LYS E 1 25  ? -14.115 26.134  17.920 1.00 24.43 ? 475  LYS E CB  1 
ATOM   1971 C CG  . LYS E 1 25  ? -13.948 24.628  17.817 1.00 27.56 ? 475  LYS E CG  1 
ATOM   1972 C CD  . LYS E 1 25  ? -15.251 23.918  18.162 1.00 29.14 ? 475  LYS E CD  1 
ATOM   1973 C CE  . LYS E 1 25  ? -15.114 22.407  18.040 1.00 31.59 ? 475  LYS E CE  1 
ATOM   1974 N NZ  . LYS E 1 25  ? -16.309 21.695  18.571 1.00 38.41 ? 475  LYS E NZ  1 
ATOM   1975 N N   . LYS E 1 26  ? -13.131 29.195  18.581 1.00 19.69 ? 476  LYS E N   1 
ATOM   1976 C CA  . LYS E 1 26  ? -13.587 30.580  18.587 1.00 21.23 ? 476  LYS E CA  1 
ATOM   1977 C C   . LYS E 1 26  ? -12.462 31.510  19.013 1.00 18.93 ? 476  LYS E C   1 
ATOM   1978 O O   . LYS E 1 26  ? -11.515 31.107  19.693 1.00 19.31 ? 476  LYS E O   1 
ATOM   1979 C CB  . LYS E 1 26  ? -14.782 30.794  19.527 1.00 26.98 ? 476  LYS E CB  1 
ATOM   1980 C CG  . LYS E 1 26  ? -16.141 30.535  18.901 1.00 36.67 ? 476  LYS E CG  1 
ATOM   1981 C CD  . LYS E 1 26  ? -16.460 29.056  18.841 1.00 41.44 ? 476  LYS E CD  1 
ATOM   1982 C CE  . LYS E 1 26  ? -17.822 28.812  18.211 1.00 44.30 ? 476  LYS E CE  1 
ATOM   1983 N NZ  . LYS E 1 26  ? -18.067 27.360  17.978 1.00 46.32 ? 476  LYS E NZ  1 
ATOM   1984 N N   . GLN E 1 27  ? -12.597 32.778  18.617 1.00 19.12 ? 477  GLN E N   1 
ATOM   1985 C CA  . GLN E 1 27  ? -11.626 33.809  18.964 1.00 17.01 ? 477  GLN E CA  1 
ATOM   1986 C C   . GLN E 1 27  ? -11.319 33.790  20.456 1.00 18.80 ? 477  GLN E C   1 
ATOM   1987 O O   . GLN E 1 27  ? -12.224 33.883  21.289 1.00 21.07 ? 477  GLN E O   1 
ATOM   1988 C CB  . GLN E 1 27  ? -12.191 35.174  18.573 1.00 20.41 ? 477  GLN E CB  1 
ATOM   1989 C CG  . GLN E 1 27  ? -11.290 36.344  18.913 1.00 20.34 ? 477  GLN E CG  1 
ATOM   1990 C CD  . GLN E 1 27  ? -10.243 36.592  17.851 1.00 22.17 ? 477  GLN E CD  1 
ATOM   1991 O OE1 . GLN E 1 27  ? -9.759  35.660  17.211 1.00 20.42 ? 477  GLN E OE1 1 
ATOM   1992 N NE2 . GLN E 1 27  ? -9.898  37.860  17.645 1.00 23.93 ? 477  GLN E NE2 1 
ATOM   1993 N N   . GLY E 1 28  ? -10.041 33.625  20.790 1.00 18.78 ? 478  GLY E N   1 
ATOM   1994 C CA  . GLY E 1 28  ? -9.598  33.671  22.167 1.00 16.24 ? 478  GLY E CA  1 
ATOM   1995 C C   . GLY E 1 28  ? -9.636  32.358  22.924 1.00 18.96 ? 478  GLY E C   1 
ATOM   1996 O O   . GLY E 1 28  ? -9.271  32.345  24.108 1.00 18.58 ? 478  GLY E O   1 
ATOM   1997 N N   . ASP E 1 29  ? -10.085 31.271  22.297 1.00 16.88 ? 479  ASP E N   1 
ATOM   1998 C CA  . ASP E 1 29  ? -10.029 29.955  22.924 1.00 16.15 ? 479  ASP E CA  1 
ATOM   1999 C C   . ASP E 1 29  ? -8.574  29.582  23.184 1.00 16.04 ? 479  ASP E C   1 
ATOM   2000 O O   . ASP E 1 29  ? -7.712  29.793  22.331 1.00 16.48 ? 479  ASP E O   1 
ATOM   2001 C CB  . ASP E 1 29  ? -10.607 28.907  21.968 1.00 18.54 ? 479  ASP E CB  1 
ATOM   2002 C CG  . ASP E 1 29  ? -12.128 28.884  21.941 1.00 21.32 ? 479  ASP E CG  1 
ATOM   2003 O OD1 . ASP E 1 29  ? -12.762 29.647  22.696 1.00 22.63 ? 479  ASP E OD1 1 
ATOM   2004 O OD2 . ASP E 1 29  ? -12.686 28.087  21.152 1.00 21.81 ? 479  ASP E OD2 1 
ATOM   2005 N N   . PHE E 1 30  ? -8.294  28.993  24.349 1.00 16.31 ? 480  PHE E N   1 
ATOM   2006 C CA  . PHE E 1 30  ? -6.915  28.594  24.622 1.00 14.11 ? 480  PHE E CA  1 
ATOM   2007 C C   . PHE E 1 30  ? -6.832  27.395  25.559 1.00 14.72 ? 480  PHE E C   1 
ATOM   2008 O O   . PHE E 1 30  ? -7.743  27.116  26.343 1.00 15.17 ? 480  PHE E O   1 
ATOM   2009 C CB  . PHE E 1 30  ? -6.083  29.750  25.190 1.00 17.66 ? 480  PHE E CB  1 
ATOM   2010 C CG  . PHE E 1 30  ? -6.438  30.119  26.598 1.00 16.50 ? 480  PHE E CG  1 
ATOM   2011 C CD1 . PHE E 1 30  ? -7.470  31.011  26.851 1.00 18.12 ? 480  PHE E CD1 1 
ATOM   2012 C CD2 . PHE E 1 30  ? -5.738  29.591  27.672 1.00 18.06 ? 480  PHE E CD2 1 
ATOM   2013 C CE1 . PHE E 1 30  ? -7.798  31.364  28.146 1.00 18.25 ? 480  PHE E CE1 1 
ATOM   2014 C CE2 . PHE E 1 30  ? -6.066  29.937  28.971 1.00 18.49 ? 480  PHE E CE2 1 
ATOM   2015 C CZ  . PHE E 1 30  ? -7.097  30.828  29.207 1.00 18.72 ? 480  PHE E CZ  1 
ATOM   2016 N N   . LEU E 1 31  ? -5.691  26.709  25.479 1.00 12.54 ? 481  LEU E N   1 
ATOM   2017 C CA  . LEU E 1 31  ? -5.339  25.620  26.381 1.00 12.02 ? 481  LEU E CA  1 
ATOM   2018 C C   . LEU E 1 31  ? -3.820  25.507  26.447 1.00 11.29 ? 481  LEU E C   1 
ATOM   2019 O O   . LEU E 1 31  ? -3.104  26.039  25.595 1.00 11.87 ? 481  LEU E O   1 
ATOM   2020 C CB  . LEU E 1 31  ? -5.971  24.288  25.934 1.00 14.03 ? 481  LEU E CB  1 
ATOM   2021 C CG  . LEU E 1 31  ? -5.650  23.750  24.531 1.00 14.62 ? 481  LEU E CG  1 
ATOM   2022 C CD1 . LEU E 1 31  ? -4.345  22.958  24.485 1.00 13.05 ? 481  LEU E CD1 1 
ATOM   2023 C CD2 . LEU E 1 31  ? -6.803  22.902  23.991 1.00 17.17 ? 481  LEU E CD2 1 
ATOM   2024 N N   . VAL E 1 32  ? -3.327  24.810  27.468 1.00 10.68 ? 482  VAL E N   1 
ATOM   2025 C CA  . VAL E 1 32  ? -1.907  24.497  27.601 1.00 10.64 ? 482  VAL E CA  1 
ATOM   2026 C C   . VAL E 1 32  ? -1.726  22.983  27.526 1.00 10.32 ? 482  VAL E C   1 
ATOM   2027 O O   . VAL E 1 32  ? -2.533  22.223  28.073 1.00 11.09 ? 482  VAL E O   1 
ATOM   2028 C CB  . VAL E 1 32  ? -1.309  25.097  28.892 1.00 10.82 ? 482  VAL E CB  1 
ATOM   2029 C CG1 . VAL E 1 32  ? 0.120   24.617  29.116 1.00 14.31 ? 482  VAL E CG1 1 
ATOM   2030 C CG2 . VAL E 1 32  ? -1.343  26.628  28.826 1.00 13.38 ? 482  VAL E CG2 1 
ATOM   2031 N N   . ARG E 1 33  ? -0.673  22.548  26.835 1.00 9.94  ? 483  ARG E N   1 
ATOM   2032 C CA  . ARG E 1 33  ? -0.393  21.128  26.653 1.00 9.91  ? 483  ARG E CA  1 
ATOM   2033 C C   . ARG E 1 33  ? 1.115   20.904  26.644 1.00 10.06 ? 483  ARG E C   1 
ATOM   2034 O O   . ARG E 1 33  ? 1.906   21.844  26.550 1.00 11.42 ? 483  ARG E O   1 
ATOM   2035 C CB  . ARG E 1 33  ? -1.015  20.619  25.348 1.00 9.73  ? 483  ARG E CB  1 
ATOM   2036 C CG  . ARG E 1 33  ? -0.506  21.355  24.120 1.00 11.66 ? 483  ARG E CG  1 
ATOM   2037 C CD  . ARG E 1 33  ? -1.253  20.938  22.863 1.00 10.70 ? 483  ARG E CD  1 
ATOM   2038 N NE  . ARG E 1 33  ? -0.843  21.734  21.708 1.00 10.88 ? 483  ARG E NE  1 
ATOM   2039 C CZ  . ARG E 1 33  ? 0.186   21.439  20.917 1.00 10.80 ? 483  ARG E CZ  1 
ATOM   2040 N NH1 . ARG E 1 33  ? 0.920   20.349  21.128 1.00 11.22 ? 483  ARG E NH1 1 
ATOM   2041 N NH2 . ARG E 1 33  ? 0.486   22.239  19.906 1.00 11.63 ? 483  ARG E NH2 1 
ATOM   2042 N N   . GLU E 1 34  ? 1.512   19.634  26.752 1.00 10.31 ? 484  GLU E N   1 
ATOM   2043 C CA  . GLU E 1 34  ? 2.913   19.229  26.684 1.00 11.17 ? 484  GLU E CA  1 
ATOM   2044 C C   . GLU E 1 34  ? 3.260   18.913  25.236 1.00 14.10 ? 484  GLU E C   1 
ATOM   2045 O O   . GLU E 1 34  ? 2.601   18.079  24.609 1.00 15.82 ? 484  GLU E O   1 
ATOM   2046 C CB  . GLU E 1 34  ? 3.137   17.970  27.531 1.00 13.18 ? 484  GLU E CB  1 
ATOM   2047 C CG  . GLU E 1 34  ? 2.562   18.050  28.940 1.00 20.84 ? 484  GLU E CG  1 
ATOM   2048 C CD  . GLU E 1 34  ? 3.627   18.201  30.010 1.00 34.68 ? 484  GLU E CD  1 
ATOM   2049 O OE1 . GLU E 1 34  ? 3.315   17.953  31.194 1.00 40.40 ? 484  GLU E OE1 1 
ATOM   2050 O OE2 . GLU E 1 34  ? 4.773   18.563  29.672 1.00 37.33 ? 484  GLU E OE2 1 
ATOM   2051 N N   . SER E 1 35  ? 4.306   19.551  24.719 1.00 10.41 ? 485  SER E N   1 
ATOM   2052 C CA  . SER E 1 35  ? 4.653   19.439  23.307 1.00 10.60 ? 485  SER E CA  1 
ATOM   2053 C C   . SER E 1 35  ? 5.109   18.033  22.929 1.00 10.24 ? 485  SER E C   1 
ATOM   2054 O O   . SER E 1 35  ? 5.771   17.338  23.706 1.00 10.91 ? 485  SER E O   1 
ATOM   2055 C CB  . SER E 1 35  ? 5.779   20.419  22.989 1.00 11.80 ? 485  SER E CB  1 
ATOM   2056 O OG  . SER E 1 35  ? 6.178   20.330  21.634 1.00 11.23 ? 485  SER E OG  1 
ATOM   2057 N N   . HIS E 1 36  ? 4.760   17.621  21.710 1.00 9.95  ? 486  HIS E N   1 
ATOM   2058 C CA  . HIS E 1 36  ? 5.346   16.450  21.068 1.00 9.97  ? 486  HIS E CA  1 
ATOM   2059 C C   . HIS E 1 36  ? 6.470   16.805  20.109 1.00 10.35 ? 486  HIS E C   1 
ATOM   2060 O O   . HIS E 1 36  ? 7.485   16.106  20.069 1.00 12.07 ? 486  HIS E O   1 
ATOM   2061 C CB  . HIS E 1 36  ? 4.264   15.643  20.338 1.00 10.54 ? 486  HIS E CB  1 
ATOM   2062 C CG  . HIS E 1 36  ? 3.358   14.896  21.264 1.00 10.99 ? 486  HIS E CG  1 
ATOM   2063 N ND1 . HIS E 1 36  ? 2.258   15.471  21.867 1.00 14.46 ? 486  HIS E ND1 1 
ATOM   2064 C CD2 . HIS E 1 36  ? 3.406   13.618  21.711 1.00 13.31 ? 486  HIS E CD2 1 
ATOM   2065 C CE1 . HIS E 1 36  ? 1.668   14.577  22.641 1.00 14.20 ? 486  HIS E CE1 1 
ATOM   2066 N NE2 . HIS E 1 36  ? 2.344   13.448  22.566 1.00 16.83 ? 486  HIS E NE2 1 
ATOM   2067 N N   . GLY E 1 37  ? 6.324   17.894  19.348 1.00 10.53 ? 487  GLY E N   1 
ATOM   2068 C CA  . GLY E 1 37  ? 7.378   18.286  18.429 1.00 12.40 ? 487  GLY E CA  1 
ATOM   2069 C C   . GLY E 1 37  ? 8.632   18.759  19.130 1.00 11.89 ? 487  GLY E C   1 
ATOM   2070 O O   . GLY E 1 37  ? 9.738   18.615  18.598 1.00 14.50 ? 487  GLY E O   1 
ATOM   2071 N N   . LYS E 1 38  ? 8.485   19.330  20.325 1.00 11.55 ? 488  LYS E N   1 
ATOM   2072 C CA  . LYS E 1 38  ? 9.611   19.785  21.144 1.00 11.16 ? 488  LYS E CA  1 
ATOM   2073 C C   . LYS E 1 38  ? 9.465   19.183  22.533 1.00 10.42 ? 488  LYS E C   1 
ATOM   2074 O O   . LYS E 1 38  ? 8.995   19.848  23.467 1.00 10.61 ? 488  LYS E O   1 
ATOM   2075 C CB  . LYS E 1 38  ? 9.706   21.311  21.164 1.00 12.09 ? 488  LYS E CB  1 
ATOM   2076 C CG  . LYS E 1 38  ? 10.070  21.866  19.794 1.00 13.74 ? 488  LYS E CG  1 
ATOM   2077 C CD  . LYS E 1 38  ? 10.020  23.369  19.718 1.00 21.07 ? 488  LYS E CD  1 
ATOM   2078 C CE  . LYS E 1 38  ? 10.457  23.803  18.331 1.00 28.66 ? 488  LYS E CE  1 
ATOM   2079 N NZ  . LYS E 1 38  ? 11.861  23.389  18.043 1.00 31.97 ? 488  LYS E NZ  1 
ATOM   2080 N N   . PRO E 1 39  ? 9.853   17.917  22.700 1.00 10.24 ? 489  PRO E N   1 
ATOM   2081 C CA  . PRO E 1 39  ? 9.602   17.218  23.966 1.00 10.40 ? 489  PRO E CA  1 
ATOM   2082 C C   . PRO E 1 39  ? 10.187  17.962  25.155 1.00 11.19 ? 489  PRO E C   1 
ATOM   2083 O O   . PRO E 1 39  ? 11.293  18.507  25.095 1.00 12.36 ? 489  PRO E O   1 
ATOM   2084 C CB  . PRO E 1 39  ? 10.286  15.862  23.763 1.00 11.41 ? 489  PRO E CB  1 
ATOM   2085 C CG  . PRO E 1 39  ? 10.269  15.653  22.284 1.00 13.12 ? 489  PRO E CG  1 
ATOM   2086 C CD  . PRO E 1 39  ? 10.438  17.028  21.679 1.00 11.08 ? 489  PRO E CD  1 
ATOM   2087 N N   . GLY E 1 40  ? 9.421   17.975  26.241 1.00 9.78  ? 490  GLY E N   1 
ATOM   2088 C CA  . GLY E 1 40  ? 9.796   18.661  27.453 1.00 11.12 ? 490  GLY E CA  1 
ATOM   2089 C C   . GLY E 1 40  ? 9.370   20.107  27.520 1.00 10.87 ? 490  GLY E C   1 
ATOM   2090 O O   . GLY E 1 40  ? 9.462   20.702  28.600 1.00 12.43 ? 490  GLY E O   1 
ATOM   2091 N N   . GLU E 1 41  ? 8.923   20.690  26.407 1.00 10.38 ? 491  GLU E N   1 
ATOM   2092 C CA  . GLU E 1 41  ? 8.417   22.054  26.387 1.00 9.98  ? 491  GLU E CA  1 
ATOM   2093 C C   . GLU E 1 41  ? 6.908   22.047  26.571 1.00 10.04 ? 491  GLU E C   1 
ATOM   2094 O O   . GLU E 1 41  ? 6.220   21.084  26.214 1.00 11.12 ? 491  GLU E O   1 
ATOM   2095 C CB  . GLU E 1 41  ? 8.745   22.737  25.056 1.00 12.49 ? 491  GLU E CB  1 
ATOM   2096 C CG  . GLU E 1 41  ? 10.200  22.665  24.621 1.00 19.70 ? 491  GLU E CG  1 
ATOM   2097 C CD  . GLU E 1 41  ? 11.096  23.632  25.361 1.00 24.74 ? 491  GLU E CD  1 
ATOM   2098 O OE1 . GLU E 1 41  ? 12.324  23.577  25.142 1.00 26.57 ? 491  GLU E OE1 1 
ATOM   2099 O OE2 . GLU E 1 41  ? 10.577  24.446  26.153 1.00 23.48 ? 491  GLU E OE2 1 
ATOM   2100 N N   . TYR E 1 42  ? 6.393   23.139  27.119 1.00 10.12 ? 492  TYR E N   1 
ATOM   2101 C CA  . TYR E 1 42  ? 4.961   23.364  27.202 1.00 10.17 ? 492  TYR E CA  1 
ATOM   2102 C C   . TYR E 1 42  ? 4.520   24.294  26.079 1.00 10.41 ? 492  TYR E C   1 
ATOM   2103 O O   . TYR E 1 42  ? 5.296   25.133  25.604 1.00 10.83 ? 492  TYR E O   1 
ATOM   2104 C CB  . TYR E 1 42  ? 4.585   23.988  28.540 1.00 11.75 ? 492  TYR E CB  1 
ATOM   2105 C CG  . TYR E 1 42  ? 4.758   23.084  29.738 1.00 11.80 ? 492  TYR E CG  1 
ATOM   2106 C CD1 . TYR E 1 42  ? 5.960   23.041  30.434 1.00 13.10 ? 492  TYR E CD1 1 
ATOM   2107 C CD2 . TYR E 1 42  ? 3.704   22.312  30.204 1.00 12.78 ? 492  TYR E CD2 1 
ATOM   2108 C CE1 . TYR E 1 42  ? 6.107   22.246  31.557 1.00 14.63 ? 492  TYR E CE1 1 
ATOM   2109 C CE2 . TYR E 1 42  ? 3.843   21.508  31.323 1.00 13.44 ? 492  TYR E CE2 1 
ATOM   2110 C CZ  . TYR E 1 42  ? 5.045   21.482  31.994 1.00 16.25 ? 492  TYR E CZ  1 
ATOM   2111 O OH  . TYR E 1 42  ? 5.189   20.695  33.119 1.00 17.11 ? 492  TYR E OH  1 
ATOM   2112 N N   . VAL E 1 43  ? 3.258   24.149  25.669 1.00 10.43 ? 493  VAL E N   1 
ATOM   2113 C CA  . VAL E 1 43  ? 2.684   24.884  24.546 1.00 10.70 ? 493  VAL E CA  1 
ATOM   2114 C C   . VAL E 1 43  ? 1.423   25.584  25.018 1.00 11.01 ? 493  VAL E C   1 
ATOM   2115 O O   . VAL E 1 43  ? 0.586   24.976  25.697 1.00 11.27 ? 493  VAL E O   1 
ATOM   2116 C CB  . VAL E 1 43  ? 2.329   23.946  23.374 1.00 10.62 ? 493  VAL E CB  1 
ATOM   2117 C CG1 . VAL E 1 43  ? 1.815   24.744  22.187 1.00 13.17 ? 493  VAL E CG1 1 
ATOM   2118 C CG2 . VAL E 1 43  ? 3.523   23.127  22.970 1.00 12.84 ? 493  VAL E CG2 1 
ATOM   2119 N N   . LEU E 1 44  ? 1.286   26.855  24.655 1.00 11.42 ? 494  LEU E N   1 
ATOM   2120 C CA  . LEU E 1 44  ? 0.018   27.563  24.733 1.00 11.82 ? 494  LEU E CA  1 
ATOM   2121 C C   . LEU E 1 44  ? -0.588  27.559  23.336 1.00 11.95 ? 494  LEU E C   1 
ATOM   2122 O O   . LEU E 1 44  ? 0.006   28.105  22.401 1.00 13.66 ? 494  LEU E O   1 
ATOM   2123 C CB  . LEU E 1 44  ? 0.231   29.002  25.207 1.00 13.02 ? 494  LEU E CB  1 
ATOM   2124 C CG  . LEU E 1 44  ? -1.000  29.900  25.102 1.00 13.40 ? 494  LEU E CG  1 
ATOM   2125 C CD1 . LEU E 1 44  ? -2.067  29.482  26.100 1.00 15.07 ? 494  LEU E CD1 1 
ATOM   2126 C CD2 . LEU E 1 44  ? -0.602  31.352  25.314 1.00 16.01 ? 494  LEU E CD2 1 
ATOM   2127 N N   . SER E 1 45  ? -1.739  26.912  23.185 1.00 12.21 ? 495  SER E N   1 
ATOM   2128 C CA  . SER E 1 45  ? -2.428  26.816  21.904 1.00 12.72 ? 495  SER E CA  1 
ATOM   2129 C C   . SER E 1 45  ? -3.665  27.700  21.973 1.00 16.00 ? 495  SER E C   1 
ATOM   2130 O O   . SER E 1 45  ? -4.446  27.595  22.922 1.00 14.63 ? 495  SER E O   1 
ATOM   2131 C CB  . SER E 1 45  ? -2.817  25.358  21.619 1.00 14.62 ? 495  SER E CB  1 
ATOM   2132 O OG  . SER E 1 45  ? -1.673  24.522  21.458 1.00 13.61 ? 495  SER E OG  1 
ATOM   2133 N N   . VAL E 1 46  ? -3.824  28.591  20.989 1.00 16.24 ? 496  VAL E N   1 
ATOM   2134 C CA  . VAL E 1 46  ? -4.890  29.592  20.988 1.00 18.77 ? 496  VAL E CA  1 
ATOM   2135 C C   . VAL E 1 46  ? -5.519  29.663  19.603 1.00 19.70 ? 496  VAL E C   1 
ATOM   2136 O O   . VAL E 1 46  ? -4.817  29.587  18.590 1.00 29.20 ? 496  VAL E O   1 
ATOM   2137 C CB  . VAL E 1 46  ? -4.354  30.996  21.355 1.00 19.38 ? 496  VAL E CB  1 
ATOM   2138 C CG1 . VAL E 1 46  ? -5.497  31.943  21.693 1.00 22.83 ? 496  VAL E CG1 1 
ATOM   2139 C CG2 . VAL E 1 46  ? -3.365  30.939  22.498 1.00 19.44 ? 496  VAL E CG2 1 
ATOM   2140 N N   . TYR E 1 47  ? -6.842  29.830  19.556 1.00 16.60 ? 497  TYR E N   1 
ATOM   2141 C CA  . TYR E 1 47  ? -7.530  30.197  18.323 1.00 16.84 ? 497  TYR E CA  1 
ATOM   2142 C C   . TYR E 1 47  ? -7.588  31.719  18.273 1.00 17.30 ? 497  TYR E C   1 
ATOM   2143 O O   . TYR E 1 47  ? -8.125  32.349  19.188 1.00 17.76 ? 497  TYR E O   1 
ATOM   2144 C CB  . TYR E 1 47  ? -8.949  29.632  18.286 1.00 17.79 ? 497  TYR E CB  1 
ATOM   2145 C CG  . TYR E 1 47  ? -9.633  29.772  16.938 1.00 16.78 ? 497  TYR E CG  1 
ATOM   2146 C CD1 . TYR E 1 47  ? -10.250 30.965  16.557 1.00 17.43 ? 497  TYR E CD1 1 
ATOM   2147 C CD2 . TYR E 1 47  ? -9.671  28.710  16.046 1.00 23.32 ? 497  TYR E CD2 1 
ATOM   2148 C CE1 . TYR E 1 47  ? -10.877 31.088  15.322 1.00 19.96 ? 497  TYR E CE1 1 
ATOM   2149 C CE2 . TYR E 1 47  ? -10.294 28.824  14.813 1.00 22.94 ? 497  TYR E CE2 1 
ATOM   2150 C CZ  . TYR E 1 47  ? -10.898 30.016  14.457 1.00 22.81 ? 497  TYR E CZ  1 
ATOM   2151 O OH  . TYR E 1 47  ? -11.520 30.142  13.234 1.00 27.78 ? 497  TYR E OH  1 
ATOM   2152 N N   . SER E 1 48  ? -7.028  32.309  17.221 1.00 16.24 ? 498  SER E N   1 
ATOM   2153 C CA  . SER E 1 48  ? -6.979  33.762  17.130 1.00 16.78 ? 498  SER E CA  1 
ATOM   2154 C C   . SER E 1 48  ? -7.016  34.182  15.671 1.00 17.47 ? 498  SER E C   1 
ATOM   2155 O O   . SER E 1 48  ? -6.202  33.721  14.866 1.00 19.87 ? 498  SER E O   1 
ATOM   2156 C CB  . SER E 1 48  ? -5.709  34.291  17.799 1.00 17.28 ? 498  SER E CB  1 
ATOM   2157 O OG  . SER E 1 48  ? -5.696  35.707  17.796 1.00 20.84 ? 498  SER E OG  1 
ATOM   2158 N N   . ASP E 1 49  ? -7.954  35.074  15.348 1.00 18.22 ? 499  ASP E N   1 
ATOM   2159 C CA  . ASP E 1 49  ? -8.091  35.644  14.010 1.00 20.72 ? 499  ASP E CA  1 
ATOM   2160 C C   . ASP E 1 49  ? -8.080  34.563  12.933 1.00 21.99 ? 499  ASP E C   1 
ATOM   2161 O O   . ASP E 1 49  ? -7.329  34.619  11.957 1.00 25.32 ? 499  ASP E O   1 
ATOM   2162 C CB  . ASP E 1 49  ? -7.058  36.743  13.761 1.00 22.87 ? 499  ASP E CB  1 
ATOM   2163 C CG  . ASP E 1 49  ? -7.215  37.904  14.729 1.00 28.72 ? 499  ASP E CG  1 
ATOM   2164 O OD1 . ASP E 1 49  ? -8.368  38.200  15.114 1.00 27.39 ? 499  ASP E OD1 1 
ATOM   2165 O OD2 . ASP E 1 49  ? -6.195  38.511  15.118 1.00 33.45 ? 499  ASP E OD2 1 
ATOM   2166 N N   . GLY E 1 50  ? -8.904  33.541  13.153 1.00 21.11 ? 500  GLY E N   1 
ATOM   2167 C CA  . GLY E 1 50  ? -9.184  32.532  12.153 1.00 24.53 ? 500  GLY E CA  1 
ATOM   2168 C C   . GLY E 1 50  ? -8.201  31.385  12.064 1.00 24.04 ? 500  GLY E C   1 
ATOM   2169 O O   . GLY E 1 50  ? -8.388  30.504  11.214 1.00 26.99 ? 500  GLY E O   1 
ATOM   2170 N N   . GLN E 1 51  ? -7.168  31.353  12.905 1.00 22.42 ? 501  GLN E N   1 
ATOM   2171 C CA  . GLN E 1 51  ? -6.170  30.296  12.832 1.00 23.98 ? 501  GLN E CA  1 
ATOM   2172 C C   . GLN E 1 51  ? -5.807  29.819  14.230 1.00 22.99 ? 501  GLN E C   1 
ATOM   2173 O O   . GLN E 1 51  ? -5.887  30.571  15.205 1.00 20.74 ? 501  GLN E O   1 
ATOM   2174 C CB  . GLN E 1 51  ? -4.898  30.770  12.118 1.00 27.17 ? 501  GLN E CB  1 
ATOM   2175 C CG  . GLN E 1 51  ? -5.123  31.259  10.693 1.00 34.67 ? 501  GLN E CG  1 
ATOM   2176 C CD  . GLN E 1 51  ? -3.869  31.842  10.074 1.00 43.19 ? 501  GLN E CD  1 
ATOM   2177 O OE1 . GLN E 1 51  ? -2.760  31.601  10.548 1.00 44.63 ? 501  GLN E OE1 1 
ATOM   2178 N NE2 . GLN E 1 51  ? -4.040  32.621  9.012  1.00 48.58 ? 501  GLN E NE2 1 
ATOM   2179 N N   . ARG E 1 52  ? -5.397  28.558  14.320 1.00 22.86 ? 502  ARG E N   1 
ATOM   2180 C CA  . ARG E 1 52  ? -4.858  28.026  15.562 1.00 20.71 ? 502  ARG E CA  1 
ATOM   2181 C C   . ARG E 1 52  ? -3.373  28.340  15.639 1.00 19.11 ? 502  ARG E C   1 
ATOM   2182 O O   . ARG E 1 52  ? -2.624  28.081  14.690 1.00 26.12 ? 502  ARG E O   1 
ATOM   2183 C CB  . ARG E 1 52  ? -5.059  26.516  15.660 1.00 24.38 ? 502  ARG E CB  1 
ATOM   2184 C CG  . ARG E 1 52  ? -6.459  26.098  16.046 1.00 30.12 ? 502  ARG E CG  1 
ATOM   2185 C CD  . ARG E 1 52  ? -7.220  25.630  14.830 1.00 32.98 ? 502  ARG E CD  1 
ATOM   2186 N NE  . ARG E 1 52  ? -8.586  25.243  15.154 1.00 33.66 ? 502  ARG E NE  1 
ATOM   2187 C CZ  . ARG E 1 52  ? -9.557  25.150  14.255 1.00 31.90 ? 502  ARG E CZ  1 
ATOM   2188 N NH1 . ARG E 1 52  ? -9.304  25.421  12.982 1.00 35.76 ? 502  ARG E NH1 1 
ATOM   2189 N NH2 . ARG E 1 52  ? -10.778 24.795  14.627 1.00 35.05 ? 502  ARG E NH2 1 
ATOM   2190 N N   . ARG E 1 53  ? -2.953  28.898  16.767 1.00 17.26 ? 503  ARG E N   1 
ATOM   2191 C CA  . ARG E 1 53  ? -1.586  29.352  16.950 1.00 19.50 ? 503  ARG E CA  1 
ATOM   2192 C C   . ARG E 1 53  ? -0.994  28.697  18.189 1.00 19.11 ? 503  ARG E C   1 
ATOM   2193 O O   . ARG E 1 53  ? -1.654  28.595  19.228 1.00 19.56 ? 503  ARG E O   1 
ATOM   2194 C CB  . ARG E 1 53  ? -1.529  30.880  17.027 1.00 21.95 ? 503  ARG E CB  1 
ATOM   2195 C CG  . ARG E 1 53  ? -2.068  31.524  15.753 1.00 28.09 ? 503  ARG E CG  1 
ATOM   2196 C CD  . ARG E 1 53  ? -2.303  33.015  15.870 1.00 29.92 ? 503  ARG E CD  1 
ATOM   2197 N NE  . ARG E 1 53  ? -3.275  33.459  14.872 1.00 32.53 ? 503  ARG E NE  1 
ATOM   2198 C CZ  . ARG E 1 53  ? -2.973  33.781  13.617 1.00 37.25 ? 503  ARG E CZ  1 
ATOM   2199 N NH1 . ARG E 1 53  ? -1.717  33.714  13.194 1.00 41.12 ? 503  ARG E NH1 1 
ATOM   2200 N NH2 . ARG E 1 53  ? -3.928  34.172  12.782 1.00 33.55 ? 503  ARG E NH2 1 
ATOM   2201 N N   . HIS E 1 54  ? 0.244   28.235  18.060 1.00 15.42 ? 504  HIS E N   1 
ATOM   2202 C CA  . HIS E 1 54  ? 0.885   27.404  19.070 1.00 13.00 ? 504  HIS E CA  1 
ATOM   2203 C C   . HIS E 1 54  ? 2.175   28.076  19.508 1.00 13.54 ? 504  HIS E C   1 
ATOM   2204 O O   . HIS E 1 54  ? 3.104   28.232  18.707 1.00 16.33 ? 504  HIS E O   1 
ATOM   2205 C CB  . HIS E 1 54  ? 1.142   26.007  18.508 1.00 15.53 ? 504  HIS E CB  1 
ATOM   2206 C CG  . HIS E 1 54  ? -0.094  25.351  17.983 1.00 13.86 ? 504  HIS E CG  1 
ATOM   2207 N ND1 . HIS E 1 54  ? -1.009  24.734  18.805 1.00 14.47 ? 504  HIS E ND1 1 
ATOM   2208 C CD2 . HIS E 1 54  ? -0.588  25.253  16.725 1.00 14.18 ? 504  HIS E CD2 1 
ATOM   2209 C CE1 . HIS E 1 54  ? -2.003  24.264  18.076 1.00 14.77 ? 504  HIS E CE1 1 
ATOM   2210 N NE2 . HIS E 1 54  ? -1.774  24.566  16.811 1.00 15.36 ? 504  HIS E NE2 1 
ATOM   2211 N N   . PHE E 1 55  ? 2.230   28.477  20.773 1.00 12.31 ? 505  PHE E N   1 
ATOM   2212 C CA  . PHE E 1 55  ? 3.376   29.186  21.327 1.00 15.04 ? 505  PHE E CA  1 
ATOM   2213 C C   . PHE E 1 55  ? 4.124   28.281  22.293 1.00 13.01 ? 505  PHE E C   1 
ATOM   2214 O O   . PHE E 1 55  ? 3.530   27.754  23.241 1.00 13.32 ? 505  PHE E O   1 
ATOM   2215 C CB  . PHE E 1 55  ? 2.929   30.424  22.106 1.00 15.72 ? 505  PHE E CB  1 
ATOM   2216 C CG  . PHE E 1 55  ? 2.184   31.435  21.281 1.00 15.31 ? 505  PHE E CG  1 
ATOM   2217 C CD1 . PHE E 1 55  ? 2.857   32.477  20.660 1.00 17.75 ? 505  PHE E CD1 1 
ATOM   2218 C CD2 . PHE E 1 55  ? 0.808   31.360  21.145 1.00 17.65 ? 505  PHE E CD2 1 
ATOM   2219 C CE1 . PHE E 1 55  ? 2.173   33.420  19.904 1.00 19.11 ? 505  PHE E CE1 1 
ATOM   2220 C CE2 . PHE E 1 55  ? 0.120   32.309  20.393 1.00 18.36 ? 505  PHE E CE2 1 
ATOM   2221 C CZ  . PHE E 1 55  ? 0.809   33.336  19.772 1.00 20.29 ? 505  PHE E CZ  1 
ATOM   2222 N N   . ILE E 1 56  ? 5.427   28.117  22.077 1.00 11.98 ? 506  ILE E N   1 
ATOM   2223 C CA  . ILE E 1 56  ? 6.248   27.466  23.088 1.00 12.25 ? 506  ILE E CA  1 
ATOM   2224 C C   . ILE E 1 56  ? 6.388   28.405  24.276 1.00 11.69 ? 506  ILE E C   1 
ATOM   2225 O O   . ILE E 1 56  ? 6.677   29.602  24.113 1.00 13.94 ? 506  ILE E O   1 
ATOM   2226 C CB  . ILE E 1 56  ? 7.620   27.084  22.514 1.00 12.34 ? 506  ILE E CB  1 
ATOM   2227 C CG1 . ILE E 1 56  ? 7.466   26.018  21.426 1.00 14.06 ? 506  ILE E CG1 1 
ATOM   2228 C CG2 . ILE E 1 56  ? 8.558   26.607  23.627 1.00 13.86 ? 506  ILE E CG2 1 
ATOM   2229 C CD1 . ILE E 1 56  ? 7.040   24.654  21.959 1.00 14.75 ? 506  ILE E CD1 1 
ATOM   2230 N N   . ILE E 1 57  ? 6.157   27.880  25.476 1.00 12.72 ? 507  ILE E N   1 
ATOM   2231 C CA  . ILE E 1 57  ? 6.379   28.635  26.704 1.00 14.08 ? 507  ILE E CA  1 
ATOM   2232 C C   . ILE E 1 57  ? 7.855   28.492  27.047 1.00 18.12 ? 507  ILE E C   1 
ATOM   2233 O O   . ILE E 1 57  ? 8.314   27.408  27.410 1.00 17.58 ? 507  ILE E O   1 
ATOM   2234 C CB  . ILE E 1 57  ? 5.489   28.131  27.845 1.00 14.21 ? 507  ILE E CB  1 
ATOM   2235 C CG1 . ILE E 1 57  ? 4.014   28.205  27.442 1.00 15.17 ? 507  ILE E CG1 1 
ATOM   2236 C CG2 . ILE E 1 57  ? 5.750   28.927  29.118 1.00 18.65 ? 507  ILE E CG2 1 
ATOM   2237 C CD1 . ILE E 1 57  ? 3.051   27.615  28.461 1.00 14.96 ? 507  ILE E CD1 1 
ATOM   2238 N N   . GLN E 1 58  ? 8.607   29.577  26.910 1.00 15.88 ? 508  GLN E N   1 
ATOM   2239 C CA  . GLN E 1 58  ? 10.038  29.502  27.150 1.00 17.23 ? 508  GLN E CA  1 
ATOM   2240 C C   . GLN E 1 58  ? 10.317  29.291  28.630 1.00 16.79 ? 508  GLN E C   1 
ATOM   2241 O O   . GLN E 1 58  ? 9.675   29.895  29.493 1.00 16.86 ? 508  GLN E O   1 
ATOM   2242 C CB  . GLN E 1 58  ? 10.719  30.788  26.687 1.00 18.07 ? 508  GLN E CB  1 
ATOM   2243 C CG  . GLN E 1 58  ? 12.222  30.783  26.920 1.00 28.60 ? 508  GLN E CG  1 
ATOM   2244 C CD  . GLN E 1 58  ? 12.924  31.991  26.332 1.00 37.45 ? 508  GLN E CD  1 
ATOM   2245 O OE1 . GLN E 1 58  ? 12.586  33.135  26.638 1.00 40.45 ? 508  GLN E OE1 1 
ATOM   2246 N NE2 . GLN E 1 58  ? 13.911  31.740  25.479 1.00 41.66 ? 508  GLN E NE2 1 
ATOM   2247 N N   . TYR E 1 59  ? 11.276  28.422  28.923 1.00 15.20 ? 509  TYR E N   1 
ATOM   2248 C CA  . TYR E 1 59  ? 11.736  28.189  30.286 1.00 14.98 ? 509  TYR E CA  1 
ATOM   2249 C C   . TYR E 1 59  ? 13.228  28.492  30.334 1.00 16.46 ? 509  TYR E C   1 
ATOM   2250 O O   . TYR E 1 59  ? 14.040  27.730  29.798 1.00 19.57 ? 509  TYR E O   1 
ATOM   2251 C CB  . TYR E 1 59  ? 11.433  26.763  30.737 1.00 15.93 ? 509  TYR E CB  1 
ATOM   2252 C CG  . TYR E 1 59  ? 11.923  26.475  32.131 1.00 15.39 ? 509  TYR E CG  1 
ATOM   2253 C CD1 . TYR E 1 59  ? 11.336  27.082  33.234 1.00 16.71 ? 509  TYR E CD1 1 
ATOM   2254 C CD2 . TYR E 1 59  ? 12.982  25.606  32.344 1.00 18.47 ? 509  TYR E CD2 1 
ATOM   2255 C CE1 . TYR E 1 59  ? 11.789  26.828  34.510 1.00 18.34 ? 509  TYR E CE1 1 
ATOM   2256 C CE2 . TYR E 1 59  ? 13.442  25.349  33.614 1.00 17.84 ? 509  TYR E CE2 1 
ATOM   2257 C CZ  . TYR E 1 59  ? 12.841  25.958  34.695 1.00 18.67 ? 509  TYR E CZ  1 
ATOM   2258 O OH  . TYR E 1 59  ? 13.297  25.701  35.965 1.00 22.64 ? 509  TYR E OH  1 
ATOM   2259 N N   . VAL E 1 60  ? 13.579  29.615  30.959 1.00 17.14 ? 510  VAL E N   1 
ATOM   2260 C CA  . VAL E 1 60  ? 14.957  30.095  31.032 1.00 20.94 ? 510  VAL E CA  1 
ATOM   2261 C C   . VAL E 1 60  ? 15.165  30.740  32.394 1.00 22.79 ? 510  VAL E C   1 
ATOM   2262 O O   . VAL E 1 60  ? 14.287  31.446  32.898 1.00 20.35 ? 510  VAL E O   1 
ATOM   2263 C CB  . VAL E 1 60  ? 15.254  31.111  29.909 1.00 26.95 ? 510  VAL E CB  1 
ATOM   2264 C CG1 . VAL E 1 60  ? 15.409  30.411  28.569 1.00 31.39 ? 510  VAL E CG1 1 
ATOM   2265 C CG2 . VAL E 1 60  ? 14.155  32.162  29.841 1.00 30.40 ? 510  VAL E CG2 1 
ATOM   2266 N N   . ASP E 1 61  ? 16.336  30.499  32.988 1.00 26.29 ? 511  ASP E N   1 
ATOM   2267 C CA  . ASP E 1 61  ? 16.705  31.110  34.269 1.00 28.93 ? 511  ASP E CA  1 
ATOM   2268 C C   . ASP E 1 61  ? 15.661  30.830  35.349 1.00 23.27 ? 511  ASP E C   1 
ATOM   2269 O O   . ASP E 1 61  ? 15.336  31.698  36.163 1.00 24.03 ? 511  ASP E O   1 
ATOM   2270 C CB  . ASP E 1 61  ? 16.966  32.615  34.137 1.00 34.97 ? 511  ASP E CB  1 
ATOM   2271 C CG  . ASP E 1 61  ? 18.008  32.942  33.085 1.00 45.24 ? 511  ASP E CG  1 
ATOM   2272 O OD1 . ASP E 1 61  ? 19.005  32.198  32.980 1.00 46.34 ? 511  ASP E OD1 1 
ATOM   2273 O OD2 . ASP E 1 61  ? 17.827  33.947  32.363 1.00 49.24 ? 511  ASP E OD2 1 
ATOM   2274 N N   . ASN E 1 62  ? 15.116  29.613  35.343 1.00 21.09 ? 512  ASN E N   1 
ATOM   2275 C CA  . ASN E 1 62  ? 14.093  29.181  36.294 1.00 24.01 ? 512  ASN E CA  1 
ATOM   2276 C C   . ASN E 1 62  ? 12.783  29.953  36.158 1.00 22.40 ? 512  ASN E C   1 
ATOM   2277 O O   . ASN E 1 62  ? 11.997  30.013  37.108 1.00 26.30 ? 512  ASN E O   1 
ATOM   2278 C CB  . ASN E 1 62  ? 14.593  29.209  37.745 1.00 30.96 ? 512  ASN E CB  1 
ATOM   2279 C CG  . ASN E 1 62  ? 15.953  28.563  37.904 1.00 37.44 ? 512  ASN E CG  1 
ATOM   2280 O OD1 . ASN E 1 62  ? 16.100  27.353  37.743 1.00 39.77 ? 512  ASN E OD1 1 
ATOM   2281 N ND2 . ASN E 1 62  ? 16.957  29.370  38.229 1.00 40.46 ? 512  ASN E ND2 1 
ATOM   2282 N N   . MET E 1 63  ? 12.527  30.552  34.997 1.00 17.43 ? 513  MET E N   1 
ATOM   2283 C CA  . MET E 1 63  ? 11.325  31.340  34.787 1.00 18.35 ? 513  MET E CA  1 
ATOM   2284 C C   . MET E 1 63  ? 10.651  30.924  33.491 1.00 16.93 ? 513  MET E C   1 
ATOM   2285 O O   . MET E 1 63  ? 11.312  30.578  32.508 1.00 18.89 ? 513  MET E O   1 
ATOM   2286 C CB  . MET E 1 63  ? 11.646  32.835  34.702 1.00 18.01 ? 513  MET E CB  1 
ATOM   2287 C CG  . MET E 1 63  ? 12.200  33.437  35.982 1.00 23.73 ? 513  MET E CG  1 
ATOM   2288 S SD  . MET E 1 63  ? 12.618  35.174  35.757 1.00 26.84 ? 513  MET E SD  1 
ATOM   2289 C CE  . MET E 1 63  ? 14.185  35.043  34.907 1.00 28.51 ? 513  MET E CE  1 
ATOM   2290 N N   . TYR E 1 64  ? 9.324   30.962  33.503 1.00 14.04 ? 514  TYR E N   1 
ATOM   2291 C CA  . TYR E 1 64  ? 8.518   30.754  32.312 1.00 13.02 ? 514  TYR E CA  1 
ATOM   2292 C C   . TYR E 1 64  ? 8.113   32.109  31.749 1.00 13.78 ? 514  TYR E C   1 
ATOM   2293 O O   . TYR E 1 64  ? 7.740   33.020  32.497 1.00 15.60 ? 514  TYR E O   1 
ATOM   2294 C CB  . TYR E 1 64  ? 7.269   29.943  32.648 1.00 14.64 ? 514  TYR E CB  1 
ATOM   2295 C CG  . TYR E 1 64  ? 7.570   28.538  33.130 1.00 12.79 ? 514  TYR E CG  1 
ATOM   2296 C CD1 . TYR E 1 64  ? 7.721   27.486  32.231 1.00 13.27 ? 514  TYR E CD1 1 
ATOM   2297 C CD2 . TYR E 1 64  ? 7.695   28.258  34.485 1.00 13.79 ? 514  TYR E CD2 1 
ATOM   2298 C CE1 . TYR E 1 64  ? 7.991   26.195  32.672 1.00 12.98 ? 514  TYR E CE1 1 
ATOM   2299 C CE2 . TYR E 1 64  ? 7.963   26.970  34.933 1.00 13.00 ? 514  TYR E CE2 1 
ATOM   2300 C CZ  . TYR E 1 64  ? 8.113   25.943  34.021 1.00 12.28 ? 514  TYR E CZ  1 
ATOM   2301 O OH  . TYR E 1 64  ? 8.374   24.660  34.464 1.00 14.39 ? 514  TYR E OH  1 
ATOM   2302 N N   . ARG E 1 65  ? 8.188   32.246  30.429 1.00 13.84 ? 515  ARG E N   1 
ATOM   2303 C CA  . ARG E 1 65  ? 7.935   33.539  29.810 1.00 13.79 ? 515  ARG E CA  1 
ATOM   2304 C C   . ARG E 1 65  ? 7.632   33.348  28.332 1.00 14.78 ? 515  ARG E C   1 
ATOM   2305 O O   . ARG E 1 65  ? 7.861   32.281  27.756 1.00 15.17 ? 515  ARG E O   1 
ATOM   2306 C CB  . ARG E 1 65  ? 9.137   34.475  29.985 1.00 18.55 ? 515  ARG E CB  1 
ATOM   2307 C CG  . ARG E 1 65  ? 10.402  33.988  29.283 1.00 19.15 ? 515  ARG E CG  1 
ATOM   2308 C CD  . ARG E 1 65  ? 11.601  34.900  29.557 1.00 27.14 ? 515  ARG E CD  1 
ATOM   2309 N NE  . ARG E 1 65  ? 11.429  36.238  28.997 1.00 31.98 ? 515  ARG E NE  1 
ATOM   2310 C CZ  . ARG E 1 65  ? 11.860  36.607  27.793 1.00 36.83 ? 515  ARG E CZ  1 
ATOM   2311 N NH1 . ARG E 1 65  ? 12.488  35.736  27.015 1.00 36.38 ? 515  ARG E NH1 1 
ATOM   2312 N NH2 . ARG E 1 65  ? 11.663  37.848  27.366 1.00 41.28 ? 515  ARG E NH2 1 
ATOM   2313 N N   . PHE E 1 66  ? 7.099   34.416  27.728 1.00 17.78 ? 516  PHE E N   1 
ATOM   2314 C CA  . PHE E 1 66  ? 7.033   34.530  26.281 1.00 19.53 ? 516  PHE E CA  1 
ATOM   2315 C C   . PHE E 1 66  ? 8.042   35.585  25.876 1.00 24.18 ? 516  PHE E C   1 
ATOM   2316 O O   . PHE E 1 66  ? 9.226   35.259  25.665 1.00 26.64 ? 516  PHE E O   1 
ATOM   2317 C CB  . PHE E 1 66  ? 5.606   34.835  25.799 1.00 19.23 ? 516  PHE E CB  1 
ATOM   2318 C CG  . PHE E 1 66  ? 4.618   33.730  26.064 1.00 15.80 ? 516  PHE E CG  1 
ATOM   2319 C CD1 . PHE E 1 66  ? 4.711   32.522  25.391 1.00 15.95 ? 516  PHE E CD1 1 
ATOM   2320 C CD2 . PHE E 1 66  ? 3.587   33.909  26.967 1.00 16.12 ? 516  PHE E CD2 1 
ATOM   2321 C CE1 . PHE E 1 66  ? 3.801   31.503  25.629 1.00 16.11 ? 516  PHE E CE1 1 
ATOM   2322 C CE2 . PHE E 1 66  ? 2.671   32.897  27.208 1.00 16.09 ? 516  PHE E CE2 1 
ATOM   2323 C CZ  . PHE E 1 66  ? 2.781   31.688  26.537 1.00 16.14 ? 516  PHE E CZ  1 
ATOM   2324 N N   . GLU E 1 67  ? 7.654   36.858  25.766 1.00 23.09 ? 517  GLU E N   1 
ATOM   2325 C CA  . GLU E 1 67  ? 8.545   37.931  25.342 1.00 26.54 ? 517  GLU E CA  1 
ATOM   2326 C C   . GLU E 1 67  ? 8.848   38.944  26.431 1.00 27.34 ? 517  GLU E C   1 
ATOM   2327 O O   . GLU E 1 67  ? 9.592   39.898  26.173 1.00 28.08 ? 517  GLU E O   1 
ATOM   2328 C CB  . GLU E 1 67  ? 7.939   38.698  24.163 1.00 29.57 ? 517  GLU E CB  1 
ATOM   2329 C CG  . GLU E 1 67  ? 7.967   37.970  22.859 1.00 34.26 ? 517  GLU E CG  1 
ATOM   2330 C CD  . GLU E 1 67  ? 7.406   38.810  21.737 1.00 34.84 ? 517  GLU E CD  1 
ATOM   2331 O OE1 . GLU E 1 67  ? 6.819   39.876  22.026 1.00 37.51 ? 517  GLU E OE1 1 
ATOM   2332 O OE2 . GLU E 1 67  ? 7.555   38.402  20.568 1.00 37.45 ? 517  GLU E OE2 1 
ATOM   2333 N N   . GLY E 1 68  ? 8.283   38.795  27.620 1.00 25.76 ? 518  GLY E N   1 
ATOM   2334 C CA  . GLY E 1 68  ? 8.460   39.826  28.618 1.00 27.53 ? 518  GLY E CA  1 
ATOM   2335 C C   . GLY E 1 68  ? 8.857   39.305  29.980 1.00 25.06 ? 518  GLY E C   1 
ATOM   2336 O O   . GLY E 1 68  ? 9.890   38.647  30.136 1.00 22.96 ? 518  GLY E O   1 
ATOM   2337 N N   . THR E 1 69  ? 8.029   39.615  30.971 1.00 24.42 ? 519  THR E N   1 
ATOM   2338 C CA  . THR E 1 69  ? 8.299   39.247  32.351 1.00 26.22 ? 519  THR E CA  1 
ATOM   2339 C C   . THR E 1 69  ? 8.354   37.728  32.508 1.00 20.00 ? 519  THR E C   1 
ATOM   2340 O O   . THR E 1 69  ? 7.634   36.985  31.839 1.00 22.69 ? 519  THR E O   1 
ATOM   2341 C CB  . THR E 1 69  ? 7.188   39.827  33.230 1.00 29.01 ? 519  THR E CB  1 
ATOM   2342 O OG1 . THR E 1 69  ? 7.160   41.253  33.077 1.00 34.87 ? 519  THR E OG1 1 
ATOM   2343 C CG2 . THR E 1 69  ? 7.399   39.484  34.691 1.00 32.32 ? 519  THR E CG2 1 
ATOM   2344 N N   . GLY E 1 70  ? 9.237   37.272  33.400 1.00 18.47 ? 520  GLY E N   1 
ATOM   2345 C CA  . GLY E 1 70  ? 9.296   35.864  33.759 1.00 18.66 ? 520  GLY E CA  1 
ATOM   2346 C C   . GLY E 1 70  ? 8.470   35.545  34.996 1.00 20.85 ? 520  GLY E C   1 
ATOM   2347 O O   . GLY E 1 70  ? 8.276   36.383  35.874 1.00 20.58 ? 520  GLY E O   1 
ATOM   2348 N N   . PHE E 1 71  ? 7.983   34.308  35.060 1.00 17.47 ? 521  PHE E N   1 
ATOM   2349 C CA  . PHE E 1 71  ? 7.130   33.854  36.149 1.00 14.87 ? 521  PHE E CA  1 
ATOM   2350 C C   . PHE E 1 71  ? 7.644   32.528  36.689 1.00 15.40 ? 521  PHE E C   1 
ATOM   2351 O O   . PHE E 1 71  ? 8.201   31.711  35.949 1.00 15.88 ? 521  PHE E O   1 
ATOM   2352 C CB  . PHE E 1 71  ? 5.659   33.705  35.704 1.00 15.10 ? 521  PHE E CB  1 
ATOM   2353 C CG  . PHE E 1 71  ? 5.036   34.999  35.255 1.00 15.02 ? 521  PHE E CG  1 
ATOM   2354 C CD1 . PHE E 1 71  ? 5.230   35.468  33.966 1.00 18.28 ? 521  PHE E CD1 1 
ATOM   2355 C CD2 . PHE E 1 71  ? 4.268   35.753  36.129 1.00 15.96 ? 521  PHE E CD2 1 
ATOM   2356 C CE1 . PHE E 1 71  ? 4.665   36.668  33.554 1.00 18.66 ? 521  PHE E CE1 1 
ATOM   2357 C CE2 . PHE E 1 71  ? 3.702   36.942  35.723 1.00 16.76 ? 521  PHE E CE2 1 
ATOM   2358 C CZ  . PHE E 1 71  ? 3.902   37.404  34.438 1.00 19.15 ? 521  PHE E CZ  1 
ATOM   2359 N N   . SER E 1 72  ? 7.423   32.310  37.988 1.00 15.92 ? 522  SER E N   1 
ATOM   2360 C CA  A SER E 1 72  ? 7.921   31.102  38.640 0.45 15.55 ? 522  SER E CA  1 
ATOM   2361 C CA  B SER E 1 72  ? 7.929   31.102  38.632 0.55 15.29 ? 522  SER E CA  1 
ATOM   2362 C C   . SER E 1 72  ? 7.229   29.848  38.125 1.00 16.92 ? 522  SER E C   1 
ATOM   2363 O O   . SER E 1 72  ? 7.821   28.761  38.139 1.00 19.00 ? 522  SER E O   1 
ATOM   2364 C CB  A SER E 1 72  ? 7.732   31.202  40.153 0.45 18.59 ? 522  SER E CB  1 
ATOM   2365 C CB  B SER E 1 72  ? 7.788   31.210  40.150 0.55 18.83 ? 522  SER E CB  1 
ATOM   2366 O OG  A SER E 1 72  ? 8.486   32.268  40.695 0.45 19.67 ? 522  SER E OG  1 
ATOM   2367 O OG  B SER E 1 72  ? 6.429   31.335  40.533 0.55 19.50 ? 522  SER E OG  1 
ATOM   2368 N N   . ASN E 1 73  ? 5.980   29.965  37.682 1.00 14.14 ? 523  ASN E N   1 
ATOM   2369 C CA  . ASN E 1 73  ? 5.264   28.790  37.211 1.00 13.19 ? 523  ASN E CA  1 
ATOM   2370 C C   . ASN E 1 73  ? 4.313   29.190  36.093 1.00 13.05 ? 523  ASN E C   1 
ATOM   2371 O O   . ASN E 1 73  ? 4.014   30.367  35.898 1.00 13.32 ? 523  ASN E O   1 
ATOM   2372 C CB  . ASN E 1 73  ? 4.533   28.067  38.352 1.00 14.80 ? 523  ASN E CB  1 
ATOM   2373 C CG  . ASN E 1 73  ? 3.549   28.965  39.080 1.00 15.90 ? 523  ASN E CG  1 
ATOM   2374 O OD1 . ASN E 1 73  ? 2.575   29.440  38.499 1.00 18.00 ? 523  ASN E OD1 1 
ATOM   2375 N ND2 . ASN E 1 73  ? 3.791   29.182  40.375 1.00 18.93 ? 523  ASN E ND2 1 
ATOM   2376 N N   . ILE E 1 74  ? 3.841   28.193  35.357 1.00 12.47 ? 524  ILE E N   1 
ATOM   2377 C CA  . ILE E 1 74  ? 2.990   28.423  34.192 1.00 12.22 ? 524  ILE E CA  1 
ATOM   2378 C C   . ILE E 1 74  ? 1.634   29.019  34.568 1.00 13.52 ? 524  ILE E C   1 
ATOM   2379 O O   . ILE E 1 74  ? 1.174   29.951  33.889 1.00 13.60 ? 524  ILE E O   1 
ATOM   2380 C CB  . ILE E 1 74  ? 2.898   27.168  33.314 1.00 12.47 ? 524  ILE E CB  1 
ATOM   2381 C CG1 . ILE E 1 74  ? 4.242   26.965  32.620 1.00 11.44 ? 524  ILE E CG1 1 
ATOM   2382 C CG2 . ILE E 1 74  ? 1.771   27.293  32.299 1.00 15.39 ? 524  ILE E CG2 1 
ATOM   2383 C CD1 . ILE E 1 74  ? 4.348   25.666  31.891 1.00 13.90 ? 524  ILE E CD1 1 
ATOM   2384 N N   . PRO E 1 75  ? 0.953   28.540  35.619 1.00 14.46 ? 525  PRO E N   1 
ATOM   2385 C CA  . PRO E 1 75  ? -0.317  29.187  35.997 1.00 13.92 ? 525  PRO E CA  1 
ATOM   2386 C C   . PRO E 1 75  ? -0.208  30.691  36.217 1.00 17.33 ? 525  PRO E C   1 
ATOM   2387 O O   . PRO E 1 75  ? -1.122  31.430  35.834 1.00 17.75 ? 525  PRO E O   1 
ATOM   2388 C CB  . PRO E 1 75  ? -0.736  28.416  37.255 1.00 14.63 ? 525  PRO E CB  1 
ATOM   2389 C CG  . PRO E 1 75  ? -0.181  27.030  37.015 1.00 16.39 ? 525  PRO E CG  1 
ATOM   2390 C CD  . PRO E 1 75  ? 1.164   27.290  36.379 1.00 15.20 ? 525  PRO E CD  1 
ATOM   2391 N N   . GLN E 1 76  ? 0.898   31.173  36.791 1.00 16.16 ? 526  GLN E N   1 
ATOM   2392 C CA  . GLN E 1 76  ? 1.066   32.619  36.954 1.00 15.11 ? 526  GLN E CA  1 
ATOM   2393 C C   . GLN E 1 76  ? 1.165   33.330  35.610 1.00 15.97 ? 526  GLN E C   1 
ATOM   2394 O O   . GLN E 1 76  ? 0.590   34.411  35.426 1.00 17.64 ? 526  GLN E O   1 
ATOM   2395 C CB  . GLN E 1 76  ? 2.316   32.917  37.776 1.00 18.11 ? 526  GLN E CB  1 
ATOM   2396 C CG  . GLN E 1 76  ? 2.221   32.583  39.242 1.00 18.71 ? 526  GLN E CG  1 
ATOM   2397 C CD  . GLN E 1 76  ? 3.566   32.710  39.918 1.00 26.97 ? 526  GLN E CD  1 
ATOM   2398 O OE1 . GLN E 1 76  ? 4.605   32.557  39.274 1.00 25.87 ? 526  GLN E OE1 1 
ATOM   2399 N NE2 . GLN E 1 76  ? 3.561   33.004  41.212 1.00 29.39 ? 526  GLN E NE2 1 
ATOM   2400 N N   . LEU E 1 77  ? 1.926   32.765  34.673 1.00 15.81 ? 527  LEU E N   1 
ATOM   2401 C CA  . LEU E 1 77  ? 2.061   33.372  33.354 1.00 16.40 ? 527  LEU E CA  1 
ATOM   2402 C C   . LEU E 1 77  ? 0.720   33.415  32.626 1.00 18.22 ? 527  LEU E C   1 
ATOM   2403 O O   . LEU E 1 77  ? 0.338   34.450  32.061 1.00 16.49 ? 527  LEU E O   1 
ATOM   2404 C CB  . LEU E 1 77  ? 3.103   32.602  32.542 1.00 17.08 ? 527  LEU E CB  1 
ATOM   2405 C CG  . LEU E 1 77  ? 3.259   32.962  31.066 1.00 17.92 ? 527  LEU E CG  1 
ATOM   2406 C CD1 . LEU E 1 77  ? 3.783   34.375  30.906 1.00 17.07 ? 527  LEU E CD1 1 
ATOM   2407 C CD2 . LEU E 1 77  ? 4.189   31.982  30.383 1.00 16.58 ? 527  LEU E CD2 1 
ATOM   2408 N N   . ILE E 1 78  ? -0.020  32.302  32.646 1.00 17.03 ? 528  ILE E N   1 
ATOM   2409 C CA  . ILE E 1 78  ? -1.300  32.238  31.944 1.00 18.38 ? 528  ILE E CA  1 
ATOM   2410 C C   . ILE E 1 78  ? -2.301  33.202  32.570 1.00 19.51 ? 528  ILE E C   1 
ATOM   2411 O O   . ILE E 1 78  ? -3.003  33.943  31.870 1.00 19.12 ? 528  ILE E O   1 
ATOM   2412 C CB  . ILE E 1 78  ? -1.827  30.792  31.926 1.00 16.91 ? 528  ILE E CB  1 
ATOM   2413 C CG1 . ILE E 1 78  ? -0.854  29.875  31.179 1.00 18.21 ? 528  ILE E CG1 1 
ATOM   2414 C CG2 . ILE E 1 78  ? -3.207  30.746  31.302 1.00 18.62 ? 528  ILE E CG2 1 
ATOM   2415 C CD1 . ILE E 1 78  ? -0.653  30.232  29.716 1.00 20.79 ? 528  ILE E CD1 1 
ATOM   2416 N N   . ASP E 1 79  ? -2.378  33.207  33.901 1.00 17.67 ? 529  ASP E N   1 
ATOM   2417 C CA  . ASP E 1 79  ? -3.309  34.103  34.582 1.00 21.76 ? 529  ASP E CA  1 
ATOM   2418 C C   . ASP E 1 79  ? -2.977  35.562  34.307 1.00 18.72 ? 529  ASP E C   1 
ATOM   2419 O O   . ASP E 1 79  ? -3.880  36.393  34.146 1.00 21.67 ? 529  ASP E O   1 
ATOM   2420 C CB  . ASP E 1 79  ? -3.289  33.840  36.080 1.00 24.75 ? 529  ASP E CB  1 
ATOM   2421 C CG  . ASP E 1 79  ? -4.514  34.395  36.779 1.00 34.31 ? 529  ASP E CG  1 
ATOM   2422 O OD1 . ASP E 1 79  ? -5.626  34.015  36.367 1.00 38.00 ? 529  ASP E OD1 1 
ATOM   2423 O OD2 . ASP E 1 79  ? -4.371  35.204  37.725 1.00 37.95 ? 529  ASP E OD2 1 
ATOM   2424 N N   . HIS E 1 80  ? -1.687  35.900  34.269 1.00 20.15 ? 530  HIS E N   1 
ATOM   2425 C CA  . HIS E 1 80  ? -1.298  37.262  33.921 1.00 20.08 ? 530  HIS E CA  1 
ATOM   2426 C C   . HIS E 1 80  ? -1.924  37.677  32.593 1.00 22.41 ? 530  HIS E C   1 
ATOM   2427 O O   . HIS E 1 80  ? -2.552  38.736  32.487 1.00 23.05 ? 530  HIS E O   1 
ATOM   2428 C CB  . HIS E 1 80  ? 0.226   37.364  33.865 1.00 22.83 ? 530  HIS E CB  1 
ATOM   2429 C CG  . HIS E 1 80  ? 0.720   38.583  33.152 1.00 24.00 ? 530  HIS E CG  1 
ATOM   2430 N ND1 . HIS E 1 80  ? 0.665   39.843  33.707 1.00 28.22 ? 530  HIS E ND1 1 
ATOM   2431 C CD2 . HIS E 1 80  ? 1.257   38.738  31.919 1.00 25.21 ? 530  HIS E CD2 1 
ATOM   2432 C CE1 . HIS E 1 80  ? 1.156   40.721  32.850 1.00 27.41 ? 530  HIS E CE1 1 
ATOM   2433 N NE2 . HIS E 1 80  ? 1.523   40.076  31.758 1.00 27.53 ? 530  HIS E NE2 1 
ATOM   2434 N N   . HIS E 1 81  ? -1.820  36.814  31.584 1.00 19.07 ? 531  HIS E N   1 
ATOM   2435 C CA  . HIS E 1 81  ? -2.364  37.152  30.275 1.00 21.30 ? 531  HIS E CA  1 
ATOM   2436 C C   . HIS E 1 81  ? -3.884  37.088  30.266 1.00 20.55 ? 531  HIS E C   1 
ATOM   2437 O O   . HIS E 1 81  ? -4.538  37.897  29.596 1.00 22.94 ? 531  HIS E O   1 
ATOM   2438 C CB  . HIS E 1 81  ? -1.761  36.241  29.211 1.00 18.60 ? 531  HIS E CB  1 
ATOM   2439 C CG  . HIS E 1 81  ? -0.359  36.608  28.850 1.00 21.40 ? 531  HIS E CG  1 
ATOM   2440 N ND1 . HIS E 1 81  ? -0.061  37.653  28.004 1.00 23.13 ? 531  HIS E ND1 1 
ATOM   2441 C CD2 . HIS E 1 81  ? 0.827   36.093  29.246 1.00 22.76 ? 531  HIS E CD2 1 
ATOM   2442 C CE1 . HIS E 1 81  ? 1.250   37.757  27.881 1.00 22.79 ? 531  HIS E CE1 1 
ATOM   2443 N NE2 . HIS E 1 81  ? 1.812   36.820  28.625 1.00 22.89 ? 531  HIS E NE2 1 
ATOM   2444 N N   . TYR E 1 82  ? -4.464  36.155  31.022 1.00 21.34 ? 532  TYR E N   1 
ATOM   2445 C CA  . TYR E 1 82  ? -5.916  36.028  31.049 1.00 22.65 ? 532  TYR E CA  1 
ATOM   2446 C C   . TYR E 1 82  ? -6.567  37.215  31.750 1.00 25.97 ? 532  TYR E C   1 
ATOM   2447 O O   . TYR E 1 82  ? -7.619  37.700  31.315 1.00 26.70 ? 532  TYR E O   1 
ATOM   2448 C CB  . TYR E 1 82  ? -6.313  34.713  31.717 1.00 26.73 ? 532  TYR E CB  1 
ATOM   2449 C CG  . TYR E 1 82  ? -7.801  34.473  31.750 1.00 27.39 ? 532  TYR E CG  1 
ATOM   2450 C CD1 . TYR E 1 82  ? -8.516  34.263  30.579 1.00 26.36 ? 532  TYR E CD1 1 
ATOM   2451 C CD2 . TYR E 1 82  ? -8.492  34.446  32.955 1.00 33.05 ? 532  TYR E CD2 1 
ATOM   2452 C CE1 . TYR E 1 82  ? -9.880  34.042  30.604 1.00 29.87 ? 532  TYR E CE1 1 
ATOM   2453 C CE2 . TYR E 1 82  ? -9.855  34.221  32.991 1.00 35.17 ? 532  TYR E CE2 1 
ATOM   2454 C CZ  . TYR E 1 82  ? -10.544 34.020  31.814 1.00 33.19 ? 532  TYR E CZ  1 
ATOM   2455 O OH  . TYR E 1 82  ? -11.901 33.796  31.845 1.00 36.68 ? 532  TYR E OH  1 
ATOM   2456 N N   . THR E 1 83  ? -5.957  37.705  32.831 1.00 25.58 ? 533  THR E N   1 
ATOM   2457 C CA  . THR E 1 83  ? -6.567  38.799  33.581 1.00 28.75 ? 533  THR E CA  1 
ATOM   2458 C C   . THR E 1 83  ? -6.322  40.152  32.922 1.00 27.61 ? 533  THR E C   1 
ATOM   2459 O O   . THR E 1 83  ? -7.245  40.966  32.817 1.00 30.27 ? 533  THR E O   1 
ATOM   2460 C CB  . THR E 1 83  ? -6.068  38.802  35.028 1.00 29.70 ? 533  THR E CB  1 
ATOM   2461 O OG1 . THR E 1 83  ? -4.649  38.996  35.050 1.00 34.65 ? 533  THR E OG1 1 
ATOM   2462 C CG2 . THR E 1 83  ? -6.410  37.489  35.711 1.00 32.00 ? 533  THR E CG2 1 
ATOM   2463 N N   . THR E 1 84  ? -5.092  40.415  32.478 1.00 28.39 ? 534  THR E N   1 
ATOM   2464 C CA  . THR E 1 84  ? -4.745  41.729  31.945 1.00 26.80 ? 534  THR E CA  1 
ATOM   2465 C C   . THR E 1 84  ? -5.089  41.899  30.472 1.00 31.16 ? 534  THR E C   1 
ATOM   2466 O O   . THR E 1 84  ? -5.132  43.037  29.991 1.00 31.01 ? 534  THR E O   1 
ATOM   2467 C CB  . THR E 1 84  ? -3.250  42.014  32.123 1.00 28.73 ? 534  THR E CB  1 
ATOM   2468 O OG1 . THR E 1 84  ? -2.490  41.095  31.324 1.00 27.02 ? 534  THR E OG1 1 
ATOM   2469 C CG2 . THR E 1 84  ? -2.840  41.874  33.582 1.00 28.94 ? 534  THR E CG2 1 
ATOM   2470 N N   . LYS E 1 85  ? -5.317  40.805  29.745 1.00 25.66 ? 535  LYS E N   1 
ATOM   2471 C CA  . LYS E 1 85  ? -5.537  40.791  28.300 1.00 29.02 ? 535  LYS E CA  1 
ATOM   2472 C C   . LYS E 1 85  ? -4.332  41.281  27.506 1.00 25.37 ? 535  LYS E C   1 
ATOM   2473 O O   . LYS E 1 85  ? -4.471  41.596  26.316 1.00 30.19 ? 535  LYS E O   1 
ATOM   2474 C CB  . LYS E 1 85  ? -6.814  41.520  27.865 1.00 27.79 ? 535  LYS E CB  1 
ATOM   2475 C CG  . LYS E 1 85  ? -8.085  40.996  28.515 1.00 28.36 ? 535  LYS E CG  1 
ATOM   2476 C CD  . LYS E 1 85  ? -8.229  39.497  28.349 1.00 26.67 ? 535  LYS E CD  1 
ATOM   2477 C CE  . LYS E 1 85  ? -9.510  39.003  28.999 1.00 28.70 ? 535  LYS E CE  1 
ATOM   2478 N NZ  . LYS E 1 85  ? -9.560  37.521  29.068 1.00 26.36 ? 535  LYS E NZ  1 
ATOM   2479 N N   . GLN E 1 86  ? -3.153  41.336  28.119 1.00 24.59 ? 536  GLN E N   1 
ATOM   2480 C CA  . GLN E 1 86  ? -1.946  41.692  27.388 1.00 28.74 ? 536  GLN E CA  1 
ATOM   2481 C C   . GLN E 1 86  ? -1.621  40.614  26.363 1.00 27.61 ? 536  GLN E C   1 
ATOM   2482 O O   . GLN E 1 86  ? -1.804  39.417  26.612 1.00 21.08 ? 536  GLN E O   1 
ATOM   2483 C CB  . GLN E 1 86  ? -0.784  41.875  28.362 1.00 28.05 ? 536  GLN E CB  1 
ATOM   2484 C CG  . GLN E 1 86  ? -0.928  43.111  29.248 1.00 35.30 ? 536  GLN E CG  1 
ATOM   2485 C CD  . GLN E 1 86  ? 0.179   43.238  30.281 1.00 37.83 ? 536  GLN E CD  1 
ATOM   2486 O OE1 . GLN E 1 86  ? 1.260   42.665  30.130 1.00 37.37 ? 536  GLN E OE1 1 
ATOM   2487 N NE2 . GLN E 1 86  ? -0.089  43.993  31.340 1.00 39.52 ? 536  GLN E NE2 1 
ATOM   2488 N N   . VAL E 1 87  ? -1.144  41.046  25.194 1.00 23.28 ? 537  VAL E N   1 
ATOM   2489 C CA  . VAL E 1 87  ? -0.922  40.123  24.087 1.00 22.00 ? 537  VAL E CA  1 
ATOM   2490 C C   . VAL E 1 87  ? 0.181   39.129  24.429 1.00 23.74 ? 537  VAL E C   1 
ATOM   2491 O O   . VAL E 1 87  ? 1.099   39.417  25.210 1.00 23.82 ? 537  VAL E O   1 
ATOM   2492 C CB  . VAL E 1 87  ? -0.606  40.889  22.789 1.00 26.19 ? 537  VAL E CB  1 
ATOM   2493 C CG1 . VAL E 1 87  ? -1.795  41.755  22.376 1.00 27.03 ? 537  VAL E CG1 1 
ATOM   2494 C CG2 . VAL E 1 87  ? 0.648   41.732  22.966 1.00 30.54 ? 537  VAL E CG2 1 
ATOM   2495 N N   . ILE E 1 88  ? 0.081   37.936  23.839 1.00 19.66 ? 538  ILE E N   1 
ATOM   2496 C CA  . ILE E 1 88  ? 1.080   36.896  24.067 1.00 20.13 ? 538  ILE E CA  1 
ATOM   2497 C C   . ILE E 1 88  ? 2.430   37.324  23.503 1.00 21.79 ? 538  ILE E C   1 
ATOM   2498 O O   . ILE E 1 88  ? 3.465   37.208  24.169 1.00 22.57 ? 538  ILE E O   1 
ATOM   2499 C CB  . ILE E 1 88  ? 0.606   35.560  23.467 1.00 19.41 ? 538  ILE E CB  1 
ATOM   2500 C CG1 . ILE E 1 88  ? -0.709  35.109  24.108 1.00 21.85 ? 538  ILE E CG1 1 
ATOM   2501 C CG2 . ILE E 1 88  ? 1.679   34.488  23.622 1.00 18.48 ? 538  ILE E CG2 1 
ATOM   2502 C CD1 . ILE E 1 88  ? -0.647  34.967  25.610 1.00 20.16 ? 538  ILE E CD1 1 
ATOM   2503 N N   . THR E 1 89  ? 2.440   37.792  22.255 1.00 21.30 ? 539  THR E N   1 
ATOM   2504 C CA  . THR E 1 89  ? 3.608   38.412  21.644 1.00 23.73 ? 539  THR E CA  1 
ATOM   2505 C C   . THR E 1 89  ? 3.138   39.633  20.869 1.00 27.30 ? 539  THR E C   1 
ATOM   2506 O O   . THR E 1 89  ? 1.962   39.750  20.519 1.00 26.19 ? 539  THR E O   1 
ATOM   2507 C CB  . THR E 1 89  ? 4.339   37.479  20.667 1.00 24.38 ? 539  THR E CB  1 
ATOM   2508 O OG1 . THR E 1 89  ? 3.476   37.162  19.567 1.00 25.58 ? 539  THR E OG1 1 
ATOM   2509 C CG2 . THR E 1 89  ? 4.776   36.195  21.352 1.00 23.78 ? 539  THR E CG2 1 
ATOM   2510 N N   . LYS E 1 90  ? 4.077   40.545  20.600 1.00 29.13 ? 540  LYS E N   1 
ATOM   2511 C CA  . LYS E 1 90  ? 3.746   41.746  19.837 1.00 34.59 ? 540  LYS E CA  1 
ATOM   2512 C C   . LYS E 1 90  ? 3.326   41.396  18.416 1.00 33.55 ? 540  LYS E C   1 
ATOM   2513 O O   . LYS E 1 90  ? 2.323   41.913  17.909 1.00 33.50 ? 540  LYS E O   1 
ATOM   2514 C CB  . LYS E 1 90  ? 4.936   42.705  19.812 1.00 44.86 ? 540  LYS E CB  1 
ATOM   2515 C CG  . LYS E 1 90  ? 5.572   42.957  21.162 1.00 49.91 ? 540  LYS E CG  1 
ATOM   2516 C CD  . LYS E 1 90  ? 4.553   43.421  22.187 1.00 50.71 ? 540  LYS E CD  1 
ATOM   2517 C CE  . LYS E 1 90  ? 5.184   43.470  23.564 1.00 50.17 ? 540  LYS E CE  1 
ATOM   2518 N NZ  . LYS E 1 90  ? 5.978   42.235  23.820 1.00 44.49 ? 540  LYS E NZ  1 
ATOM   2519 N N   . LYS E 1 91  ? 4.091   40.523  17.753 1.00 30.29 ? 541  LYS E N   1 
ATOM   2520 C CA  . LYS E 1 91  ? 3.792   40.176  16.366 1.00 32.78 ? 541  LYS E CA  1 
ATOM   2521 C C   . LYS E 1 91  ? 2.432   39.501  16.237 1.00 31.27 ? 541  LYS E C   1 
ATOM   2522 O O   . LYS E 1 91  ? 1.662   39.811  15.321 1.00 33.43 ? 541  LYS E O   1 
ATOM   2523 C CB  . LYS E 1 91  ? 4.897   39.291  15.782 1.00 36.73 ? 541  LYS E CB  1 
ATOM   2524 C CG  . LYS E 1 91  ? 4.470   38.538  14.525 1.00 41.98 ? 541  LYS E CG  1 
ATOM   2525 C CD  . LYS E 1 91  ? 5.641   38.189  13.613 1.00 45.98 ? 541  LYS E CD  1 
ATOM   2526 C CE  . LYS E 1 91  ? 6.486   37.055  14.168 1.00 46.95 ? 541  LYS E CE  1 
ATOM   2527 N NZ  . LYS E 1 91  ? 7.314   36.417  13.102 1.00 49.56 ? 541  LYS E NZ  1 
ATOM   2528 N N   . SER E 1 92  ? 2.114   38.578  17.148 1.00 26.67 ? 542  SER E N   1 
ATOM   2529 C CA  . SER E 1 92  ? 0.863   37.837  17.034 1.00 27.99 ? 542  SER E CA  1 
ATOM   2530 C C   . SER E 1 92  ? -0.341  38.650  17.491 1.00 26.69 ? 542  SER E C   1 
ATOM   2531 O O   . SER E 1 92  ? -1.430  38.502  16.925 1.00 30.11 ? 542  SER E O   1 
ATOM   2532 C CB  . SER E 1 92  ? 0.943   36.534  17.834 1.00 26.64 ? 542  SER E CB  1 
ATOM   2533 O OG  . SER E 1 92  ? 0.783   36.781  19.222 1.00 22.80 ? 542  SER E OG  1 
ATOM   2534 N N   . GLY E 1 93  ? -0.178  39.500  18.503 1.00 25.70 ? 543  GLY E N   1 
ATOM   2535 C CA  . GLY E 1 93  ? -1.307  40.216  19.066 1.00 27.74 ? 543  GLY E CA  1 
ATOM   2536 C C   . GLY E 1 93  ? -2.377  39.336  19.672 1.00 26.08 ? 543  GLY E C   1 
ATOM   2537 O O   . GLY E 1 93  ? -3.526  39.768  19.793 1.00 27.69 ? 543  GLY E O   1 
ATOM   2538 N N   . VAL E 1 94  ? -2.032  38.114  20.074 1.00 21.65 ? 544  VAL E N   1 
ATOM   2539 C CA  . VAL E 1 94  ? -3.026  37.151  20.537 1.00 23.88 ? 544  VAL E CA  1 
ATOM   2540 C C   . VAL E 1 94  ? -3.456  37.486  21.961 1.00 21.22 ? 544  VAL E C   1 
ATOM   2541 O O   . VAL E 1 94  ? -2.623  37.779  22.828 1.00 21.02 ? 544  VAL E O   1 
ATOM   2542 C CB  . VAL E 1 94  ? -2.461  35.723  20.426 1.00 22.02 ? 544  VAL E CB  1 
ATOM   2543 C CG1 . VAL E 1 94  ? -3.332  34.737  21.177 1.00 23.30 ? 544  VAL E CG1 1 
ATOM   2544 C CG2 . VAL E 1 94  ? -2.339  35.319  18.962 1.00 26.91 ? 544  VAL E CG2 1 
ATOM   2545 N N   . VAL E 1 95  ? -4.766  37.436  22.209 1.00 22.49 ? 545  VAL E N   1 
ATOM   2546 C CA  . VAL E 1 95  ? -5.345  37.703  23.521 1.00 19.85 ? 545  VAL E CA  1 
ATOM   2547 C C   . VAL E 1 95  ? -6.147  36.487  23.972 1.00 21.01 ? 545  VAL E C   1 
ATOM   2548 O O   . VAL E 1 95  ? -6.919  35.920  23.192 1.00 23.34 ? 545  VAL E O   1 
ATOM   2549 C CB  . VAL E 1 95  ? -6.236  38.963  23.496 1.00 23.50 ? 545  VAL E CB  1 
ATOM   2550 C CG1 . VAL E 1 95  ? -6.942  39.134  24.832 1.00 21.11 ? 545  VAL E CG1 1 
ATOM   2551 C CG2 . VAL E 1 95  ? -5.406  40.196  23.149 1.00 25.12 ? 545  VAL E CG2 1 
ATOM   2552 N N   . LEU E 1 96  ? -5.975  36.102  25.238 1.00 21.60 ? 546  LEU E N   1 
ATOM   2553 C CA  . LEU E 1 96  ? -6.648  34.942  25.816 1.00 20.17 ? 546  LEU E CA  1 
ATOM   2554 C C   . LEU E 1 96  ? -8.032  35.338  26.317 1.00 21.18 ? 546  LEU E C   1 
ATOM   2555 O O   . LEU E 1 96  ? -8.162  36.273  27.114 1.00 24.32 ? 546  LEU E O   1 
ATOM   2556 C CB  . LEU E 1 96  ? -5.832  34.398  26.987 1.00 18.78 ? 546  LEU E CB  1 
ATOM   2557 C CG  . LEU E 1 96  ? -4.378  34.020  26.694 1.00 19.79 ? 546  LEU E CG  1 
ATOM   2558 C CD1 . LEU E 1 96  ? -3.761  33.326  27.902 1.00 18.01 ? 546  LEU E CD1 1 
ATOM   2559 C CD2 . LEU E 1 96  ? -4.272  33.146  25.450 1.00 18.95 ? 546  LEU E CD2 1 
ATOM   2560 N N   . LEU E 1 97  ? -9.056  34.606  25.875 1.00 21.67 ? 547  LEU E N   1 
ATOM   2561 C CA  . LEU E 1 97  ? -10.438 34.907  26.238 1.00 22.43 ? 547  LEU E CA  1 
ATOM   2562 C C   . LEU E 1 97  ? -11.165 33.738  26.883 1.00 23.60 ? 547  LEU E C   1 
ATOM   2563 O O   . LEU E 1 97  ? -11.834 33.927  27.908 1.00 25.06 ? 547  LEU E O   1 
ATOM   2564 C CB  . LEU E 1 97  ? -11.236 35.393  25.015 1.00 21.99 ? 547  LEU E CB  1 
ATOM   2565 C CG  . LEU E 1 97  ? -10.839 36.713  24.353 1.00 21.96 ? 547  LEU E CG  1 
ATOM   2566 C CD1 . LEU E 1 97  ? -11.793 37.044  23.213 1.00 25.10 ? 547  LEU E CD1 1 
ATOM   2567 C CD2 . LEU E 1 97  ? -10.807 37.843  25.366 1.00 25.11 ? 547  LEU E CD2 1 
ATOM   2568 N N   . ASN E 1 98  ? -11.071 32.538  26.309 1.00 22.03 ? 548  ASN E N   1 
ATOM   2569 C CA  . ASN E 1 98  ? -11.893 31.397  26.715 1.00 23.19 ? 548  ASN E CA  1 
ATOM   2570 C C   . ASN E 1 98  ? -11.013 30.193  27.037 1.00 21.63 ? 548  ASN E C   1 
ATOM   2571 O O   . ASN E 1 98  ? -10.509 29.525  26.119 1.00 20.87 ? 548  ASN E O   1 
ATOM   2572 C CB  . ASN E 1 98  ? -12.881 31.025  25.614 1.00 23.14 ? 548  ASN E CB  1 
ATOM   2573 C CG  . ASN E 1 98  ? -13.494 32.235  24.939 1.00 25.71 ? 548  ASN E CG  1 
ATOM   2574 O OD1 . ASN E 1 98  ? -14.029 33.122  25.599 1.00 28.04 ? 548  ASN E OD1 1 
ATOM   2575 N ND2 . ASN E 1 98  ? -13.411 32.280  23.614 1.00 23.97 ? 548  ASN E ND2 1 
ATOM   2576 N N   . PRO E 1 99  ? -10.824 29.864  28.314 1.00 20.36 ? 549  PRO E N   1 
ATOM   2577 C CA  . PRO E 1 99  ? -10.086 28.636  28.656 1.00 21.58 ? 549  PRO E CA  1 
ATOM   2578 C C   . PRO E 1 99  ? -10.918 27.405  28.323 1.00 20.15 ? 549  PRO E C   1 
ATOM   2579 O O   . PRO E 1 99  ? -12.039 27.250  28.809 1.00 24.57 ? 549  PRO E O   1 
ATOM   2580 C CB  . PRO E 1 99  ? -9.861  28.772  30.165 1.00 20.87 ? 549  PRO E CB  1 
ATOM   2581 C CG  . PRO E 1 99  ? -10.982 29.656  30.627 1.00 24.30 ? 549  PRO E CG  1 
ATOM   2582 C CD  . PRO E 1 99  ? -11.220 30.625  29.510 1.00 23.73 ? 549  PRO E CD  1 
ATOM   2583 N N   . ILE E 1 100 ? -10.364 26.527  27.493 1.00 18.07 ? 550  ILE E N   1 
ATOM   2584 C CA  . ILE E 1 100 ? -11.049 25.294  27.111 1.00 20.25 ? 550  ILE E CA  1 
ATOM   2585 C C   . ILE E 1 100 ? -10.905 24.275  28.235 1.00 18.17 ? 550  ILE E C   1 
ATOM   2586 O O   . ILE E 1 100 ? -9.775  23.930  28.615 1.00 18.67 ? 550  ILE E O   1 
ATOM   2587 C CB  . ILE E 1 100 ? -10.508 24.744  25.783 1.00 22.90 ? 550  ILE E CB  1 
ATOM   2588 C CG1 . ILE E 1 100 ? -10.741 25.750  24.655 1.00 27.70 ? 550  ILE E CG1 1 
ATOM   2589 C CG2 . ILE E 1 100 ? -11.142 23.395  25.467 1.00 25.00 ? 550  ILE E CG2 1 
ATOM   2590 C CD1 . ILE E 1 100 ? -12.180 26.219  24.537 1.00 28.97 ? 550  ILE E CD1 1 
ATOM   2591 N N   . PRO E 1 101 ? -12.004 23.778  28.798 1.00 19.21 ? 551  PRO E N   1 
ATOM   2592 C CA  . PRO E 1 101 ? -11.898 22.872  29.946 1.00 22.05 ? 551  PRO E CA  1 
ATOM   2593 C C   . PRO E 1 101 ? -11.342 21.519  29.541 1.00 23.10 ? 551  PRO E C   1 
ATOM   2594 O O   . PRO E 1 101 ? -11.560 21.035  28.427 1.00 21.71 ? 551  PRO E O   1 
ATOM   2595 C CB  . PRO E 1 101 ? -13.347 22.746  30.432 1.00 25.66 ? 551  PRO E CB  1 
ATOM   2596 C CG  . PRO E 1 101 ? -14.172 23.024  29.220 1.00 28.01 ? 551  PRO E CG  1 
ATOM   2597 C CD  . PRO E 1 101 ? -13.405 24.041  28.421 1.00 23.59 ? 551  PRO E CD  1 
ATOM   2598 N N   . LYS E 1 102 ? -10.617 20.908  30.472 1.00 21.76 ? 552  LYS E N   1 
ATOM   2599 C CA  . LYS E 1 102 ? -9.988  19.613  30.242 1.00 26.86 ? 552  LYS E CA  1 
ATOM   2600 C C   . LYS E 1 102 ? -11.029 18.504  30.257 1.00 30.23 ? 552  LYS E C   1 
ATOM   2601 O O   . LYS E 1 102 ? -12.141 18.693  30.748 1.00 31.65 ? 552  LYS E O   1 
ATOM   2602 C CB  . LYS E 1 102 ? -8.930  19.339  31.312 1.00 29.86 ? 552  LYS E CB  1 
ATOM   2603 C CG  . LYS E 1 102 ? -9.499  19.192  32.716 1.00 32.67 ? 552  LYS E CG  1 
ATOM   2604 C CD  . LYS E 1 102 ? -8.418  18.828  33.719 1.00 34.26 ? 552  LYS E CD  1 
ATOM   2605 C CE  . LYS E 1 102 ? -7.425  19.953  33.846 1.00 34.22 ? 552  LYS E CE  1 
ATOM   2606 N NZ  . LYS E 1 102 ? -6.244  19.635  34.692 1.00 38.21 ? 552  LYS E NZ  1 
ATOM   2607 O OXT . LYS E 1 102 ? -10.779 17.395  29.785 1.00 34.48 ? 552  LYS E OXT 1 
ATOM   2608 N N   . ASP F 2 1   ? 6.049   20.318  12.861 1.00 27.76 ? 1    ASP F N   1 
ATOM   2609 C CA  . ASP F 2 1   ? 5.020   21.340  12.702 1.00 24.68 ? 1    ASP F CA  1 
ATOM   2610 C C   . ASP F 2 1   ? 5.512   22.693  13.213 1.00 24.93 ? 1    ASP F C   1 
ATOM   2611 O O   . ASP F 2 1   ? 6.505   22.763  13.933 1.00 25.87 ? 1    ASP F O   1 
ATOM   2612 C CB  . ASP F 2 1   ? 3.743   20.926  13.428 1.00 20.19 ? 1    ASP F CB  1 
ATOM   2613 C CG  . ASP F 2 1   ? 3.176   19.619  12.910 1.00 20.60 ? 1    ASP F CG  1 
ATOM   2614 O OD1 . ASP F 2 1   ? 3.502   19.235  11.766 1.00 24.09 ? 1    ASP F OD1 1 
ATOM   2615 O OD2 . ASP F 2 1   ? 2.407   18.976  13.650 1.00 19.34 ? 1    ASP F OD2 1 
ATOM   2616 N N   . GLU F 2 2   ? 4.806   23.760  12.848 1.00 23.24 ? 2    GLU F N   1 
ATOM   2617 C CA  . GLU F 2 2   ? 5.259   25.116  13.148 1.00 23.59 ? 2    GLU F CA  1 
ATOM   2618 C C   . GLU F 2 2   ? 4.747   25.673  14.474 1.00 19.69 ? 2    GLU F C   1 
ATOM   2619 O O   . GLU F 2 2   ? 3.572   25.532  14.818 1.00 20.00 ? 2    GLU F O   1 
ATOM   2620 C CB  . GLU F 2 2   ? 4.881   26.062  12.002 1.00 37.00 ? 2    GLU F CB  1 
ATOM   2621 C CG  . GLU F 2 2   ? 5.476   25.672  10.656 1.00 48.65 ? 2    GLU F CG  1 
ATOM   2622 C CD  . GLU F 2 2   ? 6.955   26.007  10.540 1.00 55.97 ? 2    GLU F CD  1 
ATOM   2623 O OE1 . GLU F 2 2   ? 7.308   26.834  9.673  1.00 58.90 ? 2    GLU F OE1 1 
ATOM   2624 O OE2 . GLU F 2 2   ? 7.765   25.450  11.311 1.00 57.92 ? 2    GLU F OE2 1 
HETATM 2625 N N   . PTR F 2 3   ? 5.645   26.312  15.211 1.00 16.13 ? 3    PTR F N   1 
HETATM 2626 C CA  . PTR F 2 3   ? 5.274   27.071  16.388 1.00 15.31 ? 3    PTR F CA  1 
HETATM 2627 C C   . PTR F 2 3   ? 5.482   28.558  16.091 1.00 18.81 ? 3    PTR F C   1 
HETATM 2628 O O   . PTR F 2 3   ? 6.414   28.920  15.373 1.00 19.61 ? 3    PTR F O   1 
HETATM 2629 C CB  . PTR F 2 3   ? 6.091   26.607  17.593 1.00 15.73 ? 3    PTR F CB  1 
HETATM 2630 C CG  . PTR F 2 3   ? 5.719   25.234  18.119 1.00 13.89 ? 3    PTR F CG  1 
HETATM 2631 C CD1 . PTR F 2 3   ? 4.607   25.064  18.929 1.00 12.68 ? 3    PTR F CD1 1 
HETATM 2632 C CD2 . PTR F 2 3   ? 6.491   24.116  17.822 1.00 16.85 ? 3    PTR F CD2 1 
HETATM 2633 C CE1 . PTR F 2 3   ? 4.263   23.812  19.422 1.00 11.91 ? 3    PTR F CE1 1 
HETATM 2634 C CE2 . PTR F 2 3   ? 6.156   22.861  18.314 1.00 15.62 ? 3    PTR F CE2 1 
HETATM 2635 C CZ  . PTR F 2 3   ? 5.036   22.712  19.106 1.00 12.80 ? 3    PTR F CZ  1 
HETATM 2636 O OH  . PTR F 2 3   ? 4.735   21.511  19.581 1.00 11.68 ? 3    PTR F OH  1 
HETATM 2637 P P   . PTR F 2 3   ? 3.764   20.468  18.828 1.00 11.43 ? 3    PTR F P   1 
HETATM 2638 O O1P . PTR F 2 3   ? 4.537   19.917  17.632 1.00 13.29 ? 3    PTR F O1P 1 
HETATM 2639 O O2P . PTR F 2 3   ? 3.466   19.364  19.859 1.00 11.75 ? 3    PTR F O2P 1 
HETATM 2640 O O3P . PTR F 2 3   ? 2.557   21.234  18.403 1.00 11.33 ? 3    PTR F O3P 1 
ATOM   2641 N N   . GLU F 2 4   ? 4.613   29.401  16.639 1.00 19.95 ? 4    GLU F N   1 
ATOM   2642 C CA  . GLU F 2 4   ? 4.611   30.836  16.333 1.00 25.74 ? 4    GLU F CA  1 
ATOM   2643 C C   . GLU F 2 4   ? 5.924   31.532  16.665 1.00 28.82 ? 4    GLU F C   1 
ATOM   2644 O O   . GLU F 2 4   ? 6.421   32.356  15.891 1.00 30.63 ? 4    GLU F O   1 
ATOM   2645 C CB  . GLU F 2 4   ? 3.489   31.534  17.104 1.00 31.97 ? 4    GLU F CB  1 
ATOM   2646 C CG  . GLU F 2 4   ? 2.097   31.094  16.715 1.00 39.18 ? 4    GLU F CG  1 
ATOM   2647 C CD  . GLU F 2 4   ? 1.715   31.545  15.322 1.00 47.91 ? 4    GLU F CD  1 
ATOM   2648 O OE1 . GLU F 2 4   ? 1.329   32.723  15.161 1.00 51.68 ? 4    GLU F OE1 1 
ATOM   2649 O OE2 . GLU F 2 4   ? 1.811   30.724  14.386 1.00 50.49 ? 4    GLU F OE2 1 
ATOM   2650 N N   . ASN F 2 5   ? 6.480   31.198  17.828 1.00 28.74 ? 5    ASN F N   1 
ATOM   2651 C CA  . ASN F 2 5   ? 7.592   31.932  18.415 1.00 31.98 ? 5    ASN F CA  1 
ATOM   2652 C C   . ASN F 2 5   ? 8.884   31.124  18.441 1.00 39.54 ? 5    ASN F C   1 
ATOM   2653 O O   . ASN F 2 5   ? 9.793   31.440  19.215 1.00 41.51 ? 5    ASN F O   1 
ATOM   2654 C CB  . ASN F 2 5   ? 7.218   32.391  19.824 1.00 29.26 ? 5    ASN F CB  1 
ATOM   2655 C CG  . ASN F 2 5   ? 6.776   31.240  20.710 1.00 26.18 ? 5    ASN F CG  1 
ATOM   2656 O OD1 . ASN F 2 5   ? 6.440   30.156  20.223 1.00 23.22 ? 5    ASN F OD1 1 
ATOM   2657 N ND2 . ASN F 2 5   ? 6.774   31.470  22.015 1.00 24.47 ? 5    ASN F ND2 1 
ATOM   2658 N N   . VAL F 2 6   ? 8.979   30.079  17.626 1.00 44.49 ? 6    VAL F N   1 
ATOM   2659 C CA  . VAL F 2 6   ? 10.189  29.265  17.573 1.00 48.93 ? 6    VAL F CA  1 
ATOM   2660 C C   . VAL F 2 6   ? 10.597  28.983  16.131 1.00 51.24 ? 6    VAL F C   1 
ATOM   2661 O O   . VAL F 2 6   ? 9.796   29.131  15.207 1.00 52.25 ? 6    VAL F O   1 
ATOM   2662 C CB  . VAL F 2 6   ? 10.044  27.960  18.377 1.00 50.75 ? 6    VAL F CB  1 
ATOM   2663 C CG1 . VAL F 2 6   ? 11.298  27.127  18.228 1.00 53.07 ? 6    VAL F CG1 1 
ATOM   2664 C CG2 . VAL F 2 6   ? 9.786   28.257  19.844 1.00 48.90 ? 6    VAL F CG2 1 
ATOM   2665 N N   . SER G 1 2   ? 14.759  -32.581 62.283 1.00 47.35 ? 452  SER G N   1 
ATOM   2666 C CA  . SER G 1 2   ? 13.692  -33.563 62.439 1.00 44.03 ? 452  SER G CA  1 
ATOM   2667 C C   . SER G 1 2   ? 12.323  -32.963 62.130 1.00 37.82 ? 452  SER G C   1 
ATOM   2668 O O   . SER G 1 2   ? 11.337  -33.686 62.003 1.00 36.35 ? 452  SER G O   1 
ATOM   2669 C CB  . SER G 1 2   ? 13.718  -34.176 63.841 1.00 48.01 ? 452  SER G CB  1 
ATOM   2670 O OG  . SER G 1 2   ? 13.886  -33.178 64.831 1.00 51.82 ? 452  SER G OG  1 
ATOM   2671 N N   . LYS G 1 3   ? 12.260  -31.640 62.018 1.00 29.87 ? 453  LYS G N   1 
ATOM   2672 C CA  . LYS G 1 3   ? 11.066  -31.019 61.468 1.00 26.04 ? 453  LYS G CA  1 
ATOM   2673 C C   . LYS G 1 3   ? 11.009  -31.302 59.966 1.00 18.04 ? 453  LYS G C   1 
ATOM   2674 O O   . LYS G 1 3   ? 12.027  -31.205 59.276 1.00 19.90 ? 453  LYS G O   1 
ATOM   2675 C CB  . LYS G 1 3   ? 11.079  -29.510 61.715 1.00 30.79 ? 453  LYS G CB  1 
ATOM   2676 C CG  . LYS G 1 3   ? 11.244  -29.136 63.183 1.00 38.27 ? 453  LYS G CG  1 
ATOM   2677 C CD  . LYS G 1 3   ? 10.817  -27.704 63.468 1.00 41.87 ? 453  LYS G CD  1 
ATOM   2678 C CE  . LYS G 1 3   ? 11.641  -26.707 62.680 1.00 42.01 ? 453  LYS G CE  1 
ATOM   2679 N NZ  . LYS G 1 3   ? 11.421  -25.308 63.152 1.00 45.97 ? 453  LYS G NZ  1 
ATOM   2680 N N   . PRO G 1 4   ? 9.849   -31.676 59.437 1.00 17.50 ? 454  PRO G N   1 
ATOM   2681 C CA  . PRO G 1 4   ? 9.761   -31.975 58.002 1.00 16.86 ? 454  PRO G CA  1 
ATOM   2682 C C   . PRO G 1 4   ? 9.763   -30.701 57.171 1.00 14.64 ? 454  PRO G C   1 
ATOM   2683 O O   . PRO G 1 4   ? 9.189   -29.679 57.559 1.00 15.28 ? 454  PRO G O   1 
ATOM   2684 C CB  . PRO G 1 4   ? 8.416   -32.704 57.874 1.00 23.45 ? 454  PRO G CB  1 
ATOM   2685 C CG  . PRO G 1 4   ? 8.024   -33.077 59.291 1.00 26.80 ? 454  PRO G CG  1 
ATOM   2686 C CD  . PRO G 1 4   ? 8.602   -32.000 60.144 1.00 24.96 ? 454  PRO G CD  1 
ATOM   2687 N N   . LEU G 1 5   ? 10.421  -30.774 56.010 1.00 13.24 ? 455  LEU G N   1 
ATOM   2688 C CA  . LEU G 1 5   ? 10.480  -29.622 55.112 1.00 13.15 ? 455  LEU G CA  1 
ATOM   2689 C C   . LEU G 1 5   ? 9.090   -29.139 54.716 1.00 12.09 ? 455  LEU G C   1 
ATOM   2690 O O   . LEU G 1 5   ? 8.850   -27.925 54.637 1.00 12.15 ? 455  LEU G O   1 
ATOM   2691 C CB  . LEU G 1 5   ? 11.296  -29.964 53.865 1.00 13.54 ? 455  LEU G CB  1 
ATOM   2692 C CG  . LEU G 1 5   ? 12.808  -29.847 54.022 1.00 13.22 ? 455  LEU G CG  1 
ATOM   2693 C CD1 . LEU G 1 5   ? 13.522  -30.592 52.904 1.00 15.31 ? 455  LEU G CD1 1 
ATOM   2694 C CD2 . LEU G 1 5   ? 13.207  -28.373 54.060 1.00 12.20 ? 455  LEU G CD2 1 
ATOM   2695 N N   . ALA G 1 6   ? 8.161   -30.067 54.468 1.00 12.54 ? 456  ALA G N   1 
ATOM   2696 C CA  . ALA G 1 6   ? 6.836   -29.678 53.998 1.00 15.12 ? 456  ALA G CA  1 
ATOM   2697 C C   . ALA G 1 6   ? 6.070   -28.852 55.022 1.00 16.52 ? 456  ALA G C   1 
ATOM   2698 O O   . ALA G 1 6   ? 5.121   -28.151 54.651 1.00 23.44 ? 456  ALA G O   1 
ATOM   2699 C CB  . ALA G 1 6   ? 6.026   -30.915 53.600 1.00 17.48 ? 456  ALA G CB  1 
ATOM   2700 N N   . GLU G 1 7   ? 6.459   -28.905 56.291 1.00 15.16 ? 457  GLU G N   1 
ATOM   2701 C CA  . GLU G 1 7   ? 5.793   -28.119 57.320 1.00 17.73 ? 457  GLU G CA  1 
ATOM   2702 C C   . GLU G 1 7   ? 6.352   -26.709 57.460 1.00 16.28 ? 457  GLU G C   1 
ATOM   2703 O O   . GLU G 1 7   ? 5.793   -25.913 58.221 1.00 20.61 ? 457  GLU G O   1 
ATOM   2704 C CB  . GLU G 1 7   ? 5.858   -28.835 58.672 1.00 19.41 ? 457  GLU G CB  1 
ATOM   2705 C CG  . GLU G 1 7   ? 4.977   -30.075 58.747 1.00 22.11 ? 457  GLU G CG  1 
ATOM   2706 C CD  . GLU G 1 7   ? 4.970   -30.718 60.121 1.00 27.18 ? 457  GLU G CD  1 
ATOM   2707 O OE1 . GLU G 1 7   ? 5.739   -30.268 61.002 1.00 26.76 ? 457  GLU G OE1 1 
ATOM   2708 O OE2 . GLU G 1 7   ? 4.192   -31.676 60.320 1.00 28.59 ? 457  GLU G OE2 1 
ATOM   2709 N N   . GLN G 1 8   ? 7.427   -26.375 56.752 1.00 12.05 ? 458  GLN G N   1 
ATOM   2710 C CA  . GLN G 1 8   ? 8.055   -25.067 56.890 1.00 10.82 ? 458  GLN G CA  1 
ATOM   2711 C C   . GLN G 1 8   ? 7.475   -24.097 55.867 1.00 12.49 ? 458  GLN G C   1 
ATOM   2712 O O   . GLN G 1 8   ? 7.411   -24.409 54.674 1.00 12.61 ? 458  GLN G O   1 
ATOM   2713 C CB  . GLN G 1 8   ? 9.561   -25.191 56.673 1.00 11.56 ? 458  GLN G CB  1 
ATOM   2714 C CG  . GLN G 1 8   ? 10.210  -26.288 57.493 1.00 14.85 ? 458  GLN G CG  1 
ATOM   2715 C CD  . GLN G 1 8   ? 9.756   -26.281 58.945 1.00 19.57 ? 458  GLN G CD  1 
ATOM   2716 O OE1 . GLN G 1 8   ? 9.870   -25.272 59.644 1.00 22.43 ? 458  GLN G OE1 1 
ATOM   2717 N NE2 . GLN G 1 8   ? 9.226   -27.410 59.400 1.00 20.75 ? 458  GLN G NE2 1 
ATOM   2718 N N   . ASP G 1 9   ? 7.093   -22.903 56.334 1.00 13.37 ? 459  ASP G N   1 
ATOM   2719 C CA  . ASP G 1 9   ? 6.481   -21.910 55.452 1.00 13.86 ? 459  ASP G CA  1 
ATOM   2720 C C   . ASP G 1 9   ? 7.390   -21.538 54.285 1.00 11.73 ? 459  ASP G C   1 
ATOM   2721 O O   . ASP G 1 9   ? 6.903   -21.265 53.180 1.00 11.93 ? 459  ASP G O   1 
ATOM   2722 C CB  . ASP G 1 9   ? 6.140   -20.640 56.237 1.00 17.66 ? 459  ASP G CB  1 
ATOM   2723 C CG  . ASP G 1 9   ? 5.119   -20.871 57.335 1.00 26.53 ? 459  ASP G CG  1 
ATOM   2724 O OD1 . ASP G 1 9   ? 5.158   -20.124 58.339 1.00 29.26 ? 459  ASP G OD1 1 
ATOM   2725 O OD2 . ASP G 1 9   ? 4.285   -21.790 57.200 1.00 29.06 ? 459  ASP G OD2 1 
ATOM   2726 N N   . TRP G 1 10  ? 8.703   -21.521 54.508 1.00 10.30 ? 460  TRP G N   1 
ATOM   2727 C CA  . TRP G 1 10  ? 9.664   -21.066 53.512 1.00 9.29  ? 460  TRP G CA  1 
ATOM   2728 C C   . TRP G 1 10  ? 10.078  -22.145 52.515 1.00 8.24  ? 460  TRP G C   1 
ATOM   2729 O O   . TRP G 1 10  ? 10.904  -21.861 51.646 1.00 7.81  ? 460  TRP G O   1 
ATOM   2730 C CB  . TRP G 1 10  ? 10.900  -20.481 54.210 1.00 9.40  ? 460  TRP G CB  1 
ATOM   2731 C CG  . TRP G 1 10  ? 11.382  -21.306 55.384 1.00 8.94  ? 460  TRP G CG  1 
ATOM   2732 C CD1 . TRP G 1 10  ? 11.192  -21.025 56.704 1.00 10.38 ? 460  TRP G CD1 1 
ATOM   2733 C CD2 . TRP G 1 10  ? 12.121  -22.543 55.337 1.00 8.58  ? 460  TRP G CD2 1 
ATOM   2734 N NE1 . TRP G 1 10  ? 11.772  -22.002 57.482 1.00 11.51 ? 460  TRP G NE1 1 
ATOM   2735 C CE2 . TRP G 1 10  ? 12.343  -22.947 56.671 1.00 9.20  ? 460  TRP G CE2 1 
ATOM   2736 C CE3 . TRP G 1 10  ? 12.614  -23.346 54.299 1.00 9.68  ? 460  TRP G CE3 1 
ATOM   2737 C CZ2 . TRP G 1 10  ? 13.037  -24.116 56.999 1.00 10.82 ? 460  TRP G CZ2 1 
ATOM   2738 C CZ3 . TRP G 1 10  ? 13.305  -24.517 54.629 1.00 9.25  ? 460  TRP G CZ3 1 
ATOM   2739 C CH2 . TRP G 1 10  ? 13.506  -24.886 55.968 1.00 9.91  ? 460  TRP G CH2 1 
ATOM   2740 N N   . TYR G 1 11  ? 9.551   -23.366 52.610 1.00 8.68  ? 461  TYR G N   1 
ATOM   2741 C CA  . TYR G 1 11  ? 9.905   -24.418 51.665 1.00 8.30  ? 461  TYR G CA  1 
ATOM   2742 C C   . TYR G 1 11  ? 8.899   -24.434 50.518 1.00 8.63  ? 461  TYR G C   1 
ATOM   2743 O O   . TYR G 1 11  ? 7.693   -24.596 50.744 1.00 11.11 ? 461  TYR G O   1 
ATOM   2744 C CB  . TYR G 1 11  ? 9.938   -25.768 52.374 1.00 9.74  ? 461  TYR G CB  1 
ATOM   2745 C CG  . TYR G 1 11  ? 10.160  -26.920 51.428 1.00 10.02 ? 461  TYR G CG  1 
ATOM   2746 C CD1 . TYR G 1 11  ? 11.382  -27.091 50.782 1.00 11.29 ? 461  TYR G CD1 1 
ATOM   2747 C CD2 . TYR G 1 11  ? 9.143   -27.828 51.161 1.00 12.38 ? 461  TYR G CD2 1 
ATOM   2748 C CE1 . TYR G 1 11  ? 11.579  -28.147 49.906 1.00 14.51 ? 461  TYR G CE1 1 
ATOM   2749 C CE2 . TYR G 1 11  ? 9.337   -28.884 50.284 1.00 15.01 ? 461  TYR G CE2 1 
ATOM   2750 C CZ  . TYR G 1 11  ? 10.554  -29.033 49.666 1.00 14.83 ? 461  TYR G CZ  1 
ATOM   2751 O OH  . TYR G 1 11  ? 10.727  -30.090 48.792 1.00 19.31 ? 461  TYR G OH  1 
ATOM   2752 N N   . HIS G 1 12  ? 9.396   -24.289 49.293 1.00 8.19  ? 462  HIS G N   1 
ATOM   2753 C CA  . HIS G 1 12  ? 8.546   -24.184 48.111 1.00 8.37  ? 462  HIS G CA  1 
ATOM   2754 C C   . HIS G 1 12  ? 8.649   -25.376 47.166 1.00 10.16 ? 462  HIS G C   1 
ATOM   2755 O O   . HIS G 1 12  ? 8.112   -25.314 46.053 1.00 11.41 ? 462  HIS G O   1 
ATOM   2756 C CB  . HIS G 1 12  ? 8.843   -22.893 47.347 1.00 8.38  ? 462  HIS G CB  1 
ATOM   2757 C CG  . HIS G 1 12  ? 8.385   -21.654 48.048 1.00 9.50  ? 462  HIS G CG  1 
ATOM   2758 N ND1 . HIS G 1 12  ? 7.478   -20.778 47.486 1.00 11.38 ? 462  HIS G ND1 1 
ATOM   2759 C CD2 . HIS G 1 12  ? 8.712   -21.140 49.257 1.00 8.08  ? 462  HIS G CD2 1 
ATOM   2760 C CE1 . HIS G 1 12  ? 7.270   -19.778 48.324 1.00 11.69 ? 462  HIS G CE1 1 
ATOM   2761 N NE2 . HIS G 1 12  ? 8.002   -19.975 49.407 1.00 10.94 ? 462  HIS G NE2 1 
ATOM   2762 N N   . GLY G 1 13  ? 9.321   -26.454 47.562 1.00 9.35  ? 463  GLY G N   1 
ATOM   2763 C CA  . GLY G 1 13  ? 9.353   -27.628 46.698 1.00 10.26 ? 463  GLY G CA  1 
ATOM   2764 C C   . GLY G 1 13  ? 10.091  -27.332 45.406 1.00 9.31  ? 463  GLY G C   1 
ATOM   2765 O O   . GLY G 1 13  ? 11.092  -26.609 45.377 1.00 10.99 ? 463  GLY G O   1 
ATOM   2766 N N   . ALA G 1 14  ? 9.577   -27.863 44.302 1.00 11.67 ? 464  ALA G N   1 
ATOM   2767 C CA  . ALA G 1 14  ? 10.310  -27.802 43.042 1.00 11.22 ? 464  ALA G CA  1 
ATOM   2768 C C   . ALA G 1 14  ? 9.948   -26.600 42.173 1.00 11.63 ? 464  ALA G C   1 
ATOM   2769 O O   . ALA G 1 14  ? 9.992   -26.705 40.944 1.00 13.88 ? 464  ALA G O   1 
ATOM   2770 C CB  . ALA G 1 14  ? 10.146  -29.115 42.279 1.00 15.08 ? 464  ALA G CB  1 
ATOM   2771 N N   . ILE G 1 15  ? 9.638   -25.438 42.753 1.00 10.15 ? 465  ILE G N   1 
ATOM   2772 C CA  . ILE G 1 15  ? 9.393   -24.282 41.880 1.00 10.51 ? 465  ILE G CA  1 
ATOM   2773 C C   . ILE G 1 15  ? 10.675  -23.945 41.136 1.00 10.94 ? 465  ILE G C   1 
ATOM   2774 O O   . ILE G 1 15  ? 11.780  -24.068 41.710 1.00 12.39 ? 465  ILE G O   1 
ATOM   2775 C CB  . ILE G 1 15  ? 8.881   -23.061 42.664 1.00 11.61 ? 465  ILE G CB  1 
ATOM   2776 C CG1 . ILE G 1 15  ? 9.902   -22.597 43.711 1.00 11.79 ? 465  ILE G CG1 1 
ATOM   2777 C CG2 . ILE G 1 15  ? 7.531   -23.342 43.280 1.00 11.30 ? 465  ILE G CG2 1 
ATOM   2778 C CD1 . ILE G 1 15  ? 9.657   -21.181 44.182 1.00 12.27 ? 465  ILE G CD1 1 
ATOM   2779 N N   . PRO G 1 16  ? 10.605  -23.556 39.874 1.00 10.50 ? 466  PRO G N   1 
ATOM   2780 C CA  . PRO G 1 16  ? 11.814  -23.200 39.133 1.00 11.31 ? 466  PRO G CA  1 
ATOM   2781 C C   . PRO G 1 16  ? 12.346  -21.840 39.544 1.00 11.20 ? 466  PRO G C   1 
ATOM   2782 O O   . PRO G 1 16  ? 11.653  -21.017 40.148 1.00 10.94 ? 466  PRO G O   1 
ATOM   2783 C CB  . PRO G 1 16  ? 11.317  -23.137 37.689 1.00 12.42 ? 466  PRO G CB  1 
ATOM   2784 C CG  . PRO G 1 16  ? 9.891   -22.728 37.823 1.00 12.53 ? 466  PRO G CG  1 
ATOM   2785 C CD  . PRO G 1 16  ? 9.398   -23.470 39.039 1.00 11.89 ? 466  PRO G CD  1 
ATOM   2786 N N   . ARG G 1 17  ? 13.607  -21.614 39.165 1.00 10.34 ? 467  ARG G N   1 
ATOM   2787 C CA  . ARG G 1 17  ? 14.274  -20.350 39.455 1.00 9.84  ? 467  ARG G CA  1 
ATOM   2788 C C   . ARG G 1 17  ? 13.435  -19.146 39.022 1.00 10.23 ? 467  ARG G C   1 
ATOM   2789 O O   . ARG G 1 17  ? 13.332  -18.157 39.758 1.00 10.11 ? 467  ARG G O   1 
ATOM   2790 C CB  . ARG G 1 17  ? 15.641  -20.331 38.771 1.00 11.88 ? 467  ARG G CB  1 
ATOM   2791 C CG  . ARG G 1 17  ? 16.396  -19.022 38.949 1.00 12.03 ? 467  ARG G CG  1 
ATOM   2792 C CD  . ARG G 1 17  ? 17.735  -19.060 38.222 1.00 12.10 ? 467  ARG G CD  1 
ATOM   2793 N NE  . ARG G 1 17  ? 18.669  -19.959 38.897 1.00 12.10 ? 467  ARG G NE  1 
ATOM   2794 C CZ  . ARG G 1 17  ? 19.927  -19.650 39.218 1.00 11.98 ? 467  ARG G CZ  1 
ATOM   2795 N NH1 . ARG G 1 17  ? 20.435  -18.461 38.908 1.00 14.19 ? 467  ARG G NH1 1 
ATOM   2796 N NH2 . ARG G 1 17  ? 20.684  -20.531 39.843 1.00 11.46 ? 467  ARG G NH2 1 
ATOM   2797 N N   . ILE G 1 18  ? 12.815  -19.212 37.840 1.00 8.87  ? 468  ILE G N   1 
ATOM   2798 C CA  . ILE G 1 18  ? 12.059  -18.064 37.335 1.00 10.18 ? 468  ILE G CA  1 
ATOM   2799 C C   . ILE G 1 18  ? 10.886  -17.718 38.248 1.00 10.56 ? 468  ILE G C   1 
ATOM   2800 O O   . ILE G 1 18  ? 10.507  -16.545 38.365 1.00 12.97 ? 468  ILE G O   1 
ATOM   2801 C CB  . ILE G 1 18  ? 11.632  -18.272 35.863 1.00 9.89  ? 468  ILE G CB  1 
ATOM   2802 C CG1 . ILE G 1 18  ? 11.101  -16.964 35.270 1.00 13.21 ? 468  ILE G CG1 1 
ATOM   2803 C CG2 . ILE G 1 18  ? 10.593  -19.382 35.744 1.00 11.79 ? 468  ILE G CG2 1 
ATOM   2804 C CD1 . ILE G 1 18  ? 12.134  -15.860 35.188 1.00 14.16 ? 468  ILE G CD1 1 
ATOM   2805 N N   . GLU G 1 19  ? 10.291  -18.714 38.910 1.00 8.74  ? 469  GLU G N   1 
ATOM   2806 C CA  . GLU G 1 19  ? 9.212   -18.436 39.852 1.00 11.09 ? 469  GLU G CA  1 
ATOM   2807 C C   . GLU G 1 19  ? 9.743   -17.884 41.167 1.00 12.29 ? 469  GLU G C   1 
ATOM   2808 O O   . GLU G 1 19  ? 9.121   -17.001 41.775 1.00 12.22 ? 469  GLU G O   1 
ATOM   2809 C CB  . GLU G 1 19  ? 8.389   -19.698 40.092 1.00 11.30 ? 469  GLU G CB  1 
ATOM   2810 C CG  . GLU G 1 19  ? 7.537   -20.057 38.895 1.00 13.07 ? 469  GLU G CG  1 
ATOM   2811 C CD  . GLU G 1 19  ? 6.649   -21.253 39.136 1.00 15.73 ? 469  GLU G CD  1 
ATOM   2812 O OE1 . GLU G 1 19  ? 6.138   -21.812 38.137 1.00 15.14 ? 469  GLU G OE1 1 
ATOM   2813 O OE2 . GLU G 1 19  ? 6.454   -21.641 40.309 1.00 14.76 ? 469  GLU G OE2 1 
ATOM   2814 N N   . ALA G 1 20  ? 10.891  -18.387 41.620 1.00 13.34 ? 470  ALA G N   1 
ATOM   2815 C CA  . ALA G 1 20  ? 11.506  -17.824 42.815 1.00 12.10 ? 470  ALA G CA  1 
ATOM   2816 C C   . ALA G 1 20  ? 11.783  -16.342 42.628 1.00 12.31 ? 470  ALA G C   1 
ATOM   2817 O O   . ALA G 1 20  ? 11.687  -15.563 43.583 1.00 13.44 ? 470  ALA G O   1 
ATOM   2818 C CB  . ALA G 1 20  ? 12.790  -18.582 43.149 1.00 14.98 ? 470  ALA G CB  1 
ATOM   2819 N N   . GLN G 1 21  ? 12.084  -15.932 41.394 1.00 15.44 ? 471  GLN G N   1 
ATOM   2820 C CA  . GLN G 1 21  ? 12.355  -14.528 41.099 1.00 19.86 ? 471  GLN G CA  1 
ATOM   2821 C C   . GLN G 1 21  ? 11.165  -13.637 41.442 1.00 19.29 ? 471  GLN G C   1 
ATOM   2822 O O   . GLN G 1 21  ? 11.342  -12.519 41.944 1.00 27.06 ? 471  GLN G O   1 
ATOM   2823 C CB  . GLN G 1 21  ? 12.729  -14.397 39.621 1.00 19.88 ? 471  GLN G CB  1 
ATOM   2824 C CG  . GLN G 1 21  ? 13.139  -13.012 39.156 1.00 26.25 ? 471  GLN G CG  1 
ATOM   2825 C CD  . GLN G 1 21  ? 13.553  -13.007 37.692 1.00 29.24 ? 471  GLN G CD  1 
ATOM   2826 O OE1 . GLN G 1 21  ? 14.458  -13.738 37.289 1.00 35.05 ? 471  GLN G OE1 1 
ATOM   2827 N NE2 . GLN G 1 21  ? 12.877  -12.196 36.888 1.00 36.07 ? 471  GLN G NE2 1 
ATOM   2828 N N   . GLU G 1 22  ? 9.944   -14.110 41.187 1.00 17.81 ? 472  GLU G N   1 
ATOM   2829 C CA  . GLU G 1 22  ? 8.752   -13.329 41.502 1.00 17.70 ? 472  GLU G CA  1 
ATOM   2830 C C   . GLU G 1 22  ? 8.511   -13.220 42.998 1.00 18.82 ? 472  GLU G C   1 
ATOM   2831 O O   . GLU G 1 22  ? 7.833   -12.287 43.444 1.00 19.79 ? 472  GLU G O   1 
ATOM   2832 C CB  . GLU G 1 22  ? 7.518   -13.988 40.884 1.00 24.58 ? 472  GLU G CB  1 
ATOM   2833 C CG  . GLU G 1 22  ? 7.539   -14.100 39.376 1.00 33.86 ? 472  GLU G CG  1 
ATOM   2834 C CD  . GLU G 1 22  ? 7.267   -12.778 38.690 1.00 41.61 ? 472  GLU G CD  1 
ATOM   2835 O OE1 . GLU G 1 22  ? 7.780   -12.574 37.570 1.00 46.46 ? 472  GLU G OE1 1 
ATOM   2836 O OE2 . GLU G 1 22  ? 6.540   -11.946 39.272 1.00 43.42 ? 472  GLU G OE2 1 
ATOM   2837 N N   . LEU G 1 23  ? 9.040   -14.155 43.780 1.00 13.41 ? 473  LEU G N   1 
ATOM   2838 C CA  . LEU G 1 23  ? 8.738   -14.217 45.200 1.00 12.30 ? 473  LEU G CA  1 
ATOM   2839 C C   . LEU G 1 23  ? 9.750   -13.480 46.061 1.00 12.81 ? 473  LEU G C   1 
ATOM   2840 O O   . LEU G 1 23  ? 9.470   -13.221 47.238 1.00 13.49 ? 473  LEU G O   1 
ATOM   2841 C CB  . LEU G 1 23  ? 8.672   -15.681 45.638 1.00 10.83 ? 473  LEU G CB  1 
ATOM   2842 C CG  . LEU G 1 23  ? 7.499   -16.452 45.033 1.00 14.03 ? 473  LEU G CG  1 
ATOM   2843 C CD1 . LEU G 1 23  ? 7.741   -17.946 45.141 1.00 14.38 ? 473  LEU G CD1 1 
ATOM   2844 C CD2 . LEU G 1 23  ? 6.200   -16.067 45.721 1.00 21.26 ? 473  LEU G CD2 1 
ATOM   2845 N N   . LEU G 1 24  ? 10.908  -13.140 45.509 1.00 10.46 ? 474  LEU G N   1 
ATOM   2846 C CA  . LEU G 1 24  ? 12.007  -12.551 46.264 1.00 10.04 ? 474  LEU G CA  1 
ATOM   2847 C C   . LEU G 1 24  ? 12.140  -11.108 45.805 1.00 10.77 ? 474  LEU G C   1 
ATOM   2848 O O   . LEU G 1 24  ? 12.583  -10.848 44.683 1.00 12.88 ? 474  LEU G O   1 
ATOM   2849 C CB  . LEU G 1 24  ? 13.286  -13.349 46.014 1.00 11.01 ? 474  LEU G CB  1 
ATOM   2850 C CG  . LEU G 1 24  ? 13.170  -14.813 46.463 1.00 12.27 ? 474  LEU G CG  1 
ATOM   2851 C CD1 . LEU G 1 24  ? 14.360  -15.633 45.992 1.00 14.64 ? 474  LEU G CD1 1 
ATOM   2852 C CD2 . LEU G 1 24  ? 13.022  -14.911 47.978 1.00 12.43 ? 474  LEU G CD2 1 
ATOM   2853 N N   . LYS G 1 25  ? 11.756  -10.176 46.676 1.00 10.55 ? 475  LYS G N   1 
ATOM   2854 C CA  . LYS G 1 25  ? 11.608  -8.777  46.289 1.00 11.69 ? 475  LYS G CA  1 
ATOM   2855 C C   . LYS G 1 25  ? 12.297  -7.791  47.210 1.00 11.46 ? 475  LYS G C   1 
ATOM   2856 O O   . LYS G 1 25  ? 12.573  -6.664  46.769 1.00 12.63 ? 475  LYS G O   1 
ATOM   2857 C CB  . LYS G 1 25  ? 10.120  -8.400  46.218 1.00 14.61 ? 475  LYS G CB  1 
ATOM   2858 C CG  . LYS G 1 25  ? 9.342   -9.098  45.125 1.00 19.36 ? 475  LYS G CG  1 
ATOM   2859 C CD  . LYS G 1 25  ? 9.847   -8.693  43.752 1.00 28.51 ? 475  LYS G CD  1 
ATOM   2860 C CE  . LYS G 1 25  ? 9.048   -9.362  42.646 1.00 31.40 ? 475  LYS G CE  1 
ATOM   2861 N NZ  . LYS G 1 25  ? 7.602   -9.025  42.738 1.00 35.48 ? 475  LYS G NZ  1 
ATOM   2862 N N   . LYS G 1 26  ? 12.572  -8.154  48.460 1.00 10.30 ? 476  LYS G N   1 
ATOM   2863 C CA  . LYS G 1 26  ? 13.053  -7.225  49.467 1.00 10.61 ? 476  LYS G CA  1 
ATOM   2864 C C   . LYS G 1 26  ? 14.225  -7.832  50.222 1.00 9.61  ? 476  LYS G C   1 
ATOM   2865 O O   . LYS G 1 26  ? 14.329  -9.056  50.354 1.00 9.02  ? 476  LYS G O   1 
ATOM   2866 C CB  . LYS G 1 26  ? 11.937  -6.875  50.461 1.00 13.59 ? 476  LYS G CB  1 
ATOM   2867 C CG  . LYS G 1 26  ? 10.853  -5.991  49.852 1.00 17.51 ? 476  LYS G CG  1 
ATOM   2868 C CD  . LYS G 1 26  ? 9.625   -5.887  50.749 1.00 20.93 ? 476  LYS G CD  1 
ATOM   2869 C CE  . LYS G 1 26  ? 8.594   -4.907  50.183 1.00 20.57 ? 476  LYS G CE  1 
ATOM   2870 N NZ  . LYS G 1 26  ? 9.053   -3.489  50.281 1.00 22.93 ? 476  LYS G NZ  1 
ATOM   2871 N N   . GLN G 1 27  ? 15.094  -6.958  50.728 1.00 10.55 ? 477  GLN G N   1 
ATOM   2872 C CA  . GLN G 1 27  ? 16.307  -7.365  51.428 1.00 10.66 ? 477  GLN G CA  1 
ATOM   2873 C C   . GLN G 1 27  ? 16.023  -8.449  52.459 1.00 9.25  ? 477  GLN G C   1 
ATOM   2874 O O   . GLN G 1 27  ? 15.195  -8.273  53.357 1.00 10.61 ? 477  GLN G O   1 
ATOM   2875 C CB  . GLN G 1 27  ? 16.902  -6.143  52.125 1.00 12.03 ? 477  GLN G CB  1 
ATOM   2876 C CG  . GLN G 1 27  ? 18.258  -6.396  52.745 1.00 14.02 ? 477  GLN G CG  1 
ATOM   2877 C CD  . GLN G 1 27  ? 19.384  -6.251  51.743 1.00 19.60 ? 477  GLN G CD  1 
ATOM   2878 O OE1 . GLN G 1 27  ? 19.154  -6.187  50.536 1.00 15.50 ? 477  GLN G OE1 1 
ATOM   2879 N NE2 . GLN G 1 27  ? 20.616  -6.164  52.244 1.00 22.84 ? 477  GLN G NE2 1 
ATOM   2880 N N   . GLY G 1 28  ? 16.710  -9.577  52.328 1.00 8.97  ? 478  GLY G N   1 
ATOM   2881 C CA  . GLY G 1 28  ? 16.590  -10.634 53.305 1.00 8.85  ? 478  GLY G CA  1 
ATOM   2882 C C   . GLY G 1 28  ? 15.447  -11.606 53.084 1.00 8.82  ? 478  GLY G C   1 
ATOM   2883 O O   . GLY G 1 28  ? 15.304  -12.544 53.878 1.00 8.31  ? 478  GLY G O   1 
ATOM   2884 N N   . ASP G 1 29  ? 14.623  -11.410 52.047 1.00 8.00  ? 479  ASP G N   1 
ATOM   2885 C CA  . ASP G 1 29  ? 13.615  -12.398 51.669 1.00 7.22  ? 479  ASP G CA  1 
ATOM   2886 C C   . ASP G 1 29  ? 14.309  -13.709 51.323 1.00 6.78  ? 479  ASP G C   1 
ATOM   2887 O O   . ASP G 1 29  ? 15.346  -13.711 50.658 1.00 8.44  ? 479  ASP G O   1 
ATOM   2888 C CB  . ASP G 1 29  ? 12.902  -11.942 50.388 1.00 8.01  ? 479  ASP G CB  1 
ATOM   2889 C CG  . ASP G 1 29  ? 11.855  -10.858 50.609 1.00 9.16  ? 479  ASP G CG  1 
ATOM   2890 O OD1 . ASP G 1 29  ? 11.599  -10.446 51.758 1.00 10.98 ? 479  ASP G OD1 1 
ATOM   2891 O OD2 . ASP G 1 29  ? 11.267  -10.429 49.584 1.00 10.48 ? 479  ASP G OD2 1 
ATOM   2892 N N   . PHE G 1 30  ? 13.734  -14.835 51.747 1.00 6.79  ? 480  PHE G N   1 
ATOM   2893 C CA  . PHE G 1 30  ? 14.351  -16.114 51.413 1.00 6.55  ? 480  PHE G CA  1 
ATOM   2894 C C   . PHE G 1 30  ? 13.315  -17.218 51.287 1.00 6.48  ? 480  PHE G C   1 
ATOM   2895 O O   . PHE G 1 30  ? 12.225  -17.160 51.866 1.00 7.10  ? 480  PHE G O   1 
ATOM   2896 C CB  . PHE G 1 30  ? 15.433  -16.523 52.425 1.00 7.40  ? 480  PHE G CB  1 
ATOM   2897 C CG  . PHE G 1 30  ? 14.898  -16.900 53.781 1.00 7.29  ? 480  PHE G CG  1 
ATOM   2898 C CD1 . PHE G 1 30  ? 14.693  -15.927 54.750 1.00 8.45  ? 480  PHE G CD1 1 
ATOM   2899 C CD2 . PHE G 1 30  ? 14.636  -18.226 54.105 1.00 8.47  ? 480  PHE G CD2 1 
ATOM   2900 C CE1 . PHE G 1 30  ? 14.217  -16.264 56.002 1.00 9.85  ? 480  PHE G CE1 1 
ATOM   2901 C CE2 . PHE G 1 30  ? 14.153  -18.568 55.359 1.00 9.17  ? 480  PHE G CE2 1 
ATOM   2902 C CZ  . PHE G 1 30  ? 13.950  -17.585 56.307 1.00 9.20  ? 480  PHE G CZ  1 
ATOM   2903 N N   . LEU G 1 31  ? 13.705  -18.249 50.543 1.00 6.46  ? 481  LEU G N   1 
ATOM   2904 C CA  . LEU G 1 31  ? 12.943  -19.487 50.445 1.00 7.80  ? 481  LEU G CA  1 
ATOM   2905 C C   . LEU G 1 31  ? 13.907  -20.621 50.118 1.00 7.52  ? 481  LEU G C   1 
ATOM   2906 O O   . LEU G 1 31  ? 15.046  -20.385 49.701 1.00 7.34  ? 481  LEU G O   1 
ATOM   2907 C CB  . LEU G 1 31  ? 11.826  -19.373 49.395 1.00 7.28  ? 481  LEU G CB  1 
ATOM   2908 C CG  . LEU G 1 31  ? 12.248  -19.053 47.956 1.00 6.93  ? 481  LEU G CG  1 
ATOM   2909 C CD1 . LEU G 1 31  ? 12.665  -20.286 47.171 1.00 8.17  ? 481  LEU G CD1 1 
ATOM   2910 C CD2 . LEU G 1 31  ? 11.118  -18.345 47.222 1.00 10.22 ? 481  LEU G CD2 1 
ATOM   2911 N N   . VAL G 1 32  ? 13.442  -21.861 50.296 1.00 6.81  ? 482  VAL G N   1 
ATOM   2912 C CA  . VAL G 1 32  ? 14.200  -23.046 49.909 1.00 7.32  ? 482  VAL G CA  1 
ATOM   2913 C C   . VAL G 1 32  ? 13.420  -23.822 48.855 1.00 7.11  ? 482  VAL G C   1 
ATOM   2914 O O   . VAL G 1 32  ? 12.188  -23.922 48.925 1.00 7.45  ? 482  VAL G O   1 
ATOM   2915 C CB  . VAL G 1 32  ? 14.529  -23.926 51.132 1.00 7.23  ? 482  VAL G CB  1 
ATOM   2916 C CG1 . VAL G 1 32  ? 15.121  -25.281 50.709 1.00 8.71  ? 482  VAL G CG1 1 
ATOM   2917 C CG2 . VAL G 1 32  ? 15.478  -23.176 52.064 1.00 8.85  ? 482  VAL G CG2 1 
ATOM   2918 N N   . ARG G 1 33  ? 14.138  -24.347 47.862 1.00 7.05  ? 483  ARG G N   1 
ATOM   2919 C CA  . ARG G 1 33  ? 13.529  -25.071 46.753 1.00 7.86  ? 483  ARG G CA  1 
ATOM   2920 C C   . ARG G 1 33  ? 14.446  -26.207 46.309 1.00 9.20  ? 483  ARG G C   1 
ATOM   2921 O O   . ARG G 1 33  ? 15.619  -26.268 46.679 1.00 8.61  ? 483  ARG G O   1 
ATOM   2922 C CB  . ARG G 1 33  ? 13.234  -24.116 45.588 1.00 7.57  ? 483  ARG G CB  1 
ATOM   2923 C CG  . ARG G 1 33  ? 14.467  -23.430 45.016 1.00 8.33  ? 483  ARG G CG  1 
ATOM   2924 C CD  . ARG G 1 33  ? 14.101  -22.369 43.978 1.00 9.31  ? 483  ARG G CD  1 
ATOM   2925 N NE  . ARG G 1 33  ? 15.303  -21.677 43.519 1.00 8.58  ? 483  ARG G NE  1 
ATOM   2926 C CZ  . ARG G 1 33  ? 16.091  -22.115 42.543 1.00 9.00  ? 483  ARG G CZ  1 
ATOM   2927 N NH1 . ARG G 1 33  ? 15.795  -23.232 41.877 1.00 9.63  ? 483  ARG G NH1 1 
ATOM   2928 N NH2 . ARG G 1 33  ? 17.182  -21.433 42.228 1.00 9.10  ? 483  ARG G NH2 1 
ATOM   2929 N N   . GLU G 1 34  ? 13.891  -27.111 45.496 1.00 9.39  ? 484  GLU G N   1 
ATOM   2930 C CA  . GLU G 1 34  ? 14.631  -28.234 44.929 1.00 10.40 ? 484  GLU G CA  1 
ATOM   2931 C C   . GLU G 1 34  ? 15.191  -27.816 43.574 1.00 11.84 ? 484  GLU G C   1 
ATOM   2932 O O   . GLU G 1 34  ? 14.431  -27.414 42.688 1.00 13.63 ? 484  GLU G O   1 
ATOM   2933 C CB  . GLU G 1 34  ? 13.689  -29.426 44.716 1.00 12.31 ? 484  GLU G CB  1 
ATOM   2934 C CG  . GLU G 1 34  ? 12.776  -29.754 45.893 1.00 21.26 ? 484  GLU G CG  1 
ATOM   2935 C CD  . GLU G 1 34  ? 13.279  -30.904 46.745 1.00 27.28 ? 484  GLU G CD  1 
ATOM   2936 O OE1 . GLU G 1 34  ? 14.310  -31.516 46.393 1.00 26.85 ? 484  GLU G OE1 1 
ATOM   2937 O OE2 . GLU G 1 34  ? 12.629  -31.197 47.770 1.00 28.91 ? 484  GLU G OE2 1 
ATOM   2938 N N   . SER G 1 35  ? 16.506  -27.954 43.399 1.00 10.41 ? 485  SER G N   1 
ATOM   2939 C CA  . SER G 1 35  ? 17.181  -27.455 42.201 1.00 10.00 ? 485  SER G CA  1 
ATOM   2940 C C   . SER G 1 35  ? 16.734  -28.175 40.930 1.00 9.76  ? 485  SER G C   1 
ATOM   2941 O O   . SER G 1 35  ? 16.503  -29.387 40.925 1.00 11.69 ? 485  SER G O   1 
ATOM   2942 C CB  . SER G 1 35  ? 18.687  -27.653 42.350 1.00 9.45  ? 485  SER G CB  1 
ATOM   2943 O OG  . SER G 1 35  ? 19.393  -27.184 41.213 1.00 10.00 ? 485  SER G OG  1 
ATOM   2944 N N   . HIS G 1 36  ? 16.667  -27.422 39.830 1.00 9.95  ? 486  HIS G N   1 
ATOM   2945 C CA  . HIS G 1 36  ? 16.554  -28.007 38.497 1.00 9.84  ? 486  HIS G CA  1 
ATOM   2946 C C   . HIS G 1 36  ? 17.895  -28.135 37.795 1.00 11.65 ? 486  HIS G C   1 
ATOM   2947 O O   . HIS G 1 36  ? 18.151  -29.159 37.156 1.00 11.71 ? 486  HIS G O   1 
ATOM   2948 C CB  . HIS G 1 36  ? 15.580  -27.209 37.616 1.00 12.11 ? 486  HIS G CB  1 
ATOM   2949 C CG  . HIS G 1 36  ? 14.152  -27.352 38.037 1.00 13.89 ? 486  HIS G CG  1 
ATOM   2950 N ND1 . HIS G 1 36  ? 13.293  -28.270 37.473 1.00 18.23 ? 486  HIS G ND1 1 
ATOM   2951 C CD2 . HIS G 1 36  ? 13.442  -26.711 38.995 1.00 14.43 ? 486  HIS G CD2 1 
ATOM   2952 C CE1 . HIS G 1 36  ? 12.112  -28.181 38.058 1.00 17.24 ? 486  HIS G CE1 1 
ATOM   2953 N NE2 . HIS G 1 36  ? 12.176  -27.242 38.984 1.00 18.92 ? 486  HIS G NE2 1 
ATOM   2954 N N   . GLY G 1 37  ? 18.763  -27.127 37.906 1.00 10.92 ? 487  GLY G N   1 
ATOM   2955 C CA  . GLY G 1 37  ? 20.039  -27.188 37.214 1.00 12.34 ? 487  GLY G CA  1 
ATOM   2956 C C   . GLY G 1 37  ? 20.986  -28.214 37.801 1.00 11.24 ? 487  GLY G C   1 
ATOM   2957 O O   . GLY G 1 37  ? 21.855  -28.736 37.095 1.00 13.92 ? 487  GLY G O   1 
ATOM   2958 N N   . LYS G 1 38  ? 20.836  -28.514 39.088 1.00 10.31 ? 488  LYS G N   1 
ATOM   2959 C CA  . LYS G 1 38  ? 21.647  -29.512 39.788 1.00 10.42 ? 488  LYS G CA  1 
ATOM   2960 C C   . LYS G 1 38  ? 20.684  -30.465 40.477 1.00 9.02  ? 488  LYS G C   1 
ATOM   2961 O O   . LYS G 1 38  ? 20.438  -30.362 41.686 1.00 10.15 ? 488  LYS G O   1 
ATOM   2962 C CB  . LYS G 1 38  ? 22.605  -28.849 40.778 1.00 12.43 ? 488  LYS G CB  1 
ATOM   2963 C CG  . LYS G 1 38  ? 23.710  -28.047 40.101 1.00 14.46 ? 488  LYS G CG  1 
ATOM   2964 C CD  . LYS G 1 38  ? 24.546  -27.277 41.116 1.00 16.22 ? 488  LYS G CD  1 
ATOM   2965 C CE  . LYS G 1 38  ? 25.659  -26.487 40.440 1.00 21.43 ? 488  LYS G CE  1 
ATOM   2966 N NZ  . LYS G 1 38  ? 26.740  -27.371 39.916 1.00 26.84 ? 488  LYS G NZ  1 
ATOM   2967 N N   . PRO G 1 39  ? 20.115  -31.407 39.730 1.00 10.20 ? 489  PRO G N   1 
ATOM   2968 C CA  . PRO G 1 39  ? 19.057  -32.256 40.290 1.00 10.92 ? 489  PRO G CA  1 
ATOM   2969 C C   . PRO G 1 39  ? 19.518  -32.992 41.536 1.00 10.48 ? 489  PRO G C   1 
ATOM   2970 O O   . PRO G 1 39  ? 20.656  -33.458 41.628 1.00 12.32 ? 489  PRO G O   1 
ATOM   2971 C CB  . PRO G 1 39  ? 18.753  -33.229 39.146 1.00 12.30 ? 489  PRO G CB  1 
ATOM   2972 C CG  . PRO G 1 39  ? 19.089  -32.444 37.909 1.00 11.73 ? 489  PRO G CG  1 
ATOM   2973 C CD  . PRO G 1 39  ? 20.308  -31.635 38.288 1.00 10.41 ? 489  PRO G CD  1 
ATOM   2974 N N   . GLY G 1 40  ? 18.619  -33.066 42.512 1.00 9.72  ? 490  GLY G N   1 
ATOM   2975 C CA  . GLY G 1 40  ? 18.924  -33.665 43.793 1.00 11.76 ? 490  GLY G CA  1 
ATOM   2976 C C   . GLY G 1 40  ? 19.453  -32.711 44.842 1.00 11.35 ? 490  GLY G C   1 
ATOM   2977 O O   . GLY G 1 40  ? 19.462  -33.072 46.025 1.00 11.89 ? 490  GLY G O   1 
ATOM   2978 N N   . GLU G 1 41  ? 19.894  -31.514 44.454 1.00 9.92  ? 491  GLU G N   1 
ATOM   2979 C CA  . GLU G 1 41  ? 20.388  -30.520 45.400 1.00 9.77  ? 491  GLU G CA  1 
ATOM   2980 C C   . GLU G 1 41  ? 19.251  -29.631 45.887 1.00 9.54  ? 491  GLU G C   1 
ATOM   2981 O O   . GLU G 1 41  ? 18.266  -29.401 45.182 1.00 10.15 ? 491  GLU G O   1 
ATOM   2982 C CB  . GLU G 1 41  ? 21.449  -29.624 44.749 1.00 12.22 ? 491  GLU G CB  1 
ATOM   2983 C CG  . GLU G 1 41  ? 22.659  -30.350 44.166 1.00 12.59 ? 491  GLU G CG  1 
ATOM   2984 C CD  . GLU G 1 41  ? 23.545  -31.012 45.206 1.00 17.12 ? 491  GLU G CD  1 
ATOM   2985 O OE1 . GLU G 1 41  ? 24.362  -31.866 44.806 1.00 22.93 ? 491  GLU G OE1 1 
ATOM   2986 O OE2 . GLU G 1 41  ? 23.447  -30.684 46.410 1.00 17.47 ? 491  GLU G OE2 1 
ATOM   2987 N N   . TYR G 1 42  ? 19.409  -29.108 47.092 1.00 9.17  ? 492  TYR G N   1 
ATOM   2988 C CA  . TYR G 1 42  ? 18.513  -28.093 47.613 1.00 8.63  ? 492  TYR G CA  1 
ATOM   2989 C C   . TYR G 1 42  ? 19.176  -26.729 47.495 1.00 8.12  ? 492  TYR G C   1 
ATOM   2990 O O   . TYR G 1 42  ? 20.405  -26.611 47.523 1.00 8.82  ? 492  TYR G O   1 
ATOM   2991 C CB  . TYR G 1 42  ? 18.212  -28.358 49.077 1.00 9.55  ? 492  TYR G CB  1 
ATOM   2992 C CG  . TYR G 1 42  ? 17.310  -29.533 49.335 1.00 8.88  ? 492  TYR G CG  1 
ATOM   2993 C CD1 . TYR G 1 42  ? 17.834  -30.804 49.548 1.00 10.60 ? 492  TYR G CD1 1 
ATOM   2994 C CD2 . TYR G 1 42  ? 15.936  -29.369 49.413 1.00 10.48 ? 492  TYR G CD2 1 
ATOM   2995 C CE1 . TYR G 1 42  ? 17.005  -31.874 49.818 1.00 12.32 ? 492  TYR G CE1 1 
ATOM   2996 C CE2 . TYR G 1 42  ? 15.101  -30.435 49.686 1.00 12.00 ? 492  TYR G CE2 1 
ATOM   2997 C CZ  . TYR G 1 42  ? 15.643  -31.685 49.887 1.00 12.35 ? 492  TYR G CZ  1 
ATOM   2998 O OH  . TYR G 1 42  ? 14.819  -32.760 50.165 1.00 15.20 ? 492  TYR G OH  1 
ATOM   2999 N N   . VAL G 1 43  ? 18.343  -25.695 47.379 1.00 8.11  ? 493  VAL G N   1 
ATOM   3000 C CA  . VAL G 1 43  ? 18.793  -24.335 47.107 1.00 7.74  ? 493  VAL G CA  1 
ATOM   3001 C C   . VAL G 1 43  ? 18.148  -23.393 48.107 1.00 8.07  ? 493  VAL G C   1 
ATOM   3002 O O   . VAL G 1 43  ? 16.933  -23.449 48.327 1.00 7.67  ? 493  VAL G O   1 
ATOM   3003 C CB  . VAL G 1 43  ? 18.411  -23.897 45.678 1.00 7.93  ? 493  VAL G CB  1 
ATOM   3004 C CG1 . VAL G 1 43  ? 18.908  -22.481 45.392 1.00 10.30 ? 493  VAL G CG1 1 
ATOM   3005 C CG2 . VAL G 1 43  ? 18.930  -24.898 44.638 1.00 11.68 ? 493  VAL G CG2 1 
ATOM   3006 N N   . LEU G 1 44  ? 18.956  -22.528 48.706 1.00 7.29  ? 494  LEU G N   1 
ATOM   3007 C CA  . LEU G 1 44  ? 18.467  -21.366 49.428 1.00 7.31  ? 494  LEU G CA  1 
ATOM   3008 C C   . LEU G 1 44  ? 18.524  -20.175 48.477 1.00 7.33  ? 494  LEU G C   1 
ATOM   3009 O O   . LEU G 1 44  ? 19.608  -19.786 48.028 1.00 8.11  ? 494  LEU G O   1 
ATOM   3010 C CB  . LEU G 1 44  ? 19.347  -21.099 50.648 1.00 8.64  ? 494  LEU G CB  1 
ATOM   3011 C CG  . LEU G 1 44  ? 19.052  -19.792 51.378 1.00 9.34  ? 494  LEU G CG  1 
ATOM   3012 C CD1 . LEU G 1 44  ? 17.728  -19.842 52.114 1.00 10.60 ? 494  LEU G CD1 1 
ATOM   3013 C CD2 . LEU G 1 44  ? 20.178  -19.419 52.327 1.00 15.02 ? 494  LEU G CD2 1 
ATOM   3014 N N   . SER G 1 45  ? 17.364  -19.618 48.147 1.00 7.07  ? 495  SER G N   1 
ATOM   3015 C CA  . SER G 1 45  ? 17.271  -18.444 47.284 1.00 7.25  ? 495  SER G CA  1 
ATOM   3016 C C   . SER G 1 45  ? 16.942  -17.232 48.145 1.00 7.38  ? 495  SER G C   1 
ATOM   3017 O O   . SER G 1 45  ? 16.009  -17.278 48.953 1.00 7.52  ? 495  SER G O   1 
ATOM   3018 C CB  . SER G 1 45  ? 16.199  -18.652 46.207 1.00 8.33  ? 495  SER G CB  1 
ATOM   3019 O OG  . SER G 1 45  ? 16.552  -19.719 45.334 1.00 9.33  ? 495  SER G OG  1 
ATOM   3020 N N   . VAL G 1 46  ? 17.723  -16.160 48.001 1.00 8.78  ? 496  VAL G N   1 
ATOM   3021 C CA  . VAL G 1 46  ? 17.640  -14.994 48.884 1.00 8.72  ? 496  VAL G CA  1 
ATOM   3022 C C   . VAL G 1 46  ? 17.757  -13.722 48.057 1.00 11.15 ? 496  VAL G C   1 
ATOM   3023 O O   . VAL G 1 46  ? 18.524  -13.672 47.090 1.00 13.95 ? 496  VAL G O   1 
ATOM   3024 C CB  . VAL G 1 46  ? 18.756  -15.006 49.956 1.00 11.29 ? 496  VAL G CB  1 
ATOM   3025 C CG1 . VAL G 1 46  ? 18.497  -13.965 51.045 1.00 16.27 ? 496  VAL G CG1 1 
ATOM   3026 C CG2 . VAL G 1 46  ? 18.903  -16.348 50.590 1.00 18.11 ? 496  VAL G CG2 1 
ATOM   3027 N N   . TYR G 1 47  ? 17.019  -12.683 48.451 1.00 8.73  ? 497  TYR G N   1 
ATOM   3028 C CA  . TYR G 1 47  ? 17.171  -11.355 47.867 1.00 9.58  ? 497  TYR G CA  1 
ATOM   3029 C C   . TYR G 1 47  ? 18.131  -10.553 48.730 1.00 10.37 ? 497  TYR G C   1 
ATOM   3030 O O   . TYR G 1 47  ? 17.922  -10.424 49.940 1.00 12.08 ? 497  TYR G O   1 
ATOM   3031 C CB  . TYR G 1 47  ? 15.826  -10.631 47.844 1.00 9.83  ? 497  TYR G CB  1 
ATOM   3032 C CG  . TYR G 1 47  ? 15.781  -9.434  46.920 1.00 10.34 ? 497  TYR G CG  1 
ATOM   3033 C CD1 . TYR G 1 47  ? 16.062  -8.155  47.391 1.00 10.91 ? 497  TYR G CD1 1 
ATOM   3034 C CD2 . TYR G 1 47  ? 15.458  -9.582  45.579 1.00 10.73 ? 497  TYR G CD2 1 
ATOM   3035 C CE1 . TYR G 1 47  ? 16.012  -7.046  46.545 1.00 11.21 ? 497  TYR G CE1 1 
ATOM   3036 C CE2 . TYR G 1 47  ? 15.409  -8.491  44.724 1.00 10.74 ? 497  TYR G CE2 1 
ATOM   3037 C CZ  . TYR G 1 47  ? 15.692  -7.230  45.214 1.00 11.20 ? 497  TYR G CZ  1 
ATOM   3038 O OH  . TYR G 1 47  ? 15.637  -6.151  44.362 1.00 12.92 ? 497  TYR G OH  1 
ATOM   3039 N N   . SER G 1 48  ? 19.186  -10.025 48.121 1.00 11.49 ? 498  SER G N   1 
ATOM   3040 C CA  . SER G 1 48  ? 20.134  -9.243  48.900 1.00 14.16 ? 498  SER G CA  1 
ATOM   3041 C C   . SER G 1 48  ? 20.771  -8.192  48.012 1.00 16.53 ? 498  SER G C   1 
ATOM   3042 O O   . SER G 1 48  ? 21.276  -8.512  46.932 1.00 16.18 ? 498  SER G O   1 
ATOM   3043 C CB  . SER G 1 48  ? 21.210  -10.144 49.512 1.00 16.32 ? 498  SER G CB  1 
ATOM   3044 O OG  . SER G 1 48  ? 21.964  -9.432  50.479 1.00 23.56 ? 498  SER G OG  1 
ATOM   3045 N N   . ASP G 1 49  ? 20.745  -6.945  48.485 1.00 15.32 ? 499  ASP G N   1 
ATOM   3046 C CA  . ASP G 1 49  ? 21.337  -5.806  47.782 1.00 17.90 ? 499  ASP G CA  1 
ATOM   3047 C C   . ASP G 1 49  ? 20.852  -5.735  46.337 1.00 15.88 ? 499  ASP G C   1 
ATOM   3048 O O   . ASP G 1 49  ? 21.624  -5.558  45.392 1.00 21.70 ? 499  ASP G O   1 
ATOM   3049 C CB  . ASP G 1 49  ? 22.864  -5.809  47.887 1.00 23.55 ? 499  ASP G CB  1 
ATOM   3050 C CG  . ASP G 1 49  ? 23.344  -5.692  49.320 1.00 31.10 ? 499  ASP G CG  1 
ATOM   3051 O OD1 . ASP G 1 49  ? 22.591  -5.153  50.159 1.00 31.80 ? 499  ASP G OD1 1 
ATOM   3052 O OD2 . ASP G 1 49  ? 24.474  -6.137  49.609 1.00 35.97 ? 499  ASP G OD2 1 
ATOM   3053 N N   . GLY G 1 50  ? 19.544  -5.904  46.174 1.00 15.75 ? 500  GLY G N   1 
ATOM   3054 C CA  . GLY G 1 50  ? 18.929  -5.790  44.872 1.00 15.88 ? 500  GLY G CA  1 
ATOM   3055 C C   . GLY G 1 50  ? 19.162  -6.953  43.939 1.00 17.36 ? 500  GLY G C   1 
ATOM   3056 O O   . GLY G 1 50  ? 18.843  -6.842  42.752 1.00 22.02 ? 500  GLY G O   1 
ATOM   3057 N N   . GLN G 1 51  ? 19.690  -8.075  44.437 1.00 15.10 ? 501  GLN G N   1 
ATOM   3058 C CA  . GLN G 1 51  ? 19.989  -9.231  43.603 1.00 16.44 ? 501  GLN G CA  1 
ATOM   3059 C C   . GLN G 1 51  ? 19.402  -10.500 44.202 1.00 13.79 ? 501  GLN G C   1 
ATOM   3060 O O   . GLN G 1 51  ? 19.372  -10.686 45.422 1.00 13.76 ? 501  GLN G O   1 
ATOM   3061 C CB  . GLN G 1 51  ? 21.496  -9.427  43.441 1.00 18.26 ? 501  GLN G CB  1 
ATOM   3062 C CG  . GLN G 1 51  ? 22.194  -8.253  42.770 1.00 24.48 ? 501  GLN G CG  1 
ATOM   3063 C CD  . GLN G 1 51  ? 23.653  -8.540  42.488 1.00 33.85 ? 501  GLN G CD  1 
ATOM   3064 O OE1 . GLN G 1 51  ? 24.374  -9.042  43.351 1.00 35.74 ? 501  GLN G OE1 1 
ATOM   3065 N NE2 . GLN G 1 51  ? 24.093  -8.238  41.272 1.00 37.79 ? 501  GLN G NE2 1 
ATOM   3066 N N   . ARG G 1 52  ? 18.953  -11.388 43.328 1.00 13.16 ? 502  ARG G N   1 
ATOM   3067 C CA  . ARG G 1 52  ? 18.517  -12.707 43.752 1.00 13.47 ? 502  ARG G CA  1 
ATOM   3068 C C   . ARG G 1 52  ? 19.709  -13.642 43.674 1.00 12.90 ? 502  ARG G C   1 
ATOM   3069 O O   . ARG G 1 52  ? 20.344  -13.764 42.621 1.00 16.94 ? 502  ARG G O   1 
ATOM   3070 C CB  . ARG G 1 52  ? 17.379  -13.200 42.868 1.00 19.03 ? 502  ARG G CB  1 
ATOM   3071 C CG  . ARG G 1 52  ? 16.099  -12.463 43.164 1.00 23.90 ? 502  ARG G CG  1 
ATOM   3072 C CD  . ARG G 1 52  ? 15.231  -12.322 41.952 1.00 27.72 ? 502  ARG G CD  1 
ATOM   3073 N NE  . ARG G 1 52  ? 14.081  -11.476 42.241 1.00 23.25 ? 502  ARG G NE  1 
ATOM   3074 C CZ  . ARG G 1 52  ? 13.823  -10.323 41.635 1.00 22.68 ? 502  ARG G CZ  1 
ATOM   3075 N NH1 . ARG G 1 52  ? 14.628  -9.863  40.683 1.00 26.60 ? 502  ARG G NH1 1 
ATOM   3076 N NH2 . ARG G 1 52  ? 12.743  -9.639  41.973 1.00 22.26 ? 502  ARG G NH2 1 
ATOM   3077 N N   . ARG G 1 53  ? 20.026  -14.273 44.793 1.00 10.82 ? 503  ARG G N   1 
ATOM   3078 C CA  . ARG G 1 53  ? 21.197  -15.122 44.905 1.00 12.74 ? 503  ARG G CA  1 
ATOM   3079 C C   . ARG G 1 53  ? 20.766  -16.516 45.330 1.00 11.54 ? 503  ARG G C   1 
ATOM   3080 O O   . ARG G 1 53  ? 19.836  -16.675 46.126 1.00 11.60 ? 503  ARG G O   1 
ATOM   3081 C CB  . ARG G 1 53  ? 22.190  -14.501 45.880 1.00 15.31 ? 503  ARG G CB  1 
ATOM   3082 C CG  . ARG G 1 53  ? 22.617  -13.116 45.402 1.00 18.24 ? 503  ARG G CG  1 
ATOM   3083 C CD  . ARG G 1 53  ? 23.441  -12.371 46.413 1.00 20.89 ? 503  ARG G CD  1 
ATOM   3084 N NE  . ARG G 1 53  ? 24.735  -13.002 46.615 1.00 20.38 ? 503  ARG G NE  1 
ATOM   3085 C CZ  . ARG G 1 53  ? 25.703  -12.487 47.363 1.00 23.21 ? 503  ARG G CZ  1 
ATOM   3086 N NH1 . ARG G 1 53  ? 25.520  -11.324 47.973 1.00 27.31 ? 503  ARG G NH1 1 
ATOM   3087 N NH2 . ARG G 1 53  ? 26.851  -13.133 47.498 1.00 26.01 ? 503  ARG G NH2 1 
ATOM   3088 N N   . HIS G 1 54  ? 21.419  -17.523 44.766 1.00 8.74  ? 504  HIS G N   1 
ATOM   3089 C CA  . HIS G 1 54  ? 20.990  -18.911 44.901 1.00 8.59  ? 504  HIS G CA  1 
ATOM   3090 C C   . HIS G 1 54  ? 22.156  -19.731 45.426 1.00 9.20  ? 504  HIS G C   1 
ATOM   3091 O O   . HIS G 1 54  ? 23.146  -19.935 44.713 1.00 11.12 ? 504  HIS G O   1 
ATOM   3092 C CB  . HIS G 1 54  ? 20.485  -19.434 43.560 1.00 9.16  ? 504  HIS G CB  1 
ATOM   3093 C CG  . HIS G 1 54  ? 19.429  -18.565 42.956 1.00 7.60  ? 504  HIS G CG  1 
ATOM   3094 N ND1 . HIS G 1 54  ? 18.103  -18.644 43.327 1.00 7.58  ? 504  HIS G ND1 1 
ATOM   3095 C CD2 . HIS G 1 54  ? 19.508  -17.573 42.037 1.00 10.89 ? 504  HIS G CD2 1 
ATOM   3096 C CE1 . HIS G 1 54  ? 17.408  -17.749 42.646 1.00 9.63  ? 504  HIS G CE1 1 
ATOM   3097 N NE2 . HIS G 1 54  ? 18.238  -17.087 41.859 1.00 10.65 ? 504  HIS G NE2 1 
ATOM   3098 N N   . PHE G 1 55  ? 22.036  -20.197 46.666 1.00 8.38  ? 505  PHE G N   1 
ATOM   3099 C CA  . PHE G 1 55  ? 23.090  -20.929 47.359 1.00 9.61  ? 505  PHE G CA  1 
ATOM   3100 C C   . PHE G 1 55  ? 22.736  -22.403 47.412 1.00 9.99  ? 505  PHE G C   1 
ATOM   3101 O O   . PHE G 1 55  ? 21.639  -22.764 47.851 1.00 10.35 ? 505  PHE G O   1 
ATOM   3102 C CB  . PHE G 1 55  ? 23.222  -20.441 48.803 1.00 11.25 ? 505  PHE G CB  1 
ATOM   3103 C CG  . PHE G 1 55  ? 23.666  -19.023 48.929 1.00 10.70 ? 505  PHE G CG  1 
ATOM   3104 C CD1 . PHE G 1 55  ? 25.005  -18.719 49.142 1.00 12.28 ? 505  PHE G CD1 1 
ATOM   3105 C CD2 . PHE G 1 55  ? 22.752  -17.991 48.840 1.00 12.12 ? 505  PHE G CD2 1 
ATOM   3106 C CE1 . PHE G 1 55  ? 25.422  -17.405 49.266 1.00 14.63 ? 505  PHE G CE1 1 
ATOM   3107 C CE2 . PHE G 1 55  ? 23.162  -16.674 48.953 1.00 15.31 ? 505  PHE G CE2 1 
ATOM   3108 C CZ  . PHE G 1 55  ? 24.498  -16.381 49.168 1.00 13.64 ? 505  PHE G CZ  1 
ATOM   3109 N N   . ILE G 1 56  ? 23.673  -23.257 47.012 1.00 9.84  ? 506  ILE G N   1 
ATOM   3110 C CA  . ILE G 1 56  ? 23.479  -24.684 47.231 1.00 10.80 ? 506  ILE G CA  1 
ATOM   3111 C C   . ILE G 1 56  ? 23.584  -24.971 48.723 1.00 11.73 ? 506  ILE G C   1 
ATOM   3112 O O   . ILE G 1 56  ? 24.510  -24.505 49.400 1.00 12.74 ? 506  ILE G O   1 
ATOM   3113 C CB  . ILE G 1 56  ? 24.500  -25.502 46.424 1.00 11.95 ? 506  ILE G CB  1 
ATOM   3114 C CG1 . ILE G 1 56  ? 24.291  -25.296 44.927 1.00 14.92 ? 506  ILE G CG1 1 
ATOM   3115 C CG2 . ILE G 1 56  ? 24.395  -26.998 46.762 1.00 12.95 ? 506  ILE G CG2 1 
ATOM   3116 C CD1 . ILE G 1 56  ? 22.969  -25.773 44.445 1.00 15.42 ? 506  ILE G CD1 1 
ATOM   3117 N N   . ILE G 1 57  ? 22.594  -25.685 49.255 1.00 9.76  ? 507  ILE G N   1 
ATOM   3118 C CA  . ILE G 1 57  ? 22.670  -26.238 50.603 1.00 10.44 ? 507  ILE G CA  1 
ATOM   3119 C C   . ILE G 1 57  ? 23.409  -27.564 50.466 1.00 11.38 ? 507  ILE G C   1 
ATOM   3120 O O   . ILE G 1 57  ? 22.824  -28.563 50.046 1.00 12.28 ? 507  ILE G O   1 
ATOM   3121 C CB  . ILE G 1 57  ? 21.282  -26.420 51.217 1.00 10.66 ? 507  ILE G CB  1 
ATOM   3122 C CG1 . ILE G 1 57  ? 20.517  -25.096 51.209 1.00 12.89 ? 507  ILE G CG1 1 
ATOM   3123 C CG2 . ILE G 1 57  ? 21.384  -27.011 52.628 1.00 13.48 ? 507  ILE G CG2 1 
ATOM   3124 C CD1 . ILE G 1 57  ? 19.058  -25.233 51.578 1.00 12.68 ? 507  ILE G CD1 1 
ATOM   3125 N N   . GLN G 1 58  ? 24.701  -27.572 50.787 1.00 10.60 ? 508  GLN G N   1 
ATOM   3126 C CA  . GLN G 1 58  ? 25.525  -28.748 50.533 1.00 11.86 ? 508  GLN G CA  1 
ATOM   3127 C C   . GLN G 1 58  ? 25.122  -29.903 51.435 1.00 12.43 ? 508  GLN G C   1 
ATOM   3128 O O   . GLN G 1 58  ? 24.805  -29.718 52.612 1.00 13.62 ? 508  GLN G O   1 
ATOM   3129 C CB  . GLN G 1 58  ? 26.997  -28.426 50.762 1.00 12.38 ? 508  GLN G CB  1 
ATOM   3130 C CG  . GLN G 1 58  ? 27.589  -27.481 49.736 1.00 20.69 ? 508  GLN G CG  1 
ATOM   3131 C CD  . GLN G 1 58  ? 29.005  -27.081 50.081 1.00 24.28 ? 508  GLN G CD  1 
ATOM   3132 O OE1 . GLN G 1 58  ? 29.588  -27.587 51.044 1.00 26.51 ? 508  GLN G OE1 1 
ATOM   3133 N NE2 . GLN G 1 58  ? 29.569  -26.170 49.301 1.00 28.42 ? 508  GLN G NE2 1 
ATOM   3134 N N   . TYR G 1 59  ? 25.138  -31.103 50.874 1.00 13.05 ? 509  TYR G N   1 
ATOM   3135 C CA  . TYR G 1 59  ? 24.864  -32.331 51.615 1.00 12.60 ? 509  TYR G CA  1 
ATOM   3136 C C   . TYR G 1 59  ? 26.110  -33.203 51.494 1.00 14.02 ? 509  TYR G C   1 
ATOM   3137 O O   . TYR G 1 59  ? 26.369  -33.787 50.437 1.00 14.51 ? 509  TYR G O   1 
ATOM   3138 C CB  . TYR G 1 59  ? 23.614  -33.039 51.096 1.00 13.82 ? 509  TYR G CB  1 
ATOM   3139 C CG  . TYR G 1 59  ? 23.341  -34.342 51.810 1.00 13.96 ? 509  TYR G CG  1 
ATOM   3140 C CD1 . TYR G 1 59  ? 22.932  -34.357 53.140 1.00 13.86 ? 509  TYR G CD1 1 
ATOM   3141 C CD2 . TYR G 1 59  ? 23.512  -35.559 51.163 1.00 13.66 ? 509  TYR G CD2 1 
ATOM   3142 C CE1 . TYR G 1 59  ? 22.702  -35.555 53.809 1.00 13.54 ? 509  TYR G CE1 1 
ATOM   3143 C CE2 . TYR G 1 59  ? 23.277  -36.762 51.819 1.00 15.51 ? 509  TYR G CE2 1 
ATOM   3144 C CZ  . TYR G 1 59  ? 22.868  -36.753 53.138 1.00 13.71 ? 509  TYR G CZ  1 
ATOM   3145 O OH  . TYR G 1 59  ? 22.641  -37.947 53.794 1.00 15.66 ? 509  TYR G OH  1 
ATOM   3146 N N   . VAL G 1 60  ? 26.901  -33.250 52.562 1.00 14.60 ? 510  VAL G N   1 
ATOM   3147 C CA  . VAL G 1 60  ? 28.182  -33.946 52.574 1.00 17.42 ? 510  VAL G CA  1 
ATOM   3148 C C   . VAL G 1 60  ? 28.289  -34.699 53.889 1.00 19.08 ? 510  VAL G C   1 
ATOM   3149 O O   . VAL G 1 60  ? 28.042  -34.125 54.955 1.00 18.27 ? 510  VAL G O   1 
ATOM   3150 C CB  . VAL G 1 60  ? 29.361  -32.963 52.430 1.00 20.76 ? 510  VAL G CB  1 
ATOM   3151 C CG1 . VAL G 1 60  ? 30.686  -33.705 52.498 1.00 24.85 ? 510  VAL G CG1 1 
ATOM   3152 C CG2 . VAL G 1 60  ? 29.257  -32.171 51.133 1.00 23.56 ? 510  VAL G CG2 1 
ATOM   3153 N N   . ASP G 1 61  ? 28.640  -35.982 53.811 1.00 20.94 ? 511  ASP G N   1 
ATOM   3154 C CA  . ASP G 1 61  ? 28.855  -36.816 54.992 1.00 22.29 ? 511  ASP G CA  1 
ATOM   3155 C C   . ASP G 1 61  ? 27.666  -36.740 55.954 1.00 17.37 ? 511  ASP G C   1 
ATOM   3156 O O   . ASP G 1 61  ? 27.809  -36.538 57.160 1.00 18.88 ? 511  ASP G O   1 
ATOM   3157 C CB  . ASP G 1 61  ? 30.187  -36.480 55.673 1.00 25.19 ? 511  ASP G CB  1 
ATOM   3158 C CG  . ASP G 1 61  ? 30.570  -37.481 56.743 1.00 32.06 ? 511  ASP G CG  1 
ATOM   3159 O OD1 . ASP G 1 61  ? 30.383  -38.697 56.520 1.00 35.09 ? 511  ASP G OD1 1 
ATOM   3160 O OD2 . ASP G 1 61  ? 31.071  -37.050 57.803 1.00 38.00 ? 511  ASP G OD2 1 
ATOM   3161 N N   . ASN G 1 62  ? 26.468  -36.887 55.391 1.00 16.22 ? 512  ASN G N   1 
ATOM   3162 C CA  . ASN G 1 62  ? 25.202  -36.959 56.116 1.00 16.19 ? 512  ASN G CA  1 
ATOM   3163 C C   . ASN G 1 62  ? 24.806  -35.644 56.771 1.00 15.93 ? 512  ASN G C   1 
ATOM   3164 O O   . ASN G 1 62  ? 23.888  -35.627 57.602 1.00 17.46 ? 512  ASN G O   1 
ATOM   3165 C CB  . ASN G 1 62  ? 25.149  -38.123 57.116 1.00 19.30 ? 512  ASN G CB  1 
ATOM   3166 C CG  . ASN G 1 62  ? 25.381  -39.467 56.447 1.00 25.62 ? 512  ASN G CG  1 
ATOM   3167 O OD1 . ASN G 1 62  ? 24.517  -39.978 55.732 1.00 32.33 ? 512  ASN G OD1 1 
ATOM   3168 N ND2 . ASN G 1 62  ? 26.553  -40.043 56.674 1.00 28.80 ? 512  ASN G ND2 1 
ATOM   3169 N N   . MET G 1 63  ? 25.441  -34.538 56.393 1.00 15.48 ? 513  MET G N   1 
ATOM   3170 C CA  . MET G 1 63  ? 25.185  -33.238 56.988 1.00 15.69 ? 513  MET G CA  1 
ATOM   3171 C C   . MET G 1 63  ? 24.796  -32.245 55.910 1.00 14.74 ? 513  MET G C   1 
ATOM   3172 O O   . MET G 1 63  ? 25.354  -32.258 54.808 1.00 15.63 ? 513  MET G O   1 
ATOM   3173 C CB  . MET G 1 63  ? 26.443  -32.704 57.681 1.00 16.85 ? 513  MET G CB  1 
ATOM   3174 C CG  . MET G 1 63  ? 26.889  -33.495 58.882 1.00 19.46 ? 513  MET G CG  1 
ATOM   3175 S SD  . MET G 1 63  ? 25.668  -33.379 60.199 1.00 23.53 ? 513  MET G SD  1 
ATOM   3176 C CE  . MET G 1 63  ? 26.692  -33.726 61.618 1.00 28.39 ? 513  MET G CE  1 
ATOM   3177 N N   . TYR G 1 64  ? 23.859  -31.367 56.252 1.00 12.75 ? 514  TYR G N   1 
ATOM   3178 C CA  . TYR G 1 64  ? 23.544  -30.200 55.446 1.00 11.62 ? 514  TYR G CA  1 
ATOM   3179 C C   . TYR G 1 64  ? 24.285  -28.997 56.013 1.00 11.86 ? 514  TYR G C   1 
ATOM   3180 O O   . TYR G 1 64  ? 24.309  -28.783 57.234 1.00 13.39 ? 514  TYR G O   1 
ATOM   3181 C CB  . TYR G 1 64  ? 22.044  -29.931 55.442 1.00 12.05 ? 514  TYR G CB  1 
ATOM   3182 C CG  . TYR G 1 64  ? 21.238  -31.022 54.786 1.00 11.05 ? 514  TYR G CG  1 
ATOM   3183 C CD1 . TYR G 1 64  ? 21.031  -31.033 53.411 1.00 11.41 ? 514  TYR G CD1 1 
ATOM   3184 C CD2 . TYR G 1 64  ? 20.675  -32.037 55.541 1.00 12.15 ? 514  TYR G CD2 1 
ATOM   3185 C CE1 . TYR G 1 64  ? 20.288  -32.024 52.816 1.00 12.08 ? 514  TYR G CE1 1 
ATOM   3186 C CE2 . TYR G 1 64  ? 19.932  -33.032 54.953 1.00 12.98 ? 514  TYR G CE2 1 
ATOM   3187 C CZ  . TYR G 1 64  ? 19.738  -33.020 53.589 1.00 12.40 ? 514  TYR G CZ  1 
ATOM   3188 O OH  . TYR G 1 64  ? 18.990  -34.026 53.006 1.00 13.86 ? 514  TYR G OH  1 
ATOM   3189 N N   . ARG G 1 65  ? 24.890  -28.219 55.128 1.00 12.23 ? 515  ARG G N   1 
ATOM   3190 C CA  . ARG G 1 65  ? 25.706  -27.106 55.571 1.00 12.68 ? 515  ARG G CA  1 
ATOM   3191 C C   . ARG G 1 65  ? 25.757  -26.060 54.473 1.00 13.05 ? 515  ARG G C   1 
ATOM   3192 O O   . ARG G 1 65  ? 25.408  -26.313 53.312 1.00 13.19 ? 515  ARG G O   1 
ATOM   3193 C CB  . ARG G 1 65  ? 27.131  -27.568 55.883 1.00 16.04 ? 515  ARG G CB  1 
ATOM   3194 C CG  . ARG G 1 65  ? 27.885  -27.996 54.633 1.00 18.49 ? 515  ARG G CG  1 
ATOM   3195 C CD  . ARG G 1 65  ? 29.176  -28.735 54.938 1.00 27.50 ? 515  ARG G CD  1 
ATOM   3196 N NE  . ARG G 1 65  ? 30.006  -28.853 53.742 1.00 33.74 ? 515  ARG G NE  1 
ATOM   3197 C CZ  . ARG G 1 65  ? 31.058  -29.658 53.631 1.00 38.18 ? 515  ARG G CZ  1 
ATOM   3198 N NH1 . ARG G 1 65  ? 31.413  -30.437 54.645 1.00 37.79 ? 515  ARG G NH1 1 
ATOM   3199 N NH2 . ARG G 1 65  ? 31.751  -29.690 52.501 1.00 41.49 ? 515  ARG G NH2 1 
ATOM   3200 N N   . PHE G 1 66  ? 26.183  -24.865 54.869 1.00 13.95 ? 516  PHE G N   1 
ATOM   3201 C CA  . PHE G 1 66  ? 26.628  -23.877 53.902 1.00 14.90 ? 516  PHE G CA  1 
ATOM   3202 C C   . PHE G 1 66  ? 28.147  -23.931 53.841 1.00 17.19 ? 516  PHE G C   1 
ATOM   3203 O O   . PHE G 1 66  ? 28.706  -24.647 53.002 1.00 20.30 ? 516  PHE G O   1 
ATOM   3204 C CB  . PHE G 1 66  ? 26.077  -22.486 54.237 1.00 16.66 ? 516  PHE G CB  1 
ATOM   3205 C CG  . PHE G 1 66  ? 24.602  -22.362 53.985 1.00 15.15 ? 516  PHE G CG  1 
ATOM   3206 C CD1 . PHE G 1 66  ? 24.097  -22.546 52.704 1.00 15.16 ? 516  PHE G CD1 1 
ATOM   3207 C CD2 . PHE G 1 66  ? 23.721  -22.106 55.019 1.00 15.91 ? 516  PHE G CD2 1 
ATOM   3208 C CE1 . PHE G 1 66  ? 22.735  -22.465 52.457 1.00 19.27 ? 516  PHE G CE1 1 
ATOM   3209 C CE2 . PHE G 1 66  ? 22.357  -22.018 54.777 1.00 18.32 ? 516  PHE G CE2 1 
ATOM   3210 C CZ  . PHE G 1 66  ? 21.867  -22.201 53.493 1.00 19.66 ? 516  PHE G CZ  1 
ATOM   3211 N N   . GLU G 1 67  ? 28.821  -23.230 54.756 1.00 19.32 ? 517  GLU G N   1 
ATOM   3212 C CA  . GLU G 1 67  ? 30.276  -23.252 54.842 1.00 22.90 ? 517  GLU G CA  1 
ATOM   3213 C C   . GLU G 1 67  ? 30.778  -23.605 56.236 1.00 22.22 ? 517  GLU G C   1 
ATOM   3214 O O   . GLU G 1 67  ? 31.991  -23.568 56.468 1.00 28.58 ? 517  GLU G O   1 
ATOM   3215 C CB  . GLU G 1 67  ? 30.870  -21.899 54.439 1.00 28.44 ? 517  GLU G CB  1 
ATOM   3216 C CG  . GLU G 1 67  ? 31.086  -21.699 52.955 1.00 34.47 ? 517  GLU G CG  1 
ATOM   3217 C CD  . GLU G 1 67  ? 31.736  -20.362 52.665 1.00 39.20 ? 517  GLU G CD  1 
ATOM   3218 O OE1 . GLU G 1 67  ? 31.904  -19.574 53.620 1.00 39.17 ? 517  GLU G OE1 1 
ATOM   3219 O OE2 . GLU G 1 67  ? 32.080  -20.095 51.495 1.00 40.79 ? 517  GLU G OE2 1 
ATOM   3220 N N   . GLY G 1 68  ? 29.889  -23.936 57.167 1.00 17.94 ? 518  GLY G N   1 
ATOM   3221 C CA  . GLY G 1 68  ? 30.302  -24.124 58.540 1.00 19.40 ? 518  GLY G CA  1 
ATOM   3222 C C   . GLY G 1 68  ? 29.687  -25.340 59.193 1.00 17.41 ? 518  GLY G C   1 
ATOM   3223 O O   . GLY G 1 68  ? 29.868  -26.468 58.723 1.00 23.09 ? 518  GLY G O   1 
ATOM   3224 N N   . THR G 1 69  ? 28.960  -25.118 60.286 1.00 16.66 ? 519  THR G N   1 
ATOM   3225 C CA  . THR G 1 69  ? 28.376  -26.222 61.036 1.00 17.74 ? 519  THR G CA  1 
ATOM   3226 C C   . THR G 1 69  ? 27.429  -27.031 60.157 1.00 14.20 ? 519  THR G C   1 
ATOM   3227 O O   . THR G 1 69  ? 26.635  -26.480 59.388 1.00 14.82 ? 519  THR G O   1 
ATOM   3228 C CB  . THR G 1 69  ? 27.612  -25.665 62.238 1.00 17.14 ? 519  THR G CB  1 
ATOM   3229 O OG1 . THR G 1 69  ? 28.528  -24.993 63.109 1.00 17.56 ? 519  THR G OG1 1 
ATOM   3230 C CG2 . THR G 1 69  ? 26.913  -26.764 63.000 1.00 15.91 ? 519  THR G CG2 1 
ATOM   3231 N N   . GLY G 1 70  ? 27.520  -28.349 60.271 1.00 15.39 ? 520  GLY G N   1 
ATOM   3232 C CA  . GLY G 1 70  ? 26.604  -29.253 59.600 1.00 13.84 ? 520  GLY G CA  1 
ATOM   3233 C C   . GLY G 1 70  ? 25.508  -29.721 60.541 1.00 13.80 ? 520  GLY G C   1 
ATOM   3234 O O   . GLY G 1 70  ? 25.753  -29.980 61.721 1.00 15.61 ? 520  GLY G O   1 
ATOM   3235 N N   . PHE G 1 71  ? 24.298  -29.831 60.000 1.00 14.38 ? 521  PHE G N   1 
ATOM   3236 C CA  . PHE G 1 71  ? 23.155  -30.345 60.734 1.00 15.11 ? 521  PHE G CA  1 
ATOM   3237 C C   . PHE G 1 71  ? 22.566  -31.507 59.949 1.00 15.83 ? 521  PHE G C   1 
ATOM   3238 O O   . PHE G 1 71  ? 22.731  -31.609 58.730 1.00 14.57 ? 521  PHE G O   1 
ATOM   3239 C CB  . PHE G 1 71  ? 22.085  -29.266 60.957 1.00 16.71 ? 521  PHE G CB  1 
ATOM   3240 C CG  . PHE G 1 71  ? 22.582  -28.055 61.712 1.00 16.17 ? 521  PHE G CG  1 
ATOM   3241 C CD1 . PHE G 1 71  ? 23.110  -26.964 61.036 1.00 14.39 ? 521  PHE G CD1 1 
ATOM   3242 C CD2 . PHE G 1 71  ? 22.517  -28.009 63.098 1.00 20.86 ? 521  PHE G CD2 1 
ATOM   3243 C CE1 . PHE G 1 71  ? 23.560  -25.842 61.722 1.00 18.54 ? 521  PHE G CE1 1 
ATOM   3244 C CE2 . PHE G 1 71  ? 22.968  -26.891 63.793 1.00 21.91 ? 521  PHE G CE2 1 
ATOM   3245 C CZ  . PHE G 1 71  ? 23.491  -25.810 63.103 1.00 20.84 ? 521  PHE G CZ  1 
ATOM   3246 N N   . SER G 1 72  ? 21.866  -32.391 60.657 1.00 19.54 ? 522  SER G N   1 
ATOM   3247 C CA  . SER G 1 72  ? 21.317  -33.568 59.996 1.00 16.94 ? 522  SER G CA  1 
ATOM   3248 C C   . SER G 1 72  ? 20.191  -33.228 59.027 1.00 16.33 ? 522  SER G C   1 
ATOM   3249 O O   . SER G 1 72  ? 19.847  -34.063 58.182 1.00 15.63 ? 522  SER G O   1 
ATOM   3250 C CB  . SER G 1 72  ? 20.785  -34.554 61.028 1.00 20.67 ? 522  SER G CB  1 
ATOM   3251 O OG  . SER G 1 72  ? 19.669  -34.006 61.701 1.00 20.65 ? 522  SER G OG  1 
ATOM   3252 N N   . ASN G 1 73  ? 19.605  -32.039 59.137 1.00 13.65 ? 523  ASN G N   1 
ATOM   3253 C CA  . ASN G 1 73  ? 18.422  -31.698 58.360 1.00 13.60 ? 523  ASN G CA  1 
ATOM   3254 C C   . ASN G 1 73  ? 18.426  -30.212 58.031 1.00 12.24 ? 523  ASN G C   1 
ATOM   3255 O O   . ASN G 1 73  ? 19.014  -29.388 58.739 1.00 13.02 ? 523  ASN G O   1 
ATOM   3256 C CB  . ASN G 1 73  ? 17.150  -32.048 59.133 1.00 16.13 ? 523  ASN G CB  1 
ATOM   3257 C CG  . ASN G 1 73  ? 17.053  -31.293 60.432 1.00 20.18 ? 523  ASN G CG  1 
ATOM   3258 O OD1 . ASN G 1 73  ? 16.418  -30.249 60.498 1.00 17.21 ? 523  ASN G OD1 1 
ATOM   3259 N ND2 . ASN G 1 73  ? 17.726  -31.791 61.470 1.00 21.91 ? 523  ASN G ND2 1 
ATOM   3260 N N   . ILE G 1 74  ? 17.733  -29.876 56.949 1.00 10.41 ? 524  ILE G N   1 
ATOM   3261 C CA  . ILE G 1 74  ? 17.696  -28.508 56.439 1.00 10.08 ? 524  ILE G CA  1 
ATOM   3262 C C   . ILE G 1 74  ? 16.948  -27.543 57.357 1.00 10.35 ? 524  ILE G C   1 
ATOM   3263 O O   . ILE G 1 74  ? 17.430  -26.421 57.569 1.00 10.65 ? 524  ILE G O   1 
ATOM   3264 C CB  . ILE G 1 74  ? 17.193  -28.467 54.990 1.00 9.41  ? 524  ILE G CB  1 
ATOM   3265 C CG1 . ILE G 1 74  ? 18.245  -29.111 54.095 1.00 9.44  ? 524  ILE G CG1 1 
ATOM   3266 C CG2 . ILE G 1 74  ? 16.914  -27.035 54.564 1.00 9.69  ? 524  ILE G CG2 1 
ATOM   3267 C CD1 . ILE G 1 74  ? 17.811  -29.241 52.661 1.00 11.07 ? 524  ILE G CD1 1 
ATOM   3268 N N   . PRO G 1 75  ? 15.772  -27.895 57.903 1.00 10.00 ? 525  PRO G N   1 
ATOM   3269 C CA  . PRO G 1 75  ? 15.107  -26.950 58.815 1.00 12.71 ? 525  PRO G CA  1 
ATOM   3270 C C   . PRO G 1 75  ? 15.974  -26.509 59.988 1.00 11.67 ? 525  PRO G C   1 
ATOM   3271 O O   . PRO G 1 75  ? 15.909  -25.339 60.381 1.00 13.04 ? 525  PRO G O   1 
ATOM   3272 C CB  . PRO G 1 75  ? 13.840  -27.702 59.247 1.00 13.52 ? 525  PRO G CB  1 
ATOM   3273 C CG  . PRO G 1 75  ? 13.554  -28.631 58.096 1.00 13.03 ? 525  PRO G CG  1 
ATOM   3274 C CD  . PRO G 1 75  ? 14.922  -29.072 57.634 1.00 11.72 ? 525  PRO G CD  1 
ATOM   3275 N N   . GLN G 1 76  ? 16.808  -27.390 60.543 1.00 12.32 ? 526  GLN G N   1 
ATOM   3276 C CA  . GLN G 1 76  ? 17.670  -26.957 61.638 1.00 13.49 ? 526  GLN G CA  1 
ATOM   3277 C C   . GLN G 1 76  ? 18.706  -25.948 61.160 1.00 13.29 ? 526  GLN G C   1 
ATOM   3278 O O   . GLN G 1 76  ? 19.002  -24.973 61.861 1.00 14.20 ? 526  GLN G O   1 
ATOM   3279 C CB  . GLN G 1 76  ? 18.341  -28.160 62.292 1.00 16.00 ? 526  GLN G CB  1 
ATOM   3280 C CG  . GLN G 1 76  ? 19.034  -27.825 63.599 1.00 19.94 ? 526  GLN G CG  1 
ATOM   3281 C CD  . GLN G 1 76  ? 19.583  -29.053 64.293 1.00 24.91 ? 526  GLN G CD  1 
ATOM   3282 O OE1 . GLN G 1 76  ? 19.499  -30.167 63.774 1.00 27.16 ? 526  GLN G OE1 1 
ATOM   3283 N NE2 . GLN G 1 76  ? 20.154  -28.854 65.477 1.00 24.83 ? 526  GLN G NE2 1 
ATOM   3284 N N   . LEU G 1 77  ? 19.263  -26.163 59.966 1.00 13.09 ? 527  LEU G N   1 
ATOM   3285 C CA  . LEU G 1 77  ? 20.233  -25.227 59.407 1.00 13.15 ? 527  LEU G CA  1 
ATOM   3286 C C   . LEU G 1 77  ? 19.595  -23.869 59.141 1.00 11.84 ? 527  LEU G C   1 
ATOM   3287 O O   . LEU G 1 77  ? 20.146  -22.825 59.515 1.00 13.12 ? 527  LEU G O   1 
ATOM   3288 C CB  . LEU G 1 77  ? 20.810  -25.807 58.114 1.00 12.41 ? 527  LEU G CB  1 
ATOM   3289 C CG  . LEU G 1 77  ? 21.773  -24.911 57.323 1.00 13.61 ? 527  LEU G CG  1 
ATOM   3290 C CD1 . LEU G 1 77  ? 23.034  -24.606 58.117 1.00 16.65 ? 527  LEU G CD1 1 
ATOM   3291 C CD2 . LEU G 1 77  ? 22.129  -25.546 55.989 1.00 14.85 ? 527  LEU G CD2 1 
ATOM   3292 N N   . ILE G 1 78  ? 18.433  -23.865 58.482 1.00 10.93 ? 528  ILE G N   1 
ATOM   3293 C CA  . ILE G 1 78  ? 17.761  -22.607 58.167 1.00 11.08 ? 528  ILE G CA  1 
ATOM   3294 C C   . ILE G 1 78  ? 17.325  -21.885 59.436 1.00 12.64 ? 528  ILE G C   1 
ATOM   3295 O O   . ILE G 1 78  ? 17.525  -20.672 59.568 1.00 11.46 ? 528  ILE G O   1 
ATOM   3296 C CB  . ILE G 1 78  ? 16.583  -22.846 57.204 1.00 9.56  ? 528  ILE G CB  1 
ATOM   3297 C CG1 . ILE G 1 78  ? 17.066  -23.475 55.895 1.00 11.40 ? 528  ILE G CG1 1 
ATOM   3298 C CG2 . ILE G 1 78  ? 15.826  -21.545 56.952 1.00 12.09 ? 528  ILE G CG2 1 
ATOM   3299 C CD1 . ILE G 1 78  ? 18.074  -22.634 55.140 1.00 17.55 ? 528  ILE G CD1 1 
ATOM   3300 N N   . ASP G 1 79  ? 16.719  -22.610 60.385 1.00 12.42 ? 529  ASP G N   1 
ATOM   3301 C CA  . ASP G 1 79  ? 16.295  -21.986 61.638 1.00 13.78 ? 529  ASP G CA  1 
ATOM   3302 C C   . ASP G 1 79  ? 17.476  -21.373 62.373 1.00 15.05 ? 529  ASP G C   1 
ATOM   3303 O O   . ASP G 1 79  ? 17.354  -20.296 62.970 1.00 14.56 ? 529  ASP G O   1 
ATOM   3304 C CB  . ASP G 1 79  ? 15.616  -23.010 62.545 1.00 17.10 ? 529  ASP G CB  1 
ATOM   3305 C CG  . ASP G 1 79  ? 14.289  -23.486 62.004 1.00 21.86 ? 529  ASP G CG  1 
ATOM   3306 O OD1 . ASP G 1 79  ? 13.811  -22.922 60.999 1.00 24.47 ? 529  ASP G OD1 1 
ATOM   3307 O OD2 . ASP G 1 79  ? 13.729  -24.435 62.589 1.00 27.89 ? 529  ASP G OD2 1 
ATOM   3308 N N   . HIS G 1 80  ? 18.624  -22.051 62.354 1.00 14.13 ? 530  HIS G N   1 
ATOM   3309 C CA  . HIS G 1 80  ? 19.814  -21.507 62.996 1.00 15.01 ? 530  HIS G CA  1 
ATOM   3310 C C   . HIS G 1 80  ? 20.172  -20.145 62.416 1.00 15.75 ? 530  HIS G C   1 
ATOM   3311 O O   . HIS G 1 80  ? 20.372  -19.173 63.154 1.00 16.45 ? 530  HIS G O   1 
ATOM   3312 C CB  . HIS G 1 80  ? 20.982  -22.488 62.860 1.00 17.27 ? 530  HIS G CB  1 
ATOM   3313 C CG  . HIS G 1 80  ? 22.299  -21.906 63.263 1.00 22.92 ? 530  HIS G CG  1 
ATOM   3314 N ND1 . HIS G 1 80  ? 22.632  -21.658 64.578 1.00 24.51 ? 530  HIS G ND1 1 
ATOM   3315 C CD2 . HIS G 1 80  ? 23.360  -21.508 62.522 1.00 24.49 ? 530  HIS G CD2 1 
ATOM   3316 C CE1 . HIS G 1 80  ? 23.841  -21.128 64.628 1.00 26.37 ? 530  HIS G CE1 1 
ATOM   3317 N NE2 . HIS G 1 80  ? 24.308  -21.033 63.396 1.00 27.39 ? 530  HIS G NE2 1 
ATOM   3318 N N   . HIS G 1 81  ? 20.212  -20.045 61.087 1.00 13.53 ? 531  HIS G N   1 
ATOM   3319 C CA  . HIS G 1 81  ? 20.569  -18.780 60.458 1.00 14.60 ? 531  HIS G CA  1 
ATOM   3320 C C   . HIS G 1 81  ? 19.477  -17.732 60.640 1.00 12.96 ? 531  HIS G C   1 
ATOM   3321 O O   . HIS G 1 81  ? 19.775  -16.546 60.822 1.00 13.28 ? 531  HIS G O   1 
ATOM   3322 C CB  . HIS G 1 81  ? 20.911  -19.009 58.987 1.00 14.32 ? 531  HIS G CB  1 
ATOM   3323 C CG  . HIS G 1 81  ? 22.270  -19.602 58.788 1.00 14.52 ? 531  HIS G CG  1 
ATOM   3324 N ND1 . HIS G 1 81  ? 23.407  -18.828 58.693 1.00 15.25 ? 531  HIS G ND1 1 
ATOM   3325 C CD2 . HIS G 1 81  ? 22.685  -20.890 58.710 1.00 18.03 ? 531  HIS G CD2 1 
ATOM   3326 C CE1 . HIS G 1 81  ? 24.461  -19.612 58.546 1.00 21.10 ? 531  HIS G CE1 1 
ATOM   3327 N NE2 . HIS G 1 81  ? 24.051  -20.868 58.553 1.00 19.22 ? 531  HIS G NE2 1 
ATOM   3328 N N   . TYR G 1 82  ? 18.208  -18.145 60.611 1.00 12.48 ? 532  TYR G N   1 
ATOM   3329 C CA  . TYR G 1 82  ? 17.128  -17.178 60.776 1.00 13.55 ? 532  TYR G CA  1 
ATOM   3330 C C   . TYR G 1 82  ? 17.103  -16.595 62.188 1.00 14.45 ? 532  TYR G C   1 
ATOM   3331 O O   . TYR G 1 82  ? 16.891  -15.390 62.365 1.00 16.21 ? 532  TYR G O   1 
ATOM   3332 C CB  . TYR G 1 82  ? 15.794  -17.830 60.430 1.00 13.57 ? 532  TYR G CB  1 
ATOM   3333 C CG  . TYR G 1 82  ? 14.609  -16.910 60.597 1.00 15.05 ? 532  TYR G CG  1 
ATOM   3334 C CD1 . TYR G 1 82  ? 14.424  -15.826 59.753 1.00 12.83 ? 532  TYR G CD1 1 
ATOM   3335 C CD2 . TYR G 1 82  ? 13.674  -17.127 61.602 1.00 19.42 ? 532  TYR G CD2 1 
ATOM   3336 C CE1 . TYR G 1 82  ? 13.337  -14.982 59.901 1.00 15.04 ? 532  TYR G CE1 1 
ATOM   3337 C CE2 . TYR G 1 82  ? 12.584  -16.288 61.755 1.00 21.98 ? 532  TYR G CE2 1 
ATOM   3338 C CZ  . TYR G 1 82  ? 12.422  -15.218 60.900 1.00 20.46 ? 532  TYR G CZ  1 
ATOM   3339 O OH  . TYR G 1 82  ? 11.339  -14.378 61.048 1.00 25.76 ? 532  TYR G OH  1 
ATOM   3340 N N   . THR G 1 83  ? 17.312  -17.424 63.210 1.00 15.09 ? 533  THR G N   1 
ATOM   3341 C CA  . THR G 1 83  ? 17.191  -16.917 64.573 1.00 16.54 ? 533  THR G CA  1 
ATOM   3342 C C   . THR G 1 83  ? 18.455  -16.208 65.048 1.00 20.51 ? 533  THR G C   1 
ATOM   3343 O O   . THR G 1 83  ? 18.361  -15.204 65.765 1.00 22.86 ? 533  THR G O   1 
ATOM   3344 C CB  . THR G 1 83  ? 16.837  -18.047 65.543 1.00 19.54 ? 533  THR G CB  1 
ATOM   3345 O OG1 . THR G 1 83  ? 17.875  -19.034 65.532 1.00 24.77 ? 533  THR G OG1 1 
ATOM   3346 C CG2 . THR G 1 83  ? 15.519  -18.698 65.165 1.00 21.89 ? 533  THR G CG2 1 
ATOM   3347 N N   . THR G 1 84  ? 19.636  -16.702 64.678 1.00 17.44 ? 534  THR G N   1 
ATOM   3348 C CA  . THR G 1 84  ? 20.876  -16.086 65.135 1.00 20.47 ? 534  THR G CA  1 
ATOM   3349 C C   . THR G 1 84  ? 21.364  -14.972 64.223 1.00 17.87 ? 534  THR G C   1 
ATOM   3350 O O   . THR G 1 84  ? 22.253  -14.214 64.624 1.00 18.33 ? 534  THR G O   1 
ATOM   3351 C CB  . THR G 1 84  ? 21.991  -17.125 65.253 1.00 20.41 ? 534  THR G CB  1 
ATOM   3352 O OG1 . THR G 1 84  ? 22.310  -17.630 63.949 1.00 20.93 ? 534  THR G OG1 1 
ATOM   3353 C CG2 . THR G 1 84  ? 21.572  -18.273 66.165 1.00 22.50 ? 534  THR G CG2 1 
ATOM   3354 N N   . LYS G 1 85  ? 20.822  -14.870 63.011 1.00 16.53 ? 535  LYS G N   1 
ATOM   3355 C CA  . LYS G 1 85  ? 21.250  -13.900 62.005 1.00 15.73 ? 535  LYS G CA  1 
ATOM   3356 C C   . LYS G 1 85  ? 22.703  -14.091 61.588 1.00 15.42 ? 535  LYS G C   1 
ATOM   3357 O O   . LYS G 1 85  ? 23.343  -13.155 61.094 1.00 17.84 ? 535  LYS G O   1 
ATOM   3358 C CB  . LYS G 1 85  ? 20.973  -12.449 62.417 1.00 15.85 ? 535  LYS G CB  1 
ATOM   3359 C CG  . LYS G 1 85  ? 19.529  -12.178 62.778 1.00 15.00 ? 535  LYS G CG  1 
ATOM   3360 C CD  . LYS G 1 85  ? 18.590  -12.563 61.658 1.00 13.83 ? 535  LYS G CD  1 
ATOM   3361 C CE  . LYS G 1 85  ? 17.153  -12.302 62.049 1.00 14.70 ? 535  LYS G CE  1 
ATOM   3362 N NZ  . LYS G 1 85  ? 16.217  -13.010 61.135 1.00 14.82 ? 535  LYS G NZ  1 
ATOM   3363 N N   . GLN G 1 86  ? 23.240  -15.291 61.779 1.00 16.17 ? 536  GLN G N   1 
ATOM   3364 C CA  . GLN G 1 86  ? 24.566  -15.600 61.274 1.00 17.83 ? 536  GLN G CA  1 
ATOM   3365 C C   . GLN G 1 86  ? 24.574  -15.534 59.750 1.00 18.03 ? 536  GLN G C   1 
ATOM   3366 O O   . GLN G 1 86  ? 23.658  -16.025 59.083 1.00 15.42 ? 536  GLN G O   1 
ATOM   3367 C CB  . GLN G 1 86  ? 24.944  -17.006 61.733 1.00 21.80 ? 536  GLN G CB  1 
ATOM   3368 C CG  . GLN G 1 86  ? 26.347  -17.433 61.403 1.00 25.06 ? 536  GLN G CG  1 
ATOM   3369 C CD  . GLN G 1 86  ? 26.683  -18.777 62.017 1.00 27.43 ? 536  GLN G CD  1 
ATOM   3370 O OE1 . GLN G 1 86  ? 26.104  -19.170 63.029 1.00 34.00 ? 536  GLN G OE1 1 
ATOM   3371 N NE2 . GLN G 1 86  ? 27.609  -19.494 61.398 1.00 29.04 ? 536  GLN G NE2 1 
ATOM   3372 N N   . VAL G 1 87  ? 25.622  -14.924 59.190 1.00 18.12 ? 537  VAL G N   1 
ATOM   3373 C CA  . VAL G 1 87  ? 25.729  -14.828 57.739 1.00 17.53 ? 537  VAL G CA  1 
ATOM   3374 C C   . VAL G 1 87  ? 25.740  -16.217 57.116 1.00 18.19 ? 537  VAL G C   1 
ATOM   3375 O O   . VAL G 1 87  ? 26.277  -17.173 57.689 1.00 20.00 ? 537  VAL G O   1 
ATOM   3376 C CB  . VAL G 1 87  ? 26.969  -14.011 57.339 1.00 18.80 ? 537  VAL G CB  1 
ATOM   3377 C CG1 . VAL G 1 87  ? 26.820  -12.568 57.799 1.00 22.59 ? 537  VAL G CG1 1 
ATOM   3378 C CG2 . VAL G 1 87  ? 28.228  -14.642 57.910 1.00 21.43 ? 537  VAL G CG2 1 
ATOM   3379 N N   . ILE G 1 88  ? 25.118  -16.332 55.937 1.00 17.33 ? 538  ILE G N   1 
ATOM   3380 C CA  . ILE G 1 88  ? 25.032  -17.620 55.246 1.00 15.96 ? 538  ILE G CA  1 
ATOM   3381 C C   . ILE G 1 88  ? 26.425  -18.175 54.998 1.00 17.21 ? 538  ILE G C   1 
ATOM   3382 O O   . ILE G 1 88  ? 26.709  -19.349 55.269 1.00 19.08 ? 538  ILE G O   1 
ATOM   3383 C CB  . ILE G 1 88  ? 24.226  -17.492 53.935 1.00 15.27 ? 538  ILE G CB  1 
ATOM   3384 C CG1 . ILE G 1 88  ? 22.772  -17.133 54.238 1.00 19.20 ? 538  ILE G CG1 1 
ATOM   3385 C CG2 . ILE G 1 88  ? 24.295  -18.791 53.132 1.00 21.31 ? 538  ILE G CG2 1 
ATOM   3386 C CD1 . ILE G 1 88  ? 22.122  -18.059 55.242 1.00 19.22 ? 538  ILE G CD1 1 
ATOM   3387 N N   . THR G 1 89  ? 27.302  -17.343 54.443 1.00 19.16 ? 539  THR G N   1 
ATOM   3388 C CA  . THR G 1 89  ? 28.719  -17.636 54.315 1.00 19.48 ? 539  THR G CA  1 
ATOM   3389 C C   . THR G 1 89  ? 29.457  -16.338 54.592 1.00 23.30 ? 539  THR G C   1 
ATOM   3390 O O   . THR G 1 89  ? 28.886  -15.250 54.490 1.00 23.62 ? 539  THR G O   1 
ATOM   3391 C CB  . THR G 1 89  ? 29.081  -18.098 52.899 1.00 23.84 ? 539  THR G CB  1 
ATOM   3392 O OG1 . THR G 1 89  ? 28.842  -17.030 51.977 1.00 21.85 ? 539  THR G OG1 1 
ATOM   3393 C CG2 . THR G 1 89  ? 28.261  -19.312 52.482 1.00 24.82 ? 539  THR G CG2 1 
ATOM   3394 N N   . LYS G 1 90  ? 30.738  -16.453 54.948 1.00 23.75 ? 540  LYS G N   1 
ATOM   3395 C CA  . LYS G 1 90  ? 31.518  -15.246 55.203 1.00 27.66 ? 540  LYS G CA  1 
ATOM   3396 C C   . LYS G 1 90  ? 31.683  -14.417 53.936 1.00 25.81 ? 540  LYS G C   1 
ATOM   3397 O O   . LYS G 1 90  ? 31.621  -13.183 53.980 1.00 26.39 ? 540  LYS G O   1 
ATOM   3398 C CB  . LYS G 1 90  ? 32.874  -15.605 55.811 1.00 34.81 ? 540  LYS G CB  1 
ATOM   3399 C CG  . LYS G 1 90  ? 32.763  -16.410 57.090 1.00 40.41 ? 540  LYS G CG  1 
ATOM   3400 C CD  . LYS G 1 90  ? 33.922  -16.143 58.033 1.00 46.93 ? 540  LYS G CD  1 
ATOM   3401 C CE  . LYS G 1 90  ? 33.785  -16.967 59.303 1.00 47.87 ? 540  LYS G CE  1 
ATOM   3402 N NZ  . LYS G 1 90  ? 34.660  -16.463 60.397 1.00 48.72 ? 540  LYS G NZ  1 
ATOM   3403 N N   . LYS G 1 91  ? 31.870  -15.078 52.792 1.00 29.05 ? 541  LYS G N   1 
ATOM   3404 C CA  . LYS G 1 91  ? 32.084  -14.357 51.541 1.00 33.80 ? 541  LYS G CA  1 
ATOM   3405 C C   . LYS G 1 91  ? 30.853  -13.553 51.137 1.00 33.62 ? 541  LYS G C   1 
ATOM   3406 O O   . LYS G 1 91  ? 30.977  -12.431 50.630 1.00 36.58 ? 541  LYS G O   1 
ATOM   3407 C CB  . LYS G 1 91  ? 32.473  -15.341 50.437 1.00 38.67 ? 541  LYS G CB  1 
ATOM   3408 C CG  . LYS G 1 91  ? 32.508  -14.736 49.043 1.00 41.54 ? 541  LYS G CG  1 
ATOM   3409 C CD  . LYS G 1 91  ? 32.761  -15.795 47.978 1.00 46.14 ? 541  LYS G CD  1 
ATOM   3410 C CE  . LYS G 1 91  ? 34.137  -16.424 48.128 1.00 50.27 ? 541  LYS G CE  1 
ATOM   3411 N NZ  . LYS G 1 91  ? 34.561  -17.125 46.883 1.00 53.00 ? 541  LYS G NZ  1 
ATOM   3412 N N   . SER G 1 92  ? 29.656  -14.104 51.354 1.00 28.21 ? 542  SER G N   1 
ATOM   3413 C CA  . SER G 1 92  ? 28.442  -13.437 50.893 1.00 26.24 ? 542  SER G CA  1 
ATOM   3414 C C   . SER G 1 92  ? 27.959  -12.379 51.881 1.00 22.17 ? 542  SER G C   1 
ATOM   3415 O O   . SER G 1 92  ? 27.441  -11.337 51.468 1.00 28.66 ? 542  SER G O   1 
ATOM   3416 C CB  . SER G 1 92  ? 27.331  -14.462 50.641 1.00 26.47 ? 542  SER G CB  1 
ATOM   3417 O OG  . SER G 1 92  ? 26.835  -14.981 51.866 1.00 21.69 ? 542  SER G OG  1 
ATOM   3418 N N   . GLY G 1 93  ? 28.108  -12.634 53.180 1.00 20.05 ? 543  GLY G N   1 
ATOM   3419 C CA  . GLY G 1 93  ? 27.563  -11.745 54.189 1.00 21.55 ? 543  GLY G CA  1 
ATOM   3420 C C   . GLY G 1 93  ? 26.052  -11.657 54.210 1.00 19.00 ? 543  GLY G C   1 
ATOM   3421 O O   . GLY G 1 93  ? 25.506  -10.709 54.770 1.00 21.06 ? 543  GLY G O   1 
ATOM   3422 N N   . VAL G 1 94  ? 25.356  -12.633 53.637 1.00 19.09 ? 544  VAL G N   1 
ATOM   3423 C CA  . VAL G 1 94  ? 23.902  -12.569 53.491 1.00 15.14 ? 544  VAL G CA  1 
ATOM   3424 C C   . VAL G 1 94  ? 23.230  -12.991 54.792 1.00 16.09 ? 544  VAL G C   1 
ATOM   3425 O O   . VAL G 1 94  ? 23.611  -13.994 55.408 1.00 15.10 ? 544  VAL G O   1 
ATOM   3426 C CB  . VAL G 1 94  ? 23.466  -13.460 52.315 1.00 16.67 ? 544  VAL G CB  1 
ATOM   3427 C CG1 . VAL G 1 94  ? 21.975  -13.749 52.366 1.00 14.21 ? 544  VAL G CG1 1 
ATOM   3428 C CG2 . VAL G 1 94  ? 23.845  -12.802 50.992 1.00 21.72 ? 544  VAL G CG2 1 
ATOM   3429 N N   . VAL G 1 95  ? 22.218  -12.229 55.211 1.00 14.15 ? 545  VAL G N   1 
ATOM   3430 C CA  . VAL G 1 95  ? 21.480  -12.478 56.446 1.00 14.06 ? 545  VAL G CA  1 
ATOM   3431 C C   . VAL G 1 95  ? 20.017  -12.736 56.099 1.00 13.64 ? 545  VAL G C   1 
ATOM   3432 O O   . VAL G 1 95  ? 19.418  -11.990 55.314 1.00 13.54 ? 545  VAL G O   1 
ATOM   3433 C CB  . VAL G 1 95  ? 21.612  -11.296 57.425 1.00 15.16 ? 545  VAL G CB  1 
ATOM   3434 C CG1 . VAL G 1 95  ? 20.681  -11.490 58.610 1.00 18.39 ? 545  VAL G CG1 1 
ATOM   3435 C CG2 . VAL G 1 95  ? 23.063  -11.151 57.887 1.00 17.55 ? 545  VAL G CG2 1 
ATOM   3436 N N   . LEU G 1 96  ? 19.442  -13.786 56.688 1.00 11.80 ? 546  LEU G N   1 
ATOM   3437 C CA  . LEU G 1 96  ? 18.047  -14.144 56.450 1.00 11.59 ? 546  LEU G CA  1 
ATOM   3438 C C   . LEU G 1 96  ? 17.131  -13.291 57.318 1.00 12.68 ? 546  LEU G C   1 
ATOM   3439 O O   . LEU G 1 96  ? 17.315  -13.215 58.538 1.00 14.07 ? 546  LEU G O   1 
ATOM   3440 C CB  . LEU G 1 96  ? 17.822  -15.618 56.775 1.00 12.64 ? 546  LEU G CB  1 
ATOM   3441 C CG  . LEU G 1 96  ? 18.711  -16.620 56.044 1.00 12.14 ? 546  LEU G CG  1 
ATOM   3442 C CD1 . LEU G 1 96  ? 18.256  -18.016 56.385 1.00 12.85 ? 546  LEU G CD1 1 
ATOM   3443 C CD2 . LEU G 1 96  ? 18.677  -16.388 54.532 1.00 13.75 ? 546  LEU G CD2 1 
ATOM   3444 N N   . LEU G 1 97  ? 16.143  -12.654 56.694 1.00 9.99  ? 547  LEU G N   1 
ATOM   3445 C CA  . LEU G 1 97  ? 15.223  -11.770 57.406 1.00 10.15 ? 547  LEU G CA  1 
ATOM   3446 C C   . LEU G 1 97  ? 13.756  -12.133 57.256 1.00 9.76  ? 547  LEU G C   1 
ATOM   3447 O O   . LEU G 1 97  ? 13.014  -12.077 58.239 1.00 13.29 ? 547  LEU G O   1 
ATOM   3448 C CB  . LEU G 1 97  ? 15.409  -10.315 56.958 1.00 12.04 ? 547  LEU G CB  1 
ATOM   3449 C CG  . LEU G 1 97  ? 16.753  -9.648  57.238 1.00 11.83 ? 547  LEU G CG  1 
ATOM   3450 C CD1 . LEU G 1 97  ? 16.746  -8.217  56.723 1.00 13.54 ? 547  LEU G CD1 1 
ATOM   3451 C CD2 . LEU G 1 97  ? 17.079  -9.687  58.732 1.00 14.86 ? 547  LEU G CD2 1 
ATOM   3452 N N   . ASN G 1 98  ? 13.292  -12.473 56.054 1.00 9.77  ? 548  ASN G N   1 
ATOM   3453 C CA  . ASN G 1 98  ? 11.858  -12.606 55.792 1.00 10.10 ? 548  ASN G CA  1 
ATOM   3454 C C   . ASN G 1 98  ? 11.585  -13.935 55.098 1.00 9.61  ? 548  ASN G C   1 
ATOM   3455 O O   . ASN G 1 98  ? 11.845  -14.065 53.890 1.00 9.54  ? 548  ASN G O   1 
ATOM   3456 C CB  . ASN G 1 98  ? 11.361  -11.463 54.911 1.00 11.17 ? 548  ASN G CB  1 
ATOM   3457 C CG  . ASN G 1 98  ? 11.927  -10.109 55.321 1.00 11.57 ? 548  ASN G CG  1 
ATOM   3458 O OD1 . ASN G 1 98  ? 11.814  -9.713  56.477 1.00 14.22 ? 548  ASN G OD1 1 
ATOM   3459 N ND2 . ASN G 1 98  ? 12.538  -9.404  54.374 1.00 11.79 ? 548  ASN G ND2 1 
ATOM   3460 N N   . PRO G 1 99  ? 11.070  -14.940 55.808 1.00 9.69  ? 549  PRO G N   1 
ATOM   3461 C CA  . PRO G 1 99  ? 10.712  -16.203 55.135 1.00 8.73  ? 549  PRO G CA  1 
ATOM   3462 C C   . PRO G 1 99  ? 9.504   -15.977 54.237 1.00 10.00 ? 549  PRO G C   1 
ATOM   3463 O O   . PRO G 1 99  ? 8.452   -15.530 54.695 1.00 11.61 ? 549  PRO G O   1 
ATOM   3464 C CB  . PRO G 1 99  ? 10.379  -17.146 56.298 1.00 10.32 ? 549  PRO G CB  1 
ATOM   3465 C CG  . PRO G 1 99  ? 10.001  -16.228 57.435 1.00 15.18 ? 549  PRO G CG  1 
ATOM   3466 C CD  . PRO G 1 99  ? 10.800  -14.969 57.256 1.00 12.40 ? 549  PRO G CD  1 
ATOM   3467 N N   . ILE G 1 100 ? 9.645   -16.283 52.950 1.00 9.00  ? 550  ILE G N   1 
ATOM   3468 C CA  . ILE G 1 100 ? 8.582   -16.061 51.978 1.00 9.43  ? 550  ILE G CA  1 
ATOM   3469 C C   . ILE G 1 100 ? 7.694   -17.302 51.947 1.00 10.32 ? 550  ILE G C   1 
ATOM   3470 O O   . ILE G 1 100 ? 8.200   -18.403 51.658 1.00 11.20 ? 550  ILE G O   1 
ATOM   3471 C CB  . ILE G 1 100 ? 9.141   -15.736 50.591 1.00 10.14 ? 550  ILE G CB  1 
ATOM   3472 C CG1 . ILE G 1 100 ? 9.965   -14.446 50.657 1.00 12.64 ? 550  ILE G CG1 1 
ATOM   3473 C CG2 . ILE G 1 100 ? 8.008   -15.604 49.583 1.00 12.07 ? 550  ILE G CG2 1 
ATOM   3474 C CD1 . ILE G 1 100 ? 9.218   -13.257 51.240 1.00 17.20 ? 550  ILE G CD1 1 
ATOM   3475 N N   . PRO G 1 101 ? 6.399   -17.181 52.223 1.00 11.06 ? 551  PRO G N   1 
ATOM   3476 C CA  . PRO G 1 101 ? 5.548   -18.367 52.339 1.00 14.76 ? 551  PRO G CA  1 
ATOM   3477 C C   . PRO G 1 101 ? 5.151   -18.913 50.983 1.00 22.36 ? 551  PRO G C   1 
ATOM   3478 O O   . PRO G 1 101 ? 5.105   -18.196 49.979 1.00 17.06 ? 551  PRO G O   1 
ATOM   3479 C CB  . PRO G 1 101 ? 4.316   -17.844 53.086 1.00 17.34 ? 551  PRO G CB  1 
ATOM   3480 C CG  . PRO G 1 101 ? 4.248   -16.400 52.717 1.00 15.54 ? 551  PRO G CG  1 
ATOM   3481 C CD  . PRO G 1 101 ? 5.686   -15.944 52.589 1.00 13.44 ? 551  PRO G CD  1 
ATOM   3482 N N   . LYS G 1 102 ? 4.858   -20.212 50.982 1.00 29.78 ? 552  LYS G N   1 
ATOM   3483 C CA  . LYS G 1 102 ? 4.436   -20.941 49.793 1.00 35.66 ? 552  LYS G CA  1 
ATOM   3484 C C   . LYS G 1 102 ? 2.997   -20.591 49.440 1.00 41.03 ? 552  LYS G C   1 
ATOM   3485 O O   . LYS G 1 102 ? 2.256   -20.061 50.269 1.00 41.88 ? 552  LYS G O   1 
ATOM   3486 C CB  . LYS G 1 102 ? 4.569   -22.451 50.022 1.00 38.34 ? 552  LYS G CB  1 
ATOM   3487 N N   . ASP H 2 1   ? 22.646  -22.091 34.973 1.00 23.03 ? 1    ASP H N   1 
ATOM   3488 C CA  . ASP H 2 1   ? 22.515  -20.804 35.642 1.00 19.13 ? 1    ASP H CA  1 
ATOM   3489 C C   . ASP H 2 1   ? 23.448  -20.767 36.840 1.00 19.58 ? 1    ASP H C   1 
ATOM   3490 O O   . ASP H 2 1   ? 23.856  -21.813 37.341 1.00 21.03 ? 1    ASP H O   1 
ATOM   3491 C CB  . ASP H 2 1   ? 21.073  -20.592 36.094 1.00 15.85 ? 1    ASP H CB  1 
ATOM   3492 C CG  . ASP H 2 1   ? 20.094  -20.630 34.943 1.00 18.65 ? 1    ASP H CG  1 
ATOM   3493 O OD1 . ASP H 2 1   ? 20.545  -20.598 33.777 1.00 23.54 ? 1    ASP H OD1 1 
ATOM   3494 O OD2 . ASP H 2 1   ? 18.878  -20.699 35.208 1.00 17.59 ? 1    ASP H OD2 1 
ATOM   3495 N N   . GLU H 2 2   ? 23.770  -19.567 37.306 1.00 19.29 ? 2    GLU H N   1 
ATOM   3496 C CA  . GLU H 2 2   ? 24.782  -19.403 38.343 1.00 21.27 ? 2    GLU H CA  1 
ATOM   3497 C C   . GLU H 2 2   ? 24.280  -19.740 39.747 1.00 14.30 ? 2    GLU H C   1 
ATOM   3498 O O   . GLU H 2 2   ? 23.220  -19.271 40.167 1.00 14.56 ? 2    GLU H O   1 
ATOM   3499 C CB  . GLU H 2 2   ? 25.341  -17.977 38.318 1.00 32.22 ? 2    GLU H CB  1 
ATOM   3500 C CG  . GLU H 2 2   ? 26.079  -17.608 37.033 1.00 46.18 ? 2    GLU H CG  1 
ATOM   3501 C CD  . GLU H 2 2   ? 27.529  -18.069 37.024 1.00 56.30 ? 2    GLU H CD  1 
ATOM   3502 O OE1 . GLU H 2 2   ? 27.795  -19.248 37.340 1.00 59.07 ? 2    GLU H OE1 1 
ATOM   3503 O OE2 . GLU H 2 2   ? 28.409  -17.242 36.704 1.00 59.38 ? 2    GLU H OE2 1 
HETATM 3504 N N   . PTR H 2 3   ? 25.063  -20.543 40.462 1.00 15.18 ? 3    PTR H N   1 
HETATM 3505 C CA  . PTR H 2 3   ? 24.839  -20.789 41.877 1.00 11.79 ? 3    PTR H CA  1 
HETATM 3506 C C   . PTR H 2 3   ? 26.042  -20.334 42.688 1.00 15.15 ? 3    PTR H C   1 
HETATM 3507 O O   . PTR H 2 3   ? 27.155  -20.218 42.154 1.00 16.00 ? 3    PTR H O   1 
HETATM 3508 C CB  . PTR H 2 3   ? 24.668  -22.277 42.137 1.00 13.65 ? 3    PTR H CB  1 
HETATM 3509 C CG  . PTR H 2 3   ? 23.319  -22.847 41.748 1.00 11.76 ? 3    PTR H CG  1 
HETATM 3510 C CD1 . PTR H 2 3   ? 22.184  -22.582 42.503 1.00 11.67 ? 3    PTR H CD1 1 
HETATM 3511 C CD2 . PTR H 2 3   ? 23.191  -23.696 40.656 1.00 12.74 ? 3    PTR H CD2 1 
HETATM 3512 C CE1 . PTR H 2 3   ? 20.953  -23.124 42.165 1.00 10.27 ? 3    PTR H CE1 1 
HETATM 3513 C CE2 . PTR H 2 3   ? 21.964  -24.248 40.316 1.00 12.23 ? 3    PTR H CE2 1 
HETATM 3514 C CZ  . PTR H 2 3   ? 20.846  -23.951 41.072 1.00 10.09 ? 3    PTR H CZ  1 
HETATM 3515 O OH  . PTR H 2 3   ? 19.684  -24.487 40.766 1.00 11.04 ? 3    PTR H OH  1 
HETATM 3516 P P   . PTR H 2 3   ? 18.671  -23.868 39.668 1.00 10.68 ? 3    PTR H P   1 
HETATM 3517 O O1P . PTR H 2 3   ? 19.317  -24.091 38.296 1.00 14.31 ? 3    PTR H O1P 1 
HETATM 3518 O O2P . PTR H 2 3   ? 17.375  -24.673 39.831 1.00 12.63 ? 3    PTR H O2P 1 
HETATM 3519 O O3P . PTR H 2 3   ? 18.491  -22.443 40.027 1.00 9.72  ? 3    PTR H O3P 1 
ATOM   3520 N N   . GLU H 2 4   ? 25.804  -20.062 43.967 1.00 11.12 ? 4    GLU H N   1 
ATOM   3521 C CA  . GLU H 2 4   ? 26.868  -19.813 44.937 1.00 13.71 ? 4    GLU H CA  1 
ATOM   3522 C C   . GLU H 2 4   ? 26.979  -20.995 45.906 1.00 13.72 ? 4    GLU H C   1 
ATOM   3523 O O   . GLU H 2 4   ? 26.078  -21.837 45.992 1.00 13.31 ? 4    GLU H O   1 
ATOM   3524 C CB  . GLU H 2 4   ? 26.595  -18.510 45.685 1.00 15.45 ? 4    GLU H CB  1 
ATOM   3525 C CG  . GLU H 2 4   ? 26.610  -17.299 44.761 1.00 18.18 ? 4    GLU H CG  1 
ATOM   3526 C CD  . GLU H 2 4   ? 26.347  -15.993 45.481 1.00 20.33 ? 4    GLU H CD  1 
ATOM   3527 O OE1 . GLU H 2 4   ? 25.419  -15.262 45.072 1.00 20.63 ? 4    GLU H OE1 1 
ATOM   3528 O OE2 . GLU H 2 4   ? 27.065  -15.696 46.457 1.00 20.76 ? 4    GLU H OE2 1 
ATOM   3529 N N   . ASN H 2 5   ? 28.094  -21.062 46.637 1.00 14.56 ? 5    ASN H N   1 
ATOM   3530 C CA  . ASN H 2 5   ? 28.370  -22.168 47.559 1.00 14.84 ? 5    ASN H CA  1 
ATOM   3531 C C   . ASN H 2 5   ? 28.408  -23.510 46.834 1.00 16.20 ? 5    ASN H C   1 
ATOM   3532 O O   . ASN H 2 5   ? 27.896  -24.512 47.336 1.00 17.96 ? 5    ASN H O   1 
ATOM   3533 C CB  . ASN H 2 5   ? 27.397  -22.207 48.740 1.00 16.88 ? 5    ASN H CB  1 
ATOM   3534 C CG  . ASN H 2 5   ? 27.971  -22.950 49.943 1.00 17.93 ? 5    ASN H CG  1 
ATOM   3535 O OD1 . ASN H 2 5   ? 29.128  -22.737 50.325 1.00 18.66 ? 5    ASN H OD1 1 
ATOM   3536 N ND2 . ASN H 2 5   ? 27.169  -23.816 50.547 1.00 15.22 ? 5    ASN H ND2 1 
ATOM   3537 N N   . VAL H 2 6   ? 29.016  -23.509 45.645 1.00 20.08 ? 6    VAL H N   1 
ATOM   3538 C CA  . VAL H 2 6   ? 29.225  -24.678 44.788 1.00 27.53 ? 6    VAL H CA  1 
ATOM   3539 C C   . VAL H 2 6   ? 27.978  -25.067 44.006 1.00 31.34 ? 6    VAL H C   1 
ATOM   3540 O O   . VAL H 2 6   ? 27.558  -24.334 43.107 1.00 29.61 ? 6    VAL H O   1 
ATOM   3541 C CB  . VAL H 2 6   ? 29.894  -25.867 45.524 1.00 30.58 ? 6    VAL H CB  1 
ATOM   3542 C CG1 . VAL H 2 6   ? 29.722  -27.144 44.731 1.00 32.72 ? 6    VAL H CG1 1 
ATOM   3543 C CG2 . VAL H 2 6   ? 31.364  -25.585 45.726 1.00 28.27 ? 6    VAL H CG2 1 
ATOM   3544 N N   . LYS I 1 3   ? 1.008   -16.663 36.164 1.00 32.97 ? 453  LYS I N   1 
ATOM   3545 C CA  . LYS I 1 3   ? 0.725   -17.600 37.246 1.00 31.40 ? 453  LYS I CA  1 
ATOM   3546 C C   . LYS I 1 3   ? 1.768   -18.709 37.321 1.00 28.51 ? 453  LYS I C   1 
ATOM   3547 O O   . LYS I 1 3   ? 2.292   -19.151 36.297 1.00 28.48 ? 453  LYS I O   1 
ATOM   3548 C CB  . LYS I 1 3   ? -0.676  -18.206 37.098 1.00 34.63 ? 453  LYS I CB  1 
ATOM   3549 C CG  . LYS I 1 3   ? -1.807  -17.284 37.534 1.00 44.78 ? 453  LYS I CG  1 
ATOM   3550 C CD  . LYS I 1 3   ? -2.311  -16.440 36.378 1.00 49.77 ? 453  LYS I CD  1 
ATOM   3551 C CE  . LYS I 1 3   ? -3.091  -17.286 35.384 1.00 50.59 ? 453  LYS I CE  1 
ATOM   3552 N NZ  . LYS I 1 3   ? -3.244  -16.596 34.073 1.00 51.66 ? 453  LYS I NZ  1 
ATOM   3553 N N   . PRO I 1 4   ? 2.069   -19.163 38.534 1.00 20.37 ? 454  PRO I N   1 
ATOM   3554 C CA  . PRO I 1 4   ? 3.039   -20.252 38.694 1.00 18.39 ? 454  PRO I CA  1 
ATOM   3555 C C   . PRO I 1 4   ? 2.524   -21.543 38.075 1.00 19.11 ? 454  PRO I C   1 
ATOM   3556 O O   . PRO I 1 4   ? 1.325   -21.724 37.849 1.00 19.72 ? 454  PRO I O   1 
ATOM   3557 C CB  . PRO I 1 4   ? 3.172   -20.396 40.215 1.00 20.37 ? 454  PRO I CB  1 
ATOM   3558 C CG  . PRO I 1 4   ? 2.644   -19.110 40.784 1.00 27.80 ? 454  PRO I CG  1 
ATOM   3559 C CD  . PRO I 1 4   ? 1.589   -18.649 39.828 1.00 21.99 ? 454  PRO I CD  1 
ATOM   3560 N N   . LEU I 1 5   ? 3.464   -22.455 37.814 1.00 16.39 ? 455  LEU I N   1 
ATOM   3561 C CA  . LEU I 1 5   ? 3.105   -23.752 37.244 1.00 14.67 ? 455  LEU I CA  1 
ATOM   3562 C C   . LEU I 1 5   ? 2.107   -24.494 38.120 1.00 17.70 ? 455  LEU I C   1 
ATOM   3563 O O   . LEU I 1 5   ? 1.149   -25.090 37.612 1.00 15.93 ? 455  LEU I O   1 
ATOM   3564 C CB  . LEU I 1 5   ? 4.356   -24.603 37.059 1.00 15.81 ? 455  LEU I CB  1 
ATOM   3565 C CG  . LEU I 1 5   ? 5.204   -24.272 35.840 1.00 13.56 ? 455  LEU I CG  1 
ATOM   3566 C CD1 . LEU I 1 5   ? 6.586   -24.877 35.970 1.00 16.08 ? 455  LEU I CD1 1 
ATOM   3567 C CD2 . LEU I 1 5   ? 4.490   -24.776 34.590 1.00 13.53 ? 455  LEU I CD2 1 
ATOM   3568 N N   . ALA I 1 6   ? 2.316   -24.479 39.437 1.00 18.41 ? 456  ALA I N   1 
ATOM   3569 C CA  . ALA I 1 6   ? 1.422   -25.191 40.343 1.00 24.13 ? 456  ALA I CA  1 
ATOM   3570 C C   . ALA I 1 6   ? -0.018  -24.699 40.265 1.00 26.85 ? 456  ALA I C   1 
ATOM   3571 O O   . ALA I 1 6   ? -0.917  -25.394 40.751 1.00 32.21 ? 456  ALA I O   1 
ATOM   3572 C CB  . ALA I 1 6   ? 1.935   -25.103 41.782 1.00 27.52 ? 456  ALA I CB  1 
ATOM   3573 N N   . GLU I 1 7   ? -0.262  -23.533 39.669 1.00 20.95 ? 457  GLU I N   1 
ATOM   3574 C CA  . GLU I 1 7   ? -1.612  -23.018 39.507 1.00 22.30 ? 457  GLU I CA  1 
ATOM   3575 C C   . GLU I 1 7   ? -2.192  -23.263 38.118 1.00 23.36 ? 457  GLU I C   1 
ATOM   3576 O O   . GLU I 1 7   ? -3.366  -22.946 37.894 1.00 26.42 ? 457  GLU I O   1 
ATOM   3577 C CB  . GLU I 1 7   ? -1.654  -21.523 39.841 1.00 26.61 ? 457  GLU I CB  1 
ATOM   3578 C CG  . GLU I 1 7   ? -1.606  -21.239 41.335 1.00 33.57 ? 457  GLU I CG  1 
ATOM   3579 C CD  . GLU I 1 7   ? -1.100  -19.846 41.660 1.00 39.75 ? 457  GLU I CD  1 
ATOM   3580 O OE1 . GLU I 1 7   ? -0.240  -19.728 42.557 1.00 40.36 ? 457  GLU I OE1 1 
ATOM   3581 O OE2 . GLU I 1 7   ? -1.554  -18.874 41.020 1.00 41.61 ? 457  GLU I OE2 1 
ATOM   3582 N N   . GLN I 1 8   ? -1.413  -23.820 37.192 1.00 17.87 ? 458  GLN I N   1 
ATOM   3583 C CA  . GLN I 1 8   ? -1.912  -24.111 35.853 1.00 17.81 ? 458  GLN I CA  1 
ATOM   3584 C C   . GLN I 1 8   ? -2.666  -25.435 35.858 1.00 19.14 ? 458  GLN I C   1 
ATOM   3585 O O   . GLN I 1 8   ? -2.164  -26.438 36.374 1.00 17.15 ? 458  GLN I O   1 
ATOM   3586 C CB  . GLN I 1 8   ? -0.746  -24.193 34.868 1.00 16.23 ? 458  GLN I CB  1 
ATOM   3587 C CG  . GLN I 1 8   ? 0.154   -22.961 34.843 1.00 17.28 ? 458  GLN I CG  1 
ATOM   3588 C CD  . GLN I 1 8   ? -0.526  -21.747 34.236 1.00 18.80 ? 458  GLN I CD  1 
ATOM   3589 O OE1 . GLN I 1 8   ? -1.503  -21.871 33.497 1.00 23.39 ? 458  GLN I OE1 1 
ATOM   3590 N NE2 . GLN I 1 8   ? -0.016  -20.560 34.557 1.00 19.46 ? 458  GLN I NE2 1 
ATOM   3591 N N   . ASP I 1 9   ? -3.865  -25.443 35.260 1.00 17.96 ? 459  ASP I N   1 
ATOM   3592 C CA  . ASP I 1 9   ? -4.680  -26.655 35.237 1.00 18.33 ? 459  ASP I CA  1 
ATOM   3593 C C   . ASP I 1 9   ? -3.961  -27.817 34.565 1.00 17.55 ? 459  ASP I C   1 
ATOM   3594 O O   . ASP I 1 9   ? -4.143  -28.973 34.967 1.00 19.93 ? 459  ASP I O   1 
ATOM   3595 C CB  . ASP I 1 9   ? -5.997  -26.408 34.497 1.00 21.55 ? 459  ASP I CB  1 
ATOM   3596 C CG  . ASP I 1 9   ? -6.862  -25.351 35.155 1.00 32.84 ? 459  ASP I CG  1 
ATOM   3597 O OD1 . ASP I 1 9   ? -7.658  -24.713 34.433 1.00 36.01 ? 459  ASP I OD1 1 
ATOM   3598 O OD2 . ASP I 1 9   ? -6.749  -25.152 36.384 1.00 31.88 ? 459  ASP I OD2 1 
ATOM   3599 N N   . TRP I 1 10  ? -3.147  -27.538 33.549 1.00 14.79 ? 460  TRP I N   1 
ATOM   3600 C CA  . TRP I 1 10  ? -2.484  -28.573 32.768 1.00 14.93 ? 460  TRP I CA  1 
ATOM   3601 C C   . TRP I 1 10  ? -1.154  -29.035 33.349 1.00 12.38 ? 460  TRP I C   1 
ATOM   3602 O O   . TRP I 1 10  ? -0.497  -29.881 32.735 1.00 11.72 ? 460  TRP I O   1 
ATOM   3603 C CB  . TRP I 1 10  ? -2.276  -28.104 31.323 1.00 14.94 ? 460  TRP I CB  1 
ATOM   3604 C CG  . TRP I 1 10  ? -1.814  -26.682 31.228 1.00 13.71 ? 460  TRP I CG  1 
ATOM   3605 C CD1 . TRP I 1 10  ? -2.584  -25.599 30.930 1.00 16.25 ? 460  TRP I CD1 1 
ATOM   3606 C CD2 . TRP I 1 10  ? -0.481  -26.187 31.438 1.00 12.65 ? 460  TRP I CD2 1 
ATOM   3607 N NE1 . TRP I 1 10  ? -1.818  -24.463 30.938 1.00 17.58 ? 460  TRP I NE1 1 
ATOM   3608 C CE2 . TRP I 1 10  ? -0.526  -24.792 31.251 1.00 13.84 ? 460  TRP I CE2 1 
ATOM   3609 C CE3 . TRP I 1 10  ? 0.740   -26.783 31.768 1.00 11.35 ? 460  TRP I CE3 1 
ATOM   3610 C CZ2 . TRP I 1 10  ? 0.602   -23.983 31.375 1.00 14.53 ? 460  TRP I CZ2 1 
ATOM   3611 C CZ3 . TRP I 1 10  ? 1.868   -25.971 31.896 1.00 11.46 ? 460  TRP I CZ3 1 
ATOM   3612 C CH2 . TRP I 1 10  ? 1.786   -24.586 31.698 1.00 12.30 ? 460  TRP I CH2 1 
ATOM   3613 N N   . TYR I 1 11  ? -0.730  -28.508 34.496 1.00 13.08 ? 461  TYR I N   1 
ATOM   3614 C CA  . TYR I 1 11  ? 0.540   -28.895 35.103 1.00 12.48 ? 461  TYR I CA  1 
ATOM   3615 C C   . TYR I 1 11  ? 0.297   -29.978 36.146 1.00 14.85 ? 461  TYR I C   1 
ATOM   3616 O O   . TYR I 1 11  ? -0.418  -29.752 37.127 1.00 15.04 ? 461  TYR I O   1 
ATOM   3617 C CB  . TYR I 1 11  ? 1.243   -27.697 35.735 1.00 12.76 ? 461  TYR I CB  1 
ATOM   3618 C CG  . TYR I 1 11  ? 2.544   -28.081 36.382 1.00 12.81 ? 461  TYR I CG  1 
ATOM   3619 C CD1 . TYR I 1 11  ? 3.639   -28.449 35.613 1.00 14.08 ? 461  TYR I CD1 1 
ATOM   3620 C CD2 . TYR I 1 11  ? 2.676   -28.100 37.760 1.00 13.15 ? 461  TYR I CD2 1 
ATOM   3621 C CE1 . TYR I 1 11  ? 4.830   -28.817 36.197 1.00 16.10 ? 461  TYR I CE1 1 
ATOM   3622 C CE2 . TYR I 1 11  ? 3.877   -28.463 38.360 1.00 15.25 ? 461  TYR I CE2 1 
ATOM   3623 C CZ  . TYR I 1 11  ? 4.946   -28.819 37.567 1.00 17.74 ? 461  TYR I CZ  1 
ATOM   3624 O OH  . TYR I 1 11  ? 6.136   -29.178 38.153 1.00 27.05 ? 461  TYR I OH  1 
ATOM   3625 N N   . HIS I 1 12  ? 0.907   -31.144 35.947 1.00 12.86 ? 462  HIS I N   1 
ATOM   3626 C CA  . HIS I 1 12  ? 0.655   -32.297 36.802 1.00 13.20 ? 462  HIS I CA  1 
ATOM   3627 C C   . HIS I 1 12  ? 1.838   -32.648 37.697 1.00 13.49 ? 462  HIS I C   1 
ATOM   3628 O O   . HIS I 1 12  ? 1.816   -33.693 38.359 1.00 16.74 ? 462  HIS I O   1 
ATOM   3629 C CB  . HIS I 1 12  ? 0.202   -33.500 35.970 1.00 13.15 ? 462  HIS I CB  1 
ATOM   3630 C CG  . HIS I 1 12  ? -1.151  -33.329 35.359 1.00 15.85 ? 462  HIS I CG  1 
ATOM   3631 N ND1 . HIS I 1 12  ? -2.191  -34.203 35.600 1.00 16.81 ? 462  HIS I ND1 1 
ATOM   3632 C CD2 . HIS I 1 12  ? -1.638  -32.387 34.518 1.00 15.70 ? 462  HIS I CD2 1 
ATOM   3633 C CE1 . HIS I 1 12  ? -3.259  -33.805 34.932 1.00 19.83 ? 462  HIS I CE1 1 
ATOM   3634 N NE2 . HIS I 1 12  ? -2.951  -32.705 34.269 1.00 16.08 ? 462  HIS I NE2 1 
ATOM   3635 N N   . GLY I 1 13  ? 2.869   -31.810 37.739 1.00 14.13 ? 463  GLY I N   1 
ATOM   3636 C CA  . GLY I 1 13  ? 3.936   -32.033 38.698 1.00 13.87 ? 463  GLY I CA  1 
ATOM   3637 C C   . GLY I 1 13  ? 4.729   -33.285 38.377 1.00 14.01 ? 463  GLY I C   1 
ATOM   3638 O O   . GLY I 1 13  ? 5.097   -33.543 37.225 1.00 14.38 ? 463  GLY I O   1 
ATOM   3639 N N   . ALA I 1 14  ? 4.974   -34.100 39.402 1.00 15.47 ? 464  ALA I N   1 
ATOM   3640 C CA  . ALA I 1 14  ? 5.938   -35.186 39.320 1.00 14.70 ? 464  ALA I CA  1 
ATOM   3641 C C   . ALA I 1 14  ? 5.335   -36.516 38.870 1.00 14.98 ? 464  ALA I C   1 
ATOM   3642 O O   . ALA I 1 14  ? 5.970   -37.558 39.064 1.00 16.09 ? 464  ALA I O   1 
ATOM   3643 C CB  . ALA I 1 14  ? 6.652   -35.360 40.663 1.00 23.10 ? 464  ALA I CB  1 
ATOM   3644 N N   . ILE I 1 15  ? 4.145   -36.515 38.269 1.00 14.31 ? 465  ILE I N   1 
ATOM   3645 C CA  . ILE I 1 15  ? 3.581   -37.816 37.880 1.00 16.59 ? 465  ILE I CA  1 
ATOM   3646 C C   . ILE I 1 15  ? 4.492   -38.485 36.861 1.00 17.21 ? 465  ILE I C   1 
ATOM   3647 O O   . ILE I 1 15  ? 5.058   -37.799 35.984 1.00 16.11 ? 465  ILE I O   1 
ATOM   3648 C CB  . ILE I 1 15  ? 2.145   -37.683 37.340 1.00 14.68 ? 465  ILE I CB  1 
ATOM   3649 C CG1 . ILE I 1 15  ? 2.095   -36.849 36.054 1.00 17.19 ? 465  ILE I CG1 1 
ATOM   3650 C CG2 . ILE I 1 15  ? 1.225   -37.137 38.413 1.00 14.38 ? 465  ILE I CG2 1 
ATOM   3651 C CD1 . ILE I 1 15  ? 0.775   -36.987 35.317 1.00 16.05 ? 465  ILE I CD1 1 
ATOM   3652 N N   . PRO I 1 16  ? 4.687   -39.796 36.930 1.00 14.43 ? 466  PRO I N   1 
ATOM   3653 C CA  . PRO I 1 16  ? 5.566   -40.468 35.974 1.00 14.32 ? 466  PRO I CA  1 
ATOM   3654 C C   . PRO I 1 16  ? 4.884   -40.655 34.627 1.00 13.96 ? 466  PRO I C   1 
ATOM   3655 O O   . PRO I 1 16  ? 3.665   -40.538 34.489 1.00 13.89 ? 466  PRO I O   1 
ATOM   3656 C CB  . PRO I 1 16  ? 5.812   -41.827 36.635 1.00 15.53 ? 466  PRO I CB  1 
ATOM   3657 C CG  . PRO I 1 16  ? 4.566   -42.067 37.426 1.00 17.01 ? 466  PRO I CG  1 
ATOM   3658 C CD  . PRO I 1 16  ? 4.169   -40.720 37.955 1.00 15.67 ? 466  PRO I CD  1 
ATOM   3659 N N   . ARG I 1 17  ? 5.712   -40.973 33.630 1.00 13.84 ? 467  ARG I N   1 
ATOM   3660 C CA  . ARG I 1 17  ? 5.218   -41.229 32.280 1.00 13.67 ? 467  ARG I CA  1 
ATOM   3661 C C   . ARG I 1 17  ? 4.027   -42.189 32.269 1.00 13.72 ? 467  ARG I C   1 
ATOM   3662 O O   . ARG I 1 17  ? 3.022   -41.938 31.594 1.00 13.59 ? 467  ARG I O   1 
ATOM   3663 C CB  . ARG I 1 17  ? 6.354   -41.759 31.404 1.00 16.55 ? 467  ARG I CB  1 
ATOM   3664 C CG  . ARG I 1 17  ? 5.893   -42.130 30.010 1.00 15.19 ? 467  ARG I CG  1 
ATOM   3665 C CD  . ARG I 1 17  ? 7.013   -42.671 29.140 1.00 17.06 ? 467  ARG I CD  1 
ATOM   3666 N NE  . ARG I 1 17  ? 7.991   -41.644 28.813 1.00 18.74 ? 467  ARG I NE  1 
ATOM   3667 C CZ  . ARG I 1 17  ? 8.575   -41.513 27.626 1.00 16.03 ? 467  ARG I CZ  1 
ATOM   3668 N NH1 . ARG I 1 17  ? 8.282   -42.350 26.631 1.00 15.89 ? 467  ARG I NH1 1 
ATOM   3669 N NH2 . ARG I 1 17  ? 9.456   -40.543 27.433 1.00 15.53 ? 467  ARG I NH2 1 
ATOM   3670 N N   . ILE I 1 18  ? 4.120   -43.297 33.013 1.00 14.05 ? 468  ILE I N   1 
ATOM   3671 C CA  . ILE I 1 18  ? 3.053   -44.299 32.988 1.00 14.25 ? 468  ILE I CA  1 
ATOM   3672 C C   . ILE I 1 18  ? 1.725   -43.716 33.455 1.00 14.95 ? 468  ILE I C   1 
ATOM   3673 O O   . ILE I 1 18  ? 0.659   -44.102 32.959 1.00 17.02 ? 468  ILE I O   1 
ATOM   3674 C CB  . ILE I 1 18  ? 3.467   -45.559 33.783 1.00 14.65 ? 468  ILE I CB  1 
ATOM   3675 C CG1 . ILE I 1 18  ? 2.443   -46.678 33.595 1.00 17.98 ? 468  ILE I CG1 1 
ATOM   3676 C CG2 . ILE I 1 18  ? 3.628   -45.263 35.261 1.00 16.14 ? 468  ILE I CG2 1 
ATOM   3677 C CD1 . ILE I 1 18  ? 2.295   -47.112 32.163 1.00 21.09 ? 468  ILE I CD1 1 
ATOM   3678 N N   . GLU I 1 19  ? 1.758   -42.776 34.399 1.00 15.27 ? 469  GLU I N   1 
ATOM   3679 C CA  . GLU I 1 19  ? 0.518   -42.150 34.839 1.00 14.42 ? 469  GLU I CA  1 
ATOM   3680 C C   . GLU I 1 19  ? 0.029   -41.124 33.828 1.00 17.21 ? 469  GLU I C   1 
ATOM   3681 O O   . GLU I 1 19  ? -1.182  -40.977 33.629 1.00 19.51 ? 469  GLU I O   1 
ATOM   3682 C CB  . GLU I 1 19  ? 0.699   -41.518 36.220 1.00 18.12 ? 469  GLU I CB  1 
ATOM   3683 C CG  . GLU I 1 19  ? 0.729   -42.534 37.347 1.00 18.73 ? 469  GLU I CG  1 
ATOM   3684 C CD  . GLU I 1 19  ? 0.906   -41.895 38.713 1.00 22.17 ? 469  GLU I CD  1 
ATOM   3685 O OE1 . GLU I 1 19  ? 1.368   -42.596 39.637 1.00 22.75 ? 469  GLU I OE1 1 
ATOM   3686 O OE2 . GLU I 1 19  ? 0.591   -40.696 38.869 1.00 19.16 ? 469  GLU I OE2 1 
ATOM   3687 N N   . ALA I 1 20  ? 0.955   -40.415 33.176 1.00 14.67 ? 470  ALA I N   1 
ATOM   3688 C CA  . ALA I 1 20  ? 0.561   -39.458 32.147 1.00 17.54 ? 470  ALA I CA  1 
ATOM   3689 C C   . ALA I 1 20  ? -0.176  -40.153 31.013 1.00 17.80 ? 470  ALA I C   1 
ATOM   3690 O O   . ALA I 1 20  ? -1.120  -39.595 30.439 1.00 21.49 ? 470  ALA I O   1 
ATOM   3691 C CB  . ALA I 1 20  ? 1.793   -38.727 31.613 1.00 18.98 ? 470  ALA I CB  1 
ATOM   3692 N N   . GLN I 1 21  ? 0.238   -41.381 30.692 1.00 21.40 ? 471  GLN I N   1 
ATOM   3693 C CA  . GLN I 1 21  ? -0.393  -42.157 29.628 1.00 26.13 ? 471  GLN I CA  1 
ATOM   3694 C C   . GLN I 1 21  ? -1.886  -42.331 29.867 1.00 28.14 ? 471  GLN I C   1 
ATOM   3695 O O   . GLN I 1 21  ? -2.690  -42.212 28.934 1.00 32.93 ? 471  GLN I O   1 
ATOM   3696 C CB  . GLN I 1 21  ? 0.278   -43.525 29.552 1.00 34.28 ? 471  GLN I CB  1 
ATOM   3697 C CG  . GLN I 1 21  ? -0.474  -44.563 28.758 1.00 41.07 ? 471  GLN I CG  1 
ATOM   3698 C CD  . GLN I 1 21  ? 0.210   -45.910 28.830 1.00 47.08 ? 471  GLN I CD  1 
ATOM   3699 O OE1 . GLN I 1 21  ? 1.409   -46.019 28.572 1.00 47.67 ? 471  GLN I OE1 1 
ATOM   3700 N NE2 . GLN I 1 21  ? -0.543  -46.941 29.196 1.00 50.20 ? 471  GLN I NE2 1 
ATOM   3701 N N   . GLU I 1 22  ? -2.276  -42.633 31.104 1.00 23.33 ? 472  GLU I N   1 
ATOM   3702 C CA  . GLU I 1 22  ? -3.683  -42.881 31.400 1.00 25.93 ? 472  GLU I CA  1 
ATOM   3703 C C   . GLU I 1 22  ? -4.530  -41.625 31.241 1.00 24.98 ? 472  GLU I C   1 
ATOM   3704 O O   . GLU I 1 22  ? -5.722  -41.716 30.930 1.00 25.18 ? 472  GLU I O   1 
ATOM   3705 C CB  . GLU I 1 22  ? -3.824  -43.460 32.806 1.00 34.29 ? 472  GLU I CB  1 
ATOM   3706 C CG  . GLU I 1 22  ? -3.117  -44.795 32.980 1.00 44.14 ? 472  GLU I CG  1 
ATOM   3707 C CD  . GLU I 1 22  ? -3.679  -45.866 32.064 1.00 50.10 ? 472  GLU I CD  1 
ATOM   3708 O OE1 . GLU I 1 22  ? -4.910  -45.874 31.852 1.00 53.06 ? 472  GLU I OE1 1 
ATOM   3709 O OE2 . GLU I 1 22  ? -2.894  -46.692 31.549 1.00 52.22 ? 472  GLU I OE2 1 
ATOM   3710 N N   . LEU I 1 23  ? -3.934  -40.451 31.439 1.00 19.21 ? 473  LEU I N   1 
ATOM   3711 C CA  . LEU I 1 23  ? -4.658  -39.185 31.407 1.00 17.97 ? 473  LEU I CA  1 
ATOM   3712 C C   . LEU I 1 23  ? -4.836  -38.621 30.003 1.00 21.66 ? 473  LEU I C   1 
ATOM   3713 O O   . LEU I 1 23  ? -5.667  -37.726 29.817 1.00 24.89 ? 473  LEU I O   1 
ATOM   3714 C CB  . LEU I 1 23  ? -3.933  -38.156 32.276 1.00 20.01 ? 473  LEU I CB  1 
ATOM   3715 C CG  . LEU I 1 23  ? -3.887  -38.503 33.764 1.00 21.31 ? 473  LEU I CG  1 
ATOM   3716 C CD1 . LEU I 1 23  ? -2.943  -37.575 34.509 1.00 19.57 ? 473  LEU I CD1 1 
ATOM   3717 C CD2 . LEU I 1 23  ? -5.287  -38.437 34.352 1.00 30.48 ? 473  LEU I CD2 1 
ATOM   3718 N N   . LEU I 1 24  ? -4.085  -39.108 29.022 1.00 17.62 ? 474  LEU I N   1 
ATOM   3719 C CA  . LEU I 1 24  ? -4.103  -38.567 27.669 1.00 19.74 ? 474  LEU I CA  1 
ATOM   3720 C C   . LEU I 1 24  ? -4.803  -39.579 26.775 1.00 19.15 ? 474  LEU I C   1 
ATOM   3721 O O   . LEU I 1 24  ? -4.320  -40.706 26.621 1.00 21.81 ? 474  LEU I O   1 
ATOM   3722 C CB  . LEU I 1 24  ? -2.674  -38.327 27.187 1.00 20.63 ? 474  LEU I CB  1 
ATOM   3723 C CG  . LEU I 1 24  ? -1.845  -37.358 28.035 1.00 16.81 ? 474  LEU I CG  1 
ATOM   3724 C CD1 . LEU I 1 24  ? -0.370  -37.459 27.676 1.00 21.99 ? 474  LEU I CD1 1 
ATOM   3725 C CD2 . LEU I 1 24  ? -2.349  -35.932 27.861 1.00 16.71 ? 474  LEU I CD2 1 
ATOM   3726 N N   . LYS I 1 25  ? -5.934  -39.181 26.188 1.00 19.57 ? 475  LYS I N   1 
ATOM   3727 C CA  . LYS I 1 25  ? -6.806  -40.152 25.531 1.00 23.79 ? 475  LYS I CA  1 
ATOM   3728 C C   . LYS I 1 25  ? -7.259  -39.757 24.129 1.00 22.35 ? 475  LYS I C   1 
ATOM   3729 O O   . LYS I 1 25  ? -7.586  -40.634 23.322 1.00 26.21 ? 475  LYS I O   1 
ATOM   3730 C CB  . LYS I 1 25  ? -8.038  -40.440 26.395 1.00 26.25 ? 475  LYS I CB  1 
ATOM   3731 C CG  . LYS I 1 25  ? -7.727  -40.965 27.786 1.00 31.13 ? 475  LYS I CG  1 
ATOM   3732 C CD  . LYS I 1 25  ? -8.986  -41.469 28.469 1.00 37.39 ? 475  LYS I CD  1 
ATOM   3733 C CE  . LYS I 1 25  ? -8.830  -41.500 29.979 1.00 39.72 ? 475  LYS I CE  1 
ATOM   3734 N NZ  . LYS I 1 25  ? -8.774  -40.123 30.544 1.00 40.55 ? 475  LYS I NZ  1 
ATOM   3735 N N   . LYS I 1 26  ? -7.318  -38.462 23.826 1.00 22.64 ? 476  LYS I N   1 
ATOM   3736 C CA  . LYS I 1 26  ? -7.831  -38.008 22.539 1.00 23.65 ? 476  LYS I CA  1 
ATOM   3737 C C   . LYS I 1 26  ? -6.894  -36.982 21.911 1.00 20.18 ? 476  LYS I C   1 
ATOM   3738 O O   . LYS I 1 26  ? -6.104  -36.320 22.593 1.00 18.44 ? 476  LYS I O   1 
ATOM   3739 C CB  . LYS I 1 26  ? -9.246  -37.405 22.644 1.00 30.96 ? 476  LYS I CB  1 
ATOM   3740 C CG  . LYS I 1 26  ? -10.289 -38.321 23.283 1.00 38.44 ? 476  LYS I CG  1 
ATOM   3741 C CD  . LYS I 1 26  ? -10.729 -37.776 24.620 1.00 41.93 ? 476  LYS I CD  1 
ATOM   3742 C CE  . LYS I 1 26  ? -11.544 -38.781 25.416 1.00 44.72 ? 476  LYS I CE  1 
ATOM   3743 N NZ  . LYS I 1 26  ? -11.622 -38.362 26.845 1.00 44.15 ? 476  LYS I NZ  1 
ATOM   3744 N N   . GLN I 1 27  ? -7.025  -36.845 20.593 1.00 21.72 ? 477  GLN I N   1 
ATOM   3745 C CA  . GLN I 1 27  ? -6.205  -35.961 19.774 1.00 19.55 ? 477  GLN I CA  1 
ATOM   3746 C C   . GLN I 1 27  ? -6.102  -34.568 20.377 1.00 17.50 ? 477  GLN I C   1 
ATOM   3747 O O   . GLN I 1 27  ? -7.111  -33.882 20.567 1.00 21.40 ? 477  GLN I O   1 
ATOM   3748 C CB  . GLN I 1 27  ? -6.814  -35.866 18.372 1.00 24.18 ? 477  GLN I CB  1 
ATOM   3749 C CG  . GLN I 1 27  ? -6.043  -34.962 17.422 1.00 22.71 ? 477  GLN I CG  1 
ATOM   3750 C CD  . GLN I 1 27  ? -4.819  -35.634 16.827 1.00 28.85 ? 477  GLN I CD  1 
ATOM   3751 O OE1 . GLN I 1 27  ? -4.469  -36.753 17.195 1.00 27.93 ? 477  GLN I OE1 1 
ATOM   3752 N NE2 . GLN I 1 27  ? -4.170  -34.956 15.891 1.00 32.62 ? 477  GLN I NE2 1 
ATOM   3753 N N   . GLY I 1 28  ? -4.877  -34.151 20.683 1.00 15.95 ? 478  GLY I N   1 
ATOM   3754 C CA  . GLY I 1 28  ? -4.628  -32.822 21.193 1.00 14.64 ? 478  GLY I CA  1 
ATOM   3755 C C   . GLY I 1 28  ? -4.671  -32.679 22.698 1.00 14.94 ? 478  GLY I C   1 
ATOM   3756 O O   . GLY I 1 28  ? -4.419  -31.576 23.196 1.00 14.86 ? 478  GLY I O   1 
ATOM   3757 N N   . ASP I 1 29  ? -4.990  -33.743 23.437 1.00 14.85 ? 479  ASP I N   1 
ATOM   3758 C CA  . ASP I 1 29  ? -4.889  -33.705 24.893 1.00 15.03 ? 479  ASP I CA  1 
ATOM   3759 C C   . ASP I 1 29  ? -3.440  -33.459 25.296 1.00 13.95 ? 479  ASP I C   1 
ATOM   3760 O O   . ASP I 1 29  ? -2.520  -34.028 24.709 1.00 14.01 ? 479  ASP I O   1 
ATOM   3761 C CB  . ASP I 1 29  ? -5.289  -35.063 25.471 1.00 14.67 ? 479  ASP I CB  1 
ATOM   3762 C CG  . ASP I 1 29  ? -6.785  -35.297 25.487 1.00 18.82 ? 479  ASP I CG  1 
ATOM   3763 O OD1 . ASP I 1 29  ? -7.553  -34.390 25.105 1.00 22.70 ? 479  ASP I OD1 1 
ATOM   3764 O OD2 . ASP I 1 29  ? -7.186  -36.412 25.898 1.00 21.49 ? 479  ASP I OD2 1 
ATOM   3765 N N   . PHE I 1 30  ? -3.226  -32.635 26.320 1.00 12.07 ? 480  PHE I N   1 
ATOM   3766 C CA  . PHE I 1 30  ? -1.853  -32.367 26.724 1.00 10.95 ? 480  PHE I CA  1 
ATOM   3767 C C   . PHE I 1 30  ? -1.766  -32.065 28.212 1.00 10.98 ? 480  PHE I C   1 
ATOM   3768 O O   . PHE I 1 30  ? -2.731  -31.623 28.849 1.00 12.25 ? 480  PHE I O   1 
ATOM   3769 C CB  . PHE I 1 30  ? -1.211  -31.238 25.901 1.00 11.68 ? 480  PHE I CB  1 
ATOM   3770 C CG  . PHE I 1 30  ? -1.759  -29.865 26.207 1.00 10.92 ? 480  PHE I CG  1 
ATOM   3771 C CD1 . PHE I 1 30  ? -2.860  -29.372 25.520 1.00 12.96 ? 480  PHE I CD1 1 
ATOM   3772 C CD2 . PHE I 1 30  ? -1.161  -29.061 27.167 1.00 11.02 ? 480  PHE I CD2 1 
ATOM   3773 C CE1 . PHE I 1 30  ? -3.361  -28.104 25.800 1.00 12.67 ? 480  PHE I CE1 1 
ATOM   3774 C CE2 . PHE I 1 30  ? -1.665  -27.789 27.445 1.00 12.42 ? 480  PHE I CE2 1 
ATOM   3775 C CZ  . PHE I 1 30  ? -2.760  -27.320 26.759 1.00 12.96 ? 480  PHE I CZ  1 
ATOM   3776 N N   . LEU I 1 31  ? -0.567  -32.292 28.748 1.00 10.50 ? 481  LEU I N   1 
ATOM   3777 C CA  . LEU I 1 31  ? -0.220  -31.896 30.103 1.00 10.79 ? 481  LEU I CA  1 
ATOM   3778 C C   . LEU I 1 31  ? 1.285   -31.675 30.171 1.00 10.32 ? 481  LEU I C   1 
ATOM   3779 O O   . LEU I 1 31  ? 2.032   -32.087 29.279 1.00 10.36 ? 481  LEU I O   1 
ATOM   3780 C CB  . LEU I 1 31  ? -0.676  -32.938 31.129 1.00 11.36 ? 481  LEU I CB  1 
ATOM   3781 C CG  . LEU I 1 31  ? -0.133  -34.365 31.010 1.00 11.44 ? 481  LEU I CG  1 
ATOM   3782 C CD1 . LEU I 1 31  ? 1.235   -34.517 31.677 1.00 13.18 ? 481  LEU I CD1 1 
ATOM   3783 C CD2 . LEU I 1 31  ? -1.126  -35.366 31.591 1.00 15.98 ? 481  LEU I CD2 1 
ATOM   3784 N N   . VAL I 1 32  ? 1.726   -31.037 31.254 1.00 9.04  ? 482  VAL I N   1 
ATOM   3785 C CA  . VAL I 1 32  ? 3.143   -30.809 31.518 1.00 11.37 ? 482  VAL I CA  1 
ATOM   3786 C C   . VAL I 1 32  ? 3.494   -31.480 32.838 1.00 9.34  ? 482  VAL I C   1 
ATOM   3787 O O   . VAL I 1 32  ? 2.693   -31.472 33.781 1.00 11.48 ? 482  VAL I O   1 
ATOM   3788 C CB  . VAL I 1 32  ? 3.499   -29.303 31.515 1.00 9.03  ? 482  VAL I CB  1 
ATOM   3789 C CG1 . VAL I 1 32  ? 4.934   -29.068 31.960 1.00 11.15 ? 482  VAL I CG1 1 
ATOM   3790 C CG2 . VAL I 1 32  ? 3.283   -28.757 30.117 1.00 10.78 ? 482  VAL I CG2 1 
ATOM   3791 N N   . ARG I 1 33  ? 4.673   -32.101 32.887 1.00 9.49  ? 483  ARG I N   1 
ATOM   3792 C CA  . ARG I 1 33  ? 5.128   -32.818 34.070 1.00 10.48 ? 483  ARG I CA  1 
ATOM   3793 C C   . ARG I 1 33  ? 6.639   -32.685 34.175 1.00 9.82  ? 483  ARG I C   1 
ATOM   3794 O O   . ARG I 1 33  ? 7.311   -32.197 33.262 1.00 10.40 ? 483  ARG I O   1 
ATOM   3795 C CB  . ARG I 1 33  ? 4.734   -34.296 34.012 1.00 10.84 ? 483  ARG I CB  1 
ATOM   3796 C CG  . ARG I 1 33  ? 5.333   -35.029 32.815 1.00 11.84 ? 483  ARG I CG  1 
ATOM   3797 C CD  . ARG I 1 33  ? 4.733   -36.418 32.631 1.00 11.05 ? 483  ARG I CD  1 
ATOM   3798 N NE  . ARG I 1 33  ? 5.232   -37.055 31.413 1.00 10.96 ? 483  ARG I NE  1 
ATOM   3799 C CZ  . ARG I 1 33  ? 6.400   -37.684 31.309 1.00 10.49 ? 483  ARG I CZ  1 
ATOM   3800 N NH1 . ARG I 1 33  ? 7.211   -37.782 32.361 1.00 11.89 ? 483  ARG I NH1 1 
ATOM   3801 N NH2 . ARG I 1 33  ? 6.767   -38.224 30.152 1.00 12.32 ? 483  ARG I NH2 1 
ATOM   3802 N N   . GLU I 1 34  ? 7.173   -33.122 35.308 1.00 11.64 ? 484  GLU I N   1 
ATOM   3803 C CA  . GLU I 1 34  ? 8.611   -33.095 35.536 1.00 13.32 ? 484  GLU I CA  1 
ATOM   3804 C C   . GLU I 1 34  ? 9.217   -34.434 35.139 1.00 15.18 ? 484  GLU I C   1 
ATOM   3805 O O   . GLU I 1 34  ? 8.741   -35.486 35.573 1.00 22.85 ? 484  GLU I O   1 
ATOM   3806 C CB  . GLU I 1 34  ? 8.887   -32.842 37.013 1.00 20.60 ? 484  GLU I CB  1 
ATOM   3807 C CG  . GLU I 1 34  ? 8.078   -31.694 37.557 1.00 23.29 ? 484  GLU I CG  1 
ATOM   3808 C CD  . GLU I 1 34  ? 8.935   -30.480 37.833 1.00 34.47 ? 484  GLU I CD  1 
ATOM   3809 O OE1 . GLU I 1 34  ? 10.154  -30.562 37.570 1.00 40.30 ? 484  GLU I OE1 1 
ATOM   3810 O OE2 . GLU I 1 34  ? 8.385   -29.466 38.314 1.00 40.08 ? 484  GLU I OE2 1 
ATOM   3811 N N   . SER I 1 35  ? 10.291  -34.390 34.355 1.00 10.79 ? 485  SER I N   1 
ATOM   3812 C CA  . SER I 1 35  ? 10.877  -35.604 33.788 1.00 10.19 ? 485  SER I CA  1 
ATOM   3813 C C   . SER I 1 35  ? 11.531  -36.472 34.859 1.00 9.68  ? 485  SER I C   1 
ATOM   3814 O O   . SER I 1 35  ? 12.137  -35.970 35.811 1.00 11.53 ? 485  SER I O   1 
ATOM   3815 C CB  . SER I 1 35  ? 11.935  -35.225 32.753 1.00 11.75 ? 485  SER I CB  1 
ATOM   3816 O OG  . SER I 1 35  ? 12.538  -36.365 32.163 1.00 11.19 ? 485  SER I OG  1 
ATOM   3817 N N   . HIS I 1 36  ? 11.418  -37.787 34.687 1.00 11.12 ? 486  HIS I N   1 
ATOM   3818 C CA  . HIS I 1 36  ? 12.239  -38.741 35.429 1.00 10.47 ? 486  HIS I CA  1 
ATOM   3819 C C   . HIS I 1 36  ? 13.457  -39.199 34.641 1.00 12.38 ? 486  HIS I C   1 
ATOM   3820 O O   . HIS I 1 36  ? 14.546  -39.318 35.208 1.00 12.86 ? 486  HIS I O   1 
ATOM   3821 C CB  . HIS I 1 36  ? 11.403  -39.953 35.866 1.00 11.58 ? 486  HIS I CB  1 
ATOM   3822 C CG  . HIS I 1 36  ? 10.461  -39.648 36.986 1.00 13.28 ? 486  HIS I CG  1 
ATOM   3823 N ND1 . HIS I 1 36  ? 9.205   -39.119 36.781 1.00 16.10 ? 486  HIS I ND1 1 
ATOM   3824 C CD2 . HIS I 1 36  ? 10.610  -39.758 38.328 1.00 17.59 ? 486  HIS I CD2 1 
ATOM   3825 C CE1 . HIS I 1 36  ? 8.612   -38.937 37.948 1.00 17.19 ? 486  HIS I CE1 1 
ATOM   3826 N NE2 . HIS I 1 36  ? 9.443   -39.318 38.903 1.00 19.51 ? 486  HIS I NE2 1 
ATOM   3827 N N   . GLY I 1 37  ? 13.298  -39.429 33.335 1.00 12.22 ? 487  GLY I N   1 
ATOM   3828 C CA  . GLY I 1 37  ? 14.426  -39.842 32.519 1.00 13.69 ? 487  GLY I CA  1 
ATOM   3829 C C   . GLY I 1 37  ? 15.500  -38.781 32.390 1.00 14.25 ? 487  GLY I C   1 
ATOM   3830 O O   . GLY I 1 37  ? 16.681  -39.106 32.235 1.00 15.74 ? 487  GLY I O   1 
ATOM   3831 N N   . LYS I 1 38  ? 15.112  -37.507 32.452 1.00 12.84 ? 488  LYS I N   1 
ATOM   3832 C CA  . LYS I 1 38  ? 16.031  -36.375 32.339 1.00 12.40 ? 488  LYS I CA  1 
ATOM   3833 C C   . LYS I 1 38  ? 15.757  -35.452 33.521 1.00 10.79 ? 488  LYS I C   1 
ATOM   3834 O O   . LYS I 1 38  ? 15.046  -34.443 33.391 1.00 11.85 ? 488  LYS I O   1 
ATOM   3835 C CB  . LYS I 1 38  ? 15.849  -35.640 31.011 1.00 14.03 ? 488  LYS I CB  1 
ATOM   3836 C CG  . LYS I 1 38  ? 16.144  -36.469 29.769 1.00 19.59 ? 488  LYS I CG  1 
ATOM   3837 C CD  . LYS I 1 38  ? 17.631  -36.693 29.582 1.00 22.96 ? 488  LYS I CD  1 
ATOM   3838 C CE  . LYS I 1 38  ? 17.986  -37.005 28.128 1.00 30.91 ? 488  LYS I CE  1 
ATOM   3839 N NZ  . LYS I 1 38  ? 18.412  -35.789 27.374 1.00 34.75 ? 488  LYS I NZ  1 
ATOM   3840 N N   . PRO I 1 39  ? 16.299  -35.776 34.695 1.00 13.09 ? 489  PRO I N   1 
ATOM   3841 C CA  . PRO I 1 39  ? 15.952  -35.017 35.905 1.00 12.50 ? 489  PRO I CA  1 
ATOM   3842 C C   . PRO I 1 39  ? 16.258  -33.533 35.767 1.00 12.34 ? 489  PRO I C   1 
ATOM   3843 O O   . PRO I 1 39  ? 17.285  -33.139 35.213 1.00 15.56 ? 489  PRO I O   1 
ATOM   3844 C CB  . PRO I 1 39  ? 16.828  -35.658 36.988 1.00 16.47 ? 489  PRO I CB  1 
ATOM   3845 C CG  . PRO I 1 39  ? 17.089  -37.028 36.489 1.00 16.24 ? 489  PRO I CG  1 
ATOM   3846 C CD  . PRO I 1 39  ? 17.181  -36.919 34.989 1.00 15.68 ? 489  PRO I CD  1 
ATOM   3847 N N   . GLY I 1 40  ? 15.356  -32.714 36.306 1.00 11.77 ? 490  GLY I N   1 
ATOM   3848 C CA  . GLY I 1 40  ? 15.469  -31.276 36.215 1.00 11.80 ? 490  GLY I CA  1 
ATOM   3849 C C   . GLY I 1 40  ? 14.828  -30.672 34.991 1.00 12.12 ? 490  GLY I C   1 
ATOM   3850 O O   . GLY I 1 40  ? 14.645  -29.451 34.950 1.00 13.62 ? 490  GLY I O   1 
ATOM   3851 N N   . GLU I 1 41  ? 14.472  -31.482 34.002 1.00 11.85 ? 491  GLU I N   1 
ATOM   3852 C CA  . GLU I 1 41  ? 13.834  -30.991 32.792 1.00 10.78 ? 491  GLU I CA  1 
ATOM   3853 C C   . GLU I 1 41  ? 12.329  -31.197 32.885 1.00 10.72 ? 491  GLU I C   1 
ATOM   3854 O O   . GLU I 1 41  ? 11.848  -32.080 33.606 1.00 11.48 ? 491  GLU I O   1 
ATOM   3855 C CB  . GLU I 1 41  ? 14.412  -31.701 31.564 1.00 15.07 ? 491  GLU I CB  1 
ATOM   3856 C CG  . GLU I 1 41  ? 15.926  -31.892 31.688 1.00 22.11 ? 491  GLU I CG  1 
ATOM   3857 C CD  . GLU I 1 41  ? 16.697  -31.537 30.439 1.00 30.21 ? 491  GLU I CD  1 
ATOM   3858 O OE1 . GLU I 1 41  ? 16.215  -31.849 29.333 1.00 31.51 ? 491  GLU I OE1 1 
ATOM   3859 O OE2 . GLU I 1 41  ? 17.786  -30.933 30.564 1.00 35.98 ? 491  GLU I OE2 1 
ATOM   3860 N N   . TYR I 1 42  ? 11.588  -30.370 32.155 1.00 9.62  ? 492  TYR I N   1 
ATOM   3861 C CA  . TYR I 1 42  ? 10.142  -30.487 32.069 1.00 9.04  ? 492  TYR I CA  1 
ATOM   3862 C C   . TYR I 1 42  ? 9.750   -31.173 30.767 1.00 9.71  ? 492  TYR I C   1 
ATOM   3863 O O   . TYR I 1 42  ? 10.496  -31.150 29.784 1.00 10.46 ? 492  TYR I O   1 
ATOM   3864 C CB  . TYR I 1 42  ? 9.488   -29.112 32.129 1.00 10.73 ? 492  TYR I CB  1 
ATOM   3865 C CG  . TYR I 1 42  ? 9.585   -28.434 33.475 1.00 10.99 ? 492  TYR I CG  1 
ATOM   3866 C CD1 . TYR I 1 42  ? 10.659  -27.613 33.782 1.00 11.02 ? 492  TYR I CD1 1 
ATOM   3867 C CD2 . TYR I 1 42  ? 8.588   -28.592 34.421 1.00 12.33 ? 492  TYR I CD2 1 
ATOM   3868 C CE1 . TYR I 1 42  ? 10.737  -26.967 35.007 1.00 12.25 ? 492  TYR I CE1 1 
ATOM   3869 C CE2 . TYR I 1 42  ? 8.654   -27.946 35.647 1.00 15.52 ? 492  TYR I CE2 1 
ATOM   3870 C CZ  . TYR I 1 42  ? 9.733   -27.141 35.930 1.00 13.69 ? 492  TYR I CZ  1 
ATOM   3871 O OH  . TYR I 1 42  ? 9.809   -26.483 37.147 1.00 15.42 ? 492  TYR I OH  1 
ATOM   3872 N N   . VAL I 1 43  ? 8.565   -31.780 30.773 1.00 8.89  ? 493  VAL I N   1 
ATOM   3873 C CA  . VAL I 1 43  ? 8.062   -32.559 29.648 1.00 9.57  ? 493  VAL I CA  1 
ATOM   3874 C C   . VAL I 1 43  ? 6.676   -32.070 29.275 1.00 9.37  ? 493  VAL I C   1 
ATOM   3875 O O   . VAL I 1 43  ? 5.824   -31.868 30.147 1.00 10.39 ? 493  VAL I O   1 
ATOM   3876 C CB  . VAL I 1 43  ? 7.960   -34.056 30.014 1.00 10.01 ? 493  VAL I CB  1 
ATOM   3877 C CG1 . VAL I 1 43  ? 7.399   -34.871 28.846 1.00 10.48 ? 493  VAL I CG1 1 
ATOM   3878 C CG2 . VAL I 1 43  ? 9.305   -34.607 30.501 1.00 10.88 ? 493  VAL I CG2 1 
ATOM   3879 N N   . LEU I 1 44  ? 6.443   -31.906 27.976 1.00 9.16  ? 494  LEU I N   1 
ATOM   3880 C CA  . LEU I 1 44  ? 5.105   -31.755 27.435 1.00 9.44  ? 494  LEU I CA  1 
ATOM   3881 C C   . LEU I 1 44  ? 4.679   -33.115 26.895 1.00 10.44 ? 494  LEU I C   1 
ATOM   3882 O O   . LEU I 1 44  ? 5.329   -33.661 25.994 1.00 11.26 ? 494  LEU I O   1 
ATOM   3883 C CB  . LEU I 1 44  ? 5.088   -30.713 26.319 1.00 11.46 ? 494  LEU I CB  1 
ATOM   3884 C CG  . LEU I 1 44  ? 3.789   -30.609 25.525 1.00 10.51 ? 494  LEU I CG  1 
ATOM   3885 C CD1 . LEU I 1 44  ? 2.645   -30.107 26.398 1.00 12.34 ? 494  LEU I CD1 1 
ATOM   3886 C CD2 . LEU I 1 44  ? 3.994   -29.719 24.304 1.00 14.85 ? 494  LEU I CD2 1 
ATOM   3887 N N   . SER I 1 45  ? 3.604   -33.669 27.451 1.00 9.84  ? 495  SER I N   1 
ATOM   3888 C CA  . SER I 1 45  ? 3.064   -34.963 27.029 1.00 10.42 ? 495  SER I CA  1 
ATOM   3889 C C   . SER I 1 45  ? 1.734   -34.746 26.323 1.00 12.56 ? 495  SER I C   1 
ATOM   3890 O O   . SER I 1 45  ? 0.863   -34.031 26.858 1.00 11.44 ? 495  SER I O   1 
ATOM   3891 C CB  . SER I 1 45  ? 2.896   -35.891 28.234 1.00 11.62 ? 495  SER I CB  1 
ATOM   3892 O OG  . SER I 1 45  ? 4.137   -36.230 28.825 1.00 12.66 ? 495  SER I OG  1 
ATOM   3893 N N   . VAL I 1 46  ? 1.571   -35.354 25.131 1.00 12.70 ? 496  VAL I N   1 
ATOM   3894 C CA  A VAL I 1 46  ? 0.412   -35.090 24.288 0.48 12.71 ? 496  VAL I CA  1 
ATOM   3895 C CA  B VAL I 1 46  ? 0.394   -35.099 24.313 0.52 12.60 ? 496  VAL I CA  1 
ATOM   3896 C C   . VAL I 1 46  ? -0.086  -36.414 23.720 1.00 14.99 ? 496  VAL I C   1 
ATOM   3897 O O   . VAL I 1 46  ? 0.699   -37.342 23.494 1.00 19.96 ? 496  VAL I O   1 
ATOM   3898 C CB  A VAL I 1 46  ? 0.754   -34.107 23.140 0.48 14.57 ? 496  VAL I CB  1 
ATOM   3899 C CB  B VAL I 1 46  ? 0.677   -34.098 23.164 0.52 14.49 ? 496  VAL I CB  1 
ATOM   3900 C CG1 A VAL I 1 46  ? -0.513  -33.661 22.399 0.48 14.86 ? 496  VAL I CG1 1 
ATOM   3901 C CG1 B VAL I 1 46  ? 1.380   -32.846 23.666 0.52 13.17 ? 496  VAL I CG1 1 
ATOM   3902 C CG2 A VAL I 1 46  ? 1.500   -32.884 23.645 0.48 13.66 ? 496  VAL I CG2 1 
ATOM   3903 C CG2 B VAL I 1 46  ? 1.465   -34.776 22.072 0.52 15.87 ? 496  VAL I CG2 1 
ATOM   3904 N N   . TYR I 1 47  ? -1.399  -36.497 23.489 1.00 15.11 ? 497  TYR I N   1 
ATOM   3905 C CA  . TYR I 1 47  ? -1.969  -37.575 22.694 1.00 15.69 ? 497  TYR I CA  1 
ATOM   3906 C C   . TYR I 1 47  ? -2.121  -37.026 21.283 1.00 15.10 ? 497  TYR I C   1 
ATOM   3907 O O   . TYR I 1 47  ? -2.776  -35.996 21.082 1.00 16.36 ? 497  TYR I O   1 
ATOM   3908 C CB  . TYR I 1 47  ? -3.335  -37.992 23.226 1.00 16.79 ? 497  TYR I CB  1 
ATOM   3909 C CG  . TYR I 1 47  ? -3.859  -39.279 22.611 1.00 17.98 ? 497  TYR I CG  1 
ATOM   3910 C CD1 . TYR I 1 47  ? -4.503  -39.283 21.376 1.00 19.26 ? 497  TYR I CD1 1 
ATOM   3911 C CD2 . TYR I 1 47  ? -3.707  -40.490 23.272 1.00 20.57 ? 497  TYR I CD2 1 
ATOM   3912 C CE1 . TYR I 1 47  ? -4.982  -40.459 20.823 1.00 23.94 ? 497  TYR I CE1 1 
ATOM   3913 C CE2 . TYR I 1 47  ? -4.183  -41.674 22.724 1.00 22.62 ? 497  TYR I CE2 1 
ATOM   3914 C CZ  . TYR I 1 47  ? -4.818  -41.649 21.502 1.00 19.28 ? 497  TYR I CZ  1 
ATOM   3915 O OH  . TYR I 1 47  ? -5.295  -42.826 20.958 1.00 26.06 ? 497  TYR I OH  1 
ATOM   3916 N N   . SER I 1 48  ? -1.497  -37.685 20.314 1.00 15.78 ? 498  SER I N   1 
ATOM   3917 C CA  . SER I 1 48  ? -1.575  -37.215 18.938 1.00 17.95 ? 498  SER I CA  1 
ATOM   3918 C C   . SER I 1 48  ? -1.462  -38.405 18.005 1.00 23.99 ? 498  SER I C   1 
ATOM   3919 O O   . SER I 1 48  ? -0.558  -39.232 18.160 1.00 22.93 ? 498  SER I O   1 
ATOM   3920 C CB  . SER I 1 48  ? -0.465  -36.205 18.637 1.00 21.40 ? 498  SER I CB  1 
ATOM   3921 O OG  . SER I 1 48  ? -0.662  -35.601 17.369 1.00 23.10 ? 498  SER I OG  1 
ATOM   3922 N N   . ASP I 1 49  ? -2.385  -38.474 17.051 1.00 22.35 ? 499  ASP I N   1 
ATOM   3923 C CA  . ASP I 1 49  ? -2.471  -39.548 16.062 1.00 26.42 ? 499  ASP I CA  1 
ATOM   3924 C C   . ASP I 1 49  ? -2.269  -40.923 16.700 1.00 25.18 ? 499  ASP I C   1 
ATOM   3925 O O   . ASP I 1 49  ? -1.384  -41.698 16.337 1.00 27.25 ? 499  ASP I O   1 
ATOM   3926 C CB  . ASP I 1 49  ? -1.557  -39.294 14.865 1.00 34.58 ? 499  ASP I CB  1 
ATOM   3927 C CG  . ASP I 1 49  ? -1.800  -37.933 14.232 1.00 41.34 ? 499  ASP I CG  1 
ATOM   3928 O OD1 . ASP I 1 49  ? -0.829  -37.312 13.750 1.00 45.59 ? 499  ASP I OD1 1 
ATOM   3929 O OD2 . ASP I 1 49  ? -2.961  -37.468 14.243 1.00 42.37 ? 499  ASP I OD2 1 
ATOM   3930 N N   . GLY I 1 50  ? -3.121  -41.203 17.686 1.00 25.43 ? 500  GLY I N   1 
ATOM   3931 C CA  . GLY I 1 50  ? -3.220  -42.513 18.294 1.00 24.85 ? 500  GLY I CA  1 
ATOM   3932 C C   . GLY I 1 50  ? -2.127  -42.882 19.270 1.00 25.71 ? 500  GLY I C   1 
ATOM   3933 O O   . GLY I 1 50  ? -2.140  -44.008 19.782 1.00 28.06 ? 500  GLY I O   1 
ATOM   3934 N N   . GLN I 1 51  ? -1.188  -41.981 19.560 1.00 20.56 ? 501  GLN I N   1 
ATOM   3935 C CA  . GLN I 1 51  ? -0.049  -42.304 20.407 1.00 21.08 ? 501  GLN I CA  1 
ATOM   3936 C C   . GLN I 1 51  ? 0.186   -41.195 21.422 1.00 19.44 ? 501  GLN I C   1 
ATOM   3937 O O   . GLN I 1 51  ? -0.096  -40.021 21.166 1.00 18.42 ? 501  GLN I O   1 
ATOM   3938 C CB  . GLN I 1 51  ? 1.237   -42.480 19.587 1.00 22.01 ? 501  GLN I CB  1 
ATOM   3939 C CG  . GLN I 1 51  ? 1.161   -43.571 18.530 1.00 28.20 ? 501  GLN I CG  1 
ATOM   3940 C CD  . GLN I 1 51  ? 1.052   -44.958 19.133 1.00 32.73 ? 501  GLN I CD  1 
ATOM   3941 O OE1 . GLN I 1 51  ? 1.545   -45.210 20.231 1.00 34.81 ? 501  GLN I OE1 1 
ATOM   3942 N NE2 . GLN I 1 51  ? 0.400   -45.865 18.416 1.00 34.95 ? 501  GLN I NE2 1 
ATOM   3943 N N   . ARG I 1 52  ? 0.723   -41.578 22.575 1.00 19.52 ? 502  ARG I N   1 
ATOM   3944 C CA  . ARG I 1 52  ? 1.210   -40.601 23.534 1.00 20.60 ? 502  ARG I CA  1 
ATOM   3945 C C   . ARG I 1 52  ? 2.634   -40.223 23.156 1.00 21.95 ? 502  ARG I C   1 
ATOM   3946 O O   . ARG I 1 52  ? 3.481   -41.098 22.944 1.00 24.34 ? 502  ARG I O   1 
ATOM   3947 C CB  . ARG I 1 52  ? 1.174   -41.175 24.950 1.00 22.48 ? 502  ARG I CB  1 
ATOM   3948 C CG  . ARG I 1 52  ? -0.218  -41.264 25.561 1.00 26.10 ? 502  ARG I CG  1 
ATOM   3949 C CD  . ARG I 1 52  ? -0.935  -42.540 25.151 1.00 28.23 ? 502  ARG I CD  1 
ATOM   3950 N NE  . ARG I 1 52  ? -2.219  -42.679 25.829 1.00 30.37 ? 502  ARG I NE  1 
ATOM   3951 C CZ  . ARG I 1 52  ? -3.106  -43.631 25.559 1.00 35.92 ? 502  ARG I CZ  1 
ATOM   3952 N NH1 . ARG I 1 52  ? -2.849  -44.533 24.620 1.00 39.29 ? 502  ARG I NH1 1 
ATOM   3953 N NH2 . ARG I 1 52  ? -4.251  -43.679 26.225 1.00 39.37 ? 502  ARG I NH2 1 
ATOM   3954 N N   . ARG I 1 53  ? 2.892   -38.922 23.047 1.00 17.00 ? 503  ARG I N   1 
ATOM   3955 C CA  . ARG I 1 53  ? 4.191   -38.418 22.628 1.00 18.12 ? 503  ARG I CA  1 
ATOM   3956 C C   . ARG I 1 53  ? 4.704   -37.442 23.675 1.00 16.23 ? 503  ARG I C   1 
ATOM   3957 O O   . ARG I 1 53  ? 3.924   -36.684 24.258 1.00 16.86 ? 503  ARG I O   1 
ATOM   3958 C CB  . ARG I 1 53  ? 4.094   -37.759 21.255 1.00 21.58 ? 503  ARG I CB  1 
ATOM   3959 C CG  . ARG I 1 53  ? 3.631   -38.761 20.203 1.00 23.97 ? 503  ARG I CG  1 
ATOM   3960 C CD  . ARG I 1 53  ? 3.179   -38.119 18.908 1.00 28.48 ? 503  ARG I CD  1 
ATOM   3961 N NE  . ARG I 1 53  ? 2.319   -39.035 18.161 1.00 34.06 ? 503  ARG I NE  1 
ATOM   3962 C CZ  . ARG I 1 53  ? 2.762   -39.967 17.324 1.00 42.95 ? 503  ARG I CZ  1 
ATOM   3963 N NH1 . ARG I 1 53  ? 4.063   -40.110 17.113 1.00 42.94 ? 503  ARG I NH1 1 
ATOM   3964 N NH2 . ARG I 1 53  ? 1.902   -40.757 16.694 1.00 43.07 ? 503  ARG I NH2 1 
ATOM   3965 N N   . HIS I 1 54  ? 6.013   -37.472 23.923 1.00 12.79 ? 504  HIS I N   1 
ATOM   3966 C CA  . HIS I 1 54  ? 6.617   -36.767 25.047 1.00 12.29 ? 504  HIS I CA  1 
ATOM   3967 C C   . HIS I 1 54  ? 7.774   -35.916 24.549 1.00 13.65 ? 504  HIS I C   1 
ATOM   3968 O O   . HIS I 1 54  ? 8.714   -36.438 23.941 1.00 14.20 ? 504  HIS I O   1 
ATOM   3969 C CB  . HIS I 1 54  ? 7.102   -37.781 26.082 1.00 11.03 ? 504  HIS I CB  1 
ATOM   3970 C CG  . HIS I 1 54  ? 6.035   -38.727 26.524 1.00 12.68 ? 504  HIS I CG  1 
ATOM   3971 N ND1 . HIS I 1 54  ? 5.122   -38.415 27.505 1.00 12.03 ? 504  HIS I ND1 1 
ATOM   3972 C CD2 . HIS I 1 54  ? 5.728   -39.978 26.106 1.00 13.91 ? 504  HIS I CD2 1 
ATOM   3973 C CE1 . HIS I 1 54  ? 4.298   -39.434 27.675 1.00 13.13 ? 504  HIS I CE1 1 
ATOM   3974 N NE2 . HIS I 1 54  ? 4.645   -40.394 26.838 1.00 15.51 ? 504  HIS I NE2 1 
ATOM   3975 N N   . PHE I 1 55  ? 7.715   -34.614 24.825 1.00 10.40 ? 505  PHE I N   1 
ATOM   3976 C CA  . PHE I 1 55  ? 8.701   -33.647 24.354 1.00 11.56 ? 505  PHE I CA  1 
ATOM   3977 C C   . PHE I 1 55  ? 9.408   -33.028 25.549 1.00 10.26 ? 505  PHE I C   1 
ATOM   3978 O O   . PHE I 1 55  ? 8.753   -32.561 26.486 1.00 11.75 ? 505  PHE I O   1 
ATOM   3979 C CB  . PHE I 1 55  ? 8.024   -32.502 23.590 1.00 11.80 ? 505  PHE I CB  1 
ATOM   3980 C CG  . PHE I 1 55  ? 7.274   -32.930 22.365 1.00 13.18 ? 505  PHE I CG  1 
ATOM   3981 C CD1 . PHE I 1 55  ? 7.878   -32.884 21.121 1.00 13.07 ? 505  PHE I CD1 1 
ATOM   3982 C CD2 . PHE I 1 55  ? 5.959   -33.355 22.453 1.00 15.58 ? 505  PHE I CD2 1 
ATOM   3983 C CE1 . PHE I 1 55  ? 7.182   -33.269 19.989 1.00 16.63 ? 505  PHE I CE1 1 
ATOM   3984 C CE2 . PHE I 1 55  ? 5.261   -33.734 21.326 1.00 19.55 ? 505  PHE I CE2 1 
ATOM   3985 C CZ  . PHE I 1 55  ? 5.877   -33.693 20.095 1.00 18.92 ? 505  PHE I CZ  1 
ATOM   3986 N N   . ILE I 1 56  ? 10.737  -32.995 25.506 1.00 10.94 ? 506  ILE I N   1 
ATOM   3987 C CA  . ILE I 1 56  ? 11.478  -32.211 26.483 1.00 10.09 ? 506  ILE I CA  1 
ATOM   3988 C C   . ILE I 1 56  ? 11.312  -30.734 26.166 1.00 10.07 ? 506  ILE I C   1 
ATOM   3989 O O   . ILE I 1 56  ? 11.420  -30.310 25.008 1.00 11.76 ? 506  ILE I O   1 
ATOM   3990 C CB  . ILE I 1 56  ? 12.961  -32.621 26.489 1.00 11.66 ? 506  ILE I CB  1 
ATOM   3991 C CG1 . ILE I 1 56  ? 13.120  -34.033 27.058 1.00 12.23 ? 506  ILE I CG1 1 
ATOM   3992 C CG2 . ILE I 1 56  ? 13.791  -31.621 27.287 1.00 14.65 ? 506  ILE I CG2 1 
ATOM   3993 C CD1 . ILE I 1 56  ? 12.792  -34.142 28.527 1.00 16.89 ? 506  ILE I CD1 1 
ATOM   3994 N N   . ILE I 1 57  ? 11.029  -29.945 27.194 1.00 10.63 ? 507  ILE I N   1 
ATOM   3995 C CA  . ILE I 1 57  ? 11.038  -28.493 27.079 1.00 10.85 ? 507  ILE I CA  1 
ATOM   3996 C C   . ILE I 1 57  ? 12.473  -28.055 27.326 1.00 12.88 ? 507  ILE I C   1 
ATOM   3997 O O   . ILE I 1 57  ? 12.979  -28.161 28.445 1.00 16.64 ? 507  ILE I O   1 
ATOM   3998 C CB  . ILE I 1 57  ? 10.079  -27.848 28.082 1.00 11.85 ? 507  ILE I CB  1 
ATOM   3999 C CG1 . ILE I 1 57  ? 8.650   -28.327 27.820 1.00 12.96 ? 507  ILE I CG1 1 
ATOM   4000 C CG2 . ILE I 1 57  ? 10.172  -26.329 28.004 1.00 12.16 ? 507  ILE I CG2 1 
ATOM   4001 C CD1 . ILE I 1 57  ? 7.638   -27.863 28.854 1.00 13.11 ? 507  ILE I CD1 1 
ATOM   4002 N N   . GLN I 1 58  ? 13.148  -27.608 26.276 1.00 12.79 ? 508  GLN I N   1 
ATOM   4003 C CA  . GLN I 1 58  ? 14.545  -27.231 26.404 1.00 12.62 ? 508  GLN I CA  1 
ATOM   4004 C C   . GLN I 1 58  ? 14.663  -25.949 27.215 1.00 13.42 ? 508  GLN I C   1 
ATOM   4005 O O   . GLN I 1 58  ? 13.811  -25.061 27.134 1.00 12.77 ? 508  GLN I O   1 
ATOM   4006 C CB  . GLN I 1 58  ? 15.155  -27.015 25.020 1.00 15.70 ? 508  GLN I CB  1 
ATOM   4007 C CG  . GLN I 1 58  ? 14.837  -28.110 24.009 1.00 26.73 ? 508  GLN I CG  1 
ATOM   4008 C CD  . GLN I 1 58  ? 15.590  -29.405 24.265 1.00 37.06 ? 508  GLN I CD  1 
ATOM   4009 O OE1 . GLN I 1 58  ? 15.261  -30.446 23.697 1.00 42.15 ? 508  GLN I OE1 1 
ATOM   4010 N NE2 . GLN I 1 58  ? 16.612  -29.344 25.112 1.00 39.90 ? 508  GLN I NE2 1 
ATOM   4011 N N   . TYR I 1 59  ? 15.720  -25.851 28.013 1.00 14.60 ? 509  TYR I N   1 
ATOM   4012 C CA  . TYR I 1 59  ? 15.990  -24.648 28.790 1.00 14.09 ? 509  TYR I CA  1 
ATOM   4013 C C   . TYR I 1 59  ? 17.428  -24.234 28.517 1.00 16.36 ? 509  TYR I C   1 
ATOM   4014 O O   . TYR I 1 59  ? 18.366  -24.915 28.948 1.00 17.61 ? 509  TYR I O   1 
ATOM   4015 C CB  . TYR I 1 59  ? 15.738  -24.882 30.281 1.00 12.63 ? 509  TYR I CB  1 
ATOM   4016 C CG  . TYR I 1 59  ? 16.065  -23.686 31.133 1.00 12.64 ? 509  TYR I CG  1 
ATOM   4017 C CD1 . TYR I 1 59  ? 15.292  -22.528 31.077 1.00 13.05 ? 509  TYR I CD1 1 
ATOM   4018 C CD2 . TYR I 1 59  ? 17.151  -23.711 32.001 1.00 14.44 ? 509  TYR I CD2 1 
ATOM   4019 C CE1 . TYR I 1 59  ? 15.599  -21.428 31.862 1.00 13.48 ? 509  TYR I CE1 1 
ATOM   4020 C CE2 . TYR I 1 59  ? 17.462  -22.625 32.784 1.00 15.79 ? 509  TYR I CE2 1 
ATOM   4021 C CZ  . TYR I 1 59  ? 16.685  -21.486 32.711 1.00 14.02 ? 509  TYR I CZ  1 
ATOM   4022 O OH  . TYR I 1 59  ? 17.000  -20.402 33.495 1.00 16.41 ? 509  TYR I OH  1 
ATOM   4023 N N   . VAL I 1 60  ? 17.590  -23.135 27.778 1.00 18.16 ? 510  VAL I N   1 
ATOM   4024 C CA  . VAL I 1 60  ? 18.876  -22.692 27.248 1.00 19.66 ? 510  VAL I CA  1 
ATOM   4025 C C   . VAL I 1 60  ? 18.922  -21.173 27.337 1.00 22.01 ? 510  VAL I C   1 
ATOM   4026 O O   . VAL I 1 60  ? 17.990  -20.496 26.891 1.00 21.93 ? 510  VAL I O   1 
ATOM   4027 C CB  . VAL I 1 60  ? 19.058  -23.127 25.779 1.00 25.04 ? 510  VAL I CB  1 
ATOM   4028 C CG1 . VAL I 1 60  ? 20.340  -22.542 25.202 1.00 26.92 ? 510  VAL I CG1 1 
ATOM   4029 C CG2 . VAL I 1 60  ? 19.051  -24.642 25.650 1.00 28.92 ? 510  VAL I CG2 1 
ATOM   4030 N N   . ASP I 1 61  ? 20.008  -20.641 27.899 1.00 24.53 ? 511  ASP I N   1 
ATOM   4031 C CA  . ASP I 1 61  ? 20.218  -19.197 28.013 1.00 25.41 ? 511  ASP I CA  1 
ATOM   4032 C C   . ASP I 1 61  ? 19.007  -18.503 28.634 1.00 22.88 ? 511  ASP I C   1 
ATOM   4033 O O   . ASP I 1 61  ? 18.491  -17.510 28.114 1.00 21.75 ? 511  ASP I O   1 
ATOM   4034 C CB  . ASP I 1 61  ? 20.604  -18.567 26.672 1.00 33.02 ? 511  ASP I CB  1 
ATOM   4035 C CG  . ASP I 1 61  ? 21.947  -19.055 26.161 1.00 44.73 ? 511  ASP I CG  1 
ATOM   4036 O OD1 . ASP I 1 61  ? 21.987  -19.656 25.066 1.00 49.27 ? 511  ASP I OD1 1 
ATOM   4037 O OD2 . ASP I 1 61  ? 22.960  -18.850 26.861 1.00 48.29 ? 511  ASP I OD2 1 
ATOM   4038 N N   . ASN I 1 62  ? 18.536  -19.065 29.749 1.00 19.16 ? 512  ASN I N   1 
ATOM   4039 C CA  . ASN I 1 62  ? 17.429  -18.529 30.537 1.00 20.50 ? 512  ASN I CA  1 
ATOM   4040 C C   . ASN I 1 62  ? 16.092  -18.567 29.812 1.00 14.41 ? 512  ASN I C   1 
ATOM   4041 O O   . ASN I 1 62  ? 15.153  -17.880 30.227 1.00 16.52 ? 512  ASN I O   1 
ATOM   4042 C CB  . ASN I 1 62  ? 17.708  -17.116 31.063 1.00 21.87 ? 512  ASN I CB  1 
ATOM   4043 C CG  . ASN I 1 62  ? 18.941  -17.052 31.939 1.00 29.42 ? 512  ASN I CG  1 
ATOM   4044 O OD1 . ASN I 1 62  ? 18.885  -17.357 33.130 1.00 36.53 ? 512  ASN I OD1 1 
ATOM   4045 N ND2 . ASN I 1 62  ? 20.062  -16.648 31.354 1.00 33.33 ? 512  ASN I ND2 1 
ATOM   4046 N N   . MET I 1 63  ? 15.971  -19.360 28.746 1.00 14.10 ? 513  MET I N   1 
ATOM   4047 C CA  . MET I 1 63  ? 14.767  -19.398 27.932 1.00 13.66 ? 513  MET I CA  1 
ATOM   4048 C C   . MET I 1 63  ? 14.292  -20.831 27.773 1.00 12.13 ? 513  MET I C   1 
ATOM   4049 O O   . MET I 1 63  ? 15.092  -21.742 27.543 1.00 15.07 ? 513  MET I O   1 
ATOM   4050 C CB  . MET I 1 63  ? 15.026  -18.820 26.538 1.00 16.03 ? 513  MET I CB  1 
ATOM   4051 C CG  . MET I 1 63  ? 15.362  -17.341 26.530 1.00 25.16 ? 513  MET I CG  1 
ATOM   4052 S SD  . MET I 1 63  ? 13.883  -16.331 26.677 1.00 31.43 ? 513  MET I SD  1 
ATOM   4053 C CE  . MET I 1 63  ? 13.999  -15.750 28.361 1.00 31.56 ? 513  MET I CE  1 
ATOM   4054 N N   . TYR I 1 64  ? 12.983  -21.014 27.874 1.00 11.32 ? 514  TYR I N   1 
ATOM   4055 C CA  . TYR I 1 64  ? 12.353  -22.287 27.557 1.00 11.31 ? 514  TYR I CA  1 
ATOM   4056 C C   . TYR I 1 64  ? 11.931  -22.295 26.093 1.00 11.69 ? 514  TYR I C   1 
ATOM   4057 O O   . TYR I 1 64  ? 11.460  -21.282 25.563 1.00 12.47 ? 514  TYR I O   1 
ATOM   4058 C CB  . TYR I 1 64  ? 11.128  -22.497 28.446 1.00 10.82 ? 514  TYR I CB  1 
ATOM   4059 C CG  . TYR I 1 64  ? 11.454  -22.618 29.919 1.00 9.01  ? 514  TYR I CG  1 
ATOM   4060 C CD1 . TYR I 1 64  ? 11.789  -23.848 30.476 1.00 9.36  ? 514  TYR I CD1 1 
ATOM   4061 C CD2 . TYR I 1 64  ? 11.421  -21.510 30.751 1.00 9.98  ? 514  TYR I CD2 1 
ATOM   4062 C CE1 . TYR I 1 64  ? 12.085  -23.963 31.817 1.00 9.45  ? 514  TYR I CE1 1 
ATOM   4063 C CE2 . TYR I 1 64  ? 11.709  -21.617 32.087 1.00 9.96  ? 514  TYR I CE2 1 
ATOM   4064 C CZ  . TYR I 1 64  ? 12.037  -22.842 32.614 1.00 9.05  ? 514  TYR I CZ  1 
ATOM   4065 O OH  . TYR I 1 64  ? 12.330  -22.936 33.959 1.00 10.75 ? 514  TYR I OH  1 
ATOM   4066 N N   . ARG I 1 65  ? 12.096  -23.443 25.437 1.00 11.38 ? 515  ARG I N   1 
ATOM   4067 C CA  . ARG I 1 65  ? 11.802  -23.515 24.012 1.00 12.66 ? 515  ARG I CA  1 
ATOM   4068 C C   . ARG I 1 65  ? 11.584  -24.959 23.583 1.00 14.33 ? 515  ARG I C   1 
ATOM   4069 O O   . ARG I 1 65  ? 11.980  -25.909 24.268 1.00 13.63 ? 515  ARG I O   1 
ATOM   4070 C CB  . ARG I 1 65  ? 12.915  -22.877 23.172 1.00 16.24 ? 515  ARG I CB  1 
ATOM   4071 C CG  . ARG I 1 65  ? 14.278  -23.524 23.342 1.00 20.68 ? 515  ARG I CG  1 
ATOM   4072 C CD  . ARG I 1 65  ? 15.361  -22.765 22.584 1.00 28.88 ? 515  ARG I CD  1 
ATOM   4073 N NE  . ARG I 1 65  ? 15.017  -22.570 21.178 1.00 35.54 ? 515  ARG I NE  1 
ATOM   4074 C CZ  . ARG I 1 65  ? 15.291  -23.440 20.210 1.00 37.71 ? 515  ARG I CZ  1 
ATOM   4075 N NH1 . ARG I 1 65  ? 15.914  -24.578 20.491 1.00 37.91 ? 515  ARG I NH1 1 
ATOM   4076 N NH2 . ARG I 1 65  ? 14.938  -23.174 18.960 1.00 38.05 ? 515  ARG I NH2 1 
ATOM   4077 N N   . PHE I 1 66  ? 10.928  -25.104 22.434 1.00 11.94 ? 516  PHE I N   1 
ATOM   4078 C CA  . PHE I 1 66  ? 10.989  -26.352 21.687 1.00 13.90 ? 516  PHE I CA  1 
ATOM   4079 C C   . PHE I 1 66  ? 11.978  -26.177 20.542 1.00 16.16 ? 516  PHE I C   1 
ATOM   4080 O O   . PHE I 1 66  ? 13.183  -26.353 20.741 1.00 22.24 ? 516  PHE I O   1 
ATOM   4081 C CB  . PHE I 1 66  ? 9.602   -26.795 21.222 1.00 13.38 ? 516  PHE I CB  1 
ATOM   4082 C CG  . PHE I 1 66  ? 8.685   -27.166 22.351 1.00 11.29 ? 516  PHE I CG  1 
ATOM   4083 C CD1 . PHE I 1 66  ? 8.998   -28.226 23.188 1.00 11.36 ? 516  PHE I CD1 1 
ATOM   4084 C CD2 . PHE I 1 66  ? 7.520   -26.454 22.587 1.00 11.00 ? 516  PHE I CD2 1 
ATOM   4085 C CE1 . PHE I 1 66  ? 8.164   -28.569 24.232 1.00 13.44 ? 516  PHE I CE1 1 
ATOM   4086 C CE2 . PHE I 1 66  ? 6.678   -26.788 23.633 1.00 12.01 ? 516  PHE I CE2 1 
ATOM   4087 C CZ  . PHE I 1 66  ? 7.001   -27.856 24.456 1.00 12.56 ? 516  PHE I CZ  1 
ATOM   4088 N N   . GLU I 1 67  ? 11.498  -25.800 19.353 1.00 15.49 ? 517  GLU I N   1 
ATOM   4089 C CA  . GLU I 1 67  ? 12.393  -25.560 18.226 1.00 16.83 ? 517  GLU I CA  1 
ATOM   4090 C C   . GLU I 1 67  ? 12.191  -24.181 17.605 1.00 18.03 ? 517  GLU I C   1 
ATOM   4091 O O   . GLU I 1 67  ? 12.659  -23.932 16.486 1.00 19.63 ? 517  GLU I O   1 
ATOM   4092 C CB  . GLU I 1 67  ? 12.291  -26.671 17.175 1.00 18.18 ? 517  GLU I CB  1 
ATOM   4093 C CG  . GLU I 1 67  ? 10.933  -26.766 16.499 1.00 19.35 ? 517  GLU I CG  1 
ATOM   4094 C CD  . GLU I 1 67  ? 10.896  -27.815 15.404 1.00 21.76 ? 517  GLU I CD  1 
ATOM   4095 O OE1 . GLU I 1 67  ? 11.607  -28.841 15.526 1.00 22.28 ? 517  GLU I OE1 1 
ATOM   4096 O OE2 . GLU I 1 67  ? 10.155  -27.606 14.422 1.00 18.63 ? 517  GLU I OE2 1 
ATOM   4097 N N   . GLY I 1 68  ? 11.514  -23.276 18.310 1.00 17.85 ? 518  GLY I N   1 
ATOM   4098 C CA  . GLY I 1 68  ? 11.299  -21.929 17.822 1.00 17.02 ? 518  GLY I CA  1 
ATOM   4099 C C   . GLY I 1 68  ? 11.916  -20.882 18.726 1.00 17.50 ? 518  GLY I C   1 
ATOM   4100 O O   . GLY I 1 68  ? 13.075  -21.010 19.131 1.00 20.29 ? 518  GLY I O   1 
ATOM   4101 N N   . THR I 1 69  ? 11.148  -19.852 19.063 1.00 16.30 ? 519  THR I N   1 
ATOM   4102 C CA  . THR I 1 69  ? 11.663  -18.768 19.881 1.00 17.29 ? 519  THR I CA  1 
ATOM   4103 C C   . THR I 1 69  ? 11.639  -19.148 21.363 1.00 14.79 ? 519  THR I C   1 
ATOM   4104 O O   . THR I 1 69  ? 11.036  -20.144 21.776 1.00 16.10 ? 519  THR I O   1 
ATOM   4105 C CB  . THR I 1 69  ? 10.860  -17.490 19.643 1.00 20.67 ? 519  THR I CB  1 
ATOM   4106 O OG1 . THR I 1 69  ? 9.523   -17.676 20.115 1.00 21.21 ? 519  THR I OG1 1 
ATOM   4107 C CG2 . THR I 1 69  ? 10.822  -17.146 18.158 1.00 22.22 ? 519  THR I CG2 1 
ATOM   4108 N N   . GLY I 1 70  ? 12.305  -18.330 22.167 1.00 16.33 ? 520  GLY I N   1 
ATOM   4109 C CA  . GLY I 1 70  ? 12.465  -18.593 23.584 1.00 15.67 ? 520  GLY I CA  1 
ATOM   4110 C C   . GLY I 1 70  ? 11.486  -17.815 24.443 1.00 16.69 ? 520  GLY I C   1 
ATOM   4111 O O   . GLY I 1 70  ? 11.074  -16.707 24.100 1.00 14.96 ? 520  GLY I O   1 
ATOM   4112 N N   . PHE I 1 71  ? 11.133  -18.408 25.582 1.00 13.36 ? 521  PHE I N   1 
ATOM   4113 C CA  . PHE I 1 71  ? 10.165  -17.843 26.514 1.00 11.24 ? 521  PHE I CA  1 
ATOM   4114 C C   . PHE I 1 71  ? 10.745  -17.841 27.920 1.00 12.74 ? 521  PHE I C   1 
ATOM   4115 O O   . PHE I 1 71  ? 11.441  -18.781 28.315 1.00 12.54 ? 521  PHE I O   1 
ATOM   4116 C CB  . PHE I 1 71  ? 8.881   -18.671 26.509 1.00 11.98 ? 521  PHE I CB  1 
ATOM   4117 C CG  . PHE I 1 71  ? 8.146   -18.621 25.201 1.00 12.10 ? 521  PHE I CG  1 
ATOM   4118 C CD1 . PHE I 1 71  ? 8.513   -19.440 24.144 1.00 12.37 ? 521  PHE I CD1 1 
ATOM   4119 C CD2 . PHE I 1 71  ? 7.102   -17.729 25.024 1.00 13.37 ? 521  PHE I CD2 1 
ATOM   4120 C CE1 . PHE I 1 71  ? 7.838   -19.369 22.939 1.00 13.08 ? 521  PHE I CE1 1 
ATOM   4121 C CE2 . PHE I 1 71  ? 6.424   -17.662 23.819 1.00 14.97 ? 521  PHE I CE2 1 
ATOM   4122 C CZ  . PHE I 1 71  ? 6.794   -18.477 22.780 1.00 13.96 ? 521  PHE I CZ  1 
ATOM   4123 N N   . SER I 1 72  ? 10.439  -16.794 28.689 1.00 12.35 ? 522  SER I N   1 
ATOM   4124 C CA  . SER I 1 72  ? 10.968  -16.708 30.045 1.00 12.13 ? 522  SER I CA  1 
ATOM   4125 C C   . SER I 1 72  ? 10.375  -17.769 30.963 1.00 10.88 ? 522  SER I C   1 
ATOM   4126 O O   . SER I 1 72  ? 10.995  -18.136 31.968 1.00 11.36 ? 522  SER I O   1 
ATOM   4127 C CB  . SER I 1 72  ? 10.705  -15.322 30.625 1.00 15.55 ? 522  SER I CB  1 
ATOM   4128 O OG  . SER I 1 72  ? 9.315   -15.086 30.753 1.00 25.19 ? 522  SER I OG  1 
ATOM   4129 N N   . ASN I 1 73  ? 9.170   -18.246 30.663 1.00 10.58 ? 523  ASN I N   1 
ATOM   4130 C CA  . ASN I 1 73  ? 8.527   -19.221 31.531 1.00 9.89  ? 523  ASN I CA  1 
ATOM   4131 C C   . ASN I 1 73  ? 7.720   -20.194 30.688 1.00 9.22  ? 523  ASN I C   1 
ATOM   4132 O O   . ASN I 1 73  ? 7.352   -19.915 29.542 1.00 10.94 ? 523  ASN I O   1 
ATOM   4133 C CB  . ASN I 1 73  ? 7.679   -18.549 32.621 1.00 12.31 ? 523  ASN I CB  1 
ATOM   4134 C CG  . ASN I 1 73  ? 6.581   -17.682 32.050 1.00 13.54 ? 523  ASN I CG  1 
ATOM   4135 O OD1 . ASN I 1 73  ? 5.594   -18.184 31.522 1.00 12.50 ? 523  ASN I OD1 1 
ATOM   4136 N ND2 . ASN I 1 73  ? 6.740   -16.366 32.170 1.00 21.55 ? 523  ASN I ND2 1 
ATOM   4137 N N   . ILE I 1 74  ? 7.468   -21.355 31.271 1.00 8.49  ? 524  ILE I N   1 
ATOM   4138 C CA  . ILE I 1 74  ? 6.758   -22.426 30.579 1.00 9.00  ? 524  ILE I CA  1 
ATOM   4139 C C   . ILE I 1 74  ? 5.309   -22.050 30.274 1.00 9.30  ? 524  ILE I C   1 
ATOM   4140 O O   . ILE I 1 74  ? 4.842   -22.339 29.164 1.00 8.75  ? 524  ILE I O   1 
ATOM   4141 C CB  . ILE I 1 74  ? 6.904   -23.758 31.332 1.00 8.26  ? 524  ILE I CB  1 
ATOM   4142 C CG1 . ILE I 1 74  ? 8.354   -24.231 31.216 1.00 9.54  ? 524  ILE I CG1 1 
ATOM   4143 C CG2 . ILE I 1 74  ? 5.942   -24.801 30.779 1.00 9.17  ? 524  ILE I CG2 1 
ATOM   4144 C CD1 . ILE I 1 74  ? 8.671   -25.467 32.031 1.00 10.90 ? 524  ILE I CD1 1 
ATOM   4145 N N   . PRO I 1 75  ? 4.550   -21.430 31.190 1.00 8.66  ? 525  PRO I N   1 
ATOM   4146 C CA  . PRO I 1 75  ? 3.166   -21.072 30.830 1.00 9.58  ? 525  PRO I CA  1 
ATOM   4147 C C   . PRO I 1 75  ? 3.059   -20.241 29.561 1.00 10.79 ? 525  PRO I C   1 
ATOM   4148 O O   . PRO I 1 75  ? 2.139   -20.454 28.766 1.00 9.38  ? 525  PRO I O   1 
ATOM   4149 C CB  . PRO I 1 75  ? 2.664   -20.346 32.083 1.00 10.55 ? 525  PRO I CB  1 
ATOM   4150 C CG  . PRO I 1 75  ? 3.417   -21.049 33.205 1.00 10.34 ? 525  PRO I CG  1 
ATOM   4151 C CD  . PRO I 1 75  ? 4.806   -21.182 32.628 1.00 9.74  ? 525  PRO I CD  1 
ATOM   4152 N N   . GLN I 1 76  ? 3.999   -19.324 29.322 1.00 9.18  ? 526  GLN I N   1 
ATOM   4153 C CA  . GLN I 1 76  ? 3.940   -18.532 28.099 1.00 10.20 ? 526  GLN I CA  1 
ATOM   4154 C C   . GLN I 1 76  ? 4.263   -19.366 26.865 1.00 10.17 ? 526  GLN I C   1 
ATOM   4155 O O   . GLN I 1 76  ? 3.665   -19.171 25.807 1.00 10.21 ? 526  GLN I O   1 
ATOM   4156 C CB  . GLN I 1 76  ? 4.857   -17.315 28.206 1.00 10.80 ? 526  GLN I CB  1 
ATOM   4157 C CG  . GLN I 1 76  ? 4.242   -16.147 28.997 1.00 14.41 ? 526  GLN I CG  1 
ATOM   4158 C CD  . GLN I 1 76  ? 2.895   -15.672 28.431 1.00 16.87 ? 526  GLN I CD  1 
ATOM   4159 O OE1 . GLN I 1 76  ? 1.834   -16.087 28.898 1.00 21.98 ? 526  GLN I OE1 1 
ATOM   4160 N NE2 . GLN I 1 76  ? 2.939   -14.784 27.436 1.00 15.53 ? 526  GLN I NE2 1 
ATOM   4161 N N   . LEU I 1 77  ? 5.212   -20.292 26.972 1.00 9.22  ? 527  LEU I N   1 
ATOM   4162 C CA  . LEU I 1 77  ? 5.497   -21.181 25.850 1.00 10.19 ? 527  LEU I CA  1 
ATOM   4163 C C   . LEU I 1 77  ? 4.270   -22.016 25.506 1.00 9.79  ? 527  LEU I C   1 
ATOM   4164 O O   . LEU I 1 77  ? 3.861   -22.110 24.338 1.00 9.84  ? 527  LEU I O   1 
ATOM   4165 C CB  . LEU I 1 77  ? 6.673   -22.087 26.222 1.00 9.07  ? 527  LEU I CB  1 
ATOM   4166 C CG  . LEU I 1 77  ? 6.992   -23.236 25.266 1.00 9.84  ? 527  LEU I CG  1 
ATOM   4167 C CD1 . LEU I 1 77  ? 7.458   -22.764 23.898 1.00 13.01 ? 527  LEU I CD1 1 
ATOM   4168 C CD2 . LEU I 1 77  ? 8.033   -24.151 25.889 1.00 11.71 ? 527  LEU I CD2 1 
ATOM   4169 N N   . ILE I 1 78  ? 3.662   -22.625 26.526 1.00 9.70  ? 528  ILE I N   1 
ATOM   4170 C CA  . ILE I 1 78  ? 2.475   -23.442 26.308 1.00 10.24 ? 528  ILE I CA  1 
ATOM   4171 C C   . ILE I 1 78  ? 1.349   -22.603 25.721 1.00 9.46  ? 528  ILE I C   1 
ATOM   4172 O O   . ILE I 1 78  ? 0.678   -23.018 24.765 1.00 11.24 ? 528  ILE I O   1 
ATOM   4173 C CB  . ILE I 1 78  ? 2.065   -24.142 27.618 1.00 10.42 ? 528  ILE I CB  1 
ATOM   4174 C CG1 . ILE I 1 78  ? 3.162   -25.106 28.097 1.00 11.25 ? 528  ILE I CG1 1 
ATOM   4175 C CG2 . ILE I 1 78  ? 0.733   -24.858 27.441 1.00 12.77 ? 528  ILE I CG2 1 
ATOM   4176 C CD1 . ILE I 1 78  ? 3.531   -26.189 27.091 1.00 12.41 ? 528  ILE I CD1 1 
ATOM   4177 N N   . ASP I 1 79  ? 1.140   -21.400 26.260 1.00 10.32 ? 529  ASP I N   1 
ATOM   4178 C CA  . ASP I 1 79  ? 0.012   -20.604 25.792 1.00 10.69 ? 529  ASP I CA  1 
ATOM   4179 C C   . ASP I 1 79  ? 0.215   -20.111 24.370 1.00 11.79 ? 529  ASP I C   1 
ATOM   4180 O O   . ASP I 1 79  ? -0.762  -19.944 23.634 1.00 11.60 ? 529  ASP I O   1 
ATOM   4181 C CB  . ASP I 1 79  ? -0.268  -19.434 26.731 1.00 11.94 ? 529  ASP I CB  1 
ATOM   4182 C CG  . ASP I 1 79  ? -1.665  -18.884 26.552 1.00 17.72 ? 529  ASP I CG  1 
ATOM   4183 O OD1 . ASP I 1 79  ? -2.625  -19.690 26.537 1.00 17.65 ? 529  ASP I OD1 1 
ATOM   4184 O OD2 . ASP I 1 79  ? -1.806  -17.653 26.418 1.00 17.57 ? 529  ASP I OD2 1 
ATOM   4185 N N   . HIS I 1 80  ? 1.460   -19.895 23.951 1.00 10.17 ? 530  HIS I N   1 
ATOM   4186 C CA  . HIS I 1 80  ? 1.697   -19.561 22.555 1.00 12.75 ? 530  HIS I CA  1 
ATOM   4187 C C   . HIS I 1 80  ? 1.185   -20.669 21.650 1.00 11.77 ? 530  HIS I C   1 
ATOM   4188 O O   . HIS I 1 80  ? 0.448   -20.414 20.694 1.00 11.42 ? 530  HIS I O   1 
ATOM   4189 C CB  . HIS I 1 80  ? 3.180   -19.313 22.305 1.00 11.70 ? 530  HIS I CB  1 
ATOM   4190 C CG  . HIS I 1 80  ? 3.547   -19.345 20.856 1.00 11.74 ? 530  HIS I CG  1 
ATOM   4191 N ND1 . HIS I 1 80  ? 3.202   -18.342 19.974 1.00 13.29 ? 530  HIS I ND1 1 
ATOM   4192 C CD2 . HIS I 1 80  ? 4.207   -20.277 20.131 1.00 13.72 ? 530  HIS I CD2 1 
ATOM   4193 C CE1 . HIS I 1 80  ? 3.645   -18.653 18.768 1.00 13.10 ? 530  HIS I CE1 1 
ATOM   4194 N NE2 . HIS I 1 80  ? 4.255   -19.822 18.837 1.00 14.83 ? 530  HIS I NE2 1 
ATOM   4195 N N   . HIS I 1 81  ? 1.530   -21.917 21.968 1.00 10.25 ? 531  HIS I N   1 
ATOM   4196 C CA  . HIS I 1 81  ? 1.105   -23.033 21.133 1.00 10.43 ? 531  HIS I CA  1 
ATOM   4197 C C   . HIS I 1 81  ? -0.391  -23.276 21.246 1.00 10.89 ? 531  HIS I C   1 
ATOM   4198 O O   . HIS I 1 81  ? -1.048  -23.602 20.249 1.00 11.16 ? 531  HIS I O   1 
ATOM   4199 C CB  . HIS I 1 81  ? 1.918   -24.274 21.488 1.00 11.12 ? 531  HIS I CB  1 
ATOM   4200 C CG  . HIS I 1 81  ? 3.321   -24.198 20.991 1.00 11.23 ? 531  HIS I CG  1 
ATOM   4201 N ND1 . HIS I 1 81  ? 3.654   -24.447 19.678 1.00 11.75 ? 531  HIS I ND1 1 
ATOM   4202 C CD2 . HIS I 1 81  ? 4.470   -23.840 21.610 1.00 11.13 ? 531  HIS I CD2 1 
ATOM   4203 C CE1 . HIS I 1 81  ? 4.953   -24.271 19.515 1.00 11.97 ? 531  HIS I CE1 1 
ATOM   4204 N NE2 . HIS I 1 81  ? 5.470   -23.891 20.669 1.00 10.84 ? 531  HIS I NE2 1 
ATOM   4205 N N   . TYR I 1 82  ? -0.956  -23.093 22.435 1.00 10.63 ? 532  TYR I N   1 
ATOM   4206 C CA  . TYR I 1 82  ? -2.388  -23.307 22.595 1.00 11.07 ? 532  TYR I CA  1 
ATOM   4207 C C   . TYR I 1 82  ? -3.197  -22.229 21.886 1.00 11.64 ? 532  TYR I C   1 
ATOM   4208 O O   . TYR I 1 82  ? -4.269  -22.519 21.340 1.00 13.57 ? 532  TYR I O   1 
ATOM   4209 C CB  . TYR I 1 82  ? -2.739  -23.352 24.081 1.00 14.34 ? 532  TYR I CB  1 
ATOM   4210 C CG  . TYR I 1 82  ? -4.191  -23.654 24.357 1.00 15.98 ? 532  TYR I CG  1 
ATOM   4211 C CD1 . TYR I 1 82  ? -4.716  -24.911 24.101 1.00 16.02 ? 532  TYR I CD1 1 
ATOM   4212 C CD2 . TYR I 1 82  ? -5.034  -22.685 24.886 1.00 22.95 ? 532  TYR I CD2 1 
ATOM   4213 C CE1 . TYR I 1 82  ? -6.043  -25.195 24.355 1.00 21.32 ? 532  TYR I CE1 1 
ATOM   4214 C CE2 . TYR I 1 82  ? -6.363  -22.961 25.144 1.00 23.37 ? 532  TYR I CE2 1 
ATOM   4215 C CZ  . TYR I 1 82  ? -6.861  -24.217 24.877 1.00 23.88 ? 532  TYR I CZ  1 
ATOM   4216 O OH  . TYR I 1 82  ? -8.185  -24.492 25.134 1.00 34.89 ? 532  TYR I OH  1 
ATOM   4217 N N   . THR I 1 83  ? -2.692  -20.995 21.856 1.00 11.73 ? 533  THR I N   1 
ATOM   4218 C CA  . THR I 1 83  ? -3.440  -19.895 21.251 1.00 12.97 ? 533  THR I CA  1 
ATOM   4219 C C   . THR I 1 83  ? -3.292  -19.878 19.732 1.00 12.61 ? 533  THR I C   1 
ATOM   4220 O O   . THR I 1 83  ? -4.280  -19.685 19.014 1.00 15.06 ? 533  THR I O   1 
ATOM   4221 C CB  . THR I 1 83  ? -3.005  -18.558 21.865 1.00 13.80 ? 533  THR I CB  1 
ATOM   4222 O OG1 . THR I 1 83  ? -3.266  -18.568 23.275 1.00 15.38 ? 533  THR I OG1 1 
ATOM   4223 C CG2 . THR I 1 83  ? -3.769  -17.401 21.240 1.00 14.70 ? 533  THR I CG2 1 
ATOM   4224 N N   . THR I 1 84  ? -2.079  -20.081 19.220 1.00 12.44 ? 534  THR I N   1 
ATOM   4225 C CA  . THR I 1 84  ? -1.834  -19.969 17.789 1.00 14.30 ? 534  THR I CA  1 
ATOM   4226 C C   . THR I 1 84  ? -1.991  -21.283 17.044 1.00 14.81 ? 534  THR I C   1 
ATOM   4227 O O   . THR I 1 84  ? -2.062  -21.270 15.809 1.00 14.30 ? 534  THR I O   1 
ATOM   4228 C CB  . THR I 1 84  ? -0.415  -19.461 17.522 1.00 12.56 ? 534  THR I CB  1 
ATOM   4229 O OG1 . THR I 1 84  ? 0.531   -20.464 17.934 1.00 13.24 ? 534  THR I OG1 1 
ATOM   4230 C CG2 . THR I 1 84  ? -0.163  -18.129 18.253 1.00 14.29 ? 534  THR I CG2 1 
ATOM   4231 N N   . LYS I 1 85  ? -2.018  -22.406 17.754 1.00 12.36 ? 535  LYS I N   1 
ATOM   4232 C CA  . LYS I 1 85  ? -2.035  -23.738 17.156 1.00 12.46 ? 535  LYS I CA  1 
ATOM   4233 C C   . LYS I 1 85  ? -0.791  -24.024 16.324 1.00 15.44 ? 535  LYS I C   1 
ATOM   4234 O O   . LYS I 1 85  ? -0.791  -24.945 15.510 1.00 14.62 ? 535  LYS I O   1 
ATOM   4235 C CB  . LYS I 1 85  ? -3.318  -24.009 16.356 1.00 14.01 ? 535  LYS I CB  1 
ATOM   4236 C CG  . LYS I 1 85  ? -4.594  -23.812 17.153 1.00 15.64 ? 535  LYS I CG  1 
ATOM   4237 C CD  . LYS I 1 85  ? -4.533  -24.485 18.516 1.00 17.02 ? 535  LYS I CD  1 
ATOM   4238 C CE  . LYS I 1 85  ? -5.885  -24.421 19.215 1.00 18.58 ? 535  LYS I CE  1 
ATOM   4239 N NZ  . LYS I 1 85  ? -5.790  -24.840 20.641 1.00 14.40 ? 535  LYS I NZ  1 
ATOM   4240 N N   . GLN I 1 86  ? 0.287   -23.270 16.515 1.00 14.88 ? 536  GLN I N   1 
ATOM   4241 C CA  . GLN I 1 86  ? 1.545   -23.622 15.870 1.00 14.71 ? 536  GLN I CA  1 
ATOM   4242 C C   . GLN I 1 86  ? 2.031   -24.974 16.379 1.00 14.06 ? 536  GLN I C   1 
ATOM   4243 O O   . GLN I 1 86  ? 1.896   -25.297 17.564 1.00 12.38 ? 536  GLN I O   1 
ATOM   4244 C CB  . GLN I 1 86  ? 2.595   -22.548 16.146 1.00 16.63 ? 536  GLN I CB  1 
ATOM   4245 C CG  . GLN I 1 86  ? 2.338   -21.249 15.391 1.00 28.41 ? 536  GLN I CG  1 
ATOM   4246 C CD  . GLN I 1 86  ? 2.415   -21.428 13.884 1.00 38.47 ? 536  GLN I CD  1 
ATOM   4247 O OE1 . GLN I 1 86  ? 3.481   -21.702 13.335 1.00 43.09 ? 536  GLN I OE1 1 
ATOM   4248 N NE2 . GLN I 1 86  ? 1.283   -21.277 13.211 1.00 44.98 ? 536  GLN I NE2 1 
ATOM   4249 N N   . VAL I 1 87  ? 2.600   -25.775 15.479 1.00 13.42 ? 537  VAL I N   1 
ATOM   4250 C CA  . VAL I 1 87  ? 3.008   -27.122 15.854 1.00 12.53 ? 537  VAL I CA  1 
ATOM   4251 C C   . VAL I 1 87  ? 4.143   -27.066 16.869 1.00 12.44 ? 537  VAL I C   1 
ATOM   4252 O O   . VAL I 1 87  ? 4.969   -26.144 16.870 1.00 12.23 ? 537  VAL I O   1 
ATOM   4253 C CB  . VAL I 1 87  ? 3.403   -27.946 14.614 1.00 14.97 ? 537  VAL I CB  1 
ATOM   4254 C CG1 . VAL I 1 87  ? 2.212   -28.108 13.672 1.00 15.07 ? 537  VAL I CG1 1 
ATOM   4255 C CG2 . VAL I 1 87  ? 4.601   -27.315 13.897 1.00 14.18 ? 537  VAL I CG2 1 
ATOM   4256 N N   . ILE I 1 88  ? 4.182   -28.066 17.750 1.00 11.27 ? 538  ILE I N   1 
ATOM   4257 C CA  . ILE I 1 88  ? 5.261   -28.162 18.732 1.00 10.61 ? 538  ILE I CA  1 
ATOM   4258 C C   . ILE I 1 88  ? 6.601   -28.326 18.024 1.00 12.92 ? 538  ILE I C   1 
ATOM   4259 O O   . ILE I 1 88  ? 7.576   -27.625 18.321 1.00 12.14 ? 538  ILE I O   1 
ATOM   4260 C CB  . ILE I 1 88  ? 4.986   -29.318 19.712 1.00 10.84 ? 538  ILE I CB  1 
ATOM   4261 C CG1 . ILE I 1 88  ? 3.672   -29.107 20.481 1.00 10.60 ? 538  ILE I CG1 1 
ATOM   4262 C CG2 . ILE I 1 88  ? 6.164   -29.517 20.651 1.00 11.76 ? 538  ILE I CG2 1 
ATOM   4263 C CD1 . ILE I 1 88  ? 3.615   -27.847 21.283 1.00 11.93 ? 538  ILE I CD1 1 
ATOM   4264 N N   . THR I 1 89  ? 6.669   -29.262 17.080 1.00 13.56 ? 539  THR I N   1 
ATOM   4265 C CA  . THR I 1 89  ? 7.791   -29.383 16.159 1.00 13.88 ? 539  THR I CA  1 
ATOM   4266 C C   . THR I 1 89  ? 7.223   -29.681 14.780 1.00 13.49 ? 539  THR I C   1 
ATOM   4267 O O   . THR I 1 89  ? 6.140   -30.255 14.654 1.00 15.03 ? 539  THR I O   1 
ATOM   4268 C CB  . THR I 1 89  ? 8.769   -30.510 16.547 1.00 13.77 ? 539  THR I CB  1 
ATOM   4269 O OG1 . THR I 1 89  ? 8.116   -31.776 16.412 1.00 15.91 ? 539  THR I OG1 1 
ATOM   4270 C CG2 . THR I 1 89  ? 9.267   -30.366 17.990 1.00 14.68 ? 539  THR I CG2 1 
ATOM   4271 N N   . LYS I 1 90  ? 7.959   -29.285 13.741 1.00 14.56 ? 540  LYS I N   1 
ATOM   4272 C CA  . LYS I 1 90  ? 7.510   -29.588 12.386 1.00 15.85 ? 540  LYS I CA  1 
ATOM   4273 C C   . LYS I 1 90  ? 7.466   -31.093 12.142 1.00 18.25 ? 540  LYS I C   1 
ATOM   4274 O O   . LYS I 1 90  ? 6.548   -31.592 11.483 1.00 18.92 ? 540  LYS I O   1 
ATOM   4275 C CB  . LYS I 1 90  ? 8.409   -28.900 11.365 1.00 17.28 ? 540  LYS I CB  1 
ATOM   4276 C CG  . LYS I 1 90  ? 8.204   -27.404 11.254 1.00 20.40 ? 540  LYS I CG  1 
ATOM   4277 C CD  . LYS I 1 90  ? 9.130   -26.828 10.192 1.00 24.53 ? 540  LYS I CD  1 
ATOM   4278 C CE  . LYS I 1 90  ? 9.019   -25.316 10.123 1.00 30.08 ? 540  LYS I CE  1 
ATOM   4279 N NZ  . LYS I 1 90  ? 7.641   -24.892 9.778  1.00 37.49 ? 540  LYS I NZ  1 
ATOM   4280 N N   . LYS I 1 91  ? 8.443   -31.830 12.674 1.00 16.39 ? 541  LYS I N   1 
ATOM   4281 C CA  . LYS I 1 91  ? 8.493   -33.273 12.448 1.00 18.11 ? 541  LYS I CA  1 
ATOM   4282 C C   . LYS I 1 91  ? 7.289   -33.975 13.065 1.00 17.11 ? 541  LYS I C   1 
ATOM   4283 O O   . LYS I 1 91  ? 6.710   -34.881 12.454 1.00 18.61 ? 541  LYS I O   1 
ATOM   4284 C CB  . LYS I 1 91  ? 9.794   -33.847 13.006 1.00 21.63 ? 541  LYS I CB  1 
ATOM   4285 C CG  . LYS I 1 91  ? 9.889   -35.364 12.880 1.00 25.93 ? 541  LYS I CG  1 
ATOM   4286 C CD  . LYS I 1 91  ? 11.303  -35.874 13.091 1.00 32.79 ? 541  LYS I CD  1 
ATOM   4287 C CE  . LYS I 1 91  ? 11.688  -35.880 14.556 1.00 34.92 ? 541  LYS I CE  1 
ATOM   4288 N NZ  . LYS I 1 91  ? 12.701  -36.938 14.841 1.00 42.04 ? 541  LYS I NZ  1 
ATOM   4289 N N   . SER I 1 92  ? 6.889   -33.562 14.269 1.00 16.62 ? 542  SER I N   1 
ATOM   4290 C CA  . SER I 1 92  ? 5.768   -34.209 14.942 1.00 17.51 ? 542  SER I CA  1 
ATOM   4291 C C   . SER I 1 92  ? 4.422   -33.710 14.432 1.00 15.60 ? 542  SER I C   1 
ATOM   4292 O O   . SER I 1 92  ? 3.453   -34.476 14.413 1.00 18.12 ? 542  SER I O   1 
ATOM   4293 C CB  . SER I 1 92  ? 5.861   -34.003 16.456 1.00 14.79 ? 542  SER I CB  1 
ATOM   4294 O OG  . SER I 1 92  ? 5.527   -32.671 16.824 1.00 14.14 ? 542  SER I OG  1 
ATOM   4295 N N   . GLY I 1 93  ? 4.336   -32.435 14.039 1.00 15.03 ? 543  GLY I N   1 
ATOM   4296 C CA  . GLY I 1 93  ? 3.071   -31.823 13.669 1.00 15.36 ? 543  GLY I CA  1 
ATOM   4297 C C   . GLY I 1 93  ? 2.072   -31.710 14.800 1.00 14.98 ? 543  GLY I C   1 
ATOM   4298 O O   . GLY I 1 93  ? 0.885   -31.485 14.549 1.00 16.73 ? 543  GLY I O   1 
ATOM   4299 N N   . VAL I 1 94  ? 2.520   -31.843 16.049 1.00 14.06 ? 544  VAL I N   1 
ATOM   4300 C CA  . VAL I 1 94  ? 1.593   -31.923 17.170 1.00 13.39 ? 544  VAL I CA  1 
ATOM   4301 C C   . VAL I 1 94  ? 0.989   -30.558 17.462 1.00 13.92 ? 544  VAL I C   1 
ATOM   4302 O O   . VAL I 1 94  ? 1.701   -29.548 17.544 1.00 13.58 ? 544  VAL I O   1 
ATOM   4303 C CB  . VAL I 1 94  ? 2.315   -32.484 18.405 1.00 13.30 ? 544  VAL I CB  1 
ATOM   4304 C CG1 . VAL I 1 94  ? 1.487   -32.245 19.656 1.00 16.61 ? 544  VAL I CG1 1 
ATOM   4305 C CG2 . VAL I 1 94  ? 2.591   -33.962 18.212 1.00 17.99 ? 544  VAL I CG2 1 
ATOM   4306 N N   . VAL I 1 95  ? -0.326  -30.538 17.683 1.00 13.11 ? 545  VAL I N   1 
ATOM   4307 C CA  . VAL I 1 95  ? -1.094  -29.337 17.985 1.00 14.02 ? 545  VAL I CA  1 
ATOM   4308 C C   . VAL I 1 95  ? -1.768  -29.519 19.340 1.00 12.89 ? 545  VAL I C   1 
ATOM   4309 O O   . VAL I 1 95  ? -2.392  -30.556 19.593 1.00 15.11 ? 545  VAL I O   1 
ATOM   4310 C CB  . VAL I 1 95  ? -2.149  -29.093 16.892 1.00 15.37 ? 545  VAL I CB  1 
ATOM   4311 C CG1 . VAL I 1 95  ? -3.019  -27.903 17.245 1.00 16.00 ? 545  VAL I CG1 1 
ATOM   4312 C CG2 . VAL I 1 95  ? -1.475  -28.901 15.540 1.00 16.29 ? 545  VAL I CG2 1 
ATOM   4313 N N   . LEU I 1 96  ? -1.652  -28.509 20.208 1.00 12.76 ? 546  LEU I N   1 
ATOM   4314 C CA  . LEU I 1 96  ? -2.301  -28.558 21.515 1.00 13.15 ? 546  LEU I CA  1 
ATOM   4315 C C   . LEU I 1 96  ? -3.753  -28.118 21.388 1.00 14.21 ? 546  LEU I C   1 
ATOM   4316 O O   . LEU I 1 96  ? -4.034  -27.025 20.882 1.00 15.47 ? 546  LEU I O   1 
ATOM   4317 C CB  . LEU I 1 96  ? -1.574  -27.648 22.510 1.00 14.16 ? 546  LEU I CB  1 
ATOM   4318 C CG  . LEU I 1 96  ? -0.077  -27.864 22.656 1.00 10.70 ? 546  LEU I CG  1 
ATOM   4319 C CD1 . LEU I 1 96  ? 0.466   -27.007 23.796 1.00 13.92 ? 546  LEU I CD1 1 
ATOM   4320 C CD2 . LEU I 1 96  ? 0.235   -29.343 22.886 1.00 12.42 ? 546  LEU I CD2 1 
ATOM   4321 N N   . LEU I 1 97  ? -4.672  -28.960 21.858 1.00 15.01 ? 547  LEU I N   1 
ATOM   4322 C CA  . LEU I 1 97  ? -6.099  -28.671 21.782 1.00 17.53 ? 547  LEU I CA  1 
ATOM   4323 C C   . LEU I 1 97  ? -6.810  -28.688 23.125 1.00 18.68 ? 547  LEU I C   1 
ATOM   4324 O O   . LEU I 1 97  ? -7.698  -27.864 23.350 1.00 22.09 ? 547  LEU I O   1 
ATOM   4325 C CB  . LEU I 1 97  ? -6.803  -29.673 20.853 1.00 19.22 ? 547  LEU I CB  1 
ATOM   4326 C CG  . LEU I 1 97  ? -6.432  -29.679 19.371 1.00 18.71 ? 547  LEU I CG  1 
ATOM   4327 C CD1 . LEU I 1 97  ? -7.289  -30.683 18.617 1.00 20.94 ? 547  LEU I CD1 1 
ATOM   4328 C CD2 . LEU I 1 97  ? -6.591  -28.299 18.772 1.00 22.59 ? 547  LEU I CD2 1 
ATOM   4329 N N   . ASN I 1 98  ? -6.475  -29.615 24.019 1.00 16.50 ? 548  ASN I N   1 
ATOM   4330 C CA  A ASN I 1 98  ? -7.245  -29.827 25.236 0.58 19.32 ? 548  ASN I CA  1 
ATOM   4331 C CA  B ASN I 1 98  ? -7.250  -29.825 25.242 0.42 19.30 ? 548  ASN I CA  1 
ATOM   4332 C C   . ASN I 1 98  ? -6.317  -29.978 26.434 1.00 16.68 ? 548  ASN I C   1 
ATOM   4333 O O   . ASN I 1 98  ? -5.663  -31.024 26.583 1.00 16.23 ? 548  ASN I O   1 
ATOM   4334 C CB  A ASN I 1 98  ? -8.092  -31.093 25.123 0.58 21.85 ? 548  ASN I CB  1 
ATOM   4335 C CB  B ASN I 1 98  ? -8.141  -31.049 25.090 0.42 21.71 ? 548  ASN I CB  1 
ATOM   4336 C CG  A ASN I 1 98  ? -8.666  -31.294 23.738 0.58 23.61 ? 548  ASN I CG  1 
ATOM   4337 C CG  B ASN I 1 98  ? -9.066  -31.254 26.272 0.42 24.14 ? 548  ASN I CG  1 
ATOM   4338 O OD1 A ASN I 1 98  ? -9.310  -30.406 23.189 0.58 25.96 ? 548  ASN I OD1 1 
ATOM   4339 O OD1 B ASN I 1 98  ? -9.569  -30.293 26.861 0.42 28.25 ? 548  ASN I OD1 1 
ATOM   4340 N ND2 A ASN I 1 98  ? -8.414  -32.463 23.156 0.58 25.47 ? 548  ASN I ND2 1 
ATOM   4341 N ND2 B ASN I 1 98  ? -9.313  -32.506 26.611 0.42 28.00 ? 548  ASN I ND2 1 
ATOM   4342 N N   . PRO I 1 99  ? -6.239  -28.977 27.311 1.00 15.78 ? 549  PRO I N   1 
ATOM   4343 C CA  . PRO I 1 99  ? -5.422  -29.121 28.525 1.00 15.83 ? 549  PRO I CA  1 
ATOM   4344 C C   . PRO I 1 99  ? -6.106  -30.094 29.475 1.00 16.49 ? 549  PRO I C   1 
ATOM   4345 O O   . PRO I 1 99  ? -7.273  -29.918 29.834 1.00 18.68 ? 549  PRO I O   1 
ATOM   4346 C CB  . PRO I 1 99  ? -5.386  -27.699 29.100 1.00 17.15 ? 549  PRO I CB  1 
ATOM   4347 C CG  . PRO I 1 99  ? -6.658  -27.067 28.599 1.00 17.73 ? 549  PRO I CG  1 
ATOM   4348 C CD  . PRO I 1 99  ? -6.899  -27.659 27.234 1.00 16.83 ? 549  PRO I CD  1 
ATOM   4349 N N   . ILE I 1 100 ? -5.392  -31.150 29.849 1.00 15.99 ? 550  ILE I N   1 
ATOM   4350 C CA  . ILE I 1 100 ? -5.950  -32.144 30.759 1.00 17.67 ? 550  ILE I CA  1 
ATOM   4351 C C   . ILE I 1 100 ? -5.824  -31.622 32.181 1.00 17.83 ? 550  ILE I C   1 
ATOM   4352 O O   . ILE I 1 100 ? -4.705  -31.366 32.650 1.00 17.81 ? 550  ILE I O   1 
ATOM   4353 C CB  . ILE I 1 100 ? -5.281  -33.513 30.580 1.00 16.91 ? 550  ILE I CB  1 
ATOM   4354 C CG1 . ILE I 1 100 ? -5.599  -34.081 29.193 1.00 18.76 ? 550  ILE I CG1 1 
ATOM   4355 C CG2 . ILE I 1 100 ? -5.755  -34.469 31.666 1.00 18.28 ? 550  ILE I CG2 1 
ATOM   4356 C CD1 . ILE I 1 100 ? -7.087  -34.254 28.929 1.00 20.57 ? 550  ILE I CD1 1 
ATOM   4357 N N   . PRO I 1 101 ? -6.933  -31.432 32.893 1.00 19.25 ? 551  PRO I N   1 
ATOM   4358 C CA  . PRO I 1 101 ? -6.854  -30.828 34.226 1.00 22.71 ? 551  PRO I CA  1 
ATOM   4359 C C   . PRO I 1 101 ? -6.277  -31.792 35.247 1.00 23.67 ? 551  PRO I C   1 
ATOM   4360 O O   . PRO I 1 101 ? -6.486  -33.007 35.187 1.00 25.03 ? 551  PRO I O   1 
ATOM   4361 C CB  . PRO I 1 101 ? -8.315  -30.497 34.549 1.00 24.85 ? 551  PRO I CB  1 
ATOM   4362 C CG  . PRO I 1 101 ? -9.095  -31.511 33.783 1.00 24.32 ? 551  PRO I CG  1 
ATOM   4363 C CD  . PRO I 1 101 ? -8.318  -31.761 32.511 1.00 20.41 ? 551  PRO I CD  1 
ATOM   4364 N N   . LYS I 1 102 ? -5.534  -31.229 36.190 1.00 27.00 ? 552  LYS I N   1 
ATOM   4365 C CA  . LYS I 1 102 ? -5.007  -31.993 37.309 1.00 30.91 ? 552  LYS I CA  1 
ATOM   4366 C C   . LYS I 1 102 ? -6.116  -32.232 38.325 1.00 36.21 ? 552  LYS I C   1 
ATOM   4367 O O   . LYS I 1 102 ? -7.148  -31.558 38.297 1.00 35.57 ? 552  LYS I O   1 
ATOM   4368 C CB  . LYS I 1 102 ? -3.858  -31.233 37.963 1.00 32.58 ? 552  LYS I CB  1 
ATOM   4369 C CG  . LYS I 1 102 ? -4.223  -29.812 38.344 1.00 34.73 ? 552  LYS I CG  1 
ATOM   4370 C CD  . LYS I 1 102 ? -3.033  -29.075 38.918 1.00 40.32 ? 552  LYS I CD  1 
ATOM   4371 C CE  . LYS I 1 102 ? -3.381  -27.633 39.214 1.00 43.57 ? 552  LYS I CE  1 
ATOM   4372 N NZ  . LYS I 1 102 ? -2.195  -26.884 39.692 1.00 47.98 ? 552  LYS I NZ  1 
ATOM   4373 N N   . ASP J 2 1   ? 13.459  -44.254 28.336 1.00 36.01 ? 1    ASP J N   1 
ATOM   4374 C CA  . ASP J 2 1   ? 12.351  -44.060 27.411 1.00 35.24 ? 1    ASP J CA  1 
ATOM   4375 C C   . ASP J 2 1   ? 12.659  -42.955 26.405 1.00 35.26 ? 1    ASP J C   1 
ATOM   4376 O O   . ASP J 2 1   ? 13.523  -42.111 26.636 1.00 39.96 ? 1    ASP J O   1 
ATOM   4377 C CB  . ASP J 2 1   ? 11.065  -43.737 28.172 1.00 34.90 ? 1    ASP J CB  1 
ATOM   4378 C CG  . ASP J 2 1   ? 10.611  -44.879 29.058 1.00 36.91 ? 1    ASP J CG  1 
ATOM   4379 O OD1 . ASP J 2 1   ? 11.062  -46.023 28.833 1.00 37.75 ? 1    ASP J OD1 1 
ATOM   4380 O OD2 . ASP J 2 1   ? 9.799   -44.634 29.972 1.00 34.01 ? 1    ASP J OD2 1 
ATOM   4381 N N   . GLU J 2 2   ? 11.935  -42.963 25.292 1.00 27.19 ? 2    GLU J N   1 
ATOM   4382 C CA  . GLU J 2 2   ? 12.182  -42.028 24.204 1.00 26.17 ? 2    GLU J CA  1 
ATOM   4383 C C   . GLU J 2 2   ? 11.447  -40.695 24.380 1.00 18.25 ? 2    GLU J C   1 
ATOM   4384 O O   . GLU J 2 2   ? 10.274  -40.662 24.747 1.00 19.41 ? 2    GLU J O   1 
ATOM   4385 C CB  . GLU J 2 2   ? 11.788  -42.672 22.871 1.00 39.23 ? 2    GLU J CB  1 
ATOM   4386 C CG  . GLU J 2 2   ? 11.678  -41.702 21.704 1.00 52.81 ? 2    GLU J CG  1 
ATOM   4387 C CD  . GLU J 2 2   ? 11.115  -42.354 20.456 1.00 61.48 ? 2    GLU J CD  1 
ATOM   4388 O OE1 . GLU J 2 2   ? 11.174  -41.727 19.376 1.00 63.94 ? 2    GLU J OE1 1 
ATOM   4389 O OE2 . GLU J 2 2   ? 10.612  -43.493 20.555 1.00 64.24 ? 2    GLU J OE2 1 
HETATM 4390 N N   . PTR J 2 3   ? 12.158  -39.606 24.113 1.00 16.51 ? 3    PTR J N   1 
HETATM 4391 C CA  . PTR J 2 3   ? 11.532  -38.299 23.974 1.00 15.91 ? 3    PTR J CA  1 
HETATM 4392 C C   . PTR J 2 3   ? 11.584  -37.924 22.494 1.00 19.62 ? 3    PTR J C   1 
HETATM 4393 O O   . PTR J 2 3   ? 12.612  -38.135 21.849 1.00 20.13 ? 3    PTR J O   1 
HETATM 4394 C CB  . PTR J 2 3   ? 12.217  -37.274 24.882 1.00 15.25 ? 3    PTR J CB  1 
HETATM 4395 C CG  . PTR J 2 3   ? 11.907  -37.446 26.360 1.00 12.83 ? 3    PTR J CG  1 
HETATM 4396 C CD1 . PTR J 2 3   ? 10.674  -37.072 26.878 1.00 12.92 ? 3    PTR J CD1 1 
HETATM 4397 C CD2 . PTR J 2 3   ? 12.846  -37.978 27.239 1.00 15.10 ? 3    PTR J CD2 1 
HETATM 4398 C CE1 . PTR J 2 3   ? 10.382  -37.230 28.224 1.00 12.77 ? 3    PTR J CE1 1 
HETATM 4399 C CE2 . PTR J 2 3   ? 12.564  -38.130 28.590 1.00 15.04 ? 3    PTR J CE2 1 
HETATM 4400 C CZ  . PTR J 2 3   ? 11.327  -37.761 29.078 1.00 13.05 ? 3    PTR J CZ  1 
HETATM 4401 O OH  . PTR J 2 3   ? 11.055  -37.890 30.360 1.00 11.87 ? 3    PTR J OH  1 
HETATM 4402 P P   . PTR J 2 3   ? 10.405  -39.223 31.007 1.00 11.33 ? 3    PTR J P   1 
HETATM 4403 O O1P . PTR J 2 3   ? 9.209   -39.553 30.198 1.00 12.13 ? 3    PTR J O1P 1 
HETATM 4404 O O2P . PTR J 2 3   ? 10.012  -38.817 32.444 1.00 13.69 ? 3    PTR J O2P 1 
HETATM 4405 O O3P . PTR J 2 3   ? 11.453  -40.343 30.993 1.00 14.74 ? 3    PTR J O3P 1 
ATOM   4406 N N   . GLU J 2 4   ? 10.487  -37.377 21.973 1.00 16.77 ? 4    GLU J N   1 
ATOM   4407 C CA  . GLU J 2 4   ? 10.332  -37.122 20.538 1.00 20.20 ? 4    GLU J CA  1 
ATOM   4408 C C   . GLU J 2 4   ? 11.426  -36.236 19.957 1.00 20.94 ? 4    GLU J C   1 
ATOM   4409 O O   . GLU J 2 4   ? 11.843  -36.413 18.810 1.00 21.34 ? 4    GLU J O   1 
ATOM   4410 C CB  . GLU J 2 4   ? 8.983   -36.450 20.262 1.00 24.75 ? 4    GLU J CB  1 
ATOM   4411 C CG  . GLU J 2 4   ? 7.762   -37.289 20.589 1.00 33.46 ? 4    GLU J CG  1 
ATOM   4412 C CD  . GLU J 2 4   ? 7.616   -38.487 19.676 1.00 40.47 ? 4    GLU J CD  1 
ATOM   4413 O OE1 . GLU J 2 4   ? 7.799   -39.625 20.156 1.00 42.80 ? 4    GLU J OE1 1 
ATOM   4414 O OE2 . GLU J 2 4   ? 7.330   -38.290 18.477 1.00 42.09 ? 4    GLU J OE2 1 
ATOM   4415 N N   . ASN J 2 5   ? 11.873  -35.264 20.748 1.00 19.08 ? 5    ASN J N   1 
ATOM   4416 C CA  . ASN J 2 5   ? 12.777  -34.224 20.277 1.00 19.72 ? 5    ASN J CA  1 
ATOM   4417 C C   . ASN J 2 5   ? 14.174  -34.342 20.873 1.00 24.31 ? 5    ASN J C   1 
ATOM   4418 O O   . ASN J 2 5   ? 14.936  -33.371 20.850 1.00 27.70 ? 5    ASN J O   1 
ATOM   4419 C CB  . ASN J 2 5   ? 12.183  -32.842 20.548 1.00 18.15 ? 5    ASN J CB  1 
ATOM   4420 C CG  . ASN J 2 5   ? 11.881  -32.610 22.022 1.00 15.39 ? 5    ASN J CG  1 
ATOM   4421 O OD1 . ASN J 2 5   ? 11.692  -33.559 22.800 1.00 15.39 ? 5    ASN J OD1 1 
ATOM   4422 N ND2 . ASN J 2 5   ? 11.825  -31.340 22.410 1.00 18.20 ? 5    ASN J ND2 1 
ATOM   4423 N N   . VAL J 2 6   ? 14.526  -35.509 21.403 1.00 25.26 ? 6    VAL J N   1 
ATOM   4424 C CA  . VAL J 2 6   ? 15.842  -35.719 21.999 1.00 33.76 ? 6    VAL J CA  1 
ATOM   4425 C C   . VAL J 2 6   ? 16.591  -36.842 21.292 1.00 36.21 ? 6    VAL J C   1 
ATOM   4426 O O   . VAL J 2 6   ? 16.070  -37.945 21.139 1.00 37.84 ? 6    VAL J O   1 
ATOM   4427 C CB  . VAL J 2 6   ? 15.739  -35.982 23.513 1.00 36.41 ? 6    VAL J CB  1 
ATOM   4428 C CG1 . VAL J 2 6   ? 17.100  -36.352 24.084 1.00 43.54 ? 6    VAL J CG1 1 
ATOM   4429 C CG2 . VAL J 2 6   ? 15.177  -34.762 24.219 1.00 30.49 ? 6    VAL J CG2 1 
ATOM   4430 N N   . SER K 1 2   ? -4.516  -50.013 39.408 1.00 44.20 ? 452  SER K N   1 
ATOM   4431 C CA  . SER K 1 2   ? -4.005  -49.320 40.585 1.00 41.88 ? 452  SER K CA  1 
ATOM   4432 C C   . SER K 1 2   ? -4.245  -47.814 40.514 1.00 41.35 ? 452  SER K C   1 
ATOM   4433 O O   . SER K 1 2   ? -4.348  -47.236 39.432 1.00 43.33 ? 452  SER K O   1 
ATOM   4434 C CB  . SER K 1 2   ? -2.510  -49.602 40.773 1.00 40.85 ? 452  SER K CB  1 
ATOM   4435 O OG  . SER K 1 2   ? -2.293  -50.892 41.318 1.00 42.41 ? 452  SER K OG  1 
ATOM   4436 N N   . LYS K 1 3   ? -4.332  -47.189 41.683 1.00 38.52 ? 453  LYS K N   1 
ATOM   4437 C CA  . LYS K 1 3   ? -4.481  -45.750 41.793 1.00 35.72 ? 453  LYS K CA  1 
ATOM   4438 C C   . LYS K 1 3   ? -3.136  -45.067 41.571 1.00 29.42 ? 453  LYS K C   1 
ATOM   4439 O O   . LYS K 1 3   ? -2.082  -45.697 41.692 1.00 28.94 ? 453  LYS K O   1 
ATOM   4440 C CB  . LYS K 1 3   ? -5.002  -45.403 43.185 1.00 38.63 ? 453  LYS K CB  1 
ATOM   4441 C CG  . LYS K 1 3   ? -6.508  -45.536 43.339 1.00 43.18 ? 453  LYS K CG  1 
ATOM   4442 C CD  . LYS K 1 3   ? -6.897  -45.798 44.787 1.00 44.44 ? 453  LYS K CD  1 
ATOM   4443 C CE  . LYS K 1 3   ? -6.228  -44.819 45.736 1.00 43.71 ? 453  LYS K CE  1 
ATOM   4444 N NZ  . LYS K 1 3   ? -6.582  -45.099 47.155 1.00 46.12 ? 453  LYS K NZ  1 
ATOM   4445 N N   . PRO K 1 4   ? -3.140  -43.777 41.236 1.00 23.57 ? 454  PRO K N   1 
ATOM   4446 C CA  . PRO K 1 4   ? -1.869  -43.061 41.077 1.00 19.74 ? 454  PRO K CA  1 
ATOM   4447 C C   . PRO K 1 4   ? -1.047  -43.085 42.359 1.00 19.07 ? 454  PRO K C   1 
ATOM   4448 O O   . PRO K 1 4   ? -1.563  -43.290 43.460 1.00 18.45 ? 454  PRO K O   1 
ATOM   4449 C CB  . PRO K 1 4   ? -2.309  -41.634 40.734 1.00 22.51 ? 454  PRO K CB  1 
ATOM   4450 C CG  . PRO K 1 4   ? -3.651  -41.805 40.104 1.00 24.58 ? 454  PRO K CG  1 
ATOM   4451 C CD  . PRO K 1 4   ? -4.293  -42.951 40.831 1.00 26.08 ? 454  PRO K CD  1 
ATOM   4452 N N   . LEU K 1 5   ? 0.265   -42.888 42.191 1.00 16.83 ? 455  LEU K N   1 
ATOM   4453 C CA  . LEU K 1 5   ? 1.188   -42.884 43.324 1.00 18.41 ? 455  LEU K CA  1 
ATOM   4454 C C   . LEU K 1 5   ? 0.759   -41.899 44.401 1.00 18.90 ? 455  LEU K C   1 
ATOM   4455 O O   . LEU K 1 5   ? 0.788   -42.216 45.596 1.00 19.96 ? 455  LEU K O   1 
ATOM   4456 C CB  . LEU K 1 5   ? 2.599   -42.542 42.845 1.00 20.14 ? 455  LEU K CB  1 
ATOM   4457 C CG  . LEU K 1 5   ? 3.455   -43.706 42.360 1.00 18.60 ? 455  LEU K CG  1 
ATOM   4458 C CD1 . LEU K 1 5   ? 4.720   -43.180 41.707 1.00 18.67 ? 455  LEU K CD1 1 
ATOM   4459 C CD2 . LEU K 1 5   ? 3.797   -44.635 43.526 1.00 15.54 ? 455  LEU K CD2 1 
ATOM   4460 N N   . ALA K 1 6   ? 0.381   -40.683 43.997 1.00 16.69 ? 456  ALA K N   1 
ATOM   4461 C CA  . ALA K 1 6   ? 0.050   -39.647 44.968 1.00 19.13 ? 456  ALA K CA  1 
ATOM   4462 C C   . ALA K 1 6   ? -1.102  -40.055 45.873 1.00 20.67 ? 456  ALA K C   1 
ATOM   4463 O O   . ALA K 1 6   ? -1.241  -39.501 46.968 1.00 25.85 ? 456  ALA K O   1 
ATOM   4464 C CB  . ALA K 1 6   ? -0.269  -38.336 44.248 1.00 20.62 ? 456  ALA K CB  1 
ATOM   4465 N N   . GLU K 1 7   ? -1.917  -41.019 45.450 1.00 19.48 ? 457  GLU K N   1 
ATOM   4466 C CA  . GLU K 1 7   ? -3.043  -41.493 46.239 1.00 21.23 ? 457  GLU K CA  1 
ATOM   4467 C C   . GLU K 1 7   ? -2.719  -42.726 47.075 1.00 22.87 ? 457  GLU K C   1 
ATOM   4468 O O   . GLU K 1 7   ? -3.604  -43.229 47.774 1.00 26.63 ? 457  GLU K O   1 
ATOM   4469 C CB  . GLU K 1 7   ? -4.246  -41.772 45.331 1.00 21.73 ? 457  GLU K CB  1 
ATOM   4470 C CG  . GLU K 1 7   ? -4.737  -40.544 44.578 1.00 25.17 ? 457  GLU K CG  1 
ATOM   4471 C CD  . GLU K 1 7   ? -5.874  -40.857 43.624 1.00 30.17 ? 457  GLU K CD  1 
ATOM   4472 O OE1 . GLU K 1 7   ? -6.613  -41.833 43.873 1.00 34.07 ? 457  GLU K OE1 1 
ATOM   4473 O OE2 . GLU K 1 7   ? -6.024  -40.129 42.620 1.00 32.54 ? 457  GLU K OE2 1 
ATOM   4474 N N   . GLN K 1 8   ? -1.486  -43.225 47.028 1.00 17.13 ? 458  GLN K N   1 
ATOM   4475 C CA  . GLN K 1 8   ? -1.093  -44.372 47.835 1.00 17.01 ? 458  GLN K CA  1 
ATOM   4476 C C   . GLN K 1 8   ? -0.646  -43.893 49.209 1.00 17.50 ? 458  GLN K C   1 
ATOM   4477 O O   . GLN K 1 8   ? 0.151   -42.956 49.316 1.00 16.45 ? 458  GLN K O   1 
ATOM   4478 C CB  . GLN K 1 8   ? 0.043   -45.145 47.165 1.00 16.16 ? 458  GLN K CB  1 
ATOM   4479 C CG  . GLN K 1 8   ? -0.259  -45.602 45.744 1.00 19.17 ? 458  GLN K CG  1 
ATOM   4480 C CD  . GLN K 1 8   ? -1.353  -46.654 45.674 1.00 22.92 ? 458  GLN K CD  1 
ATOM   4481 O OE1 . GLN K 1 8   ? -1.605  -47.379 46.638 1.00 24.34 ? 458  GLN K OE1 1 
ATOM   4482 N NE2 . GLN K 1 8   ? -2.010  -46.741 44.524 1.00 25.98 ? 458  GLN K NE2 1 
ATOM   4483 N N   . ASP K 1 9   ? -1.155  -44.545 50.259 1.00 19.59 ? 459  ASP K N   1 
ATOM   4484 C CA  . ASP K 1 9   ? -0.839  -44.109 51.614 1.00 20.98 ? 459  ASP K CA  1 
ATOM   4485 C C   . ASP K 1 9   ? 0.659   -44.139 51.880 1.00 18.07 ? 459  ASP K C   1 
ATOM   4486 O O   . ASP K 1 9   ? 1.177   -43.287 52.611 1.00 18.85 ? 459  ASP K O   1 
ATOM   4487 C CB  . ASP K 1 9   ? -1.569  -44.977 52.641 1.00 26.45 ? 459  ASP K CB  1 
ATOM   4488 C CG  . ASP K 1 9   ? -3.078  -44.934 52.481 1.00 34.67 ? 459  ASP K CG  1 
ATOM   4489 O OD1 . ASP K 1 9   ? -3.722  -45.998 52.607 1.00 37.70 ? 459  ASP K OD1 1 
ATOM   4490 O OD2 . ASP K 1 9   ? -3.620  -43.840 52.219 1.00 37.12 ? 459  ASP K OD2 1 
ATOM   4491 N N   . TRP K 1 10  ? 1.368   -45.094 51.287 1.00 15.03 ? 460  TRP K N   1 
ATOM   4492 C CA  . TRP K 1 10  ? 2.788   -45.292 51.545 1.00 13.92 ? 460  TRP K CA  1 
ATOM   4493 C C   . TRP K 1 10  ? 3.695   -44.453 50.652 1.00 12.87 ? 460  TRP K C   1 
ATOM   4494 O O   . TRP K 1 10  ? 4.917   -44.588 50.744 1.00 13.65 ? 460  TRP K O   1 
ATOM   4495 C CB  . TRP K 1 10  ? 3.147   -46.777 51.398 1.00 14.38 ? 460  TRP K CB  1 
ATOM   4496 C CG  . TRP K 1 10  ? 2.499   -47.441 50.205 1.00 14.95 ? 460  TRP K CG  1 
ATOM   4497 C CD1 . TRP K 1 10  ? 1.407   -48.260 50.219 1.00 18.55 ? 460  TRP K CD1 1 
ATOM   4498 C CD2 . TRP K 1 10  ? 2.897   -47.333 48.827 1.00 14.71 ? 460  TRP K CD2 1 
ATOM   4499 N NE1 . TRP K 1 10  ? 1.106   -48.675 48.944 1.00 17.95 ? 460  TRP K NE1 1 
ATOM   4500 C CE2 . TRP K 1 10  ? 2.005   -48.121 48.071 1.00 16.31 ? 460  TRP K CE2 1 
ATOM   4501 C CE3 . TRP K 1 10  ? 3.925   -46.655 48.164 1.00 14.84 ? 460  TRP K CE3 1 
ATOM   4502 C CZ2 . TRP K 1 10  ? 2.104   -48.242 46.685 1.00 16.24 ? 460  TRP K CZ2 1 
ATOM   4503 C CZ3 . TRP K 1 10  ? 4.021   -46.778 46.784 1.00 14.41 ? 460  TRP K CZ3 1 
ATOM   4504 C CH2 . TRP K 1 10  ? 3.117   -47.565 46.063 1.00 16.03 ? 460  TRP K CH2 1 
ATOM   4505 N N   . TYR K 1 11  ? 3.143   -43.611 49.780 1.00 12.99 ? 461  TYR K N   1 
ATOM   4506 C CA  . TYR K 1 11  ? 3.959   -42.777 48.905 1.00 13.78 ? 461  TYR K CA  1 
ATOM   4507 C C   . TYR K 1 11  ? 4.142   -41.404 49.538 1.00 13.61 ? 461  TYR K C   1 
ATOM   4508 O O   . TYR K 1 11  ? 3.160   -40.713 49.833 1.00 15.00 ? 461  TYR K O   1 
ATOM   4509 C CB  . TYR K 1 11  ? 3.326   -42.644 47.524 1.00 15.69 ? 461  TYR K CB  1 
ATOM   4510 C CG  . TYR K 1 11  ? 4.134   -41.774 46.593 1.00 13.25 ? 461  TYR K CG  1 
ATOM   4511 C CD1 . TYR K 1 11  ? 5.340   -42.223 46.071 1.00 15.54 ? 461  TYR K CD1 1 
ATOM   4512 C CD2 . TYR K 1 11  ? 3.696   -40.503 46.239 1.00 14.32 ? 461  TYR K CD2 1 
ATOM   4513 C CE1 . TYR K 1 11  ? 6.090   -41.428 45.223 1.00 17.74 ? 461  TYR K CE1 1 
ATOM   4514 C CE2 . TYR K 1 11  ? 4.443   -39.706 45.387 1.00 16.09 ? 461  TYR K CE2 1 
ATOM   4515 C CZ  . TYR K 1 11  ? 5.635   -40.177 44.885 1.00 17.20 ? 461  TYR K CZ  1 
ATOM   4516 O OH  . TYR K 1 11  ? 6.387   -39.396 44.036 1.00 30.61 ? 461  TYR K OH  1 
ATOM   4517 N N   . HIS K 1 12  ? 5.398   -41.002 49.718 1.00 12.00 ? 462  HIS K N   1 
ATOM   4518 C CA  . HIS K 1 12  ? 5.735   -39.758 50.402 1.00 11.33 ? 462  HIS K CA  1 
ATOM   4519 C C   . HIS K 1 12  ? 6.374   -38.714 49.496 1.00 11.82 ? 462  HIS K C   1 
ATOM   4520 O O   . HIS K 1 12  ? 6.917   -37.724 50.000 1.00 13.89 ? 462  HIS K O   1 
ATOM   4521 C CB  . HIS K 1 12  ? 6.637   -40.047 51.600 1.00 11.95 ? 462  HIS K CB  1 
ATOM   4522 C CG  . HIS K 1 12  ? 5.941   -40.757 52.716 1.00 11.63 ? 462  HIS K CG  1 
ATOM   4523 N ND1 . HIS K 1 12  ? 5.855   -40.240 53.992 1.00 14.30 ? 462  HIS K ND1 1 
ATOM   4524 C CD2 . HIS K 1 12  ? 5.282   -41.939 52.745 1.00 13.53 ? 462  HIS K CD2 1 
ATOM   4525 C CE1 . HIS K 1 12  ? 5.178   -41.077 54.758 1.00 17.69 ? 462  HIS K CE1 1 
ATOM   4526 N NE2 . HIS K 1 12  ? 4.819   -42.116 54.025 1.00 14.56 ? 462  HIS K NE2 1 
ATOM   4527 N N   . GLY K 1 13  ? 6.328   -38.895 48.181 1.00 12.89 ? 463  GLY K N   1 
ATOM   4528 C CA  . GLY K 1 13  ? 6.855   -37.861 47.307 1.00 12.18 ? 463  GLY K CA  1 
ATOM   4529 C C   . GLY K 1 13  ? 8.344   -37.655 47.498 1.00 14.20 ? 463  GLY K C   1 
ATOM   4530 O O   . GLY K 1 13  ? 9.115   -38.604 47.655 1.00 14.13 ? 463  GLY K O   1 
ATOM   4531 N N   . ALA K 1 14  ? 8.764   -36.392 47.509 1.00 14.49 ? 464  ALA K N   1 
ATOM   4532 C CA  . ALA K 1 14  ? 10.184  -36.064 47.495 1.00 13.96 ? 464  ALA K CA  1 
ATOM   4533 C C   . ALA K 1 14  ? 10.774  -35.858 48.887 1.00 14.32 ? 464  ALA K C   1 
ATOM   4534 O O   . ALA K 1 14  ? 11.750  -35.109 49.024 1.00 15.04 ? 464  ALA K O   1 
ATOM   4535 C CB  . ALA K 1 14  ? 10.453  -34.862 46.585 1.00 20.13 ? 464  ALA K CB  1 
ATOM   4536 N N   . ILE K 1 15  ? 10.248  -36.525 49.914 1.00 13.64 ? 465  ILE K N   1 
ATOM   4537 C CA  . ILE K 1 15  ? 10.888  -36.351 51.226 1.00 12.35 ? 465  ILE K CA  1 
ATOM   4538 C C   . ILE K 1 15  ? 12.320  -36.862 51.161 1.00 12.65 ? 465  ILE K C   1 
ATOM   4539 O O   . ILE K 1 15  ? 12.589  -37.875 50.479 1.00 13.28 ? 465  ILE K O   1 
ATOM   4540 C CB  . ILE K 1 15  ? 10.102  -37.048 52.351 1.00 13.60 ? 465  ILE K CB  1 
ATOM   4541 C CG1 . ILE K 1 15  ? 10.023  -38.564 52.127 1.00 13.15 ? 465  ILE K CG1 1 
ATOM   4542 C CG2 . ILE K 1 15  ? 8.726   -36.420 52.525 1.00 15.13 ? 465  ILE K CG2 1 
ATOM   4543 C CD1 . ILE K 1 15  ? 9.670   -39.331 53.391 1.00 14.62 ? 465  ILE K CD1 1 
ATOM   4544 N N   . PRO K 1 16  ? 13.272  -36.217 51.828 1.00 12.05 ? 466  PRO K N   1 
ATOM   4545 C CA  . PRO K 1 16  ? 14.657  -36.692 51.802 1.00 12.24 ? 466  PRO K CA  1 
ATOM   4546 C C   . PRO K 1 16  ? 14.845  -37.909 52.693 1.00 12.71 ? 466  PRO K C   1 
ATOM   4547 O O   . PRO K 1 16  ? 14.022  -38.221 53.556 1.00 12.10 ? 466  PRO K O   1 
ATOM   4548 C CB  . PRO K 1 16  ? 15.440  -35.499 52.364 1.00 13.84 ? 466  PRO K CB  1 
ATOM   4549 C CG  . PRO K 1 16  ? 14.464  -34.824 53.275 1.00 15.26 ? 466  PRO K CG  1 
ATOM   4550 C CD  . PRO K 1 16  ? 13.133  -34.954 52.576 1.00 13.12 ? 466  PRO K CD  1 
ATOM   4551 N N   . ARG K 1 17  ? 15.974  -38.584 52.469 1.00 12.60 ? 467  ARG K N   1 
ATOM   4552 C CA  . ARG K 1 17  ? 16.323  -39.762 53.256 1.00 12.13 ? 467  ARG K CA  1 
ATOM   4553 C C   . ARG K 1 17  ? 16.197  -39.505 54.755 1.00 11.96 ? 467  ARG K C   1 
ATOM   4554 O O   . ARG K 1 17  ? 15.676  -40.351 55.492 1.00 13.18 ? 467  ARG K O   1 
ATOM   4555 C CB  . ARG K 1 17  ? 17.744  -40.202 52.916 1.00 13.55 ? 467  ARG K CB  1 
ATOM   4556 C CG  . ARG K 1 17  ? 18.244  -41.334 53.794 1.00 15.37 ? 467  ARG K CG  1 
ATOM   4557 C CD  . ARG K 1 17  ? 19.661  -41.773 53.436 1.00 14.57 ? 467  ARG K CD  1 
ATOM   4558 N NE  . ARG K 1 17  ? 19.700  -42.413 52.128 1.00 16.19 ? 467  ARG K NE  1 
ATOM   4559 C CZ  . ARG K 1 17  ? 20.411  -43.499 51.841 1.00 15.27 ? 467  ARG K CZ  1 
ATOM   4560 N NH1 . ARG K 1 17  ? 21.148  -44.087 52.776 1.00 15.12 ? 467  ARG K NH1 1 
ATOM   4561 N NH2 . ARG K 1 17  ? 20.373  -44.002 50.621 1.00 14.14 ? 467  ARG K NH2 1 
ATOM   4562 N N   . ILE K 1 18  ? 16.668  -38.346 55.230 1.00 12.05 ? 468  ILE K N   1 
ATOM   4563 C CA  . ILE K 1 18  ? 16.667  -38.079 56.669 1.00 13.76 ? 468  ILE K CA  1 
ATOM   4564 C C   . ILE K 1 18  ? 15.247  -38.100 57.228 1.00 13.34 ? 468  ILE K C   1 
ATOM   4565 O O   . ILE K 1 18  ? 15.009  -38.586 58.341 1.00 14.39 ? 468  ILE K O   1 
ATOM   4566 C CB  . ILE K 1 18  ? 17.426  -36.775 57.002 1.00 12.58 ? 468  ILE K CB  1 
ATOM   4567 C CG1 . ILE K 1 18  ? 17.564  -36.604 58.517 1.00 15.93 ? 468  ILE K CG1 1 
ATOM   4568 C CG2 . ILE K 1 18  ? 16.757  -35.531 56.387 1.00 14.56 ? 468  ILE K CG2 1 
ATOM   4569 C CD1 . ILE K 1 18  ? 18.297  -37.741 59.200 1.00 19.39 ? 468  ILE K CD1 1 
ATOM   4570 N N   . GLU K 1 19  ? 14.278  -37.594 56.464 1.00 12.51 ? 469  GLU K N   1 
ATOM   4571 C CA  . GLU K 1 19  ? 12.893  -37.625 56.922 1.00 12.98 ? 469  GLU K CA  1 
ATOM   4572 C C   . GLU K 1 19  ? 12.323  -39.038 56.884 1.00 15.36 ? 469  GLU K C   1 
ATOM   4573 O O   . GLU K 1 19  ? 11.585  -39.441 57.792 1.00 14.82 ? 469  GLU K O   1 
ATOM   4574 C CB  . GLU K 1 19  ? 12.044  -36.670 56.087 1.00 17.07 ? 469  GLU K CB  1 
ATOM   4575 C CG  . GLU K 1 19  ? 12.304  -35.208 56.411 1.00 16.84 ? 469  GLU K CG  1 
ATOM   4576 C CD  . GLU K 1 19  ? 11.446  -34.263 55.601 1.00 18.71 ? 469  GLU K CD  1 
ATOM   4577 O OE1 . GLU K 1 19  ? 11.886  -33.114 55.383 1.00 16.66 ? 469  GLU K OE1 1 
ATOM   4578 O OE2 . GLU K 1 19  ? 10.340  -34.654 55.174 1.00 15.86 ? 469  GLU K OE2 1 
ATOM   4579 N N   . ALA K 1 20  ? 12.648  -39.807 55.844 1.00 14.07 ? 470  ALA K N   1 
ATOM   4580 C CA  . ALA K 1 20  ? 12.169  -41.183 55.787 1.00 15.80 ? 470  ALA K CA  1 
ATOM   4581 C C   . ALA K 1 20  ? 12.678  -41.981 56.975 1.00 18.65 ? 470  ALA K C   1 
ATOM   4582 O O   . ALA K 1 20  ? 11.951  -42.806 57.544 1.00 16.53 ? 470  ALA K O   1 
ATOM   4583 C CB  . ALA K 1 20  ? 12.599  -41.840 54.476 1.00 19.37 ? 470  ALA K CB  1 
ATOM   4584 N N   . GLN K 1 21  ? 13.922  -41.735 57.381 1.00 15.64 ? 471  GLN K N   1 
ATOM   4585 C CA  . GLN K 1 21  ? 14.506  -42.532 58.451 1.00 22.75 ? 471  GLN K CA  1 
ATOM   4586 C C   . GLN K 1 21  ? 13.814  -42.285 59.787 1.00 24.04 ? 471  GLN K C   1 
ATOM   4587 O O   . GLN K 1 21  ? 13.767  -43.185 60.632 1.00 27.56 ? 471  GLN K O   1 
ATOM   4588 C CB  . GLN K 1 21  ? 16.021  -42.313 58.498 1.00 29.35 ? 471  GLN K CB  1 
ATOM   4589 C CG  . GLN K 1 21  ? 16.694  -42.811 57.211 1.00 33.08 ? 471  GLN K CG  1 
ATOM   4590 C CD  . GLN K 1 21  ? 18.211  -42.852 57.269 1.00 32.55 ? 471  GLN K CD  1 
ATOM   4591 O OE1 . GLN K 1 21  ? 18.856  -41.912 57.738 1.00 36.93 ? 471  GLN K OE1 1 
ATOM   4592 N NE2 . GLN K 1 21  ? 18.792  -43.950 56.776 1.00 20.00 ? 471  GLN K NE2 1 
ATOM   4593 N N   . GLU K 1 22  ? 13.229  -41.101 59.979 1.00 23.83 ? 472  GLU K N   1 
ATOM   4594 C CA  . GLU K 1 22  ? 12.476  -40.814 61.196 1.00 23.63 ? 472  GLU K CA  1 
ATOM   4595 C C   . GLU K 1 22  ? 11.077  -41.418 61.181 1.00 23.65 ? 472  GLU K C   1 
ATOM   4596 O O   . GLU K 1 22  ? 10.457  -41.544 62.241 1.00 30.40 ? 472  GLU K O   1 
ATOM   4597 C CB  . GLU K 1 22  ? 12.377  -39.302 61.407 1.00 31.70 ? 472  GLU K CB  1 
ATOM   4598 C CG  . GLU K 1 22  ? 13.686  -38.566 61.188 1.00 38.39 ? 472  GLU K CG  1 
ATOM   4599 C CD  . GLU K 1 22  ? 14.261  -37.996 62.466 1.00 45.61 ? 472  GLU K CD  1 
ATOM   4600 O OE1 . GLU K 1 22  ? 13.684  -38.250 63.544 1.00 48.70 ? 472  GLU K OE1 1 
ATOM   4601 O OE2 . GLU K 1 22  ? 15.289  -37.290 62.389 1.00 46.57 ? 472  GLU K OE2 1 
ATOM   4602 N N   . LEU K 1 23  ? 10.570  -41.790 60.008 1.00 16.37 ? 473  LEU K N   1 
ATOM   4603 C CA  . LEU K 1 23  ? 9.261   -42.411 59.869 1.00 17.25 ? 473  LEU K CA  1 
ATOM   4604 C C   . LEU K 1 23  ? 9.310   -43.931 59.941 1.00 19.98 ? 473  LEU K C   1 
ATOM   4605 O O   . LEU K 1 23  ? 8.260   -44.564 60.098 1.00 22.62 ? 473  LEU K O   1 
ATOM   4606 C CB  . LEU K 1 23  ? 8.635   -41.987 58.536 1.00 15.26 ? 473  LEU K CB  1 
ATOM   4607 C CG  . LEU K 1 23  ? 8.238   -40.515 58.454 1.00 18.02 ? 473  LEU K CG  1 
ATOM   4608 C CD1 . LEU K 1 23  ? 7.997   -40.121 57.007 1.00 19.78 ? 473  LEU K CD1 1 
ATOM   4609 C CD2 . LEU K 1 23  ? 7.002   -40.261 59.304 1.00 27.66 ? 473  LEU K CD2 1 
ATOM   4610 N N   . LEU K 1 24  ? 10.490  -44.525 59.835 1.00 16.63 ? 474  LEU K N   1 
ATOM   4611 C CA  . LEU K 1 24  ? 10.644  -45.972 59.792 1.00 14.99 ? 474  LEU K CA  1 
ATOM   4612 C C   . LEU K 1 24  ? 11.246  -46.421 61.117 1.00 19.68 ? 474  LEU K C   1 
ATOM   4613 O O   . LEU K 1 24  ? 12.375  -46.043 61.450 1.00 20.33 ? 474  LEU K O   1 
ATOM   4614 C CB  . LEU K 1 24  ? 11.531  -46.359 58.611 1.00 17.56 ? 474  LEU K CB  1 
ATOM   4615 C CG  . LEU K 1 24  ? 10.992  -45.863 57.264 1.00 16.98 ? 474  LEU K CG  1 
ATOM   4616 C CD1 . LEU K 1 24  ? 12.031  -46.018 56.169 1.00 19.00 ? 474  LEU K CD1 1 
ATOM   4617 C CD2 . LEU K 1 24  ? 9.710   -46.599 56.897 1.00 21.03 ? 474  LEU K CD2 1 
ATOM   4618 N N   . LYS K 1 25  ? 10.491  -47.228 61.867 1.00 17.30 ? 475  LYS K N   1 
ATOM   4619 C CA  . LYS K 1 25  ? 10.816  -47.490 63.267 1.00 18.76 ? 475  LYS K CA  1 
ATOM   4620 C C   . LYS K 1 25  ? 10.796  -48.969 63.643 1.00 23.28 ? 475  LYS K C   1 
ATOM   4621 O O   . LYS K 1 25  ? 11.528  -49.388 64.546 1.00 25.09 ? 475  LYS K O   1 
ATOM   4622 C CB  . LYS K 1 25  ? 9.836   -46.745 64.178 1.00 23.42 ? 475  LYS K CB  1 
ATOM   4623 C CG  . LYS K 1 25  ? 9.872   -45.231 64.057 1.00 26.59 ? 475  LYS K CG  1 
ATOM   4624 C CD  . LYS K 1 25  ? 8.701   -44.574 64.794 1.00 34.67 ? 475  LYS K CD  1 
ATOM   4625 C CE  . LYS K 1 25  ? 8.871   -44.608 66.310 1.00 44.94 ? 475  LYS K CE  1 
ATOM   4626 N NZ  . LYS K 1 25  ? 8.386   -45.874 66.936 1.00 49.95 ? 475  LYS K NZ  1 
ATOM   4627 N N   . LYS K 1 26  ? 9.947   -49.759 62.987 1.00 18.55 ? 476  LYS K N   1 
ATOM   4628 C CA  . LYS K 1 26  ? 9.691   -51.135 63.382 1.00 20.21 ? 476  LYS K CA  1 
ATOM   4629 C C   . LYS K 1 26  ? 9.877   -52.069 62.197 1.00 18.39 ? 476  LYS K C   1 
ATOM   4630 O O   . LYS K 1 26  ? 9.839   -51.651 61.037 1.00 17.53 ? 476  LYS K O   1 
ATOM   4631 C CB  . LYS K 1 26  ? 8.269   -51.297 63.934 1.00 23.99 ? 476  LYS K CB  1 
ATOM   4632 C CG  . LYS K 1 26  ? 8.013   -50.514 65.210 1.00 33.10 ? 476  LYS K CG  1 
ATOM   4633 C CD  . LYS K 1 26  ? 6.571   -50.660 65.662 1.00 40.82 ? 476  LYS K CD  1 
ATOM   4634 C CE  . LYS K 1 26  ? 6.340   -49.966 66.994 1.00 48.75 ? 476  LYS K CE  1 
ATOM   4635 N NZ  . LYS K 1 26  ? 4.920   -50.058 67.432 1.00 54.02 ? 476  LYS K NZ  1 
ATOM   4636 N N   . GLN K 1 27  ? 10.064  -53.352 62.515 1.00 19.31 ? 477  GLN K N   1 
ATOM   4637 C CA  . GLN K 1 27  ? 10.288  -54.383 61.508 1.00 19.47 ? 477  GLN K CA  1 
ATOM   4638 C C   . GLN K 1 27  ? 9.212   -54.348 60.431 1.00 19.70 ? 477  GLN K C   1 
ATOM   4639 O O   . GLN K 1 27  ? 8.018   -54.445 60.725 1.00 22.66 ? 477  GLN K O   1 
ATOM   4640 C CB  . GLN K 1 27  ? 10.294  -55.747 62.196 1.00 19.84 ? 477  GLN K CB  1 
ATOM   4641 C CG  . GLN K 1 27  ? 10.535  -56.916 61.261 1.00 19.57 ? 477  GLN K CG  1 
ATOM   4642 C CD  . GLN K 1 27  ? 12.005  -57.125 60.936 1.00 20.84 ? 477  GLN K CD  1 
ATOM   4643 O OE1 . GLN K 1 27  ? 12.784  -56.179 60.857 1.00 19.39 ? 477  GLN K OE1 1 
ATOM   4644 N NE2 . GLN K 1 27  ? 12.390  -58.384 60.750 1.00 22.91 ? 477  GLN K NE2 1 
ATOM   4645 N N   . GLY K 1 28  ? 9.638   -54.182 59.180 1.00 17.84 ? 478  GLY K N   1 
ATOM   4646 C CA  . GLY K 1 28  ? 8.726   -54.210 58.056 1.00 18.92 ? 478  GLY K CA  1 
ATOM   4647 C C   . GLY K 1 28  ? 8.055   -52.898 57.700 1.00 15.92 ? 478  GLY K C   1 
ATOM   4648 O O   . GLY K 1 28  ? 7.280   -52.874 56.734 1.00 16.35 ? 478  GLY K O   1 
ATOM   4649 N N   . ASP K 1 29  ? 8.305   -51.818 58.451 1.00 15.90 ? 479  ASP K N   1 
ATOM   4650 C CA  . ASP K 1 29  ? 7.832   -50.487 58.074 1.00 14.17 ? 479  ASP K CA  1 
ATOM   4651 C C   . ASP K 1 29  ? 8.394   -50.103 56.710 1.00 14.12 ? 479  ASP K C   1 
ATOM   4652 O O   . ASP K 1 29  ? 9.572   -50.326 56.430 1.00 14.77 ? 479  ASP K O   1 
ATOM   4653 C CB  . ASP K 1 29  ? 8.344   -49.465 59.094 1.00 13.88 ? 479  ASP K CB  1 
ATOM   4654 C CG  . ASP K 1 29  ? 7.540   -49.438 60.384 1.00 16.72 ? 479  ASP K CG  1 
ATOM   4655 O OD1 . ASP K 1 29  ? 6.555   -50.194 60.515 1.00 19.96 ? 479  ASP K OD1 1 
ATOM   4656 O OD2 . ASP K 1 29  ? 7.897   -48.631 61.270 1.00 18.48 ? 479  ASP K OD2 1 
ATOM   4657 N N   . PHE K 1 30  ? 7.565   -49.502 55.856 1.00 14.04 ? 480  PHE K N   1 
ATOM   4658 C CA  . PHE K 1 30  ? 8.068   -49.127 54.541 1.00 13.57 ? 480  PHE K CA  1 
ATOM   4659 C C   . PHE K 1 30  ? 7.343   -47.906 53.994 1.00 15.17 ? 480  PHE K C   1 
ATOM   4660 O O   . PHE K 1 30  ? 6.205   -47.606 54.367 1.00 13.91 ? 480  PHE K O   1 
ATOM   4661 C CB  . PHE K 1 30  ? 7.980   -50.287 53.540 1.00 13.40 ? 480  PHE K CB  1 
ATOM   4662 C CG  . PHE K 1 30  ? 6.582   -50.618 53.110 1.00 14.77 ? 480  PHE K CG  1 
ATOM   4663 C CD1 . PHE K 1 30  ? 5.817   -51.517 53.842 1.00 17.23 ? 480  PHE K CD1 1 
ATOM   4664 C CD2 . PHE K 1 30  ? 6.037   -50.068 51.962 1.00 15.25 ? 480  PHE K CD2 1 
ATOM   4665 C CE1 . PHE K 1 30  ? 4.529   -51.848 53.441 1.00 19.20 ? 480  PHE K CE1 1 
ATOM   4666 C CE2 . PHE K 1 30  ? 4.751   -50.393 51.556 1.00 15.26 ? 480  PHE K CE2 1 
ATOM   4667 C CZ  . PHE K 1 30  ? 3.996   -51.288 52.298 1.00 17.45 ? 480  PHE K CZ  1 
ATOM   4668 N N   . LEU K 1 31  ? 8.026   -47.217 53.081 1.00 11.62 ? 481  LEU K N   1 
ATOM   4669 C CA  . LEU K 1 31  ? 7.449   -46.123 52.316 1.00 12.31 ? 481  LEU K CA  1 
ATOM   4670 C C   . LEU K 1 31  ? 8.201   -46.024 50.997 1.00 11.45 ? 481  LEU K C   1 
ATOM   4671 O O   . LEU K 1 31  ? 9.277   -46.602 50.836 1.00 11.39 ? 481  LEU K O   1 
ATOM   4672 C CB  . LEU K 1 31  ? 7.491   -44.793 53.091 1.00 13.25 ? 481  LEU K CB  1 
ATOM   4673 C CG  . LEU K 1 31  ? 8.850   -44.246 53.551 1.00 13.25 ? 481  LEU K CG  1 
ATOM   4674 C CD1 . LEU K 1 31  ? 9.569   -43.474 52.453 1.00 13.45 ? 481  LEU K CD1 1 
ATOM   4675 C CD2 . LEU K 1 31  ? 8.662   -43.351 54.769 1.00 16.20 ? 481  LEU K CD2 1 
ATOM   4676 N N   . VAL K 1 32  ? 7.634   -45.266 50.055 1.00 10.59 ? 482  VAL K N   1 
ATOM   4677 C CA  . VAL K 1 32  ? 8.264   -44.997 48.768 1.00 10.59 ? 482  VAL K CA  1 
ATOM   4678 C C   . VAL K 1 32  ? 8.448   -43.489 48.623 1.00 10.57 ? 482  VAL K C   1 
ATOM   4679 O O   . VAL K 1 32  ? 7.586   -42.707 49.039 1.00 12.36 ? 482  VAL K O   1 
ATOM   4680 C CB  . VAL K 1 32  ? 7.457   -45.599 47.592 1.00 10.79 ? 482  VAL K CB  1 
ATOM   4681 C CG1 . VAL K 1 32  ? 8.007   -45.143 46.234 1.00 11.82 ? 482  VAL K CG1 1 
ATOM   4682 C CG2 . VAL K 1 32  ? 7.460   -47.128 47.676 1.00 12.84 ? 482  VAL K CG2 1 
ATOM   4683 N N   . ARG K 1 33  ? 9.583   -43.084 48.052 1.00 10.42 ? 483  ARG K N   1 
ATOM   4684 C CA  . ARG K 1 33  ? 9.900   -41.673 47.874 1.00 10.14 ? 483  ARG K CA  1 
ATOM   4685 C C   . ARG K 1 33  ? 10.709  -41.494 46.596 1.00 10.48 ? 483  ARG K C   1 
ATOM   4686 O O   . ARG K 1 33  ? 11.214  -42.460 46.018 1.00 11.13 ? 483  ARG K O   1 
ATOM   4687 C CB  . ARG K 1 33  ? 10.679  -41.132 49.084 1.00 13.36 ? 483  ARG K CB  1 
ATOM   4688 C CG  . ARG K 1 33  ? 11.996  -41.856 49.332 1.00 11.27 ? 483  ARG K CG  1 
ATOM   4689 C CD  . ARG K 1 33  ? 12.676  -41.413 50.619 1.00 11.73 ? 483  ARG K CD  1 
ATOM   4690 N NE  . ARG K 1 33  ? 13.854  -42.227 50.895 1.00 10.93 ? 483  ARG K NE  1 
ATOM   4691 C CZ  . ARG K 1 33  ? 15.070  -41.984 50.409 1.00 11.85 ? 483  ARG K CZ  1 
ATOM   4692 N NH1 . ARG K 1 33  ? 15.290  -40.927 49.630 1.00 12.01 ? 483  ARG K NH1 1 
ATOM   4693 N NH2 . ARG K 1 33  ? 16.076  -42.796 50.711 1.00 12.20 ? 483  ARG K NH2 1 
ATOM   4694 N N   . GLU K 1 34  ? 10.809  -40.247 46.144 1.00 10.84 ? 484  GLU K N   1 
ATOM   4695 C CA  . GLU K 1 34  ? 11.654  -39.892 45.010 1.00 12.72 ? 484  GLU K CA  1 
ATOM   4696 C C   . GLU K 1 34  ? 13.064  -39.622 45.511 1.00 15.73 ? 484  GLU K C   1 
ATOM   4697 O O   . GLU K 1 34  ? 13.249  -38.828 46.438 1.00 19.89 ? 484  GLU K O   1 
ATOM   4698 C CB  . GLU K 1 34  ? 11.166  -38.602 44.353 1.00 16.37 ? 484  GLU K CB  1 
ATOM   4699 C CG  . GLU K 1 34  ? 9.684   -38.477 44.086 1.00 22.84 ? 484  GLU K CG  1 
ATOM   4700 C CD  . GLU K 1 34  ? 9.326   -37.046 43.712 1.00 33.27 ? 484  GLU K CD  1 
ATOM   4701 O OE1 . GLU K 1 34  ? 8.253   -36.555 44.120 1.00 42.43 ? 484  GLU K OE1 1 
ATOM   4702 O OE2 . GLU K 1 34  ? 10.144  -36.399 43.025 1.00 37.72 ? 484  GLU K OE2 1 
ATOM   4703 N N   . SER K 1 35  ? 14.055  -40.201 44.841 1.00 9.68  ? 485  SER K N   1 
ATOM   4704 C CA  . SER K 1 35  ? 15.441  -40.126 45.289 1.00 10.91 ? 485  SER K CA  1 
ATOM   4705 C C   . SER K 1 35  ? 16.037  -38.732 45.099 1.00 10.23 ? 485  SER K C   1 
ATOM   4706 O O   . SER K 1 35  ? 15.747  -38.032 44.128 1.00 11.19 ? 485  SER K O   1 
ATOM   4707 C CB  . SER K 1 35  ? 16.279  -41.111 44.476 1.00 11.28 ? 485  SER K CB  1 
ATOM   4708 O OG  . SER K 1 35  ? 17.635  -41.108 44.891 1.00 11.21 ? 485  SER K OG  1 
ATOM   4709 N N   . HIS K 1 36  ? 16.909  -38.346 46.034 1.00 10.72 ? 486  HIS K N   1 
ATOM   4710 C CA  . HIS K 1 36  ? 17.814  -37.218 45.842 1.00 11.08 ? 486  HIS K CA  1 
ATOM   4711 C C   . HIS K 1 36  ? 19.205  -37.641 45.396 1.00 11.22 ? 486  HIS K C   1 
ATOM   4712 O O   . HIS K 1 36  ? 19.801  -36.979 44.542 1.00 12.04 ? 486  HIS K O   1 
ATOM   4713 C CB  . HIS K 1 36  ? 17.905  -36.357 47.109 1.00 12.03 ? 486  HIS K CB  1 
ATOM   4714 C CG  . HIS K 1 36  ? 16.693  -35.523 47.345 1.00 12.94 ? 486  HIS K CG  1 
ATOM   4715 N ND1 . HIS K 1 36  ? 15.543  -36.025 47.918 1.00 14.81 ? 486  HIS K ND1 1 
ATOM   4716 C CD2 . HIS K 1 36  ? 16.430  -34.231 47.042 1.00 13.87 ? 486  HIS K CD2 1 
ATOM   4717 C CE1 . HIS K 1 36  ? 14.632  -35.070 47.978 1.00 14.43 ? 486  HIS K CE1 1 
ATOM   4718 N NE2 . HIS K 1 36  ? 15.143  -33.974 47.449 1.00 15.91 ? 486  HIS K NE2 1 
ATOM   4719 N N   . GLY K 1 37  ? 19.734  -38.738 45.945 1.00 11.16 ? 487  GLY K N   1 
ATOM   4720 C CA  . GLY K 1 37  ? 21.059  -39.183 45.549 1.00 11.59 ? 487  GLY K CA  1 
ATOM   4721 C C   . GLY K 1 37  ? 21.123  -39.676 44.117 1.00 11.88 ? 487  GLY K C   1 
ATOM   4722 O O   . GLY K 1 37  ? 22.170  -39.572 43.466 1.00 15.17 ? 487  GLY K O   1 
ATOM   4723 N N   . LYS K 1 38  ? 20.017  -40.223 43.608 1.00 10.67 ? 488  LYS K N   1 
ATOM   4724 C CA  . LYS K 1 38  ? 19.909  -40.686 42.222 1.00 12.42 ? 488  LYS K CA  1 
ATOM   4725 C C   . LYS K 1 38  ? 18.663  -40.050 41.622 1.00 10.75 ? 488  LYS K C   1 
ATOM   4726 O O   . LYS K 1 38  ? 17.594  -40.676 41.553 1.00 11.29 ? 488  LYS K O   1 
ATOM   4727 C CB  . LYS K 1 38  ? 19.880  -42.214 42.132 1.00 13.27 ? 488  LYS K CB  1 
ATOM   4728 C CG  . LYS K 1 38  ? 21.149  -42.868 42.678 1.00 15.71 ? 488  LYS K CG  1 
ATOM   4729 C CD  . LYS K 1 38  ? 21.256  -44.337 42.285 1.00 24.71 ? 488  LYS K CD  1 
ATOM   4730 C CE  . LYS K 1 38  ? 21.805  -44.487 40.873 1.00 32.53 ? 488  LYS K CE  1 
ATOM   4731 N NZ  . LYS K 1 38  ? 23.170  -43.902 40.747 1.00 38.63 ? 488  LYS K NZ  1 
ATOM   4732 N N   . PRO K 1 39  ? 18.760  -38.791 41.195 1.00 10.55 ? 489  PRO K N   1 
ATOM   4733 C CA  . PRO K 1 39  ? 17.569  -38.063 40.746 1.00 10.21 ? 489  PRO K CA  1 
ATOM   4734 C C   . PRO K 1 39  ? 16.841  -38.805 39.635 1.00 11.82 ? 489  PRO K C   1 
ATOM   4735 O O   . PRO K 1 39  ? 17.461  -39.399 38.751 1.00 12.21 ? 489  PRO K O   1 
ATOM   4736 C CB  . PRO K 1 39  ? 18.145  -36.732 40.248 1.00 12.53 ? 489  PRO K CB  1 
ATOM   4737 C CG  . PRO K 1 39  ? 19.390  -36.545 41.061 1.00 12.26 ? 489  PRO K CG  1 
ATOM   4738 C CD  . PRO K 1 39  ? 19.963  -37.939 41.204 1.00 11.28 ? 489  PRO K CD  1 
ATOM   4739 N N   . GLY K 1 40  ? 15.508  -38.753 39.680 1.00 10.49 ? 490  GLY K N   1 
ATOM   4740 C CA  . GLY K 1 40  ? 14.670  -39.435 38.720 1.00 11.38 ? 490  GLY K CA  1 
ATOM   4741 C C   . GLY K 1 40  ? 14.303  -40.848 39.102 1.00 11.64 ? 490  GLY K C   1 
ATOM   4742 O O   . GLY K 1 40  ? 13.368  -41.405 38.514 1.00 11.88 ? 490  GLY K O   1 
ATOM   4743 N N   . GLU K 1 41  ? 15.017  -41.443 40.060 1.00 10.87 ? 491  GLU K N   1 
ATOM   4744 C CA  . GLU K 1 41  ? 14.731  -42.791 40.528 1.00 10.25 ? 491  GLU K CA  1 
ATOM   4745 C C   . GLU K 1 41  ? 13.779  -42.751 41.714 1.00 9.93  ? 491  GLU K C   1 
ATOM   4746 O O   . GLU K 1 41  ? 13.717  -41.770 42.461 1.00 12.09 ? 491  GLU K O   1 
ATOM   4747 C CB  . GLU K 1 41  ? 16.010  -43.518 40.969 1.00 12.26 ? 491  GLU K CB  1 
ATOM   4748 C CG  . GLU K 1 41  ? 17.149  -43.560 39.959 1.00 15.70 ? 491  GLU K CG  1 
ATOM   4749 C CD  . GLU K 1 41  ? 16.907  -44.516 38.814 1.00 21.79 ? 491  GLU K CD  1 
ATOM   4750 O OE1 . GLU K 1 41  ? 17.710  -44.498 37.856 1.00 26.99 ? 491  GLU K OE1 1 
ATOM   4751 O OE2 . GLU K 1 41  ? 15.923  -45.285 38.870 1.00 21.76 ? 491  GLU K OE2 1 
ATOM   4752 N N   . TYR K 1 42  ? 13.041  -43.836 41.884 1.00 10.42 ? 492  TYR K N   1 
ATOM   4753 C CA  . TYR K 1 42  ? 12.196  -44.033 43.047 1.00 9.92  ? 492  TYR K CA  1 
ATOM   4754 C C   . TYR K 1 42  ? 12.884  -44.971 44.033 1.00 10.88 ? 492  TYR K C   1 
ATOM   4755 O O   . TYR K 1 42  ? 13.669  -45.844 43.645 1.00 10.57 ? 492  TYR K O   1 
ATOM   4756 C CB  . TYR K 1 42  ? 10.852  -44.625 42.643 1.00 10.66 ? 492  TYR K CB  1 
ATOM   4757 C CG  . TYR K 1 42  ? 9.944   -43.688 41.884 1.00 10.54 ? 492  TYR K CG  1 
ATOM   4758 C CD1 . TYR K 1 42  ? 9.957   -43.646 40.492 1.00 11.31 ? 492  TYR K CD1 1 
ATOM   4759 C CD2 . TYR K 1 42  ? 9.044   -42.873 42.556 1.00 12.90 ? 492  TYR K CD2 1 
ATOM   4760 C CE1 . TYR K 1 42  ? 9.106   -42.804 39.794 1.00 13.19 ? 492  TYR K CE1 1 
ATOM   4761 C CE2 . TYR K 1 42  ? 8.186   -42.022 41.863 1.00 12.21 ? 492  TYR K CE2 1 
ATOM   4762 C CZ  . TYR K 1 42  ? 8.224   -42.003 40.485 1.00 13.10 ? 492  TYR K CZ  1 
ATOM   4763 O OH  . TYR K 1 42  ? 7.370   -41.167 39.794 1.00 15.68 ? 492  TYR K OH  1 
ATOM   4764 N N   . VAL K 1 43  ? 12.572  -44.791 45.315 1.00 9.91  ? 493  VAL K N   1 
ATOM   4765 C CA  . VAL K 1 43  ? 13.225  -45.509 46.408 1.00 10.20 ? 493  VAL K CA  1 
ATOM   4766 C C   . VAL K 1 43  ? 12.164  -46.183 47.262 1.00 10.26 ? 493  VAL K C   1 
ATOM   4767 O O   . VAL K 1 43  ? 11.166  -45.554 47.628 1.00 10.93 ? 493  VAL K O   1 
ATOM   4768 C CB  . VAL K 1 43  ? 14.047  -44.551 47.291 1.00 11.08 ? 493  VAL K CB  1 
ATOM   4769 C CG1 . VAL K 1 43  ? 14.763  -45.314 48.404 1.00 12.87 ? 493  VAL K CG1 1 
ATOM   4770 C CG2 . VAL K 1 43  ? 15.043  -43.775 46.464 1.00 13.01 ? 493  VAL K CG2 1 
ATOM   4771 N N   . LEU K 1 44  ? 12.382  -47.459 47.581 1.00 10.87 ? 494  LEU K N   1 
ATOM   4772 C CA  . LEU K 1 44  ? 11.649  -48.141 48.641 1.00 11.06 ? 494  LEU K CA  1 
ATOM   4773 C C   . LEU K 1 44  ? 12.519  -48.101 49.893 1.00 12.25 ? 494  LEU K C   1 
ATOM   4774 O O   . LEU K 1 44  ? 13.626  -48.651 49.897 1.00 13.15 ? 494  LEU K O   1 
ATOM   4775 C CB  . LEU K 1 44  ? 11.350  -49.590 48.244 1.00 12.89 ? 494  LEU K CB  1 
ATOM   4776 C CG  . LEU K 1 44  ? 10.768  -50.500 49.337 1.00 13.95 ? 494  LEU K CG  1 
ATOM   4777 C CD1 . LEU K 1 44  ? 9.364   -50.078 49.724 1.00 13.75 ? 494  LEU K CD1 1 
ATOM   4778 C CD2 . LEU K 1 44  ? 10.780  -51.958 48.899 1.00 16.07 ? 494  LEU K CD2 1 
ATOM   4779 N N   . SER K 1 45  ? 12.045  -47.420 50.934 1.00 11.55 ? 495  SER K N   1 
ATOM   4780 C CA  . SER K 1 45  ? 12.761  -47.313 52.199 1.00 13.75 ? 495  SER K CA  1 
ATOM   4781 C C   . SER K 1 45  ? 12.054  -48.193 53.220 1.00 13.33 ? 495  SER K C   1 
ATOM   4782 O O   . SER K 1 45  ? 10.831  -48.111 53.371 1.00 12.87 ? 495  SER K O   1 
ATOM   4783 C CB  . SER K 1 45  ? 12.813  -45.857 52.676 1.00 12.77 ? 495  SER K CB  1 
ATOM   4784 O OG  . SER K 1 45  ? 13.592  -45.052 51.799 1.00 13.17 ? 495  SER K OG  1 
ATOM   4785 N N   . VAL K 1 46  ? 12.813  -49.055 53.901 1.00 15.20 ? 496  VAL K N   1 
ATOM   4786 C CA  A VAL K 1 46  ? 12.243  -50.053 54.801 0.65 17.73 ? 496  VAL K CA  1 
ATOM   4787 C CA  B VAL K 1 46  ? 12.248  -50.056 54.799 0.35 17.35 ? 496  VAL K CA  1 
ATOM   4788 C C   . VAL K 1 46  ? 13.076  -50.107 56.075 1.00 20.41 ? 496  VAL K C   1 
ATOM   4789 O O   . VAL K 1 46  ? 14.297  -49.920 56.042 1.00 28.43 ? 496  VAL K O   1 
ATOM   4790 C CB  A VAL K 1 46  ? 12.179  -51.452 54.139 0.65 18.01 ? 496  VAL K CB  1 
ATOM   4791 C CB  B VAL K 1 46  ? 12.202  -51.456 54.143 0.35 17.79 ? 496  VAL K CB  1 
ATOM   4792 C CG1 A VAL K 1 46  ? 11.423  -52.448 55.013 0.65 16.78 ? 496  VAL K CG1 1 
ATOM   4793 C CG1 B VAL K 1 46  ? 11.432  -51.427 52.834 0.35 19.02 ? 496  VAL K CG1 1 
ATOM   4794 C CG2 A VAL K 1 46  ? 11.537  -51.387 52.770 0.65 20.42 ? 496  VAL K CG2 1 
ATOM   4795 C CG2 B VAL K 1 46  ? 13.609  -51.994 53.919 0.35 17.66 ? 496  VAL K CG2 1 
ATOM   4796 N N   . TYR K 1 47  ? 12.409  -50.356 57.202 1.00 16.37 ? 497  TYR K N   1 
ATOM   4797 C CA  . TYR K 1 47  ? 13.094  -50.724 58.436 1.00 17.61 ? 497  TYR K CA  1 
ATOM   4798 C C   . TYR K 1 47  ? 13.078  -52.246 58.525 1.00 17.13 ? 497  TYR K C   1 
ATOM   4799 O O   . TYR K 1 47  ? 12.005  -52.857 58.519 1.00 17.60 ? 497  TYR K O   1 
ATOM   4800 C CB  . TYR K 1 47  ? 12.396  -50.134 59.661 1.00 18.10 ? 497  TYR K CB  1 
ATOM   4801 C CG  . TYR K 1 47  ? 13.203  -50.287 60.935 1.00 16.45 ? 497  TYR K CG  1 
ATOM   4802 C CD1 . TYR K 1 47  ? 13.183  -51.473 61.665 1.00 18.80 ? 497  TYR K CD1 1 
ATOM   4803 C CD2 . TYR K 1 47  ? 13.995  -49.248 61.403 1.00 21.16 ? 497  TYR K CD2 1 
ATOM   4804 C CE1 . TYR K 1 47  ? 13.923  -51.610 62.821 1.00 18.98 ? 497  TYR K CE1 1 
ATOM   4805 C CE2 . TYR K 1 47  ? 14.740  -49.381 62.563 1.00 22.83 ? 497  TYR K CE2 1 
ATOM   4806 C CZ  . TYR K 1 47  ? 14.701  -50.564 63.266 1.00 20.45 ? 497  TYR K CZ  1 
ATOM   4807 O OH  . TYR K 1 47  ? 15.438  -50.709 64.422 1.00 25.47 ? 497  TYR K OH  1 
ATOM   4808 N N   . SER K 1 48  ? 14.257  -52.858 58.598 1.00 16.24 ? 498  SER K N   1 
ATOM   4809 C CA  . SER K 1 48  ? 14.347  -54.310 58.595 1.00 17.31 ? 498  SER K CA  1 
ATOM   4810 C C   . SER K 1 48  ? 15.578  -54.734 59.378 1.00 17.47 ? 498  SER K C   1 
ATOM   4811 O O   . SER K 1 48  ? 16.681  -54.244 59.120 1.00 18.19 ? 498  SER K O   1 
ATOM   4812 C CB  . SER K 1 48  ? 14.429  -54.844 57.161 1.00 17.19 ? 498  SER K CB  1 
ATOM   4813 O OG  . SER K 1 48  ? 14.497  -56.260 57.174 1.00 19.60 ? 498  SER K OG  1 
ATOM   4814 N N   . ASP K 1 49  ? 15.374  -55.655 60.320 1.00 18.29 ? 499  ASP K N   1 
ATOM   4815 C CA  . ASP K 1 49  ? 16.448  -56.218 61.139 1.00 21.83 ? 499  ASP K CA  1 
ATOM   4816 C C   . ASP K 1 49  ? 17.360  -55.132 61.710 1.00 21.25 ? 499  ASP K C   1 
ATOM   4817 O O   . ASP K 1 49  ? 18.584  -55.163 61.571 1.00 21.43 ? 499  ASP K O   1 
ATOM   4818 C CB  . ASP K 1 49  ? 17.219  -57.302 60.385 1.00 23.98 ? 499  ASP K CB  1 
ATOM   4819 C CG  . ASP K 1 49  ? 16.337  -58.489 60.030 1.00 29.58 ? 499  ASP K CG  1 
ATOM   4820 O OD1 . ASP K 1 49  ? 15.362  -58.745 60.768 1.00 24.87 ? 499  ASP K OD1 1 
ATOM   4821 O OD2 . ASP K 1 49  ? 16.610  -59.164 59.015 1.00 34.67 ? 499  ASP K OD2 1 
ATOM   4822 N N   . GLY K 1 50  ? 16.732  -54.131 62.328 1.00 19.95 ? 500  GLY K N   1 
ATOM   4823 C CA  . GLY K 1 50  ? 17.440  -53.115 63.074 1.00 22.10 ? 500  GLY K CA  1 
ATOM   4824 C C   . GLY K 1 50  ? 18.030  -51.974 62.272 1.00 20.71 ? 500  GLY K C   1 
ATOM   4825 O O   . GLY K 1 50  ? 18.710  -51.124 62.859 1.00 24.10 ? 500  GLY K O   1 
ATOM   4826 N N   . GLN K 1 51  ? 17.805  -51.915 60.961 1.00 19.59 ? 501  GLN K N   1 
ATOM   4827 C CA  . GLN K 1 51  ? 18.400  -50.859 60.153 1.00 20.98 ? 501  GLN K CA  1 
ATOM   4828 C C   . GLN K 1 51  ? 17.402  -50.352 59.125 1.00 20.59 ? 501  GLN K C   1 
ATOM   4829 O O   . GLN K 1 51  ? 16.538  -51.093 58.646 1.00 18.23 ? 501  GLN K O   1 
ATOM   4830 C CB  . GLN K 1 51  ? 19.673  -51.333 59.434 1.00 22.83 ? 501  GLN K CB  1 
ATOM   4831 C CG  . GLN K 1 51  ? 20.757  -51.845 60.375 1.00 25.55 ? 501  GLN K CG  1 
ATOM   4832 C CD  . GLN K 1 51  ? 21.927  -52.463 59.644 1.00 34.08 ? 501  GLN K CD  1 
ATOM   4833 O OE1 . GLN K 1 51  ? 22.449  -51.887 58.691 1.00 38.50 ? 501  GLN K OE1 1 
ATOM   4834 N NE2 . GLN K 1 51  ? 22.347  -53.644 60.089 1.00 36.19 ? 501  GLN K NE2 1 
ATOM   4835 N N   . ARG K 1 52  ? 17.526  -49.069 58.801 1.00 18.79 ? 502  ARG K N   1 
ATOM   4836 C CA  . ARG K 1 52  ? 16.816  -48.508 57.664 1.00 18.19 ? 502  ARG K CA  1 
ATOM   4837 C C   . ARG K 1 52  ? 17.576  -48.860 56.394 1.00 18.90 ? 502  ARG K C   1 
ATOM   4838 O O   . ARG K 1 52  ? 18.793  -48.662 56.311 1.00 25.99 ? 502  ARG K O   1 
ATOM   4839 C CB  . ARG K 1 52  ? 16.710  -46.990 57.798 1.00 25.16 ? 502  ARG K CB  1 
ATOM   4840 C CG  . ARG K 1 52  ? 15.665  -46.509 58.794 1.00 29.05 ? 502  ARG K CG  1 
ATOM   4841 C CD  . ARG K 1 52  ? 16.289  -46.130 60.127 1.00 30.83 ? 502  ARG K CD  1 
ATOM   4842 N NE  . ARG K 1 52  ? 15.279  -45.705 61.091 1.00 27.40 ? 502  ARG K NE  1 
ATOM   4843 C CZ  . ARG K 1 52  ? 15.464  -45.687 62.406 1.00 28.65 ? 502  ARG K CZ  1 
ATOM   4844 N NH1 . ARG K 1 52  ? 16.625  -46.076 62.917 1.00 31.71 ? 502  ARG K NH1 1 
ATOM   4845 N NH2 . ARG K 1 52  ? 14.487  -45.293 63.210 1.00 34.41 ? 502  ARG K NH2 1 
ATOM   4846 N N   . ARG K 1 53  ? 16.864  -49.398 55.410 1.00 17.44 ? 503  ARG K N   1 
ATOM   4847 C CA  . ARG K 1 53  ? 17.477  -49.826 54.165 1.00 17.48 ? 503  ARG K CA  1 
ATOM   4848 C C   . ARG K 1 53  ? 16.724  -49.204 53.001 1.00 19.11 ? 503  ARG K C   1 
ATOM   4849 O O   . ARG K 1 53  ? 15.504  -49.031 53.052 1.00 18.83 ? 503  ARG K O   1 
ATOM   4850 C CB  . ARG K 1 53  ? 17.485  -51.349 54.070 1.00 21.37 ? 503  ARG K CB  1 
ATOM   4851 C CG  . ARG K 1 53  ? 18.180  -51.979 55.272 1.00 22.55 ? 503  ARG K CG  1 
ATOM   4852 C CD  . ARG K 1 53  ? 17.942  -53.470 55.388 1.00 24.68 ? 503  ARG K CD  1 
ATOM   4853 N NE  . ARG K 1 53  ? 18.263  -53.945 56.732 1.00 25.10 ? 503  ARG K NE  1 
ATOM   4854 C CZ  . ARG K 1 53  ? 19.469  -54.357 57.114 1.00 29.77 ? 503  ARG K CZ  1 
ATOM   4855 N NH1 . ARG K 1 53  ? 20.476  -54.357 56.252 1.00 31.62 ? 503  ARG K NH1 1 
ATOM   4856 N NH2 . ARG K 1 53  ? 19.669  -54.771 58.360 1.00 26.32 ? 503  ARG K NH2 1 
ATOM   4857 N N   . HIS K 1 54  ? 17.464  -48.855 51.954 1.00 14.14 ? 504  HIS K N   1 
ATOM   4858 C CA  . HIS K 1 54  ? 16.919  -48.065 50.857 1.00 13.52 ? 504  HIS K CA  1 
ATOM   4859 C C   . HIS K 1 54  ? 17.230  -48.761 49.545 1.00 14.49 ? 504  HIS K C   1 
ATOM   4860 O O   . HIS K 1 54  ? 18.403  -48.954 49.200 1.00 15.81 ? 504  HIS K O   1 
ATOM   4861 C CB  . HIS K 1 54  ? 17.505  -46.654 50.886 1.00 13.47 ? 504  HIS K CB  1 
ATOM   4862 C CG  . HIS K 1 54  ? 17.353  -45.979 52.213 1.00 13.75 ? 504  HIS K CG  1 
ATOM   4863 N ND1 . HIS K 1 54  ? 16.202  -45.318 52.584 1.00 14.40 ? 504  HIS K ND1 1 
ATOM   4864 C CD2 . HIS K 1 54  ? 18.196  -45.886 53.270 1.00 14.38 ? 504  HIS K CD2 1 
ATOM   4865 C CE1 . HIS K 1 54  ? 16.348  -44.833 53.804 1.00 16.28 ? 504  HIS K CE1 1 
ATOM   4866 N NE2 . HIS K 1 54  ? 17.548  -45.164 54.243 1.00 16.26 ? 504  HIS K NE2 1 
ATOM   4867 N N   . PHE K 1 55  ? 16.181  -49.137 48.822 1.00 13.20 ? 505  PHE K N   1 
ATOM   4868 C CA  . PHE K 1 55  ? 16.295  -49.873 47.569 1.00 13.68 ? 505  PHE K CA  1 
ATOM   4869 C C   . PHE K 1 55  ? 15.870  -48.986 46.409 1.00 12.74 ? 505  PHE K C   1 
ATOM   4870 O O   . PHE K 1 55  ? 14.787  -48.395 46.443 1.00 14.42 ? 505  PHE K O   1 
ATOM   4871 C CB  . PHE K 1 55  ? 15.373  -51.093 47.583 1.00 13.64 ? 505  PHE K CB  1 
ATOM   4872 C CG  . PHE K 1 55  ? 15.706  -52.098 48.647 1.00 15.06 ? 505  PHE K CG  1 
ATOM   4873 C CD1 . PHE K 1 55  ? 16.511  -53.189 48.355 1.00 16.19 ? 505  PHE K CD1 1 
ATOM   4874 C CD2 . PHE K 1 55  ? 15.218  -51.957 49.939 1.00 17.27 ? 505  PHE K CD2 1 
ATOM   4875 C CE1 . PHE K 1 55  ? 16.821  -54.122 49.330 1.00 19.25 ? 505  PHE K CE1 1 
ATOM   4876 C CE2 . PHE K 1 55  ? 15.526  -52.882 50.923 1.00 21.38 ? 505  PHE K CE2 1 
ATOM   4877 C CZ  . PHE K 1 55  ? 16.332  -53.970 50.614 1.00 20.35 ? 505  PHE K CZ  1 
ATOM   4878 N N   . ILE K 1 56  ? 16.707  -48.905 45.378 1.00 14.01 ? 506  ILE K N   1 
ATOM   4879 C CA  . ILE K 1 56  ? 16.272  -48.272 44.140 1.00 13.76 ? 506  ILE K CA  1 
ATOM   4880 C C   . ILE K 1 56  ? 15.268  -49.183 43.447 1.00 13.06 ? 506  ILE K C   1 
ATOM   4881 O O   . ILE K 1 56  ? 15.508  -50.388 43.285 1.00 15.00 ? 506  ILE K O   1 
ATOM   4882 C CB  . ILE K 1 56  ? 17.471  -47.965 43.229 1.00 16.19 ? 506  ILE K CB  1 
ATOM   4883 C CG1 . ILE K 1 56  ? 18.364  -46.897 43.868 1.00 15.49 ? 506  ILE K CG1 1 
ATOM   4884 C CG2 . ILE K 1 56  ? 16.988  -47.522 41.834 1.00 15.69 ? 506  ILE K CG2 1 
ATOM   4885 C CD1 . ILE K 1 56  ? 17.701  -45.538 43.969 1.00 14.71 ? 506  ILE K CD1 1 
ATOM   4886 N N   . ILE K 1 57  ? 14.127  -48.620 43.065 1.00 12.99 ? 507  ILE K N   1 
ATOM   4887 C CA  . ILE K 1 57  ? 13.150  -49.330 42.247 1.00 15.28 ? 507  ILE K CA  1 
ATOM   4888 C C   . ILE K 1 57  ? 13.616  -49.214 40.804 1.00 16.51 ? 507  ILE K C   1 
ATOM   4889 O O   . ILE K 1 57  ? 13.561  -48.137 40.209 1.00 16.47 ? 507  ILE K O   1 
ATOM   4890 C CB  . ILE K 1 57  ? 11.743  -48.754 42.431 1.00 15.87 ? 507  ILE K CB  1 
ATOM   4891 C CG1 . ILE K 1 57  ? 11.343  -48.839 43.905 1.00 20.20 ? 507  ILE K CG1 1 
ATOM   4892 C CG2 . ILE K 1 57  ? 10.747  -49.498 41.552 1.00 18.57 ? 507  ILE K CG2 1 
ATOM   4893 C CD1 . ILE K 1 57  ? 10.014  -48.207 44.241 1.00 18.46 ? 507  ILE K CD1 1 
ATOM   4894 N N   . GLN K 1 58  ? 14.110  -50.314 40.248 1.00 13.99 ? 508  GLN K N   1 
ATOM   4895 C CA  . GLN K 1 58  ? 14.664  -50.276 38.906 1.00 14.12 ? 508  GLN K CA  1 
ATOM   4896 C C   . GLN K 1 58  ? 13.548  -50.052 37.901 1.00 13.77 ? 508  GLN K C   1 
ATOM   4897 O O   . GLN K 1 58  ? 12.468  -50.639 38.003 1.00 14.83 ? 508  GLN K O   1 
ATOM   4898 C CB  . GLN K 1 58  ? 15.377  -51.588 38.585 1.00 17.50 ? 508  GLN K CB  1 
ATOM   4899 C CG  . GLN K 1 58  ? 16.417  -52.011 39.620 1.00 28.98 ? 508  GLN K CG  1 
ATOM   4900 C CD  . GLN K 1 58  ? 17.537  -50.995 39.789 1.00 38.77 ? 508  GLN K CD  1 
ATOM   4901 O OE1 . GLN K 1 58  ? 18.083  -50.833 40.881 1.00 42.65 ? 508  GLN K OE1 1 
ATOM   4902 N NE2 . GLN K 1 58  ? 17.887  -50.310 38.705 1.00 42.33 ? 508  GLN K NE2 1 
ATOM   4903 N N   . TYR K 1 59  ? 13.808  -49.185 36.932 1.00 13.14 ? 509  TYR K N   1 
ATOM   4904 C CA  . TYR K 1 59  ? 12.896  -48.931 35.825 1.00 12.62 ? 509  TYR K CA  1 
ATOM   4905 C C   . TYR K 1 59  ? 13.655  -49.286 34.557 1.00 14.08 ? 509  TYR K C   1 
ATOM   4906 O O   . TYR K 1 59  ? 14.584  -48.575 34.160 1.00 16.47 ? 509  TYR K O   1 
ATOM   4907 C CB  . TYR K 1 59  ? 12.415  -47.480 35.819 1.00 13.20 ? 509  TYR K CB  1 
ATOM   4908 C CG  . TYR K 1 59  ? 11.513  -47.183 34.648 1.00 13.16 ? 509  TYR K CG  1 
ATOM   4909 C CD1 . TYR K 1 59  ? 10.260  -47.775 34.541 1.00 14.38 ? 509  TYR K CD1 1 
ATOM   4910 C CD2 . TYR K 1 59  ? 11.923  -46.331 33.631 1.00 14.63 ? 509  TYR K CD2 1 
ATOM   4911 C CE1 . TYR K 1 59  ? 9.434   -47.524 33.456 1.00 15.36 ? 509  TYR K CE1 1 
ATOM   4912 C CE2 . TYR K 1 59  ? 11.104  -46.068 32.542 1.00 14.96 ? 509  TYR K CE2 1 
ATOM   4913 C CZ  . TYR K 1 59  ? 9.861   -46.666 32.458 1.00 15.56 ? 509  TYR K CZ  1 
ATOM   4914 O OH  . TYR K 1 59  ? 9.039   -46.416 31.380 1.00 18.98 ? 509  TYR K OH  1 
ATOM   4915 N N   . VAL K 1 60  ? 13.279  -50.408 33.950 1.00 16.17 ? 510  VAL K N   1 
ATOM   4916 C CA  . VAL K 1 60  ? 13.977  -50.971 32.801 1.00 19.00 ? 510  VAL K CA  1 
ATOM   4917 C C   . VAL K 1 60  ? 12.938  -51.604 31.892 1.00 20.48 ? 510  VAL K C   1 
ATOM   4918 O O   . VAL K 1 60  ? 12.004  -52.260 32.363 1.00 18.52 ? 510  VAL K O   1 
ATOM   4919 C CB  . VAL K 1 60  ? 15.032  -52.005 33.252 1.00 24.31 ? 510  VAL K CB  1 
ATOM   4920 C CG1 . VAL K 1 60  ? 14.394  -53.076 34.131 1.00 30.13 ? 510  VAL K CG1 1 
ATOM   4921 C CG2 . VAL K 1 60  ? 15.712  -52.640 32.051 1.00 26.67 ? 510  VAL K CG2 1 
ATOM   4922 N N   . ASP K 1 61  ? 13.098  -51.394 30.587 1.00 20.04 ? 511  ASP K N   1 
ATOM   4923 C CA  . ASP K 1 61  ? 12.204  -51.984 29.592 1.00 23.01 ? 511  ASP K CA  1 
ATOM   4924 C C   . ASP K 1 61  ? 10.740  -51.665 29.901 1.00 21.11 ? 511  ASP K C   1 
ATOM   4925 O O   . ASP K 1 61  ? 9.859   -52.523 29.807 1.00 23.76 ? 511  ASP K O   1 
ATOM   4926 C CB  . ASP K 1 61  ? 12.445  -53.493 29.466 1.00 28.61 ? 511  ASP K CB  1 
ATOM   4927 C CG  . ASP K 1 61  ? 11.757  -54.100 28.257 1.00 39.80 ? 511  ASP K CG  1 
ATOM   4928 O OD1 . ASP K 1 61  ? 11.351  -53.339 27.354 1.00 44.13 ? 511  ASP K OD1 1 
ATOM   4929 O OD2 . ASP K 1 61  ? 11.615  -55.341 28.219 1.00 42.48 ? 511  ASP K OD2 1 
ATOM   4930 N N   . ASN K 1 62  ? 10.485  -50.415 30.295 1.00 21.32 ? 512  ASN K N   1 
ATOM   4931 C CA  . ASN K 1 62  ? 9.146   -49.915 30.597 1.00 21.79 ? 512  ASN K CA  1 
ATOM   4932 C C   . ASN K 1 62  ? 8.495   -50.627 31.775 1.00 19.85 ? 512  ASN K C   1 
ATOM   4933 O O   . ASN K 1 62  ? 7.265   -50.659 31.883 1.00 24.27 ? 512  ASN K O   1 
ATOM   4934 C CB  . ASN K 1 62  ? 8.228   -49.934 29.368 1.00 30.52 ? 512  ASN K CB  1 
ATOM   4935 C CG  . ASN K 1 62  ? 8.872   -49.291 28.158 1.00 36.96 ? 512  ASN K CG  1 
ATOM   4936 O OD1 . ASN K 1 62  ? 9.175   -49.965 27.173 1.00 44.03 ? 512  ASN K OD1 1 
ATOM   4937 N ND2 . ASN K 1 62  ? 9.095   -47.983 28.228 1.00 37.69 ? 512  ASN K ND2 1 
ATOM   4938 N N   . MET K 1 63  ? 9.294   -51.194 32.669 1.00 16.65 ? 513  MET K N   1 
ATOM   4939 C CA  . MET K 1 63  ? 8.776   -51.942 33.800 1.00 16.83 ? 513  MET K CA  1 
ATOM   4940 C C   . MET K 1 63  ? 9.537   -51.556 35.054 1.00 17.82 ? 513  MET K C   1 
ATOM   4941 O O   . MET K 1 63  ? 10.722  -51.213 35.001 1.00 16.80 ? 513  MET K O   1 
ATOM   4942 C CB  . MET K 1 63  ? 8.956   -53.445 33.604 1.00 20.87 ? 513  MET K CB  1 
ATOM   4943 C CG  . MET K 1 63  ? 8.169   -54.016 32.459 1.00 25.58 ? 513  MET K CG  1 
ATOM   4944 S SD  . MET K 1 63  ? 8.422   -55.792 32.351 1.00 30.48 ? 513  MET K SD  1 
ATOM   4945 C CE  . MET K 1 63  ? 9.973   -55.884 31.475 1.00 30.42 ? 513  MET K CE  1 
ATOM   4946 N N   . TYR K 1 64  ? 8.849   -51.640 36.185 1.00 13.97 ? 514  TYR K N   1 
ATOM   4947 C CA  . TYR K 1 64  ? 9.460   -51.425 37.487 1.00 13.43 ? 514  TYR K CA  1 
ATOM   4948 C C   . TYR K 1 64  ? 9.705   -52.771 38.156 1.00 14.45 ? 514  TYR K C   1 
ATOM   4949 O O   . TYR K 1 64  ? 8.865   -53.673 38.080 1.00 15.88 ? 514  TYR K O   1 
ATOM   4950 C CB  . TYR K 1 64  ? 8.552   -50.574 38.371 1.00 15.01 ? 514  TYR K CB  1 
ATOM   4951 C CG  . TYR K 1 64  ? 8.342   -49.172 37.849 1.00 11.59 ? 514  TYR K CG  1 
ATOM   4952 C CD1 . TYR K 1 64  ? 9.211   -48.148 38.197 1.00 11.22 ? 514  TYR K CD1 1 
ATOM   4953 C CD2 . TYR K 1 64  ? 7.270   -48.874 37.017 1.00 12.32 ? 514  TYR K CD2 1 
ATOM   4954 C CE1 . TYR K 1 64  ? 9.029   -46.866 37.730 1.00 11.33 ? 514  TYR K CE1 1 
ATOM   4955 C CE2 . TYR K 1 64  ? 7.077   -47.591 36.539 1.00 12.19 ? 514  TYR K CE2 1 
ATOM   4956 C CZ  . TYR K 1 64  ? 7.963   -46.592 36.900 1.00 11.15 ? 514  TYR K CZ  1 
ATOM   4957 O OH  . TYR K 1 64  ? 7.782   -45.308 36.443 1.00 12.72 ? 514  TYR K OH  1 
ATOM   4958 N N   . ARG K 1 65  ? 10.854  -52.910 38.813 1.00 13.97 ? 515  ARG K N   1 
ATOM   4959 C CA  . ARG K 1 65  ? 11.200  -54.198 39.399 1.00 14.80 ? 515  ARG K CA  1 
ATOM   4960 C C   . ARG K 1 65  ? 12.295  -54.017 40.436 1.00 15.03 ? 515  ARG K C   1 
ATOM   4961 O O   . ARG K 1 65  ? 12.945  -52.971 40.520 1.00 14.61 ? 515  ARG K O   1 
ATOM   4962 C CB  . ARG K 1 65  ? 11.676  -55.181 38.326 1.00 18.22 ? 515  ARG K CB  1 
ATOM   4963 C CG  . ARG K 1 65  ? 13.006  -54.782 37.697 1.00 22.92 ? 515  ARG K CG  1 
ATOM   4964 C CD  . ARG K 1 65  ? 13.317  -55.619 36.465 1.00 29.93 ? 515  ARG K CD  1 
ATOM   4965 N NE  . ARG K 1 65  ? 13.568  -57.019 36.791 1.00 38.39 ? 515  ARG K NE  1 
ATOM   4966 C CZ  . ARG K 1 65  ? 14.775  -57.523 37.025 1.00 42.62 ? 515  ARG K CZ  1 
ATOM   4967 N NH1 . ARG K 1 65  ? 15.845  -56.739 36.972 1.00 44.34 ? 515  ARG K NH1 1 
ATOM   4968 N NH2 . ARG K 1 65  ? 14.915  -58.810 37.311 1.00 43.79 ? 515  ARG K NH2 1 
ATOM   4969 N N   . PHE K 1 66  ? 12.488  -55.073 41.229 1.00 18.92 ? 516  PHE K N   1 
ATOM   4970 C CA  . PHE K 1 66  ? 13.681  -55.217 42.039 1.00 19.22 ? 516  PHE K CA  1 
ATOM   4971 C C   . PHE K 1 66  ? 14.555  -56.259 41.366 1.00 26.13 ? 516  PHE K C   1 
ATOM   4972 O O   . PHE K 1 66  ? 15.405  -55.903 40.524 1.00 29.55 ? 516  PHE K O   1 
ATOM   4973 C CB  . PHE K 1 66  ? 13.330  -55.531 43.501 1.00 22.54 ? 516  PHE K CB  1 
ATOM   4974 C CG  . PHE K 1 66  ? 12.607  -54.414 44.206 1.00 18.75 ? 516  PHE K CG  1 
ATOM   4975 C CD1 . PHE K 1 66  ? 13.235  -53.198 44.437 1.00 17.06 ? 516  PHE K CD1 1 
ATOM   4976 C CD2 . PHE K 1 66  ? 11.298  -54.573 44.636 1.00 18.06 ? 516  PHE K CD2 1 
ATOM   4977 C CE1 . PHE K 1 66  ? 12.574  -52.163 45.080 1.00 20.64 ? 516  PHE K CE1 1 
ATOM   4978 C CE2 . PHE K 1 66  ? 10.631  -53.534 45.283 1.00 18.03 ? 516  PHE K CE2 1 
ATOM   4979 C CZ  . PHE K 1 66  ? 11.276  -52.330 45.503 1.00 17.37 ? 516  PHE K CZ  1 
ATOM   4980 N N   . GLU K 1 67  ? 14.384  -57.547 41.660 1.00 23.56 ? 517  GLU K N   1 
ATOM   4981 C CA  . GLU K 1 67  ? 15.251  -58.601 41.150 1.00 29.09 ? 517  GLU K CA  1 
ATOM   4982 C C   . GLU K 1 67  ? 14.552  -59.592 40.235 1.00 31.63 ? 517  GLU K C   1 
ATOM   4983 O O   . GLU K 1 67  ? 15.213  -60.496 39.712 1.00 36.47 ? 517  GLU K O   1 
ATOM   4984 C CB  . GLU K 1 67  ? 15.850  -59.394 42.309 1.00 32.24 ? 517  GLU K CB  1 
ATOM   4985 C CG  . GLU K 1 67  ? 16.939  -58.692 43.043 1.00 40.70 ? 517  GLU K CG  1 
ATOM   4986 C CD  . GLU K 1 67  ? 17.711  -59.646 43.912 1.00 44.00 ? 517  GLU K CD  1 
ATOM   4987 O OE1 . GLU K 1 67  ? 17.118  -60.652 44.356 1.00 45.78 ? 517  GLU K OE1 1 
ATOM   4988 O OE2 . GLU K 1 67  ? 18.911  -59.397 44.143 1.00 51.83 ? 517  GLU K OE2 1 
ATOM   4989 N N   . GLY K 1 68  ? 13.245  -59.482 40.048 1.00 28.39 ? 518  GLY K N   1 
ATOM   4990 C CA  . GLY K 1 68  ? 12.566  -60.496 39.272 1.00 27.32 ? 518  GLY K CA  1 
ATOM   4991 C C   . GLY K 1 68  ? 11.550  -59.945 38.300 1.00 22.25 ? 518  GLY K C   1 
ATOM   4992 O O   . GLY K 1 68  ? 11.894  -59.217 37.364 1.00 23.28 ? 518  GLY K O   1 
ATOM   4993 N N   . THR K 1 69  ? 10.289  -60.295 38.535 1.00 22.33 ? 519  THR K N   1 
ATOM   4994 C CA  . THR K 1 69  ? 9.194   -59.899 37.661 1.00 21.24 ? 519  THR K CA  1 
ATOM   4995 C C   . THR K 1 69  ? 9.106   -58.379 37.538 1.00 20.71 ? 519  THR K C   1 
ATOM   4996 O O   . THR K 1 69  ? 9.308   -57.649 38.511 1.00 20.53 ? 519  THR K O   1 
ATOM   4997 C CB  . THR K 1 69  ? 7.890   -60.440 38.255 1.00 29.61 ? 519  THR K CB  1 
ATOM   4998 O OG1 . THR K 1 69  ? 8.005   -61.857 38.438 1.00 34.05 ? 519  THR K OG1 1 
ATOM   4999 C CG2 . THR K 1 69  ? 6.713   -60.153 37.349 1.00 30.19 ? 519  THR K CG2 1 
ATOM   5000 N N   . GLY K 1 70  ? 8.806   -57.905 36.328 1.00 17.74 ? 520  GLY K N   1 
ATOM   5001 C CA  . GLY K 1 70  ? 8.562   -56.492 36.109 1.00 18.03 ? 520  GLY K CA  1 
ATOM   5002 C C   . GLY K 1 70  ? 7.080   -56.154 36.149 1.00 16.95 ? 520  GLY K C   1 
ATOM   5003 O O   . GLY K 1 70  ? 6.226   -56.979 35.820 1.00 19.34 ? 520  GLY K O   1 
ATOM   5004 N N   . PHE K 1 71  ? 6.783   -54.919 36.557 1.00 14.96 ? 521  PHE K N   1 
ATOM   5005 C CA  . PHE K 1 71  ? 5.412   -54.445 36.693 1.00 15.23 ? 521  PHE K CA  1 
ATOM   5006 C C   . PHE K 1 71  ? 5.244   -53.122 35.959 1.00 14.92 ? 521  PHE K C   1 
ATOM   5007 O O   . PHE K 1 71  ? 6.189   -52.337 35.834 1.00 16.60 ? 521  PHE K O   1 
ATOM   5008 C CB  . PHE K 1 71  ? 5.011   -54.284 38.173 1.00 13.84 ? 521  PHE K CB  1 
ATOM   5009 C CG  . PHE K 1 71  ? 5.049   -55.573 38.948 1.00 14.76 ? 521  PHE K CG  1 
ATOM   5010 C CD1 . PHE K 1 71  ? 6.243   -56.064 39.452 1.00 19.27 ? 521  PHE K CD1 1 
ATOM   5011 C CD2 . PHE K 1 71  ? 3.888   -56.292 39.166 1.00 14.98 ? 521  PHE K CD2 1 
ATOM   5012 C CE1 . PHE K 1 71  ? 6.273   -57.262 40.159 1.00 18.76 ? 521  PHE K CE1 1 
ATOM   5013 C CE2 . PHE K 1 71  ? 3.909   -57.481 39.871 1.00 17.69 ? 521  PHE K CE2 1 
ATOM   5014 C CZ  . PHE K 1 71  ? 5.099   -57.966 40.365 1.00 17.55 ? 521  PHE K CZ  1 
ATOM   5015 N N   . SER K 1 72  ? 4.017   -52.874 35.496 1.00 14.98 ? 522  SER K N   1 
ATOM   5016 C CA  A SER K 1 72  ? 3.742   -51.668 34.720 0.45 15.74 ? 522  SER K CA  1 
ATOM   5017 C CA  B SER K 1 72  ? 3.755   -51.669 34.717 0.55 15.66 ? 522  SER K CA  1 
ATOM   5018 C C   . SER K 1 72  ? 3.877   -50.405 35.557 1.00 16.30 ? 522  SER K C   1 
ATOM   5019 O O   . SER K 1 72  ? 4.220   -49.342 35.025 1.00 16.13 ? 522  SER K O   1 
ATOM   5020 C CB  A SER K 1 72  ? 2.335   -51.734 34.131 0.45 17.65 ? 522  SER K CB  1 
ATOM   5021 C CB  B SER K 1 72  ? 2.371   -51.748 34.072 0.55 17.42 ? 522  SER K CB  1 
ATOM   5022 O OG  A SER K 1 72  ? 2.169   -52.892 33.340 0.45 19.71 ? 522  SER K OG  1 
ATOM   5023 O OG  B SER K 1 72  ? 1.356   -51.885 35.052 0.55 17.67 ? 522  SER K OG  1 
ATOM   5024 N N   . ASN K 1 73  ? 3.595   -50.489 36.853 1.00 12.45 ? 523  ASN K N   1 
ATOM   5025 C CA  . ASN K 1 73  ? 3.672   -49.320 37.713 1.00 11.27 ? 523  ASN K CA  1 
ATOM   5026 C C   . ASN K 1 73  ? 4.122   -49.742 39.103 1.00 11.88 ? 523  ASN K C   1 
ATOM   5027 O O   . ASN K 1 73  ? 4.076   -50.918 39.472 1.00 13.87 ? 523  ASN K O   1 
ATOM   5028 C CB  . ASN K 1 73  ? 2.340   -48.557 37.753 1.00 14.89 ? 523  ASN K CB  1 
ATOM   5029 C CG  . ASN K 1 73  ? 1.188   -49.423 38.219 1.00 14.61 ? 523  ASN K CG  1 
ATOM   5030 O OD1 . ASN K 1 73  ? 1.167   -49.875 39.363 1.00 17.18 ? 523  ASN K OD1 1 
ATOM   5031 N ND2 . ASN K 1 73  ? 0.216   -49.649 37.339 1.00 16.73 ? 523  ASN K ND2 1 
ATOM   5032 N N   . ILE K 1 74  ? 4.552   -48.758 39.876 1.00 12.03 ? 524  ILE K N   1 
ATOM   5033 C CA  . ILE K 1 74  ? 5.092   -48.993 41.211 1.00 11.21 ? 524  ILE K CA  1 
ATOM   5034 C C   . ILE K 1 74  ? 4.035   -49.535 42.170 1.00 12.01 ? 524  ILE K C   1 
ATOM   5035 O O   . ILE K 1 74  ? 4.336   -50.468 42.932 1.00 13.53 ? 524  ILE K O   1 
ATOM   5036 C CB  . ILE K 1 74  ? 5.820   -47.742 41.734 1.00 12.41 ? 524  ILE K CB  1 
ATOM   5037 C CG1 . ILE K 1 74  ? 7.077   -47.494 40.890 1.00 12.10 ? 524  ILE K CG1 1 
ATOM   5038 C CG2 . ILE K 1 74  ? 6.158   -47.876 43.223 1.00 12.77 ? 524  ILE K CG2 1 
ATOM   5039 C CD1 . ILE K 1 74  ? 7.828   -46.244 41.258 1.00 12.24 ? 524  ILE K CD1 1 
ATOM   5040 N N   . PRO K 1 75  ? 2.796   -49.018 42.179 1.00 12.47 ? 525  PRO K N   1 
ATOM   5041 C CA  . PRO K 1 75  ? 1.795   -49.619 43.080 1.00 13.99 ? 525  PRO K CA  1 
ATOM   5042 C C   . PRO K 1 75  ? 1.612   -51.115 42.871 1.00 15.64 ? 525  PRO K C   1 
ATOM   5043 O O   . PRO K 1 75  ? 1.455   -51.850 43.854 1.00 17.07 ? 525  PRO K O   1 
ATOM   5044 C CB  . PRO K 1 75  ? 0.530   -48.801 42.795 1.00 14.36 ? 525  PRO K CB  1 
ATOM   5045 C CG  . PRO K 1 75  ? 1.065   -47.464 42.406 1.00 14.55 ? 525  PRO K CG  1 
ATOM   5046 C CD  . PRO K 1 75  ? 2.274   -47.779 41.566 1.00 12.25 ? 525  PRO K CD  1 
ATOM   5047 N N   . GLN K 1 76  ? 1.675   -51.592 41.620 1.00 15.62 ? 526  GLN K N   1 
ATOM   5048 C CA  A GLN K 1 76  ? 1.570   -53.026 41.376 0.61 14.57 ? 526  GLN K CA  1 
ATOM   5049 C CA  B GLN K 1 76  ? 1.572   -53.028 41.356 0.39 14.56 ? 526  GLN K CA  1 
ATOM   5050 C C   . GLN K 1 76  ? 2.742   -53.778 41.991 1.00 14.63 ? 526  GLN K C   1 
ATOM   5051 O O   . GLN K 1 76  ? 2.560   -54.842 42.596 1.00 17.81 ? 526  GLN K O   1 
ATOM   5052 C CB  A GLN K 1 76  ? 1.493   -53.309 39.881 0.61 17.84 ? 526  GLN K CB  1 
ATOM   5053 C CB  B GLN K 1 76  ? 1.551   -53.276 39.844 0.39 17.81 ? 526  GLN K CB  1 
ATOM   5054 C CG  A GLN K 1 76  ? 0.164   -52.985 39.239 0.61 20.91 ? 526  GLN K CG  1 
ATOM   5055 C CG  B GLN K 1 76  ? 0.244   -52.902 39.182 0.39 21.08 ? 526  GLN K CG  1 
ATOM   5056 C CD  A GLN K 1 76  ? 0.226   -53.102 37.734 0.61 22.86 ? 526  GLN K CD  1 
ATOM   5057 C CD  B GLN K 1 76  ? -0.938  -53.613 39.810 0.39 25.72 ? 526  GLN K CD  1 
ATOM   5058 O OE1 A GLN K 1 76  ? 1.286   -52.937 37.133 0.61 22.95 ? 526  GLN K OE1 1 
ATOM   5059 O OE1 B GLN K 1 76  ? -0.873  -54.804 40.101 0.39 31.95 ? 526  GLN K OE1 1 
ATOM   5060 N NE2 A GLN K 1 76  ? -0.911  -53.398 37.115 0.61 29.71 ? 526  GLN K NE2 1 
ATOM   5061 N NE2 B GLN K 1 76  ? -2.026  -52.879 40.033 0.39 32.10 ? 526  GLN K NE2 1 
ATOM   5062 N N   . LEU K 1 77  ? 3.956   -53.253 41.828 1.00 14.26 ? 527  LEU K N   1 
ATOM   5063 C CA  . LEU K 1 77  ? 5.140   -53.886 42.394 1.00 16.08 ? 527  LEU K CA  1 
ATOM   5064 C C   . LEU K 1 77  ? 5.062   -53.922 43.914 1.00 16.92 ? 527  LEU K C   1 
ATOM   5065 O O   . LEU K 1 77  ? 5.331   -54.956 44.537 1.00 18.03 ? 527  LEU K O   1 
ATOM   5066 C CB  . LEU K 1 77  ? 6.382   -53.119 41.936 1.00 15.36 ? 527  LEU K CB  1 
ATOM   5067 C CG  . LEU K 1 77  ? 7.709   -53.497 42.596 1.00 15.78 ? 527  LEU K CG  1 
ATOM   5068 C CD1 . LEU K 1 77  ? 8.116   -54.923 42.245 1.00 17.60 ? 527  LEU K CD1 1 
ATOM   5069 C CD2 . LEU K 1 77  ? 8.798   -52.511 42.199 1.00 17.60 ? 527  LEU K CD2 1 
ATOM   5070 N N   . ILE K 1 78  ? 4.699   -52.797 44.533 1.00 15.47 ? 528  ILE K N   1 
ATOM   5071 C CA  . ILE K 1 78  ? 4.621   -52.755 45.991 1.00 19.11 ? 528  ILE K CA  1 
ATOM   5072 C C   . ILE K 1 78  ? 3.517   -53.671 46.498 1.00 19.01 ? 528  ILE K C   1 
ATOM   5073 O O   . ILE K 1 78  ? 3.707   -54.413 47.470 1.00 19.10 ? 528  ILE K O   1 
ATOM   5074 C CB  . ILE K 1 78  ? 4.440   -51.310 46.486 1.00 15.99 ? 528  ILE K CB  1 
ATOM   5075 C CG1 . ILE K 1 78  ? 5.630   -50.446 46.068 1.00 16.60 ? 528  ILE K CG1 1 
ATOM   5076 C CG2 . ILE K 1 78  ? 4.262   -51.296 48.002 1.00 18.29 ? 528  ILE K CG2 1 
ATOM   5077 C CD1 . ILE K 1 78  ? 6.951   -50.881 46.665 1.00 17.99 ? 528  ILE K CD1 1 
ATOM   5078 N N   . ASP K 1 79  ? 2.349   -53.639 45.853 1.00 19.38 ? 529  ASP K N   1 
ATOM   5079 C CA  . ASP K 1 79  ? 1.247   -54.490 46.297 1.00 21.82 ? 529  ASP K CA  1 
ATOM   5080 C C   . ASP K 1 79  ? 1.589   -55.970 46.156 1.00 21.25 ? 529  ASP K C   1 
ATOM   5081 O O   . ASP K 1 79  ? 1.161   -56.790 46.975 1.00 22.45 ? 529  ASP K O   1 
ATOM   5082 C CB  . ASP K 1 79  ? -0.040  -54.147 45.547 1.00 25.87 ? 529  ASP K CB  1 
ATOM   5083 C CG  . ASP K 1 79  ? -1.278  -54.672 46.252 1.00 37.58 ? 529  ASP K CG  1 
ATOM   5084 O OD1 . ASP K 1 79  ? -1.406  -54.440 47.475 1.00 40.62 ? 529  ASP K OD1 1 
ATOM   5085 O OD2 . ASP K 1 79  ? -2.123  -55.309 45.589 1.00 38.69 ? 529  ASP K OD2 1 
ATOM   5086 N N   . HIS K 1 80  ? 2.354   -56.333 45.124 1.00 19.79 ? 530  HIS K N   1 
ATOM   5087 C CA  . HIS K 1 80  ? 2.812   -57.714 44.990 1.00 19.32 ? 530  HIS K CA  1 
ATOM   5088 C C   . HIS K 1 80  ? 3.627   -58.143 46.206 1.00 20.82 ? 530  HIS K C   1 
ATOM   5089 O O   . HIS K 1 80  ? 3.405   -59.219 46.771 1.00 21.32 ? 530  HIS K O   1 
ATOM   5090 C CB  . HIS K 1 80  ? 3.635   -57.875 43.711 1.00 22.05 ? 530  HIS K CB  1 
ATOM   5091 C CG  . HIS K 1 80  ? 4.486   -59.107 43.700 1.00 23.56 ? 530  HIS K CG  1 
ATOM   5092 N ND1 . HIS K 1 80  ? 3.960   -60.373 43.558 1.00 27.86 ? 530  HIS K ND1 1 
ATOM   5093 C CD2 . HIS K 1 80  ? 5.823   -59.267 43.837 1.00 22.25 ? 530  HIS K CD2 1 
ATOM   5094 C CE1 . HIS K 1 80  ? 4.939   -61.260 43.600 1.00 27.15 ? 530  HIS K CE1 1 
ATOM   5095 N NE2 . HIS K 1 80  ? 6.079   -60.615 43.771 1.00 28.43 ? 530  HIS K NE2 1 
ATOM   5096 N N   . HIS K 1 81  ? 4.574   -57.303 46.631 1.00 17.99 ? 531  HIS K N   1 
ATOM   5097 C CA  . HIS K 1 81  ? 5.414   -57.655 47.771 1.00 19.78 ? 531  HIS K CA  1 
ATOM   5098 C C   . HIS K 1 81  ? 4.639   -57.581 49.081 1.00 19.17 ? 531  HIS K C   1 
ATOM   5099 O O   . HIS K 1 81  ? 4.865   -58.389 49.993 1.00 20.20 ? 531  HIS K O   1 
ATOM   5100 C CB  . HIS K 1 81  ? 6.653   -56.758 47.801 1.00 19.41 ? 531  HIS K CB  1 
ATOM   5101 C CG  . HIS K 1 81  ? 7.691   -57.148 46.796 1.00 19.24 ? 531  HIS K CG  1 
ATOM   5102 N ND1 . HIS K 1 81  ? 8.533   -58.222 46.986 1.00 20.31 ? 531  HIS K ND1 1 
ATOM   5103 C CD2 . HIS K 1 81  ? 8.000   -56.636 45.582 1.00 17.29 ? 531  HIS K CD2 1 
ATOM   5104 C CE1 . HIS K 1 81  ? 9.327   -58.347 45.937 1.00 19.15 ? 531  HIS K CE1 1 
ATOM   5105 N NE2 . HIS K 1 81  ? 9.022   -57.399 45.069 1.00 19.80 ? 531  HIS K NE2 1 
ATOM   5106 N N   . TYR K 1 82  ? 3.711   -56.629 49.186 1.00 19.47 ? 532  TYR K N   1 
ATOM   5107 C CA  . TYR K 1 82  ? 2.933   -56.484 50.409 1.00 19.29 ? 532  TYR K CA  1 
ATOM   5108 C C   . TYR K 1 82  ? 1.983   -57.657 50.611 1.00 22.44 ? 532  TYR K C   1 
ATOM   5109 O O   . TYR K 1 82  ? 1.803   -58.126 51.739 1.00 23.73 ? 532  TYR K O   1 
ATOM   5110 C CB  . TYR K 1 82  ? 2.168   -55.163 50.374 1.00 23.25 ? 532  TYR K CB  1 
ATOM   5111 C CG  . TYR K 1 82  ? 1.334   -54.912 51.604 1.00 23.50 ? 532  TYR K CG  1 
ATOM   5112 C CD1 . TYR K 1 82  ? 1.931   -54.738 52.844 1.00 21.17 ? 532  TYR K CD1 1 
ATOM   5113 C CD2 . TYR K 1 82  ? -0.050  -54.834 51.523 1.00 28.12 ? 532  TYR K CD2 1 
ATOM   5114 C CE1 . TYR K 1 82  ? 1.173   -54.502 53.970 1.00 24.62 ? 532  TYR K CE1 1 
ATOM   5115 C CE2 . TYR K 1 82  ? -0.817  -54.598 52.645 1.00 29.63 ? 532  TYR K CE2 1 
ATOM   5116 C CZ  . TYR K 1 82  ? -0.199  -54.432 53.866 1.00 30.32 ? 532  TYR K CZ  1 
ATOM   5117 O OH  . TYR K 1 82  ? -0.955  -54.197 54.990 1.00 35.36 ? 532  TYR K OH  1 
ATOM   5118 N N   . THR K 1 83  ? 1.370   -58.149 49.534 1.00 24.35 ? 533  THR K N   1 
ATOM   5119 C CA  . THR K 1 83  ? 0.396   -59.225 49.680 1.00 25.76 ? 533  THR K CA  1 
ATOM   5120 C C   . THR K 1 83  ? 1.067   -60.588 49.797 1.00 24.65 ? 533  THR K C   1 
ATOM   5121 O O   . THR K 1 83  ? 0.673   -61.403 50.639 1.00 28.37 ? 533  THR K O   1 
ATOM   5122 C CB  . THR K 1 83  ? -0.599  -59.212 48.517 1.00 30.31 ? 533  THR K CB  1 
ATOM   5123 O OG1 . THR K 1 83  ? 0.112   -59.290 47.277 1.00 34.30 ? 533  THR K OG1 1 
ATOM   5124 C CG2 . THR K 1 83  ? -1.435  -57.943 48.536 1.00 27.31 ? 533  THR K CG2 1 
ATOM   5125 N N   . THR K 1 84  ? 2.075   -60.860 48.966 1.00 23.17 ? 534  THR K N   1 
ATOM   5126 C CA  . THR K 1 84  ? 2.696   -62.179 48.951 1.00 24.67 ? 534  THR K CA  1 
ATOM   5127 C C   . THR K 1 84  ? 3.757   -62.360 50.024 1.00 25.32 ? 534  THR K C   1 
ATOM   5128 O O   . THR K 1 84  ? 4.102   -63.505 50.339 1.00 26.17 ? 534  THR K O   1 
ATOM   5129 C CB  . THR K 1 84  ? 3.363   -62.458 47.601 1.00 28.35 ? 534  THR K CB  1 
ATOM   5130 O OG1 . THR K 1 84  ? 4.459   -61.552 47.418 1.00 26.35 ? 534  THR K OG1 1 
ATOM   5131 C CG2 . THR K 1 84  ? 2.373   -62.307 46.457 1.00 27.55 ? 534  THR K CG2 1 
ATOM   5132 N N   . LYS K 1 85  ? 4.290   -61.273 50.576 1.00 24.16 ? 535  LYS K N   1 
ATOM   5133 C CA  . LYS K 1 85  ? 5.404   -61.292 51.518 1.00 22.47 ? 535  LYS K CA  1 
ATOM   5134 C C   . LYS K 1 85  ? 6.689   -61.830 50.902 1.00 23.86 ? 535  LYS K C   1 
ATOM   5135 O O   . LYS K 1 85  ? 7.618   -62.194 51.633 1.00 27.32 ? 535  LYS K O   1 
ATOM   5136 C CB  . LYS K 1 85  ? 5.069   -62.009 52.837 1.00 25.39 ? 535  LYS K CB  1 
ATOM   5137 C CG  . LYS K 1 85  ? 3.822   -61.482 53.532 1.00 24.60 ? 535  LYS K CG  1 
ATOM   5138 C CD  . LYS K 1 85  ? 3.862   -59.968 53.657 1.00 24.80 ? 535  LYS K CD  1 
ATOM   5139 C CE  . LYS K 1 85  ? 2.681   -59.439 54.457 1.00 25.22 ? 535  LYS K CE  1 
ATOM   5140 N NZ  . LYS K 1 85  ? 2.684   -57.947 54.511 1.00 23.16 ? 535  LYS K NZ  1 
ATOM   5141 N N   . GLN K 1 86  ? 6.766   -61.887 49.574 1.00 24.44 ? 536  GLN K N   1 
ATOM   5142 C CA  . GLN K 1 86  ? 8.002   -62.280 48.917 1.00 25.74 ? 536  GLN K CA  1 
ATOM   5143 C C   . GLN K 1 86  ? 9.081   -61.239 49.178 1.00 21.91 ? 536  GLN K C   1 
ATOM   5144 O O   . GLN K 1 86  ? 8.809   -60.033 49.228 1.00 21.53 ? 536  GLN K O   1 
ATOM   5145 C CB  . GLN K 1 86  ? 7.762   -62.451 47.417 1.00 25.14 ? 536  GLN K CB  1 
ATOM   5146 C CG  . GLN K 1 86  ? 6.917   -63.686 47.093 1.00 28.91 ? 536  GLN K CG  1 
ATOM   5147 C CD  . GLN K 1 86  ? 6.609   -63.839 45.613 1.00 36.00 ? 536  GLN K CD  1 
ATOM   5148 O OE1 . GLN K 1 86  ? 7.338   -63.340 44.755 1.00 35.91 ? 536  GLN K OE1 1 
ATOM   5149 N NE2 . GLN K 1 86  ? 5.521   -64.541 45.309 1.00 38.90 ? 536  GLN K NE2 1 
ATOM   5150 N N   . VAL K 1 87  ? 10.319  -61.708 49.349 1.00 22.22 ? 537  VAL K N   1 
ATOM   5151 C CA  . VAL K 1 87  ? 11.398  -60.811 49.737 1.00 20.92 ? 537  VAL K CA  1 
ATOM   5152 C C   . VAL K 1 87  ? 11.682  -59.796 48.631 1.00 22.73 ? 537  VAL K C   1 
ATOM   5153 O O   . VAL K 1 87  ? 11.502  -60.068 47.437 1.00 22.55 ? 537  VAL K O   1 
ATOM   5154 C CB  . VAL K 1 87  ? 12.666  -61.598 50.108 1.00 22.35 ? 537  VAL K CB  1 
ATOM   5155 C CG1 . VAL K 1 87  ? 12.407  -62.475 51.323 1.00 27.23 ? 537  VAL K CG1 1 
ATOM   5156 C CG2 . VAL K 1 87  ? 13.138  -62.443 48.928 1.00 25.82 ? 537  VAL K CG2 1 
ATOM   5157 N N   . ILE K 1 88  ? 12.117  -58.601 49.042 1.00 19.42 ? 538  ILE K N   1 
ATOM   5158 C CA  . ILE K 1 88  ? 12.472  -57.556 48.080 1.00 17.81 ? 538  ILE K CA  1 
ATOM   5159 C C   . ILE K 1 88  ? 13.629  -58.017 47.204 1.00 18.68 ? 538  ILE K C   1 
ATOM   5160 O O   . ILE K 1 88  ? 13.597  -57.881 45.976 1.00 19.18 ? 538  ILE K O   1 
ATOM   5161 C CB  . ILE K 1 88  ? 12.793  -56.235 48.804 1.00 17.44 ? 538  ILE K CB  1 
ATOM   5162 C CG1 . ILE K 1 88  ? 11.589  -55.766 49.621 1.00 21.50 ? 538  ILE K CG1 1 
ATOM   5163 C CG2 . ILE K 1 88  ? 13.206  -55.155 47.805 1.00 20.66 ? 538  ILE K CG2 1 
ATOM   5164 C CD1 . ILE K 1 88  ? 10.347  -55.534 48.804 1.00 20.44 ? 538  ILE K CD1 1 
ATOM   5165 N N   . THR K 1 89  ? 14.676  -58.557 47.829 1.00 21.48 ? 539  THR K N   1 
ATOM   5166 C CA  . THR K 1 89  ? 15.784  -59.190 47.132 1.00 23.70 ? 539  THR K CA  1 
ATOM   5167 C C   . THR K 1 89  ? 16.206  -60.402 47.946 1.00 24.55 ? 539  THR K C   1 
ATOM   5168 O O   . THR K 1 89  ? 16.030  -60.434 49.167 1.00 23.33 ? 539  THR K O   1 
ATOM   5169 C CB  . THR K 1 89  ? 17.003  -58.256 46.963 1.00 26.46 ? 539  THR K CB  1 
ATOM   5170 O OG1 . THR K 1 89  ? 17.566  -57.955 48.245 1.00 25.66 ? 539  THR K OG1 1 
ATOM   5171 C CG2 . THR K 1 89  ? 16.629  -56.948 46.255 1.00 25.85 ? 539  THR K CG2 1 
ATOM   5172 N N   . LYS K 1 90  ? 16.750  -61.408 47.257 1.00 27.08 ? 540  LYS K N   1 
ATOM   5173 C CA  . LYS K 1 90  ? 17.261  -62.586 47.954 1.00 29.48 ? 540  LYS K CA  1 
ATOM   5174 C C   . LYS K 1 90  ? 18.352  -62.204 48.945 1.00 29.52 ? 540  LYS K C   1 
ATOM   5175 O O   . LYS K 1 90  ? 18.380  -62.703 50.075 1.00 31.82 ? 540  LYS K O   1 
ATOM   5176 C CB  . LYS K 1 90  ? 17.801  -63.601 46.945 1.00 37.51 ? 540  LYS K CB  1 
ATOM   5177 C CG  . LYS K 1 90  ? 16.743  -64.311 46.123 1.00 44.82 ? 540  LYS K CG  1 
ATOM   5178 C CD  . LYS K 1 90  ? 17.376  -65.140 45.014 1.00 54.45 ? 540  LYS K CD  1 
ATOM   5179 C CE  . LYS K 1 90  ? 16.320  -65.717 44.086 1.00 57.41 ? 540  LYS K CE  1 
ATOM   5180 N NZ  . LYS K 1 90  ? 16.911  -66.624 43.064 1.00 61.70 ? 540  LYS K NZ  1 
ATOM   5181 N N   . LYS K 1 91  ? 19.247  -61.302 48.541 1.00 28.45 ? 541  LYS K N   1 
ATOM   5182 C CA  . LYS K 1 91  ? 20.367  -60.918 49.391 1.00 30.20 ? 541  LYS K CA  1 
ATOM   5183 C C   . LYS K 1 91  ? 19.892  -60.230 50.666 1.00 28.92 ? 541  LYS K C   1 
ATOM   5184 O O   . LYS K 1 91  ? 20.440  -60.468 51.749 1.00 31.65 ? 541  LYS K O   1 
ATOM   5185 C CB  . LYS K 1 91  ? 21.302  -60.008 48.594 1.00 34.38 ? 541  LYS K CB  1 
ATOM   5186 C CG  . LYS K 1 91  ? 22.514  -59.483 49.332 1.00 38.98 ? 541  LYS K CG  1 
ATOM   5187 C CD  . LYS K 1 91  ? 23.318  -58.577 48.407 1.00 42.73 ? 541  LYS K CD  1 
ATOM   5188 C CE  . LYS K 1 91  ? 24.509  -57.953 49.109 1.00 46.54 ? 541  LYS K CE  1 
ATOM   5189 N NZ  . LYS K 1 91  ? 25.301  -57.099 48.180 1.00 48.58 ? 541  LYS K NZ  1 
ATOM   5190 N N   . SER K 1 92  ? 18.865  -59.381 50.562 1.00 24.87 ? 542  SER K N   1 
ATOM   5191 C CA  . SER K 1 92  ? 18.419  -58.617 51.723 1.00 23.73 ? 542  SER K CA  1 
ATOM   5192 C C   . SER K 1 92  ? 17.412  -59.379 52.577 1.00 23.29 ? 542  SER K C   1 
ATOM   5193 O O   . SER K 1 92  ? 17.375  -59.182 53.797 1.00 27.47 ? 542  SER K O   1 
ATOM   5194 C CB  . SER K 1 92  ? 17.814  -57.281 51.283 1.00 25.69 ? 542  SER K CB  1 
ATOM   5195 O OG  . SER K 1 92  ? 16.541  -57.472 50.688 1.00 21.28 ? 542  SER K OG  1 
ATOM   5196 N N   . GLY K 1 93  ? 16.584  -60.227 51.966 1.00 22.18 ? 543  GLY K N   1 
ATOM   5197 C CA  . GLY K 1 93  ? 15.540  -60.919 52.701 1.00 24.43 ? 543  GLY K CA  1 
ATOM   5198 C C   . GLY K 1 93  ? 14.468  -60.024 53.284 1.00 22.99 ? 543  GLY K C   1 
ATOM   5199 O O   . GLY K 1 93  ? 13.717  -60.457 54.160 1.00 25.42 ? 543  GLY K O   1 
ATOM   5200 N N   . VAL K 1 94  ? 14.363  -58.782 52.809 1.00 20.23 ? 544  VAL K N   1 
ATOM   5201 C CA  . VAL K 1 94  ? 13.446  -57.815 53.402 1.00 20.97 ? 544  VAL K CA  1 
ATOM   5202 C C   . VAL K 1 94  ? 12.006  -58.133 53.016 1.00 18.95 ? 544  VAL K C   1 
ATOM   5203 O O   . VAL K 1 94  ? 11.700  -58.421 51.849 1.00 19.44 ? 544  VAL K O   1 
ATOM   5204 C CB  . VAL K 1 94  ? 13.844  -56.393 52.973 1.00 19.99 ? 544  VAL K CB  1 
ATOM   5205 C CG1 . VAL K 1 94  ? 12.726  -55.404 53.274 1.00 22.53 ? 544  VAL K CG1 1 
ATOM   5206 C CG2 . VAL K 1 94  ? 15.134  -55.985 53.664 1.00 20.77 ? 544  VAL K CG2 1 
ATOM   5207 N N   . VAL K 1 95  ? 11.105  -58.045 53.996 1.00 19.64 ? 545  VAL K N   1 
ATOM   5208 C CA  . VAL K 1 95  ? 9.681   -58.307 53.818 1.00 18.52 ? 545  VAL K CA  1 
ATOM   5209 C C   . VAL K 1 95  ? 8.894   -57.065 54.226 1.00 19.23 ? 545  VAL K C   1 
ATOM   5210 O O   . VAL K 1 95  ? 9.131   -56.497 55.298 1.00 20.72 ? 545  VAL K O   1 
ATOM   5211 C CB  . VAL K 1 95  ? 9.232   -59.538 54.627 1.00 20.37 ? 545  VAL K CB  1 
ATOM   5212 C CG1 . VAL K 1 95  ? 7.719   -59.692 54.573 1.00 19.53 ? 545  VAL K CG1 1 
ATOM   5213 C CG2 . VAL K 1 95  ? 9.927   -60.791 54.107 1.00 22.65 ? 545  VAL K CG2 1 
ATOM   5214 N N   . LEU K 1 96  ? 7.949   -56.653 53.378 1.00 17.52 ? 546  LEU K N   1 
ATOM   5215 C CA  . LEU K 1 96  ? 7.133   -55.477 53.660 1.00 17.90 ? 546  LEU K CA  1 
ATOM   5216 C C   . LEU K 1 96  ? 5.971   -55.848 54.573 1.00 18.93 ? 546  LEU K C   1 
ATOM   5217 O O   . LEU K 1 96  ? 5.191   -56.753 54.259 1.00 21.60 ? 546  LEU K O   1 
ATOM   5218 C CB  . LEU K 1 96  ? 6.583   -54.906 52.357 1.00 17.08 ? 546  LEU K CB  1 
ATOM   5219 C CG  . LEU K 1 96  ? 7.592   -54.540 51.271 1.00 17.10 ? 546  LEU K CG  1 
ATOM   5220 C CD1 . LEU K 1 96  ? 6.902   -53.785 50.140 1.00 17.32 ? 546  LEU K CD1 1 
ATOM   5221 C CD2 . LEU K 1 96  ? 8.728   -53.717 51.863 1.00 16.97 ? 546  LEU K CD2 1 
ATOM   5222 N N   . LEU K 1 97  ? 5.839   -55.133 55.692 1.00 17.58 ? 547  LEU K N   1 
ATOM   5223 C CA  . LEU K 1 97  ? 4.791   -55.418 56.667 1.00 19.82 ? 547  LEU K CA  1 
ATOM   5224 C C   . LEU K 1 97  ? 3.845   -54.257 56.930 1.00 23.12 ? 547  LEU K C   1 
ATOM   5225 O O   . LEU K 1 97  ? 2.631   -54.467 56.976 1.00 23.66 ? 547  LEU K O   1 
ATOM   5226 C CB  . LEU K 1 97  ? 5.392   -55.900 57.996 1.00 20.25 ? 547  LEU K CB  1 
ATOM   5227 C CG  . LEU K 1 97  ? 6.132   -57.239 57.966 1.00 21.89 ? 547  LEU K CG  1 
ATOM   5228 C CD1 . LEU K 1 97  ? 6.540   -57.637 59.369 1.00 21.47 ? 547  LEU K CD1 1 
ATOM   5229 C CD2 . LEU K 1 97  ? 5.281   -58.326 57.322 1.00 22.09 ? 547  LEU K CD2 1 
ATOM   5230 N N   . ASN K 1 98  ? 4.354   -53.041 57.102 1.00 19.12 ? 548  ASN K N   1 
ATOM   5231 C CA  . ASN K 1 98  ? 3.546   -51.918 57.578 1.00 18.52 ? 548  ASN K CA  1 
ATOM   5232 C C   . ASN K 1 98  ? 3.739   -50.702 56.684 1.00 16.51 ? 548  ASN K C   1 
ATOM   5233 O O   . ASN K 1 98  ? 4.794   -50.040 56.769 1.00 18.34 ? 548  ASN K O   1 
ATOM   5234 C CB  . ASN K 1 98  ? 3.926   -51.557 59.012 1.00 19.82 ? 548  ASN K CB  1 
ATOM   5235 C CG  . ASN K 1 98  ? 4.109   -52.776 59.891 1.00 25.38 ? 548  ASN K CG  1 
ATOM   5236 O OD1 . ASN K 1 98  ? 3.207   -53.599 60.025 1.00 25.92 ? 548  ASN K OD1 1 
ATOM   5237 N ND2 . ASN K 1 98  ? 5.289   -52.904 60.483 1.00 26.23 ? 548  ASN K ND2 1 
ATOM   5238 N N   . PRO K 1 99  ? 2.769   -50.356 55.839 1.00 19.46 ? 549  PRO K N   1 
ATOM   5239 C CA  . PRO K 1 99  ? 2.888   -49.116 55.058 1.00 18.94 ? 549  PRO K CA  1 
ATOM   5240 C C   . PRO K 1 99  ? 2.756   -47.898 55.964 1.00 18.31 ? 549  PRO K C   1 
ATOM   5241 O O   . PRO K 1 99  ? 1.780   -47.761 56.703 1.00 22.61 ? 549  PRO K O   1 
ATOM   5242 C CB  . PRO K 1 99  ? 1.725   -49.204 54.063 1.00 19.10 ? 549  PRO K CB  1 
ATOM   5243 C CG  . PRO K 1 99  ? 0.738   -50.130 54.708 1.00 23.46 ? 549  PRO K CG  1 
ATOM   5244 C CD  . PRO K 1 99  ? 1.541   -51.106 55.521 1.00 21.93 ? 549  PRO K CD  1 
ATOM   5245 N N   . ILE K 1 100 ? 3.741   -47.008 55.894 1.00 16.84 ? 550  ILE K N   1 
ATOM   5246 C CA  . ILE K 1 100 ? 3.782   -45.819 56.742 1.00 17.30 ? 550  ILE K CA  1 
ATOM   5247 C C   . ILE K 1 100 ? 3.125   -44.671 55.981 1.00 17.74 ? 550  ILE K C   1 
ATOM   5248 O O   . ILE K 1 100 ? 3.579   -44.337 54.881 1.00 17.98 ? 550  ILE K O   1 
ATOM   5249 C CB  . ILE K 1 100 ? 5.221   -45.462 57.133 1.00 17.64 ? 550  ILE K CB  1 
ATOM   5250 C CG1 . ILE K 1 100 ? 5.860   -46.615 57.910 1.00 20.71 ? 550  ILE K CG1 1 
ATOM   5251 C CG2 . ILE K 1 100 ? 5.246   -44.176 57.953 1.00 18.44 ? 550  ILE K CG2 1 
ATOM   5252 C CD1 . ILE K 1 100 ? 5.053   -47.062 59.108 1.00 22.86 ? 550  ILE K CD1 1 
ATOM   5253 N N   . PRO K 1 101 ? 2.083   -44.050 56.519 1.00 20.16 ? 551  PRO K N   1 
ATOM   5254 C CA  . PRO K 1 101 ? 1.422   -42.948 55.819 1.00 20.17 ? 551  PRO K CA  1 
ATOM   5255 C C   . PRO K 1 101 ? 2.090   -41.608 56.109 1.00 21.57 ? 551  PRO K C   1 
ATOM   5256 O O   . PRO K 1 101 ? 2.961   -41.483 56.972 1.00 22.11 ? 551  PRO K O   1 
ATOM   5257 C CB  . PRO K 1 101 ? 0.013   -42.978 56.423 1.00 23.01 ? 551  PRO K CB  1 
ATOM   5258 C CG  . PRO K 1 101 ? 0.240   -43.425 57.823 1.00 20.72 ? 551  PRO K CG  1 
ATOM   5259 C CD  . PRO K 1 101 ? 1.399   -44.397 57.777 1.00 21.39 ? 551  PRO K CD  1 
ATOM   5260 N N   . LYS K 1 102 ? 1.666   -40.598 55.354 1.00 22.82 ? 552  LYS K N   1 
ATOM   5261 C CA  . LYS K 1 102 ? 2.190   -39.245 55.520 1.00 28.11 ? 552  LYS K CA  1 
ATOM   5262 C C   . LYS K 1 102 ? 1.588   -38.548 56.737 1.00 30.78 ? 552  LYS K C   1 
ATOM   5263 O O   . LYS K 1 102 ? 0.558   -38.969 57.268 1.00 30.88 ? 552  LYS K O   1 
ATOM   5264 C CB  . LYS K 1 102 ? 1.928   -38.415 54.262 1.00 31.11 ? 552  LYS K CB  1 
ATOM   5265 C CG  . LYS K 1 102 ? 2.713   -38.876 53.044 1.00 34.64 ? 552  LYS K CG  1 
ATOM   5266 C CD  . LYS K 1 102 ? 2.287   -38.135 51.783 1.00 39.80 ? 552  LYS K CD  1 
ATOM   5267 C CE  . LYS K 1 102 ? 2.219   -36.632 52.008 1.00 46.62 ? 552  LYS K CE  1 
ATOM   5268 N NZ  . LYS K 1 102 ? 2.550   -35.877 50.767 1.00 50.25 ? 552  LYS K NZ  1 
ATOM   5269 O OXT . LYS K 1 102 ? 2.120   -37.545 57.217 1.00 33.41 ? 552  LYS K OXT 1 
ATOM   5270 N N   . ASP L 2 1   ? 25.394  -41.505 49.806 1.00 28.49 ? 1    ASP L N   1 
ATOM   5271 C CA  . ASP L 2 1   ? 24.734  -42.442 50.706 1.00 24.51 ? 1    ASP L CA  1 
ATOM   5272 C C   . ASP L 2 1   ? 24.492  -43.772 50.001 1.00 23.63 ? 1    ASP L C   1 
ATOM   5273 O O   . ASP L 2 1   ? 24.359  -43.827 48.780 1.00 24.61 ? 1    ASP L O   1 
ATOM   5274 C CB  . ASP L 2 1   ? 23.410  -41.865 51.200 1.00 18.89 ? 1    ASP L CB  1 
ATOM   5275 C CG  . ASP L 2 1   ? 23.594  -40.644 52.071 1.00 20.66 ? 1    ASP L CG  1 
ATOM   5276 O OD1 . ASP L 2 1   ? 24.750  -40.338 52.444 1.00 23.55 ? 1    ASP L OD1 1 
ATOM   5277 O OD2 . ASP L 2 1   ? 22.579  -39.993 52.384 1.00 18.56 ? 1    ASP L OD2 1 
ATOM   5278 N N   . GLU L 2 2   ? 24.422  -44.842 50.782 1.00 23.58 ? 2    GLU L N   1 
ATOM   5279 C CA  . GLU L 2 2   ? 24.291  -46.179 50.214 1.00 24.86 ? 2    GLU L CA  1 
ATOM   5280 C C   . GLU L 2 2   ? 22.861  -46.567 49.870 1.00 19.68 ? 2    GLU L C   1 
ATOM   5281 O O   . GLU L 2 2   ? 21.938  -46.340 50.651 1.00 19.28 ? 2    GLU L O   1 
ATOM   5282 C CB  . GLU L 2 2   ? 24.891  -47.226 51.158 1.00 35.32 ? 2    GLU L CB  1 
ATOM   5283 C CG  . GLU L 2 2   ? 26.395  -47.323 51.056 1.00 47.23 ? 2    GLU L CG  1 
ATOM   5284 C CD  . GLU L 2 2   ? 26.860  -47.436 49.619 1.00 56.25 ? 2    GLU L CD  1 
ATOM   5285 O OE1 . GLU L 2 2   ? 26.521  -48.441 48.959 1.00 59.42 ? 2    GLU L OE1 1 
ATOM   5286 O OE2 . GLU L 2 2   ? 27.546  -46.507 49.143 1.00 58.83 ? 2    GLU L OE2 1 
HETATM 5287 N N   . PTR L 2 3   ? 22.698  -47.163 48.694 1.00 18.95 ? 3    PTR L N   1 
HETATM 5288 C CA  . PTR L 2 3   ? 21.472  -47.867 48.348 1.00 19.04 ? 3    PTR L CA  1 
HETATM 5289 C C   . PTR L 2 3   ? 21.786  -49.362 48.386 1.00 21.82 ? 3    PTR L C   1 
HETATM 5290 O O   . PTR L 2 3   ? 22.851  -49.791 47.933 1.00 21.98 ? 3    PTR L O   1 
HETATM 5291 C CB  . PTR L 2 3   ? 20.888  -47.397 47.012 1.00 16.23 ? 3    PTR L CB  1 
HETATM 5292 C CG  . PTR L 2 3   ? 20.261  -46.010 47.070 1.00 13.55 ? 3    PTR L CG  1 
HETATM 5293 C CD1 . PTR L 2 3   ? 19.008  -45.812 47.637 1.00 12.76 ? 3    PTR L CD1 1 
HETATM 5294 C CD2 . PTR L 2 3   ? 20.922  -44.901 46.554 1.00 16.83 ? 3    PTR L CD2 1 
HETATM 5295 C CE1 . PTR L 2 3   ? 18.432  -44.549 47.694 1.00 12.18 ? 3    PTR L CE1 1 
HETATM 5296 C CE2 . PTR L 2 3   ? 20.351  -43.636 46.604 1.00 15.49 ? 3    PTR L CE2 1 
HETATM 5297 C CZ  . PTR L 2 3   ? 19.108  -43.462 47.182 1.00 14.43 ? 3    PTR L CZ  1 
HETATM 5298 O OH  . PTR L 2 3   ? 18.546  -42.266 47.221 1.00 11.67 ? 3    PTR L OH  1 
HETATM 5299 P P   . PTR L 2 3   ? 18.785  -41.208 48.422 1.00 12.18 ? 3    PTR L P   1 
HETATM 5300 O O1P . PTR L 2 3   ? 17.793  -40.074 48.115 1.00 13.01 ? 3    PTR L O1P 1 
HETATM 5301 O O2P . PTR L 2 3   ? 18.479  -41.901 49.703 1.00 12.96 ? 3    PTR L O2P 1 
HETATM 5302 O O3P . PTR L 2 3   ? 20.234  -40.746 48.326 1.00 14.26 ? 3    PTR L O3P 1 
ATOM   5303 N N   . GLU L 2 4   ? 20.866  -50.140 48.949 1.00 24.41 ? 4    GLU L N   1 
ATOM   5304 C CA  . GLU L 2 4   ? 21.102  -51.556 49.218 1.00 33.69 ? 4    GLU L CA  1 
ATOM   5305 C C   . GLU L 2 4   ? 21.424  -52.353 47.966 1.00 35.79 ? 4    GLU L C   1 
ATOM   5306 O O   . GLU L 2 4   ? 22.334  -53.184 47.962 1.00 37.32 ? 4    GLU L O   1 
ATOM   5307 C CB  . GLU L 2 4   ? 19.890  -52.173 49.916 1.00 40.41 ? 4    GLU L CB  1 
ATOM   5308 C CG  . GLU L 2 4   ? 20.037  -52.291 51.418 1.00 51.54 ? 4    GLU L CG  1 
ATOM   5309 C CD  . GLU L 2 4   ? 21.379  -52.867 51.821 1.00 64.18 ? 4    GLU L CD  1 
ATOM   5310 O OE1 . GLU L 2 4   ? 22.124  -52.180 52.551 1.00 68.74 ? 4    GLU L OE1 1 
ATOM   5311 O OE2 . GLU L 2 4   ? 21.694  -54.001 51.400 1.00 68.27 ? 4    GLU L OE2 1 
ATOM   5312 N N   . ASN L 2 5   ? 20.669  -52.097 46.900 1.00 32.62 ? 5    ASN L N   1 
ATOM   5313 C CA  . ASN L 2 5   ? 20.779  -52.856 45.663 1.00 34.10 ? 5    ASN L CA  1 
ATOM   5314 C C   . ASN L 2 5   ? 21.635  -52.157 44.612 1.00 41.50 ? 5    ASN L C   1 
ATOM   5315 O O   . ASN L 2 5   ? 21.497  -52.445 43.418 1.00 45.23 ? 5    ASN L O   1 
ATOM   5316 C CB  . ASN L 2 5   ? 19.391  -53.191 45.117 1.00 33.15 ? 5    ASN L CB  1 
ATOM   5317 C CG  . ASN L 2 5   ? 18.494  -51.970 45.015 1.00 31.43 ? 5    ASN L CG  1 
ATOM   5318 O OD1 . ASN L 2 5   ? 18.780  -50.915 45.596 1.00 21.15 ? 5    ASN L OD1 1 
ATOM   5319 N ND2 . ASN L 2 5   ? 17.397  -52.109 44.281 1.00 31.87 ? 5    ASN L ND2 1 
ATOM   5320 N N   . VAL L 2 6   ? 22.504  -51.239 45.027 1.00 45.27 ? 6    VAL L N   1 
ATOM   5321 C CA  . VAL L 2 6   ? 23.464  -50.623 44.115 1.00 48.17 ? 6    VAL L CA  1 
ATOM   5322 C C   . VAL L 2 6   ? 24.865  -50.672 44.718 1.00 47.51 ? 6    VAL L C   1 
ATOM   5323 O O   . VAL L 2 6   ? 25.060  -50.342 45.890 1.00 46.18 ? 6    VAL L O   1 
ATOM   5324 C CB  . VAL L 2 6   ? 23.073  -49.179 43.729 1.00 52.11 ? 6    VAL L CB  1 
ATOM   5325 C CG1 . VAL L 2 6   ? 23.940  -48.694 42.576 1.00 54.47 ? 6    VAL L CG1 1 
ATOM   5326 C CG2 . VAL L 2 6   ? 21.595  -49.088 43.368 1.00 52.36 ? 6    VAL L CG2 1 
HETATM 5327 O O   . HOH M 3 .   ? 5.223   11.593  27.239 1.00 33.03 ? 601  HOH A O   1 
HETATM 5328 O O   . HOH M 3 .   ? 0.257   10.742  24.581 1.00 31.27 ? 602  HOH A O   1 
HETATM 5329 O O   . HOH M 3 .   ? -3.056  -1.106  5.780  1.00 42.56 ? 603  HOH A O   1 
HETATM 5330 O O   . HOH M 3 .   ? -4.264  -2.699  31.598 1.00 36.52 ? 604  HOH A O   1 
HETATM 5331 O O   . HOH M 3 .   ? -11.921 -7.449  20.864 1.00 35.10 ? 605  HOH A O   1 
HETATM 5332 O O   . HOH M 3 .   ? 7.231   -4.154  6.012  1.00 26.54 ? 606  HOH A O   1 
HETATM 5333 O O   . HOH M 3 .   ? 2.388   11.845  5.362  1.00 32.51 ? 607  HOH A O   1 
HETATM 5334 O O   . HOH M 3 .   ? -3.580  -11.369 32.294 1.00 43.57 ? 608  HOH A O   1 
HETATM 5335 O O   . HOH M 3 .   ? -11.345 -8.716  19.215 1.00 32.06 ? 609  HOH A O   1 
HETATM 5336 O O   . HOH M 3 .   ? -10.940 9.324   15.451 1.00 25.76 ? 610  HOH A O   1 
HETATM 5337 O O   . HOH M 3 .   ? 5.167   9.288   5.032  1.00 44.24 ? 611  HOH A O   1 
HETATM 5338 O O   . HOH M 3 .   ? 6.415   4.333   27.056 1.00 16.55 ? 612  HOH A O   1 
HETATM 5339 O O   . HOH M 3 .   ? 5.084   -11.421 -0.270 1.00 40.28 ? 613  HOH A O   1 
HETATM 5340 O O   . HOH M 3 .   ? -3.295  -8.240  29.570 1.00 23.03 ? 614  HOH A O   1 
HETATM 5341 O O   . HOH M 3 .   ? -11.101 2.842   19.626 1.00 18.51 ? 615  HOH A O   1 
HETATM 5342 O O   . HOH M 3 .   ? -11.159 1.654   8.135  1.00 23.37 ? 616  HOH A O   1 
HETATM 5343 O O   . HOH M 3 .   ? -10.547 0.099   17.737 1.00 28.32 ? 617  HOH A O   1 
HETATM 5344 O O   . HOH M 3 .   ? 4.557   9.339   16.792 1.00 14.39 ? 618  HOH A O   1 
HETATM 5345 O O   . HOH M 3 .   ? -14.676 14.091  24.284 1.00 34.39 ? 619  HOH A O   1 
HETATM 5346 O O   . HOH M 3 .   ? -1.383  17.176  13.609 1.00 14.79 ? 620  HOH A O   1 
HETATM 5347 O O   . HOH M 3 .   ? 11.596  -5.188  12.068 1.00 38.09 ? 621  HOH A O   1 
HETATM 5348 O O   . HOH M 3 .   ? -8.691  -4.159  4.344  1.00 34.10 ? 622  HOH A O   1 
HETATM 5349 O O   . HOH M 3 .   ? 7.281   13.124  13.513 1.00 31.76 ? 623  HOH A O   1 
HETATM 5350 O O   . HOH M 3 .   ? 2.734   -16.866 24.520 1.00 12.64 ? 624  HOH A O   1 
HETATM 5351 O O   . HOH M 3 .   ? 2.314   3.109   35.507 1.00 17.12 ? 625  HOH A O   1 
HETATM 5352 O O   . HOH M 3 .   ? 1.965   13.589  17.596 1.00 12.55 ? 626  HOH A O   1 
HETATM 5353 O O   . HOH M 3 .   ? 7.201   10.034  13.667 1.00 20.27 ? 627  HOH A O   1 
HETATM 5354 O O   . HOH M 3 .   ? -9.307  -7.124  25.127 1.00 24.18 ? 628  HOH A O   1 
HETATM 5355 O O   . HOH M 3 .   ? -13.704 -6.540  12.295 1.00 37.38 ? 629  HOH A O   1 
HETATM 5356 O O   . HOH M 3 .   ? -9.867  14.936  19.091 1.00 27.25 ? 630  HOH A O   1 
HETATM 5357 O O   . HOH M 3 .   ? 7.671   -0.246  8.061  1.00 42.10 ? 631  HOH A O   1 
HETATM 5358 O O   . HOH M 3 .   ? 15.797  9.475   21.264 1.00 33.67 ? 632  HOH A O   1 
HETATM 5359 O O   . HOH M 3 .   ? -2.963  15.562  11.991 1.00 13.40 ? 633  HOH A O   1 
HETATM 5360 O O   . HOH M 3 .   ? -1.480  11.973  24.018 1.00 16.38 ? 634  HOH A O   1 
HETATM 5361 O O   . HOH M 3 .   ? 8.203   9.272   32.064 1.00 36.72 ? 635  HOH A O   1 
HETATM 5362 O O   . HOH M 3 .   ? -6.120  -10.934 25.703 1.00 20.13 ? 636  HOH A O   1 
HETATM 5363 O O   . HOH M 3 .   ? -1.683  0.972   7.634  1.00 17.44 ? 637  HOH A O   1 
HETATM 5364 O O   . HOH M 3 .   ? -8.193  -7.157  5.680  1.00 26.60 ? 638  HOH A O   1 
HETATM 5365 O O   . HOH M 3 .   ? -0.434  3.379   7.539  1.00 14.73 ? 639  HOH A O   1 
HETATM 5366 O O   . HOH M 3 .   ? -9.869  11.480  8.516  1.00 24.69 ? 640  HOH A O   1 
HETATM 5367 O O   . HOH M 3 .   ? -3.913  -10.712 27.701 1.00 20.59 ? 641  HOH A O   1 
HETATM 5368 O O   . HOH M 3 .   ? -5.706  -14.090 20.924 1.00 18.16 ? 642  HOH A O   1 
HETATM 5369 O O   . HOH M 3 .   ? 0.697   -0.216  7.393  1.00 17.69 ? 643  HOH A O   1 
HETATM 5370 O O   . HOH M 3 .   ? -11.340 6.620   29.476 1.00 36.28 ? 644  HOH A O   1 
HETATM 5371 O O   . HOH M 3 .   ? -13.680 15.010  19.499 1.00 35.40 ? 645  HOH A O   1 
HETATM 5372 O O   . HOH M 3 .   ? 11.860  10.945  16.958 1.00 33.41 ? 646  HOH A O   1 
HETATM 5373 O O   . HOH M 3 .   ? 9.125   -11.078 7.745  1.00 42.40 ? 647  HOH A O   1 
HETATM 5374 O O   . HOH M 3 .   ? 7.423   -0.105  36.439 1.00 20.15 ? 648  HOH A O   1 
HETATM 5375 O O   . HOH M 3 .   ? -13.702 -1.160  8.851  1.00 39.82 ? 649  HOH A O   1 
HETATM 5376 O O   . HOH M 3 .   ? 9.787   -5.376  27.669 1.00 28.13 ? 650  HOH A O   1 
HETATM 5377 O O   . HOH M 3 .   ? -1.596  0.720   32.075 1.00 22.72 ? 651  HOH A O   1 
HETATM 5378 O O   . HOH M 3 .   ? 6.219   15.311  11.051 1.00 25.98 ? 652  HOH A O   1 
HETATM 5379 O O   . HOH M 3 .   ? -10.721 -9.414  21.995 1.00 32.58 ? 653  HOH A O   1 
HETATM 5380 O O   . HOH M 3 .   ? -3.033  1.313   4.324  1.00 28.65 ? 654  HOH A O   1 
HETATM 5381 O O   . HOH M 3 .   ? -12.668 4.711   27.769 1.00 26.32 ? 655  HOH A O   1 
HETATM 5382 O O   . HOH M 3 .   ? 15.074  7.575   26.168 1.00 37.25 ? 656  HOH A O   1 
HETATM 5383 O O   . HOH M 3 .   ? 1.184   -0.456  33.595 1.00 21.01 ? 657  HOH A O   1 
HETATM 5384 O O   . HOH M 3 .   ? -1.320  -3.120  5.766  1.00 32.58 ? 658  HOH A O   1 
HETATM 5385 O O   . HOH M 3 .   ? -2.596  -11.465 15.946 1.00 16.71 ? 659  HOH A O   1 
HETATM 5386 O O   . HOH M 3 .   ? 5.947   -14.289 26.541 1.00 21.11 ? 660  HOH A O   1 
HETATM 5387 O O   . HOH M 3 .   ? -10.929 -8.649  17.148 1.00 27.01 ? 661  HOH A O   1 
HETATM 5388 O O   . HOH M 3 .   ? 12.186  11.488  19.647 1.00 27.59 ? 662  HOH A O   1 
HETATM 5389 O O   . HOH M 3 .   ? -0.836  15.483  4.439  1.00 32.94 ? 663  HOH A O   1 
HETATM 5390 O O   . HOH M 3 .   ? 6.792   10.750  24.491 1.00 17.63 ? 664  HOH A O   1 
HETATM 5391 O O   . HOH M 3 .   ? -1.850  -8.794  31.936 1.00 30.27 ? 665  HOH A O   1 
HETATM 5392 O O   . HOH M 3 .   ? -4.866  -5.384  12.374 1.00 11.66 ? 666  HOH A O   1 
HETATM 5393 O O   . HOH M 3 .   ? -3.054  3.401   1.049  1.00 14.75 ? 667  HOH A O   1 
HETATM 5394 O O   . HOH M 3 .   ? 1.365   -12.755 9.921  1.00 43.03 ? 668  HOH A O   1 
HETATM 5395 O O   . HOH M 3 .   ? -3.719  11.409  17.324 1.00 13.82 ? 669  HOH A O   1 
HETATM 5396 O O   . HOH M 3 .   ? 4.232   12.075  17.411 1.00 12.46 ? 670  HOH A O   1 
HETATM 5397 O O   . HOH M 3 .   ? 2.211   -9.322  5.862  1.00 29.24 ? 671  HOH A O   1 
HETATM 5398 O O   . HOH M 3 .   ? -6.827  10.353  5.813  1.00 16.61 ? 672  HOH A O   1 
HETATM 5399 O O   . HOH M 3 .   ? -0.909  15.994  16.125 1.00 11.59 ? 673  HOH A O   1 
HETATM 5400 O O   . HOH M 3 .   ? -4.429  6.353   29.615 1.00 22.19 ? 674  HOH A O   1 
HETATM 5401 O O   . HOH M 3 .   ? -10.929 4.127   11.347 1.00 19.65 ? 675  HOH A O   1 
HETATM 5402 O O   . HOH M 3 .   ? -9.370  -12.706 19.900 1.00 34.86 ? 676  HOH A O   1 
HETATM 5403 O O   . HOH M 3 .   ? -11.973 -2.029  24.578 1.00 19.50 ? 677  HOH A O   1 
HETATM 5404 O O   . HOH M 3 .   ? -5.604  -4.387  31.638 1.00 30.79 ? 678  HOH A O   1 
HETATM 5405 O O   . HOH M 3 .   ? -1.297  10.684  3.197  1.00 25.78 ? 679  HOH A O   1 
HETATM 5406 O O   . HOH M 3 .   ? 9.269   -10.309 23.495 1.00 29.45 ? 680  HOH A O   1 
HETATM 5407 O O   . HOH M 3 .   ? -1.412  10.735  28.645 1.00 34.36 ? 681  HOH A O   1 
HETATM 5408 O O   . HOH M 3 .   ? -13.864 -5.685  8.421  1.00 26.02 ? 682  HOH A O   1 
HETATM 5409 O O   . HOH M 3 .   ? -15.209 2.115   27.204 1.00 14.15 ? 683  HOH A O   1 
HETATM 5410 O O   . HOH M 3 .   ? 4.488   10.811  22.952 1.00 19.80 ? 684  HOH A O   1 
HETATM 5411 O O   . HOH M 3 .   ? -11.813 2.192   23.051 1.00 25.98 ? 685  HOH A O   1 
HETATM 5412 O O   . HOH M 3 .   ? -7.235  12.124  7.841  1.00 18.44 ? 686  HOH A O   1 
HETATM 5413 O O   . HOH M 3 .   ? -14.967 0.312   24.254 1.00 31.98 ? 687  HOH A O   1 
HETATM 5414 O O   . HOH M 3 .   ? -0.429  -16.248 22.142 1.00 12.31 ? 688  HOH A O   1 
HETATM 5415 O O   . HOH M 3 .   ? 6.716   15.897  8.362  1.00 27.68 ? 689  HOH A O   1 
HETATM 5416 O O   . HOH M 3 .   ? 7.984   -4.164  10.779 1.00 22.97 ? 690  HOH A O   1 
HETATM 5417 O O   . HOH M 3 .   ? 8.880   10.457  27.118 1.00 24.33 ? 691  HOH A O   1 
HETATM 5418 O O   . HOH M 3 .   ? -2.068  3.661   31.927 1.00 22.27 ? 692  HOH A O   1 
HETATM 5419 O O   . HOH M 3 .   ? -11.770 6.659   14.660 1.00 44.42 ? 693  HOH A O   1 
HETATM 5420 O O   . HOH M 3 .   ? 16.844  6.466   23.392 1.00 41.48 ? 694  HOH A O   1 
HETATM 5421 O O   . HOH M 3 .   ? -10.818 13.636  26.533 1.00 32.70 ? 695  HOH A O   1 
HETATM 5422 O O   . HOH M 3 .   ? -8.117  12.388  17.659 1.00 36.58 ? 696  HOH A O   1 
HETATM 5423 O O   . HOH M 3 .   ? -3.183  -6.541  5.348  1.00 23.82 ? 697  HOH A O   1 
HETATM 5424 O O   . HOH M 3 .   ? -9.968  -2.713  26.252 1.00 22.72 ? 698  HOH A O   1 
HETATM 5425 O O   . HOH M 3 .   ? 1.987   -3.174  33.855 1.00 18.11 ? 699  HOH A O   1 
HETATM 5426 O O   . HOH M 3 .   ? 2.788   5.313   3.458  1.00 42.29 ? 700  HOH A O   1 
HETATM 5427 O O   . HOH M 3 .   ? 6.829   -4.565  26.409 1.00 20.60 ? 701  HOH A O   1 
HETATM 5428 O O   . HOH M 3 .   ? -0.383  -11.208 14.676 1.00 22.40 ? 702  HOH A O   1 
HETATM 5429 O O   . HOH M 3 .   ? 1.458   21.804  10.255 1.00 41.04 ? 703  HOH A O   1 
HETATM 5430 O O   . HOH M 3 .   ? 2.042   3.088   1.091  1.00 44.06 ? 704  HOH A O   1 
HETATM 5431 O O   . HOH M 3 .   ? -6.577  7.879   29.411 1.00 33.41 ? 705  HOH A O   1 
HETATM 5432 O O   . HOH M 3 .   ? 10.487  -8.890  19.685 1.00 46.01 ? 706  HOH A O   1 
HETATM 5433 O O   . HOH M 3 .   ? -4.244  -18.122 29.912 1.00 29.82 ? 707  HOH A O   1 
HETATM 5434 O O   . HOH M 3 .   ? 7.357   -5.685  34.267 1.00 28.14 ? 708  HOH A O   1 
HETATM 5435 O O   . HOH M 3 .   ? 10.813  -5.861  21.015 1.00 40.79 ? 709  HOH A O   1 
HETATM 5436 O O   . HOH M 3 .   ? -12.871 6.848   18.273 1.00 34.19 ? 710  HOH A O   1 
HETATM 5437 O O   . HOH M 3 .   ? 9.378   -5.892  25.175 1.00 16.62 ? 711  HOH A O   1 
HETATM 5438 O O   . HOH M 3 .   ? 5.774   5.876   7.184  1.00 46.32 ? 712  HOH A O   1 
HETATM 5439 O O   . HOH M 3 .   ? -12.354 1.787   11.350 1.00 29.11 ? 713  HOH A O   1 
HETATM 5440 O O   . HOH M 3 .   ? -14.507 4.708   24.218 1.00 44.93 ? 714  HOH A O   1 
HETATM 5441 O O   . HOH M 3 .   ? -0.086  8.026   31.776 1.00 28.55 ? 715  HOH A O   1 
HETATM 5442 O O   . HOH M 3 .   ? 4.430   11.331  3.516  1.00 37.43 ? 716  HOH A O   1 
HETATM 5443 O O   . HOH M 3 .   ? 13.070  -4.461  25.104 1.00 26.49 ? 717  HOH A O   1 
HETATM 5444 O O   . HOH M 3 .   ? -4.086  15.534  8.048  1.00 21.17 ? 718  HOH A O   1 
HETATM 5445 O O   . HOH M 3 .   ? 0.676   -15.816 13.120 1.00 41.85 ? 719  HOH A O   1 
HETATM 5446 O O   . HOH M 3 .   ? 6.918   -11.713 0.860  1.00 40.92 ? 720  HOH A O   1 
HETATM 5447 O O   . HOH M 3 .   ? 1.814   -9.339  1.403  1.00 43.93 ? 721  HOH A O   1 
HETATM 5448 O O   . HOH M 3 .   ? 10.155  -11.870 30.701 1.00 41.34 ? 722  HOH A O   1 
HETATM 5449 O O   . HOH M 3 .   ? 6.506   8.965   28.055 1.00 41.44 ? 723  HOH A O   1 
HETATM 5450 O O   . HOH M 3 .   ? 5.277   -13.187 30.719 1.00 22.83 ? 724  HOH A O   1 
HETATM 5451 O O   . HOH M 3 .   ? -11.491 5.018   8.572  1.00 16.17 ? 725  HOH A O   1 
HETATM 5452 O O   . HOH M 3 .   ? -9.496  9.778   6.173  1.00 21.08 ? 726  HOH A O   1 
HETATM 5453 O O   . HOH M 3 .   ? -10.038 -12.452 23.935 1.00 37.14 ? 727  HOH A O   1 
HETATM 5454 O O   . HOH M 3 .   ? 0.504   -17.903 14.409 1.00 38.10 ? 728  HOH A O   1 
HETATM 5455 O O   . HOH M 3 .   ? -8.141  -3.100  33.433 1.00 45.98 ? 729  HOH A O   1 
HETATM 5456 O O   . HOH M 3 .   ? -2.035  19.737  12.674 1.00 24.18 ? 730  HOH A O   1 
HETATM 5457 O O   . HOH M 3 .   ? -4.383  17.144  10.177 1.00 18.44 ? 731  HOH A O   1 
HETATM 5458 O O   . HOH M 3 .   ? -0.591  4.382   0.855  1.00 31.13 ? 732  HOH A O   1 
HETATM 5459 O O   . HOH M 3 .   ? -1.147  -7.154  34.402 1.00 39.05 ? 733  HOH A O   1 
HETATM 5460 O O   . HOH M 3 .   ? 5.699   8.119   7.290  1.00 37.43 ? 734  HOH A O   1 
HETATM 5461 O O   . HOH M 3 .   ? 1.747   16.302  17.000 1.00 14.29 ? 735  HOH A O   1 
HETATM 5462 O O   . HOH M 3 .   ? -10.189 -1.566  19.763 1.00 22.46 ? 736  HOH A O   1 
HETATM 5463 O O   . HOH M 3 .   ? 0.364   6.392   0.949  1.00 40.42 ? 737  HOH A O   1 
HETATM 5464 O O   . HOH M 3 .   ? 3.257   5.296   34.169 1.00 22.44 ? 738  HOH A O   1 
HETATM 5465 O O   . HOH M 3 .   ? -0.201  2.071   35.270 1.00 24.61 ? 739  HOH A O   1 
HETATM 5466 O O   . HOH M 3 .   ? 0.708   -1.476  4.857  1.00 28.48 ? 740  HOH A O   1 
HETATM 5467 O O   . HOH M 3 .   ? -7.578  -13.173 24.836 1.00 22.01 ? 741  HOH A O   1 
HETATM 5468 O O   . HOH M 3 .   ? -12.577 9.268   29.295 1.00 37.99 ? 742  HOH A O   1 
HETATM 5469 O O   . HOH M 3 .   ? -3.870  12.291  25.375 1.00 22.51 ? 743  HOH A O   1 
HETATM 5470 O O   . HOH M 3 .   ? -3.216  8.753   29.818 1.00 40.72 ? 744  HOH A O   1 
HETATM 5471 O O   . HOH M 3 .   ? -14.468 2.294   23.347 1.00 43.95 ? 745  HOH A O   1 
HETATM 5472 O O   . HOH M 3 .   ? -11.293 -0.725  22.335 1.00 24.16 ? 746  HOH A O   1 
HETATM 5473 O O   . HOH M 3 .   ? 6.198   13.843  16.204 1.00 24.38 ? 747  HOH A O   1 
HETATM 5474 O O   . HOH M 3 .   ? -11.344 -11.175 17.981 1.00 46.57 ? 748  HOH A O   1 
HETATM 5475 O O   . HOH M 3 .   ? 15.169  3.997   26.110 1.00 22.67 ? 749  HOH A O   1 
HETATM 5476 O O   . HOH M 3 .   ? -11.793 -10.804 15.260 1.00 30.82 ? 750  HOH A O   1 
HETATM 5477 O O   . HOH M 3 .   ? -13.782 1.102   8.089  1.00 36.26 ? 751  HOH A O   1 
HETATM 5478 O O   . HOH M 3 .   ? 13.555  -6.395  29.252 1.00 35.30 ? 752  HOH A O   1 
HETATM 5479 O O   . HOH M 3 .   ? -18.216 10.990  23.863 1.00 40.68 ? 753  HOH A O   1 
HETATM 5480 O O   . HOH M 3 .   ? 4.904   14.782  27.659 1.00 32.31 ? 754  HOH A O   1 
HETATM 5481 O O   . HOH M 3 .   ? -4.207  5.451   31.951 1.00 26.11 ? 755  HOH A O   1 
HETATM 5482 O O   . HOH M 3 .   ? -2.435  7.974   32.054 1.00 44.63 ? 756  HOH A O   1 
HETATM 5483 O O   . HOH M 3 .   ? -6.471  -15.164 23.224 1.00 23.11 ? 757  HOH A O   1 
HETATM 5484 O O   . HOH M 3 .   ? 1.090   -5.556  3.139  1.00 41.78 ? 758  HOH A O   1 
HETATM 5485 O O   . HOH M 3 .   ? -11.867 13.052  9.311  1.00 33.39 ? 759  HOH A O   1 
HETATM 5486 O O   . HOH M 3 .   ? -13.166 16.430  23.920 1.00 29.24 ? 760  HOH A O   1 
HETATM 5487 O O   . HOH M 3 .   ? -15.071 8.389   9.287  1.00 45.21 ? 761  HOH A O   1 
HETATM 5488 O O   . HOH M 3 .   ? -3.948  -12.699 29.599 1.00 23.34 ? 762  HOH A O   1 
HETATM 5489 O O   . HOH M 3 .   ? -3.672  12.319  28.034 1.00 39.98 ? 763  HOH A O   1 
HETATM 5490 O O   . HOH M 3 .   ? -1.257  4.528   34.160 1.00 29.45 ? 764  HOH A O   1 
HETATM 5491 O O   . HOH M 3 .   ? -1.019  0.071   34.202 1.00 27.28 ? 765  HOH A O   1 
HETATM 5492 O O   . HOH M 3 .   ? -1.223  -0.502  2.619  1.00 30.71 ? 766  HOH A O   1 
HETATM 5493 O O   . HOH M 3 .   ? -8.091  -14.144 27.519 1.00 28.76 ? 767  HOH A O   1 
HETATM 5494 O O   . HOH M 3 .   ? 0.962   6.646   33.844 1.00 28.84 ? 768  HOH A O   1 
HETATM 5495 O O   . HOH M 3 .   ? -8.097  -9.343  26.511 1.00 28.82 ? 769  HOH A O   1 
HETATM 5496 O O   . HOH M 3 .   ? -12.510 16.886  21.228 1.00 30.05 ? 770  HOH A O   1 
HETATM 5497 O O   . HOH M 3 .   ? -1.701  -4.424  3.701  1.00 42.56 ? 771  HOH A O   1 
HETATM 5498 O O   . HOH M 3 .   ? -5.691  -7.047  30.491 1.00 28.69 ? 772  HOH A O   1 
HETATM 5499 O O   . HOH M 3 .   ? 0.060   -4.534  35.033 1.00 25.14 ? 773  HOH A O   1 
HETATM 5500 O O   . HOH M 3 .   ? 11.509  -6.883  5.059  1.00 47.50 ? 774  HOH A O   1 
HETATM 5501 O O   . HOH M 3 .   ? 9.457   -11.073 -1.527 1.00 41.80 ? 775  HOH A O   1 
HETATM 5502 O O   . HOH M 3 .   ? 10.365  -9.264  1.524  1.00 37.11 ? 776  HOH A O   1 
HETATM 5503 O O   . HOH M 3 .   ? 12.238  -9.519  5.599  1.00 32.71 ? 777  HOH A O   1 
HETATM 5504 O O   . HOH N 3 .   ? 15.025  0.722   16.698 1.00 42.14 ? 101  HOH B O   1 
HETATM 5505 O O   . HOH N 3 .   ? 10.003  -4.142  18.891 1.00 20.62 ? 102  HOH B O   1 
HETATM 5506 O O   . HOH N 3 .   ? 13.095  2.196   26.121 1.00 15.08 ? 103  HOH B O   1 
HETATM 5507 O O   . HOH N 3 .   ? 14.166  2.821   22.819 1.00 19.70 ? 104  HOH B O   1 
HETATM 5508 O O   . HOH N 3 .   ? 18.210  -0.429  27.190 1.00 15.48 ? 105  HOH B O   1 
HETATM 5509 O O   . HOH N 3 .   ? 9.409   3.060   27.548 1.00 11.21 ? 106  HOH B O   1 
HETATM 5510 O O   . HOH N 3 .   ? 15.577  2.594   18.794 1.00 38.99 ? 107  HOH B O   1 
HETATM 5511 O O   . HOH N 3 .   ? 18.228  0.658   20.873 1.00 32.02 ? 108  HOH B O   1 
HETATM 5512 O O   . HOH N 3 .   ? 15.209  -3.932  22.459 1.00 32.32 ? 109  HOH B O   1 
HETATM 5513 O O   . HOH N 3 .   ? 19.800  -1.973  16.628 1.00 45.15 ? 110  HOH B O   1 
HETATM 5514 O O   . HOH N 3 .   ? 17.629  2.485   25.236 1.00 23.20 ? 111  HOH B O   1 
HETATM 5515 O O   . HOH N 3 .   ? 6.153   1.720   9.690  1.00 24.95 ? 112  HOH B O   1 
HETATM 5516 O O   . HOH N 3 .   ? 14.891  4.270   20.605 1.00 31.58 ? 113  HOH B O   1 
HETATM 5517 O O   . HOH N 3 .   ? 19.525  2.620   20.880 1.00 29.51 ? 114  HOH B O   1 
HETATM 5518 O O   . HOH O 3 .   ? 27.932  5.133   44.150 1.00 30.30 ? 601  HOH C O   1 
HETATM 5519 O O   . HOH O 3 .   ? 6.379   8.416   33.487 1.00 27.21 ? 602  HOH C O   1 
HETATM 5520 O O   . HOH O 3 .   ? 20.008  5.601   28.765 1.00 15.13 ? 603  HOH C O   1 
HETATM 5521 O O   . HOH O 3 .   ? 8.739   8.388   56.474 1.00 43.07 ? 604  HOH C O   1 
HETATM 5522 O O   . HOH O 3 .   ? 31.593  18.028  41.482 1.00 37.82 ? 605  HOH C O   1 
HETATM 5523 O O   . HOH O 3 .   ? 20.209  -5.566  40.894 1.00 26.43 ? 606  HOH C O   1 
HETATM 5524 O O   . HOH O 3 .   ? 9.235   16.879  35.496 1.00 18.71 ? 607  HOH C O   1 
HETATM 5525 O O   . HOH O 3 .   ? 24.004  6.260   32.059 1.00 32.91 ? 608  HOH C O   1 
HETATM 5526 O O   . HOH O 3 .   ? 5.528   9.650   53.534 1.00 38.46 ? 609  HOH C O   1 
HETATM 5527 O O   . HOH O 3 .   ? 16.723  8.416   27.322 1.00 40.88 ? 610  HOH C O   1 
HETATM 5528 O O   . HOH O 3 .   ? 22.029  14.478  54.455 1.00 32.45 ? 611  HOH C O   1 
HETATM 5529 O O   . HOH O 3 .   ? -2.486  -2.782  38.051 1.00 38.27 ? 612  HOH C O   1 
HETATM 5530 O O   . HOH O 3 .   ? -1.812  10.676  46.728 1.00 44.01 ? 613  HOH C O   1 
HETATM 5531 O O   . HOH O 3 .   ? 8.605   -2.990  43.605 1.00 28.97 ? 614  HOH C O   1 
HETATM 5532 O O   . HOH O 3 .   ? 20.728  -3.853  25.026 1.00 38.62 ? 615  HOH C O   1 
HETATM 5533 O O   . HOH O 3 .   ? 19.816  12.407  52.616 1.00 20.29 ? 616  HOH C O   1 
HETATM 5534 O O   . HOH O 3 .   ? 0.600   19.369  38.254 1.00 19.90 ? 617  HOH C O   1 
HETATM 5535 O O   . HOH O 3 .   ? 5.762   6.286   33.326 1.00 17.29 ? 618  HOH C O   1 
HETATM 5536 O O   . HOH O 3 .   ? 11.813  25.703  44.447 1.00 39.44 ? 619  HOH C O   1 
HETATM 5537 O O   . HOH O 3 .   ? 8.547   6.194   55.863 1.00 39.21 ? 620  HOH C O   1 
HETATM 5538 O O   . HOH O 3 .   ? 15.419  0.122   56.447 1.00 28.79 ? 621  HOH C O   1 
HETATM 5539 O O   . HOH O 3 .   ? 13.588  -3.287  32.047 1.00 12.26 ? 622  HOH C O   1 
HETATM 5540 O O   . HOH O 3 .   ? 13.397  -8.968  35.522 1.00 42.06 ? 623  HOH C O   1 
HETATM 5541 O O   . HOH O 3 .   ? 12.202  4.125   30.586 1.00 12.74 ? 624  HOH C O   1 
HETATM 5542 O O   . HOH O 3 .   ? 9.634   -4.339  46.565 1.00 21.44 ? 625  HOH C O   1 
HETATM 5543 O O   . HOH O 3 .   ? 4.991   17.283  51.173 1.00 35.79 ? 626  HOH C O   1 
HETATM 5544 O O   . HOH O 3 .   ? 11.031  -2.891  52.518 1.00 25.84 ? 627  HOH C O   1 
HETATM 5545 O O   . HOH O 3 .   ? 24.331  -7.056  28.216 1.00 40.94 ? 628  HOH C O   1 
HETATM 5546 O O   . HOH O 3 .   ? 29.244  9.499   43.179 1.00 29.91 ? 629  HOH C O   1 
HETATM 5547 O O   . HOH O 3 .   ? 15.091  7.230   33.134 1.00 13.69 ? 630  HOH C O   1 
HETATM 5548 O O   . HOH O 3 .   ? 23.840  4.005   43.291 1.00 17.00 ? 631  HOH C O   1 
HETATM 5549 O O   . HOH O 3 .   ? 2.514   11.383  32.015 1.00 42.93 ? 632  HOH C O   1 
HETATM 5550 O O   . HOH O 3 .   ? 18.086  -6.822  38.713 1.00 30.41 ? 633  HOH C O   1 
HETATM 5551 O O   . HOH O 3 .   ? 21.318  8.902   31.299 1.00 35.97 ? 634  HOH C O   1 
HETATM 5552 O O   . HOH O 3 .   ? 22.080  1.970   43.435 1.00 16.30 ? 635  HOH C O   1 
HETATM 5553 O O   . HOH O 3 .   ? 13.236  -4.132  47.644 1.00 12.16 ? 636  HOH C O   1 
HETATM 5554 O O   . HOH O 3 .   ? 13.183  20.784  56.632 1.00 32.96 ? 637  HOH C O   1 
HETATM 5555 O O   . HOH O 3 .   ? 23.105  -5.021  31.756 1.00 24.90 ? 638  HOH C O   1 
HETATM 5556 O O   . HOH O 3 .   ? 14.011  13.267  58.228 1.00 30.99 ? 639  HOH C O   1 
HETATM 5557 O O   . HOH O 3 .   ? 12.612  -2.011  29.809 1.00 11.35 ? 640  HOH C O   1 
HETATM 5558 O O   . HOH O 3 .   ? 21.578  13.420  29.297 1.00 41.52 ? 641  HOH C O   1 
HETATM 5559 O O   . HOH O 3 .   ? 2.351   19.083  42.025 1.00 22.77 ? 642  HOH C O   1 
HETATM 5560 O O   . HOH O 3 .   ? 22.038  11.769  53.578 1.00 22.01 ? 643  HOH C O   1 
HETATM 5561 O O   . HOH O 3 .   ? -1.013  4.880   45.172 1.00 44.83 ? 644  HOH C O   1 
HETATM 5562 O O   . HOH O 3 .   ? 15.841  22.164  56.262 1.00 44.70 ? 645  HOH C O   1 
HETATM 5563 O O   . HOH O 3 .   ? 3.107   24.755  38.302 1.00 21.85 ? 646  HOH C O   1 
HETATM 5564 O O   . HOH O 3 .   ? 13.270  19.380  26.890 1.00 18.82 ? 647  HOH C O   1 
HETATM 5565 O O   . HOH O 3 .   ? 8.887   -0.641  51.234 1.00 29.60 ? 648  HOH C O   1 
HETATM 5566 O O   . HOH O 3 .   ? 27.349  16.522  46.297 1.00 34.30 ? 649  HOH C O   1 
HETATM 5567 O O   . HOH O 3 .   ? 11.304  23.029  54.244 1.00 33.08 ? 650  HOH C O   1 
HETATM 5568 O O   . HOH O 3 .   ? 18.556  11.885  27.983 1.00 40.31 ? 651  HOH C O   1 
HETATM 5569 O O   . HOH O 3 .   ? 3.915   5.567   50.613 1.00 32.25 ? 652  HOH C O   1 
HETATM 5570 O O   . HOH O 3 .   ? 23.096  0.645   53.635 1.00 27.46 ? 653  HOH C O   1 
HETATM 5571 O O   . HOH O 3 .   ? 9.967   12.751  30.111 1.00 17.80 ? 654  HOH C O   1 
HETATM 5572 O O   . HOH O 3 .   ? 24.941  2.934   46.951 1.00 29.67 ? 655  HOH C O   1 
HETATM 5573 O O   . HOH O 3 .   ? 17.847  11.416  54.244 1.00 17.65 ? 656  HOH C O   1 
HETATM 5574 O O   . HOH O 3 .   ? 9.937   2.875   33.955 1.00 15.28 ? 657  HOH C O   1 
HETATM 5575 O O   . HOH O 3 .   ? 19.306  6.984   30.950 1.00 20.61 ? 658  HOH C O   1 
HETATM 5576 O O   . HOH O 3 .   ? 14.663  9.685   26.153 1.00 27.35 ? 659  HOH C O   1 
HETATM 5577 O O   . HOH O 3 .   ? 9.943   -5.950  35.780 1.00 26.53 ? 660  HOH C O   1 
HETATM 5578 O O   . HOH O 3 .   ? 7.236   16.548  54.190 1.00 39.10 ? 661  HOH C O   1 
HETATM 5579 O O   . HOH O 3 .   ? 13.968  6.298   30.647 1.00 12.71 ? 662  HOH C O   1 
HETATM 5580 O O   . HOH O 3 .   ? 22.189  1.399   40.804 1.00 24.95 ? 663  HOH C O   1 
HETATM 5581 O O   . HOH O 3 .   ? 9.864   1.083   35.797 1.00 12.56 ? 664  HOH C O   1 
HETATM 5582 O O   . HOH O 3 .   ? 3.729   3.111   47.051 1.00 26.34 ? 665  HOH C O   1 
HETATM 5583 O O   . HOH O 3 .   ? 6.564   1.607   47.095 1.00 38.52 ? 666  HOH C O   1 
HETATM 5584 O O   . HOH O 3 .   ? 18.036  20.255  29.331 1.00 30.60 ? 667  HOH C O   1 
HETATM 5585 O O   . HOH O 3 .   ? 28.088  8.807   50.622 1.00 29.56 ? 668  HOH C O   1 
HETATM 5586 O O   . HOH O 3 .   ? 22.838  -2.331  32.485 1.00 21.03 ? 669  HOH C O   1 
HETATM 5587 O O   . HOH O 3 .   ? 9.882   1.785   48.172 1.00 22.57 ? 670  HOH C O   1 
HETATM 5588 O O   . HOH O 3 .   ? 18.474  5.386   50.419 1.00 10.91 ? 671  HOH C O   1 
HETATM 5589 O O   . HOH O 3 .   ? 19.870  -6.617  30.883 1.00 38.47 ? 672  HOH C O   1 
HETATM 5590 O O   . HOH O 3 .   ? 24.624  -2.089  36.819 1.00 26.39 ? 673  HOH C O   1 
HETATM 5591 O O   . HOH O 3 .   ? 16.557  13.060  27.122 1.00 33.26 ? 674  HOH C O   1 
HETATM 5592 O O   . HOH O 3 .   ? 1.910   15.309  49.439 1.00 32.16 ? 675  HOH C O   1 
HETATM 5593 O O   . HOH O 3 .   ? 25.085  9.285   53.738 1.00 15.84 ? 676  HOH C O   1 
HETATM 5594 O O   . HOH O 3 .   ? 17.482  18.663  55.576 1.00 34.02 ? 677  HOH C O   1 
HETATM 5595 O O   . HOH O 3 .   ? 8.947   0.820   45.428 1.00 21.49 ? 678  HOH C O   1 
HETATM 5596 O O   . HOH O 3 .   ? 15.499  13.618  25.412 1.00 38.36 ? 679  HOH C O   1 
HETATM 5597 O O   . HOH O 3 .   ? 12.561  5.325   56.400 1.00 23.33 ? 680  HOH C O   1 
HETATM 5598 O O   . HOH O 3 .   ? 11.060  0.222   30.252 1.00 24.95 ? 681  HOH C O   1 
HETATM 5599 O O   . HOH O 3 .   ? 0.766   14.264  38.041 1.00 41.70 ? 682  HOH C O   1 
HETATM 5600 O O   . HOH O 3 .   ? 17.727  6.502   29.218 1.00 35.02 ? 683  HOH C O   1 
HETATM 5601 O O   . HOH O 3 .   ? 25.715  1.580   37.553 1.00 33.08 ? 684  HOH C O   1 
HETATM 5602 O O   . HOH O 3 .   ? 2.033   16.226  42.458 1.00 22.26 ? 685  HOH C O   1 
HETATM 5603 O O   . HOH O 3 .   ? 8.879   15.954  29.198 1.00 26.01 ? 686  HOH C O   1 
HETATM 5604 O O   . HOH O 3 .   ? 20.409  21.585  45.013 1.00 38.82 ? 687  HOH C O   1 
HETATM 5605 O O   . HOH O 3 .   ? 10.022  10.341  31.207 1.00 19.57 ? 688  HOH C O   1 
HETATM 5606 O O   . HOH O 3 .   ? 24.598  9.993   32.835 1.00 34.30 ? 689  HOH C O   1 
HETATM 5607 O O   . HOH O 3 .   ? 3.351   20.938  43.749 1.00 25.51 ? 690  HOH C O   1 
HETATM 5608 O O   . HOH O 3 .   ? 1.041   13.973  40.365 1.00 32.08 ? 691  HOH C O   1 
HETATM 5609 O O   . HOH O 3 .   ? -0.515  7.954   39.015 1.00 33.58 ? 692  HOH C O   1 
HETATM 5610 O O   . HOH O 3 .   ? 17.455  -3.549  54.816 1.00 17.90 ? 693  HOH C O   1 
HETATM 5611 O O   . HOH O 3 .   ? 17.537  25.237  53.695 1.00 36.97 ? 694  HOH C O   1 
HETATM 5612 O O   . HOH O 3 .   ? 15.024  18.613  57.207 1.00 26.92 ? 695  HOH C O   1 
HETATM 5613 O O   . HOH O 3 .   ? 17.925  17.499  26.692 1.00 31.19 ? 696  HOH C O   1 
HETATM 5614 O O   . HOH O 3 .   ? 23.110  0.347   45.658 1.00 28.17 ? 697  HOH C O   1 
HETATM 5615 O O   . HOH O 3 .   ? 17.117  23.681  46.751 1.00 28.34 ? 698  HOH C O   1 
HETATM 5616 O O   . HOH O 3 .   ? 27.083  16.383  41.235 1.00 28.44 ? 699  HOH C O   1 
HETATM 5617 O O   . HOH O 3 .   ? 8.052   -3.714  40.851 1.00 35.75 ? 700  HOH C O   1 
HETATM 5618 O O   . HOH O 3 .   ? 7.424   23.557  50.738 1.00 39.93 ? 701  HOH C O   1 
HETATM 5619 O O   . HOH O 3 .   ? 0.993   9.829   39.437 1.00 37.50 ? 702  HOH C O   1 
HETATM 5620 O O   . HOH O 3 .   ? -2.221  1.431   37.037 1.00 43.27 ? 703  HOH C O   1 
HETATM 5621 O O   . HOH O 3 .   ? 16.105  -6.293  32.692 1.00 28.10 ? 704  HOH C O   1 
HETATM 5622 O O   . HOH O 3 .   ? 3.478   8.023   50.628 1.00 35.09 ? 705  HOH C O   1 
HETATM 5623 O O   . HOH O 3 .   ? 22.019  11.401  33.274 1.00 31.75 ? 706  HOH C O   1 
HETATM 5624 O O   . HOH O 3 .   ? 23.058  -5.257  37.053 1.00 39.17 ? 707  HOH C O   1 
HETATM 5625 O O   . HOH O 3 .   ? -2.143  2.205   44.923 1.00 33.69 ? 708  HOH C O   1 
HETATM 5626 O O   . HOH O 3 .   ? 12.911  1.300   55.464 1.00 35.83 ? 709  HOH C O   1 
HETATM 5627 O O   . HOH O 3 .   ? 27.685  14.482  50.573 1.00 38.04 ? 710  HOH C O   1 
HETATM 5628 O O   . HOH O 3 .   ? 29.518  0.463   42.081 1.00 38.66 ? 711  HOH C O   1 
HETATM 5629 O O   . HOH O 3 .   ? 27.488  -0.701  35.533 1.00 34.56 ? 712  HOH C O   1 
HETATM 5630 O O   . HOH O 3 .   ? 25.541  16.721  56.013 1.00 29.16 ? 713  HOH C O   1 
HETATM 5631 O O   . HOH O 3 .   ? 14.040  -5.850  39.322 1.00 28.43 ? 714  HOH C O   1 
HETATM 5632 O O   . HOH O 3 .   ? 6.544   28.816  46.771 1.00 31.83 ? 715  HOH C O   1 
HETATM 5633 O O   . HOH O 3 .   ? 20.318  7.782   28.064 1.00 37.34 ? 716  HOH C O   1 
HETATM 5634 O O   . HOH O 3 .   ? 24.146  -1.566  44.205 1.00 31.31 ? 717  HOH C O   1 
HETATM 5635 O O   . HOH O 3 .   ? 0.976   13.348  35.708 1.00 32.61 ? 718  HOH C O   1 
HETATM 5636 O O   . HOH O 3 .   ? 9.032   -6.328  40.338 1.00 25.39 ? 719  HOH C O   1 
HETATM 5637 O O   . HOH O 3 .   ? 5.407   -2.797  43.982 1.00 30.91 ? 720  HOH C O   1 
HETATM 5638 O O   . HOH O 3 .   ? 22.059  14.789  57.261 1.00 24.68 ? 721  HOH C O   1 
HETATM 5639 O O   . HOH O 3 .   ? 6.887   -1.946  37.910 1.00 38.48 ? 722  HOH C O   1 
HETATM 5640 O O   . HOH O 3 .   ? 22.749  -2.861  35.342 1.00 27.58 ? 723  HOH C O   1 
HETATM 5641 O O   . HOH O 3 .   ? 27.621  1.081   44.094 1.00 31.67 ? 724  HOH C O   1 
HETATM 5642 O O   . HOH O 3 .   ? 27.654  1.432   36.296 1.00 33.53 ? 725  HOH C O   1 
HETATM 5643 O O   . HOH O 3 .   ? 18.763  4.956   26.677 1.00 27.61 ? 726  HOH C O   1 
HETATM 5644 O O   . HOH O 3 .   ? 31.794  9.847   43.954 1.00 40.69 ? 727  HOH C O   1 
HETATM 5645 O O   . HOH O 3 .   ? 15.668  24.571  40.239 1.00 38.08 ? 728  HOH C O   1 
HETATM 5646 O O   . HOH O 3 .   ? 12.267  -8.202  32.680 1.00 35.14 ? 729  HOH C O   1 
HETATM 5647 O O   . HOH O 3 .   ? 11.810  2.376   28.490 1.00 11.55 ? 730  HOH C O   1 
HETATM 5648 O O   . HOH O 3 .   ? 1.585   18.198  35.927 1.00 21.50 ? 731  HOH C O   1 
HETATM 5649 O O   . HOH O 3 .   ? 13.799  -6.116  31.576 1.00 21.58 ? 732  HOH C O   1 
HETATM 5650 O O   . HOH O 3 .   ? 15.538  18.606  25.475 1.00 32.26 ? 733  HOH C O   1 
HETATM 5651 O O   . HOH O 3 .   ? 20.441  11.615  31.058 1.00 35.22 ? 734  HOH C O   1 
HETATM 5652 O O   . HOH O 3 .   ? 14.384  22.284  31.363 1.00 32.51 ? 735  HOH C O   1 
HETATM 5653 O O   . HOH O 3 .   ? 7.457   -1.477  45.434 1.00 40.48 ? 736  HOH C O   1 
HETATM 5654 O O   . HOH O 3 .   ? 25.908  -3.044  52.404 1.00 42.78 ? 737  HOH C O   1 
HETATM 5655 O O   . HOH O 3 .   ? 5.623   3.809   49.251 1.00 27.93 ? 738  HOH C O   1 
HETATM 5656 O O   . HOH O 3 .   ? 26.865  13.400  52.943 1.00 32.80 ? 739  HOH C O   1 
HETATM 5657 O O   . HOH O 3 .   ? -0.512  18.008  40.367 1.00 28.97 ? 740  HOH C O   1 
HETATM 5658 O O   . HOH O 3 .   ? 16.530  21.783  27.895 1.00 37.40 ? 741  HOH C O   1 
HETATM 5659 O O   . HOH O 3 .   ? 8.782   3.781   49.764 1.00 23.87 ? 742  HOH C O   1 
HETATM 5660 O O   . HOH O 3 .   ? 12.228  -4.207  28.005 1.00 21.10 ? 743  HOH C O   1 
HETATM 5661 O O   . HOH O 3 .   ? 26.268  3.040   44.580 1.00 24.20 ? 744  HOH C O   1 
HETATM 5662 O O   . HOH O 3 .   ? 15.571  6.121   28.278 1.00 27.44 ? 745  HOH C O   1 
HETATM 5663 O O   . HOH O 3 .   ? 4.019   -3.345  35.893 1.00 24.84 ? 746  HOH C O   1 
HETATM 5664 O O   . HOH O 3 .   ? 26.794  2.439   48.396 1.00 37.10 ? 747  HOH C O   1 
HETATM 5665 O O   . HOH O 3 .   ? 12.692  24.947  40.436 1.00 29.88 ? 748  HOH C O   1 
HETATM 5666 O O   . HOH O 3 .   ? 22.106  -5.819  23.449 1.00 42.96 ? 749  HOH C O   1 
HETATM 5667 O O   . HOH O 3 .   ? -1.837  -2.297  35.462 1.00 33.92 ? 750  HOH C O   1 
HETATM 5668 O O   . HOH O 3 .   ? 13.453  -2.628  56.701 1.00 37.16 ? 751  HOH C O   1 
HETATM 5669 O O   . HOH O 3 .   ? 9.960   -0.905  53.808 1.00 39.25 ? 752  HOH C O   1 
HETATM 5670 O O   . HOH O 3 .   ? 17.691  15.092  26.203 1.00 35.71 ? 753  HOH C O   1 
HETATM 5671 O O   . HOH O 3 .   ? 14.169  5.533   58.743 1.00 33.97 ? 754  HOH C O   1 
HETATM 5672 O O   . HOH O 3 .   ? 15.411  13.272  23.303 1.00 38.86 ? 755  HOH C O   1 
HETATM 5673 O O   . HOH O 3 .   ? 7.358   -5.728  46.753 1.00 22.69 ? 756  HOH C O   1 
HETATM 5674 O O   . HOH O 3 .   ? 21.812  -7.159  33.038 1.00 44.07 ? 757  HOH C O   1 
HETATM 5675 O O   . HOH O 3 .   ? 1.167   8.389   51.745 1.00 44.12 ? 758  HOH C O   1 
HETATM 5676 O O   . HOH O 3 .   ? 15.243  -4.672  56.225 1.00 20.23 ? 759  HOH C O   1 
HETATM 5677 O O   . HOH O 3 .   ? 0.245   15.787  36.009 1.00 27.86 ? 760  HOH C O   1 
HETATM 5678 O O   . HOH O 3 .   ? -0.727  15.614  38.910 1.00 39.14 ? 761  HOH C O   1 
HETATM 5679 O O   . HOH O 3 .   ? 0.063   17.036  44.239 1.00 36.67 ? 762  HOH C O   1 
HETATM 5680 O O   . HOH O 3 .   ? 25.626  -6.002  32.818 1.00 36.50 ? 763  HOH C O   1 
HETATM 5681 O O   . HOH O 3 .   ? 13.854  14.762  23.143 1.00 33.21 ? 764  HOH C O   1 
HETATM 5682 O O   . HOH O 3 .   ? 26.829  -7.936  29.086 1.00 41.06 ? 765  HOH C O   1 
HETATM 5683 O O   . HOH O 3 .   ? 1.383   21.002  45.851 1.00 38.02 ? 766  HOH C O   1 
HETATM 5684 O O   . HOH P 3 .   ? 13.951  21.912  34.053 1.00 23.74 ? 101  HOH D O   1 
HETATM 5685 O O   . HOH P 3 .   ? 21.484  13.020  37.337 1.00 18.82 ? 102  HOH D O   1 
HETATM 5686 O O   . HOH P 3 .   ? 26.056  12.514  42.818 1.00 23.65 ? 103  HOH D O   1 
HETATM 5687 O O   . HOH P 3 .   ? 24.312  16.501  35.655 1.00 40.98 ? 104  HOH D O   1 
HETATM 5688 O O   . HOH P 3 .   ? 28.055  5.402   33.655 1.00 40.32 ? 105  HOH D O   1 
HETATM 5689 O O   . HOH P 3 .   ? 16.421  27.183  34.532 1.00 31.69 ? 106  HOH D O   1 
HETATM 5690 O O   . HOH P 3 .   ? 27.627  3.525   37.231 1.00 35.16 ? 107  HOH D O   1 
HETATM 5691 O O   . HOH P 3 .   ? 17.224  20.457  33.586 1.00 26.91 ? 108  HOH D O   1 
HETATM 5692 O O   . HOH P 3 .   ? 10.639  19.811  35.171 1.00 14.28 ? 109  HOH D O   1 
HETATM 5693 O O   . HOH P 3 .   ? 22.443  18.888  35.025 1.00 27.89 ? 110  HOH D O   1 
HETATM 5694 O O   . HOH P 3 .   ? 28.364  11.122  35.018 1.00 39.21 ? 111  HOH D O   1 
HETATM 5695 O O   . HOH P 3 .   ? 19.588  24.301  38.769 1.00 40.26 ? 112  HOH D O   1 
HETATM 5696 O O   . HOH P 3 .   ? 19.853  18.680  41.723 1.00 16.86 ? 113  HOH D O   1 
HETATM 5697 O O   . HOH P 3 .   ? 26.165  22.171  42.492 1.00 46.74 ? 114  HOH D O   1 
HETATM 5698 O O   . HOH P 3 .   ? 26.166  15.007  43.791 1.00 28.61 ? 115  HOH D O   1 
HETATM 5699 O O   . HOH P 3 .   ? 25.042  12.495  35.526 1.00 26.59 ? 116  HOH D O   1 
HETATM 5700 O O   . HOH P 3 .   ? 26.314  10.956  33.898 1.00 34.85 ? 117  HOH D O   1 
HETATM 5701 O O   . HOH P 3 .   ? 25.944  18.234  38.328 1.00 34.07 ? 118  HOH D O   1 
HETATM 5702 O O   . HOH P 3 .   ? 32.032  5.895   35.921 1.00 41.68 ? 119  HOH D O   1 
HETATM 5703 O O   . HOH P 3 .   ? 11.371  22.369  34.485 1.00 14.35 ? 120  HOH D O   1 
HETATM 5704 O O   . HOH P 3 .   ? 19.110  26.949  34.604 1.00 35.81 ? 121  HOH D O   1 
HETATM 5705 O O   . HOH P 3 .   ? 19.054  19.490  31.861 1.00 39.30 ? 122  HOH D O   1 
HETATM 5706 O O   . HOH P 3 .   ? 26.877  6.948   32.481 1.00 42.21 ? 123  HOH D O   1 
HETATM 5707 O O   . HOH P 3 .   ? 22.548  13.468  34.929 1.00 34.74 ? 124  HOH D O   1 
HETATM 5708 O O   . HOH P 3 .   ? 33.812  7.969   35.982 1.00 37.92 ? 125  HOH D O   1 
HETATM 5709 O O   . HOH Q 3 .   ? 6.362   18.962  28.243 1.00 22.34 ? 601  HOH E O   1 
HETATM 5710 O O   . HOH Q 3 .   ? 5.257   40.862  25.601 1.00 32.32 ? 602  HOH E O   1 
HETATM 5711 O O   . HOH Q 3 .   ? 0.751   43.065  19.296 1.00 38.49 ? 603  HOH E O   1 
HETATM 5712 O O   . HOH Q 3 .   ? 6.627   39.382  18.515 1.00 32.83 ? 604  HOH E O   1 
HETATM 5713 O O   . HOH Q 3 .   ? -14.941 28.802  23.469 1.00 35.57 ? 605  HOH E O   1 
HETATM 5714 O O   . HOH Q 3 .   ? -0.159  40.488  35.948 1.00 30.62 ? 606  HOH E O   1 
HETATM 5715 O O   . HOH Q 3 .   ? -13.960 23.876  22.276 1.00 32.23 ? 607  HOH E O   1 
HETATM 5716 O O   . HOH Q 3 .   ? 1.173   18.029  22.533 1.00 17.33 ? 608  HOH E O   1 
HETATM 5717 O O   . HOH Q 3 .   ? -6.444  12.657  24.652 1.00 15.58 ? 609  HOH E O   1 
HETATM 5718 O O   . HOH Q 3 .   ? 4.990   38.190  25.995 1.00 21.86 ? 610  HOH E O   1 
HETATM 5719 O O   . HOH Q 3 .   ? 8.619   38.410  37.437 1.00 20.75 ? 611  HOH E O   1 
HETATM 5720 O O   . HOH Q 3 .   ? 13.378  22.197  23.190 1.00 36.69 ? 612  HOH E O   1 
HETATM 5721 O O   . HOH Q 3 .   ? 8.371   24.922  28.253 1.00 16.98 ? 613  HOH E O   1 
HETATM 5722 O O   . HOH Q 3 .   ? -14.804 34.351  21.146 1.00 28.70 ? 614  HOH E O   1 
HETATM 5723 O O   . HOH Q 3 .   ? 10.473  28.328  38.432 1.00 22.63 ? 615  HOH E O   1 
HETATM 5724 O O   . HOH Q 3 .   ? -4.271  36.653  15.796 1.00 26.54 ? 616  HOH E O   1 
HETATM 5725 O O   . HOH Q 3 .   ? 8.533   35.955  20.620 1.00 35.25 ? 617  HOH E O   1 
HETATM 5726 O O   . HOH Q 3 .   ? 11.558  25.701  37.964 1.00 20.42 ? 618  HOH E O   1 
HETATM 5727 O O   . HOH Q 3 .   ? 3.303   18.971  33.822 1.00 17.45 ? 619  HOH E O   1 
HETATM 5728 O O   . HOH Q 3 .   ? 15.575  33.543  38.052 1.00 31.21 ? 620  HOH E O   1 
HETATM 5729 O O   . HOH Q 3 .   ? 12.073  38.017  31.517 1.00 33.12 ? 621  HOH E O   1 
HETATM 5730 O O   . HOH Q 3 .   ? 9.381   22.990  32.656 1.00 14.91 ? 622  HOH E O   1 
HETATM 5731 O O   . HOH Q 3 .   ? 6.828   36.795  29.302 1.00 19.81 ? 623  HOH E O   1 
HETATM 5732 O O   . HOH Q 3 .   ? 4.288   37.835  28.656 1.00 24.38 ? 624  HOH E O   1 
HETATM 5733 O O   . HOH Q 3 .   ? -5.877  11.954  18.674 1.00 19.80 ? 625  HOH E O   1 
HETATM 5734 O O   . HOH Q 3 .   ? -13.228 19.865  32.904 1.00 32.65 ? 626  HOH E O   1 
HETATM 5735 O O   . HOH Q 3 .   ? -15.592 32.632  27.730 1.00 34.44 ? 627  HOH E O   1 
HETATM 5736 O O   . HOH Q 3 .   ? -8.464  27.214  11.156 1.00 43.47 ? 628  HOH E O   1 
HETATM 5737 O O   . HOH Q 3 .   ? 14.197  25.329  28.580 1.00 31.03 ? 629  HOH E O   1 
HETATM 5738 O O   . HOH Q 3 .   ? 2.487   41.433  26.354 1.00 27.99 ? 630  HOH E O   1 
HETATM 5739 O O   . HOH Q 3 .   ? -14.962 26.682  21.561 1.00 28.53 ? 631  HOH E O   1 
HETATM 5740 O O   . HOH Q 3 .   ? -6.530  37.279  19.836 1.00 22.43 ? 632  HOH E O   1 
HETATM 5741 O O   . HOH Q 3 .   ? -15.147 35.518  25.006 1.00 34.54 ? 633  HOH E O   1 
HETATM 5742 O O   . HOH Q 3 .   ? -5.699  43.570  24.915 1.00 31.87 ? 634  HOH E O   1 
HETATM 5743 O O   . HOH Q 3 .   ? 12.389  19.122  18.304 1.00 42.09 ? 635  HOH E O   1 
HETATM 5744 O O   . HOH Q 3 .   ? -12.150 36.704  29.345 1.00 36.48 ? 636  HOH E O   1 
HETATM 5745 O O   . HOH Q 3 .   ? 10.136  17.698  16.055 1.00 37.97 ? 637  HOH E O   1 
HETATM 5746 O O   . HOH Q 3 .   ? 6.623   17.045  26.286 1.00 18.05 ? 638  HOH E O   1 
HETATM 5747 O O   . HOH Q 3 .   ? -8.431  17.318  26.034 1.00 18.65 ? 639  HOH E O   1 
HETATM 5748 O O   . HOH Q 3 .   ? -3.157  30.466  39.482 1.00 42.45 ? 640  HOH E O   1 
HETATM 5749 O O   . HOH Q 3 .   ? -8.483  16.016  23.549 1.00 19.04 ? 641  HOH E O   1 
HETATM 5750 O O   . HOH Q 3 .   ? -11.831 27.902  11.670 1.00 32.76 ? 642  HOH E O   1 
HETATM 5751 O O   . HOH Q 3 .   ? 0.012   36.015  37.589 1.00 21.94 ? 643  HOH E O   1 
HETATM 5752 O O   . HOH Q 3 .   ? 4.755   35.370  17.911 1.00 23.71 ? 644  HOH E O   1 
HETATM 5753 O O   . HOH Q 3 .   ? -4.837  17.145  34.819 1.00 37.81 ? 645  HOH E O   1 
HETATM 5754 O O   . HOH Q 3 .   ? 12.084  26.682  26.725 1.00 32.11 ? 646  HOH E O   1 
HETATM 5755 O O   . HOH Q 3 .   ? -13.915 27.165  14.240 1.00 35.77 ? 647  HOH E O   1 
HETATM 5756 O O   . HOH Q 3 .   ? -17.162 26.396  20.405 1.00 36.54 ? 648  HOH E O   1 
HETATM 5757 O O   . HOH Q 3 .   ? 12.640  19.769  23.036 1.00 24.23 ? 649  HOH E O   1 
HETATM 5758 O O   . HOH Q 3 .   ? -14.704 30.883  14.871 1.00 24.05 ? 650  HOH E O   1 
HETATM 5759 O O   . HOH Q 3 .   ? 8.970   33.095  43.311 1.00 27.93 ? 651  HOH E O   1 
HETATM 5760 O O   . HOH Q 3 .   ? 10.008  23.820  36.574 1.00 14.65 ? 652  HOH E O   1 
HETATM 5761 O O   . HOH Q 3 .   ? -5.195  14.844  28.572 1.00 40.04 ? 653  HOH E O   1 
HETATM 5762 O O   . HOH Q 3 .   ? -5.934  29.777  35.906 1.00 43.63 ? 654  HOH E O   1 
HETATM 5763 O O   . HOH Q 3 .   ? 9.852   23.206  29.837 1.00 14.74 ? 655  HOH E O   1 
HETATM 5764 O O   . HOH Q 3 .   ? 4.492   25.527  36.014 1.00 16.49 ? 656  HOH E O   1 
HETATM 5765 O O   . HOH Q 3 .   ? 4.531   42.270  33.218 1.00 46.31 ? 657  HOH E O   1 
HETATM 5766 O O   . HOH Q 3 .   ? -6.679  34.066  9.257  1.00 27.75 ? 658  HOH E O   1 
HETATM 5767 O O   . HOH Q 3 .   ? -4.123  37.723  26.789 1.00 18.60 ? 659  HOH E O   1 
HETATM 5768 O O   . HOH Q 3 .   ? -4.166  42.545  19.805 1.00 32.27 ? 660  HOH E O   1 
HETATM 5769 O O   . HOH Q 3 .   ? -8.750  36.942  21.243 1.00 22.52 ? 661  HOH E O   1 
HETATM 5770 O O   . HOH Q 3 .   ? -11.144 40.271  18.565 1.00 35.36 ? 662  HOH E O   1 
HETATM 5771 O O   . HOH Q 3 .   ? 13.838  22.129  27.100 1.00 33.50 ? 663  HOH E O   1 
HETATM 5772 O O   . HOH Q 3 .   ? -8.032  26.870  36.263 1.00 34.11 ? 664  HOH E O   1 
HETATM 5773 O O   . HOH Q 3 .   ? -3.499  36.347  10.947 1.00 39.02 ? 665  HOH E O   1 
HETATM 5774 O O   . HOH Q 3 .   ? -5.931  31.641  34.762 1.00 40.67 ? 666  HOH E O   1 
HETATM 5775 O O   . HOH Q 3 .   ? -9.759  16.913  21.065 1.00 19.11 ? 667  HOH E O   1 
HETATM 5776 O O   . HOH Q 3 .   ? 9.718   14.573  19.072 1.00 30.04 ? 668  HOH E O   1 
HETATM 5777 O O   . HOH Q 3 .   ? -10.710 30.293  9.512  1.00 40.01 ? 669  HOH E O   1 
HETATM 5778 O O   . HOH Q 3 .   ? -1.792  25.669  13.332 1.00 43.81 ? 670  HOH E O   1 
HETATM 5779 O O   . HOH Q 3 .   ? 5.602   23.845  34.615 1.00 17.35 ? 671  HOH E O   1 
HETATM 5780 O O   . HOH Q 3 .   ? 5.859   28.300  42.198 1.00 34.61 ? 672  HOH E O   1 
HETATM 5781 O O   . HOH Q 3 .   ? -1.007  13.725  29.836 1.00 25.68 ? 673  HOH E O   1 
HETATM 5782 O O   . HOH Q 3 .   ? 8.210   14.834  17.561 1.00 30.95 ? 674  HOH E O   1 
HETATM 5783 O O   . HOH Q 3 .   ? -4.158  22.811  17.204 1.00 37.25 ? 675  HOH E O   1 
HETATM 5784 O O   . HOH Q 3 .   ? 6.188   14.477  24.150 1.00 23.22 ? 676  HOH E O   1 
HETATM 5785 O O   . HOH Q 3 .   ? -4.974  17.482  32.164 1.00 33.27 ? 677  HOH E O   1 
HETATM 5786 O O   . HOH Q 3 .   ? 2.253   30.617  42.474 1.00 35.82 ? 678  HOH E O   1 
HETATM 5787 O O   . HOH Q 3 .   ? -0.238  22.067  12.255 1.00 24.16 ? 679  HOH E O   1 
HETATM 5788 O O   . HOH Q 3 .   ? -3.341  23.448  14.462 1.00 21.62 ? 680  HOH E O   1 
HETATM 5789 O O   . HOH Q 3 .   ? 6.422   30.350  43.434 1.00 40.26 ? 681  HOH E O   1 
HETATM 5790 O O   . HOH Q 3 .   ? 1.590   26.110  39.811 1.00 34.02 ? 682  HOH E O   1 
HETATM 5791 O O   . HOH Q 3 .   ? -5.231  27.009  11.652 1.00 30.92 ? 683  HOH E O   1 
HETATM 5792 O O   . HOH Q 3 .   ? -0.843  44.161  25.226 1.00 29.86 ? 684  HOH E O   1 
HETATM 5793 O O   . HOH Q 3 .   ? -12.121 28.311  33.579 1.00 37.43 ? 685  HOH E O   1 
HETATM 5794 O O   . HOH Q 3 .   ? 9.731   30.236  23.534 1.00 32.47 ? 686  HOH E O   1 
HETATM 5795 O O   . HOH Q 3 .   ? -4.447  28.748  40.577 1.00 29.96 ? 687  HOH E O   1 
HETATM 5796 O O   . HOH Q 3 .   ? -4.448  45.246  27.797 1.00 37.14 ? 688  HOH E O   1 
HETATM 5797 O O   . HOH Q 3 .   ? -14.323 32.791  30.014 1.00 40.40 ? 689  HOH E O   1 
HETATM 5798 O O   . HOH Q 3 .   ? 3.657   15.084  25.107 1.00 31.10 ? 690  HOH E O   1 
HETATM 5799 O O   . HOH Q 3 .   ? -14.257 19.280  20.441 1.00 38.60 ? 691  HOH E O   1 
HETATM 5800 O O   . HOH Q 3 .   ? 0.613   26.256  13.300 1.00 39.28 ? 692  HOH E O   1 
HETATM 5801 O O   . HOH Q 3 .   ? 11.440  39.300  34.736 1.00 17.92 ? 693  HOH E O   1 
HETATM 5802 O O   . HOH Q 3 .   ? -15.036 33.396  16.513 1.00 18.44 ? 694  HOH E O   1 
HETATM 5803 O O   . HOH Q 3 .   ? -12.322 26.308  31.941 1.00 40.43 ? 695  HOH E O   1 
HETATM 5804 O O   . HOH Q 3 .   ? 6.768   42.777  26.987 1.00 33.49 ? 696  HOH E O   1 
HETATM 5805 O O   . HOH Q 3 .   ? 7.305   36.090  18.178 1.00 36.94 ? 697  HOH E O   1 
HETATM 5806 O O   . HOH Q 3 .   ? 4.616   40.378  30.384 1.00 34.05 ? 698  HOH E O   1 
HETATM 5807 O O   . HOH Q 3 .   ? -3.590  31.853  38.185 1.00 44.29 ? 699  HOH E O   1 
HETATM 5808 O O   . HOH Q 3 .   ? 12.681  26.114  22.783 1.00 41.21 ? 700  HOH E O   1 
HETATM 5809 O O   . HOH Q 3 .   ? -3.462  19.724  10.379 1.00 32.84 ? 701  HOH E O   1 
HETATM 5810 O O   . HOH Q 3 .   ? -7.009  18.021  10.245 1.00 27.26 ? 702  HOH E O   1 
HETATM 5811 O O   . HOH Q 3 .   ? -9.227  29.216  34.374 1.00 40.11 ? 703  HOH E O   1 
HETATM 5812 O O   . HOH Q 3 .   ? -8.006  14.270  26.118 1.00 30.01 ? 704  HOH E O   1 
HETATM 5813 O O   . HOH Q 3 .   ? 5.764   16.602  15.664 1.00 23.59 ? 705  HOH E O   1 
HETATM 5814 O O   . HOH Q 3 .   ? 11.822  28.544  24.288 1.00 40.35 ? 706  HOH E O   1 
HETATM 5815 O O   . HOH Q 3 .   ? 14.746  17.363  23.425 1.00 43.93 ? 707  HOH E O   1 
HETATM 5816 O O   . HOH Q 3 .   ? -5.425  24.505  12.420 1.00 38.43 ? 708  HOH E O   1 
HETATM 5817 O O   . HOH Q 3 .   ? 12.219  15.418  18.858 1.00 34.79 ? 709  HOH E O   1 
HETATM 5818 O O   . HOH Q 3 .   ? -3.946  14.389  31.089 1.00 46.35 ? 710  HOH E O   1 
HETATM 5819 O O   . HOH Q 3 .   ? 12.744  23.113  29.608 1.00 31.59 ? 711  HOH E O   1 
HETATM 5820 O O   . HOH Q 3 .   ? 2.419   23.553  42.968 1.00 42.48 ? 712  HOH E O   1 
HETATM 5821 O O   . HOH Q 3 .   ? -9.461  39.617  21.582 1.00 25.14 ? 713  HOH E O   1 
HETATM 5822 O O   . HOH Q 3 .   ? 13.549  19.195  20.768 1.00 47.10 ? 714  HOH E O   1 
HETATM 5823 O O   . HOH Q 3 .   ? -14.538 21.220  25.165 1.00 35.26 ? 715  HOH E O   1 
HETATM 5824 O O   . HOH Q 3 .   ? -14.093 37.869  27.269 1.00 34.82 ? 716  HOH E O   1 
HETATM 5825 O O   . HOH Q 3 .   ? 17.332  24.746  28.592 1.00 40.34 ? 717  HOH E O   1 
HETATM 5826 O O   . HOH Q 3 .   ? -14.843 23.442  24.838 1.00 40.49 ? 718  HOH E O   1 
HETATM 5827 O O   . HOH Q 3 .   ? -16.150 25.276  26.286 1.00 42.35 ? 719  HOH E O   1 
HETATM 5828 O O   . HOH Q 3 .   ? -0.012  19.021  45.777 1.00 37.33 ? 720  HOH E O   1 
HETATM 5829 O O   . HOH R 3 .   ? 3.577   18.067  15.984 1.00 16.91 ? 101  HOH F O   1 
HETATM 5830 O O   . HOH R 3 .   ? 6.447   20.548  15.878 1.00 22.89 ? 102  HOH F O   1 
HETATM 5831 O O   . HOH R 3 .   ? 1.588   17.462  19.388 1.00 14.51 ? 103  HOH F O   1 
HETATM 5832 O O   . HOH R 3 .   ? 3.793   16.972  10.229 1.00 20.39 ? 104  HOH F O   1 
HETATM 5833 O O   . HOH R 3 .   ? 6.761   29.960  12.757 1.00 38.40 ? 105  HOH F O   1 
HETATM 5834 O O   . HOH R 3 .   ? 8.277   26.760  14.159 1.00 29.23 ? 106  HOH F O   1 
HETATM 5835 O O   . HOH R 3 .   ? 1.398   27.952  15.333 1.00 24.87 ? 107  HOH F O   1 
HETATM 5836 O O   . HOH R 3 .   ? 2.502   24.042  10.916 1.00 40.21 ? 108  HOH F O   1 
HETATM 5837 O O   . HOH R 3 .   ? 6.634   17.331  12.817 1.00 41.38 ? 109  HOH F O   1 
HETATM 5838 O O   . HOH R 3 .   ? 7.928   34.175  22.831 1.00 25.55 ? 110  HOH F O   1 
HETATM 5839 O O   . HOH R 3 .   ? 9.326   24.264  15.006 1.00 45.18 ? 111  HOH F O   1 
HETATM 5840 O O   . HOH R 3 .   ? 3.360   35.402  15.422 1.00 41.31 ? 112  HOH F O   1 
HETATM 5841 O O   . HOH R 3 .   ? 7.861   32.777  12.756 1.00 48.45 ? 113  HOH F O   1 
HETATM 5842 O O   . HOH R 3 .   ? 8.899   21.541  16.223 1.00 38.60 ? 114  HOH F O   1 
HETATM 5843 O O   . HOH S 3 .   ? 15.536  -15.589 37.965 1.00 30.75 ? 601  HOH G O   1 
HETATM 5844 O O   . HOH S 3 .   ? 31.663  -19.171 55.841 1.00 24.91 ? 602  HOH G O   1 
HETATM 5845 O O   . HOH S 3 .   ? 30.610  -20.498 49.776 1.00 24.63 ? 603  HOH G O   1 
HETATM 5846 O O   . HOH S 3 .   ? 28.834  -39.937 57.782 1.00 40.74 ? 604  HOH G O   1 
HETATM 5847 O O   . HOH S 3 .   ? 32.982  -17.628 52.818 1.00 29.73 ? 605  HOH G O   1 
HETATM 5848 O O   . HOH S 3 .   ? 26.103  -33.364 45.399 1.00 32.95 ? 606  HOH G O   1 
HETATM 5849 O O   . HOH S 3 .   ? 11.947  -11.634 60.341 1.00 32.11 ? 607  HOH G O   1 
HETATM 5850 O O   . HOH S 3 .   ? 17.457  -7.981  41.155 1.00 43.76 ? 608  HOH G O   1 
HETATM 5851 O O   . HOH S 3 .   ? 6.240   -10.130 40.821 1.00 36.24 ? 609  HOH G O   1 
HETATM 5852 O O   . HOH S 3 .   ? 16.374  -31.523 45.154 1.00 19.93 ? 610  HOH G O   1 
HETATM 5853 O O   . HOH S 3 .   ? 21.298  -5.819  54.560 1.00 32.64 ? 611  HOH G O   1 
HETATM 5854 O O   . HOH S 3 .   ? 5.163   -20.802 60.713 1.00 41.35 ? 612  HOH G O   1 
HETATM 5855 O O   . HOH S 3 .   ? 23.589  -30.437 36.594 1.00 42.52 ? 613  HOH G O   1 
HETATM 5856 O O   . HOH S 3 .   ? 31.278  -28.133 57.480 1.00 29.47 ? 614  HOH G O   1 
HETATM 5857 O O   . HOH S 3 .   ? 14.052  -25.122 41.488 1.00 17.87 ? 615  HOH G O   1 
HETATM 5858 O O   . HOH S 3 .   ? 10.053  -12.541 59.902 1.00 33.89 ? 616  HOH G O   1 
HETATM 5859 O O   . HOH S 3 .   ? 24.328  -8.873  49.799 1.00 43.41 ? 617  HOH G O   1 
HETATM 5860 O O   . HOH S 3 .   ? 12.235  -32.568 49.912 1.00 16.15 ? 618  HOH G O   1 
HETATM 5861 O O   . HOH S 3 .   ? 13.279  -20.420 60.683 1.00 32.78 ? 619  HOH G O   1 
HETATM 5862 O O   . HOH S 3 .   ? 13.939  -32.908 58.953 1.00 38.96 ? 620  HOH G O   1 
HETATM 5863 O O   . HOH S 3 .   ? 29.024  -18.087 49.602 1.00 27.55 ? 621  HOH G O   1 
HETATM 5864 O O   . HOH S 3 .   ? 19.324  -34.432 50.451 1.00 11.86 ? 622  HOH G O   1 
HETATM 5865 O O   . HOH S 3 .   ? 25.453  -34.179 48.026 1.00 23.36 ? 623  HOH G O   1 
HETATM 5866 O O   . HOH S 3 .   ? 21.692  -30.287 48.432 1.00 13.25 ? 624  HOH G O   1 
HETATM 5867 O O   . HOH S 3 .   ? 4.525   -34.100 59.379 1.00 27.80 ? 625  HOH G O   1 
HETATM 5868 O O   . HOH S 3 .   ? 14.910  -3.870  45.461 1.00 11.03 ? 626  HOH G O   1 
HETATM 5869 O O   . HOH S 3 .   ? 14.622  -29.833 62.381 1.00 24.37 ? 627  HOH G O   1 
HETATM 5870 O O   . HOH S 3 .   ? 9.248   -9.487  52.481 1.00 17.65 ? 628  HOH G O   1 
HETATM 5871 O O   . HOH S 3 .   ? 7.401   -11.916 48.250 1.00 19.10 ? 629  HOH G O   1 
HETATM 5872 O O   . HOH S 3 .   ? 29.825  -32.634 56.228 1.00 31.53 ? 630  HOH G O   1 
HETATM 5873 O O   . HOH S 3 .   ? 31.383  -38.665 59.888 1.00 39.72 ? 631  HOH G O   1 
HETATM 5874 O O   . HOH S 3 .   ? 21.311  -36.294 57.623 1.00 15.75 ? 632  HOH G O   1 
HETATM 5875 O O   . HOH S 3 .   ? 9.001   -15.494 61.673 1.00 32.23 ? 633  HOH G O   1 
HETATM 5876 O O   . HOH S 3 .   ? 18.612  -30.489 34.889 1.00 36.23 ? 634  HOH G O   1 
HETATM 5877 O O   . HOH S 3 .   ? 11.260  -23.050 60.158 1.00 19.55 ? 635  HOH G O   1 
HETATM 5878 O O   . HOH S 3 .   ? 27.907  -21.203 56.780 1.00 18.90 ? 636  HOH G O   1 
HETATM 5879 O O   . HOH S 3 .   ? 13.783  -6.381  54.641 1.00 16.01 ? 637  HOH G O   1 
HETATM 5880 O O   . HOH S 3 .   ? 20.568  -37.930 55.509 1.00 14.68 ? 638  HOH G O   1 
HETATM 5881 O O   . HOH S 3 .   ? 8.672   -9.711  49.666 1.00 16.40 ? 639  HOH G O   1 
HETATM 5882 O O   . HOH S 3 .   ? 25.532  -31.323 47.996 1.00 19.21 ? 640  HOH G O   1 
HETATM 5883 O O   . HOH S 3 .   ? 4.698   -23.625 40.833 1.00 16.49 ? 641  HOH G O   1 
HETATM 5884 O O   . HOH S 3 .   ? 16.464  -13.267 65.819 1.00 34.52 ? 642  HOH G O   1 
HETATM 5885 O O   . HOH S 3 .   ? 10.286  -10.559 58.553 1.00 31.11 ? 643  HOH G O   1 
HETATM 5886 O O   . HOH S 3 .   ? 25.098  -31.888 42.193 1.00 35.32 ? 644  HOH G O   1 
HETATM 5887 O O   . HOH S 3 .   ? 26.680  -8.328  54.194 1.00 26.76 ? 645  HOH G O   1 
HETATM 5888 O O   . HOH S 3 .   ? 14.013  -11.440 60.885 1.00 25.08 ? 646  HOH G O   1 
HETATM 5889 O O   . HOH S 3 .   ? 6.708   -20.835 35.666 1.00 19.09 ? 647  HOH G O   1 
HETATM 5890 O O   . HOH S 3 .   ? 26.458  -22.116 58.762 1.00 18.42 ? 648  HOH G O   1 
HETATM 5891 O O   . HOH S 3 .   ? 5.990   -25.557 52.635 1.00 33.04 ? 649  HOH G O   1 
HETATM 5892 O O   . HOH S 3 .   ? 19.626  -14.439 40.078 1.00 39.87 ? 650  HOH G O   1 
HETATM 5893 O O   . HOH S 3 .   ? 23.910  -9.031  46.447 1.00 23.73 ? 651  HOH G O   1 
HETATM 5894 O O   . HOH S 3 .   ? 8.497   -31.131 47.589 1.00 34.02 ? 652  HOH G O   1 
HETATM 5895 O O   . HOH S 3 .   ? 21.035  -15.306 58.595 1.00 11.83 ? 653  HOH G O   1 
HETATM 5896 O O   . HOH S 3 .   ? 20.769  -33.001 48.460 1.00 24.95 ? 654  HOH G O   1 
HETATM 5897 O O   . HOH S 3 .   ? 28.581  -17.867 59.063 1.00 28.75 ? 655  HOH G O   1 
HETATM 5898 O O   . HOH S 3 .   ? 27.025  -24.466 57.523 1.00 14.37 ? 656  HOH G O   1 
HETATM 5899 O O   . HOH S 3 .   ? 26.748  -28.518 37.391 1.00 29.40 ? 657  HOH G O   1 
HETATM 5900 O O   . HOH S 3 .   ? 12.842  -7.438  57.692 1.00 30.74 ? 658  HOH G O   1 
HETATM 5901 O O   . HOH S 3 .   ? 16.137  -31.609 42.551 1.00 16.95 ? 659  HOH G O   1 
HETATM 5902 O O   . HOH S 3 .   ? 27.599  -29.159 41.873 1.00 38.23 ? 660  HOH G O   1 
HETATM 5903 O O   . HOH S 3 .   ? 19.532  -9.315  54.523 1.00 15.62 ? 661  HOH G O   1 
HETATM 5904 O O   . HOH S 3 .   ? 24.861  -31.331 63.998 1.00 22.42 ? 662  HOH G O   1 
HETATM 5905 O O   . HOH S 3 .   ? 18.385  -24.667 64.569 1.00 21.45 ? 663  HOH G O   1 
HETATM 5906 O O   . HOH S 3 .   ? 31.285  -24.568 62.921 1.00 13.36 ? 664  HOH G O   1 
HETATM 5907 O O   . HOH S 3 .   ? 5.864   -20.014 42.507 1.00 16.06 ? 665  HOH G O   1 
HETATM 5908 O O   . HOH S 3 .   ? 8.605   -15.077 36.621 1.00 40.57 ? 666  HOH G O   1 
HETATM 5909 O O   . HOH S 3 .   ? 8.173   -12.909 55.648 1.00 21.58 ? 667  HOH G O   1 
HETATM 5910 O O   . HOH S 3 .   ? 11.585  -35.432 59.824 1.00 31.04 ? 668  HOH G O   1 
HETATM 5911 O O   . HOH S 3 .   ? 28.472  -37.122 59.821 1.00 30.63 ? 669  HOH G O   1 
HETATM 5912 O O   . HOH S 3 .   ? 28.479  -30.332 62.282 1.00 14.77 ? 670  HOH G O   1 
HETATM 5913 O O   . HOH S 3 .   ? 18.773  -36.729 53.737 1.00 10.90 ? 671  HOH G O   1 
HETATM 5914 O O   . HOH S 3 .   ? 5.790   -26.124 44.695 1.00 32.86 ? 672  HOH G O   1 
HETATM 5915 O O   . HOH S 3 .   ? 6.488   -17.147 55.893 1.00 24.50 ? 673  HOH G O   1 
HETATM 5916 O O   . HOH S 3 .   ? 28.499  -22.471 61.126 1.00 22.06 ? 674  HOH G O   1 
HETATM 5917 O O   . HOH S 3 .   ? 23.120  -32.761 40.453 1.00 30.42 ? 675  HOH G O   1 
HETATM 5918 O O   . HOH S 3 .   ? 31.443  -26.076 52.533 1.00 40.87 ? 676  HOH G O   1 
HETATM 5919 O O   . HOH S 3 .   ? 20.950  -32.109 65.214 1.00 25.68 ? 677  HOH G O   1 
HETATM 5920 O O   . HOH S 3 .   ? 17.916  -4.791  48.416 1.00 12.38 ? 678  HOH G O   1 
HETATM 5921 O O   . HOH S 3 .   ? 16.370  -31.881 55.500 1.00 15.25 ? 679  HOH G O   1 
HETATM 5922 O O   . HOH S 3 .   ? 30.465  -12.018 56.284 1.00 26.02 ? 680  HOH G O   1 
HETATM 5923 O O   . HOH S 3 .   ? 4.825   -30.714 63.643 1.00 19.39 ? 681  HOH G O   1 
HETATM 5924 O O   . HOH S 3 .   ? 6.059   -26.509 49.442 1.00 34.00 ? 682  HOH G O   1 
HETATM 5925 O O   . HOH S 3 .   ? 21.896  -28.107 34.320 1.00 44.22 ? 683  HOH G O   1 
HETATM 5926 O O   . HOH S 3 .   ? 8.979   -35.212 62.491 1.00 40.27 ? 684  HOH G O   1 
HETATM 5927 O O   . HOH S 3 .   ? 5.681   -20.980 45.280 1.00 15.99 ? 685  HOH G O   1 
HETATM 5928 O O   . HOH S 3 .   ? 18.856  -10.593 40.569 1.00 28.20 ? 686  HOH G O   1 
HETATM 5929 O O   . HOH S 3 .   ? 14.576  -6.576  41.725 1.00 21.07 ? 687  HOH G O   1 
HETATM 5930 O O   . HOH S 3 .   ? 16.559  -32.493 53.103 1.00 19.85 ? 688  HOH G O   1 
HETATM 5931 O O   . HOH S 3 .   ? 23.023  -33.924 43.203 1.00 38.73 ? 689  HOH G O   1 
HETATM 5932 O O   . HOH S 3 .   ? 7.001   -17.909 58.447 1.00 24.27 ? 690  HOH G O   1 
HETATM 5933 O O   . HOH S 3 .   ? 7.550   -28.130 61.703 1.00 38.10 ? 691  HOH G O   1 
HETATM 5934 O O   . HOH S 3 .   ? 26.001  -7.247  47.421 1.00 44.12 ? 692  HOH G O   1 
HETATM 5935 O O   . HOH S 3 .   ? 15.367  -4.360  49.479 1.00 10.29 ? 693  HOH G O   1 
HETATM 5936 O O   . HOH S 3 .   ? 6.253   -17.399 41.604 1.00 17.89 ? 694  HOH G O   1 
HETATM 5937 O O   . HOH S 3 .   ? 20.692  -22.403 66.606 1.00 27.46 ? 695  HOH G O   1 
HETATM 5938 O O   . HOH S 3 .   ? 7.436   -22.349 59.166 1.00 23.86 ? 696  HOH G O   1 
HETATM 5939 O O   . HOH S 3 .   ? 26.801  -36.661 50.459 1.00 23.51 ? 697  HOH G O   1 
HETATM 5940 O O   . HOH S 3 .   ? 19.548  -14.711 68.374 1.00 33.32 ? 698  HOH G O   1 
HETATM 5941 O O   . HOH S 3 .   ? 1.953   -31.877 58.469 1.00 30.16 ? 699  HOH G O   1 
HETATM 5942 O O   . HOH S 3 .   ? 7.007   -29.244 44.315 1.00 30.28 ? 700  HOH G O   1 
HETATM 5943 O O   . HOH S 3 .   ? 33.645  -32.296 54.301 1.00 40.56 ? 701  HOH G O   1 
HETATM 5944 O O   . HOH S 3 .   ? 22.682  -32.875 63.425 1.00 26.98 ? 702  HOH G O   1 
HETATM 5945 O O   . HOH S 3 .   ? 7.120   -2.183  48.506 1.00 32.25 ? 703  HOH G O   1 
HETATM 5946 O O   . HOH S 3 .   ? 25.947  -17.398 65.359 1.00 31.01 ? 704  HOH G O   1 
HETATM 5947 O O   . HOH S 3 .   ? 33.465  -17.832 62.702 1.00 39.10 ? 705  HOH G O   1 
HETATM 5948 O O   . HOH S 3 .   ? 14.851  -31.309 39.438 1.00 23.53 ? 706  HOH G O   1 
HETATM 5949 O O   . HOH S 3 .   ? 21.895  -9.701  53.405 1.00 23.08 ? 707  HOH G O   1 
HETATM 5950 O O   . HOH S 3 .   ? 29.543  -37.001 51.204 1.00 32.91 ? 708  HOH G O   1 
HETATM 5951 O O   . HOH S 3 .   ? 5.928   -24.514 60.842 1.00 39.01 ? 709  HOH G O   1 
HETATM 5952 O O   . HOH S 3 .   ? 19.487  -16.557 36.801 1.00 26.38 ? 710  HOH G O   1 
HETATM 5953 O O   . HOH S 3 .   ? 31.313  -34.065 57.754 1.00 37.68 ? 711  HOH G O   1 
HETATM 5954 O O   . HOH S 3 .   ? 24.040  -36.351 60.510 1.00 23.84 ? 712  HOH G O   1 
HETATM 5955 O O   . HOH S 3 .   ? 15.157  -16.205 41.162 1.00 19.69 ? 713  HOH G O   1 
HETATM 5956 O O   . HOH S 3 .   ? 7.524   -3.398  52.887 1.00 38.40 ? 714  HOH G O   1 
HETATM 5957 O O   . HOH S 3 .   ? 18.619  -36.522 63.013 1.00 43.06 ? 715  HOH G O   1 
HETATM 5958 O O   . HOH S 3 .   ? 27.734  -14.310 61.292 1.00 29.93 ? 716  HOH G O   1 
HETATM 5959 O O   . HOH S 3 .   ? 4.242   -15.434 48.995 1.00 25.28 ? 717  HOH G O   1 
HETATM 5960 O O   . HOH S 3 .   ? 25.285  -13.809 64.619 1.00 31.27 ? 718  HOH G O   1 
HETATM 5961 O O   . HOH S 3 .   ? 17.336  -15.137 39.648 1.00 18.88 ? 719  HOH G O   1 
HETATM 5962 O O   . HOH S 3 .   ? 13.398  -8.613  38.113 1.00 37.25 ? 720  HOH G O   1 
HETATM 5963 O O   . HOH S 3 .   ? 24.585  -27.639 36.000 1.00 26.99 ? 721  HOH G O   1 
HETATM 5964 O O   . HOH S 3 .   ? 16.512  -31.164 64.476 1.00 36.35 ? 722  HOH G O   1 
HETATM 5965 O O   . HOH S 3 .   ? 11.333  -7.530  40.021 1.00 28.74 ? 723  HOH G O   1 
HETATM 5966 O O   . HOH S 3 .   ? 6.046   -11.327 45.922 1.00 29.95 ? 724  HOH G O   1 
HETATM 5967 O O   . HOH S 3 .   ? 19.222  -19.140 68.470 1.00 46.34 ? 725  HOH G O   1 
HETATM 5968 O O   . HOH S 3 .   ? 16.553  -11.916 39.065 1.00 45.09 ? 726  HOH G O   1 
HETATM 5969 O O   . HOH S 3 .   ? 24.021  -5.224  53.172 1.00 41.75 ? 727  HOH G O   1 
HETATM 5970 O O   . HOH S 3 .   ? 32.672  -27.213 54.925 1.00 42.42 ? 728  HOH G O   1 
HETATM 5971 O O   . HOH S 3 .   ? 14.122  -13.638 63.700 1.00 44.91 ? 729  HOH G O   1 
HETATM 5972 O O   . HOH S 3 .   ? 5.186   -28.192 51.248 1.00 32.97 ? 730  HOH G O   1 
HETATM 5973 O O   . HOH S 3 .   ? 12.767  -12.688 33.507 1.00 31.56 ? 731  HOH G O   1 
HETATM 5974 O O   . HOH S 3 .   ? 17.512  -22.443 65.673 1.00 36.20 ? 732  HOH G O   1 
HETATM 5975 O O   . HOH S 3 .   ? 22.788  -7.306  54.646 1.00 32.18 ? 733  HOH G O   1 
HETATM 5976 O O   . HOH S 3 .   ? 15.859  -25.959 64.813 1.00 39.06 ? 734  HOH G O   1 
HETATM 5977 O O   . HOH S 3 .   ? 2.507   -20.808 54.422 1.00 42.03 ? 735  HOH G O   1 
HETATM 5978 O O   . HOH S 3 .   ? 29.337  -30.436 58.021 1.00 22.49 ? 736  HOH G O   1 
HETATM 5979 O O   . HOH S 3 .   ? 20.425  -25.429 66.522 1.00 19.53 ? 737  HOH G O   1 
HETATM 5980 O O   . HOH S 3 .   ? 15.696  -34.184 40.744 1.00 27.76 ? 738  HOH G O   1 
HETATM 5981 O O   . HOH S 3 .   ? 22.072  -37.847 59.842 1.00 21.25 ? 739  HOH G O   1 
HETATM 5982 O O   . HOH S 3 .   ? 9.193   -31.324 45.398 1.00 42.10 ? 740  HOH G O   1 
HETATM 5983 O O   . HOH S 3 .   ? 5.743   -27.682 47.559 1.00 40.33 ? 741  HOH G O   1 
HETATM 5984 O O   . HOH S 3 .   ? 23.723  -25.564 37.326 1.00 25.79 ? 742  HOH G O   1 
HETATM 5985 O O   . HOH S 3 .   ? 23.189  -30.873 66.075 1.00 30.71 ? 743  HOH G O   1 
HETATM 5986 O O   . HOH S 3 .   ? 37.658  -15.115 46.722 1.00 36.06 ? 744  HOH G O   1 
HETATM 5987 O O   . HOH S 3 .   ? 11.900  -18.733 59.258 1.00 21.26 ? 745  HOH G O   1 
HETATM 5988 O O   . HOH S 3 .   ? 33.190  -27.678 59.892 1.00 28.82 ? 746  HOH G O   1 
HETATM 5989 O O   . HOH S 3 .   ? 12.520  -20.314 63.347 1.00 33.30 ? 747  HOH G O   1 
HETATM 5990 O O   . HOH S 3 .   ? 19.554  -37.148 51.020 1.00 11.87 ? 748  HOH G O   1 
HETATM 5991 O O   . HOH S 3 .   ? 4.304   -13.445 44.225 1.00 36.42 ? 749  HOH G O   1 
HETATM 5992 O O   . HOH S 3 .   ? 18.981  -25.414 34.517 1.00 29.18 ? 750  HOH G O   1 
HETATM 5993 O O   . HOH S 3 .   ? 29.949  -16.628 60.500 1.00 41.26 ? 751  HOH G O   1 
HETATM 5994 O O   . HOH S 3 .   ? 22.390  -40.447 58.900 1.00 32.23 ? 752  HOH G O   1 
HETATM 5995 O O   . HOH S 3 .   ? 9.647   -32.766 51.371 1.00 18.25 ? 753  HOH G O   1 
HETATM 5996 O O   . HOH S 3 .   ? 37.549  -17.301 44.418 1.00 27.32 ? 754  HOH G O   1 
HETATM 5997 O O   . HOH S 3 .   ? 5.170   -13.679 34.871 1.00 40.36 ? 755  HOH G O   1 
HETATM 5998 O O   . HOH S 3 .   ? 22.517  -34.961 47.624 1.00 19.29 ? 756  HOH G O   1 
HETATM 5999 O O   . HOH S 3 .   ? 30.359  -31.114 60.491 1.00 20.55 ? 757  HOH G O   1 
HETATM 6000 O O   . HOH S 3 .   ? 9.266   -7.140  54.156 1.00 20.35 ? 758  HOH G O   1 
HETATM 6001 O O   . HOH S 3 .   ? 15.268  -9.241  62.146 1.00 32.77 ? 759  HOH G O   1 
HETATM 6002 O O   . HOH S 3 .   ? 6.091   -25.795 40.582 1.00 24.41 ? 760  HOH G O   1 
HETATM 6003 O O   . HOH S 3 .   ? 25.941  -35.264 43.319 1.00 46.39 ? 761  HOH G O   1 
HETATM 6004 O O   . HOH S 3 .   ? 9.180   -19.418 59.196 1.00 23.03 ? 762  HOH G O   1 
HETATM 6005 O O   . HOH S 3 .   ? 19.402  -33.203 66.504 1.00 39.86 ? 763  HOH G O   1 
HETATM 6006 O O   . HOH S 3 .   ? 35.524  -16.793 53.496 1.00 36.09 ? 764  HOH G O   1 
HETATM 6007 O O   . HOH S 3 .   ? 4.631   -33.369 56.563 1.00 36.53 ? 765  HOH G O   1 
HETATM 6008 O O   . HOH S 3 .   ? 30.092  -19.795 57.852 1.00 21.76 ? 766  HOH G O   1 
HETATM 6009 O O   . HOH S 3 .   ? 10.846  -5.977  58.361 1.00 31.68 ? 767  HOH G O   1 
HETATM 6010 O O   . HOH S 3 .   ? 31.162  -33.598 60.372 1.00 28.24 ? 768  HOH G O   1 
HETATM 6011 O O   . HOH S 3 .   ? 21.557  -32.164 34.496 1.00 36.55 ? 769  HOH G O   1 
HETATM 6012 O O   . HOH S 3 .   ? 4.239   -23.126 43.727 1.00 29.48 ? 770  HOH G O   1 
HETATM 6013 O O   . HOH S 3 .   ? 11.410  -5.210  54.063 1.00 20.42 ? 771  HOH G O   1 
HETATM 6014 O O   . HOH S 3 .   ? 38.032  -19.424 45.592 1.00 32.38 ? 772  HOH G O   1 
HETATM 6015 O O   . HOH S 3 .   ? 13.014  -32.181 42.232 1.00 32.01 ? 773  HOH G O   1 
HETATM 6016 O O   . HOH S 3 .   ? 31.443  -12.987 58.383 1.00 27.71 ? 774  HOH G O   1 
HETATM 6017 O O   . HOH S 3 .   ? 19.813  -21.323 68.777 1.00 36.89 ? 775  HOH G O   1 
HETATM 6018 O O   . HOH S 3 .   ? 6.907   -6.079  53.174 1.00 29.45 ? 776  HOH G O   1 
HETATM 6019 O O   . HOH S 3 .   ? 20.605  -38.366 62.148 1.00 31.83 ? 777  HOH G O   1 
HETATM 6020 O O   . HOH S 3 .   ? 29.533  -8.328  54.065 1.00 25.59 ? 778  HOH G O   1 
HETATM 6021 O O   . HOH S 3 .   ? 23.184  -36.477 39.411 1.00 44.98 ? 779  HOH G O   1 
HETATM 6022 O O   . HOH S 3 .   ? 4.231   -14.735 56.105 1.00 40.33 ? 780  HOH G O   1 
HETATM 6023 O O   . HOH S 3 .   ? 8.108   -12.583 58.290 1.00 33.65 ? 781  HOH G O   1 
HETATM 6024 O O   . HOH S 3 .   ? 5.145   -4.315  48.130 1.00 36.76 ? 782  HOH G O   1 
HETATM 6025 O O   . HOH S 3 .   ? 15.233  -9.888  64.322 1.00 36.89 ? 783  HOH G O   1 
HETATM 6026 O O   . HOH S 3 .   ? 3.080   -14.915 40.169 1.00 37.38 ? 784  HOH G O   1 
HETATM 6027 O O   . HOH S 3 .   ? 7.140   -32.726 50.149 1.00 33.52 ? 785  HOH G O   1 
HETATM 6028 O O   . HOH S 3 .   ? 9.403   -17.857 63.488 1.00 46.73 ? 786  HOH G O   1 
HETATM 6029 O O   . HOH S 3 .   ? 5.259   -27.088 42.527 1.00 33.85 ? 787  HOH G O   1 
HETATM 6030 O O   . HOH S 3 .   ? 13.077  -15.665 65.221 1.00 49.14 ? 788  HOH G O   1 
HETATM 6031 O O   . HOH S 3 .   ? 20.800  -36.009 37.673 1.00 31.73 ? 789  HOH G O   1 
HETATM 6032 O O   . HOH S 3 .   ? 7.379   -11.000 53.860 1.00 20.81 ? 790  HOH G O   1 
HETATM 6033 O O   . HOH S 3 .   ? 36.273  -18.399 55.076 1.00 44.27 ? 791  HOH G O   1 
HETATM 6034 O O   . HOH S 3 .   ? 6.883   -15.790 59.959 1.00 34.62 ? 792  HOH G O   1 
HETATM 6035 O O   . HOH S 3 .   ? 5.348   -12.957 49.740 1.00 23.98 ? 793  HOH G O   1 
HETATM 6036 O O   . HOH S 3 .   ? 4.381   -15.710 42.601 1.00 30.74 ? 794  HOH G O   1 
HETATM 6037 O O   . HOH S 3 .   ? 5.706   -7.092  50.967 1.00 26.21 ? 795  HOH G O   1 
HETATM 6038 O O   . HOH S 3 .   ? 7.049   -7.755  48.594 1.00 21.88 ? 796  HOH G O   1 
HETATM 6039 O O   . HOH S 3 .   ? 5.615   -30.607 50.084 1.00 44.94 ? 797  HOH G O   1 
HETATM 6040 O O   . HOH S 3 .   ? 3.665   -12.983 46.344 1.00 40.58 ? 798  HOH G O   1 
HETATM 6041 O O   . HOH S 3 .   ? 5.440   -12.120 52.256 1.00 37.17 ? 799  HOH G O   1 
HETATM 6042 O O   . HOH S 3 .   ? 3.795   -13.215 54.504 1.00 37.06 ? 800  HOH G O   1 
HETATM 6043 O O   . HOH S 3 .   ? 11.757  -18.151 64.756 1.00 41.30 ? 801  HOH G O   1 
HETATM 6044 O O   . HOH S 3 .   ? 10.818  -4.448  56.438 1.00 44.30 ? 802  HOH G O   1 
HETATM 6045 O O   . HOH T 3 .   ? 18.205  -23.232 36.080 1.00 18.94 ? 101  HOH H O   1 
HETATM 6046 O O   . HOH T 3 .   ? 24.824  -15.231 42.497 1.00 26.00 ? 102  HOH H O   1 
HETATM 6047 O O   . HOH T 3 .   ? 29.187  -16.712 47.694 1.00 23.60 ? 103  HOH H O   1 
HETATM 6048 O O   . HOH T 3 .   ? 21.518  -24.030 36.774 1.00 20.44 ? 104  HOH H O   1 
HETATM 6049 O O   . HOH T 3 .   ? 28.718  -18.067 41.638 1.00 43.63 ? 105  HOH H O   1 
HETATM 6050 O O   . HOH T 3 .   ? 31.497  -24.041 50.643 1.00 43.35 ? 106  HOH H O   1 
HETATM 6051 O O   . HOH T 3 .   ? 20.078  -20.917 31.108 1.00 23.44 ? 107  HOH H O   1 
HETATM 6052 O O   . HOH T 3 .   ? 15.089  -23.913 38.539 1.00 12.91 ? 108  HOH H O   1 
HETATM 6053 O O   . HOH T 3 .   ? 29.822  -20.866 41.896 1.00 37.79 ? 109  HOH H O   1 
HETATM 6054 O O   . HOH T 3 .   ? 30.171  -21.569 43.996 1.00 29.90 ? 110  HOH H O   1 
HETATM 6055 O O   . HOH T 3 .   ? 27.172  -22.072 39.251 1.00 27.68 ? 111  HOH H O   1 
HETATM 6056 O O   . HOH T 3 .   ? 22.649  -17.190 36.112 1.00 27.18 ? 112  HOH H O   1 
HETATM 6057 O O   . HOH T 3 .   ? 22.973  -17.207 42.194 1.00 21.42 ? 113  HOH H O   1 
HETATM 6058 O O   . HOH T 3 .   ? 30.096  -18.997 46.185 1.00 24.50 ? 114  HOH H O   1 
HETATM 6059 O O   . HOH T 3 .   ? 31.898  -23.440 47.913 1.00 38.18 ? 115  HOH H O   1 
HETATM 6060 O O   . HOH T 3 .   ? 26.878  -28.374 44.466 1.00 33.99 ? 116  HOH H O   1 
HETATM 6061 O O   . HOH T 3 .   ? 26.914  -15.718 40.547 1.00 46.28 ? 117  HOH H O   1 
HETATM 6062 O O   . HOH U 3 .   ? 11.756  -31.079 36.310 1.00 26.27 ? 601  HOH I O   1 
HETATM 6063 O O   . HOH U 3 .   ? -0.809  -21.940 13.483 1.00 28.44 ? 602  HOH I O   1 
HETATM 6064 O O   . HOH U 3 .   ? 3.057   -44.406 28.339 1.00 36.84 ? 603  HOH I O   1 
HETATM 6065 O O   . HOH U 3 .   ? 6.191   -35.943 10.449 1.00 16.00 ? 604  HOH I O   1 
HETATM 6066 O O   . HOH U 3 .   ? -9.924  -29.534 29.054 1.00 38.87 ? 605  HOH I O   1 
HETATM 6067 O O   . HOH U 3 .   ? 0.985   -17.495 30.624 1.00 35.75 ? 606  HOH I O   1 
HETATM 6068 O O   . HOH U 3 .   ? 7.441   -37.510 35.045 1.00 17.77 ? 607  HOH I O   1 
HETATM 6069 O O   . HOH U 3 .   ? -7.981  -37.390 30.738 1.00 37.23 ? 608  HOH I O   1 
HETATM 6070 O O   . HOH U 3 .   ? -1.645  -33.244 17.219 1.00 25.17 ? 609  HOH I O   1 
HETATM 6071 O O   . HOH U 3 .   ? 12.905  -28.067 31.005 1.00 17.82 ? 610  HOH I O   1 
HETATM 6072 O O   . HOH U 3 .   ? -9.285  -22.723 34.406 1.00 38.55 ? 611  HOH I O   1 
HETATM 6073 O O   . HOH U 3 .   ? 0.611   -39.696 41.251 1.00 18.75 ? 612  HOH I O   1 
HETATM 6074 O O   . HOH U 3 .   ? -9.336  -36.766 27.303 1.00 36.58 ? 613  HOH I O   1 
HETATM 6075 O O   . HOH U 3 .   ? -5.803  -25.625 38.759 1.00 36.43 ? 614  HOH I O   1 
HETATM 6076 O O   . HOH U 3 .   ? 20.278  -23.863 30.375 1.00 31.77 ? 615  HOH I O   1 
HETATM 6077 O O   . HOH U 3 .   ? 8.032   -26.947 39.021 1.00 19.34 ? 616  HOH I O   1 
HETATM 6078 O O   . HOH U 3 .   ? 9.494   -15.951 22.143 1.00 19.92 ? 617  HOH I O   1 
HETATM 6079 O O   . HOH U 3 .   ? 9.939   -23.645 34.806 1.00 19.07 ? 618  HOH I O   1 
HETATM 6080 O O   . HOH U 3 .   ? 13.719  -25.029 34.754 1.00 14.02 ? 619  HOH I O   1 
HETATM 6081 O O   . HOH U 3 .   ? -6.740  -20.640 19.028 1.00 34.49 ? 620  HOH I O   1 
HETATM 6082 O O   . HOH U 3 .   ? 18.598  -34.032 33.085 1.00 30.02 ? 621  HOH I O   1 
HETATM 6083 O O   . HOH U 3 .   ? -0.791  -16.200 28.498 1.00 21.58 ? 622  HOH I O   1 
HETATM 6084 O O   . HOH U 3 .   ? 1.286   -44.488 22.780 1.00 32.09 ? 623  HOH I O   1 
HETATM 6085 O O   . HOH U 3 .   ? 1.852   -45.154 39.031 1.00 21.18 ? 624  HOH I O   1 
HETATM 6086 O O   . HOH U 3 .   ? 15.001  -18.918 34.473 1.00 14.12 ? 625  HOH I O   1 
HETATM 6087 O O   . HOH U 3 .   ? 7.323   -17.971 18.580 1.00 31.66 ? 626  HOH I O   1 
HETATM 6088 O O   . HOH U 3 .   ? 0.060   -16.405 24.915 1.00 13.03 ? 627  HOH I O   1 
HETATM 6089 O O   . HOH U 3 .   ? 13.638  -17.680 32.455 1.00 15.63 ? 628  HOH I O   1 
HETATM 6090 O O   . HOH U 3 .   ? 8.706   -25.156 18.360 1.00 14.82 ? 629  HOH I O   1 
HETATM 6091 O O   . HOH U 3 .   ? 9.714   -33.852 17.174 1.00 15.68 ? 630  HOH I O   1 
HETATM 6092 O O   . HOH U 3 .   ? -9.527  -33.668 19.309 1.00 28.59 ? 631  HOH I O   1 
HETATM 6093 O O   . HOH U 3 .   ? -1.666  -39.556 37.829 1.00 32.87 ? 632  HOH I O   1 
HETATM 6094 O O   . HOH U 3 .   ? -8.723  -41.218 20.905 1.00 26.46 ? 633  HOH I O   1 
HETATM 6095 O O   . HOH U 3 .   ? -5.497  -17.460 24.419 1.00 26.31 ? 634  HOH I O   1 
HETATM 6096 O O   . HOH U 3 .   ? 4.320   -30.132 10.831 1.00 22.32 ? 635  HOH I O   1 
HETATM 6097 O O   . HOH U 3 .   ? 5.804   -23.950 15.435 1.00 26.56 ? 636  HOH I O   1 
HETATM 6098 O O   . HOH U 3 .   ? 19.402  -38.738 32.453 1.00 37.37 ? 637  HOH I O   1 
HETATM 6099 O O   . HOH U 3 .   ? -10.810 -28.564 24.584 1.00 44.16 ? 638  HOH I O   1 
HETATM 6100 O O   . HOH U 3 .   ? -4.393  -16.141 31.608 1.00 41.58 ? 639  HOH I O   1 
HETATM 6101 O O   . HOH U 3 .   ? 7.927   -22.949 19.837 1.00 15.72 ? 640  HOH I O   1 
HETATM 6102 O O   . HOH U 3 .   ? 10.844  -14.117 25.056 1.00 35.51 ? 641  HOH I O   1 
HETATM 6103 O O   . HOH U 3 .   ? 12.731  -30.487 17.457 1.00 27.55 ? 642  HOH I O   1 
HETATM 6104 O O   . HOH U 3 .   ? -0.178  -26.133 19.220 1.00 12.00 ? 643  HOH I O   1 
HETATM 6105 O O   . HOH U 3 .   ? -4.109  -32.082 18.021 1.00 18.84 ? 644  HOH I O   1 
HETATM 6106 O O   . HOH U 3 .   ? -2.428  -35.653 37.972 1.00 31.32 ? 645  HOH I O   1 
HETATM 6107 O O   . HOH U 3 .   ? 14.580  -27.257 33.224 1.00 12.61 ? 646  HOH I O   1 
HETATM 6108 O O   . HOH U 3 .   ? -8.333  -25.678 21.452 1.00 24.90 ? 647  HOH I O   1 
HETATM 6109 O O   . HOH U 3 .   ? -8.864  -24.032 37.842 1.00 30.09 ? 648  HOH I O   1 
HETATM 6110 O O   . HOH U 3 .   ? 16.986  -40.364 36.111 1.00 21.87 ? 649  HOH I O   1 
HETATM 6111 O O   . HOH U 3 .   ? -1.569  -32.837 14.709 1.00 24.87 ? 650  HOH I O   1 
HETATM 6112 O O   . HOH U 3 .   ? 15.547  -29.123 29.354 1.00 32.33 ? 651  HOH I O   1 
HETATM 6113 O O   . HOH U 3 .   ? 10.269  -22.713 20.939 1.00 14.21 ? 652  HOH I O   1 
HETATM 6114 O O   . HOH U 3 .   ? -2.324  -22.147 27.868 1.00 22.14 ? 653  HOH I O   1 
HETATM 6115 O O   . HOH U 3 .   ? 17.277  -28.142 28.539 1.00 31.30 ? 654  HOH I O   1 
HETATM 6116 O O   . HOH U 3 .   ? -7.820  -43.333 24.107 1.00 29.79 ? 655  HOH I O   1 
HETATM 6117 O O   . HOH U 3 .   ? 12.653  -33.549 37.167 1.00 20.92 ? 656  HOH I O   1 
HETATM 6118 O O   . HOH U 3 .   ? 13.710  -21.124 35.629 1.00 10.54 ? 657  HOH I O   1 
HETATM 6119 O O   . HOH U 3 .   ? -0.391  -21.162 29.821 1.00 20.86 ? 658  HOH I O   1 
HETATM 6120 O O   . HOH U 3 .   ? 1.550   -21.476 43.885 1.00 34.60 ? 659  HOH I O   1 
HETATM 6121 O O   . HOH U 3 .   ? 8.452   -21.827 33.885 1.00 13.15 ? 660  HOH I O   1 
HETATM 6122 O O   . HOH U 3 .   ? -1.469  -45.247 22.249 1.00 37.60 ? 661  HOH I O   1 
HETATM 6123 O O   . HOH U 3 .   ? 1.756   -15.952 20.459 1.00 13.41 ? 662  HOH I O   1 
HETATM 6124 O O   . HOH U 3 .   ? 18.099  -31.176 27.324 1.00 45.32 ? 663  HOH I O   1 
HETATM 6125 O O   . HOH U 3 .   ? -0.780  -17.794 33.343 1.00 32.83 ? 664  HOH I O   1 
HETATM 6126 O O   . HOH U 3 .   ? 9.006   -25.063 13.915 1.00 29.90 ? 665  HOH I O   1 
HETATM 6127 O O   . HOH U 3 .   ? 11.804  -27.224 12.134 1.00 40.23 ? 666  HOH I O   1 
HETATM 6128 O O   . HOH U 3 .   ? -7.677  -25.498 31.697 1.00 29.12 ? 667  HOH I O   1 
HETATM 6129 O O   . HOH U 3 .   ? -3.120  -21.936 31.102 1.00 32.36 ? 668  HOH I O   1 
HETATM 6130 O O   . HOH U 3 .   ? -2.870  -41.433 35.879 1.00 25.95 ? 669  HOH I O   1 
HETATM 6131 O O   . HOH U 3 .   ? 2.616   -41.720 28.344 1.00 40.82 ? 670  HOH I O   1 
HETATM 6132 O O   . HOH U 3 .   ? 3.735   -43.097 26.736 1.00 25.87 ? 671  HOH I O   1 
HETATM 6133 O O   . HOH U 3 .   ? -0.679  -34.218 39.644 1.00 22.52 ? 672  HOH I O   1 
HETATM 6134 O O   . HOH U 3 .   ? -4.012  -49.317 31.667 1.00 42.94 ? 673  HOH I O   1 
HETATM 6135 O O   . HOH U 3 .   ? -4.519  -23.130 33.711 1.00 26.28 ? 674  HOH I O   1 
HETATM 6136 O O   . HOH U 3 .   ? 15.198  -19.766 20.635 1.00 30.70 ? 675  HOH I O   1 
HETATM 6137 O O   . HOH U 3 .   ? 5.471   -33.711 9.874  1.00 20.58 ? 676  HOH I O   1 
HETATM 6138 O O   . HOH U 3 .   ? -8.016  -35.360 34.523 1.00 32.96 ? 677  HOH I O   1 
HETATM 6139 O O   . HOH U 3 .   ? 0.341   -30.037 39.900 1.00 32.24 ? 678  HOH I O   1 
HETATM 6140 O O   . HOH U 3 .   ? -5.454  -19.828 27.161 1.00 33.27 ? 679  HOH I O   1 
HETATM 6141 O O   . HOH U 3 .   ? -4.191  -17.096 17.703 1.00 18.79 ? 680  HOH I O   1 
HETATM 6142 O O   . HOH U 3 .   ? 12.594  -29.174 20.243 1.00 19.89 ? 681  HOH I O   1 
HETATM 6143 O O   . HOH U 3 .   ? 19.739  -34.668 34.739 1.00 35.94 ? 682  HOH I O   1 
HETATM 6144 O O   . HOH U 3 .   ? 7.866   -12.878 29.480 1.00 30.02 ? 683  HOH I O   1 
HETATM 6145 O O   . HOH U 3 .   ? 8.951   -14.648 27.344 1.00 25.62 ? 684  HOH I O   1 
HETATM 6146 O O   . HOH U 3 .   ? 8.711   -14.809 33.694 1.00 24.05 ? 685  HOH I O   1 
HETATM 6147 O O   . HOH U 3 .   ? 12.560  -36.664 38.647 1.00 25.98 ? 686  HOH I O   1 
HETATM 6148 O O   . HOH U 3 .   ? -1.051  -44.847 16.047 1.00 44.61 ? 687  HOH I O   1 
HETATM 6149 O O   . HOH U 3 .   ? 13.667  -15.926 21.063 1.00 33.23 ? 688  HOH I O   1 
HETATM 6150 O O   . HOH U 3 .   ? 3.572   -37.088 15.846 1.00 34.72 ? 689  HOH I O   1 
HETATM 6151 O O   . HOH U 3 .   ? -8.436  -38.994 19.079 1.00 25.32 ? 690  HOH I O   1 
HETATM 6152 O O   . HOH U 3 .   ? -5.625  -39.575 17.605 1.00 38.68 ? 691  HOH I O   1 
HETATM 6153 O O   . HOH U 3 .   ? -7.798  -28.071 32.131 1.00 34.45 ? 692  HOH I O   1 
HETATM 6154 O O   . HOH U 3 .   ? 5.045   -18.604 35.245 1.00 32.91 ? 693  HOH I O   1 
HETATM 6155 O O   . HOH U 3 .   ? 17.048  -41.255 30.166 1.00 42.69 ? 694  HOH I O   1 
HETATM 6156 O O   . HOH U 3 .   ? 5.433   -21.190 16.426 1.00 28.87 ? 695  HOH I O   1 
HETATM 6157 O O   . HOH U 3 .   ? -5.111  -22.552 40.346 1.00 44.25 ? 696  HOH I O   1 
HETATM 6158 O O   . HOH U 3 .   ? -4.644  -35.348 12.857 1.00 33.54 ? 697  HOH I O   1 
HETATM 6159 O O   . HOH U 3 .   ? 22.141  -22.702 28.595 1.00 36.66 ? 698  HOH I O   1 
HETATM 6160 O O   . HOH U 3 .   ? 3.448   -33.525 41.978 1.00 23.73 ? 699  HOH I O   1 
HETATM 6161 O O   . HOH U 3 .   ? 17.950  -27.874 30.707 1.00 31.25 ? 700  HOH I O   1 
HETATM 6162 O O   . HOH U 3 .   ? 13.194  -21.998 14.127 1.00 44.64 ? 701  HOH I O   1 
HETATM 6163 O O   . HOH U 3 .   ? 6.857   -45.106 26.841 1.00 29.87 ? 702  HOH I O   1 
HETATM 6164 O O   . HOH U 3 .   ? 3.192   -16.683 32.874 1.00 34.77 ? 703  HOH I O   1 
HETATM 6165 O O   . HOH U 3 .   ? 6.516   -24.243 12.648 1.00 24.82 ? 704  HOH I O   1 
HETATM 6166 O O   . HOH U 3 .   ? 8.095   -20.504 18.387 1.00 22.84 ? 705  HOH I O   1 
HETATM 6167 O O   . HOH U 3 .   ? 4.606   -25.220 10.827 1.00 21.41 ? 706  HOH I O   1 
HETATM 6168 O O   . HOH U 3 .   ? 2.209   -20.990 10.127 1.00 29.55 ? 707  HOH I O   1 
HETATM 6169 O O   . HOH U 3 .   ? 8.246   -31.656 40.743 1.00 36.60 ? 708  HOH I O   1 
HETATM 6170 O O   . HOH U 3 .   ? -2.163  -38.018 10.845 1.00 40.55 ? 709  HOH I O   1 
HETATM 6171 O O   . HOH U 3 .   ? 7.207   -37.876 11.216 1.00 31.78 ? 710  HOH I O   1 
HETATM 6172 O O   . HOH U 3 .   ? 4.178   -14.318 32.315 1.00 29.38 ? 711  HOH I O   1 
HETATM 6173 O O   . HOH U 3 .   ? -10.446 -31.914 38.151 1.00 42.17 ? 712  HOH I O   1 
HETATM 6174 O O   . HOH U 3 .   ? -9.125  -23.145 22.179 1.00 44.90 ? 713  HOH I O   1 
HETATM 6175 O O   . HOH U 3 .   ? 4.091   -36.709 11.269 1.00 35.00 ? 714  HOH I O   1 
HETATM 6176 O O   . HOH U 3 .   ? 6.686   -42.217 23.358 1.00 38.29 ? 715  HOH I O   1 
HETATM 6177 O O   . HOH U 3 .   ? 1.615   -35.359 11.646 1.00 43.54 ? 716  HOH I O   1 
HETATM 6178 O O   . HOH U 3 .   ? 10.080  -22.667 14.355 1.00 45.83 ? 717  HOH I O   1 
HETATM 6179 O O   . HOH U 3 .   ? 17.246  -27.426 33.248 1.00 23.92 ? 718  HOH I O   1 
HETATM 6180 O O   . HOH U 3 .   ? 16.346  -16.774 35.780 1.00 24.14 ? 719  HOH I O   1 
HETATM 6181 O O   . HOH U 3 .   ? 7.411   -38.152 14.084 1.00 31.10 ? 720  HOH I O   1 
HETATM 6182 O O   . HOH U 3 .   ? 15.451  -23.307 36.035 1.00 13.75 ? 721  HOH I O   1 
HETATM 6183 O O   . HOH U 3 .   ? 8.476   -23.578 16.081 1.00 24.74 ? 722  HOH I O   1 
HETATM 6184 O O   . HOH U 3 .   ? 16.445  -14.559 33.889 1.00 38.45 ? 723  HOH I O   1 
HETATM 6185 O O   . HOH U 3 .   ? -5.586  -23.998 30.743 1.00 31.87 ? 724  HOH I O   1 
HETATM 6186 O O   . HOH U 3 .   ? 5.366   -17.236 38.910 1.00 27.74 ? 725  HOH I O   1 
HETATM 6187 O O   . HOH U 3 .   ? 13.399  -43.236 32.784 1.00 25.07 ? 726  HOH I O   1 
HETATM 6188 O O   . HOH U 3 .   ? 3.168   -38.480 41.546 1.00 22.26 ? 727  HOH I O   1 
HETATM 6189 O O   . HOH U 3 .   ? 19.462  -40.011 34.774 1.00 35.01 ? 728  HOH I O   1 
HETATM 6190 O O   . HOH U 3 .   ? -4.105  -24.249 27.811 1.00 21.97 ? 729  HOH I O   1 
HETATM 6191 O O   . HOH U 3 .   ? 9.710   -33.546 40.011 1.00 39.03 ? 730  HOH I O   1 
HETATM 6192 O O   . HOH U 3 .   ? 14.196  -14.770 32.365 1.00 25.48 ? 731  HOH I O   1 
HETATM 6193 O O   . HOH U 3 .   ? 5.192   -45.756 29.559 1.00 28.13 ? 732  HOH I O   1 
HETATM 6194 O O   . HOH U 3 .   ? -8.798  -34.883 39.805 1.00 38.71 ? 733  HOH I O   1 
HETATM 6195 O O   . HOH U 3 .   ? 20.575  -37.050 30.564 1.00 46.59 ? 734  HOH I O   1 
HETATM 6196 O O   . HOH U 3 .   ? -1.706  -38.073 41.026 1.00 22.28 ? 735  HOH I O   1 
HETATM 6197 O O   . HOH U 3 .   ? -5.075  -35.038 38.979 1.00 31.88 ? 736  HOH I O   1 
HETATM 6198 O O   . HOH U 3 .   ? 1.616   -31.512 41.928 1.00 42.20 ? 737  HOH I O   1 
HETATM 6199 O O   . HOH U 3 .   ? -10.386 -26.575 28.615 1.00 40.43 ? 738  HOH I O   1 
HETATM 6200 O O   . HOH U 3 .   ? -1.252  -18.723 30.734 1.00 33.82 ? 739  HOH I O   1 
HETATM 6201 O O   . HOH U 3 .   ? -2.205  -14.656 30.343 1.00 23.27 ? 740  HOH I O   1 
HETATM 6202 O O   . HOH U 3 .   ? -6.414  -44.954 17.311 1.00 47.93 ? 741  HOH I O   1 
HETATM 6203 O O   . HOH U 3 .   ? -7.220  -19.497 24.947 1.00 37.24 ? 742  HOH I O   1 
HETATM 6204 O O   . HOH U 3 .   ? 20.107  -36.150 32.497 1.00 44.49 ? 743  HOH I O   1 
HETATM 6205 O O   . HOH U 3 .   ? 2.569   -36.181 42.497 1.00 39.64 ? 744  HOH I O   1 
HETATM 6206 O O   . HOH U 3 .   ? 8.835   -20.752 15.357 1.00 42.06 ? 745  HOH I O   1 
HETATM 6207 O O   . HOH U 3 .   ? -6.454  -15.769 18.820 1.00 19.62 ? 746  HOH I O   1 
HETATM 6208 O O   . HOH U 3 .   ? -9.684  -26.156 18.822 1.00 35.34 ? 747  HOH I O   1 
HETATM 6209 O O   . HOH U 3 .   ? 14.082  -37.071 10.500 1.00 28.79 ? 748  HOH I O   1 
HETATM 6210 O O   . HOH U 3 .   ? 15.940  -15.665 22.945 1.00 48.22 ? 749  HOH I O   1 
HETATM 6211 O O   . HOH U 3 .   ? 21.746  -34.247 35.409 1.00 43.06 ? 750  HOH I O   1 
HETATM 6212 O O   . HOH U 3 .   ? -3.091  -37.922 38.706 1.00 29.78 ? 751  HOH I O   1 
HETATM 6213 O O   . HOH U 3 .   ? -0.435  -35.774 41.924 1.00 26.50 ? 752  HOH I O   1 
HETATM 6214 O O   . HOH U 3 .   ? -9.335  -35.650 32.516 1.00 39.67 ? 753  HOH I O   1 
HETATM 6215 O O   . HOH U 3 .   ? -9.663  -24.828 29.949 1.00 43.68 ? 754  HOH I O   1 
HETATM 6216 O O   . HOH U 3 .   ? -5.660  -40.998 36.542 1.00 44.47 ? 755  HOH I O   1 
HETATM 6217 O O   . HOH U 3 .   ? -9.369  -36.509 38.199 1.00 35.91 ? 756  HOH I O   1 
HETATM 6218 O O   . HOH U 3 .   ? -11.809 -36.672 33.464 1.00 41.06 ? 757  HOH I O   1 
HETATM 6219 O O   . HOH U 3 .   ? 25.913  -16.459 22.640 1.00 42.32 ? 758  HOH I O   1 
HETATM 6220 O O   . HOH V 3 .   ? 6.162   -37.590 16.527 1.00 34.90 ? 101  HOH J O   1 
HETATM 6221 O O   . HOH V 3 .   ? 13.355  -41.295 29.560 1.00 23.09 ? 102  HOH J O   1 
HETATM 6222 O O   . HOH V 3 .   ? 10.957  -42.751 31.727 1.00 19.33 ? 103  HOH J O   1 
HETATM 6223 O O   . HOH V 3 .   ? 11.041  -38.022 16.845 1.00 29.66 ? 104  HOH J O   1 
HETATM 6224 O O   . HOH V 3 .   ? 8.446   -40.433 34.024 1.00 12.51 ? 105  HOH J O   1 
HETATM 6225 O O   . HOH V 3 .   ? 7.560   -39.731 22.899 1.00 23.13 ? 106  HOH J O   1 
HETATM 6226 O O   . HOH V 3 .   ? 13.426  -39.772 19.735 1.00 36.22 ? 107  HOH J O   1 
HETATM 6227 O O   . HOH V 3 .   ? 14.905  -39.924 23.251 1.00 34.93 ? 108  HOH J O   1 
HETATM 6228 O O   . HOH V 3 .   ? 14.128  -37.688 17.547 1.00 43.98 ? 109  HOH J O   1 
HETATM 6229 O O   . HOH V 3 .   ? 9.938   -45.128 24.989 1.00 40.79 ? 110  HOH J O   1 
HETATM 6230 O O   . HOH V 3 .   ? 8.552   -36.382 16.281 1.00 24.15 ? 111  HOH J O   1 
HETATM 6231 O O   . HOH V 3 .   ? 15.358  -42.926 30.622 1.00 41.74 ? 112  HOH J O   1 
HETATM 6232 O O   . HOH V 3 .   ? 15.643  -40.223 28.698 1.00 42.24 ? 113  HOH J O   1 
HETATM 6233 O O   . HOH V 3 .   ? 12.287  -33.154 16.805 1.00 29.99 ? 114  HOH J O   1 
HETATM 6234 O O   . HOH V 3 .   ? 15.944  -39.193 25.950 1.00 39.34 ? 115  HOH J O   1 
HETATM 6235 O O   . HOH V 3 .   ? 15.330  -42.604 22.591 1.00 36.78 ? 116  HOH J O   1 
HETATM 6236 O O   . HOH W 3 .   ? 6.277   -37.283 43.785 1.00 33.27 ? 901  HOH K O   1 
HETATM 6237 O O   . HOH W 3 .   ? 19.790  -60.401 45.884 1.00 30.57 ? 902  HOH K O   1 
HETATM 6238 O O   . HOH W 3 .   ? 24.365  -38.741 43.601 1.00 33.52 ? 903  HOH K O   1 
HETATM 6239 O O   . HOH W 3 .   ? -0.825  -53.942 57.345 1.00 45.31 ? 904  HOH K O   1 
HETATM 6240 O O   . HOH W 3 .   ? 11.819  -58.556 35.070 1.00 44.17 ? 905  HOH K O   1 
HETATM 6241 O O   . HOH W 3 .   ? 12.394  -35.611 42.448 1.00 34.18 ? 906  HOH K O   1 
HETATM 6242 O O   . HOH W 3 .   ? 7.092   -34.394 44.160 1.00 46.08 ? 907  HOH K O   1 
HETATM 6243 O O   . HOH W 3 .   ? 16.804  -57.194 56.855 1.00 29.50 ? 908  HOH K O   1 
HETATM 6244 O O   . HOH W 3 .   ? 14.294  -38.515 48.704 1.00 16.82 ? 909  HOH K O   1 
HETATM 6245 O O   . HOH W 3 .   ? 0.789   -49.114 58.589 1.00 35.39 ? 910  HOH K O   1 
HETATM 6246 O O   . HOH W 3 .   ? -7.001  -39.970 40.270 1.00 39.23 ? 911  HOH K O   1 
HETATM 6247 O O   . HOH W 3 .   ? 13.158  -45.673 39.655 1.00 14.22 ? 912  HOH K O   1 
HETATM 6248 O O   . HOH W 3 .   ? -2.083  -54.991 42.354 1.00 45.01 ? 913  HOH K O   1 
HETATM 6249 O O   . HOH W 3 .   ? 21.521  -54.595 62.323 1.00 33.49 ? 914  HOH K O   1 
HETATM 6250 O O   . HOH W 3 .   ? 6.742   -63.060 40.348 1.00 37.99 ? 915  HOH K O   1 
HETATM 6251 O O   . HOH W 3 .   ? 0.723   -53.736 59.284 1.00 45.44 ? 916  HOH K O   1 
HETATM 6252 O O   . HOH W 3 .   ? 19.470  -56.925 43.579 1.00 40.63 ? 917  HOH K O   1 
HETATM 6253 O O   . HOH W 3 .   ? 4.709   -37.251 57.136 1.00 35.93 ? 918  HOH K O   1 
HETATM 6254 O O   . HOH W 3 .   ? 14.681  -47.818 31.655 1.00 31.66 ? 919  HOH K O   1 
HETATM 6255 O O   . HOH W 3 .   ? 16.175  -63.759 51.041 1.00 37.50 ? 920  HOH K O   1 
HETATM 6256 O O   . HOH W 3 .   ? 15.246  -62.472 44.035 1.00 45.65 ? 921  HOH K O   1 
HETATM 6257 O O   . HOH W 3 .   ? 9.263   -56.463 27.786 1.00 26.56 ? 922  HOH K O   1 
HETATM 6258 O O   . HOH W 3 .   ? 9.868   -43.684 36.483 1.00 14.72 ? 923  HOH K O   1 
HETATM 6259 O O   . HOH W 3 .   ? 4.796   -59.041 34.983 1.00 20.14 ? 924  HOH K O   1 
HETATM 6260 O O   . HOH W 3 .   ? 1.438   -60.869 42.930 1.00 28.42 ? 925  HOH K O   1 
HETATM 6261 O O   . HOH W 3 .   ? 12.752  -58.890 43.675 1.00 20.96 ? 926  HOH K O   1 
HETATM 6262 O O   . HOH W 3 .   ? 6.643   -54.806 62.964 1.00 29.72 ? 927  HOH K O   1 
HETATM 6263 O O   . HOH W 3 .   ? 8.765   -32.879 53.978 1.00 14.38 ? 928  HOH K O   1 
HETATM 6264 O O   . HOH W 3 .   ? 5.735   -65.588 50.057 1.00 41.31 ? 929  HOH K O   1 
HETATM 6265 O O   . HOH W 3 .   ? 8.061   -54.149 28.707 1.00 32.01 ? 930  HOH K O   1 
HETATM 6266 O O   . HOH W 3 .   ? 17.080  -35.363 61.965 1.00 40.31 ? 931  HOH K O   1 
HETATM 6267 O O   . HOH W 3 .   ? 8.476   -36.283 56.168 1.00 19.65 ? 932  HOH K O   1 
HETATM 6268 O O   . HOH W 3 .   ? 6.322   -47.207 62.885 1.00 30.56 ? 933  HOH K O   1 
HETATM 6269 O O   . HOH W 3 .   ? 6.130   -44.504 61.728 1.00 31.41 ? 934  HOH K O   1 
HETATM 6270 O O   . HOH W 3 .   ? 19.195  -50.741 65.470 1.00 42.30 ? 935  HOH K O   1 
HETATM 6271 O O   . HOH W 3 .   ? 5.396   -48.862 32.659 1.00 21.84 ? 936  HOH K O   1 
HETATM 6272 O O   . HOH W 3 .   ? -1.151  -57.359 44.150 1.00 42.05 ? 937  HOH K O   1 
HETATM 6273 O O   . HOH W 3 .   ? 0.603   -39.960 48.872 1.00 40.46 ? 938  HOH K O   1 
HETATM 6274 O O   . HOH W 3 .   ? 14.088  -32.460 56.787 1.00 21.60 ? 939  HOH K O   1 
HETATM 6275 O O   . HOH W 3 .   ? 18.507  -41.200 60.318 1.00 34.18 ? 940  HOH K O   1 
HETATM 6276 O O   . HOH W 3 .   ? 6.387   -46.331 31.936 1.00 17.07 ? 941  HOH K O   1 
HETATM 6277 O O   . HOH W 3 .   ? 11.244  -62.123 45.680 1.00 26.44 ? 942  HOH K O   1 
HETATM 6278 O O   . HOH W 3 .   ? 12.289  -57.799 56.771 1.00 22.62 ? 943  HOH K O   1 
HETATM 6279 O O   . HOH W 3 .   ? 10.228  -58.547 42.916 1.00 24.26 ? 944  HOH K O   1 
HETATM 6280 O O   . HOH W 3 .   ? 16.546  -55.707 34.550 1.00 40.41 ? 945  HOH K O   1 
HETATM 6281 O O   . HOH W 3 .   ? 16.937  -43.087 35.654 1.00 32.97 ? 946  HOH K O   1 
HETATM 6282 O O   . HOH W 3 .   ? 16.793  -48.550 65.394 1.00 34.68 ? 947  HOH K O   1 
HETATM 6283 O O   . HOH W 3 .   ? 12.176  -48.294 29.977 1.00 26.33 ? 948  HOH K O   1 
HETATM 6284 O O   . HOH W 3 .   ? 15.865  -46.175 34.466 1.00 27.64 ? 949  HOH K O   1 
HETATM 6285 O O   . HOH W 3 .   ? 5.761   -39.434 41.175 1.00 18.52 ? 950  HOH K O   1 
HETATM 6286 O O   . HOH W 3 .   ? 16.203  -47.553 37.359 1.00 21.78 ? 951  HOH K O   1 
HETATM 6287 O O   . HOH W 3 .   ? 14.108  -37.825 41.940 1.00 16.84 ? 952  HOH K O   1 
HETATM 6288 O O   . HOH W 3 .   ? 1.453   -57.016 56.781 1.00 25.57 ? 953  HOH K O   1 
HETATM 6289 O O   . HOH W 3 .   ? 13.354  -63.109 54.778 1.00 32.57 ? 954  HOH K O   1 
HETATM 6290 O O   . HOH W 3 .   ? 3.193   -41.361 59.709 1.00 31.99 ? 955  HOH K O   1 
HETATM 6291 O O   . HOH W 3 .   ? -4.121  -38.157 42.386 1.00 30.93 ? 956  HOH K O   1 
HETATM 6292 O O   . HOH W 3 .   ? 5.972   -35.241 50.728 1.00 29.85 ? 957  HOH K O   1 
HETATM 6293 O O   . HOH W 3 .   ? 11.075  -57.482 40.638 1.00 19.56 ? 958  HOH K O   1 
HETATM 6294 O O   . HOH W 3 .   ? 8.508   -64.059 53.480 1.00 33.91 ? 959  HOH K O   1 
HETATM 6295 O O   . HOH W 3 .   ? 20.129  -43.146 37.991 1.00 26.11 ? 960  HOH K O   1 
HETATM 6296 O O   . HOH W 3 .   ? 0.393   -56.483 42.023 1.00 21.17 ? 961  HOH K O   1 
HETATM 6297 O O   . HOH W 3 .   ? 1.795   -34.918 56.371 1.00 41.86 ? 962  HOH K O   1 
HETATM 6298 O O   . HOH W 3 .   ? 4.462   -49.617 62.262 1.00 33.48 ? 963  HOH K O   1 
HETATM 6299 O O   . HOH W 3 .   ? 6.232   -37.626 54.889 1.00 16.67 ? 964  HOH K O   1 
HETATM 6300 O O   . HOH W 3 .   ? 21.601  -56.740 58.860 1.00 38.02 ? 965  HOH K O   1 
HETATM 6301 O O   . HOH W 3 .   ? 10.960  -60.787 60.987 1.00 36.79 ? 966  HOH K O   1 
HETATM 6302 O O   . HOH W 3 .   ? 9.795   -57.484 57.843 1.00 21.60 ? 967  HOH K O   1 
HETATM 6303 O O   . HOH W 3 .   ? 20.011  -40.591 38.718 1.00 23.55 ? 968  HOH K O   1 
HETATM 6304 O O   . HOH W 3 .   ? 7.501   -58.333 51.055 1.00 17.40 ? 969  HOH K O   1 
HETATM 6305 O O   . HOH W 3 .   ? 21.790  -35.728 42.985 1.00 32.78 ? 970  HOH K O   1 
HETATM 6306 O O   . HOH W 3 .   ? 6.317   -44.390 38.672 1.00 18.69 ? 971  HOH K O   1 
HETATM 6307 O O   . HOH W 3 .   ? -0.192  -40.853 53.080 1.00 33.62 ? 972  HOH K O   1 
HETATM 6308 O O   . HOH W 3 .   ? 12.417  -43.905 37.576 1.00 14.02 ? 973  HOH K O   1 
HETATM 6309 O O   . HOH W 3 .   ? -1.072  -50.143 47.874 1.00 35.15 ? 974  HOH K O   1 
HETATM 6310 O O   . HOH W 3 .   ? 6.160   -47.026 65.608 1.00 29.61 ? 975  HOH K O   1 
HETATM 6311 O O   . HOH W 3 .   ? 6.788   -44.399 33.945 1.00 12.85 ? 976  HOH K O   1 
HETATM 6312 O O   . HOH W 3 .   ? -1.517  -40.203 49.707 1.00 34.51 ? 977  HOH K O   1 
HETATM 6313 O O   . HOH W 3 .   ? 12.474  -51.434 66.279 1.00 24.04 ? 978  HOH K O   1 
HETATM 6314 O O   . HOH W 3 .   ? 13.358  -47.737 65.968 1.00 30.01 ? 979  HOH K O   1 
HETATM 6315 O O   . HOH W 3 .   ? -0.700  -60.747 53.046 1.00 43.18 ? 980  HOH K O   1 
HETATM 6316 O O   . HOH W 3 .   ? 4.376   -46.048 38.998 1.00 15.48 ? 981  HOH K O   1 
HETATM 6317 O O   . HOH W 3 .   ? 22.305  -35.703 45.094 1.00 28.02 ? 982  HOH K O   1 
HETATM 6318 O O   . HOH W 3 .   ? 20.995  -40.537 56.416 1.00 24.38 ? 983  HOH K O   1 
HETATM 6319 O O   . HOH W 3 .   ? -0.024  -52.113 48.459 1.00 32.72 ? 984  HOH K O   1 
HETATM 6320 O O   . HOH W 3 .   ? -0.215  -50.710 45.905 1.00 29.20 ? 985  HOH K O   1 
HETATM 6321 O O   . HOH W 3 .   ? -4.044  -48.755 44.165 1.00 35.74 ? 986  HOH K O   1 
HETATM 6322 O O   . HOH W 3 .   ? 12.166  -39.647 41.269 1.00 20.11 ? 987  HOH K O   1 
HETATM 6323 O O   . HOH W 3 .   ? 0.464   -40.161 59.901 1.00 40.22 ? 988  HOH K O   1 
HETATM 6324 O O   . HOH W 3 .   ? 0.477   -37.412 48.010 1.00 39.40 ? 989  HOH K O   1 
HETATM 6325 O O   . HOH W 3 .   ? -0.675  -46.546 55.736 1.00 39.87 ? 990  HOH K O   1 
HETATM 6326 O O   . HOH W 3 .   ? -2.485  -50.883 37.519 1.00 29.91 ? 991  HOH K O   1 
HETATM 6327 O O   . HOH W 3 .   ? 21.436  -49.858 56.505 1.00 39.08 ? 992  HOH K O   1 
HETATM 6328 O O   . HOH W 3 .   ? 15.747  -35.215 43.408 1.00 23.04 ? 993  HOH K O   1 
HETATM 6329 O O   . HOH W 3 .   ? 9.742   -37.360 58.654 1.00 21.85 ? 994  HOH K O   1 
HETATM 6330 O O   . HOH W 3 .   ? -8.013  -38.019 42.898 1.00 38.67 ? 995  HOH K O   1 
HETATM 6331 O O   . HOH W 3 .   ? 1.981   -35.589 59.376 1.00 25.54 ? 996  HOH K O   1 
HETATM 6332 O O   . HOH W 3 .   ? 7.062   -34.042 47.137 1.00 34.11 ? 997  HOH K O   1 
HETATM 6333 O O   . HOH W 3 .   ? 19.847  -56.125 48.104 1.00 20.15 ? 998  HOH K O   1 
HETATM 6334 O O   . HOH W 3 .   ? -2.253  -47.216 49.635 1.00 32.48 ? 999  HOH K O   1 
HETATM 6335 O O   . HOH W 3 .   ? -0.681  -36.483 58.330 1.00 32.07 ? 1000 HOH K O   1 
HETATM 6336 O O   . HOH W 3 .   ? 3.901   -64.669 42.818 1.00 33.93 ? 1001 HOH K O   1 
HETATM 6337 O O   . HOH W 3 .   ? -0.625  -46.615 39.267 1.00 31.20 ? 1002 HOH K O   1 
HETATM 6338 O O   . HOH W 3 .   ? -2.497  -51.080 44.301 1.00 37.81 ? 1003 HOH K O   1 
HETATM 6339 O O   . HOH W 3 .   ? 3.511   -56.213 61.461 1.00 30.62 ? 1004 HOH K O   1 
HETATM 6340 O O   . HOH W 3 .   ? 20.445  -48.706 52.261 1.00 23.88 ? 1005 HOH K O   1 
HETATM 6341 O O   . HOH W 3 .   ? 22.273  -42.891 55.302 1.00 25.45 ? 1006 HOH K O   1 
HETATM 6342 O O   . HOH W 3 .   ? 24.134  -40.123 41.239 1.00 34.15 ? 1007 HOH K O   1 
HETATM 6343 O O   . HOH W 3 .   ? 19.547  -44.965 59.535 1.00 43.19 ? 1008 HOH K O   1 
HETATM 6344 O O   . HOH W 3 .   ? -2.046  -48.087 54.052 1.00 38.60 ? 1009 HOH K O   1 
HETATM 6345 O O   . HOH W 3 .   ? 2.118   -52.260 30.347 1.00 44.62 ? 1010 HOH K O   1 
HETATM 6346 O O   . HOH W 3 .   ? 5.307   -36.776 52.424 1.00 39.10 ? 1011 HOH K O   1 
HETATM 6347 O O   . HOH W 3 .   ? -6.543  -43.757 51.311 1.00 41.85 ? 1012 HOH K O   1 
HETATM 6348 O O   . HOH W 3 .   ? 15.704  -50.141 29.557 1.00 42.81 ? 1013 HOH K O   1 
HETATM 6349 O O   . HOH W 3 .   ? -3.390  -41.342 50.429 1.00 46.88 ? 1014 HOH K O   1 
HETATM 6350 O O   . HOH W 3 .   ? -0.486  -48.399 34.594 1.00 31.94 ? 1015 HOH K O   1 
HETATM 6351 O O   . HOH W 3 .   ? 11.191  -46.622 68.079 1.00 43.84 ? 1016 HOH K O   1 
HETATM 6352 O O   . HOH W 3 .   ? 20.084  -47.574 59.870 1.00 29.38 ? 1017 HOH K O   1 
HETATM 6353 O O   . HOH W 3 .   ? 10.222  -64.848 49.073 1.00 22.63 ? 1018 HOH K O   1 
HETATM 6354 O O   . HOH W 3 .   ? 22.187  -46.815 54.033 1.00 39.06 ? 1019 HOH K O   1 
HETATM 6355 O O   . HOH W 3 .   ? 13.553  -35.688 44.979 1.00 40.99 ? 1020 HOH K O   1 
HETATM 6356 O O   . HOH W 3 .   ? 9.026   -61.085 41.808 1.00 40.48 ? 1021 HOH K O   1 
HETATM 6357 O O   . HOH W 3 .   ? 21.177  -56.927 45.487 1.00 40.63 ? 1022 HOH K O   1 
HETATM 6358 O O   . HOH W 3 .   ? 20.930  -57.966 56.448 1.00 38.67 ? 1023 HOH K O   1 
HETATM 6359 O O   . HOH W 3 .   ? 23.783  -36.912 41.541 1.00 29.02 ? 1024 HOH K O   1 
HETATM 6360 O O   . HOH W 3 .   ? 9.214   -43.054 33.904 1.00 13.93 ? 1025 HOH K O   1 
HETATM 6361 O O   . HOH W 3 .   ? 6.659   -34.176 54.921 1.00 24.95 ? 1026 HOH K O   1 
HETATM 6362 O O   . HOH W 3 .   ? 24.546  -37.090 45.020 1.00 35.25 ? 1027 HOH K O   1 
HETATM 6363 O O   . HOH W 3 .   ? -1.551  -49.298 51.613 1.00 39.26 ? 1028 HOH K O   1 
HETATM 6364 O O   . HOH W 3 .   ? 0.383   -51.581 51.387 1.00 31.61 ? 1029 HOH K O   1 
HETATM 6365 O O   . HOH W 3 .   ? -0.036  -49.650 32.109 1.00 43.02 ? 1030 HOH K O   1 
HETATM 6366 O O   . HOH W 3 .   ? 2.639   -49.968 30.714 1.00 41.16 ? 1031 HOH K O   1 
HETATM 6367 O O   . HOH W 3 .   ? 0.525   -33.985 58.016 1.00 20.60 ? 1032 HOH K O   1 
HETATM 6368 O O   . HOH W 3 .   ? 5.697   -53.511 29.435 1.00 37.15 ? 1033 HOH K O   1 
HETATM 6369 O O   . HOH W 3 .   ? 4.061   -38.507 60.686 1.00 37.20 ? 1034 HOH K O   1 
HETATM 6370 O O   . HOH W 3 .   ? 14.239  -43.880 35.293 1.00 21.70 ? 1035 HOH K O   1 
HETATM 6371 O O   . HOH W 3 .   ? 13.015  -61.666 43.770 1.00 28.44 ? 1036 HOH K O   1 
HETATM 6372 O O   . HOH W 3 .   ? 5.596   -36.540 59.619 1.00 26.63 ? 1037 HOH K O   1 
HETATM 6373 O O   . HOH W 3 .   ? 9.136   -60.127 58.336 1.00 23.94 ? 1038 HOH K O   1 
HETATM 6374 O O   . HOH W 3 .   ? 12.358  -63.445 41.829 1.00 37.68 ? 1039 HOH K O   1 
HETATM 6375 O O   . HOH W 3 .   ? 8.095   -32.366 42.624 1.00 32.64 ? 1040 HOH K O   1 
HETATM 6376 O O   . HOH W 3 .   ? -5.789  -35.892 41.234 1.00 32.76 ? 1041 HOH K O   1 
HETATM 6377 O O   . HOH W 3 .   ? 5.488   -57.481 62.945 1.00 32.75 ? 1042 HOH K O   1 
HETATM 6378 O O   . HOH W 3 .   ? -8.395  -36.430 41.405 1.00 31.85 ? 1043 HOH K O   1 
HETATM 6379 O O   . HOH W 3 .   ? 2.001   -48.829 61.160 1.00 43.73 ? 1044 HOH K O   1 
HETATM 6380 O O   . HOH W 3 .   ? -5.755  -38.873 38.211 1.00 37.38 ? 1045 HOH K O   1 
HETATM 6381 O O   . HOH W 3 .   ? 1.728   -58.405 59.173 1.00 36.64 ? 1046 HOH K O   1 
HETATM 6382 O O   . HOH W 3 .   ? 11.047  -64.469 53.899 1.00 36.38 ? 1047 HOH K O   1 
HETATM 6383 O O   . HOH W 3 .   ? 2.992   -36.254 45.154 1.00 44.55 ? 1048 HOH K O   1 
HETATM 6384 O O   . HOH W 3 .   ? 1.937   -45.881 61.119 1.00 45.10 ? 1049 HOH K O   1 
HETATM 6385 O O   . HOH W 3 .   ? 3.551   -43.666 61.257 1.00 36.93 ? 1050 HOH K O   1 
HETATM 6386 O O   . HOH W 3 .   ? 3.789   -51.811 26.430 1.00 37.05 ? 1051 HOH K O   1 
HETATM 6387 O O   . HOH X 3 .   ? 21.138  -56.281 50.295 1.00 42.48 ? 101  HOH L O   1 
HETATM 6388 O O   . HOH X 3 .   ? 21.244  -39.056 50.092 1.00 16.11 ? 102  HOH L O   1 
HETATM 6389 O O   . HOH X 3 .   ? 25.067  -47.631 46.800 1.00 35.80 ? 103  HOH L O   1 
HETATM 6390 O O   . HOH X 3 .   ? 17.273  -38.095 49.966 1.00 13.22 ? 104  HOH L O   1 
HETATM 6391 O O   . HOH X 3 .   ? 26.319  -38.094 52.863 1.00 19.80 ? 105  HOH L O   1 
HETATM 6392 O O   . HOH X 3 .   ? 22.810  -41.629 47.596 1.00 23.13 ? 106  HOH L O   1 
HETATM 6393 O O   . HOH X 3 .   ? 24.669  -44.498 53.648 1.00 39.24 ? 107  HOH L O   1 
HETATM 6394 O O   . HOH X 3 .   ? 19.762  -55.418 53.175 1.00 36.59 ? 108  HOH L O   1 
HETATM 6395 O O   . HOH X 3 .   ? 25.580  -38.485 49.438 1.00 51.44 ? 109  HOH L O   1 
HETATM 6396 O O   . HOH X 3 .   ? 17.471  -54.903 42.920 1.00 22.79 ? 110  HOH L O   1 
HETATM 6397 O O   . HOH X 3 .   ? 28.032  -40.229 52.421 1.00 47.15 ? 111  HOH L O   1 
HETATM 6398 O O   . HOH X 3 .   ? 24.292  -39.574 47.188 1.00 36.42 ? 112  HOH L O   1 
HETATM 6399 O O   . HOH X 3 .   ? 23.710  -42.547 45.305 1.00 37.96 ? 113  HOH L O   1 
HETATM 6400 O O   . HOH X 3 .   ? 22.874  -37.670 48.324 1.00 21.02 ? 114  HOH L O   1 
HETATM 6401 O O   . HOH X 3 .   ? 23.948  -45.674 44.885 1.00 41.09 ? 115  HOH L O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
7    N N   . LYS A 3   ? 0.4565 0.5335 0.6950 0.0127  -0.0568 0.1266  453 LYS A N   
8    C CA  . LYS A 3   ? 0.3901 0.4725 0.6456 0.0245  -0.0311 0.1100  453 LYS A CA  
9    C C   . LYS A 3   ? 0.3197 0.3903 0.5480 0.0271  -0.0163 0.0954  453 LYS A C   
10   O O   . LYS A 3   ? 0.3605 0.4284 0.5587 0.0184  -0.0250 0.0978  453 LYS A O   
11   C CB  . LYS A 3   ? 0.3877 0.4876 0.6448 0.0188  -0.0310 0.1062  453 LYS A CB  
12   N N   . PRO A 4   ? 0.1548 0.2160 0.3926 0.0375  0.0067  0.0817  454 PRO A N   
13   C CA  . PRO A 4   ? 0.1328 0.1778 0.3410 0.0352  0.0176  0.0681  454 PRO A CA  
14   C C   . PRO A 4   ? 0.0982 0.1549 0.2761 0.0262  0.0205  0.0570  454 PRO A C   
15   O O   . PRO A 4   ? 0.1043 0.1770 0.2923 0.0281  0.0256  0.0547  454 PRO A O   
16   C CB  . PRO A 4   ? 0.1663 0.1874 0.3855 0.0453  0.0420  0.0562  454 PRO A CB  
17   C CG  . PRO A 4   ? 0.2425 0.2679 0.5042 0.0552  0.0435  0.0681  454 PRO A CG  
18   C CD  . PRO A 4   ? 0.2195 0.2751 0.4886 0.0480  0.0241  0.0788  454 PRO A CD  
19   N N   . LEU A 5   ? 0.1087 0.1572 0.2545 0.0165  0.0182  0.0518  455 LEU A N   
20   C CA  . LEU A 5   ? 0.0841 0.1432 0.2086 0.0100  0.0205  0.0454  455 LEU A CA  
21   C C   . LEU A 5   ? 0.0942 0.1501 0.2126 0.0126  0.0331  0.0337  455 LEU A C   
22   O O   . LEU A 5   ? 0.0946 0.1626 0.2071 0.0120  0.0359  0.0324  455 LEU A O   
23   C CB  . LEU A 5   ? 0.1130 0.1668 0.2205 0.0007  0.0169  0.0452  455 LEU A CB  
24   C CG  . LEU A 5   ? 0.0993 0.1557 0.2022 -0.0047 0.0121  0.0555  455 LEU A CG  
25   C CD1 . LEU A 5   ? 0.1291 0.1801 0.2295 -0.0133 0.0121  0.0568  455 LEU A CD1 
26   C CD2 . LEU A 5   ? 0.0793 0.1479 0.1745 -0.0057 0.0162  0.0570  455 LEU A CD2 
27   N N   . ALA A 6   ? 0.1245 0.1570 0.2376 0.0139  0.0433  0.0248  456 ALA A N   
28   C CA  . ALA A 6   ? 0.1681 0.1847 0.2589 0.0119  0.0585  0.0120  456 ALA A CA  
29   C C   . ALA A 6   ? 0.2355 0.2629 0.3482 0.0215  0.0734  0.0118  456 ALA A C   
30   O O   . ALA A 6   ? 0.3084 0.3241 0.3976 0.0184  0.0876  0.0027  456 ALA A O   
31   C CB  . ALA A 6   ? 0.2507 0.2270 0.3211 0.0084  0.0713  0.0002  456 ALA A CB  
32   N N   . GLU A 7   ? 0.1281 0.1770 0.2842 0.0303  0.0690  0.0233  457 GLU A N   
33   C CA  . GLU A 7   ? 0.1638 0.2223 0.3359 0.0331  0.0731  0.0250  457 GLU A CA  
34   C C   . GLU A 7   ? 0.1282 0.2066 0.2906 0.0257  0.0566  0.0300  457 GLU A C   
35   O O   . GLU A 7   ? 0.1540 0.2405 0.3288 0.0250  0.0569  0.0318  457 GLU A O   
36   C CB  . GLU A 7   ? 0.2148 0.2741 0.4274 0.0410  0.0722  0.0347  457 GLU A CB  
37   C CG  . GLU A 7   ? 0.2953 0.3252 0.5153 0.0490  0.0962  0.0277  457 GLU A CG  
38   C CD  . GLU A 7   ? 0.4069 0.4392 0.6726 0.0573  0.0946  0.0415  457 GLU A CD  
39   O OE1 . GLU A 7   ? 0.4764 0.4816 0.7486 0.0640  0.1146  0.0373  457 GLU A OE1 
40   O OE2 . GLU A 7   ? 0.4173 0.4755 0.7098 0.0557  0.0741  0.0568  457 GLU A OE2 
41   N N   . GLN A 8   ? 0.0881 0.1712 0.2297 0.0195  0.0455  0.0322  458 GLN A N   
42   C CA  . GLN A 8   ? 0.0724 0.1631 0.1994 0.0126  0.0369  0.0346  458 GLN A CA  
43   C C   . GLN A 8   ? 0.0749 0.1603 0.1767 0.0103  0.0453  0.0269  458 GLN A C   
44   O O   . GLN A 8   ? 0.0969 0.1774 0.1847 0.0101  0.0497  0.0249  458 GLN A O   
45   C CB  . GLN A 8   ? 0.0831 0.1750 0.2000 0.0076  0.0262  0.0423  458 GLN A CB  
46   C CG  . GLN A 8   ? 0.0952 0.1907 0.2327 0.0077  0.0150  0.0538  458 GLN A CG  
47   C CD  . GLN A 8   ? 0.1750 0.2799 0.3335 0.0046  0.0030  0.0636  458 GLN A CD  
48   O OE1 . GLN A 8   ? 0.2282 0.3398 0.3844 -0.0012 0.0028  0.0627  458 GLN A OE1 
49   N NE2 . GLN A 8   ? 0.1778 0.2821 0.3577 0.0069  -0.0089 0.0750  458 GLN A NE2 
50   N N   . ASP A 9   ? 0.0748 0.1624 0.1735 0.0069  0.0468  0.0255  459 ASP A N   
51   C CA  . ASP A 9   ? 0.0763 0.1565 0.1526 0.0047  0.0540  0.0207  459 ASP A CA  
52   C C   . ASP A 9   ? 0.0771 0.1517 0.1351 0.0039  0.0491  0.0242  459 ASP A C   
53   O O   . ASP A 9   ? 0.0822 0.1526 0.1257 0.0041  0.0531  0.0257  459 ASP A O   
54   C CB  . ASP A 9   ? 0.0851 0.1681 0.1634 -0.0001 0.0561  0.0202  459 ASP A CB  
55   C CG  . ASP A 9   ? 0.1294 0.2205 0.2316 0.0013  0.0634  0.0194  459 ASP A CG  
56   O OD1 . ASP A 9   ? 0.1299 0.2279 0.2409 -0.0043 0.0648  0.0210  459 ASP A OD1 
57   O OD2 . ASP A 9   ? 0.1336 0.2220 0.2481 0.0076  0.0701  0.0179  459 ASP A OD2 
58   N N   . TRP A 10  ? 0.0673 0.1353 0.0964 0.0049  0.0183  0.0134  460 TRP A N   
59   C CA  . TRP A 10  ? 0.0619 0.1299 0.0930 0.0040  0.0188  0.0109  460 TRP A CA  
60   C C   . TRP A 10  ? 0.0622 0.1301 0.0927 0.0041  0.0180  0.0090  460 TRP A C   
61   O O   . TRP A 10  ? 0.0656 0.1340 0.0977 0.0032  0.0185  0.0072  460 TRP A O   
62   C CB  . TRP A 10  ? 0.0752 0.1430 0.1073 0.0010  0.0196  0.0093  460 TRP A CB  
63   C CG  . TRP A 10  ? 0.0739 0.1422 0.1034 -0.0015 0.0194  0.0098  460 TRP A CG  
64   C CD1 . TRP A 10  ? 0.0876 0.1555 0.1166 -0.0025 0.0192  0.0112  460 TRP A CD1 
65   C CD2 . TRP A 10  ? 0.0687 0.1386 0.0969 -0.0032 0.0192  0.0098  460 TRP A CD2 
66   N NE1 . TRP A 10  ? 0.0936 0.1630 0.1203 -0.0048 0.0191  0.0118  460 TRP A NE1 
67   C CE2 . TRP A 10  ? 0.0862 0.1571 0.1129 -0.0053 0.0191  0.0114  460 TRP A CE2 
68   C CE3 . TRP A 10  ? 0.0801 0.1511 0.1096 -0.0034 0.0188  0.0094  460 TRP A CE3 
69   C CZ2 . TRP A 10  ? 0.0980 0.1717 0.1248 -0.0074 0.0187  0.0131  460 TRP A CZ2 
70   C CZ3 . TRP A 10  ? 0.0832 0.1565 0.1136 -0.0056 0.0181  0.0112  460 TRP A CZ3 
71   C CH2 . TRP A 10  ? 0.0885 0.1636 0.1177 -0.0076 0.0182  0.0133  460 TRP A CH2 
72   N N   . TYR A 11  ? 0.0629 0.1303 0.0921 0.0051  0.0163  0.0091  461 TYR A N   
73   C CA  . TYR A 11  ? 0.0636 0.1305 0.0946 0.0050  0.0144  0.0074  461 TYR A CA  
74   C C   . TYR A 11  ? 0.0697 0.1373 0.1007 0.0092  0.0129  0.0056  461 TYR A C   
75   O O   . TYR A 11  ? 0.0875 0.1564 0.1166 0.0127  0.0118  0.0055  461 TYR A O   
76   C CB  . TYR A 11  ? 0.0794 0.1454 0.1118 0.0037  0.0123  0.0081  461 TYR A CB  
77   C CG  . TYR A 11  ? 0.0988 0.1640 0.1358 0.0038  0.0093  0.0068  461 TYR A CG  
78   C CD1 . TYR A 11  ? 0.1071 0.1736 0.1478 0.0010  0.0097  0.0077  461 TYR A CD1 
79   C CD2 . TYR A 11  ? 0.0997 0.1636 0.1385 0.0070  0.0057  0.0044  461 TYR A CD2 
80   C CE1 . TYR A 11  ? 0.1261 0.1920 0.1730 0.0010  0.0064  0.0073  461 TYR A CE1 
81   C CE2 . TYR A 11  ? 0.1230 0.1856 0.1681 0.0072  0.0019  0.0028  461 TYR A CE2 
82   C CZ  . TYR A 11  ? 0.1235 0.1869 0.1732 0.0039  0.0022  0.0047  461 TYR A CZ  
83   O OH  . TYR A 11  ? 0.2569 0.3191 0.3147 0.0039  -0.0021 0.0039  461 TYR A OH  
84   N N   . HIS A 12  ? 0.0644 0.1324 0.0974 0.0093  0.0127  0.0042  462 HIS A N   
85   C CA  . HIS A 12  ? 0.0654 0.1353 0.0983 0.0134  0.0114  0.0026  462 HIS A CA  
86   C C   . HIS A 12  ? 0.0827 0.1514 0.1185 0.0144  0.0077  -0.0004 462 HIS A C   
87   O O   . HIS A 12  ? 0.0937 0.1642 0.1296 0.0177  0.0062  -0.0025 462 HIS A O   
88   C CB  . HIS A 12  ? 0.0656 0.1369 0.0997 0.0133  0.0136  0.0034  462 HIS A CB  
89   C CG  . HIS A 12  ? 0.0712 0.1440 0.1049 0.0134  0.0160  0.0063  462 HIS A CG  
90   N ND1 . HIS A 12  ? 0.0992 0.1759 0.1342 0.0164  0.0166  0.0085  462 HIS A ND1 
91   C CD2 . HIS A 12  ? 0.0720 0.1435 0.1057 0.0110  0.0174  0.0079  462 HIS A CD2 
92   C CE1 . HIS A 12  ? 0.1050 0.1823 0.1420 0.0156  0.0182  0.0117  462 HIS A CE1 
93   N NE2 . HIS A 12  ? 0.0873 0.1611 0.1234 0.0124  0.0185  0.0108  462 HIS A NE2 
94   N N   . GLY A 13  ? 0.0814 0.1476 0.1206 0.0117  0.0058  -0.0004 463 GLY A N   
95   C CA  . GLY A 13  ? 0.0897 0.1545 0.1343 0.0128  0.0012  -0.0030 463 GLY A CA  
96   C C   . GLY A 13  ? 0.0807 0.1458 0.1286 0.0118  0.0010  -0.0033 463 GLY A C   
97   O O   . GLY A 13  ? 0.0925 0.1584 0.1408 0.0086  0.0042  -0.0007 463 GLY A O   
98   N N   . ALA A 14  ? 0.1056 0.1706 0.1560 0.0152  -0.0029 -0.0069 464 ALA A N   
99   C CA  . ALA A 14  ? 0.0923 0.1571 0.1475 0.0142  -0.0041 -0.0071 464 ALA A CA  
100  C C   . ALA A 14  ? 0.1080 0.1755 0.1590 0.0162  -0.0014 -0.0075 464 ALA A C   
101  O O   . ALA A 14  ? 0.1203 0.1882 0.1746 0.0172  -0.0035 -0.0090 464 ALA A O   
102  C CB  . ALA A 14  ? 0.1975 0.2604 0.2602 0.0161  -0.0108 -0.0108 464 ALA A CB  
103  N N   . ILE A 15  ? 0.0954 0.1651 0.1409 0.0166  0.0029  -0.0056 465 ILE A N   
104  C CA  . ILE A 15  ? 0.0942 0.1667 0.1384 0.0180  0.0051  -0.0049 465 ILE A CA  
105  C C   . ILE A 15  ? 0.1072 0.1785 0.1554 0.0146  0.0066  -0.0037 465 ILE A C   
106  O O   . ILE A 15  ? 0.1048 0.1750 0.1547 0.0109  0.0083  -0.0020 465 ILE A O   
107  C CB  . ILE A 15  ? 0.0935 0.1685 0.1339 0.0188  0.0089  -0.0022 465 ILE A CB  
108  C CG1 . ILE A 15  ? 0.1162 0.1887 0.1569 0.0145  0.0119  -0.0001 465 ILE A CG1 
109  C CG2 . ILE A 15  ? 0.1151 0.1934 0.1515 0.0230  0.0076  -0.0026 465 ILE A CG2 
110  C CD1 . ILE A 15  ? 0.1412 0.2155 0.1817 0.0145  0.0150  0.0024  465 ILE A CD1 
111  N N   . PRO A 16  ? 0.0761 0.1490 0.1262 0.0160  0.0062  -0.0043 466 PRO A N   
112  C CA  . PRO A 16  ? 0.0722 0.1446 0.1264 0.0132  0.0077  -0.0031 466 PRO A CA  
113  C C   . PRO A 16  ? 0.0744 0.1479 0.1278 0.0116  0.0123  -0.0013 466 PRO A C   
114  O O   . PRO A 16  ? 0.0630 0.1375 0.1139 0.0129  0.0139  -0.0005 466 PRO A O   
115  C CB  . PRO A 16  ? 0.0842 0.1581 0.1404 0.0158  0.0054  -0.0045 466 PRO A CB  
116  C CG  . PRO A 16  ? 0.0949 0.1723 0.1465 0.0201  0.0052  -0.0052 466 PRO A CG  
117  C CD  . PRO A 16  ? 0.0874 0.1636 0.1357 0.0207  0.0040  -0.0062 466 PRO A CD  
118  N N   . ARG A 17  ? 0.0681 0.1421 0.1248 0.0091  0.0139  -0.0006 467 ARG A N   
119  C CA  . ARG A 17  ? 0.0671 0.1423 0.1243 0.0082  0.0175  -0.0004 467 ARG A CA  
120  C C   . ARG A 17  ? 0.0612 0.1371 0.1193 0.0104  0.0183  -0.0001 467 ARG A C   
121  O O   . ARG A 17  ? 0.0675 0.1434 0.1259 0.0104  0.0200  0.0003  467 ARG A O   
122  C CB  . ARG A 17  ? 0.0837 0.1610 0.1447 0.0065  0.0187  -0.0001 467 ARG A CB  
123  C CG  . ARG A 17  ? 0.0962 0.1754 0.1585 0.0063  0.0219  -0.0014 467 ARG A CG  
124  C CD  . ARG A 17  ? 0.0974 0.1803 0.1631 0.0054  0.0232  -0.0012 467 ARG A CD  
125  N NE  . ARG A 17  ? 0.0893 0.1760 0.1542 0.0037  0.0237  0.0003  467 ARG A NE  
126  C CZ  . ARG A 17  ? 0.0940 0.1867 0.1593 0.0033  0.0262  -0.0002 467 ARG A CZ  
127  N NH1 . ARG A 17  ? 0.1146 0.2093 0.1814 0.0048  0.0281  -0.0033 467 ARG A NH1 
128  N NH2 . ARG A 17  ? 0.0843 0.1823 0.1492 0.0019  0.0264  0.0025  467 ARG A NH2 
129  N N   . ILE A 18  ? 0.0612 0.1381 0.1207 0.0124  0.0167  0.0002  468 ILE A N   
130  C CA  . ILE A 18  ? 0.0614 0.1407 0.1231 0.0144  0.0175  0.0019  468 ILE A CA  
131  C C   . ILE A 18  ? 0.0640 0.1451 0.1233 0.0163  0.0176  0.0038  468 ILE A C   
132  O O   . ILE A 18  ? 0.0902 0.1733 0.1533 0.0169  0.0190  0.0065  468 ILE A O   
133  C CB  . ILE A 18  ? 0.0611 0.1427 0.1245 0.0164  0.0157  0.0020  468 ILE A CB  
134  C CG1 . ILE A 18  ? 0.0816 0.1669 0.1490 0.0180  0.0169  0.0049  468 ILE A CG1 
135  C CG2 . ILE A 18  ? 0.0782 0.1610 0.1376 0.0191  0.0122  0.0006  468 ILE A CG2 
136  C CD1 . ILE A 18  ? 0.1078 0.1917 0.1813 0.0159  0.0195  0.0053  468 ILE A CD1 
137  N N   . GLU A 19  ? 0.0616 0.1424 0.1159 0.0173  0.0159  0.0029  469 GLU A N   
138  C CA  . GLU A 19  ? 0.0831 0.1665 0.1351 0.0193  0.0162  0.0052  469 GLU A CA  
139  C C   . GLU A 19  ? 0.0845 0.1651 0.1374 0.0167  0.0182  0.0060  469 GLU A C   
140  O O   . GLU A 19  ? 0.0963 0.1790 0.1513 0.0175  0.0191  0.0092  469 GLU A O   
141  C CB  . GLU A 19  ? 0.0916 0.1762 0.1384 0.0220  0.0135  0.0033  469 GLU A CB  
142  C CG  . GLU A 19  ? 0.1221 0.2119 0.1680 0.0262  0.0111  0.0024  469 GLU A CG  
143  C CD  . GLU A 19  ? 0.1554 0.2471 0.1967 0.0298  0.0078  -0.0009 469 GLU A CD  
144  O OE1 . GLU A 19  ? 0.1474 0.2424 0.1881 0.0332  0.0046  -0.0039 469 GLU A OE1 
145  O OE2 . GLU A 19  ? 0.1373 0.2275 0.1760 0.0295  0.0080  -0.0010 469 GLU A OE2 
146  N N   . ALA A 20  ? 0.0758 0.1526 0.1277 0.0137  0.0186  0.0034  470 ALA A N   
147  C CA  . ALA A 20  ? 0.1021 0.1771 0.1548 0.0115  0.0201  0.0033  470 ALA A CA  
148  C C   . ALA A 20  ? 0.1591 0.2347 0.2184 0.0113  0.0213  0.0039  470 ALA A C   
149  O O   . ALA A 20  ? 0.1255 0.2004 0.1875 0.0108  0.0217  0.0046  470 ALA A O   
150  C CB  . ALA A 20  ? 0.1329 0.2065 0.1839 0.0088  0.0205  0.0008  470 ALA A CB  
151  N N   . GLN A 21  ? 0.1510 0.2122 0.2496 0.0264  -0.0457 -0.0342 471 GLN A N   
152  C CA  . GLN A 21  ? 0.1626 0.2037 0.2435 0.0348  -0.0600 -0.0300 471 GLN A CA  
153  C C   . GLN A 21  ? 0.2290 0.2392 0.2584 0.0272  -0.0663 -0.0194 471 GLN A C   
154  O O   . GLN A 21  ? 0.2875 0.2784 0.2987 0.0275  -0.0668 -0.0116 471 GLN A O   
155  C CB  . GLN A 21  ? 0.1873 0.2325 0.2890 0.0479  -0.0817 -0.0398 471 GLN A CB  
156  C CG  . GLN A 21  ? 0.2495 0.2682 0.3335 0.0586  -0.1023 -0.0356 471 GLN A CG  
157  C CD  . GLN A 21  ? 0.3155 0.3351 0.4185 0.0678  -0.1177 -0.0454 471 GLN A CD  
158  O OE1 . GLN A 21  ? 0.2898 0.3323 0.4298 0.0686  -0.1062 -0.0567 471 GLN A OE1 
159  N NE2 . GLN A 21  ? 0.4133 0.4041 0.4851 0.0716  -0.1417 -0.0398 471 GLN A NE2 
160  N N   . GLU A 22  ? 0.1923 0.1967 0.1968 0.0185  -0.0697 -0.0201 472 GLU A N   
161  C CA  . GLU A 22  ? 0.2526 0.2275 0.2037 0.0072  -0.0725 -0.0103 472 GLU A CA  
162  C C   . GLU A 22  ? 0.2856 0.2605 0.2287 -0.0052 -0.0501 -0.0050 472 GLU A C   
163  O O   . GLU A 22  ? 0.3003 0.2498 0.2053 -0.0147 -0.0496 0.0043  472 GLU A O   
164  C CB  . GLU A 22  ? 0.3446 0.3178 0.2701 -0.0013 -0.0778 -0.0157 472 GLU A CB  
165  C CG  . GLU A 22  ? 0.5239 0.4626 0.3853 -0.0143 -0.0835 -0.0052 472 GLU A CG  
166  C CD  . GLU A 22  ? 0.6293 0.5343 0.4643 -0.0046 -0.1120 0.0061  472 GLU A CD  
167  O OE1 . GLU A 22  ? 0.6305 0.5408 0.4858 0.0104  -0.1349 0.0003  472 GLU A OE1 
168  O OE2 . GLU A 22  ? 0.6908 0.5637 0.4888 -0.0119 -0.1125 0.0202  472 GLU A OE2 
169  N N   . LEU A 23  ? 0.1598 0.1615 0.1390 -0.0059 -0.0329 -0.0102 473 LEU A N   
170  C CA  . LEU A 23  ? 0.1518 0.1578 0.1303 -0.0165 -0.0147 -0.0075 473 LEU A CA  
171  C C   . LEU A 23  ? 0.1519 0.1555 0.1395 -0.0124 -0.0118 -0.0012 473 LEU A C   
172  O O   . LEU A 23  ? 0.1769 0.1801 0.1600 -0.0212 -0.0011 0.0016  473 LEU A O   
173  C CB  . LEU A 23  ? 0.1315 0.1645 0.1444 -0.0188 -0.0014 -0.0160 473 LEU A CB  
174  C CG  . LEU A 23  ? 0.1318 0.1688 0.1359 -0.0260 0.0001  -0.0263 473 LEU A CG  
175  C CD1 . LEU A 23  ? 0.1517 0.2132 0.1991 -0.0242 0.0091  -0.0362 473 LEU A CD1 
176  C CD2 . LEU A 23  ? 0.2106 0.2369 0.1815 -0.0416 0.0106  -0.0266 473 LEU A CD2 
177  N N   . LEU A 24  ? 0.1283 0.1328 0.1310 0.0003  -0.0206 -0.0016 474 LEU A N   
178  C CA  . LEU A 24  ? 0.1348 0.1403 0.1469 0.0044  -0.0166 0.0006  474 LEU A CA  
179  C C   . LEU A 24  ? 0.1470 0.1254 0.1388 0.0101  -0.0306 0.0032  474 LEU A C   
180  O O   . LEU A 24  ? 0.1616 0.1361 0.1617 0.0217  -0.0445 -0.0008 474 LEU A O   
181  C CB  . LEU A 24  ? 0.1082 0.1376 0.1554 0.0129  -0.0118 -0.0048 474 LEU A CB  
182  C CG  . LEU A 24  ? 0.0744 0.1249 0.1429 0.0075  0.0001  -0.0052 474 LEU A CG  
183  C CD1 . LEU A 24  ? 0.0932 0.1626 0.1927 0.0133  0.0045  -0.0093 474 LEU A CD1 
184  C CD2 . LEU A 24  ? 0.0937 0.1462 0.1587 0.0000  0.0094  0.0006  474 LEU A CD2 
185  N N   . LYS A 25  ? 0.1629 0.1221 0.1322 0.0022  -0.0284 0.0090  475 LYS A N   
186  C CA  . LYS A 25  ? 0.1999 0.1247 0.1448 0.0045  -0.0426 0.0138  475 LYS A CA  
187  C C   . LYS A 25  ? 0.2036 0.1182 0.1490 0.0044  -0.0398 0.0130  475 LYS A C   
188  O O   . LYS A 25  ? 0.2305 0.1193 0.1690 0.0119  -0.0532 0.0131  475 LYS A O   
189  C CB  . LYS A 25  ? 0.2483 0.1469 0.1525 -0.0102 -0.0447 0.0233  475 LYS A CB  
190  C CG  . LYS A 25  ? 0.3286 0.2277 0.2191 -0.0112 -0.0519 0.0237  475 LYS A CG  
191  C CD  . LYS A 25  ? 0.4887 0.3675 0.3355 -0.0312 -0.0453 0.0313  475 LYS A CD  
192  C CE  . LYS A 25  ? 0.6068 0.4694 0.4207 -0.0325 -0.0601 0.0346  475 LYS A CE  
193  N NZ  . LYS A 25  ? 0.6513 0.5040 0.4240 -0.0554 -0.0461 0.0379  475 LYS A NZ  
194  N N   . LYS A 26  ? 0.1814 0.1139 0.1358 -0.0033 -0.0253 0.0112  476 LYS A N   
195  C CA  . LYS A 26  ? 0.1893 0.1117 0.1399 -0.0067 -0.0231 0.0094  476 LYS A CA  
196  C C   . LYS A 26  ? 0.1614 0.1123 0.1338 -0.0028 -0.0141 0.0024  476 LYS A C   
197  O O   . LYS A 26  ? 0.1363 0.1127 0.1233 -0.0034 -0.0065 0.0031  476 LYS A O   
198  C CB  . LYS A 26  ? 0.2254 0.1365 0.1574 -0.0250 -0.0163 0.0150  476 LYS A CB  
199  C CG  . LYS A 26  ? 0.3212 0.1958 0.2208 -0.0333 -0.0236 0.0240  476 LYS A CG  
200  C CD  . LYS A 26  ? 0.3725 0.2429 0.2568 -0.0551 -0.0109 0.0278  476 LYS A CD  
201  C CE  . LYS A 26  ? 0.4073 0.2363 0.2508 -0.0671 -0.0162 0.0391  476 LYS A CE  
202  N NZ  . LYS A 26  ? 0.4324 0.2237 0.2642 -0.0650 -0.0282 0.0430  476 LYS A NZ  
203  N N   . GLN A 27  ? 0.1738 0.1176 0.1456 0.0000  -0.0156 -0.0042 477 GLN A N   
204  C CA  . GLN A 27  ? 0.1698 0.1361 0.1526 0.0026  -0.0080 -0.0112 477 GLN A CA  
205  C C   . GLN A 27  ? 0.1365 0.1243 0.1231 -0.0064 -0.0006 -0.0051 477 GLN A C   
206  O O   . GLN A 27  ? 0.1647 0.1484 0.1458 -0.0171 -0.0005 -0.0017 477 GLN A O   
207  C CB  . GLN A 27  ? 0.1972 0.1484 0.1713 0.0016  -0.0108 -0.0198 477 GLN A CB  
208  C CG  . GLN A 27  ? 0.2185 0.1897 0.1953 0.0035  -0.0038 -0.0291 477 GLN A CG  
209  C CD  . GLN A 27  ? 0.2404 0.2190 0.2300 0.0160  -0.0005 -0.0408 477 GLN A CD  
210  O OE1 . GLN A 27  ? 0.2279 0.2007 0.2307 0.0252  -0.0054 -0.0417 477 GLN A OE1 
211  N NE2 . GLN A 27  ? 0.2548 0.2472 0.2408 0.0159  0.0078  -0.0516 477 GLN A NE2 
212  N N   . GLY A 28  ? 0.1188 0.1289 0.1180 -0.0025 0.0052  -0.0040 478 GLY A N   
213  C CA  . GLY A 28  ? 0.1125 0.1398 0.1178 -0.0086 0.0089  0.0025  478 GLY A CA  
214  C C   . GLY A 28  ? 0.1020 0.1359 0.1200 -0.0120 0.0106  0.0082  478 GLY A C   
215  O O   . GLY A 28  ? 0.0952 0.1425 0.1247 -0.0154 0.0120  0.0126  478 GLY A O   
216  N N   . ASP A 29  ? 0.0925 0.1164 0.1085 -0.0110 0.0091  0.0075  479 ASP A N   
217  C CA  . ASP A 29  ? 0.0811 0.1132 0.1082 -0.0138 0.0122  0.0094  479 ASP A CA  
218  C C   . ASP A 29  ? 0.0664 0.1162 0.1142 -0.0081 0.0158  0.0107  479 ASP A C   
219  O O   . ASP A 29  ? 0.0719 0.1245 0.1230 -0.0013 0.0161  0.0087  479 ASP A O   
220  C CB  . ASP A 29  ? 0.0989 0.1159 0.1137 -0.0122 0.0074  0.0081  479 ASP A CB  
221  C CG  . ASP A 29  ? 0.1435 0.1375 0.1329 -0.0216 0.0051  0.0100  479 ASP A CG  
222  O OD1 . ASP A 29  ? 0.1530 0.1458 0.1395 -0.0305 0.0092  0.0103  479 ASP A OD1 
223  O OD2 . ASP A 29  ? 0.1571 0.1329 0.1285 -0.0208 -0.0019 0.0117  479 ASP A OD2 
224  N N   . PHE A 30  ? 0.0703 0.1032 0.0852 0.0023  0.0137  0.0165  480 PHE A N   
225  C CA  . PHE A 30  ? 0.0811 0.1158 0.0918 0.0028  0.0170  0.0117  480 PHE A CA  
226  C C   . PHE A 30  ? 0.0754 0.1163 0.0807 0.0031  0.0160  0.0134  480 PHE A C   
227  O O   . PHE A 30  ? 0.0853 0.1299 0.0883 0.0014  0.0159  0.0152  480 PHE A O   
228  C CB  . PHE A 30  ? 0.0777 0.1084 0.0800 -0.0023 0.0204  0.0073  480 PHE A CB  
229  C CG  . PHE A 30  ? 0.0782 0.1084 0.0744 -0.0053 0.0165  0.0129  480 PHE A CG  
230  C CD1 . PHE A 30  ? 0.1015 0.1283 0.0954 -0.0081 0.0152  0.0156  480 PHE A CD1 
231  C CD2 . PHE A 30  ? 0.0980 0.1307 0.0973 -0.0057 0.0133  0.0157  480 PHE A CD2 
232  C CE1 . PHE A 30  ? 0.1219 0.1488 0.1161 -0.0112 0.0102  0.0222  480 PHE A CE1 
233  C CE2 . PHE A 30  ? 0.0947 0.1271 0.1010 -0.0084 0.0081  0.0217  480 PHE A CE2 
234  C CZ  . PHE A 30  ? 0.1167 0.1465 0.1202 -0.0112 0.0064  0.0255  480 PHE A CZ  
235  N N   . LEU A 31  ? 0.0631 0.1059 0.0688 0.0040  0.0170  0.0105  481 LEU A N   
236  C CA  . LEU A 31  ? 0.0654 0.1130 0.0704 0.0035  0.0182  0.0078  481 LEU A CA  
237  C C   . LEU A 31  ? 0.0553 0.1012 0.0623 0.0044  0.0181  0.0054  481 LEU A C   
238  O O   . LEU A 31  ? 0.0714 0.1149 0.0774 0.0040  0.0185  0.0051  481 LEU A O   
239  C CB  . LEU A 31  ? 0.0731 0.1278 0.0730 -0.0008 0.0178  0.0085  481 LEU A CB  
240  C CG  . LEU A 31  ? 0.0642 0.1192 0.0652 -0.0020 0.0126  0.0136  481 LEU A CG  
241  C CD1 . LEU A 31  ? 0.0863 0.1427 0.0871 -0.0013 0.0140  0.0093  481 LEU A CD1 
242  C CD2 . LEU A 31  ? 0.1091 0.1705 0.1033 -0.0120 0.0064  0.0216  481 LEU A CD2 
243  N N   . VAL A 32  ? 0.0551 0.1031 0.0688 0.0043  0.0185  0.0021  482 VAL A N   
244  C CA  . VAL A 32  ? 0.0705 0.1172 0.0880 0.0041  0.0164  0.0014  482 VAL A CA  
245  C C   . VAL A 32  ? 0.0547 0.1061 0.0736 0.0041  0.0193  -0.0048 482 VAL A C   
246  O O   . VAL A 32  ? 0.0594 0.1156 0.0812 0.0018  0.0243  -0.0113 482 VAL A O   
247  C CB  . VAL A 32  ? 0.0596 0.1028 0.0908 0.0016  0.0106  0.0052  482 VAL A CB  
248  C CG1 . VAL A 32  ? 0.0914 0.1336 0.1304 -0.0002 0.0059  0.0062  482 VAL A CG1 
249  C CG2 . VAL A 32  ? 0.0938 0.1330 0.1151 -0.0044 0.0066  0.0125  482 VAL A CG2 
250  N N   . ARG A 33  ? 0.0620 0.1132 0.0779 0.0041  0.0175  -0.0042 483 ARG A N   
251  C CA  . ARG A 33  ? 0.0582 0.1134 0.0721 0.0017  0.0192  -0.0092 483 ARG A CA  
252  C C   . ARG A 33  ? 0.0818 0.1347 0.1007 0.0025  0.0158  -0.0086 483 ARG A C   
253  O O   . ARG A 33  ? 0.0852 0.1351 0.1049 0.0027  0.0124  -0.0034 483 ARG A O   
254  C CB  . ARG A 33  ? 0.0789 0.1380 0.0809 -0.0021 0.0174  -0.0045 483 ARG A CB  
255  C CG  . ARG A 33  ? 0.0742 0.1311 0.0806 0.0014  0.0135  0.0023  483 ARG A CG  
256  C CD  . ARG A 33  ? 0.0690 0.1289 0.0773 -0.0023 0.0075  0.0106  483 ARG A CD  
257  N NE  . ARG A 33  ? 0.0731 0.1311 0.0996 0.0024  0.0062  0.0132  483 ARG A NE  
258  C CZ  . ARG A 33  ? 0.0769 0.1365 0.1146 0.0034  0.0053  0.0134  483 ARG A CZ  
259  N NH1 . ARG A 33  ? 0.0814 0.1434 0.1103 0.0003  0.0030  0.0137  483 ARG A NH1 
260  N NH2 . ARG A 33  ? 0.0730 0.1325 0.1339 0.0067  0.0079  0.0113  483 ARG A NH2 
261  N N   . GLU A 34  ? 0.0817 0.1369 0.1020 -0.0001 0.0173  -0.0147 484 GLU A N   
262  C CA  . GLU A 34  ? 0.0950 0.1485 0.1198 -0.0001 0.0134  -0.0138 484 GLU A CA  
263  C C   . GLU A 34  ? 0.1446 0.2010 0.1581 -0.0012 0.0111  -0.0081 484 GLU A C   
264  O O   . GLU A 34  ? 0.1779 0.2381 0.1827 -0.0054 0.0110  -0.0074 484 GLU A O   
265  C CB  . GLU A 34  ? 0.1334 0.1878 0.1678 -0.0034 0.0170  -0.0252 484 GLU A CB  
266  C CG  . GLU A 34  ? 0.2579 0.3131 0.3104 -0.0040 0.0241  -0.0368 484 GLU A CG  
267  C CD  . GLU A 34  ? 0.3571 0.4146 0.4231 -0.0097 0.0322  -0.0545 484 GLU A CD  
268  O OE1 . GLU A 34  ? 0.4373 0.4992 0.5165 -0.0138 0.0434  -0.0700 484 GLU A OE1 
269  O OE2 . GLU A 34  ? 0.4513 0.5069 0.5163 -0.0112 0.0289  -0.0548 484 GLU A OE2 
270  N N   . SER A 35  ? 0.0852 0.1407 0.1011 -0.0001 0.0085  -0.0036 485 SER A N   
271  C CA  . SER A 35  ? 0.0783 0.1375 0.0945 -0.0003 0.0076  0.0002  485 SER A CA  
272  C C   . SER A 35  ? 0.0676 0.1292 0.0819 -0.0035 0.0039  0.0010  485 SER A C   
273  O O   . SER A 35  ? 0.0949 0.1547 0.1085 -0.0054 0.0031  -0.0032 485 SER A O   
274  C CB  . SER A 35  ? 0.0900 0.1503 0.1094 -0.0021 0.0091  0.0007  485 SER A CB  
275  O OG  . SER A 35  ? 0.0787 0.1442 0.1077 -0.0020 0.0111  0.0011  485 SER A OG  
276  N N   . HIS A 36  ? 0.0718 0.1372 0.0893 -0.0055 0.0000  0.0073  486 HIS A N   
277  C CA  . HIS A 36  ? 0.0742 0.1425 0.0915 -0.0107 -0.0061 0.0117  486 HIS A CA  
278  C C   . HIS A 36  ? 0.0854 0.1567 0.1194 -0.0076 -0.0067 0.0146  486 HIS A C   
279  O O   . HIS A 36  ? 0.0943 0.1664 0.1265 -0.0100 -0.0092 0.0148  486 HIS A O   
280  C CB  . HIS A 36  ? 0.0984 0.1702 0.1117 -0.0198 -0.0144 0.0211  486 HIS A CB  
281  C CG  . HIS A 36  ? 0.1083 0.1807 0.0988 -0.0298 -0.0118 0.0151  486 HIS A CG  
282  N ND1 . HIS A 36  ? 0.1611 0.2330 0.1466 -0.0290 -0.0066 0.0112  486 HIS A ND1 
283  C CD2 . HIS A 36  ? 0.1520 0.2266 0.1246 -0.0426 -0.0109 0.0091  486 HIS A CD2 
284  C CE1 . HIS A 36  ? 0.1597 0.2347 0.1270 -0.0411 -0.0017 0.0022  486 HIS A CE1 
285  N NE2 . HIS A 36  ? 0.1816 0.2584 0.1403 -0.0503 -0.0033 -0.0006 486 HIS A NE2 
286  N N   . GLY A 37  ? 0.0758 0.1493 0.1281 -0.0033 -0.0028 0.0145  487 GLY A N   
287  C CA  . GLY A 37  ? 0.0874 0.1663 0.1603 -0.0025 0.0007  0.0128  487 GLY A CA  
288  C C   . GLY A 37  ? 0.0973 0.1771 0.1582 -0.0053 0.0069  0.0061  487 GLY A C   
289  O O   . GLY A 37  ? 0.1078 0.1931 0.1776 -0.0081 0.0083  0.0053  487 GLY A O   
290  N N   . LYS A 38  ? 0.0816 0.1564 0.1245 -0.0065 0.0087  0.0032  488 LYS A N   
291  C CA  . LYS A 38  ? 0.0894 0.1641 0.1212 -0.0132 0.0091  0.0021  488 LYS A CA  
292  C C   . LYS A 38  ? 0.0793 0.1463 0.1027 -0.0121 0.0015  0.0049  488 LYS A C   
293  O O   . LYS A 38  ? 0.0817 0.1445 0.1014 -0.0128 0.0009  0.0050  488 LYS A O   
294  C CB  . LYS A 38  ? 0.1112 0.1887 0.1383 -0.0203 0.0173  -0.0031 488 LYS A CB  
295  C CG  . LYS A 38  ? 0.1470 0.2340 0.1901 -0.0236 0.0293  -0.0122 488 LYS A CG  
296  C CD  . LYS A 38  ? 0.2297 0.3192 0.2666 -0.0332 0.0407  -0.0220 488 LYS A CD  
297  C CE  . LYS A 38  ? 0.2810 0.3709 0.3380 -0.0328 0.0509  -0.0337 488 LYS A CE  
298  N NZ  . LYS A 38  ? 0.3379 0.4340 0.3926 -0.0416 0.0535  -0.0365 488 LYS A NZ  
299  N N   . PRO A 39  ? 0.0854 0.1506 0.1101 -0.0114 -0.0038 0.0058  489 PRO A N   
300  C CA  . PRO A 39  ? 0.0983 0.1568 0.1245 -0.0104 -0.0074 0.0028  489 PRO A CA  
301  C C   . PRO A 39  ? 0.0924 0.1466 0.1260 -0.0138 -0.0129 0.0063  489 PRO A C   
302  O O   . PRO A 39  ? 0.1161 0.1725 0.1481 -0.0210 -0.0177 0.0130  489 PRO A O   
303  C CB  . PRO A 39  ? 0.1128 0.1713 0.1399 -0.0126 -0.0110 0.0016  489 PRO A CB  
304  C CG  . PRO A 39  ? 0.1195 0.1847 0.1437 -0.0129 -0.0104 0.0060  489 PRO A CG  
305  C CD  . PRO A 39  ? 0.1004 0.1702 0.1292 -0.0121 -0.0058 0.0080  489 PRO A CD  
306  N N   . GLY A 40  ? 0.0798 0.1289 0.1239 -0.0112 -0.0134 0.0028  490 GLY A N   
307  C CA  . GLY A 40  ? 0.0942 0.1385 0.1541 -0.0151 -0.0225 0.0096  490 GLY A CA  
308  C C   . GLY A 40  ? 0.1022 0.1476 0.1527 -0.0192 -0.0228 0.0161  490 GLY A C   
309  O O   . GLY A 40  ? 0.1050 0.1463 0.1705 -0.0238 -0.0324 0.0238  490 GLY A O   
310  N N   . GLU A 41  ? 0.0805 0.1397 0.1592 -0.0424 -0.0014 0.0274  491 GLU A N   
311  C CA  . GLU A 41  ? 0.0755 0.1370 0.1451 -0.0351 0.0110  0.0238  491 GLU A CA  
312  C C   . GLU A 41  ? 0.0793 0.1331 0.1340 -0.0312 0.0085  0.0161  491 GLU A C   
313  O O   . GLU A 41  ? 0.0850 0.1329 0.1366 -0.0329 0.0006  0.0148  491 GLU A O   
314  C CB  . GLU A 41  ? 0.0848 0.1570 0.1708 -0.0306 0.0217  0.0282  491 GLU A CB  
315  C CG  . GLU A 41  ? 0.1402 0.2156 0.2409 -0.0320 0.0274  0.0345  491 GLU A CG  
316  C CD  . GLU A 41  ? 0.1701 0.2375 0.2536 -0.0330 0.0389  0.0356  491 GLU A CD  
317  O OE1 . GLU A 41  ? 0.2121 0.2801 0.3046 -0.0355 0.0440  0.0411  491 GLU A OE1 
318  O OE2 . GLU A 41  ? 0.1941 0.2527 0.2543 -0.0319 0.0420  0.0326  491 GLU A OE2 
319  N N   . TYR A 42  ? 0.0678 0.1180 0.1114 -0.0266 0.0145  0.0120  492 TYR A N   
320  C CA  . TYR A 42  ? 0.0675 0.1126 0.1040 -0.0227 0.0144  0.0064  492 TYR A CA  
321  C C   . TYR A 42  ? 0.0725 0.1224 0.1104 -0.0178 0.0202  0.0063  492 TYR A C   
322  O O   . TYR A 42  ? 0.0778 0.1295 0.1153 -0.0161 0.0275  0.0089  492 TYR A O   
323  C CB  . TYR A 42  ? 0.0864 0.1227 0.1172 -0.0219 0.0136  0.0033  492 TYR A CB  
324  C CG  . TYR A 42  ? 0.0866 0.1154 0.1192 -0.0246 0.0111  0.0025  492 TYR A CG  
325  C CD1 . TYR A 42  ? 0.1023 0.1293 0.1359 -0.0281 0.0080  0.0056  492 TYR A CD1 
326  C CD2 . TYR A 42  ? 0.1078 0.1274 0.1394 -0.0233 0.0145  -0.0013 492 TYR A CD2 
327  C CE1 . TYR A 42  ? 0.1194 0.1369 0.1555 -0.0297 0.0067  0.0045  492 TYR A CE1 
328  C CE2 . TYR A 42  ? 0.1125 0.1200 0.1442 -0.0243 0.0168  -0.0027 492 TYR A CE2 
329  C CZ  . TYR A 42  ? 0.1242 0.1314 0.1594 -0.0273 0.0121  -0.0001 492 TYR A CZ  
330  O OH  . TYR A 42  ? 0.1851 0.1779 0.2213 -0.0275 0.0153  -0.0018 492 TYR A OH  
331  N N   . VAL A 43  ? 0.0652 0.1130 0.1018 -0.0151 0.0190  0.0034  493 VAL A N   
332  C CA  . VAL A 43  ? 0.0672 0.1177 0.1063 -0.0101 0.0234  0.0030  493 VAL A CA  
333  C C   . VAL A 43  ? 0.0592 0.1009 0.0894 -0.0079 0.0229  -0.0019 493 VAL A C   
334  O O   . VAL A 43  ? 0.0707 0.1077 0.1003 -0.0094 0.0206  -0.0035 493 VAL A O   
335  C CB  . VAL A 43  ? 0.0544 0.1104 0.1056 -0.0101 0.0189  0.0067  493 VAL A CB  
336  C CG1 . VAL A 43  ? 0.0795 0.1387 0.1387 -0.0039 0.0245  0.0072  493 VAL A CG1 
337  C CG2 . VAL A 43  ? 0.0805 0.1448 0.1483 -0.0144 0.0143  0.0134  493 VAL A CG2 
338  N N   . LEU A 44  ? 0.0608 0.0968 0.0836 -0.0046 0.0261  -0.0038 494 LEU A N   
339  C CA  . LEU A 44  ? 0.0670 0.0947 0.0861 -0.0028 0.0235  -0.0072 494 LEU A CA  
340  C C   . LEU A 44  ? 0.0838 0.1143 0.1073 0.0017  0.0276  -0.0070 494 LEU A C   
341  O O   . LEU A 44  ? 0.0863 0.1163 0.1087 0.0057  0.0349  -0.0064 494 LEU A O   
342  C CB  . LEU A 44  ? 0.1002 0.1120 0.1025 -0.0031 0.0202  -0.0095 494 LEU A CB  
343  C CG  . LEU A 44  ? 0.0998 0.0998 0.0988 -0.0022 0.0147  -0.0123 494 LEU A CG  
344  C CD1 . LEU A 44  ? 0.1220 0.1263 0.1417 -0.0052 0.0082  -0.0110 494 LEU A CD1 
345  C CD2 . LEU A 44  ? 0.1618 0.1368 0.1333 -0.0036 0.0084  -0.0146 494 LEU A CD2 
346  N N   . SER A 45  ? 0.0670 0.0979 0.0957 0.0014  0.0249  -0.0067 495 SER A N   
347  C CA  . SER A 45  ? 0.0681 0.0993 0.1014 0.0051  0.0256  -0.0053 495 SER A CA  
348  C C   . SER A 45  ? 0.0786 0.0995 0.1074 0.0066  0.0251  -0.0084 495 SER A C   
349  O O   . SER A 45  ? 0.0755 0.0919 0.1051 0.0033  0.0232  -0.0090 495 SER A O   
350  C CB  . SER A 45  ? 0.0764 0.1083 0.1114 0.0022  0.0203  -0.0013 495 SER A CB  
351  O OG  . SER A 45  ? 0.0871 0.1265 0.1289 -0.0003 0.0166  0.0026  495 SER A OG  
352  N N   . VAL A 46  ? 0.0968 0.1124 0.1240 0.0117  0.0279  -0.0099 496 VAL A N   
353  C CA  A VAL A 46  ? 0.1157 0.1177 0.1368 0.0125  0.0255  -0.0131 496 VAL A CA  
354  C CA  B VAL A 46  ? 0.1170 0.1190 0.1381 0.0125  0.0255  -0.0131 496 VAL A CA  
355  C C   . VAL A 46  ? 0.1493 0.1492 0.1760 0.0177  0.0278  -0.0118 496 VAL A C   
356  O O   . VAL A 46  ? 0.2189 0.2263 0.2556 0.0223  0.0323  -0.0089 496 VAL A O   
357  C CB  A VAL A 46  ? 0.1498 0.1350 0.1520 0.0127  0.0245  -0.0179 496 VAL A CB  
358  C CB  B VAL A 46  ? 0.1494 0.1346 0.1517 0.0129  0.0248  -0.0179 496 VAL A CB  
359  C CG1 A VAL A 46  ? 0.1761 0.1431 0.1719 0.0110  0.0161  -0.0207 496 VAL A CG1 
360  C CG1 B VAL A 46  ? 0.1637 0.1493 0.1605 0.0078  0.0202  -0.0177 496 VAL A CG1 
361  C CG2 A VAL A 46  ? 0.1776 0.1641 0.1753 0.0076  0.0201  -0.0175 496 VAL A CG2 
362  C CG2 B VAL A 46  ? 0.1357 0.1144 0.1291 0.0200  0.0367  -0.0195 496 VAL A CG2 
363  N N   . TYR A 47  ? 0.1166 0.1066 0.1424 0.0169  0.0240  -0.0126 497 TYR A N   
364  C CA  . TYR A 47  ? 0.1181 0.1011 0.1469 0.0222  0.0252  -0.0120 497 TYR A CA  
365  C C   . TYR A 47  ? 0.1422 0.1052 0.1561 0.0250  0.0262  -0.0185 497 TYR A C   
366  O O   . TYR A 47  ? 0.1656 0.1168 0.1711 0.0197  0.0184  -0.0211 497 TYR A O   
367  C CB  . TYR A 47  ? 0.1213 0.1008 0.1545 0.0189  0.0208  -0.0081 497 TYR A CB  
368  C CG  . TYR A 47  ? 0.1169 0.0909 0.1555 0.0241  0.0199  -0.0051 497 TYR A CG  
369  C CD1 . TYR A 47  ? 0.1433 0.1021 0.1792 0.0270  0.0195  -0.0083 497 TYR A CD1 
370  C CD2 . TYR A 47  ? 0.1252 0.1061 0.1720 0.0254  0.0167  0.0016  497 TYR A CD2 
371  C CE1 . TYR A 47  ? 0.1406 0.0935 0.1841 0.0324  0.0188  -0.0052 497 TYR A CE1 
372  C CE2 . TYR A 47  ? 0.1226 0.0980 0.1789 0.0301  0.0131  0.0060  497 TYR A CE2 
373  C CZ  . TYR A 47  ? 0.1315 0.0939 0.1871 0.0342  0.0156  0.0025  497 TYR A CZ  
374  O OH  . TYR A 47  ? 0.1761 0.1323 0.2437 0.0395  0.0120  0.0074  497 TYR A OH  
375  N N   . SER A 48  ? 0.1584 0.1140 0.1695 0.0330  0.0355  -0.0205 498 SER A N   
376  C CA  . SER A 48  ? 0.2022 0.1284 0.1874 0.0358  0.0385  -0.0280 498 SER A CA  
377  C C   . SER A 48  ? 0.2690 0.1867 0.2603 0.0464  0.0514  -0.0287 498 SER A C   
378  O O   . SER A 48  ? 0.2365 0.1706 0.2489 0.0521  0.0624  -0.0241 498 SER A O   
379  C CB  . SER A 48  ? 0.2338 0.1471 0.1924 0.0343  0.0431  -0.0323 498 SER A CB  
380  O OG  . SER A 48  ? 0.3358 0.2096 0.2565 0.0353  0.0432  -0.0399 498 SER A OG  
381  N N   . ASP A 49  ? 0.3004 0.1927 0.2773 0.0482  0.0485  -0.0333 499 ASP A N   
382  C CA  . ASP A 49  ? 0.3266 0.2116 0.3097 0.0563  0.0579  -0.0336 499 ASP A CA  
383  C C   . ASP A 49  ? 0.3109 0.2239 0.3357 0.0612  0.0597  -0.0240 499 ASP A C   
384  O O   . ASP A 49  ? 0.3579 0.2804 0.4007 0.0667  0.0702  -0.0203 499 ASP A O   
385  C CB  . ASP A 49  ? 0.4403 0.3099 0.4004 0.0592  0.0725  -0.0376 499 ASP A CB  
386  C CG  . ASP A 49  ? 0.5530 0.3885 0.4654 0.0526  0.0656  -0.0453 499 ASP A CG  
387  O OD1 . ASP A 49  ? 0.5981 0.4202 0.5006 0.0463  0.0479  -0.0481 499 ASP A OD1 
388  O OD2 . ASP A 49  ? 0.6213 0.4414 0.5072 0.0527  0.0763  -0.0469 499 ASP A OD2 
389  N N   . GLY A 50  ? 0.2128 0.1373 0.2530 0.0572  0.0477  -0.0185 500 GLY A N   
390  C CA  . GLY A 50  ? 0.2259 0.1685 0.2983 0.0596  0.0426  -0.0082 500 GLY A CA  
391  C C   . GLY A 50  ? 0.1888 0.1561 0.2846 0.0595  0.0432  -0.0011 500 GLY A C   
392  O O   . GLY A 50  ? 0.2353 0.2142 0.3592 0.0613  0.0363  0.0084  500 GLY A O   
393  N N   . GLN A 51  ? 0.1866 0.1608 0.2705 0.0555  0.0477  -0.0044 501 GLN A N   
394  C CA  . GLN A 51  ? 0.2092 0.2052 0.3156 0.0545  0.0484  0.0023  501 GLN A CA  
395  C C   . GLN A 51  ? 0.1584 0.1610 0.2455 0.0448  0.0419  0.0003  501 GLN A C   
396  O O   . GLN A 51  ? 0.1869 0.1780 0.2471 0.0410  0.0427  -0.0070 501 GLN A O   
397  C CB  . GLN A 51  ? 0.2480 0.2444 0.3573 0.0577  0.0637  0.0012  501 GLN A CB  
398  C CG  . GLN A 51  ? 0.3229 0.3140 0.4504 0.0646  0.0707  0.0039  501 GLN A CG  
399  C CD  . GLN A 51  ? 0.4125 0.3951 0.5355 0.0682  0.0912  0.0019  501 GLN A CD  
400  O OE1 . GLN A 51  ? 0.4841 0.4506 0.6030 0.0741  0.1026  -0.0008 501 GLN A OE1 
401  N NE2 . GLN A 51  ? 0.4348 0.4254 0.5574 0.0645  0.0969  0.0037  501 GLN A NE2 
402  N N   . ARG A 52  ? 0.1542 0.1732 0.2572 0.0404  0.0337  0.0076  502 ARG A N   
403  C CA  . ARG A 52  ? 0.1491 0.1741 0.2378 0.0327  0.0309  0.0059  502 ARG A CA  
404  C C   . ARG A 52  ? 0.1456 0.1784 0.2433 0.0357  0.0439  0.0054  502 ARG A C   
405  O O   . ARG A 52  ? 0.1916 0.2340 0.3176 0.0395  0.0482  0.0118  502 ARG A O   
406  C CB  . ARG A 52  ? 0.1651 0.1956 0.2575 0.0255  0.0154  0.0131  502 ARG A CB  
407  C CG  . ARG A 52  ? 0.2207 0.2364 0.2908 0.0204  0.0067  0.0132  502 ARG A CG  
408  C CD  . ARG A 52  ? 0.2514 0.2605 0.3320 0.0227  -0.0031 0.0204  502 ARG A CD  
409  N NE  . ARG A 52  ? 0.2005 0.1905 0.2542 0.0175  -0.0082 0.0211  502 ARG A NE  
410  C CZ  . ARG A 52  ? 0.2269 0.2040 0.2790 0.0175  -0.0182 0.0277  502 ARG A CZ  
411  N NH1 . ARG A 52  ? 0.3027 0.2864 0.3848 0.0230  -0.0266 0.0345  502 ARG A NH1 
412  N NH2 . ARG A 52  ? 0.2501 0.2066 0.2734 0.0123  -0.0187 0.0286  502 ARG A NH2 
413  N N   . ARG A 53  ? 0.1192 0.1452 0.1918 0.0325  0.0486  -0.0011 503 ARG A N   
414  C CA  . ARG A 53  ? 0.1322 0.1589 0.2021 0.0335  0.0608  -0.0016 503 ARG A CA  
415  C C   . ARG A 53  ? 0.0942 0.1290 0.1576 0.0257  0.0539  -0.0009 503 ARG A C   
416  O O   . ARG A 53  ? 0.1103 0.1402 0.1572 0.0202  0.0438  -0.0043 503 ARG A O   
417  C CB  . ARG A 53  ? 0.1963 0.1977 0.2330 0.0362  0.0706  -0.0095 503 ARG A CB  
418  C CG  . ARG A 53  ? 0.2929 0.2804 0.3287 0.0427  0.0757  -0.0116 503 ARG A CG  
419  C CD  . ARG A 53  ? 0.4196 0.3746 0.4141 0.0435  0.0820  -0.0198 503 ARG A CD  
420  N NE  . ARG A 53  ? 0.4964 0.4411 0.4795 0.0446  0.0967  -0.0183 503 ARG A NE  
421  C CZ  . ARG A 53  ? 0.5478 0.4702 0.5165 0.0494  0.1102  -0.0200 503 ARG A CZ  
422  N NH1 . ARG A 53  ? 0.5709 0.4805 0.5349 0.0532  0.1086  -0.0239 503 ARG A NH1 
423  N NH2 . ARG A 53  ? 0.6026 0.5124 0.5603 0.0503  0.1264  -0.0176 503 ARG A NH2 
424  N N   . HIS A 54  ? 0.0915 0.1246 0.1109 -0.0006 0.0369  -0.0011 504 HIS A N   
425  C CA  . HIS A 54  ? 0.0843 0.1206 0.1018 -0.0032 0.0366  0.0006  504 HIS A CA  
426  C C   . HIS A 54  ? 0.0895 0.1301 0.1054 0.0001  0.0392  0.0015  504 HIS A C   
427  O O   . HIS A 54  ? 0.1088 0.1549 0.1309 0.0043  0.0442  0.0081  504 HIS A O   
428  C CB  . HIS A 54  ? 0.1003 0.1342 0.1203 -0.0041 0.0314  0.0046  504 HIS A CB  
429  C CG  . HIS A 54  ? 0.0957 0.1210 0.1070 -0.0030 0.0298  0.0051  504 HIS A CG  
430  N ND1 . HIS A 54  ? 0.1034 0.1229 0.0999 0.0001  0.0330  0.0057  504 HIS A ND1 
431  C CD2 . HIS A 54  ? 0.1138 0.1348 0.1279 -0.0024 0.0274  0.0074  504 HIS A CD2 
432  C CE1 . HIS A 54  ? 0.1292 0.1407 0.1167 0.0033  0.0340  0.0100  504 HIS A CE1 
433  N NE2 . HIS A 54  ? 0.1276 0.1390 0.1259 0.0006  0.0285  0.0100  504 HIS A NE2 
434  N N   . PHE A 55  ? 0.0973 0.1356 0.1072 -0.0004 0.0371  -0.0025 505 PHE A N   
435  C CA  . PHE A 55  ? 0.1006 0.1390 0.1023 0.0045  0.0390  -0.0009 505 PHE A CA  
436  C C   . PHE A 55  ? 0.0974 0.1400 0.1069 -0.0008 0.0359  0.0031  505 PHE A C   
437  O O   . PHE A 55  ? 0.1085 0.1487 0.1189 -0.0047 0.0306  -0.0022 505 PHE A O   
438  C CB  . PHE A 55  ? 0.1268 0.1534 0.1155 0.0089  0.0320  -0.0101 505 PHE A CB  
439  C CG  . PHE A 55  ? 0.1444 0.1595 0.1257 0.0161  0.0269  -0.0169 505 PHE A CG  
440  C CD1 . PHE A 55  ? 0.1606 0.1644 0.1154 0.0322  0.0282  -0.0194 505 PHE A CD1 
441  C CD2 . PHE A 55  ? 0.1603 0.1736 0.1599 0.0096  0.0205  -0.0194 505 PHE A CD2 
442  C CE1 . PHE A 55  ? 0.1975 0.1846 0.1415 0.0421  0.0182  -0.0290 505 PHE A CE1 
443  C CE2 . PHE A 55  ? 0.2048 0.2047 0.2035 0.0155  0.0106  -0.0257 505 PHE A CE2 
444  C CZ  . PHE A 55  ? 0.2272 0.2121 0.1968 0.0320  0.0069  -0.0327 505 PHE A CZ  
445  N N   . ILE A 56  ? 0.0877 0.1367 0.1064 0.0006  0.0396  0.0143  506 ILE A N   
446  C CA  . ILE A 56  ? 0.0944 0.1442 0.1231 -0.0039 0.0326  0.0183  506 ILE A CA  
447  C C   . ILE A 56  ? 0.1085 0.1521 0.1193 -0.0010 0.0316  0.0128  506 ILE A C   
448  O O   . ILE A 56  ? 0.1460 0.1849 0.1376 0.0081  0.0378  0.0136  506 ILE A O   
449  C CB  . ILE A 56  ? 0.0961 0.1555 0.1519 -0.0040 0.0360  0.0372  506 ILE A CB  
450  C CG1 . ILE A 56  ? 0.1180 0.1796 0.2003 -0.0081 0.0287  0.0414  506 ILE A CG1 
451  C CG2 . ILE A 56  ? 0.1068 0.1654 0.1760 -0.0083 0.0268  0.0433  506 ILE A CG2 
452  C CD1 . ILE A 56  ? 0.1234 0.1720 0.2073 -0.0129 0.0074  0.0312  506 ILE A CD1 
453  N N   . ILE A 57  ? 0.1028 0.1429 0.1163 -0.0057 0.0219  0.0058  507 ILE A N   
454  C CA  . ILE A 57  ? 0.1256 0.1593 0.1295 -0.0040 0.0171  0.0014  507 ILE A CA  
455  C C   . ILE A 57  ? 0.1209 0.1566 0.1311 -0.0041 0.0164  0.0142  507 ILE A C   
456  O O   . ILE A 57  ? 0.1481 0.1852 0.1766 -0.0097 0.0072  0.0166  507 ILE A O   
457  C CB  . ILE A 57  ? 0.1043 0.1359 0.1146 -0.0072 0.0098  -0.0090 507 ILE A CB  
458  C CG1 . ILE A 57  ? 0.1273 0.1606 0.1407 -0.0069 0.0147  -0.0139 507 ILE A CG1 
459  C CG2 . ILE A 57  ? 0.1501 0.1744 0.1569 -0.0059 0.0020  -0.0136 507 ILE A CG2 
460  C CD1 . ILE A 57  ? 0.1243 0.1598 0.1489 -0.0063 0.0152  -0.0178 507 ILE A CD1 
461  N N   . GLN A 58  ? 0.1250 0.1584 0.1191 0.0046  0.0254  0.0238  508 GLN A N   
462  C CA  . GLN A 58  ? 0.1292 0.1675 0.1338 0.0063  0.0305  0.0436  508 GLN A CA  
463  C C   . GLN A 58  ? 0.1299 0.1610 0.1372 0.0013  0.0161  0.0400  508 GLN A C   
464  O O   . GLN A 58  ? 0.1528 0.1719 0.1400 0.0035  0.0076  0.0252  508 GLN A O   
465  C CB  . GLN A 58  ? 0.1875 0.2209 0.1607 0.0236  0.0473  0.0554  508 GLN A CB  
466  C CG  . GLN A 58  ? 0.3281 0.3651 0.2909 0.0336  0.0617  0.0564  508 GLN A CG  
467  C CD  . GLN A 58  ? 0.3964 0.4534 0.4011 0.0297  0.0732  0.0768  508 GLN A CD  
468  O OE1 . GLN A 58  ? 0.4484 0.5102 0.4674 0.0257  0.0720  0.0709  508 GLN A OE1 
469  N NE2 . GLN A 58  ? 0.4353 0.4995 0.4644 0.0306  0.0775  0.0973  508 GLN A NE2 
470  N N   . TYR A 59  ? 0.1581 0.1651 0.1300 -0.0528 -0.0016 0.0077  509 TYR A N   
471  C CA  . TYR A 59  ? 0.1393 0.1449 0.1084 -0.0496 0.0048  0.0188  509 TYR A CA  
472  C C   . TYR A 59  ? 0.1799 0.1757 0.1423 -0.0523 0.0167  0.0210  509 TYR A C   
473  O O   . TYR A 59  ? 0.1896 0.1815 0.1686 -0.0553 0.0262  0.0134  509 TYR A O   
474  C CB  . TYR A 59  ? 0.1516 0.1633 0.1337 -0.0430 0.0068  0.0161  509 TYR A CB  
475  C CG  . TYR A 59  ? 0.1469 0.1552 0.1367 -0.0368 0.0083  0.0209  509 TYR A CG  
476  C CD1 . TYR A 59  ? 0.1597 0.1757 0.1484 -0.0332 0.0024  0.0310  509 TYR A CD1 
477  C CD2 . TYR A 59  ? 0.1677 0.1635 0.1755 -0.0338 0.0117  0.0131  509 TYR A CD2 
478  C CE1 . TYR A 59  ? 0.1558 0.1660 0.1559 -0.0246 -0.0014 0.0332  509 TYR A CE1 
479  C CE2 . TYR A 59  ? 0.1861 0.1724 0.2091 -0.0270 0.0075  0.0172  509 TYR A CE2 
480  C CZ  . TYR A 59  ? 0.1699 0.1627 0.1862 -0.0213 0.0003  0.0272  509 TYR A CZ  
481  O OH  . TYR A 59  ? 0.1928 0.1739 0.2282 -0.0117 -0.0090 0.0290  509 TYR A OH  
482  N N   . VAL A 60  ? 0.2000 0.1940 0.1399 -0.0511 0.0157  0.0326  510 VAL A N   
483  C CA  . VAL A 60  ? 0.2476 0.2373 0.1699 -0.0542 0.0303  0.0435  510 VAL A CA  
484  C C   . VAL A 60  ? 0.2680 0.2462 0.1687 -0.0478 0.0239  0.0656  510 VAL A C   
485  O O   . VAL A 60  ? 0.2577 0.2412 0.1451 -0.0394 0.0065  0.0637  510 VAL A O   
486  C CB  . VAL A 60  ? 0.2885 0.2961 0.1892 -0.0535 0.0339  0.0309  510 VAL A CB  
487  C CG1 . VAL A 60  ? 0.3552 0.3689 0.2303 -0.0561 0.0556  0.0477  510 VAL A CG1 
488  C CG2 . VAL A 60  ? 0.3126 0.3291 0.2399 -0.0570 0.0340  0.0060  510 VAL A CG2 
489  N N   . ASP A 61  ? 0.2742 0.2348 0.1787 -0.0515 0.0344  0.0866  511 ASP A N   
490  C CA  . ASP A 61  ? 0.3243 0.2676 0.2068 -0.0430 0.0255  0.1109  511 ASP A CA  
491  C C   . ASP A 61  ? 0.2790 0.2211 0.1740 -0.0319 0.0012  0.1037  511 ASP A C   
492  O O   . ASP A 61  ? 0.3106 0.2530 0.1814 -0.0208 -0.0156 0.1096  511 ASP A O   
493  C CB  . ASP A 61  ? 0.4286 0.3811 0.2611 -0.0337 0.0293  0.1169  511 ASP A CB  
494  C CG  . ASP A 61  ? 0.6674 0.5927 0.4720 -0.0261 0.0283  0.1436  511 ASP A CG  
495  O OD1 . ASP A 61  ? 0.7173 0.6177 0.5480 -0.0266 0.0197  0.1568  511 ASP A OD1 
496  O OD2 . ASP A 61  ? 0.7758 0.7026 0.5299 -0.0206 0.0328  0.1498  511 ASP A OD2 
497  N N   . ASN A 62  ? 0.2422 0.1894 0.1775 -0.0322 -0.0008 0.0867  512 ASN A N   
498  C CA  . ASN A 62  ? 0.2254 0.1830 0.1832 -0.0214 -0.0166 0.0764  512 ASN A CA  
499  C C   . ASN A 62  ? 0.2061 0.1891 0.1593 -0.0201 -0.0252 0.0665  512 ASN A C   
500  O O   . ASN A 62  ? 0.2070 0.2051 0.1813 -0.0123 -0.0368 0.0615  512 ASN A O   
501  C CB  . ASN A 62  ? 0.2766 0.2139 0.2407 -0.0097 -0.0324 0.0898  512 ASN A CB  
502  C CG  . ASN A 62  ? 0.3419 0.2484 0.3273 -0.0127 -0.0283 0.1014  512 ASN A CG  
503  O OD1 . ASN A 62  ? 0.4281 0.3372 0.4530 -0.0110 -0.0273 0.0828  512 ASN A OD1 
504  N ND2 . ASN A 62  ? 0.4328 0.3109 0.3937 -0.0163 -0.0271 0.1330  512 ASN A ND2 
505  N N   . MET A 63  ? 0.1995 0.1895 0.1359 -0.0275 -0.0210 0.0615  513 MET A N   
506  C CA  . MET A 63  ? 0.1875 0.1955 0.1315 -0.0280 -0.0338 0.0522  513 MET A CA  
507  C C   . MET A 63  ? 0.1618 0.1786 0.1198 -0.0380 -0.0268 0.0430  513 MET A C   
508  O O   . MET A 63  ? 0.1782 0.1875 0.1254 -0.0424 -0.0159 0.0384  513 MET A O   
509  C CB  . MET A 63  ? 0.2173 0.2230 0.1299 -0.0219 -0.0465 0.0499  513 MET A CB  
510  C CG  . MET A 63  ? 0.2575 0.2539 0.1483 -0.0082 -0.0604 0.0611  513 MET A CG  
511  S SD  . MET A 63  ? 0.2717 0.2846 0.2086 -0.0010 -0.0836 0.0530  513 MET A SD  
512  C CE  . MET A 63  ? 0.3326 0.3323 0.2302 0.0206  -0.1106 0.0590  513 MET A CE  
513  N N   . TYR A 64  ? 0.1257 0.1648 0.1041 -0.0296 -0.0059 0.0298  514 TYR A N   
514  C CA  . TYR A 64  ? 0.1190 0.1628 0.1047 -0.0256 -0.0070 0.0243  514 TYR A CA  
515  C C   . TYR A 64  ? 0.1250 0.1690 0.1011 -0.0191 -0.0053 0.0197  514 TYR A C   
516  O O   . TYR A 64  ? 0.1392 0.1754 0.1046 -0.0175 -0.0076 0.0182  514 TYR A O   
517  C CB  . TYR A 64  ? 0.1178 0.1499 0.1036 -0.0259 -0.0129 0.0216  514 TYR A CB  
518  C CG  . TYR A 64  ? 0.1238 0.1527 0.1162 -0.0303 -0.0161 0.0251  514 TYR A CG  
519  C CD1 . TYR A 64  ? 0.1096 0.1409 0.1107 -0.0294 -0.0191 0.0239  514 TYR A CD1 
520  C CD2 . TYR A 64  ? 0.1178 0.1401 0.1076 -0.0338 -0.0181 0.0280  514 TYR A CD2 
521  C CE1 . TYR A 64  ? 0.1112 0.1372 0.1170 -0.0326 -0.0239 0.0262  514 TYR A CE1 
522  C CE2 . TYR A 64  ? 0.1096 0.1267 0.1032 -0.0369 -0.0219 0.0306  514 TYR A CE2 
523  C CZ  . TYR A 64  ? 0.1190 0.1374 0.1201 -0.0366 -0.0246 0.0300  514 TYR A CZ  
524  O OH  . TYR A 64  ? 0.1368 0.1479 0.1405 -0.0390 -0.0302 0.0319  514 TYR A OH  
525  N N   . ARG A 65  ? 0.1264 0.1791 0.1070 -0.0143 -0.0030 0.0159  515 ARG A N   
526  C CA  . ARG A 65  ? 0.1463 0.1984 0.1162 -0.0071 -0.0017 0.0113  515 ARG A CA  
527  C C   . ARG A 65  ? 0.1356 0.1930 0.1116 -0.0002 -0.0033 0.0050  515 ARG A C   
528  O O   . ARG A 65  ? 0.1308 0.1954 0.1210 -0.0005 -0.0052 0.0040  515 ARG A O   
529  C CB  . ARG A 65  ? 0.2053 0.2633 0.1666 -0.0060 0.0066  0.0142  515 ARG A CB  
530  C CG  . ARG A 65  ? 0.2416 0.3170 0.2172 -0.0089 0.0166  0.0163  515 ARG A CG  
531  C CD  . ARG A 65  ? 0.3323 0.4103 0.2938 -0.0063 0.0285  0.0177  515 ARG A CD  
532  N NE  . ARG A 65  ? 0.4430 0.5017 0.3787 -0.0066 0.0269  0.0226  515 ARG A NE  
533  C CZ  . ARG A 65  ? 0.4919 0.5423 0.4173 -0.0133 0.0329  0.0303  515 ARG A CZ  
534  N NH1 . ARG A 65  ? 0.5329 0.5946 0.4748 -0.0224 0.0428  0.0344  515 ARG A NH1 
535  N NH2 . ARG A 65  ? 0.4918 0.5208 0.3902 -0.0105 0.0278  0.0330  515 ARG A NH2 
536  N N   . PHE A 66  ? 0.1490 0.2006 0.1130 0.0072  -0.0048 -0.0003 516 PHE A N   
537  C CA  . PHE A 66  ? 0.1584 0.2160 0.1250 0.0168  -0.0061 -0.0073 516 PHE A CA  
538  C C   . PHE A 66  ? 0.2358 0.3085 0.2015 0.0217  0.0030  -0.0086 516 PHE A C   
539  O O   . PHE A 66  ? 0.2870 0.3791 0.2686 0.0193  0.0116  -0.0073 516 PHE A O   
540  C CB  . PHE A 66  ? 0.1964 0.2325 0.1473 0.0222  -0.0142 -0.0128 516 PHE A CB  
541  C CG  . PHE A 66  ? 0.1761 0.1941 0.1239 0.0175  -0.0197 -0.0116 516 PHE A CG  
542  C CD1 . PHE A 66  ? 0.1781 0.1969 0.1335 0.0204  -0.0245 -0.0130 516 PHE A CD1 
543  C CD2 . PHE A 66  ? 0.1736 0.1732 0.1114 0.0107  -0.0199 -0.0102 516 PHE A CD2 
544  C CE1 . PHE A 66  ? 0.2008 0.1977 0.1466 0.0173  -0.0289 -0.0117 516 PHE A CE1 
545  C CE2 . PHE A 66  ? 0.2033 0.1846 0.1356 0.0060  -0.0215 -0.0091 516 PHE A CE2 
546  C CZ  . PHE A 66  ? 0.1975 0.1750 0.1302 0.0098  -0.0258 -0.0091 516 PHE A CZ  
547  N N   . GLU A 67  ? 0.2030 0.2659 0.1499 0.0279  0.0021  -0.0115 517 GLU A N   
548  C CA  . GLU A 67  ? 0.2760 0.3478 0.2147 0.0344  0.0112  -0.0131 517 GLU A CA  
549  C C   . GLU A 67  ? 0.2781 0.3367 0.1949 0.0330  0.0127  -0.0089 517 GLU A C   
550  O O   . GLU A 67  ? 0.3109 0.3704 0.2127 0.0391  0.0205  -0.0096 517 GLU A O   
551  C CB  . GLU A 67  ? 0.3204 0.3893 0.2508 0.0475  0.0068  -0.0226 517 GLU A CB  
552  C CG  . GLU A 67  ? 0.3511 0.4347 0.3004 0.0542  0.0050  -0.0298 517 GLU A CG  
553  C CD  . GLU A 67  ? 0.2733 0.3541 0.2116 0.0694  0.0014  -0.0398 517 GLU A CD  
554  O OE1 . GLU A 67  ? 0.3796 0.4407 0.2938 0.0732  -0.0031 -0.0407 517 GLU A OE1 
555  O OE2 . GLU A 67  ? 0.3834 0.4819 0.3386 0.0781  0.0019  -0.0480 517 GLU A OE2 
556  N N   . GLY A 68  ? 0.2361 0.2811 0.1492 0.0266  0.0048  -0.0058 518 GLY A N   
557  C CA  . GLY A 68  ? 0.2530 0.2836 0.1458 0.0283  0.0014  -0.0050 518 GLY A CA  
558  C C   . GLY A 68  ? 0.2434 0.2698 0.1381 0.0199  -0.0001 0.0015  518 GLY A C   
559  O O   . GLY A 68  ? 0.2578 0.2919 0.1580 0.0141  0.0086  0.0084  518 GLY A O   
560  N N   . THR A 69  ? 0.2336 0.2478 0.1255 0.0193  -0.0114 -0.0018 519 THR A N   
561  C CA  . THR A 69  ? 0.2197 0.2286 0.1127 0.0140  -0.0156 0.0019  519 THR A CA  
562  C C   . THR A 69  ? 0.1788 0.1976 0.0918 0.0045  -0.0113 0.0076  519 THR A C   
563  O O   . THR A 69  ? 0.1799 0.2046 0.1082 0.0015  -0.0110 0.0056  519 THR A O   
564  C CB  . THR A 69  ? 0.2013 0.2018 0.0992 0.0148  -0.0290 -0.0064 519 THR A CB  
565  O OG1 . THR A 69  ? 0.2394 0.2286 0.1181 0.0247  -0.0359 -0.0128 519 THR A OG1 
566  C CG2 . THR A 69  ? 0.2139 0.2107 0.1162 0.0114  -0.0351 -0.0051 519 THR A CG2 
567  N N   . GLY A 70  ? 0.1862 0.2023 0.0946 0.0005  -0.0089 0.0145  520 GLY A N   
568  C CA  . GLY A 70  ? 0.1808 0.2026 0.1057 -0.0080 -0.0074 0.0194  520 GLY A CA  
569  C C   . GLY A 70  ? 0.1631 0.1772 0.0923 -0.0098 -0.0175 0.0171  520 GLY A C   
570  O O   . GLY A 70  ? 0.1841 0.1876 0.1008 -0.0049 -0.0252 0.0141  520 GLY A O   
571  N N   . PHE A 71  ? 0.1459 0.1646 0.0925 -0.0155 -0.0180 0.0172  521 PHE A N   
572  C CA  . PHE A 71  ? 0.1404 0.1548 0.0949 -0.0176 -0.0250 0.0142  521 PHE A CA  
573  C C   . PHE A 71  ? 0.1392 0.1539 0.0995 -0.0232 -0.0232 0.0208  521 PHE A C   
574  O O   . PHE A 71  ? 0.1538 0.1740 0.1190 -0.0266 -0.0177 0.0253  521 PHE A O   
575  C CB  . PHE A 71  ? 0.1708 0.1866 0.1389 -0.0191 -0.0260 0.0061  521 PHE A CB  
576  C CG  . PHE A 71  ? 0.1908 0.2048 0.1558 -0.0147 -0.0291 -0.0017 521 PHE A CG  
577  C CD1 . PHE A 71  ? 0.1673 0.1813 0.1270 -0.0128 -0.0250 -0.0023 521 PHE A CD1 
578  C CD2 . PHE A 71  ? 0.2495 0.2613 0.2181 -0.0115 -0.0380 -0.0100 521 PHE A CD2 
579  C CE1 . PHE A 71  ? 0.2077 0.2175 0.1632 -0.0087 -0.0290 -0.0099 521 PHE A CE1 
580  C CE2 . PHE A 71  ? 0.2335 0.2428 0.2009 -0.0077 -0.0427 -0.0185 521 PHE A CE2 
581  C CZ  . PHE A 71  ? 0.2215 0.2288 0.1811 -0.0067 -0.0377 -0.0178 521 PHE A CZ  
582  N N   . SER A 72  ? 0.1629 0.1717 0.1244 -0.0233 -0.0297 0.0198  522 SER A N   
583  C CA  . SER A 72  ? 0.1517 0.1576 0.1160 -0.0279 -0.0297 0.0257  522 SER A CA  
584  C C   . SER A 72  ? 0.1500 0.1595 0.1276 -0.0315 -0.0268 0.0245  522 SER A C   
585  O O   . SER A 72  ? 0.1487 0.1558 0.1283 -0.0349 -0.0270 0.0293  522 SER A O   
586  C CB  . SER A 72  ? 0.2054 0.2024 0.1662 -0.0249 -0.0389 0.0233  522 SER A CB  
587  O OG  . SER A 72  ? 0.2126 0.2146 0.1886 -0.0230 -0.0420 0.0134  522 SER A OG  
588  N N   . ASN A 73  ? 0.1186 0.1660 0.1177 0.0080  -0.0041 0.0423  523 ASN A N   
589  C CA  . ASN A 73  ? 0.1047 0.1596 0.1191 0.0106  0.0036  0.0388  523 ASN A CA  
590  C C   . ASN A 73  ? 0.0930 0.1464 0.1014 0.0081  0.0056  0.0337  523 ASN A C   
591  O O   . ASN A 73  ? 0.1126 0.1630 0.1126 0.0046  -0.0002 0.0330  523 ASN A O   
592  C CB  . ASN A 73  ? 0.1202 0.1839 0.1585 0.0120  0.0009  0.0409  523 ASN A CB  
593  C CG  . ASN A 73  ? 0.1557 0.2221 0.2013 0.0089  -0.0083 0.0413  523 ASN A CG  
594  O OD1 . ASN A 73  ? 0.1383 0.2080 0.1909 0.0070  -0.0055 0.0378  523 ASN A OD1 
595  N ND2 . ASN A 73  ? 0.2058 0.2682 0.2477 0.0077  -0.0204 0.0458  523 ASN A ND2 
596  N N   . ILE A 74  ? 0.0839 0.1374 0.0956 0.0095  0.0127  0.0302  524 ILE A N   
597  C CA  . ILE A 74  ? 0.0897 0.1393 0.0956 0.0074  0.0139  0.0254  524 ILE A CA  
598  C C   . ILE A 74  ? 0.0857 0.1384 0.0981 0.0042  0.0103  0.0252  524 ILE A C   
599  O O   . ILE A 74  ? 0.0920 0.1416 0.0966 0.0013  0.0070  0.0227  524 ILE A O   
600  C CB  . ILE A 74  ? 0.0734 0.1183 0.0793 0.0094  0.0195  0.0225  524 ILE A CB  
601  C CG1 . ILE A 74  ? 0.0875 0.1290 0.0886 0.0119  0.0223  0.0209  524 ILE A CG1 
602  C CG2 . ILE A 74  ? 0.0923 0.1312 0.0935 0.0070  0.0185  0.0184  524 ILE A CG2 
603  C CD1 . ILE A 74  ? 0.1053 0.1419 0.1095 0.0145  0.0252  0.0187  524 ILE A CD1 
604  N N   . PRO A 75  ? 0.0759 0.1345 0.1039 0.0040  0.0116  0.0269  525 PRO A N   
605  C CA  . PRO A 75  ? 0.0917 0.1535 0.1288 0.0001  0.0093  0.0257  525 PRO A CA  
606  C C   . PRO A 75  ? 0.0926 0.1559 0.1279 -0.0019 -0.0010 0.0270  525 PRO A C   
607  O O   . PRO A 75  ? 0.1070 0.1690 0.1404 -0.0055 -0.0036 0.0246  525 PRO A O   
608  C CB  . PRO A 75  ? 0.0889 0.1573 0.1473 0.0005  0.0143  0.0265  525 PRO A CB  
609  C CG  . PRO A 75  ? 0.0994 0.1637 0.1523 0.0036  0.0217  0.0267  525 PRO A CG  
610  C CD  . PRO A 75  ? 0.0876 0.1494 0.1271 0.0067  0.0171  0.0286  525 PRO A CD  
611  N N   . GLN A 76  ? 0.0906 0.1541 0.1235 -0.0004 -0.0077 0.0308  526 GLN A N   
612  C CA  . GLN A 76  ? 0.1128 0.1729 0.1383 -0.0035 -0.0192 0.0322  526 GLN A CA  
613  C C   . GLN A 76  ? 0.1224 0.1734 0.1242 -0.0061 -0.0182 0.0285  526 GLN A C   
614  O O   . GLN A 76  ? 0.1283 0.1765 0.1250 -0.0099 -0.0247 0.0271  526 GLN A O   
615  C CB  . GLN A 76  ? 0.1395 0.1968 0.1625 -0.0024 -0.0279 0.0377  526 GLN A CB  
616  C CG  . GLN A 76  ? 0.1965 0.2472 0.2113 -0.0064 -0.0428 0.0400  526 GLN A CG  
617  C CD  . GLN A 76  ? 0.2275 0.2718 0.2390 -0.0059 -0.0542 0.0464  526 GLN A CD  
618  O OE1 . GLN A 76  ? 0.2379 0.2828 0.2508 -0.0026 -0.0494 0.0489  526 GLN A OE1 
619  N NE2 . GLN A 76  ? 0.2580 0.2945 0.2642 -0.0097 -0.0708 0.0494  526 GLN A NE2 
620  N N   . LEU A 77  ? 0.1119 0.1581 0.1014 -0.0043 -0.0100 0.0262  527 LEU A N   
621  C CA  . LEU A 77  ? 0.1226 0.1606 0.0947 -0.0065 -0.0073 0.0211  527 LEU A CA  
622  C C   . LEU A 77  ? 0.1240 0.1627 0.1009 -0.0079 -0.0062 0.0169  527 LEU A C   
623  O O   . LEU A 77  ? 0.1321 0.1660 0.0999 -0.0114 -0.0097 0.0138  527 LEU A O   
624  C CB  . LEU A 77  ? 0.1276 0.1618 0.0935 -0.0039 0.0017  0.0187  527 LEU A CB  
625  C CG  . LEU A 77  ? 0.1236 0.1505 0.0793 -0.0054 0.0070  0.0116  527 LEU A CG  
626  C CD1 . LEU A 77  ? 0.1795 0.1969 0.1150 -0.0106 0.0049  0.0100  527 LEU A CD1 
627  C CD2 . LEU A 77  ? 0.1521 0.1777 0.1117 -0.0020 0.0157  0.0086  527 LEU A CD2 
628  N N   . ILE A 78  ? 0.1036 0.1460 0.0924 -0.0060 -0.0016 0.0167  528 ILE A N   
629  C CA  . ILE A 78  ? 0.1094 0.1489 0.0995 -0.0082 -0.0007 0.0134  528 ILE A CA  
630  C C   . ILE A 78  ? 0.1258 0.1690 0.1226 -0.0123 -0.0064 0.0142  528 ILE A C   
631  O O   . ILE A 78  ? 0.1145 0.1535 0.1058 -0.0154 -0.0091 0.0110  528 ILE A O   
632  C CB  . ILE A 78  ? 0.1108 0.1487 0.1066 -0.0067 0.0053  0.0136  528 ILE A CB  
633  C CG1 . ILE A 78  ? 0.1150 0.1484 0.1061 -0.0026 0.0088  0.0124  528 ILE A CG1 
634  C CG2 . ILE A 78  ? 0.1356 0.1667 0.1290 -0.0104 0.0054  0.0111  528 ILE A CG2 
635  C CD1 . ILE A 78  ? 0.1616 0.1879 0.1453 -0.0023 0.0077  0.0072  528 ILE A CD1 
636  N N   . ASP A 79  ? 0.1118 0.1631 0.1236 -0.0123 -0.0087 0.0179  529 ASP A N   
637  C CA  . ASP A 79  ? 0.1251 0.1810 0.1492 -0.0161 -0.0150 0.0182  529 ASP A CA  
638  C C   . ASP A 79  ? 0.1359 0.1869 0.1467 -0.0185 -0.0251 0.0177  529 ASP A C   
639  O O   . ASP A 79  ? 0.1455 0.1957 0.1584 -0.0224 -0.0297 0.0157  529 ASP A O   
640  C CB  . ASP A 79  ? 0.1560 0.2214 0.2030 -0.0148 -0.0172 0.0217  529 ASP A CB  
641  C CG  . ASP A 79  ? 0.1873 0.2566 0.2489 -0.0142 -0.0056 0.0208  529 ASP A CG  
642  O OD1 . ASP A 79  ? 0.2201 0.2828 0.2718 -0.0158 0.0026  0.0181  529 ASP A OD1 
643  O OD2 . ASP A 79  ? 0.2130 0.2900 0.2953 -0.0124 -0.0050 0.0226  529 ASP A OD2 
644  N N   . HIS A 80  ? 0.1253 0.1712 0.1208 -0.0172 -0.0281 0.0193  530 HIS A N   
645  C CA  . HIS A 80  ? 0.1428 0.1793 0.1189 -0.0209 -0.0361 0.0182  530 HIS A CA  
646  C C   . HIS A 80  ? 0.1554 0.1859 0.1204 -0.0231 -0.0321 0.0120  530 HIS A C   
647  O O   . HIS A 80  ? 0.1656 0.1925 0.1264 -0.0272 -0.0390 0.0102  530 HIS A O   
648  C CB  . HIS A 80  ? 0.1833 0.2115 0.1400 -0.0202 -0.0357 0.0200  530 HIS A CB  
649  C CG  . HIS A 80  ? 0.2318 0.2458 0.1616 -0.0253 -0.0400 0.0175  530 HIS A CG  
650  N ND1 . HIS A 80  ? 0.2578 0.2650 0.1797 -0.0299 -0.0541 0.0201  530 HIS A ND1 
651  C CD2 . HIS A 80  ? 0.2746 0.2783 0.1838 -0.0271 -0.0316 0.0119  530 HIS A CD2 
652  C CE1 . HIS A 80  ? 0.3340 0.3256 0.2269 -0.0349 -0.0539 0.0164  530 HIS A CE1 
653  N NE2 . HIS A 80  ? 0.3092 0.2990 0.1951 -0.0333 -0.0391 0.0109  530 HIS A NE2 
654  N N   . HIS A 81  ? 0.1384 0.1670 0.1004 -0.0204 -0.0222 0.0086  531 HIS A N   
655  C CA  . HIS A 81  ? 0.1527 0.1748 0.1075 -0.0221 -0.0196 0.0024  531 HIS A CA  
656  C C   . HIS A 81  ? 0.1370 0.1617 0.1030 -0.0243 -0.0219 0.0019  531 HIS A C   
657  O O   . HIS A 81  ? 0.1546 0.1740 0.1149 -0.0274 -0.0247 -0.0020 531 HIS A O   
658  C CB  . HIS A 81  ? 0.1591 0.1779 0.1126 -0.0183 -0.0109 -0.0013 531 HIS A CB  
659  C CG  . HIS A 81  ? 0.1647 0.1777 0.1052 -0.0182 -0.0064 -0.0040 531 HIS A CG  
660  N ND1 . HIS A 81  ? 0.1994 0.2033 0.1269 -0.0213 -0.0042 -0.0106 531 HIS A ND1 
661  C CD2 . HIS A 81  ? 0.1968 0.2106 0.1346 -0.0161 -0.0024 -0.0014 531 HIS A CD2 
662  C CE1 . HIS A 81  ? 0.2242 0.2227 0.1407 -0.0218 0.0023  -0.0123 531 HIS A CE1 
663  N NE2 . HIS A 81  ? 0.2368 0.2412 0.1591 -0.0187 0.0030  -0.0064 531 HIS A NE2 
664  N N   . TYR A 82  ? 0.1343 0.1659 0.1155 -0.0234 -0.0195 0.0053  532 TYR A N   
665  C CA  . TYR A 82  ? 0.1312 0.1629 0.1211 -0.0269 -0.0192 0.0044  532 TYR A CA  
666  C C   . TYR A 82  ? 0.1578 0.1933 0.1550 -0.0312 -0.0273 0.0049  532 TYR A C   
667  O O   . TYR A 82  ? 0.1815 0.2137 0.1790 -0.0352 -0.0290 0.0023  532 TYR A O   
668  C CB  . TYR A 82  ? 0.1630 0.1984 0.1650 -0.0263 -0.0119 0.0069  532 TYR A CB  
669  C CG  . TYR A 82  ? 0.1569 0.1895 0.1651 -0.0316 -0.0088 0.0057  532 TYR A CG  
670  C CD1 . TYR A 82  ? 0.1587 0.1792 0.1545 -0.0339 -0.0079 0.0030  532 TYR A CD1 
671  C CD2 . TYR A 82  ? 0.2029 0.2438 0.2308 -0.0347 -0.0066 0.0069  532 TYR A CD2 
672  C CE1 . TYR A 82  ? 0.1706 0.1855 0.1684 -0.0399 -0.0045 0.0023  532 TYR A CE1 
673  C CE2 . TYR A 82  ? 0.2445 0.2816 0.2778 -0.0408 -0.0013 0.0051  532 TYR A CE2 
674  C CZ  . TYR A 82  ? 0.2170 0.2401 0.2328 -0.0438 -0.0000 0.0031  532 TYR A CZ  
675  O OH  . TYR A 82  ? 0.3232 0.3394 0.3406 -0.0511 0.0058  0.0017  532 TYR A OH  
676  N N   . THR A 83  ? 0.1573 0.1986 0.1609 -0.0307 -0.0340 0.0082  533 THR A N   
677  C CA  . THR A 83  ? 0.1700 0.2142 0.1837 -0.0348 -0.0444 0.0087  533 THR A CA  
678  C C   . THR A 83  ? 0.2029 0.2371 0.1955 -0.0376 -0.0531 0.0064  533 THR A C   
679  O O   . THR A 83  ? 0.2290 0.2616 0.2244 -0.0419 -0.0597 0.0045  533 THR A O   
680  C CB  . THR A 83  ? 0.1909 0.2438 0.2243 -0.0335 -0.0509 0.0132  533 THR A CB  
681  O OG1 . THR A 83  ? 0.2574 0.3053 0.2749 -0.0307 -0.0554 0.0162  533 THR A OG1 
682  C CG2 . THR A 83  ? 0.2079 0.2701 0.2640 -0.0316 -0.0403 0.0139  533 THR A CG2 
683  N N   . THR A 84  ? 0.1994 0.2256 0.1701 -0.0360 -0.0524 0.0061  534 THR A N   
684  C CA  . THR A 84  ? 0.2287 0.2425 0.1760 -0.0399 -0.0590 0.0032  534 THR A CA  
685  C C   . THR A 84  ? 0.2067 0.2131 0.1417 -0.0408 -0.0516 -0.0037 534 THR A C   
686  O O   . THR A 84  ? 0.2249 0.2209 0.1430 -0.0450 -0.0558 -0.0076 534 THR A O   
687  C CB  . THR A 84  ? 0.2601 0.2650 0.1864 -0.0397 -0.0605 0.0053  534 THR A CB  
688  O OG1 . THR A 84  ? 0.2448 0.2492 0.1654 -0.0359 -0.0470 0.0030  534 THR A OG1 
689  C CG2 . THR A 84  ? 0.2709 0.2811 0.2095 -0.0385 -0.0702 0.0127  534 THR A CG2 
690  N N   . LYS A 85  ? 0.1805 0.1903 0.1235 -0.0372 -0.0415 -0.0056 535 LYS A N   
691  C CA  . LYS A 85  ? 0.1758 0.1782 0.1116 -0.0371 -0.0357 -0.0123 535 LYS A CA  
692  C C   . LYS A 85  ? 0.2011 0.1938 0.1184 -0.0371 -0.0307 -0.0174 535 LYS A C   
693  O O   . LYS A 85  ? 0.2465 0.2315 0.1581 -0.0381 -0.0272 -0.0246 535 LYS A O   
694  C CB  . LYS A 85  ? 0.1948 0.1938 0.1324 -0.0413 -0.0409 -0.0153 535 LYS A CB  
695  C CG  . LYS A 85  ? 0.1764 0.1834 0.1327 -0.0427 -0.0430 -0.0113 535 LYS A CG  
696  C CD  . LYS A 85  ? 0.1704 0.1798 0.1354 -0.0393 -0.0348 -0.0095 535 LYS A CD  
697  C CE  . LYS A 85  ? 0.1538 0.1676 0.1337 -0.0426 -0.0338 -0.0068 535 LYS A CE  
698  N NZ  . LYS A 85  ? 0.1765 0.1906 0.1609 -0.0404 -0.0255 -0.0043 535 LYS A NZ  
699  N N   . GLN A 86  ? 0.2452 0.1793 0.1347 -0.0418 -0.0181 -0.0028 536 GLN A N   
700  C CA  . GLN A 86  ? 0.2626 0.1883 0.1343 -0.0420 -0.0071 -0.0108 536 GLN A CA  
701  C C   . GLN A 86  ? 0.2465 0.1809 0.1327 -0.0366 0.0048  -0.0190 536 GLN A C   
702  O O   . GLN A 86  ? 0.2197 0.1670 0.1271 -0.0334 0.0069  -0.0165 536 GLN A O   
703  C CB  . GLN A 86  ? 0.2842 0.2085 0.1474 -0.0439 -0.0033 -0.0038 536 GLN A CB  
704  C CG  . GLN A 86  ? 0.3956 0.3113 0.2402 -0.0491 -0.0150 0.0045  536 GLN A CG  
705  C CD  . GLN A 86  ? 0.4232 0.3359 0.2591 -0.0500 -0.0116 0.0133  536 GLN A CD  
706  O OE1 . GLN A 86  ? 0.4029 0.3160 0.2408 -0.0485 0.0014  0.0111  536 GLN A OE1 
707  N NE2 . GLN A 86  ? 0.4910 0.4011 0.3179 -0.0528 -0.0239 0.0243  536 GLN A NE2 
708  N N   . VAL A 87  ? 0.2600 0.1878 0.1345 -0.0354 0.0125  -0.0290 537 VAL A N   
709  C CA  . VAL A 87  ? 0.2365 0.1753 0.1267 -0.0298 0.0230  -0.0362 537 VAL A CA  
710  C C   . VAL A 87  ? 0.2383 0.1883 0.1377 -0.0307 0.0326  -0.0344 537 VAL A C   
711  O O   . VAL A 87  ? 0.2682 0.2125 0.1549 -0.0351 0.0355  -0.0303 537 VAL A O   
712  C CB  . VAL A 87  ? 0.2925 0.2227 0.1699 -0.0269 0.0303  -0.0468 537 VAL A CB  
713  C CG1 . VAL A 87  ? 0.3450 0.2589 0.2102 -0.0273 0.0204  -0.0494 537 VAL A CG1 
714  C CG2 . VAL A 87  ? 0.3399 0.2634 0.1958 -0.0304 0.0403  -0.0495 537 VAL A CG2 
715  N N   . ILE A 88  ? 0.2027 0.1681 0.1238 -0.0270 0.0371  -0.0371 538 ILE A N   
716  C CA  . ILE A 88  ? 0.2004 0.1760 0.1311 -0.0294 0.0456  -0.0366 538 ILE A CA  
717  C C   . ILE A 88  ? 0.2182 0.1925 0.1383 -0.0321 0.0578  -0.0415 538 ILE A C   
718  O O   . ILE A 88  ? 0.2284 0.1993 0.1420 -0.0375 0.0634  -0.0379 538 ILE A O   
719  C CB  . ILE A 88  ? 0.1797 0.1730 0.1341 -0.0260 0.0462  -0.0392 538 ILE A CB  
720  C CG1 . ILE A 88  ? 0.1690 0.1637 0.1321 -0.0238 0.0356  -0.0334 538 ILE A CG1 
721  C CG2 . ILE A 88  ? 0.2022 0.2049 0.1653 -0.0303 0.0546  -0.0404 538 ILE A CG2 
722  C CD1 . ILE A 88  ? 0.1927 0.1814 0.1528 -0.0269 0.0325  -0.0256 538 ILE A CD1 
723  N N   . THR A 89  ? 0.2206 0.1971 0.1393 -0.0279 0.0631  -0.0492 539 THR A N   
724  C CA  . THR A 89  ? 0.2577 0.2331 0.1652 -0.0292 0.0756  -0.0539 539 THR A CA  
725  C C   . THR A 89  ? 0.2887 0.2529 0.1824 -0.0237 0.0745  -0.0594 539 THR A C   
726  O O   . THR A 89  ? 0.2671 0.2279 0.1646 -0.0189 0.0680  -0.0625 539 THR A O   
727  C CB  . THR A 89  ? 0.2745 0.2715 0.2068 -0.0271 0.0828  -0.0560 539 THR A CB  
728  O OG1 . THR A 89  ? 0.2671 0.2749 0.2154 -0.0188 0.0809  -0.0608 539 THR A OG1 
729  C CG2 . THR A 89  ? 0.2529 0.2597 0.1998 -0.0331 0.0827  -0.0520 539 THR A CG2 
730  N N   . LYS A 90  ? 0.2878 0.2453 0.1658 -0.0246 0.0805  -0.0603 540 LYS A N   
731  C CA  . LYS A 90  ? 0.3355 0.2816 0.1993 -0.0191 0.0808  -0.0666 540 LYS A CA  
732  C C   . LYS A 90  ? 0.3631 0.3214 0.2475 -0.0090 0.0852  -0.0728 540 LYS A C   
733  O O   . LYS A 90  ? 0.3705 0.3182 0.2511 -0.0033 0.0809  -0.0778 540 LYS A O   
734  C CB  . LYS A 90  ? 0.3928 0.3331 0.2374 -0.0216 0.0884  -0.0665 540 LYS A CB  
735  C CG  . LYS A 90  ? 0.4745 0.4011 0.3007 -0.0168 0.0891  -0.0738 540 LYS A CG  
736  C CD  . LYS A 90  ? 0.5314 0.4524 0.3360 -0.0203 0.0965  -0.0732 540 LYS A CD  
737  C CE  . LYS A 90  ? 0.6242 0.5239 0.3997 -0.0208 0.0913  -0.0779 540 LYS A CE  
738  N NZ  . LYS A 90  ? 0.6549 0.5511 0.4335 -0.0113 0.0941  -0.0882 540 LYS A NZ  
739  N N   . LYS A 91  ? 0.3316 0.3114 0.2380 -0.0070 0.0931  -0.0719 541 LYS A N   
740  C CA  . LYS A 91  ? 0.3617 0.3555 0.2883 0.0032  0.0972  -0.0762 541 LYS A CA  
741  C C   . LYS A 91  ? 0.3287 0.3242 0.2692 0.0075  0.0889  -0.0769 541 LYS A C   
742  O O   . LYS A 91  ? 0.3717 0.3638 0.3165 0.0170  0.0889  -0.0814 541 LYS A O   
743  C CB  . LYS A 91  ? 0.4009 0.4194 0.3492 0.0023  0.1052  -0.0736 541 LYS A CB  
744  C CG  . LYS A 91  ? 0.4380 0.4752 0.4104 0.0128  0.1084  -0.0760 541 LYS A CG  
745  C CD  . LYS A 91  ? 0.4615 0.5244 0.4563 0.0095  0.1139  -0.0725 541 LYS A CD  
746  C CE  . LYS A 91  ? 0.4587 0.5428 0.4799 0.0194  0.1145  -0.0729 541 LYS A CE  
747  N NZ  . LYS A 91  ? 0.4631 0.5729 0.5071 0.0140  0.1171  -0.0691 541 LYS A NZ  
748  N N   . SER A 92  ? 0.2856 0.2855 0.2329 0.0010  0.0822  -0.0725 542 SER A N   
749  C CA  . SER A 92  ? 0.2866 0.2915 0.2487 0.0047  0.0750  -0.0729 542 SER A CA  
750  C C   . SER A 92  ? 0.3087 0.2902 0.2550 0.0050  0.0636  -0.0713 542 SER A C   
751  O O   . SER A 92  ? 0.3184 0.2985 0.2745 0.0114  0.0572  -0.0707 542 SER A O   
752  C CB  . SER A 92  ? 0.2647 0.2849 0.2417 -0.0015 0.0700  -0.0667 542 SER A CB  
753  O OG  . SER A 92  ? 0.2623 0.2685 0.2240 -0.0093 0.0638  -0.0612 542 SER A OG  
754  N N   . GLY A 93  ? 0.2682 0.2319 0.1908 -0.0023 0.0602  -0.0696 543 GLY A N   
755  C CA  . GLY A 93  ? 0.2831 0.2275 0.1926 -0.0046 0.0475  -0.0670 543 GLY A CA  
756  C C   . GLY A 93  ? 0.2846 0.2363 0.2103 -0.0061 0.0357  -0.0584 543 GLY A C   
757  O O   . GLY A 93  ? 0.3012 0.2406 0.2226 -0.0070 0.0255  -0.0560 543 GLY A O   
758  N N   . VAL A 94  ? 0.2439 0.2148 0.1870 -0.0071 0.0372  -0.0540 544 VAL A N   
759  C CA  . VAL A 94  ? 0.2098 0.1897 0.1688 -0.0071 0.0284  -0.0470 544 VAL A CA  
760  C C   . VAL A 94  ? 0.1979 0.1694 0.1485 -0.0136 0.0195  -0.0395 544 VAL A C   
761  O O   . VAL A 94  ? 0.1995 0.1679 0.1402 -0.0186 0.0216  -0.0373 544 VAL A O   
762  C CB  . VAL A 94  ? 0.2201 0.2219 0.1976 -0.0065 0.0335  -0.0466 544 VAL A CB  
763  C CG1 . VAL A 94  ? 0.1780 0.1868 0.1656 -0.0081 0.0260  -0.0395 544 VAL A CG1 
764  C CG2 . VAL A 94  ? 0.2368 0.2516 0.2286 0.0010  0.0385  -0.0517 544 VAL A CG2 
765  N N   . VAL A 95  ? 0.1901 0.1591 0.1461 -0.0134 0.0098  -0.0342 545 VAL A N   
766  C CA  . VAL A 95  ? 0.1790 0.1445 0.1325 -0.0189 0.0006  -0.0258 545 VAL A CA  
767  C C   . VAL A 95  ? 0.1525 0.1334 0.1253 -0.0172 -0.0018 -0.0192 545 VAL A C   
768  O O   . VAL A 95  ? 0.1710 0.1575 0.1543 -0.0132 -0.0029 -0.0192 545 VAL A O   
769  C CB  . VAL A 95  ? 0.2011 0.1501 0.1435 -0.0221 -0.0090 -0.0251 545 VAL A CB  
770  C CG1 . VAL A 95  ? 0.2307 0.1820 0.1766 -0.0278 -0.0192 -0.0149 545 VAL A CG1 
771  C CG2 . VAL A 95  ? 0.2545 0.1863 0.1731 -0.0244 -0.0062 -0.0327 545 VAL A CG2 
772  N N   . LEU A 96  ? 0.1488 0.1355 0.1249 -0.0196 -0.0021 -0.0134 546 LEU A N   
773  C CA  . LEU A 96  ? 0.1381 0.1382 0.1299 -0.0177 -0.0028 -0.0078 546 LEU A CA  
774  C C   . LEU A 96  ? 0.1575 0.1574 0.1547 -0.0193 -0.0121 0.0004  546 LEU A C   
775  O O   . LEU A 96  ? 0.1821 0.1754 0.1736 -0.0235 -0.0187 0.0052  546 LEU A O   
776  C CB  . LEU A 96  ? 0.1456 0.1491 0.1386 -0.0186 0.0016  -0.0049 546 LEU A CB  
777  C CG  . LEU A 96  ? 0.1359 0.1385 0.1237 -0.0194 0.0110  -0.0116 546 LEU A CG  
778  C CD1 . LEU A 96  ? 0.1389 0.1421 0.1294 -0.0200 0.0148  -0.0077 546 LEU A CD1 
779  C CD2 . LEU A 96  ? 0.1263 0.1393 0.1219 -0.0170 0.0162  -0.0190 546 LEU A CD2 
780  N N   . LEU A 97  ? 0.1310 0.1395 0.1396 -0.0166 -0.0131 0.0027  547 LEU A N   
781  C CA  . LEU A 97  ? 0.1243 0.1340 0.1399 -0.0189 -0.0209 0.0112  547 LEU A CA  
782  C C   . LEU A 97  ? 0.1152 0.1407 0.1445 -0.0167 -0.0188 0.0180  547 LEU A C   
783  O O   . LEU A 97  ? 0.1460 0.1765 0.1827 -0.0193 -0.0230 0.0268  547 LEU A O   
784  C CB  . LEU A 97  ? 0.1644 0.1650 0.1781 -0.0184 -0.0247 0.0093  547 LEU A CB  
785  C CG  . LEU A 97  ? 0.1722 0.1537 0.1710 -0.0204 -0.0271 0.0024  547 LEU A CG  
786  C CD1 . LEU A 97  ? 0.2087 0.1807 0.2084 -0.0179 -0.0294 0.0011  547 LEU A CD1 
787  C CD2 . LEU A 97  ? 0.2217 0.1941 0.2122 -0.0283 -0.0353 0.0061  547 LEU A CD2 
788  N N   . ASN A 98  ? 0.1109 0.1456 0.1438 -0.0123 -0.0126 0.0144  548 ASN A N   
789  C CA  . ASN A 98  ? 0.1123 0.1605 0.1546 -0.0103 -0.0103 0.0200  548 ASN A CA  
790  C C   . ASN A 98  ? 0.0977 0.1533 0.1395 -0.0076 -0.0021 0.0146  548 ASN A C   
791  O O   . ASN A 98  ? 0.0909 0.1495 0.1300 -0.0060 0.0010  0.0074  548 ASN A O   
792  C CB  . ASN A 98  ? 0.1179 0.1694 0.1628 -0.0084 -0.0126 0.0219  548 ASN A CB  
793  C CG  . ASN A 98  ? 0.1588 0.1968 0.2012 -0.0107 -0.0197 0.0238  548 ASN A CG  
794  O OD1 . ASN A 98  ? 0.1974 0.2295 0.2365 -0.0077 -0.0202 0.0193  548 ASN A OD1 
795  N ND2 . ASN A 98  ? 0.1633 0.1966 0.2079 -0.0161 -0.0254 0.0306  548 ASN A ND2 
796  N N   . PRO A 99  ? 0.0904 0.1489 0.1353 -0.0071 0.0016  0.0177  549 PRO A N   
797  C CA  . PRO A 99  ? 0.0832 0.1452 0.1262 -0.0050 0.0099  0.0117  549 PRO A CA  
798  C C   . PRO A 99  ? 0.0877 0.1611 0.1324 -0.0028 0.0125  0.0115  549 PRO A C   
799  O O   . PRO A 99  ? 0.1001 0.1808 0.1505 -0.0015 0.0119  0.0193  549 PRO A O   
800  C CB  . PRO A 99  ? 0.0991 0.1591 0.1460 -0.0034 0.0128  0.0169  549 PRO A CB  
801  C CG  . PRO A 99  ? 0.1439 0.2087 0.1996 -0.0041 0.0062  0.0277  549 PRO A CG  
802  C CD  . PRO A 99  ? 0.1030 0.1621 0.1545 -0.0081 -0.0018 0.0270  549 PRO A CD  
803  N N   . ILE A 100 ? 0.0655 0.1420 0.1052 -0.0031 0.0150  0.0030  550 ILE A N   
804  C CA  . ILE A 100 ? 0.0777 0.1655 0.1158 -0.0018 0.0162  0.0023  550 ILE A CA  
805  C C   . ILE A 100 ? 0.0894 0.1783 0.1240 -0.0008 0.0243  -0.0009 550 ILE A C   
806  O O   . ILE A 100 ? 0.0873 0.1695 0.1177 -0.0026 0.0289  -0.0091 550 ILE A O   
807  C CB  . ILE A 100 ? 0.0905 0.1835 0.1258 -0.0028 0.0137  -0.0047 550 ILE A CB  
808  C CG1 . ILE A 100 ? 0.1387 0.2289 0.1779 -0.0016 0.0071  -0.0013 550 ILE A CG1 
809  C CG2 . ILE A 100 ? 0.1086 0.2140 0.1398 -0.0019 0.0140  -0.0050 550 ILE A CG2 
810  C CD1 . ILE A 100 ? 0.1862 0.2766 0.2286 0.0000  0.0023  0.0093  550 ILE A CD1 
811  N N   . PRO A 101 ? 0.0743 0.1701 0.1101 0.0019  0.0273  0.0050  551 PRO A N   
812  C CA  . PRO A 101 ? 0.1088 0.2033 0.1409 0.0044  0.0367  0.0015  551 PRO A CA  
813  C C   . PRO A 101 ? 0.1121 0.2082 0.1317 0.0022  0.0402  -0.0096 551 PRO A C   
814  O O   . PRO A 101 ? 0.1363 0.2414 0.1510 0.0002  0.0354  -0.0110 551 PRO A O   
815  C CB  . PRO A 101 ? 0.1094 0.2137 0.1471 0.0079  0.0392  0.0120  551 PRO A CB  
816  C CG  . PRO A 101 ? 0.1176 0.2295 0.1561 0.0058  0.0311  0.0181  551 PRO A CG  
817  C CD  . PRO A 101 ? 0.0982 0.2022 0.1388 0.0029  0.0231  0.0157  551 PRO A CD  
818  N N   . LYS A 102 ? 0.1201 0.2065 0.1343 0.0025  0.0481  -0.0174 552 LYS A N   
819  C CA  . LYS A 102 ? 0.1495 0.2345 0.1502 -0.0012 0.0517  -0.0296 552 LYS A CA  
820  C C   . LYS A 102 ? 0.2971 0.3913 0.2882 0.0012  0.0556  -0.0292 552 LYS A C   
821  O O   . LYS A 102 ? 0.3133 0.4128 0.3095 0.0066  0.0590  -0.0197 552 LYS A O   
822  C CB  . LYS A 102 ? 0.1656 0.2331 0.1624 -0.0018 0.0600  -0.0379 552 LYS A CB  
823  C CG  . LYS A 102 ? 0.2139 0.2746 0.2140 0.0063  0.0693  -0.0330 552 LYS A CG  
824  C CD  . LYS A 102 ? 0.2734 0.3137 0.2713 0.0067  0.0766  -0.0394 552 LYS A CD  
825  C CE  . LYS A 102 ? 0.3302 0.3654 0.3381 0.0165  0.0835  -0.0305 552 LYS A CE  
826  N NZ  . LYS A 102 ? 0.3636 0.3771 0.3709 0.0177  0.0890  -0.0340 552 LYS A NZ  
827  O OXT . LYS A 102 ? 0.3906 0.4879 0.3681 -0.0029 0.0553  -0.0380 552 LYS A OXT 
885  N N   . LYS C 3   ? 0.4820 0.3754 0.4767 -0.0841 0.0656  0.0069  453 LYS C N   
886  C CA  . LYS C 3   ? 0.3772 0.3175 0.3954 -0.0841 0.0766  0.0004  453 LYS C CA  
887  C C   . LYS C 3   ? 0.3173 0.2804 0.3446 -0.0666 0.0650  -0.0094 453 LYS C C   
888  O O   . LYS C 3   ? 0.3258 0.2731 0.3341 -0.0545 0.0561  -0.0082 453 LYS C O   
889  C CB  . LYS C 3   ? 0.4249 0.3705 0.4253 -0.0860 0.0937  0.0087  453 LYS C CB  
890  C CG  . LYS C 3   ? 0.5102 0.4280 0.4883 -0.1063 0.1079  0.0216  453 LYS C CG  
891  C CD  . LYS C 3   ? 0.5339 0.4817 0.5129 -0.1147 0.1311  0.0216  453 LYS C CD  
892  C CE  . LYS C 3   ? 0.5459 0.5170 0.5224 -0.0923 0.1295  0.0156  453 LYS C CE  
893  N NZ  . LYS C 3   ? 0.5860 0.5199 0.5198 -0.0792 0.1213  0.0255  453 LYS C NZ  
894  N N   . PRO C 4   ? 0.1963 0.1956 0.2511 -0.0663 0.0646  -0.0193 454 PRO C N   
895  C CA  . PRO C 4   ? 0.1718 0.1867 0.2275 -0.0525 0.0532  -0.0260 454 PRO C CA  
896  C C   . PRO C 4   ? 0.1693 0.1804 0.2040 -0.0400 0.0551  -0.0203 454 PRO C C   
897  O O   . PRO C 4   ? 0.1816 0.1900 0.2074 -0.0400 0.0663  -0.0145 454 PRO C O   
898  C CB  . PRO C 4   ? 0.1903 0.2408 0.2759 -0.0546 0.0517  -0.0361 454 PRO C CB  
899  C CG  . PRO C 4   ? 0.2462 0.3004 0.3531 -0.0719 0.0598  -0.0386 454 PRO C CG  
900  C CD  . PRO C 4   ? 0.2227 0.2485 0.3081 -0.0798 0.0726  -0.0258 454 PRO C CD  
901  N N   . LEU C 5   ? 0.1598 0.1705 0.1849 -0.0308 0.0443  -0.0231 455 LEU C N   
902  C CA  . LEU C 5   ? 0.1682 0.1720 0.1737 -0.0199 0.0435  -0.0190 455 LEU C CA  
903  C C   . LEU C 5   ? 0.1824 0.2039 0.1967 -0.0135 0.0488  -0.0202 455 LEU C C   
904  O O   . LEU C 5   ? 0.1815 0.1960 0.1823 -0.0068 0.0546  -0.0169 455 LEU C O   
905  C CB  . LEU C 5   ? 0.2016 0.2039 0.1970 -0.0163 0.0319  -0.0221 455 LEU C CB  
906  C CG  . LEU C 5   ? 0.1775 0.1655 0.1606 -0.0189 0.0282  -0.0243 455 LEU C CG  
907  C CD1 . LEU C 5   ? 0.2152 0.2100 0.1917 -0.0223 0.0206  -0.0295 455 LEU C CD1 
908  C CD2 . LEU C 5   ? 0.1862 0.1557 0.1504 -0.0126 0.0302  -0.0195 455 LEU C CD2 
909  N N   . ALA C 6   ? 0.1710 0.2180 0.2098 -0.0139 0.0455  -0.0277 456 ALA C N   
910  C CA  . ALA C 6   ? 0.2190 0.2887 0.2730 -0.0045 0.0471  -0.0341 456 ALA C CA  
911  C C   . ALA C 6   ? 0.2393 0.3194 0.2998 -0.0096 0.0662  -0.0342 456 ALA C C   
912  O O   . ALA C 6   ? 0.2426 0.3400 0.3105 0.0007  0.0700  -0.0411 456 ALA C O   
913  C CB  . ALA C 6   ? 0.2200 0.3183 0.3032 -0.0040 0.0380  -0.0449 456 ALA C CB  
914  N N   . GLU C 7   ? 0.1781 0.2460 0.2333 -0.0253 0.0777  -0.0275 457 GLU C N   
915  C CA  . GLU C 7   ? 0.2047 0.2770 0.2569 -0.0354 0.0976  -0.0249 457 GLU C CA  
916  C C   . GLU C 7   ? 0.2382 0.2778 0.2509 -0.0320 0.1020  -0.0137 457 GLU C C   
917  O O   . GLU C 7   ? 0.2928 0.3308 0.2926 -0.0409 0.1188  -0.0098 457 GLU C O   
918  C CB  . GLU C 7   ? 0.2316 0.3045 0.2974 -0.0577 0.1071  -0.0230 457 GLU C CB  
919  C CG  . GLU C 7   ? 0.2897 0.3998 0.3982 -0.0622 0.1033  -0.0370 457 GLU C CG  
920  C CD  . GLU C 7   ? 0.3437 0.4508 0.4665 -0.0861 0.1112  -0.0361 457 GLU C CD  
921  O OE1 . GLU C 7   ? 0.3854 0.4659 0.4859 -0.1016 0.1244  -0.0243 457 GLU C OE1 
922  O OE2 . GLU C 7   ? 0.3314 0.4592 0.4850 -0.0897 0.1026  -0.0469 457 GLU C OE2 
923  N N   . GLN C 8   ? 0.2037 0.2186 0.1960 -0.0209 0.0877  -0.0096 458 GLN C N   
924  C CA  . GLN C 8   ? 0.2198 0.2061 0.1773 -0.0155 0.0882  -0.0020 458 GLN C CA  
925  C C   . GLN C 8   ? 0.2214 0.2186 0.1731 -0.0013 0.0904  -0.0078 458 GLN C C   
926  O O   . GLN C 8   ? 0.2066 0.2150 0.1711 0.0100  0.0799  -0.0151 458 GLN C O   
927  C CB  . GLN C 8   ? 0.2192 0.1812 0.1640 -0.0105 0.0720  0.0004  458 GLN C CB  
928  C CG  . GLN C 8   ? 0.2163 0.1679 0.1691 -0.0204 0.0664  0.0016  458 GLN C CG  
929  C CD  . GLN C 8   ? 0.2525 0.1778 0.1874 -0.0300 0.0722  0.0108  458 GLN C CD  
930  O OE1 . GLN C 8   ? 0.3161 0.2245 0.2233 -0.0280 0.0780  0.0178  458 GLN C OE1 
931  N NE2 . GLN C 8   ? 0.2573 0.1752 0.2044 -0.0407 0.0695  0.0109  458 GLN C NE2 
932  N N   . ASP C 9   ? 0.2454 0.2352 0.1739 -0.0016 0.1025  -0.0048 459 ASP C N   
933  C CA  . ASP C 9   ? 0.2508 0.2526 0.1747 0.0127  0.1053  -0.0137 459 ASP C CA  
934  C C   . ASP C 9   ? 0.2406 0.2238 0.1545 0.0280  0.0867  -0.0155 459 ASP C C   
935  O O   . ASP C 9   ? 0.2692 0.2626 0.1921 0.0416  0.0808  -0.0252 459 ASP C O   
936  C CB  . ASP C 9   ? 0.2868 0.2798 0.1792 0.0085  0.1210  -0.0099 459 ASP C CB  
937  C CG  . ASP C 9   ? 0.4212 0.4328 0.3199 -0.0113 0.1420  -0.0078 459 ASP C CG  
938  O OD1 . ASP C 9   ? 0.4995 0.4934 0.3686 -0.0209 0.1467  0.0025  459 ASP C OD1 
939  O OD2 . ASP C 9   ? 0.4008 0.4455 0.3368 -0.0174 0.1484  -0.0164 459 ASP C OD2 
940  N N   . TRP C 10  ? 0.2458 0.2014 0.1426 0.0254  0.0765  -0.0078 460 TRP C N   
941  C CA  . TRP C 10  ? 0.2575 0.1956 0.1431 0.0348  0.0617  -0.0099 460 TRP C CA  
942  C C   . TRP C 10  ? 0.2463 0.1879 0.1484 0.0339  0.0495  -0.0119 460 TRP C C   
943  O O   . TRP C 10  ? 0.2322 0.1585 0.1240 0.0371  0.0387  -0.0130 460 TRP C O   
944  C CB  . TRP C 10  ? 0.2599 0.1726 0.1224 0.0327  0.0562  -0.0050 460 TRP C CB  
945  C CG  . TRP C 10  ? 0.2542 0.1608 0.1201 0.0218  0.0566  0.0013  460 TRP C CG  
946  C CD1 . TRP C 10  ? 0.2807 0.1732 0.1294 0.0159  0.0633  0.0090  460 TRP C CD1 
947  C CD2 . TRP C 10  ? 0.2272 0.1379 0.1120 0.0155  0.0488  -0.0003 460 TRP C CD2 
948  N NE1 . TRP C 10  ? 0.2781 0.1625 0.1360 0.0079  0.0581  0.0120  460 TRP C NE1 
949  C CE2 . TRP C 10  ? 0.2358 0.1346 0.1179 0.0082  0.0498  0.0047  460 TRP C CE2 
950  C CE3 . TRP C 10  ? 0.2147 0.1359 0.1147 0.0145  0.0410  -0.0057 460 TRP C CE3 
951  C CZ2 . TRP C 10  ? 0.2273 0.1281 0.1267 0.0023  0.0427  0.0014  460 TRP C CZ2 
952  C CZ3 . TRP C 10  ? 0.1967 0.1229 0.1110 0.0068  0.0364  -0.0083 460 TRP C CZ3 
953  C CH2 . TRP C 10  ? 0.2002 0.1180 0.1166 0.0020  0.0370  -0.0063 460 TRP C CH2 
954  N N   . TYR C 11  ? 0.1815 0.1586 0.1448 0.0461  0.0480  -0.0123 461 TYR C N   
955  C CA  . TYR C 11  ? 0.1821 0.1409 0.1346 0.0401  0.0436  -0.0110 461 TYR C CA  
956  C C   . TYR C 11  ? 0.2019 0.1538 0.1615 0.0369  0.0331  -0.0129 461 TYR C C   
957  O O   . TYR C 11  ? 0.2144 0.1660 0.1843 0.0378  0.0291  -0.0125 461 TYR C O   
958  C CB  . TYR C 11  ? 0.2063 0.1511 0.1471 0.0376  0.0461  -0.0070 461 TYR C CB  
959  C CG  . TYR C 11  ? 0.2080 0.1305 0.1329 0.0291  0.0415  -0.0057 461 TYR C CG  
960  C CD1 . TYR C 11  ? 0.2516 0.1678 0.1651 0.0258  0.0466  -0.0061 461 TYR C CD1 
961  C CD2 . TYR C 11  ? 0.2267 0.1340 0.1481 0.0235  0.0317  -0.0035 461 TYR C CD2 
962  C CE1 . TYR C 11  ? 0.2889 0.1828 0.1846 0.0166  0.0431  -0.0052 461 TYR C CE1 
963  C CE2 . TYR C 11  ? 0.2807 0.1656 0.1841 0.0136  0.0262  -0.0016 461 TYR C CE2 
964  C CZ  . TYR C 11  ? 0.2900 0.1678 0.1791 0.0100  0.0325  -0.0029 461 TYR C CZ  
965  O OH  . TYR C 11  ? 0.4204 0.2742 0.2885 -0.0012 0.0279  -0.0013 461 TYR C OH  
966  N N   . HIS C 12  ? 0.1894 0.1356 0.1456 0.0329  0.0287  -0.0143 462 HIS C N   
967  C CA  . HIS C 12  ? 0.1914 0.1325 0.1579 0.0300  0.0185  -0.0158 462 HIS C CA  
968  C C   . HIS C 12  ? 0.2197 0.1395 0.1743 0.0212  0.0095  -0.0121 462 HIS C C   
969  O O   . HIS C 12  ? 0.2478 0.1625 0.2107 0.0177  -0.0002 -0.0123 462 HIS C O   
970  C CB  . HIS C 12  ? 0.2186 0.1710 0.1934 0.0320  0.0190  -0.0208 462 HIS C CB  
971  C CG  . HIS C 12  ? 0.1962 0.1660 0.1832 0.0382  0.0250  -0.0251 462 HIS C CG  
972  N ND1 . HIS C 12  ? 0.2294 0.2042 0.2326 0.0394  0.0229  -0.0300 462 HIS C ND1 
973  C CD2 . HIS C 12  ? 0.1987 0.1807 0.1833 0.0424  0.0333  -0.0251 462 HIS C CD2 
974  C CE1 . HIS C 12  ? 0.2378 0.2259 0.2449 0.0435  0.0305  -0.0335 462 HIS C CE1 
975  N NE2 . HIS C 12  ? 0.2533 0.2463 0.2491 0.0451  0.0359  -0.0300 462 HIS C NE2 
976  N N   . GLY C 13  ? 0.2220 0.1281 0.1568 0.0166  0.0124  -0.0086 463 GLY C N   
977  C CA  . GLY C 13  ? 0.2374 0.1202 0.1565 0.0060  0.0034  -0.0048 463 GLY C CA  
978  C C   . GLY C 13  ? 0.2627 0.1403 0.1753 0.0013  0.0005  -0.0063 463 GLY C C   
979  O O   . GLY C 13  ? 0.2567 0.1431 0.1664 0.0044  0.0094  -0.0093 463 GLY C O   
980  N N   . ALA C 14  ? 0.2656 0.1288 0.1775 -0.0068 -0.0131 -0.0033 464 ALA C N   
981  C CA  . ALA C 14  ? 0.2980 0.1514 0.1995 -0.0138 -0.0175 -0.0034 464 ALA C CA  
982  C C   . ALA C 14  ? 0.2907 0.1585 0.2143 -0.0092 -0.0221 -0.0069 464 ALA C C   
983  O O   . ALA C 14  ? 0.2928 0.1508 0.2139 -0.0159 -0.0312 -0.0055 464 ALA C O   
984  C CB  . ALA C 14  ? 0.3888 0.2153 0.2727 -0.0276 -0.0305 0.0028  464 ALA C CB  
985  N N   . ILE C 15  ? 0.2329 0.1221 0.1763 0.0012  -0.0158 -0.0114 465 ILE C N   
986  C CA  . ILE C 15  ? 0.2283 0.1285 0.1898 0.0044  -0.0190 -0.0156 465 ILE C CA  
987  C C   . ILE C 15  ? 0.2304 0.1301 0.1794 0.0019  -0.0157 -0.0175 465 ILE C C   
988  O O   . ILE C 15  ? 0.2549 0.1564 0.1892 0.0028  -0.0055 -0.0176 465 ILE C O   
989  C CB  . ILE C 15  ? 0.2096 0.1305 0.1901 0.0143  -0.0113 -0.0209 465 ILE C CB  
990  C CG1 . ILE C 15  ? 0.2372 0.1704 0.2073 0.0194  0.0016  -0.0229 465 ILE C CG1 
991  C CG2 . ILE C 15  ? 0.2289 0.1501 0.2254 0.0165  -0.0145 -0.0192 465 ILE C CG2 
992  C CD1 . ILE C 15  ? 0.2474 0.1997 0.2309 0.0264  0.0080  -0.0285 465 ILE C CD1 
993  N N   . PRO C 16  ? 0.2381 0.1353 0.1941 -0.0012 -0.0236 -0.0184 466 PRO C N   
994  C CA  . PRO C 16  ? 0.2427 0.1394 0.1876 -0.0039 -0.0208 -0.0199 466 PRO C CA  
995  C C   . PRO C 16  ? 0.2256 0.1428 0.1791 0.0041  -0.0115 -0.0253 466 PRO C C   
996  O O   . PRO C 16  ? 0.2097 0.1403 0.1784 0.0107  -0.0088 -0.0288 466 PRO C O   
997  C CB  . PRO C 16  ? 0.2555 0.1434 0.2089 -0.0096 -0.0341 -0.0189 466 PRO C CB  
998  C CG  . PRO C 16  ? 0.2368 0.1312 0.2160 -0.0050 -0.0394 -0.0200 466 PRO C CG  
999  C CD  . PRO C 16  ? 0.2299 0.1231 0.2060 -0.0031 -0.0361 -0.0173 466 PRO C CD  
1000 N N   . ARG C 17  ? 0.2218 0.1401 0.1650 0.0024  -0.0068 -0.0256 467 ARG C N   
1001 C CA  . ARG C 17  ? 0.2087 0.1450 0.1587 0.0080  0.0000  -0.0293 467 ARG C CA  
1002 C C   . ARG C 17  ? 0.2041 0.1503 0.1716 0.0113  -0.0043 -0.0345 467 ARG C C   
1003 O O   . ARG C 17  ? 0.2106 0.1712 0.1848 0.0166  0.0013  -0.0378 467 ARG C O   
1004 C CB  . ARG C 17  ? 0.2250 0.1587 0.1653 0.0041  0.0026  -0.0281 467 ARG C CB  
1005 C CG  . ARG C 17  ? 0.2624 0.2135 0.2103 0.0082  0.0069  -0.0305 467 ARG C CG  
1006 C CD  . ARG C 17  ? 0.2953 0.2428 0.2362 0.0039  0.0087  -0.0286 467 ARG C CD  
1007 N NE  . ARG C 17  ? 0.2834 0.2263 0.2146 0.0030  0.0186  -0.0245 467 ARG C NE  
1008 C CZ  . ARG C 17  ? 0.2516 0.2041 0.1864 0.0048  0.0268  -0.0222 467 ARG C CZ  
1009 N NH1 . ARG C 17  ? 0.2474 0.2142 0.1925 0.0068  0.0244  -0.0232 467 ARG C NH1 
1010 N NH2 . ARG C 17  ? 0.2517 0.1984 0.1806 0.0041  0.0373  -0.0188 467 ARG C NH2 
1011 N N   . ILE C 18  ? 0.2057 0.1433 0.1806 0.0076  -0.0139 -0.0353 468 ILE C N   
1012 C CA  . ILE C 18  ? 0.2149 0.1601 0.2078 0.0104  -0.0163 -0.0411 468 ILE C CA  
1013 C C   . ILE C 18  ? 0.2170 0.1695 0.2228 0.0159  -0.0120 -0.0441 468 ILE C C   
1014 O O   . ILE C 18  ? 0.2446 0.2074 0.2593 0.0193  -0.0072 -0.0502 468 ILE C O   
1015 C CB  . ILE C 18  ? 0.2097 0.1431 0.2115 0.0052  -0.0278 -0.0403 468 ILE C CB  
1016 C CG1 . ILE C 18  ? 0.2657 0.2065 0.2864 0.0080  -0.0279 -0.0473 468 ILE C CG1 
1017 C CG2 . ILE C 18  ? 0.2266 0.1470 0.2340 0.0020  -0.0363 -0.0351 468 ILE C CG2 
1018 C CD1 . ILE C 18  ? 0.2965 0.2481 0.3103 0.0093  -0.0219 -0.0519 468 ILE C CD1 
1019 N N   . GLU C 19  ? 0.3161 0.1145 0.2159 0.0053  -0.0198 0.0142  469 GLU C N   
1020 C CA  . GLU C 19  ? 0.3205 0.1175 0.2091 0.0202  -0.0073 0.0077  469 GLU C CA  
1021 C C   . GLU C 19  ? 0.3300 0.1341 0.1909 0.0221  -0.0063 -0.0012 469 GLU C C   
1022 O O   . GLU C 19  ? 0.3662 0.1656 0.2107 0.0302  0.0004  -0.0117 469 GLU C O   
1023 C CB  . GLU C 19  ? 0.3280 0.1416 0.2299 0.0215  -0.0009 0.0243  469 GLU C CB  
1024 C CG  . GLU C 19  ? 0.3314 0.1407 0.2612 0.0247  -0.0009 0.0342  469 GLU C CG  
1025 C CD  . GLU C 19  ? 0.3582 0.1914 0.3013 0.0234  0.0044  0.0524  469 GLU C CD  
1026 O OE1 . GLU C 19  ? 0.3482 0.1844 0.3162 0.0239  0.0019  0.0653  469 GLU C OE1 
1027 O OE2 . GLU C 19  ? 0.3692 0.2159 0.2960 0.0198  0.0084  0.0556  469 GLU C OE2 
1028 N N   . ALA C 20  ? 0.3055 0.1237 0.1599 0.0165  -0.0135 0.0028  470 ALA C N   
1029 C CA  . ALA C 20  ? 0.3348 0.1566 0.1630 0.0213  -0.0161 -0.0042 470 ALA C CA  
1030 C C   . ALA C 20  ? 0.3751 0.1904 0.1919 0.0199  -0.0193 -0.0188 470 ALA C C   
1031 O O   . ALA C 20  ? 0.4344 0.2465 0.2281 0.0248  -0.0175 -0.0261 470 ALA C O   
1032 C CB  . ALA C 20  ? 0.3616 0.2025 0.1866 0.0227  -0.0243 0.0004  470 ALA C CB  
1033 N N   . GLN C 21  ? 0.3958 0.2069 0.2254 0.0097  -0.0264 -0.0219 471 GLN C N   
1034 C CA  . GLN C 21  ? 0.4472 0.2467 0.2616 0.0037  -0.0336 -0.0361 471 GLN C CA  
1035 C C   . GLN C 21  ? 0.5037 0.2767 0.3015 0.0144  -0.0249 -0.0517 471 GLN C C   
1036 O O   . GLN C 21  ? 0.5966 0.3649 0.3698 0.0142  -0.0272 -0.0654 471 GLN C O   
1037 C CB  . GLN C 21  ? 0.4913 0.2849 0.3198 -0.0154 -0.0472 -0.0327 471 GLN C CB  
1038 C CG  . GLN C 21  ? 0.5010 0.3389 0.3452 -0.0270 -0.0549 -0.0169 471 GLN C CG  
1039 C CD  . GLN C 21  ? 0.5392 0.3975 0.3792 -0.0474 -0.0707 -0.0169 471 GLN C CD  
1040 O OE1 . GLN C 21  ? 0.6015 0.4273 0.4270 -0.0590 -0.0797 -0.0276 471 GLN C OE1 
1041 N NE2 . GLN C 21  ? 0.4023 0.3177 0.2529 -0.0515 -0.0750 -0.0054 471 GLN C NE2 
1042 N N   . GLU C 22  ? 0.4277 0.1903 0.2382 0.0251  -0.0145 -0.0495 472 GLU C N   
1043 C CA  . GLU C 22  ? 0.4613 0.2130 0.2578 0.0411  -0.0032 -0.0645 472 GLU C CA  
1044 C C   . GLU C 22  ? 0.4613 0.2388 0.2375 0.0456  0.0067  -0.0629 472 GLU C C   
1045 O O   . GLU C 22  ? 0.4841 0.2626 0.2378 0.0539  0.0136  -0.0779 472 GLU C O   
1046 C CB  . GLU C 22  ? 0.5570 0.3052 0.3776 0.0541  0.0054  -0.0584 472 GLU C CB  
1047 C CG  . GLU C 22  ? 0.6839 0.4243 0.4939 0.0771  0.0165  -0.0770 472 GLU C CG  
1048 C CD  . GLU C 22  ? 0.7948 0.4860 0.5958 0.0825  0.0048  -0.0975 472 GLU C CD  
1049 O OE1 . GLU C 22  ? 0.8108 0.4786 0.6218 0.0633  -0.0125 -0.0901 472 GLU C OE1 
1050 O OE2 . GLU C 22  ? 0.8695 0.5607 0.6616 0.1003  0.0116  -0.1162 472 GLU C OE2 
1051 N N   . LEU C 23  ? 0.4000 0.1959 0.1799 0.0396  0.0058  -0.0447 473 LEU C N   
1052 C CA  . LEU C 23  ? 0.4033 0.2156 0.1621 0.0395  0.0107  -0.0373 473 LEU C CA  
1053 C C   . LEU C 23  ? 0.4381 0.2499 0.1689 0.0352  0.0013  -0.0422 473 LEU C C   
1054 O O   . LEU C 23  ? 0.4613 0.2825 0.1683 0.0337  0.0034  -0.0376 473 LEU C O   
1055 C CB  . LEU C 23  ? 0.3802 0.1985 0.1481 0.0340  0.0088  -0.0160 473 LEU C CB  
1056 C CG  . LEU C 23  ? 0.3791 0.2084 0.1719 0.0356  0.0183  -0.0056 473 LEU C CG  
1057 C CD1 . LEU C 23  ? 0.3989 0.2260 0.1998 0.0267  0.0112  0.0124  473 LEU C CD1 
1058 C CD2 . LEU C 23  ? 0.4879 0.3430 0.2717 0.0379  0.0308  -0.0017 473 LEU C CD2 
1059 N N   . LEU C 24  ? 0.4020 0.2084 0.1354 0.0313  -0.0105 -0.0483 474 LEU C N   
1060 C CA  . LEU C 24  ? 0.4442 0.2591 0.1578 0.0284  -0.0214 -0.0501 474 LEU C CA  
1061 C C   . LEU C 24  ? 0.4637 0.2776 0.1697 0.0232  -0.0231 -0.0675 474 LEU C C   
1062 O O   . LEU C 24  ? 0.4774 0.2759 0.1889 0.0173  -0.0291 -0.0774 474 LEU C O   
1063 C CB  . LEU C 24  ? 0.4533 0.2787 0.1786 0.0281  -0.0337 -0.0430 474 LEU C CB  
1064 C CG  . LEU C 24  ? 0.4088 0.2335 0.1432 0.0349  -0.0334 -0.0286 474 LEU C CG  
1065 C CD1 . LEU C 24  ? 0.4296 0.2753 0.1809 0.0377  -0.0420 -0.0253 474 LEU C CD1 
1066 C CD2 . LEU C 24  ? 0.4258 0.2482 0.1499 0.0389  -0.0355 -0.0185 474 LEU C CD2 
1067 N N   . LYS C 25  ? 0.4040 0.2178 0.1787 0.0867  0.0020  -0.0576 475 LYS C N   
1068 C CA  . LYS C 25  ? 0.4455 0.2304 0.1902 0.0914  -0.0016 -0.0623 475 LYS C CA  
1069 C C   . LYS C 25  ? 0.4571 0.2271 0.1828 0.0806  -0.0087 -0.0629 475 LYS C C   
1070 O O   . LYS C 25  ? 0.5059 0.2457 0.2060 0.0794  -0.0167 -0.0661 475 LYS C O   
1071 C CB  . LYS C 25  ? 0.5146 0.3081 0.2516 0.1090  0.0123  -0.0654 475 LYS C CB  
1072 C CG  . LYS C 25  ? 0.5972 0.4002 0.3475 0.1220  0.0175  -0.0646 475 LYS C CG  
1073 C CD  . LYS C 25  ? 0.6685 0.4926 0.4199 0.1388  0.0329  -0.0651 475 LYS C CD  
1074 C CE  . LYS C 25  ? 0.6863 0.5452 0.4683 0.1451  0.0402  -0.0597 475 LYS C CE  
1075 N NZ  . LYS C 25  ? 0.7028 0.5901 0.4910 0.1597  0.0551  -0.0578 475 LYS C NZ  
1076 N N   . LYS C 26  ? 0.4380 0.2263 0.1728 0.0727  -0.0065 -0.0595 476 LYS C N   
1077 C CA  . LYS C 26  ? 0.4708 0.2468 0.1870 0.0631  -0.0135 -0.0589 476 LYS C CA  
1078 C C   . LYS C 26  ? 0.4292 0.2171 0.1609 0.0495  -0.0199 -0.0525 476 LYS C C   
1079 O O   . LYS C 26  ? 0.3957 0.2039 0.1506 0.0489  -0.0151 -0.0494 476 LYS C O   
1080 C CB  . LYS C 26  ? 0.5693 0.3522 0.2698 0.0705  -0.0022 -0.0614 476 LYS C CB  
1081 C CG  . LYS C 26  ? 0.5832 0.4006 0.3023 0.0721  0.0112  -0.0572 476 LYS C CG  
1082 C CD  . LYS C 26  ? 0.6401 0.4648 0.3429 0.0779  0.0219  -0.0586 476 LYS C CD  
1083 C CE  . LYS C 26  ? 0.6642 0.5233 0.3848 0.0755  0.0339  -0.0523 476 LYS C CE  
1084 N NZ  . LYS C 26  ? 0.6887 0.5735 0.4366 0.0814  0.0431  -0.0503 476 LYS C NZ  
1085 N N   . GLN C 27  ? 0.4342 0.2088 0.1514 0.0388  -0.0311 -0.0502 477 GLN C N   
1086 C CA  . GLN C 27  ? 0.4047 0.1873 0.1335 0.0259  -0.0401 -0.0428 477 GLN C CA  
1087 C C   . GLN C 27  ? 0.4131 0.2212 0.1577 0.0280  -0.0286 -0.0390 477 GLN C C   
1088 O O   . GLN C 27  ? 0.4200 0.2385 0.1571 0.0328  -0.0177 -0.0390 477 GLN C O   
1089 C CB  . GLN C 27  ? 0.4246 0.1953 0.1333 0.0169  -0.0505 -0.0401 477 GLN C CB  
1090 C CG  . GLN C 27  ? 0.4329 0.2141 0.1536 0.0044  -0.0611 -0.0303 477 GLN C CG  
1091 C CD  . GLN C 27  ? 0.4846 0.2615 0.2197 -0.0064 -0.0761 -0.0257 477 GLN C CD  
1092 O OE1 . GLN C 27  ? 0.5040 0.2671 0.2379 -0.0055 -0.0787 -0.0299 477 GLN C OE1 
1093 N NE2 . GLN C 27  ? 0.5816 0.3725 0.3316 -0.0164 -0.0858 -0.0152 477 GLN C NE2 
1094 N N   . GLY C 28  ? 0.3419 0.1596 0.1074 0.0235  -0.0308 -0.0352 478 GLY C N   
1095 C CA  . GLY C 28  ? 0.3208 0.1650 0.1101 0.0224  -0.0202 -0.0282 478 GLY C CA  
1096 C C   . GLY C 28  ? 0.2986 0.1604 0.1021 0.0308  -0.0053 -0.0310 478 GLY C C   
1097 O O   . GLY C 28  ? 0.2845 0.1671 0.1077 0.0274  0.0029  -0.0249 478 GLY C O   
1098 N N   . ASP C 29  ? 0.3199 0.1734 0.1130 0.0414  -0.0020 -0.0394 479 ASP C N   
1099 C CA  . ASP C 29  ? 0.3184 0.1928 0.1293 0.0495  0.0100  -0.0404 479 ASP C CA  
1100 C C   . ASP C 29  ? 0.2823 0.1685 0.1236 0.0418  0.0067  -0.0352 479 ASP C C   
1101 O O   . ASP C 29  ? 0.2810 0.1534 0.1256 0.0364  -0.0047 -0.0345 479 ASP C O   
1102 C CB  . ASP C 29  ? 0.3139 0.1808 0.1208 0.0605  0.0103  -0.0457 479 ASP C CB  
1103 C CG  . ASP C 29  ? 0.3542 0.2197 0.1430 0.0690  0.0173  -0.0487 479 ASP C CG  
1104 O OD1 . ASP C 29  ? 0.4137 0.2876 0.1951 0.0658  0.0225  -0.0464 479 ASP C OD1 
1105 O OD2 . ASP C 29  ? 0.3760 0.2307 0.1567 0.0791  0.0177  -0.0530 479 ASP C OD2 
1106 N N   . PHE C 30  ? 0.2387 0.1505 0.1008 0.0405  0.0165  -0.0311 480 PHE C N   
1107 C CA  . PHE C 30  ? 0.2101 0.1309 0.0967 0.0335  0.0140  -0.0270 480 PHE C CA  
1108 C C   . PHE C 30  ? 0.1949 0.1403 0.0980 0.0358  0.0235  -0.0259 480 PHE C C   
1109 O O   . PHE C 30  ? 0.2238 0.1858 0.1247 0.0395  0.0331  -0.0254 480 PHE C O   
1110 C CB  . PHE C 30  ? 0.2200 0.1413 0.1156 0.0221  0.0111  -0.0201 480 PHE C CB  
1111 C CG  . PHE C 30  ? 0.1970 0.1319 0.0949 0.0176  0.0205  -0.0156 480 PHE C CG  
1112 C CD1 . PHE C 30  ? 0.2428 0.1732 0.1236 0.0176  0.0223  -0.0141 480 PHE C CD1 
1113 C CD2 . PHE C 30  ? 0.1983 0.1478 0.1125 0.0118  0.0266  -0.0123 480 PHE C CD2 
1114 C CE1 . PHE C 30  ? 0.2387 0.1794 0.1200 0.0120  0.0306  -0.0086 480 PHE C CE1 
1115 C CE2 . PHE C 30  ? 0.2111 0.1690 0.1246 0.0051  0.0342  -0.0076 480 PHE C CE2 
1116 C CZ  . PHE C 30  ? 0.2071 0.1606 0.1048 0.0052  0.0363  -0.0053 480 PHE C CZ  
1117 N N   . LEU C 31  ? 0.1794 0.1288 0.0989 0.0325  0.0202  -0.0244 481 LEU C N   
1118 C CA  . LEU C 31  ? 0.1791 0.1520 0.1156 0.0308  0.0263  -0.0219 481 LEU C CA  
1119 C C   . LEU C 31  ? 0.1694 0.1398 0.1193 0.0216  0.0214  -0.0191 481 LEU C C   
1120 O O   . LEU C 31  ? 0.1648 0.1183 0.1128 0.0196  0.0140  -0.0190 481 LEU C O   
1121 C CB  . LEU C 31  ? 0.1927 0.1746 0.1298 0.0443  0.0286  -0.0249 481 LEU C CB  
1122 C CG  . LEU C 31  ? 0.2076 0.1691 0.1394 0.0522  0.0202  -0.0286 481 LEU C CG  
1123 C CD1 . LEU C 31  ? 0.1851 0.1525 0.1336 0.0459  0.0158  -0.0251 481 LEU C CD1 
1124 C CD2 . LEU C 31  ? 0.2549 0.2163 0.1765 0.0703  0.0243  -0.0328 481 LEU C CD2 
1125 N N   . VAL C 32  ? 0.1450 0.1335 0.1075 0.0155  0.0256  -0.0162 482 VAL C N   
1126 C CA  . VAL C 32  ? 0.1355 0.1220 0.1075 0.0079  0.0224  -0.0143 482 VAL C CA  
1127 C C   . VAL C 32  ? 0.1214 0.1231 0.1025 0.0111  0.0214  -0.0140 482 VAL C C   
1128 O O   . VAL C 32  ? 0.1282 0.1504 0.1135 0.0146  0.0258  -0.0130 482 VAL C O   
1129 C CB  . VAL C 32  ? 0.1377 0.1253 0.1110 -0.0042 0.0268  -0.0111 482 VAL C CB  
1130 C CG1 . VAL C 32  ? 0.1550 0.1405 0.1344 -0.0111 0.0252  -0.0102 482 VAL C CG1 
1131 C CG2 . VAL C 32  ? 0.1523 0.1234 0.1175 -0.0051 0.0266  -0.0100 482 VAL C CG2 
1132 N N   . ARG C 33  ? 0.1280 0.1215 0.1127 0.0102  0.0157  -0.0136 483 ARG C N   
1133 C CA  . ARG C 33  ? 0.1246 0.1303 0.1169 0.0134  0.0133  -0.0122 483 ARG C CA  
1134 C C   . ARG C 33  ? 0.1326 0.1328 0.1282 0.0045  0.0099  -0.0102 483 ARG C C   
1135 O O   . ARG C 33  ? 0.1374 0.1236 0.1301 -0.0010 0.0098  -0.0100 483 ARG C O   
1136 C CB  . ARG C 33  ? 0.1343 0.1305 0.1216 0.0277  0.0089  -0.0143 483 ARG C CB  
1137 C CG  . ARG C 33  ? 0.1535 0.1223 0.1324 0.0273  0.0019  -0.0158 483 ARG C CG  
1138 C CD  . ARG C 33  ? 0.1723 0.1237 0.1399 0.0401  -0.0031 -0.0187 483 ARG C CD  
1139 N NE  . ARG C 33  ? 0.1828 0.1078 0.1409 0.0359  -0.0111 -0.0193 483 ARG C NE  
1140 C CZ  . ARG C 33  ? 0.1773 0.0926 0.1382 0.0303  -0.0179 -0.0158 483 ARG C CZ  
1141 N NH1 . ARG C 33  ? 0.1907 0.1176 0.1611 0.0296  -0.0176 -0.0122 483 ARG C NH1 
1142 N NH2 . ARG C 33  ? 0.2042 0.0994 0.1579 0.0245  -0.0256 -0.0149 483 ARG C NH2 
1143 N N   . GLU C 34  ? 0.1380 0.1511 0.1397 0.0040  0.0075  -0.0077 484 GLU C N   
1144 C CA  . GLU C 34  ? 0.1581 0.1663 0.1601 -0.0035 0.0044  -0.0056 484 GLU C CA  
1145 C C   . GLU C 34  ? 0.1869 0.1803 0.1871 0.0032  -0.0020 -0.0046 484 GLU C C   
1146 O O   . GLU C 34  ? 0.2954 0.2898 0.2959 0.0137  -0.0056 -0.0042 484 GLU C O   
1147 C CB  . GLU C 34  ? 0.2021 0.2310 0.2094 -0.0085 0.0030  -0.0025 484 GLU C CB  
1148 C CG  . GLU C 34  ? 0.3112 0.3629 0.3236 -0.0122 0.0068  -0.0015 484 GLU C CG  
1149 C CD  . GLU C 34  ? 0.3563 0.4310 0.3749 -0.0192 0.0030  0.0031  484 GLU C CD  
1150 O OE1 . GLU C 34  ? 0.4386 0.5137 0.4587 -0.0154 -0.0029 0.0058  484 GLU C OE1 
1151 O OE2 . GLU C 34  ? 0.4507 0.5432 0.4720 -0.0297 0.0050  0.0051  484 GLU C OE2 
1152 N N   . SER C 35  ? 0.1463 0.1263 0.1441 -0.0026 -0.0031 -0.0034 485 SER C N   
1153 C CA  . SER C 35  ? 0.1419 0.1071 0.1376 0.0004  -0.0095 -0.0010 485 SER C CA  
1154 C C   . SER C 35  ? 0.1452 0.1136 0.1414 0.0018  -0.0145 0.0028  485 SER C C   
1155 O O   . SER C 35  ? 0.1501 0.1312 0.1482 -0.0036 -0.0130 0.0046  485 SER C O   
1156 C CB  . SER C 35  ? 0.1447 0.1020 0.1409 -0.0073 -0.0081 0.0015  485 SER C CB  
1157 O OG  . SER C 35  ? 0.1621 0.1078 0.1574 -0.0077 -0.0148 0.0055  485 SER C OG  
1158 N N   . HIS C 36  ? 0.1526 0.1067 0.1448 0.0087  -0.0213 0.0043  486 HIS C N   
1159 C CA  . HIS C 36  ? 0.1551 0.1058 0.1456 0.0097  -0.0273 0.0097  486 HIS C CA  
1160 C C   . HIS C 36  ? 0.1696 0.1066 0.1573 0.0008  -0.0306 0.0145  486 HIS C C   
1161 O O   . HIS C 36  ? 0.1896 0.1310 0.1771 -0.0047 -0.0315 0.0196  486 HIS C O   
1162 C CB  . HIS C 36  ? 0.1958 0.1365 0.1812 0.0240  -0.0326 0.0094  486 HIS C CB  
1163 C CG  . HIS C 36  ? 0.1912 0.1541 0.1830 0.0338  -0.0291 0.0084  486 HIS C CG  
1164 N ND1 . HIS C 36  ? 0.2170 0.1890 0.2107 0.0395  -0.0230 0.0032  486 HIS C ND1 
1165 C CD2 . HIS C 36  ? 0.2164 0.1985 0.2147 0.0377  -0.0309 0.0133  486 HIS C CD2 
1166 C CE1 . HIS C 36  ? 0.2071 0.2045 0.2095 0.0466  -0.0206 0.0053  486 HIS C CE1 
1167 N NE2 . HIS C 36  ? 0.2168 0.2215 0.2229 0.0457  -0.0258 0.0116  486 HIS C NE2 
1168 N N   . GLY C 37  ? 0.1702 0.1358 0.1343 -0.0046 -0.0249 0.0039  487 GLY C N   
1169 C CA  . GLY C 37  ? 0.1802 0.1465 0.1458 -0.0123 -0.0246 0.0076  487 GLY C CA  
1170 C C   . GLY C 37  ? 0.1541 0.1355 0.1270 -0.0128 -0.0211 0.0098  487 GLY C C   
1171 O O   . GLY C 37  ? 0.1912 0.1751 0.1648 -0.0173 -0.0188 0.0135  487 GLY C O   
1172 N N   . LYS C 38  ? 0.1504 0.1399 0.1262 -0.0083 -0.0200 0.0075  488 LYS C N   
1173 C CA  . LYS C 38  ? 0.1396 0.1391 0.1182 -0.0066 -0.0167 0.0088  488 LYS C CA  
1174 C C   . LYS C 38  ? 0.1290 0.1261 0.1024 -0.0023 -0.0158 0.0071  488 LYS C C   
1175 O O   . LYS C 38  ? 0.1395 0.1371 0.1110 -0.0004 -0.0157 0.0045  488 LYS C O   
1176 C CB  . LYS C 38  ? 0.1612 0.1700 0.1453 -0.0060 -0.0174 0.0077  488 LYS C CB  
1177 C CG  . LYS C 38  ? 0.2022 0.2188 0.1941 -0.0123 -0.0189 0.0094  488 LYS C CG  
1178 C CD  . LYS C 38  ? 0.2870 0.3182 0.2867 -0.0100 -0.0204 0.0086  488 LYS C CD  
1179 C CE  . LYS C 38  ? 0.3236 0.3681 0.3341 -0.0183 -0.0224 0.0103  488 LYS C CE  
1180 N NZ  . LYS C 38  ? 0.3540 0.4073 0.3693 -0.0231 -0.0166 0.0141  488 LYS C NZ  
1181 N N   . PRO C 39  ? 0.1346 0.1282 0.1039 -0.0016 -0.0156 0.0086  489 PRO C N   
1182 C CA  . PRO C 39  ? 0.1515 0.1454 0.1171 0.0006  -0.0162 0.0067  489 PRO C CA  
1183 C C   . PRO C 39  ? 0.1491 0.1442 0.1103 0.0007  -0.0138 0.0056  489 PRO C C   
1184 O O   . PRO C 39  ? 0.1623 0.1578 0.1214 0.0016  -0.0111 0.0074  489 PRO C O   
1185 C CB  . PRO C 39  ? 0.1652 0.1557 0.1261 0.0015  -0.0174 0.0094  489 PRO C CB  
1186 C CG  . PRO C 39  ? 0.1688 0.1527 0.1295 0.0001  -0.0179 0.0121  489 PRO C CG  
1187 C CD  . PRO C 39  ? 0.1474 0.1356 0.1138 -0.0037 -0.0156 0.0123  489 PRO C CD  
1188 N N   . GLY C 40  ? 0.1355 0.1303 0.0939 -0.0002 -0.0144 0.0026  490 GLY C N   
1189 C CA  . GLY C 40  ? 0.1468 0.1364 0.0960 -0.0010 -0.0126 0.0013  490 GLY C CA  
1190 C C   . GLY C 40  ? 0.1487 0.1345 0.0957 0.0005  -0.0116 0.0002  490 GLY C C   
1191 O O   . GLY C 40  ? 0.1690 0.1458 0.1045 0.0000  -0.0105 -0.0011 490 GLY C O   
1192 N N   . GLU C 41  ? 0.1382 0.1282 0.0932 0.0019  -0.0128 0.0008  491 GLU C N   
1193 C CA  . GLU C 41  ? 0.1386 0.1258 0.0912 0.0039  -0.0135 -0.0002 491 GLU C CA  
1194 C C   . GLU C 41  ? 0.1442 0.1284 0.0951 0.0012  -0.0144 -0.0028 491 GLU C C   
1195 O O   . GLU C 41  ? 0.1615 0.1496 0.1178 -0.0008 -0.0146 -0.0037 491 GLU C O   
1196 C CB  . GLU C 41  ? 0.1486 0.1441 0.1105 0.0060  -0.0151 0.0016  491 GLU C CB  
1197 C CG  . GLU C 41  ? 0.2142 0.2174 0.1807 0.0079  -0.0126 0.0044  491 GLU C CG  
1198 C CD  . GLU C 41  ? 0.3461 0.3490 0.3068 0.0150  -0.0107 0.0044  491 GLU C CD  
1199 O OE1 . GLU C 41  ? 0.3593 0.3696 0.3228 0.0179  -0.0072 0.0063  491 GLU C OE1 
1200 O OE2 . GLU C 41  ? 0.3503 0.3442 0.3015 0.0184  -0.0122 0.0027  491 GLU C OE2 
1201 N N   . TYR C 42  ? 0.1385 0.1148 0.0803 0.0021  -0.0147 -0.0039 492 TYR C N   
1202 C CA  . TYR C 42  ? 0.1431 0.1152 0.0805 -0.0004 -0.0146 -0.0062 492 TYR C CA  
1203 C C   . TYR C 42  ? 0.1447 0.1170 0.0844 0.0021  -0.0185 -0.0063 492 TYR C C   
1204 O O   . TYR C 42  ? 0.1571 0.1327 0.0998 0.0057  -0.0215 -0.0047 492 TYR C O   
1205 C CB  . TYR C 42  ? 0.1707 0.1297 0.0914 -0.0026 -0.0124 -0.0072 492 TYR C CB  
1206 C CG  . TYR C 42  ? 0.1640 0.1221 0.0804 -0.0086 -0.0090 -0.0079 492 TYR C CG  
1207 C CD1 . TYR C 42  ? 0.1714 0.1234 0.0811 -0.0079 -0.0089 -0.0067 492 TYR C CD1 
1208 C CD2 . TYR C 42  ? 0.1731 0.1371 0.0914 -0.0152 -0.0059 -0.0100 492 TYR C CD2 
1209 C CE1 . TYR C 42  ? 0.1911 0.1409 0.0948 -0.0152 -0.0070 -0.0077 492 TYR C CE1 
1210 C CE2 . TYR C 42  ? 0.1929 0.1596 0.1087 -0.0226 -0.0037 -0.0108 492 TYR C CE2 
1211 C CZ  . TYR C 42  ? 0.1987 0.1571 0.1065 -0.0233 -0.0049 -0.0097 492 TYR C CZ  
1212 O OH  . TYR C 42  ? 0.2464 0.2061 0.1498 -0.0325 -0.0039 -0.0108 492 TYR C OH  
1213 N N   . VAL C 43  ? 0.1426 0.1124 0.0808 0.0002  -0.0185 -0.0086 493 VAL C N   
1214 C CA  . VAL C 43  ? 0.1544 0.1219 0.0921 0.0010  -0.0230 -0.0094 493 VAL C CA  
1215 C C   . VAL C 43  ? 0.1708 0.1266 0.0934 0.0006  -0.0222 -0.0117 493 VAL C C   
1216 O O   . VAL C 43  ? 0.1809 0.1343 0.0985 -0.0018 -0.0169 -0.0137 493 VAL C O   
1217 C CB  . VAL C 43  ? 0.1687 0.1385 0.1137 -0.0004 -0.0238 -0.0104 493 VAL C CB  
1218 C CG1 . VAL C 43  ? 0.1665 0.1312 0.1084 -0.0016 -0.0294 -0.0115 493 VAL C CG1 
1219 C CG2 . VAL C 43  ? 0.1749 0.1526 0.1309 -0.0008 -0.0235 -0.0077 493 VAL C CG2 
1220 N N   . LEU C 44  ? 0.1687 0.1189 0.0839 0.0027  -0.0276 -0.0115 494 LEU C N   
1221 C CA  . LEU C 44  ? 0.1868 0.1237 0.0854 0.0023  -0.0284 -0.0137 494 LEU C CA  
1222 C C   . LEU C 44  ? 0.2071 0.1435 0.1079 0.0011  -0.0328 -0.0158 494 LEU C C   
1223 O O   . LEU C 44  ? 0.1979 0.1404 0.1060 0.0011  -0.0400 -0.0149 494 LEU C O   
1224 C CB  . LEU C 44  ? 0.2203 0.1486 0.1060 0.0066  -0.0334 -0.0121 494 LEU C CB  
1225 C CG  . LEU C 44  ? 0.2245 0.1371 0.0901 0.0070  -0.0366 -0.0137 494 LEU C CG  
1226 C CD1 . LEU C 44  ? 0.2489 0.1485 0.0986 0.0025  -0.0277 -0.0154 494 LEU C CD1 
1227 C CD2 . LEU C 44  ? 0.2835 0.1890 0.1377 0.0138  -0.0437 -0.0115 494 LEU C CD2 
1228 N N   . SER C 45  ? 0.1934 0.1232 0.0876 -0.0003 -0.0282 -0.0190 495 SER C N   
1229 C CA  . SER C 45  ? 0.2162 0.1393 0.1067 -0.0010 -0.0316 -0.0218 495 SER C CA  
1230 C C   . SER C 45  ? 0.2385 0.1458 0.1075 -0.0008 -0.0326 -0.0245 495 SER C C   
1231 O O   . SER C 45  ? 0.2452 0.1470 0.1031 -0.0005 -0.0252 -0.0255 495 SER C O   
1232 C CB  . SER C 45  ? 0.2248 0.1497 0.1207 0.0003  -0.0256 -0.0238 495 SER C CB  
1233 O OG  . SER C 45  ? 0.2156 0.1518 0.1280 0.0001  -0.0260 -0.0212 495 SER C OG  
1234 N N   . VAL C 46  ? 0.2572 0.1574 0.1195 -0.0021 -0.0417 -0.0256 496 VAL C N   
1235 C CA  A VAL C 46  ? 0.2775 0.1611 0.1166 -0.0017 -0.0449 -0.0278 496 VAL C CA  
1236 C CA  B VAL C 46  ? 0.2811 0.1648 0.1203 -0.0017 -0.0450 -0.0277 496 VAL C CA  
1237 C C   . VAL C 46  ? 0.2939 0.1658 0.1239 -0.0043 -0.0508 -0.0316 496 VAL C C   
1238 O O   . VAL C 46  ? 0.3455 0.2232 0.1875 -0.0079 -0.0567 -0.0313 496 VAL C O   
1239 C CB  A VAL C 46  ? 0.3101 0.1949 0.1450 0.0002  -0.0534 -0.0248 496 VAL C CB  
1240 C CB  B VAL C 46  ? 0.3051 0.1904 0.1406 0.0001  -0.0537 -0.0248 496 VAL C CB  
1241 C CG1 A VAL C 46  ? 0.3335 0.2011 0.1455 0.0015  -0.0544 -0.0255 496 VAL C CG1 
1242 C CG1 B VAL C 46  ? 0.2831 0.1769 0.1266 0.0031  -0.0492 -0.0210 496 VAL C CG1 
1243 C CG2 A VAL C 46  ? 0.2805 0.1737 0.1233 0.0031  -0.0486 -0.0210 496 VAL C CG2 
1244 C CG2 B VAL C 46  ? 0.3234 0.2198 0.1713 -0.0021 -0.0658 -0.0242 496 VAL C CG2 
1245 N N   . TYR C 47  ? 0.3106 0.1664 0.1207 -0.0032 -0.0477 -0.0343 497 TYR C N   
1246 C CA  . TYR C 47  ? 0.3325 0.1762 0.1335 -0.0054 -0.0529 -0.0367 497 TYR C CA  
1247 C C   . TYR C 47  ? 0.3349 0.1776 0.1302 -0.0067 -0.0626 -0.0346 497 TYR C C   
1248 O O   . TYR C 47  ? 0.3507 0.1881 0.1349 -0.0036 -0.0597 -0.0330 497 TYR C O   
1249 C CB  . TYR C 47  ? 0.3604 0.1895 0.1453 -0.0019 -0.0430 -0.0402 497 TYR C CB  
1250 C CG  . TYR C 47  ? 0.3783 0.1914 0.1516 -0.0034 -0.0474 -0.0431 497 TYR C CG  
1251 C CD1 . TYR C 47  ? 0.3977 0.2001 0.1570 -0.0057 -0.0540 -0.0429 497 TYR C CD1 
1252 C CD2 . TYR C 47  ? 0.4264 0.2328 0.2006 -0.0023 -0.0454 -0.0459 497 TYR C CD2 
1253 C CE1 . TYR C 47  ? 0.4155 0.2014 0.1620 -0.0079 -0.0582 -0.0456 497 TYR C CE1 
1254 C CE2 . TYR C 47  ? 0.4469 0.2350 0.2074 -0.0039 -0.0493 -0.0481 497 TYR C CE2 
1255 C CZ  . TYR C 47  ? 0.4373 0.2155 0.1841 -0.0074 -0.0557 -0.0481 497 TYR C CZ  
1256 O OH  . TYR C 47  ? 0.5272 0.2855 0.2582 -0.0098 -0.0598 -0.0504 497 TYR C OH  
1257 N N   . SER C 48  ? 0.3328 0.1814 0.1358 -0.0116 -0.0740 -0.0344 498 SER C N   
1258 C CA  . SER C 48  ? 0.3517 0.2039 0.1521 -0.0121 -0.0845 -0.0328 498 SER C CA  
1259 C C   . SER C 48  ? 0.4114 0.2636 0.2137 -0.0200 -0.0942 -0.0348 498 SER C C   
1260 O O   . SER C 48  ? 0.3898 0.2503 0.2058 -0.0261 -0.0962 -0.0350 498 SER C O   
1261 C CB  . SER C 48  ? 0.3544 0.2275 0.1711 -0.0090 -0.0893 -0.0291 498 SER C CB  
1262 O OG  . SER C 48  ? 0.3784 0.2548 0.1906 -0.0059 -0.0982 -0.0275 498 SER C OG  
1263 N N   . ASP C 49  ? 0.4271 0.2686 0.2143 -0.0208 -0.1001 -0.0359 499 ASP C N   
1264 C CA  . ASP C 49  ? 0.4947 0.3356 0.2814 -0.0295 -0.1102 -0.0379 499 ASP C CA  
1265 C C   . ASP C 49  ? 0.4697 0.2964 0.2526 -0.0353 -0.1059 -0.0405 499 ASP C C   
1266 O O   . ASP C 49  ? 0.5299 0.3633 0.3229 -0.0446 -0.1119 -0.0407 499 ASP C O   
1267 C CB  . ASP C 49  ? 0.5677 0.4381 0.3772 -0.0341 -0.1216 -0.0360 499 ASP C CB  
1268 C CG  . ASP C 49  ? 0.6521 0.5350 0.4632 -0.0257 -0.1265 -0.0334 499 ASP C CG  
1269 O OD1 . ASP C 49  ? 0.6952 0.5629 0.4867 -0.0220 -0.1290 -0.0340 499 ASP C OD1 
1270 O OD2 . ASP C 49  ? 0.6886 0.5947 0.5189 -0.0219 -0.1278 -0.0304 499 ASP C OD2 
1271 N N   . GLY C 50  ? 0.4578 0.2779 0.2434 -0.0299 -0.0880 -0.0756 500 GLY C N   
1272 C CA  . GLY C 50  ? 0.4716 0.2756 0.2572 -0.0340 -0.0815 -0.0796 500 GLY C CA  
1273 C C   . GLY C 50  ? 0.4672 0.2642 0.2644 -0.0387 -0.0749 -0.0747 500 GLY C C   
1274 O O   . GLY C 50  ? 0.5179 0.2948 0.3112 -0.0404 -0.0712 -0.0775 500 GLY C O   
1275 N N   . GLN C 51  ? 0.3896 0.1983 0.1968 -0.0395 -0.0736 -0.0671 501 GLN C N   
1276 C CA  . GLN C 51  ? 0.4033 0.2023 0.2171 -0.0436 -0.0674 -0.0617 501 GLN C CA  
1277 C C   . GLN C 51  ? 0.4006 0.2143 0.2186 -0.0345 -0.0603 -0.0527 501 GLN C C   
1278 O O   . GLN C 51  ? 0.3884 0.2176 0.2052 -0.0309 -0.0612 -0.0506 501 GLN C O   
1279 C CB  . GLN C 51  ? 0.4746 0.2805 0.3081 -0.0605 -0.0699 -0.0630 501 GLN C CB  
1280 C CG  . GLN C 51  ? 0.5311 0.3264 0.3680 -0.0729 -0.0708 -0.0731 501 GLN C CG  
1281 C CD  . GLN C 51  ? 0.6140 0.3704 0.4313 -0.0719 -0.0619 -0.0703 501 GLN C CD  
1282 O OE1 . GLN C 51  ? 0.6804 0.4177 0.4947 -0.0797 -0.0530 -0.0644 501 GLN C OE1 
1283 N NE2 . GLN C 51  ? 0.7115 0.4543 0.5124 -0.0607 -0.0638 -0.0743 501 GLN C NE2 
1284 N N   . ARG C 52  ? 0.3744 0.1810 0.1950 -0.0296 -0.0529 -0.0477 502 ARG C N   
1285 C CA  . ARG C 52  ? 0.3708 0.1970 0.2024 -0.0222 -0.0460 -0.0406 502 ARG C CA  
1286 C C   . ARG C 52  ? 0.3734 0.2127 0.2235 -0.0315 -0.0455 -0.0319 502 ARG C C   
1287 O O   . ARG C 52  ? 0.4328 0.2570 0.2835 -0.0410 -0.0447 -0.0305 502 ARG C O   
1288 C CB  . ARG C 52  ? 0.4005 0.2161 0.2255 -0.0083 -0.0416 -0.0427 502 ARG C CB  
1289 C CG  . ARG C 52  ? 0.4502 0.2666 0.2656 0.0033  -0.0394 -0.0556 502 ARG C CG  
1290 C CD  . ARG C 52  ? 0.5192 0.3060 0.3156 0.0044  -0.0451 -0.0638 502 ARG C CD  
1291 N NE  . ARG C 52  ? 0.5155 0.3141 0.3129 0.0169  -0.0403 -0.0760 502 ARG C NE  
1292 C CZ  . ARG C 52  ? 0.5647 0.3514 0.3543 0.0194  -0.0418 -0.0832 502 ARG C CZ  
1293 N NH1 . ARG C 52  ? 0.5814 0.3422 0.3598 0.0104  -0.0483 -0.0795 502 ARG C NH1 
1294 N NH2 . ARG C 52  ? 0.5656 0.3695 0.3610 0.0291  -0.0356 -0.0963 502 ARG C NH2 
1295 N N   . ARG C 53  ? 0.3139 0.1780 0.1763 -0.0302 -0.0443 -0.0275 503 ARG C N   
1296 C CA  . ARG C 53  ? 0.2987 0.1808 0.1813 -0.0374 -0.0439 -0.0218 503 ARG C CA  
1297 C C   . ARG C 53  ? 0.2490 0.1457 0.1388 -0.0299 -0.0364 -0.0148 503 ARG C C   
1298 O O   . ARG C 53  ? 0.2772 0.1790 0.1605 -0.0223 -0.0328 -0.0162 503 ARG C O   
1299 C CB  . ARG C 53  ? 0.3519 0.2506 0.2431 -0.0411 -0.0540 -0.0265 503 ARG C CB  
1300 C CG  . ARG C 53  ? 0.4103 0.2990 0.2967 -0.0486 -0.0631 -0.0373 503 ARG C CG  
1301 C CD  . ARG C 53  ? 0.4481 0.3567 0.3430 -0.0477 -0.0777 -0.0462 503 ARG C CD  
1302 N NE  . ARG C 53  ? 0.4818 0.4197 0.4091 -0.0560 -0.0790 -0.0505 503 ARG C NE  
1303 C CZ  . ARG C 53  ? 0.4998 0.4644 0.4439 -0.0536 -0.0937 -0.0631 503 ARG C CZ  
1304 N NH1 . ARG C 53  ? 0.5148 0.4739 0.4395 -0.0416 -0.1100 -0.0702 503 ARG C NH1 
1305 N NH2 . ARG C 53  ? 0.4816 0.4788 0.4603 -0.0618 -0.0926 -0.0705 503 ARG C NH2 
1306 N N   . HIS C 54  ? 0.2330 0.1351 0.1345 -0.0341 -0.0320 -0.0091 504 HIS C N   
1307 C CA  . HIS C 54  ? 0.2157 0.1289 0.1222 -0.0264 -0.0254 -0.0037 504 HIS C CA  
1308 C C   . HIS C 54  ? 0.1971 0.1323 0.1232 -0.0326 -0.0236 0.0006  504 HIS C C   
1309 O O   . HIS C 54  ? 0.2170 0.1528 0.1517 -0.0439 -0.0222 0.0010  504 HIS C O   
1310 C CB  . HIS C 54  ? 0.2382 0.1295 0.1305 -0.0208 -0.0224 -0.0015 504 HIS C CB  
1311 C CG  . HIS C 54  ? 0.2578 0.1263 0.1310 -0.0118 -0.0262 -0.0082 504 HIS C CG  
1312 N ND1 . HIS C 54  ? 0.2668 0.1456 0.1391 0.0026  -0.0262 -0.0165 504 HIS C ND1 
1313 C CD2 . HIS C 54  ? 0.3089 0.1466 0.1647 -0.0158 -0.0293 -0.0107 504 HIS C CD2 
1314 C CE1 . HIS C 54  ? 0.3008 0.1578 0.1568 0.0095  -0.0303 -0.0238 504 HIS C CE1 
1315 N NE2 . HIS C 54  ? 0.3142 0.1430 0.1578 -0.0010 -0.0328 -0.0192 504 HIS C NE2 
1316 N N   . PHE C 55  ? 0.1782 0.1304 0.1106 -0.0265 -0.0220 0.0019  505 PHE C N   
1317 C CA  . PHE C 55  ? 0.1622 0.1349 0.1119 -0.0287 -0.0214 0.0046  505 PHE C CA  
1318 C C   . PHE C 55  ? 0.1501 0.1314 0.1037 -0.0236 -0.0131 0.0086  505 PHE C C   
1319 O O   . PHE C 55  ? 0.1707 0.1521 0.1176 -0.0169 -0.0093 0.0064  505 PHE C O   
1320 C CB  . PHE C 55  ? 0.1684 0.1456 0.1144 -0.0236 -0.0276 0.0024  505 PHE C CB  
1321 C CG  . PHE C 55  ? 0.1826 0.1529 0.1214 -0.0244 -0.0392 -0.0036 505 PHE C CG  
1322 C CD1 . PHE C 55  ? 0.1807 0.1688 0.1372 -0.0262 -0.0495 -0.0099 505 PHE C CD1 
1323 C CD2 . PHE C 55  ? 0.2152 0.1648 0.1313 -0.0226 -0.0404 -0.0061 505 PHE C CD2 
1324 C CE1 . PHE C 55  ? 0.2067 0.1924 0.1577 -0.0249 -0.0631 -0.0190 505 PHE C CE1 
1325 C CE2 . PHE C 55  ? 0.2758 0.2180 0.1821 -0.0222 -0.0526 -0.0125 505 PHE C CE2 
1326 C CZ  . PHE C 55  ? 0.2498 0.2101 0.1734 -0.0227 -0.0650 -0.0191 505 PHE C CZ  
1327 N N   . ILE C 56  ? 0.1473 0.1382 0.1125 -0.0283 -0.0092 0.0120  506 ILE C N   
1328 C CA  . ILE C 56  ? 0.1292 0.1313 0.0988 -0.0229 -0.0029 0.0148  506 ILE C CA  
1329 C C   . ILE C 56  ? 0.1218 0.1392 0.1007 -0.0196 -0.0034 0.0134  506 ILE C C   
1330 O O   . ILE C 56  ? 0.1329 0.1584 0.1209 -0.0214 -0.0089 0.0119  506 ILE C O   
1331 C CB  . ILE C 56  ? 0.1336 0.1370 0.1070 -0.0297 0.0031  0.0187  506 ILE C CB  
1332 C CG1 . ILE C 56  ? 0.1725 0.1453 0.1223 -0.0314 0.0051  0.0216  506 ILE C CG1 
1333 C CG2 . ILE C 56  ? 0.1587 0.1767 0.1375 -0.0235 0.0083  0.0205  506 ILE C CG2 
1334 C CD1 . ILE C 56  ? 0.2044 0.1652 0.1358 -0.0151 0.0025  0.0214  506 ILE C CD1 
1335 N N   . ILE C 57  ? 0.1085 0.1284 0.0834 -0.0141 0.0019  0.0116  507 ILE C N   
1336 C CA  . ILE C 57  ? 0.1054 0.1303 0.0817 -0.0124 0.0049  0.0107  507 ILE C CA  
1337 C C   . ILE C 57  ? 0.1079 0.1501 0.0999 -0.0120 0.0078  0.0129  507 ILE C C   
1338 O O   . ILE C 57  ? 0.1187 0.1680 0.1133 -0.0104 0.0128  0.0125  507 ILE C O   
1339 C CB  . ILE C 57  ? 0.1115 0.1323 0.0780 -0.0120 0.0137  0.0042  507 ILE C CB  
1340 C CG1 . ILE C 57  ? 0.1629 0.1669 0.1126 -0.0138 0.0131  0.0004  507 ILE C CG1 
1341 C CG2 . ILE C 57  ? 0.1389 0.1557 0.1003 -0.0129 0.0200  0.0033  507 ILE C CG2 
1342 C CD1 . ILE C 57  ? 0.1685 0.1725 0.1115 -0.0172 0.0254  -0.0109 507 ILE C CD1 
1343 N N   . GLN C 58  ? 0.1085 0.1584 0.1101 -0.0115 0.0034  0.0134  508 GLN C N   
1344 C CA  . GLN C 58  ? 0.0969 0.1655 0.1149 -0.0118 0.0074  0.0134  508 GLN C CA  
1345 C C   . GLN C 58  ? 0.0947 0.1640 0.1094 -0.0072 0.0137  0.0122  508 GLN C C   
1346 O O   . GLN C 58  ? 0.1047 0.1586 0.1052 -0.0047 0.0143  0.0106  508 GLN C O   
1347 C CB  . GLN C 58  ? 0.1044 0.1871 0.1381 -0.0101 -0.0003 0.0089  508 GLN C CB  
1348 C CG  . GLN C 58  ? 0.1528 0.2384 0.1930 -0.0159 -0.0075 0.0050  508 GLN C CG  
1349 C CD  . GLN C 58  ? 0.1709 0.2579 0.2154 -0.0294 0.0014  0.0066  508 GLN C CD  
1350 O OE1 . GLN C 58  ? 0.2521 0.3528 0.3080 -0.0358 0.0104  0.0055  508 GLN C OE1 
1351 N NE2 . GLN C 58  ? 0.2138 0.2810 0.2436 -0.0339 0.0002  0.0090  508 GLN C NE2 
1352 N N   . TYR C 59  ? 0.0761 0.1273 0.1220 0.0061  0.0093  -0.0006 509 TYR C N   
1353 C CA  . TYR C 59  ? 0.0706 0.1246 0.1102 0.0027  0.0143  0.0008  509 TYR C CA  
1354 C C   . TYR C 59  ? 0.0742 0.1282 0.1174 0.0008  0.0181  0.0002  509 TYR C C   
1355 O O   . TYR C 59  ? 0.0806 0.1403 0.1238 -0.0010 0.0206  0.0032  509 TYR C O   
1356 C CB  . TYR C 59  ? 0.0743 0.1376 0.1139 0.0012  0.0143  0.0023  509 TYR C CB  
1357 C CG  . TYR C 59  ? 0.0659 0.1338 0.1021 -0.0054 0.0157  -0.0002 509 TYR C CG  
1358 C CD1 . TYR C 59  ? 0.0801 0.1445 0.1184 -0.0094 0.0188  -0.0013 509 TYR C CD1 
1359 C CD2 . TYR C 59  ? 0.0933 0.1685 0.1232 -0.0091 0.0132  -0.0014 509 TYR C CD2 
1360 C CE1 . TYR C 59  ? 0.0880 0.1528 0.1300 -0.0182 0.0186  -0.0062 509 TYR C CE1 
1361 C CE2 . TYR C 59  ? 0.0979 0.1765 0.1239 -0.0167 0.0114  -0.0096 509 TYR C CE2 
1362 C CZ  . TYR C 59  ? 0.0849 0.1568 0.1210 -0.0219 0.0137  -0.0133 509 TYR C CZ  
1363 O OH  . TYR C 59  ? 0.1099 0.1814 0.1487 -0.0321 0.0106  -0.0240 509 TYR C OH  
1364 N N   . VAL C 60  ? 0.0723 0.1200 0.1192 0.0023  0.0200  -0.0024 510 VAL C N   
1365 C CA  . VAL C 60  ? 0.0979 0.1467 0.1546 0.0042  0.0266  -0.0066 510 VAL C CA  
1366 C C   . VAL C 60  ? 0.0939 0.1303 0.1508 0.0046  0.0302  -0.0136 510 VAL C C   
1367 O O   . VAL C 60  ? 0.1122 0.1371 0.1731 0.0063  0.0257  -0.0082 510 VAL C O   
1368 C CB  . VAL C 60  ? 0.1019 0.1548 0.1799 0.0095  0.0229  -0.0033 510 VAL C CB  
1369 C CG1 . VAL C 60  ? 0.1120 0.1711 0.2094 0.0140  0.0333  -0.0085 510 VAL C CG1 
1370 C CG2 . VAL C 60  ? 0.0914 0.1518 0.1755 0.0063  0.0183  0.0007  510 VAL C CG2 
1371 N N   . ASP C 61  ? 0.1134 0.1507 0.1648 0.0025  0.0383  -0.0256 511 ASP C N   
1372 C CA  . ASP C 61  ? 0.1315 0.1517 0.1876 0.0024  0.0419  -0.0383 511 ASP C CA  
1373 C C   . ASP C 61  ? 0.1235 0.1300 0.1802 -0.0046 0.0347  -0.0330 511 ASP C C   
1374 O O   . ASP C 61  ? 0.1403 0.1267 0.2121 -0.0025 0.0343  -0.0292 511 ASP C O   
1375 C CB  . ASP C 61  ? 0.1729 0.1847 0.2547 0.0140  0.0477  -0.0413 511 ASP C CB  
1376 C CG  . ASP C 61  ? 0.2731 0.2615 0.3649 0.0158  0.0533  -0.0583 511 ASP C CG  
1377 O OD1 . ASP C 61  ? 0.2617 0.2490 0.3357 0.0086  0.0578  -0.0776 511 ASP C OD1 
1378 O OD2 . ASP C 61  ? 0.3172 0.2871 0.4352 0.0247  0.0513  -0.0525 511 ASP C OD2 
1379 N N   . ASN C 62  ? 0.1208 0.1401 0.1652 -0.0126 0.0298  -0.0298 512 ASN C N   
1380 C CA  . ASN C 62  ? 0.1658 0.1821 0.2153 -0.0218 0.0263  -0.0252 512 ASN C CA  
1381 C C   . ASN C 62  ? 0.1276 0.1400 0.1808 -0.0187 0.0265  -0.0072 512 ASN C C   
1382 O O   . ASN C 62  ? 0.1391 0.1485 0.1990 -0.0266 0.0283  0.0002  512 ASN C O   
1383 C CB  . ASN C 62  ? 0.2230 0.2207 0.2838 -0.0308 0.0269  -0.0384 512 ASN C CB  
1384 C CG  . ASN C 62  ? 0.2660 0.2696 0.3140 -0.0348 0.0255  -0.0615 512 ASN C CG  
1385 O OD1 . ASN C 62  ? 0.3197 0.3464 0.3529 -0.0392 0.0190  -0.0631 512 ASN C OD1 
1386 N ND2 . ASN C 62  ? 0.3474 0.3307 0.3998 -0.0318 0.0313  -0.0796 512 ASN C ND2 
1387 N N   . MET C 63  ? 0.1049 0.1201 0.1532 -0.0088 0.0247  -0.0001 513 MET C N   
1388 C CA  . MET C 63  ? 0.1146 0.1286 0.1564 -0.0051 0.0226  0.0145  513 MET C CA  
1389 C C   . MET C 63  ? 0.0978 0.1280 0.1280 -0.0010 0.0194  0.0135  513 MET C C   
1390 O O   . MET C 63  ? 0.1057 0.1415 0.1398 0.0023  0.0164  0.0070  513 MET C O   
1391 C CB  . MET C 63  ? 0.1633 0.1642 0.2126 0.0037  0.0179  0.0219  513 MET C CB  
1392 C CG  . MET C 63  ? 0.2331 0.2101 0.2999 0.0026  0.0210  0.0238  513 MET C CG  
1393 S SD  . MET C 63  ? 0.2967 0.2611 0.3606 -0.0090 0.0257  0.0420  513 MET C SD  
1394 C CE  . MET C 63  ? 0.3997 0.3434 0.4668 0.0012  0.0190  0.0685  513 MET C CE  
1395 N N   . TYR C 64  ? 0.0815 0.1346 0.0888 -0.0052 0.0160  -0.0038 514 TYR C N   
1396 C CA  . TYR C 64  ? 0.0863 0.1346 0.0921 -0.0091 0.0152  0.0017  514 TYR C CA  
1397 C C   . TYR C 64  ? 0.0990 0.1459 0.1083 -0.0092 0.0140  0.0022  514 TYR C C   
1398 O O   . TYR C 64  ? 0.1170 0.1596 0.1281 -0.0057 0.0131  -0.0008 514 TYR C O   
1399 C CB  . TYR C 64  ? 0.0923 0.1299 0.0957 -0.0086 0.0140  0.0029  514 TYR C CB  
1400 C CG  . TYR C 64  ? 0.0802 0.1193 0.0814 -0.0085 0.0135  0.0028  514 TYR C CG  
1401 C CD1 . TYR C 64  ? 0.0977 0.1357 0.0940 -0.0105 0.0119  0.0067  514 TYR C CD1 
1402 C CD2 . TYR C 64  ? 0.1103 0.1503 0.1137 -0.0066 0.0132  -0.0009 514 TYR C CD2 
1403 C CE1 . TYR C 64  ? 0.0919 0.1307 0.0857 -0.0097 0.0102  0.0067  514 TYR C CE1 
1404 C CE2 . TYR C 64  ? 0.0876 0.1296 0.0896 -0.0065 0.0115  -0.0012 514 TYR C CE2 
1405 C CZ  . TYR C 64  ? 0.0856 0.1275 0.0828 -0.0076 0.0100  0.0025  514 TYR C CZ  
1406 O OH  . TYR C 64  ? 0.1015 0.1448 0.0968 -0.0069 0.0071  0.0023  514 TYR C OH  
1407 N N   . ARG C 65  ? 0.0883 0.1370 0.0973 -0.0137 0.0129  0.0063  515 ARG C N   
1408 C CA  . ARG C 65  ? 0.1003 0.1491 0.1131 -0.0142 0.0105  0.0067  515 ARG C CA  
1409 C C   . ARG C 65  ? 0.1145 0.1595 0.1246 -0.0208 0.0075  0.0120  515 ARG C C   
1410 O O   . ARG C 65  ? 0.1121 0.1559 0.1178 -0.0252 0.0075  0.0158  515 ARG C O   
1411 C CB  . ARG C 65  ? 0.1275 0.1932 0.1489 -0.0121 0.0119  0.0035  515 ARG C CB  
1412 C CG  . ARG C 65  ? 0.1797 0.2621 0.2033 -0.0170 0.0151  0.0061  515 ARG C CG  
1413 C CD  . ARG C 65  ? 0.2997 0.4034 0.3326 -0.0135 0.0179  0.0021  515 ARG C CD  
1414 N NE  . ARG C 65  ? 0.2962 0.4181 0.3329 -0.0213 0.0206  0.0070  515 ARG C NE  
1415 C CZ  . ARG C 65  ? 0.2986 0.4450 0.3423 -0.0198 0.0255  0.0045  515 ARG C CZ  
1416 N NH1 . ARG C 65  ? 0.3570 0.5103 0.4039 -0.0090 0.0273  -0.0040 515 ARG C NH1 
1417 N NH2 . ARG C 65  ? 0.2535 0.4173 0.3003 -0.0291 0.0285  0.0106  515 ARG C NH2 
1418 N N   . PHE C 66  ? 0.1233 0.1643 0.1350 -0.0217 0.0037  0.0124  516 PHE C N   
1419 C CA  . PHE C 66  ? 0.1277 0.1684 0.1395 -0.0292 -0.0006 0.0170  516 PHE C CA  
1420 C C   . PHE C 66  ? 0.1565 0.2181 0.1808 -0.0314 -0.0002 0.0168  516 PHE C C   
1421 O O   . PHE C 66  ? 0.1932 0.2730 0.2233 -0.0331 0.0044  0.0172  516 PHE C O   
1422 C CB  . PHE C 66  ? 0.1567 0.1775 0.1601 -0.0287 -0.0063 0.0173  516 PHE C CB  
1423 C CG  . PHE C 66  ? 0.1354 0.1397 0.1279 -0.0252 -0.0058 0.0167  516 PHE C CG  
1424 C CD1 . PHE C 66  ? 0.1549 0.1533 0.1419 -0.0284 -0.0071 0.0201  516 PHE C CD1 
1425 C CD2 . PHE C 66  ? 0.1353 0.1309 0.1231 -0.0184 -0.0043 0.0132  516 PHE C CD2 
1426 C CE1 . PHE C 66  ? 0.1603 0.1457 0.1391 -0.0233 -0.0073 0.0187  516 PHE C CE1 
1427 C CE2 . PHE C 66  ? 0.1538 0.1392 0.1340 -0.0145 -0.0030 0.0122  516 PHE C CE2 
1428 C CZ  . PHE C 66  ? 0.1706 0.1513 0.1471 -0.0160 -0.0047 0.0144  516 PHE C CZ  
1429 N N   . GLU C 67  ? 0.1430 0.2042 0.1718 -0.0306 -0.0050 0.0156  517 GLU C N   
1430 C CA  . GLU C 67  ? 0.1800 0.2637 0.2231 -0.0321 -0.0057 0.0151  517 GLU C CA  
1431 C C   . GLU C 67  ? 0.1639 0.2533 0.2134 -0.0217 -0.0057 0.0087  517 GLU C C   
1432 O O   . GLU C 67  ? 0.1888 0.2959 0.2510 -0.0204 -0.0078 0.0071  517 GLU C O   
1433 C CB  . GLU C 67  ? 0.1740 0.2552 0.2196 -0.0399 -0.0135 0.0190  517 GLU C CB  
1434 C CG  . GLU C 67  ? 0.1966 0.2727 0.2371 -0.0518 -0.0155 0.0260  517 GLU C CG  
1435 C CD  . GLU C 67  ? 0.2478 0.3193 0.2904 -0.0602 -0.0250 0.0294  517 GLU C CD  
1436 O OE1 . GLU C 67  ? 0.3635 0.4313 0.4082 -0.0557 -0.0304 0.0260  517 GLU C OE1 
1437 O OE2 . GLU C 67  ? 0.3490 0.4190 0.3899 -0.0721 -0.0281 0.0359  517 GLU C OE2 
1438 N N   . GLY C 68  ? 0.1477 0.2222 0.1888 -0.0146 -0.0042 0.0053  518 GLY C N   
1439 C CA  . GLY C 68  ? 0.1430 0.2172 0.1872 -0.0054 -0.0061 0.0000  518 GLY C CA  
1440 C C   . GLY C 68  ? 0.1595 0.2351 0.2024 0.0008  -0.0013 -0.0044 518 GLY C C   
1441 O O   . GLY C 68  ? 0.1744 0.2648 0.2209 -0.0001 0.0039  -0.0052 518 GLY C O   
1442 N N   . THR C 69  ? 0.1756 0.2347 0.2118 0.0063  -0.0035 -0.0069 519 THR C N   
1443 C CA  . THR C 69  ? 0.1682 0.2243 0.2019 0.0117  -0.0012 -0.0113 519 THR C CA  
1444 C C   . THR C 69  ? 0.1537 0.2056 0.1810 0.0070  0.0037  -0.0092 519 THR C C   
1445 O O   . THR C 69  ? 0.1551 0.2010 0.1778 0.0012  0.0046  -0.0045 519 THR C O   
1446 C CB  . THR C 69  ? 0.2595 0.2963 0.2867 0.0165  -0.0065 -0.0129 519 THR C CB  
1447 O OG1 . THR C 69  ? 0.3789 0.4111 0.4038 0.0214  -0.0061 -0.0175 519 THR C OG1 
1448 C CG2 . THR C 69  ? 0.2881 0.3071 0.3044 0.0110  -0.0065 -0.0078 519 THR C CG2 
1449 N N   . GLY C 70  ? 0.1425 0.1971 0.1691 0.0105  0.0060  -0.0133 520 GLY C N   
1450 C CA  . GLY C 70  ? 0.1634 0.2159 0.1850 0.0068  0.0095  -0.0120 520 GLY C CA  
1451 C C   . GLY C 70  ? 0.1352 0.1712 0.1508 0.0070  0.0080  -0.0124 520 GLY C C   
1452 O O   . GLY C 70  ? 0.1500 0.1759 0.1641 0.0105  0.0044  -0.0148 520 GLY C O   
1453 N N   . PHE C 71  ? 0.1101 0.1437 0.1225 0.0028  0.0102  -0.0096 521 PHE C N   
1454 C CA  . PHE C 71  ? 0.1151 0.1376 0.1242 0.0011  0.0096  -0.0090 521 PHE C CA  
1455 C C   . PHE C 71  ? 0.1015 0.1285 0.1103 -0.0000 0.0107  -0.0104 521 PHE C C   
1456 O O   . PHE C 71  ? 0.1058 0.1414 0.1145 -0.0011 0.0126  -0.0091 521 PHE C O   
1457 C CB  . PHE C 71  ? 0.1436 0.1600 0.1501 -0.0022 0.0108  -0.0042 521 PHE C CB  
1458 C CG  . PHE C 71  ? 0.1360 0.1459 0.1402 -0.0014 0.0088  -0.0027 521 PHE C CG  
1459 C CD1 . PHE C 71  ? 0.1387 0.1536 0.1445 -0.0013 0.0078  -0.0018 521 PHE C CD1 
1460 C CD2 . PHE C 71  ? 0.1586 0.1570 0.1583 -0.0017 0.0071  -0.0018 521 PHE C CD2 
1461 C CE1 . PHE C 71  ? 0.1367 0.1452 0.1400 -0.0005 0.0045  -0.0007 521 PHE C CE1 
1462 C CE2 . PHE C 71  ? 0.1658 0.1568 0.1612 -0.0007 0.0043  -0.0003 521 PHE C CE2 
1463 C CZ  . PHE C 71  ? 0.1637 0.1599 0.1612 0.0004  0.0027  -0.0002 521 PHE C CZ  
1464 N N   . SER C 72  ? 0.1040 0.1243 0.1120 -0.0005 0.0085  -0.0125 522 SER C N   
1465 C CA  A SER C 72  ? 0.1125 0.1367 0.1202 -0.0017 0.0080  -0.0143 522 SER C CA  
1466 C CA  B SER C 72  ? 0.1178 0.1419 0.1255 -0.0017 0.0080  -0.0143 522 SER C CA  
1467 C C   . SER C 72  ? 0.1057 0.1339 0.1151 -0.0051 0.0099  -0.0099 522 SER C C   
1468 O O   . SER C 72  ? 0.1042 0.1378 0.1130 -0.0054 0.0092  -0.0105 522 SER C O   
1469 C CB  A SER C 72  ? 0.1717 0.1863 0.1785 -0.0028 0.0036  -0.0173 522 SER C CB  
1470 C CB  B SER C 72  ? 0.1683 0.1829 0.1751 -0.0027 0.0036  -0.0174 522 SER C CB  
1471 O OG  A SER C 72  ? 0.1664 0.1749 0.1752 -0.0079 0.0037  -0.0129 522 SER C OG  
1472 O OG  B SER C 72  ? 0.2024 0.2113 0.2061 0.0025  0.0004  -0.0229 522 SER C OG  
1473 N N   . ASN C 73  ? 0.0979 0.1233 0.1085 -0.0066 0.0117  -0.0060 523 ASN C N   
1474 C CA  . ASN C 73  ? 0.0992 0.1285 0.1117 -0.0076 0.0132  -0.0031 523 ASN C CA  
1475 C C   . ASN C 73  ? 0.1018 0.1278 0.1116 -0.0066 0.0152  -0.0002 523 ASN C C   
1476 O O   . ASN C 73  ? 0.1099 0.1304 0.1172 -0.0065 0.0155  0.0002  523 ASN C O   
1477 C CB  . ASN C 73  ? 0.1238 0.1548 0.1413 -0.0104 0.0130  -0.0027 523 ASN C CB  
1478 C CG  . ASN C 73  ? 0.1423 0.1671 0.1594 -0.0132 0.0143  -0.0011 523 ASN C CG  
1479 O OD1 . ASN C 73  ? 0.1463 0.1697 0.1612 -0.0126 0.0173  0.0014  523 ASN C OD1 
1480 N ND2 . ASN C 73  ? 0.2182 0.2375 0.2356 -0.0164 0.0112  -0.0024 523 ASN C ND2 
1481 N N   . ILE C 74  ? 0.0959 0.1240 0.1052 -0.0052 0.0154  0.0014  524 ILE C N   
1482 C CA  . ILE C 74  ? 0.0942 0.1167 0.0990 -0.0035 0.0158  0.0033  524 ILE C CA  
1483 C C   . ILE C 74  ? 0.0966 0.1161 0.1004 -0.0029 0.0186  0.0035  524 ILE C C   
1484 O O   . ILE C 74  ? 0.1017 0.1140 0.0997 -0.0024 0.0185  0.0042  524 ILE C O   
1485 C CB  . ILE C 74  ? 0.0834 0.1054 0.0861 -0.0013 0.0137  0.0044  524 ILE C CB  
1486 C CG1 . ILE C 74  ? 0.0976 0.1205 0.0975 -0.0037 0.0112  0.0059  524 ILE C CG1 
1487 C CG2 . ILE C 74  ? 0.1026 0.1160 0.0994 0.0017  0.0131  0.0051  524 ILE C CG2 
1488 C CD1 . ILE C 74  ? 0.1183 0.1380 0.1140 -0.0026 0.0076  0.0082  524 ILE C CD1 
1489 N N   . PRO C 75  ? 0.0884 0.1139 0.0970 -0.0036 0.0211  0.0034  525 PRO C N   
1490 C CA  . PRO C 75  ? 0.1083 0.1326 0.1142 -0.0040 0.0249  0.0045  525 PRO C CA  
1491 C C   . PRO C 75  ? 0.1065 0.1211 0.1063 -0.0066 0.0242  0.0056  525 PRO C C   
1492 O O   . PRO C 75  ? 0.1075 0.1161 0.0995 -0.0055 0.0257  0.0067  525 PRO C O   
1493 C CB  . PRO C 75  ? 0.1100 0.1460 0.1248 -0.0067 0.0275  0.0049  525 PRO C CB  
1494 C CG  . PRO C 75  ? 0.1033 0.1465 0.1245 -0.0040 0.0247  0.0032  525 PRO C CG  
1495 C CD  . PRO C 75  ? 0.0949 0.1303 0.1117 -0.0043 0.0205  0.0025  525 PRO C CD  
1496 N N   . GLN C 76  ? 0.0991 0.1111 0.1010 -0.0090 0.0211  0.0049  526 GLN C N   
1497 C CA  . GLN C 76  ? 0.1111 0.1133 0.1076 -0.0098 0.0189  0.0055  526 GLN C CA  
1498 C C   . GLN C 76  ? 0.1136 0.1117 0.1059 -0.0068 0.0166  0.0050  526 GLN C C   
1499 O O   . GLN C 76  ? 0.1155 0.1054 0.1013 -0.0065 0.0152  0.0062  526 GLN C O   
1500 C CB  . GLN C 76  ? 0.1166 0.1164 0.1163 -0.0112 0.0153  0.0036  526 GLN C CB  
1501 C CG  . GLN C 76  ? 0.1551 0.1526 0.1559 -0.0167 0.0155  0.0054  526 GLN C CG  
1502 C CD  . GLN C 76  ? 0.2092 0.1986 0.2026 -0.0201 0.0170  0.0098  526 GLN C CD  
1503 O OE1 . GLN C 76  ? 0.2241 0.2197 0.2168 -0.0222 0.0223  0.0126  526 GLN C OE1 
1504 N NE2 . GLN C 76  ? 0.1995 0.1752 0.1862 -0.0199 0.0123  0.0103  526 GLN C NE2 
1505 N N   . LEU C 77  ? 0.0945 0.0979 0.0900 -0.0054 0.0157  0.0039  527 LEU C N   
1506 C CA  . LEU C 77  ? 0.1143 0.1151 0.1069 -0.0047 0.0131  0.0043  527 LEU C CA  
1507 C C   . LEU C 77  ? 0.1114 0.1044 0.0959 -0.0035 0.0133  0.0055  527 LEU C C   
1508 O O   . LEU C 77  ? 0.1227 0.1086 0.1016 -0.0034 0.0105  0.0060  527 LEU C O   
1509 C CB  . LEU C 77  ? 0.1186 0.1265 0.1150 -0.0054 0.0123  0.0044  527 LEU C CB  
1510 C CG  . LEU C 77  ? 0.0992 0.1048 0.0931 -0.0070 0.0093  0.0062  527 LEU C CG  
1511 C CD1 . LEU C 77  ? 0.1243 0.1327 0.1214 -0.0076 0.0068  0.0056  527 LEU C CD1 
1512 C CD2 . LEU C 77  ? 0.1230 0.1341 0.1183 -0.0094 0.0089  0.0078  527 LEU C CD2 
1513 N N   . ILE C 78  ? 0.1114 0.1058 0.0946 -0.0018 0.0161  0.0054  528 ILE C N   
1514 C CA  . ILE C 78  ? 0.1284 0.1157 0.1026 0.0012  0.0166  0.0050  528 ILE C CA  
1515 C C   . ILE C 78  ? 0.1454 0.1282 0.1126 0.0009  0.0189  0.0058  528 ILE C C   
1516 O O   . ILE C 78  ? 0.1390 0.1122 0.0958 0.0023  0.0168  0.0056  528 ILE C O   
1517 C CB  . ILE C 78  ? 0.1334 0.1257 0.1094 0.0051  0.0192  0.0037  528 ILE C CB  
1518 C CG1 . ILE C 78  ? 0.1371 0.1300 0.1167 0.0052  0.0154  0.0039  528 ILE C CG1 
1519 C CG2 . ILE C 78  ? 0.1563 0.1421 0.1219 0.0104  0.0205  0.0018  528 ILE C CG2 
1520 C CD1 . ILE C 78  ? 0.1951 0.1767 0.1676 0.0042  0.0096  0.0048  528 ILE C CD1 
1521 N N   . ASP C 79  ? 0.1255 0.1136 0.0968 -0.0019 0.0223  0.0071  529 ASP C N   
1522 C CA  . ASP C 79  ? 0.1464 0.1293 0.1091 -0.0037 0.0246  0.0094  529 ASP C CA  
1523 C C   . ASP C 79  ? 0.1519 0.1233 0.1083 -0.0046 0.0189  0.0104  529 ASP C C   
1524 O O   . ASP C 79  ? 0.1558 0.1185 0.0999 -0.0045 0.0186  0.0119  529 ASP C O   
1525 C CB  . ASP C 79  ? 0.1496 0.1396 0.1180 -0.0084 0.0286  0.0117  529 ASP C CB  
1526 C CG  . ASP C 79  ? 0.1974 0.1848 0.1556 -0.0114 0.0329  0.0153  529 ASP C CG  
1527 O OD1 . ASP C 79  ? 0.2197 0.2090 0.1700 -0.0077 0.0371  0.0144  529 ASP C OD1 
1528 O OD2 . ASP C 79  ? 0.2307 0.2133 0.1874 -0.0173 0.0320  0.0189  529 ASP C OD2 
1529 N N   . HIS C 80  ? 0.1304 0.1026 0.0944 -0.0048 0.0142  0.0092  530 HIS C N   
1530 C CA  . HIS C 80  ? 0.1517 0.1162 0.1124 -0.0041 0.0079  0.0093  530 HIS C CA  
1531 C C   . HIS C 80  ? 0.1555 0.1139 0.1079 -0.0024 0.0049  0.0089  530 HIS C C   
1532 O O   . HIS C 80  ? 0.1559 0.1043 0.0980 -0.0019 0.0014  0.0100  530 HIS C O   
1533 C CB  . HIS C 80  ? 0.1493 0.1208 0.1215 -0.0032 0.0045  0.0071  530 HIS C CB  
1534 C CG  . HIS C 80  ? 0.1480 0.1174 0.1207 -0.0014 -0.0020 0.0064  530 HIS C CG  
1535 N ND1 . HIS C 80  ? 0.1613 0.1215 0.1289 0.0002  -0.0070 0.0071  530 HIS C ND1 
1536 C CD2 . HIS C 80  ? 0.1594 0.1353 0.1376 -0.0015 -0.0050 0.0055  530 HIS C CD2 
1537 C CE1 . HIS C 80  ? 0.1784 0.1412 0.1497 0.0020  -0.0130 0.0059  530 HIS C CE1 
1538 N NE2 . HIS C 80  ? 0.1714 0.1448 0.1499 0.0003  -0.0115 0.0052  530 HIS C NE2 
1539 N N   . HIS C 81  ? 0.1383 0.1005 0.0936 -0.0017 0.0051  0.0074  531 HIS C N   
1540 C CA  . HIS C 81  ? 0.1483 0.1018 0.0948 -0.0007 0.0005  0.0067  531 HIS C CA  
1541 C C   . HIS C 81  ? 0.1621 0.1065 0.0933 0.0022  0.0032  0.0061  531 HIS C C   
1542 O O   . HIS C 81  ? 0.1854 0.1186 0.1044 0.0031  -0.0015 0.0056  531 HIS C O   
1543 C CB  . HIS C 81  ? 0.1453 0.1022 0.0975 -0.0017 -0.0013 0.0060  531 HIS C CB  
1544 C CG  . HIS C 81  ? 0.1463 0.1122 0.1104 -0.0052 -0.0046 0.0070  531 HIS C CG  
1545 N ND1 . HIS C 81  ? 0.1581 0.1230 0.1235 -0.0075 -0.0113 0.0075  531 HIS C ND1 
1546 C CD2 . HIS C 81  ? 0.1350 0.1135 0.1105 -0.0067 -0.0020 0.0072  531 HIS C CD2 
1547 C CE1 . HIS C 81  ? 0.1612 0.1398 0.1396 -0.0101 -0.0117 0.0081  531 HIS C CE1 
1548 N NE2 . HIS C 81  ? 0.1419 0.1282 0.1254 -0.0093 -0.0058 0.0078  531 HIS C NE2 
1549 N N   . TYR C 82  ? 0.1684 0.1188 0.0996 0.0036  0.0107  0.0060  532 TYR C N   
1550 C CA  . TYR C 82  ? 0.1877 0.1339 0.1049 0.0070  0.0152  0.0050  532 TYR C CA  
1551 C C   . TYR C 82  ? 0.2043 0.1441 0.1104 0.0046  0.0155  0.0081  532 TYR C C   
1552 O O   . TYR C 82  ? 0.2156 0.1462 0.1049 0.0070  0.0153  0.0074  532 TYR C O   
1553 C CB  . TYR C 82  ? 0.1897 0.1490 0.1132 0.0089  0.0235  0.0043  532 TYR C CB  
1554 C CG  . TYR C 82  ? 0.2194 0.1793 0.1299 0.0135  0.0296  0.0026  532 TYR C CG  
1555 C CD1 . TYR C 82  ? 0.2563 0.2083 0.1559 0.0209  0.0276  -0.0024 532 TYR C CD1 
1556 C CD2 . TYR C 82  ? 0.3065 0.2744 0.2144 0.0102  0.0372  0.0060  532 TYR C CD2 
1557 C CE1 . TYR C 82  ? 0.3175 0.2713 0.2039 0.0269  0.0339  -0.0052 532 TYR C CE1 
1558 C CE2 . TYR C 82  ? 0.3589 0.3309 0.2545 0.0143  0.0443  0.0045  532 TYR C CE2 
1559 C CZ  . TYR C 82  ? 0.3655 0.3313 0.2504 0.0236  0.0430  -0.0017 532 TYR C CZ  
1560 O OH  . TYR C 82  ? 0.4600 0.4312 0.3316 0.0294  0.0507  -0.0044 532 TYR C OH  
1561 N N   . THR C 83  ? 0.1914 0.1337 0.1047 0.0001  0.0153  0.0115  533 THR C N   
1562 C CA  . THR C 83  ? 0.1865 0.1202 0.0882 -0.0029 0.0148  0.0156  533 THR C CA  
1563 C C   . THR C 83  ? 0.2048 0.1253 0.0987 -0.0018 0.0049  0.0157  533 THR C C   
1564 O O   . THR C 83  ? 0.2418 0.1509 0.1181 -0.0018 0.0032  0.0177  533 THR C O   
1565 C CB  . THR C 83  ? 0.1994 0.1373 0.1106 -0.0080 0.0164  0.0190  533 THR C CB  
1566 O OG1 . THR C 83  ? 0.2054 0.1572 0.1245 -0.0098 0.0248  0.0192  533 THR C OG1 
1567 C CG2 . THR C 83  ? 0.2053 0.1309 0.1026 -0.0121 0.0147  0.0244  533 THR C CG2 
1568 N N   . THR C 84  ? 0.2053 0.1282 0.1118 -0.0010 -0.0017 0.0136  534 THR C N   
1569 C CA  . THR C 84  ? 0.2149 0.1294 0.1185 -0.0000 -0.0117 0.0136  534 THR C CA  
1570 C C   . THR C 84  ? 0.2066 0.1165 0.1046 0.0016  -0.0170 0.0109  534 THR C C   
1571 O O   . THR C 84  ? 0.2238 0.1260 0.1166 0.0021  -0.0260 0.0110  534 THR C O   
1572 C CB  . THR C 84  ? 0.1976 0.1207 0.1194 0.0003  -0.0161 0.0125  534 THR C CB  
1573 O OG1 . THR C 84  ? 0.1922 0.1275 0.1271 -0.0001 -0.0145 0.0099  534 THR C OG1 
1574 C CG2 . THR C 84  ? 0.2222 0.1465 0.1488 -0.0008 -0.0130 0.0142  534 THR C CG2 
1575 N N   . LYS C 85  ? 0.1991 0.1126 0.0982 0.0023  -0.0132 0.0084  535 LYS C N   
1576 C CA  . LYS C 85  ? 0.2086 0.1154 0.1029 0.0030  -0.0197 0.0057  535 LYS C CA  
1577 C C   . LYS C 85  ? 0.2140 0.1270 0.1232 -0.0003 -0.0278 0.0059  535 LYS C C   
1578 O O   . LYS C 85  ? 0.2362 0.1423 0.1415 -0.0018 -0.0359 0.0048  535 LYS C O   
1579 C CB  . LYS C 85  ? 0.2277 0.1183 0.0994 0.0054  -0.0239 0.0045  535 LYS C CB  
1580 C CG  . LYS C 85  ? 0.2431 0.1309 0.0991 0.0088  -0.0145 0.0042  535 LYS C CG  
1581 C CD  . LYS C 85  ? 0.2687 0.1654 0.1312 0.0115  -0.0065 0.0016  535 LYS C CD  
1582 C CE  . LYS C 85  ? 0.2976 0.1956 0.1458 0.0156  0.0032  0.0005  535 LYS C CE  
1583 N NZ  . LYS C 85  ? 0.2509 0.1625 0.1102 0.0185  0.0114  -0.0014 535 LYS C NZ  
1584 N N   . GLN C 86  ? 0.2414 0.1298 0.1169 -0.0080 -0.0420 0.0214  536 GLN C N   
1585 C CA  . GLN C 86  ? 0.2251 0.1352 0.1284 -0.0064 -0.0492 0.0211  536 GLN C CA  
1586 C C   . GLN C 86  ? 0.2114 0.1387 0.1166 -0.0130 -0.0507 0.0171  536 GLN C C   
1587 O O   . GLN C 86  ? 0.2082 0.1387 0.1058 -0.0167 -0.0420 0.0125  536 GLN C O   
1588 C CB  . GLN C 86  ? 0.2604 0.1796 0.1908 -0.0035 -0.0367 0.0148  536 GLN C CB  
1589 C CG  . GLN C 86  ? 0.3208 0.2200 0.2585 0.0065  -0.0387 0.0231  536 GLN C CG  
1590 C CD  . GLN C 86  ? 0.4432 0.3404 0.4063 0.0102  -0.0221 0.0136  536 GLN C CD  
1591 O OE1 . GLN C 86  ? 0.4684 0.3881 0.4498 0.0067  -0.0123 0.0004  536 GLN C OE1 
1592 N NE2 . GLN C 86  ? 0.5161 0.3836 0.4780 0.0163  -0.0178 0.0201  536 GLN C NE2 
1593 N N   . VAL C 87  ? 0.2098 0.1487 0.1276 -0.0149 -0.0628 0.0210  537 VAL C N   
1594 C CA  . VAL C 87  ? 0.1993 0.1472 0.1177 -0.0222 -0.0652 0.0208  537 VAL C CA  
1595 C C   . VAL C 87  ? 0.1887 0.1600 0.1213 -0.0258 -0.0526 0.0175  537 VAL C C   
1596 O O   . VAL C 87  ? 0.1809 0.1676 0.1298 -0.0246 -0.0437 0.0126  537 VAL C O   
1597 C CB  . VAL C 87  ? 0.2046 0.1599 0.1357 -0.0272 -0.0805 0.0257  537 VAL C CB  
1598 C CG1 . VAL C 87  ? 0.2376 0.1710 0.1466 -0.0268 -0.0958 0.0277  537 VAL C CG1 
1599 C CG2 . VAL C 87  ? 0.2121 0.1955 0.1788 -0.0251 -0.0792 0.0273  537 VAL C CG2 
1600 N N   . ILE C 88  ? 0.1846 0.1577 0.1097 -0.0302 -0.0518 0.0202  538 ILE C N   
1601 C CA  . ILE C 88  ? 0.1736 0.1716 0.1059 -0.0355 -0.0433 0.0207  538 ILE C CA  
1602 C C   . ILE C 88  ? 0.1701 0.1913 0.1217 -0.0418 -0.0418 0.0225  538 ILE C C   
1603 O O   . ILE C 88  ? 0.1606 0.2037 0.1195 -0.0447 -0.0306 0.0161  538 ILE C O   
1604 C CB  . ILE C 88  ? 0.1853 0.1796 0.1088 -0.0366 -0.0460 0.0288  538 ILE C CB  
1605 C CG1 . ILE C 88  ? 0.1859 0.1642 0.0971 -0.0292 -0.0435 0.0253  538 ILE C CG1 
1606 C CG2 . ILE C 88  ? 0.1777 0.2011 0.1047 -0.0434 -0.0411 0.0340  538 ILE C CG2 
1607 C CD1 . ILE C 88  ? 0.1982 0.1880 0.1088 -0.0292 -0.0340 0.0167  538 ILE C CD1 
1608 N N   . THR C 89  ? 0.1792 0.1968 0.1395 -0.0456 -0.0517 0.0294  539 THR C N   
1609 C CA  . THR C 89  ? 0.1765 0.2191 0.1619 -0.0518 -0.0499 0.0313  539 THR C CA  
1610 C C   . THR C 89  ? 0.1993 0.2337 0.1971 -0.0513 -0.0649 0.0335  539 THR C C   
1611 O O   . THR C 89  ? 0.1875 0.1948 0.1671 -0.0509 -0.0767 0.0347  539 THR C O   
1612 C CB  . THR C 89  ? 0.1820 0.2389 0.1693 -0.0645 -0.0472 0.0417  539 THR C CB  
1613 O OG1 . THR C 89  ? 0.2077 0.2392 0.1874 -0.0688 -0.0596 0.0503  539 THR C OG1 
1614 C CG2 . THR C 89  ? 0.1802 0.2483 0.1502 -0.0665 -0.0372 0.0433  539 THR C CG2 
1615 N N   . LYS C 90  ? 0.2272 0.2881 0.2568 -0.0519 -0.0640 0.0332  540 LYS C N   
1616 C CA  . LYS C 90  ? 0.2240 0.2875 0.2715 -0.0534 -0.0816 0.0371  540 LYS C CA  
1617 C C   . LYS C 90  ? 0.2272 0.2798 0.2676 -0.0691 -0.0933 0.0428  540 LYS C C   
1618 O O   . LYS C 90  ? 0.2449 0.2778 0.2734 -0.0720 -0.1108 0.0423  540 LYS C O   
1619 C CB  . LYS C 90  ? 0.3127 0.4161 0.4060 -0.0517 -0.0765 0.0372  540 LYS C CB  
1620 C CG  . LYS C 90  ? 0.3542 0.4633 0.4624 -0.0343 -0.0662 0.0307  540 LYS C CG  
1621 C CD  . LYS C 90  ? 0.3955 0.4734 0.4833 -0.0225 -0.0798 0.0329  540 LYS C CD  
1622 C CE  . LYS C 90  ? 0.3910 0.4641 0.4898 -0.0062 -0.0664 0.0273  540 LYS C CE  
1623 N NZ  . LYS C 90  ? 0.3996 0.5004 0.5490 0.0054  -0.0674 0.0304  540 LYS C NZ  
1624 N N   . LYS C 91  ? 0.2195 0.2836 0.2660 -0.0809 -0.0835 0.0483  541 LYS C N   
1625 C CA  . LYS C 91  ? 0.2541 0.3041 0.2990 -0.0975 -0.0927 0.0550  541 LYS C CA  
1626 C C   . LYS C 91  ? 0.2357 0.2395 0.2446 -0.0948 -0.0996 0.0526  541 LYS C C   
1627 O O   . LYS C 91  ? 0.2700 0.2504 0.2723 -0.1040 -0.1132 0.0500  541 LYS C O   
1628 C CB  . LYS C 91  ? 0.3020 0.3703 0.3569 -0.1102 -0.0786 0.0655  541 LYS C CB  
1629 C CG  . LYS C 91  ? 0.3658 0.4139 0.4215 -0.1290 -0.0863 0.0747  541 LYS C CG  
1630 C CD  . LYS C 91  ? 0.4472 0.5040 0.5029 -0.1409 -0.0722 0.0905  541 LYS C CD  
1631 C CE  . LYS C 91  ? 0.5167 0.5415 0.5711 -0.1566 -0.0791 0.0997  541 LYS C CE  
1632 N NZ  . LYS C 91  ? 0.5701 0.5949 0.6174 -0.1630 -0.0662 0.1178  541 LYS C NZ  
1633 N N   . SER C 92  ? 0.2347 0.2260 0.2214 -0.0828 -0.0896 0.0516  542 SER C N   
1634 C CA  . SER C 92  ? 0.2533 0.2051 0.2127 -0.0781 -0.0922 0.0494  542 SER C CA  
1635 C C   . SER C 92  ? 0.2784 0.2090 0.2176 -0.0704 -0.1005 0.0378  542 SER C C   
1636 O O   . SER C 92  ? 0.3008 0.1976 0.2199 -0.0721 -0.1057 0.0320  542 SER C O   
1637 C CB  . SER C 92  ? 0.2366 0.1898 0.1855 -0.0688 -0.0799 0.0543  542 SER C CB  
1638 O OG  . SER C 92  ? 0.2133 0.1783 0.1563 -0.0576 -0.0740 0.0464  542 SER C OG  
1639 N N   . GLY C 93  ? 0.2277 0.1749 0.1699 -0.0620 -0.1004 0.0344  543 GLY C N   
1640 C CA  . GLY C 93  ? 0.2568 0.1843 0.1749 -0.0548 -0.1069 0.0277  543 GLY C CA  
1641 C C   . GLY C 93  ? 0.2633 0.1665 0.1541 -0.0459 -0.0962 0.0228  543 GLY C C   
1642 O O   . GLY C 93  ? 0.2871 0.1708 0.1556 -0.0418 -0.0963 0.0166  543 GLY C O   
1643 N N   . VAL C 94  ? 0.2321 0.1417 0.1291 -0.0422 -0.0837 0.0260  544 VAL C N   
1644 C CA  . VAL C 94  ? 0.2383 0.1306 0.1184 -0.0337 -0.0740 0.0224  544 VAL C CA  
1645 C C   . VAL C 94  ? 0.2379 0.1351 0.1087 -0.0262 -0.0662 0.0182  544 VAL C C   
1646 O O   . VAL C 94  ? 0.2353 0.1538 0.1194 -0.0258 -0.0627 0.0197  544 VAL C O   
1647 C CB  . VAL C 94  ? 0.2505 0.1540 0.1446 -0.0323 -0.0672 0.0310  544 VAL C CB  
1648 C CG1 . VAL C 94  ? 0.2852 0.1849 0.1731 -0.0214 -0.0571 0.0288  544 VAL C CG1 
1649 C CG2 . VAL C 94  ? 0.2951 0.1802 0.1940 -0.0393 -0.0734 0.0367  544 VAL C CG2 
1650 N N   . VAL C 95  ? 0.2715 0.1468 0.1194 -0.0213 -0.0612 0.0118  545 VAL C N   
1651 C CA  . VAL C 95  ? 0.2841 0.1587 0.1198 -0.0169 -0.0522 0.0092  545 VAL C CA  
1652 C C   . VAL C 95  ? 0.2779 0.1529 0.1133 -0.0110 -0.0375 0.0058  545 VAL C C   
1653 O O   . VAL C 95  ? 0.2859 0.1451 0.1154 -0.0072 -0.0347 0.0020  545 VAL C O   
1654 C CB  . VAL C 95  ? 0.3370 0.1934 0.1514 -0.0181 -0.0563 0.0062  545 VAL C CB  
1655 C CG1 . VAL C 95  ? 0.3420 0.1943 0.1430 -0.0149 -0.0442 0.0061  545 VAL C CG1 
1656 C CG2 . VAL C 95  ? 0.3159 0.1837 0.1457 -0.0216 -0.0696 0.0115  545 VAL C CG2 
1657 N N   . LEU C 96  ? 0.2581 0.1514 0.1034 -0.0102 -0.0277 0.0064  546 LEU C N   
1658 C CA  . LEU C 96  ? 0.2448 0.1480 0.0975 -0.0056 -0.0146 0.0040  546 LEU C CA  
1659 C C   . LEU C 96  ? 0.2589 0.1433 0.0880 -0.0042 -0.0030 -0.0019 546 LEU C C   
1660 O O   . LEU C 96  ? 0.2951 0.1716 0.1094 -0.0090 -0.0013 -0.0009 546 LEU C O   
1661 C CB  . LEU C 96  ? 0.2272 0.1613 0.1005 -0.0101 -0.0102 0.0053  546 LEU C CB  
1662 C CG  . LEU C 96  ? 0.1888 0.1451 0.0787 -0.0140 -0.0190 0.0103  546 LEU C CG  
1663 C CD1 . LEU C 96  ? 0.1936 0.1807 0.0975 -0.0205 -0.0138 0.0076  546 LEU C CD1 
1664 C CD2 . LEU C 96  ? 0.2133 0.1705 0.1110 -0.0089 -0.0255 0.0183  546 LEU C CD2 
1665 N N   . LEU C 97  ? 0.2939 0.1324 0.1148 0.0122  0.0185  -0.0047 547 LEU C N   
1666 C CA  . LEU C 97  ? 0.3267 0.1738 0.1240 0.0210  0.0293  -0.0068 547 LEU C CA  
1667 C C   . LEU C 97  ? 0.3246 0.2008 0.1280 0.0234  0.0442  -0.0152 547 LEU C C   
1668 O O   . LEU C 97  ? 0.3616 0.2521 0.1530 0.0188  0.0623  -0.0127 547 LEU C O   
1669 C CB  . LEU C 97  ? 0.3575 0.1895 0.1306 0.0364  0.0145  -0.0147 547 LEU C CB  
1670 C CG  . LEU C 97  ? 0.3476 0.1546 0.1089 0.0369  0.0003  -0.0099 547 LEU C CG  
1671 C CD1 . LEU C 97  ? 0.3865 0.1822 0.1243 0.0527  -0.0126 -0.0192 547 LEU C CD1 
1672 C CD2 . LEU C 97  ? 0.3857 0.1863 0.1350 0.0305  0.0096  0.0019  547 LEU C CD2 
1673 N N   . ASN C 98  ? 0.3145 0.1991 0.1333 0.0303  0.0363  -0.0267 548 ASN C N   
1674 C CA  . ASN C 98  ? 0.3245 0.2404 0.1493 0.0377  0.0465  -0.0406 548 ASN C CA  
1675 C C   . ASN C 98  ? 0.2935 0.2194 0.1466 0.0335  0.0455  -0.0439 548 ASN C C   
1676 O O   . ASN C 98  ? 0.2886 0.1967 0.1457 0.0406  0.0256  -0.0503 548 ASN C O   
1677 C CB  . ASN C 98  ? 0.3800 0.2959 0.1891 0.0588  0.0328  -0.0580 548 ASN C CB  
1678 C CG  . ASN C 98  ? 0.5046 0.3988 0.2863 0.0645  0.0252  -0.0540 548 ASN C CG  
1679 O OD1 . ASN C 98  ? 0.5394 0.4094 0.3155 0.0718  0.0043  -0.0556 548 ASN C OD1 
1680 N ND2 . ASN C 98  ? 0.4954 0.3992 0.2626 0.0583  0.0410  -0.0479 548 ASN C ND2 
1681 N N   . PRO C 99  ? 0.2577 0.2091 0.1274 0.0217  0.0653  -0.0404 549 PRO C N   
1682 C CA  . PRO C 99  ? 0.2360 0.1993 0.1324 0.0196  0.0642  -0.0457 549 PRO C CA  
1683 C C   . PRO C 99  ? 0.2720 0.2559 0.1700 0.0395  0.0570  -0.0691 549 PRO C C   
1684 O O   . PRO C 99  ? 0.3046 0.3172 0.1988 0.0442  0.0687  -0.0790 549 PRO C O   
1685 C CB  . PRO C 99  ? 0.2368 0.2257 0.1484 0.0021  0.0876  -0.0357 549 PRO C CB  
1686 C CG  . PRO C 99  ? 0.2745 0.2788 0.1715 0.0018  0.0937  -0.0318 549 PRO C CG  
1687 C CD  . PRO C 99  ? 0.2869 0.2561 0.1509 0.0086  0.0871  -0.0313 549 PRO C CD  
1688 N N   . ILE C 100 ? 0.2696 0.2349 0.1737 0.0486  0.0358  -0.0767 550 ILE C N   
1689 C CA  . ILE C 100 ? 0.2975 0.2748 0.2055 0.0667  0.0222  -0.0954 550 ILE C CA  
1690 C C   . ILE C 100 ? 0.2941 0.3015 0.2287 0.0628  0.0325  -0.1001 550 ILE C C   
1691 O O   . ILE C 100 ? 0.2885 0.2841 0.2352 0.0552  0.0302  -0.0954 550 ILE C O   
1692 C CB  . ILE C 100 ? 0.3165 0.2549 0.2158 0.0735  -0.0076 -0.0947 550 ILE C CB  
1693 C CG1 . ILE C 100 ? 0.3396 0.2526 0.2156 0.0755  -0.0174 -0.0882 550 ILE C CG1 
1694 C CG2 . ILE C 100 ? 0.3427 0.2945 0.2489 0.0898  -0.0227 -0.1078 550 ILE C CG2 
1695 C CD1 . ILE C 100 ? 0.3636 0.2993 0.2301 0.0879  -0.0117 -0.0971 550 ILE C CD1 
1696 N N   . PRO C 101 ? 0.3020 0.3456 0.2459 0.0664  0.0421  -0.1083 551 PRO C N   
1697 C CA  . PRO C 101 ? 0.3347 0.4056 0.3026 0.0620  0.0496  -0.1108 551 PRO C CA  
1698 C C   . PRO C 101 ? 0.3298 0.3952 0.3064 0.0766  0.0260  -0.1235 551 PRO C C   
1699 O O   . PRO C 101 ? 0.3937 0.4373 0.3572 0.0912  0.0030  -0.1298 551 PRO C O   
1700 C CB  . PRO C 101 ? 0.3850 0.4906 0.3544 0.0611  0.0629  -0.1169 551 PRO C CB  
1701 C CG  . PRO C 101 ? 0.4140 0.5135 0.3651 0.0748  0.0521  -0.1266 551 PRO C CG  
1702 C CD  . PRO C 101 ? 0.3913 0.4511 0.3236 0.0739  0.0446  -0.1161 551 PRO C CD  
1703 N N   . LYS C 102 ? 0.4409 0.5238 0.4378 0.0717  0.0302  -0.1244 552 LYS C N   
1704 C CA  . LYS C 102 ? 0.4903 0.5677 0.4945 0.0842  0.0080  -0.1349 552 LYS C CA  
1705 C C   . LYS C 102 ? 0.5127 0.6125 0.5167 0.1042  -0.0077 -0.1543 552 LYS C C   
1706 O O   . LYS C 102 ? 0.5013 0.6410 0.5158 0.1037  0.0042  -0.1636 552 LYS C O   
1707 C CB  . LYS C 102 ? 0.5339 0.6286 0.5599 0.0735  0.0178  -0.1318 552 LYS C CB  
1708 C CG  . LYS C 102 ? 0.5407 0.6142 0.5705 0.0551  0.0291  -0.1134 552 LYS C CG  
1709 C CD  . LYS C 102 ? 0.5361 0.6309 0.5868 0.0430  0.0403  -0.1076 552 LYS C CD  
1710 C CE  . LYS C 102 ? 0.4952 0.6017 0.5472 0.0245  0.0624  -0.0883 552 LYS C CE  
1711 N NZ  . LYS C 102 ? 0.4907 0.5782 0.5478 0.0076  0.0651  -0.0688 552 LYS C NZ  
1778 N N   . SER E 2   ? 0.7581 0.5850 0.4421 -0.0699 0.0876  -0.1153 452 SER E N   
1779 C CA  . SER E 2   ? 0.7031 0.5519 0.4317 -0.0615 0.0998  -0.1041 452 SER E CA  
1780 C C   . SER E 2   ? 0.6612 0.5437 0.4015 -0.0543 0.1043  -0.0893 452 SER E C   
1781 O O   . SER E 2   ? 0.6845 0.5830 0.4058 -0.0614 0.0886  -0.0864 452 SER E O   
1782 C CB  . SER E 2   ? 0.6948 0.5599 0.4552 -0.0772 0.0828  -0.1028 452 SER E CB  
1783 O OG  . SER E 2   ? 0.7355 0.5621 0.4883 -0.0825 0.0850  -0.1127 452 SER E OG  
1784 N N   . LYS E 3   ? 0.5897 0.4848 0.3673 -0.0394 0.1223  -0.0768 453 LYS E N   
1785 C CA  . LYS E 3   ? 0.4970 0.4216 0.2984 -0.0357 0.1221  -0.0585 453 LYS E CA  
1786 C C   . LYS E 3   ? 0.4008 0.3518 0.2320 -0.0435 0.0964  -0.0529 453 LYS E C   
1787 O O   . LYS E 3   ? 0.3918 0.3461 0.2393 -0.0503 0.0848  -0.0597 453 LYS E O   
1788 C CB  . LYS E 3   ? 0.4893 0.4252 0.3328 -0.0237 0.1435  -0.0474 453 LYS E CB  
1789 C CG  . LYS E 3   ? 0.5518 0.4750 0.3775 -0.0109 0.1688  -0.0498 453 LYS E CG  
1790 C CD  . LYS E 3   ? 0.5742 0.5226 0.4539 -0.0004 0.1839  -0.0378 453 LYS E CD  
1791 C CE  . LYS E 3   ? 0.6752 0.6162 0.5479 0.0163  0.1999  -0.0442 453 LYS E CE  
1792 N NZ  . LYS E 3   ? 0.7761 0.6972 0.5922 0.0191  0.2059  -0.0510 453 LYS E NZ  
1793 N N   . PRO E 4   ? 0.3827 0.3506 0.2178 -0.0412 0.0878  -0.0399 454 PRO E N   
1794 C CA  . PRO E 4   ? 0.3276 0.3209 0.1903 -0.0422 0.0653  -0.0352 454 PRO E CA  
1795 C C   . PRO E 4   ? 0.2886 0.2914 0.2005 -0.0391 0.0663  -0.0331 454 PRO E C   
1796 O O   . PRO E 4   ? 0.2711 0.2666 0.2036 -0.0345 0.0831  -0.0302 454 PRO E O   
1797 C CB  . PRO E 4   ? 0.3928 0.3887 0.2464 -0.0350 0.0612  -0.0203 454 PRO E CB  
1798 C CG  . PRO E 4   ? 0.4763 0.4523 0.2821 -0.0353 0.0750  -0.0194 454 PRO E CG  
1799 C CD  . PRO E 4   ? 0.4304 0.3911 0.2368 -0.0364 0.0979  -0.0287 454 PRO E CD  
1800 N N   . LEU E 5   ? 0.2542 0.2785 0.1846 -0.0402 0.0476  -0.0343 455 LEU E N   
1801 C CA  . LEU E 5   ? 0.2579 0.2920 0.2282 -0.0362 0.0454  -0.0329 455 LEU E CA  
1802 C C   . LEU E 5   ? 0.2640 0.2949 0.2604 -0.0281 0.0518  -0.0231 455 LEU E C   
1803 O O   . LEU E 5   ? 0.2491 0.2798 0.2740 -0.0256 0.0592  -0.0228 455 LEU E O   
1804 C CB  . LEU E 5   ? 0.3085 0.3705 0.2891 -0.0349 0.0254  -0.0333 455 LEU E CB  
1805 C CG  . LEU E 5   ? 0.2915 0.3668 0.2790 -0.0440 0.0204  -0.0396 455 LEU E CG  
1806 C CD1 . LEU E 5   ? 0.2292 0.3414 0.2301 -0.0379 0.0040  -0.0371 455 LEU E CD1 
1807 C CD2 . LEU E 5   ? 0.1895 0.2489 0.1969 -0.0425 0.0308  -0.0400 455 LEU E CD2 
1808 N N   . ALA E 6   ? 0.2279 0.2553 0.2145 -0.0249 0.0476  -0.0142 456 ALA E N   
1809 C CA  . ALA E 6   ? 0.2969 0.3178 0.3074 -0.0226 0.0502  -0.0039 456 ALA E CA  
1810 C C   . ALA E 6   ? 0.3159 0.3320 0.3405 -0.0272 0.0733  0.0010  456 ALA E C   
1811 O O   . ALA E 6   ? 0.3376 0.3558 0.3923 -0.0298 0.0758  0.0093  456 ALA E O   
1812 C CB  . ALA E 6   ? 0.3225 0.3303 0.3105 -0.0193 0.0413  0.0064  456 ALA E CB  
1813 N N   . GLU E 7   ? 0.2827 0.2940 0.2864 -0.0280 0.0898  -0.0046 457 GLU E N   
1814 C CA  . GLU E 7   ? 0.3011 0.3136 0.3167 -0.0270 0.1148  -0.0011 457 GLU E CA  
1815 C C   . GLU E 7   ? 0.2521 0.2708 0.2912 -0.0203 0.1209  -0.0106 457 GLU E C   
1816 O O   . GLU E 7   ? 0.3013 0.3274 0.3564 -0.0144 0.1415  -0.0084 457 GLU E O   
1817 C CB  . GLU E 7   ? 0.3631 0.3608 0.3316 -0.0270 0.1319  -0.0011 457 GLU E CB  
1818 C CG  . GLU E 7   ? 0.4448 0.4343 0.3886 -0.0316 0.1290  0.0129  457 GLU E CG  
1819 C CD  . GLU E 7   ? 0.5318 0.5065 0.4215 -0.0302 0.1443  0.0132  457 GLU E CD  
1820 O OE1 . GLU E 7   ? 0.5648 0.5341 0.4365 -0.0255 0.1590  0.0009  457 GLU E OE1 
1821 O OE2 . GLU E 7   ? 0.5747 0.5390 0.4352 -0.0323 0.1408  0.0256  457 GLU E OE2 
1822 N N   . GLN E 8   ? 0.1975 0.2148 0.2385 -0.0196 0.1046  -0.0194 458 GLN E N   
1823 C CA  . GLN E 8   ? 0.2004 0.2157 0.2572 -0.0123 0.1086  -0.0262 458 GLN E CA  
1824 C C   . GLN E 8   ? 0.1997 0.2376 0.3067 -0.0070 0.1041  -0.0196 458 GLN E C   
1825 O O   . GLN E 8   ? 0.1681 0.2166 0.2916 -0.0110 0.0866  -0.0156 458 GLN E O   
1826 C CB  . GLN E 8   ? 0.2121 0.2174 0.2510 -0.0172 0.0929  -0.0347 458 GLN E CB  
1827 C CG  . GLN E 8   ? 0.2338 0.2222 0.2263 -0.0270 0.0912  -0.0424 458 GLN E CG  
1828 C CD  . GLN E 8   ? 0.3037 0.2627 0.2654 -0.0236 0.1097  -0.0512 458 GLN E CD  
1829 O OE1 . GLN E 8   ? 0.3345 0.2830 0.3085 -0.0121 0.1222  -0.0532 458 GLN E OE1 
1830 N NE2 . GLN E 8   ? 0.3350 0.2798 0.2533 -0.0307 0.1106  -0.0573 458 GLN E NE2 
1831 N N   . ASP E 9   ? 0.2087 0.2540 0.3383 0.0040  0.1184  -0.0194 459 ASP E N   
1832 C CA  . ASP E 9   ? 0.2338 0.3044 0.4082 0.0082  0.1088  -0.0126 459 ASP E CA  
1833 C C   . ASP E 9   ? 0.1928 0.2658 0.3790 0.0090  0.0867  -0.0155 459 ASP E C   
1834 O O   . ASP E 9   ? 0.1662 0.2540 0.3757 0.0065  0.0704  -0.0111 459 ASP E O   
1835 C CB  . ASP E 9   ? 0.3002 0.3782 0.4850 0.0230  0.1193  -0.0120 459 ASP E CB  
1836 C CG  . ASP E 9   ? 0.4355 0.5154 0.6064 0.0256  0.1417  -0.0098 459 ASP E CG  
1837 O OD1 . ASP E 9   ? 0.4931 0.5673 0.6542 0.0412  0.1539  -0.0144 459 ASP E OD1 
1838 O OD2 . ASP E 9   ? 0.4708 0.5560 0.6371 0.0133  0.1470  -0.0033 459 ASP E OD2 
1839 N N   . TRP E 10  ? 0.1304 0.1842 0.2909 0.0108  0.0831  -0.0225 460 TRP E N   
1840 C CA  . TRP E 10  ? 0.1164 0.1728 0.2812 0.0128  0.0643  -0.0234 460 TRP E CA  
1841 C C   . TRP E 10  ? 0.0951 0.1556 0.2461 0.0037  0.0482  -0.0243 460 TRP E C   
1842 O O   . TRP E 10  ? 0.1108 0.1767 0.2612 0.0063  0.0345  -0.0250 460 TRP E O   
1843 C CB  . TRP E 10  ? 0.1503 0.1819 0.2912 0.0173  0.0681  -0.0272 460 TRP E CB  
1844 C CG  . TRP E 10  ? 0.1587 0.1623 0.2599 0.0088  0.0797  -0.0336 460 TRP E CG  
1845 C CD1 . TRP E 10  ? 0.2352 0.2148 0.3200 0.0162  0.0977  -0.0384 460 TRP E CD1 
1846 C CD2 . TRP E 10  ? 0.1773 0.1755 0.2489 -0.0075 0.0727  -0.0373 460 TRP E CD2 
1847 N NE1 . TRP E 10  ? 0.2481 0.2020 0.2908 0.0035  0.1007  -0.0461 460 TRP E NE1 
1848 C CE2 . TRP E 10  ? 0.2101 0.1785 0.2469 -0.0124 0.0848  -0.0448 460 TRP E CE2 
1849 C CE3 . TRP E 10  ? 0.1563 0.1747 0.2272 -0.0163 0.0569  -0.0356 460 TRP E CE3 
1850 C CZ2 . TRP E 10  ? 0.2331 0.1937 0.2371 -0.0292 0.0789  -0.0505 460 TRP E CZ2 
1851 C CZ3 . TRP E 10  ? 0.1532 0.1696 0.1958 -0.0303 0.0531  -0.0397 460 TRP E CZ3 
1852 C CH2 . TRP E 10  ? 0.1998 0.1887 0.2105 -0.0384 0.0628  -0.0470 460 TRP E CH2 
1853 N N   . TYR E 11  ? 0.1133 0.1719 0.2507 -0.0040 0.0500  -0.0234 461 TYR E N   
1854 C CA  . TYR E 11  ? 0.1002 0.1639 0.2238 -0.0070 0.0345  -0.0242 461 TYR E CA  
1855 C C   . TYR E 11  ? 0.1089 0.1781 0.2532 -0.0045 0.0227  -0.0206 461 TYR E C   
1856 O O   . TYR E 11  ? 0.1190 0.1836 0.2729 -0.0096 0.0294  -0.0149 461 TYR E O   
1857 C CB  . TYR E 11  ? 0.1536 0.2094 0.2453 -0.0141 0.0391  -0.0250 461 TYR E CB  
1858 C CG  . TYR E 11  ? 0.1295 0.1956 0.2092 -0.0121 0.0229  -0.0250 461 TYR E CG  
1859 C CD1 . TYR E 11  ? 0.1391 0.2222 0.2139 -0.0106 0.0124  -0.0288 461 TYR E CD1 
1860 C CD2 . TYR E 11  ? 0.1617 0.2209 0.2344 -0.0101 0.0188  -0.0198 461 TYR E CD2 
1861 C CE1 . TYR E 11  ? 0.1718 0.2715 0.2381 -0.0037 -0.0011 -0.0290 461 TYR E CE1 
1862 C CE2 . TYR E 11  ? 0.1744 0.2407 0.2340 -0.0023 0.0033  -0.0201 461 TYR E CE2 
1863 C CZ  . TYR E 11  ? 0.1587 0.2486 0.2167 0.0026  -0.0063 -0.0255 461 TYR E CZ  
1864 O OH  . TYR E 11  ? 0.2750 0.3791 0.3223 0.0151  -0.0203 -0.0261 461 TYR E OH  
1865 N N   . HIS E 12  ? 0.1281 0.1331 0.1769 -0.0004 0.0344  -0.0137 462 HIS E N   
1866 C CA  . HIS E 12  ? 0.1260 0.1316 0.1710 0.0001  0.0313  -0.0096 462 HIS E CA  
1867 C C   . HIS E 12  ? 0.1399 0.1446 0.1683 0.0011  0.0283  -0.0087 462 HIS E C   
1868 O O   . HIS E 12  ? 0.1563 0.1586 0.1789 0.0017  0.0251  -0.0052 462 HIS E O   
1869 C CB  . HIS E 12  ? 0.1372 0.1443 0.1923 0.0007  0.0270  -0.0044 462 HIS E CB  
1870 C CG  . HIS E 12  ? 0.1527 0.1621 0.2239 0.0015  0.0294  -0.0040 462 HIS E CG  
1871 N ND1 . HIS E 12  ? 0.1687 0.1829 0.2472 0.0010  0.0278  -0.0007 462 HIS E ND1 
1872 C CD2 . HIS E 12  ? 0.1436 0.1519 0.2246 0.0033  0.0333  -0.0068 462 HIS E CD2 
1873 C CE1 . HIS E 12  ? 0.1765 0.1950 0.2700 0.0033  0.0305  -0.0011 462 HIS E CE1 
1874 N NE2 . HIS E 12  ? 0.1429 0.1563 0.2376 0.0054  0.0340  -0.0048 462 HIS E NE2 
1875 N N   . GLY E 13  ? 0.1364 0.1434 0.1566 0.0017  0.0291  -0.0118 463 GLY E N   
1876 C CA  . GLY E 13  ? 0.1317 0.1394 0.1360 0.0047  0.0264  -0.0109 463 GLY E CA  
1877 C C   . GLY E 13  ? 0.1409 0.1508 0.1435 0.0068  0.0210  -0.0067 463 GLY E C   
1878 O O   . GLY E 13  ? 0.1473 0.1613 0.1588 0.0051  0.0192  -0.0055 463 GLY E O   
1879 N N   . ALA E 14  ? 0.1445 0.1499 0.1343 0.0103  0.0187  -0.0044 464 ALA E N   
1880 C CA  . ALA E 14  ? 0.1667 0.1745 0.1514 0.0134  0.0142  -0.0013 464 ALA E CA  
1881 C C   . ALA E 14  ? 0.1609 0.1639 0.1512 0.0113  0.0115  0.0025  464 ALA E C   
1882 O O   . ALA E 14  ? 0.1759 0.1760 0.1569 0.0140  0.0083  0.0050  464 ALA E O   
1883 C CB  . ALA E 14  ? 0.2559 0.2606 0.2214 0.0200  0.0131  -0.0012 464 ALA E CB  
1884 N N   . ILE E 15  ? 0.1499 0.1525 0.1547 0.0070  0.0127  0.0031  465 ILE E N   
1885 C CA  . ILE E 15  ? 0.1434 0.1443 0.1536 0.0050  0.0094  0.0072  465 ILE E CA  
1886 C C   . ILE E 15  ? 0.1419 0.1478 0.1532 0.0060  0.0053  0.0098  465 ILE E C   
1887 O O   . ILE E 15  ? 0.1569 0.1689 0.1729 0.0059  0.0058  0.0088  465 ILE E O   
1888 C CB  . ILE E 15  ? 0.1446 0.1476 0.1716 0.0016  0.0110  0.0077  465 ILE E CB  
1889 C CG1 . ILE E 15  ? 0.1454 0.1531 0.1853 0.0017  0.0122  0.0069  465 ILE E CG1 
1890 C CG2 . ILE E 15  ? 0.1694 0.1692 0.1950 -0.0004 0.0155  0.0051  465 ILE E CG2 
1891 C CD1 . ILE E 15  ? 0.1544 0.1643 0.2108 0.0009  0.0123  0.0090  465 ILE E CD1 
1892 N N   . PRO E 16  ? 0.1525 0.1559 0.1583 0.0062  0.0015  0.0130  466 PRO E N   
1893 C CA  . PRO E 16  ? 0.1469 0.1557 0.1529 0.0068  -0.0021 0.0157  466 PRO E CA  
1894 C C   . PRO E 16  ? 0.1416 0.1539 0.1632 0.0033  -0.0038 0.0188  466 PRO E C   
1895 O O   . PRO E 16  ? 0.1215 0.1327 0.1541 0.0015  -0.0029 0.0195  466 PRO E O   
1896 C CB  . PRO E 16  ? 0.1579 0.1606 0.1511 0.0079  -0.0052 0.0176  466 PRO E CB  
1897 C CG  . PRO E 16  ? 0.1949 0.1898 0.1887 0.0046  -0.0042 0.0175  466 PRO E CG  
1898 C CD  . PRO E 16  ? 0.1529 0.1474 0.1496 0.0050  0.0005  0.0141  466 PRO E CD  
1899 N N   . ARG E 17  ? 0.1281 0.1454 0.1501 0.0029  -0.0061 0.0210  467 ARG E N   
1900 C CA  . ARG E 17  ? 0.1346 0.1530 0.1685 0.0002  -0.0081 0.0249  467 ARG E CA  
1901 C C   . ARG E 17  ? 0.1227 0.1392 0.1636 -0.0008 -0.0109 0.0286  467 ARG E C   
1902 O O   . ARG E 17  ? 0.1290 0.1454 0.1827 -0.0011 -0.0107 0.0304  467 ARG E O   
1903 C CB  . ARG E 17  ? 0.1527 0.1760 0.1818 -0.0011 -0.0108 0.0274  467 ARG E CB  
1904 C CG  . ARG E 17  ? 0.1733 0.1952 0.2115 -0.0039 -0.0134 0.0326  467 ARG E CG  
1905 C CD  . ARG E 17  ? 0.1632 0.1898 0.1955 -0.0064 -0.0154 0.0352  467 ARG E CD  
1906 N NE  . ARG E 17  ? 0.1610 0.1918 0.1911 -0.0087 -0.0122 0.0318  467 ARG E NE  
1907 C CZ  . ARG E 17  ? 0.1497 0.1814 0.1803 -0.0137 -0.0123 0.0338  467 ARG E CZ  
1908 N NH1 . ARG E 17  ? 0.1727 0.2000 0.2057 -0.0159 -0.0155 0.0398  467 ARG E NH1 
1909 N NH2 . ARG E 17  ? 0.1601 0.1969 0.1878 -0.0171 -0.0092 0.0301  467 ARG E NH2 
1910 N N   . ILE E 18  ? 0.1235 0.1384 0.1555 -0.0011 -0.0135 0.0296  468 ILE E N   
1911 C CA  . ILE E 18  ? 0.1219 0.1375 0.1597 -0.0035 -0.0170 0.0333  468 ILE E CA  
1912 C C   . ILE E 18  ? 0.1287 0.1454 0.1774 -0.0042 -0.0143 0.0318  468 ILE E C   
1913 O O   . ILE E 18  ? 0.1461 0.1680 0.2072 -0.0052 -0.0163 0.0350  468 ILE E O   
1914 C CB  . ILE E 18  ? 0.1473 0.1592 0.1706 -0.0050 -0.0200 0.0337  468 ILE E CB  
1915 C CG1 . ILE E 18  ? 0.1736 0.1887 0.2029 -0.0091 -0.0244 0.0377  468 ILE E CG1 
1916 C CG2 . ILE E 18  ? 0.1578 0.1618 0.1682 -0.0043 -0.0167 0.0292  468 ILE E CG2 
1917 C CD1 . ILE E 18  ? 0.2072 0.2289 0.2470 -0.0092 -0.0285 0.0433  468 ILE E CD1 
1918 N N   . GLU E 19  ? 0.1227 0.1357 0.1666 -0.0035 -0.0096 0.0270  469 GLU E N   
1919 C CA  . GLU E 19  ? 0.1296 0.1447 0.1834 -0.0045 -0.0061 0.0251  469 GLU E CA  
1920 C C   . GLU E 19  ? 0.1506 0.1692 0.2194 -0.0018 -0.0036 0.0249  469 GLU E C   
1921 O O   . GLU E 19  ? 0.1457 0.1697 0.2280 -0.0014 -0.0026 0.0257  469 GLU E O   
1922 C CB  . GLU E 19  ? 0.1291 0.1380 0.1713 -0.0048 -0.0017 0.0204  469 GLU E CB  
1923 C CG  . GLU E 19  ? 0.1563 0.1585 0.1838 -0.0081 -0.0033 0.0207  469 GLU E CG  
1924 C CD  . GLU E 19  ? 0.1819 0.1752 0.1959 -0.0081 0.0010  0.0168  469 GLU E CD  
1925 O OE1 . GLU E 19  ? 0.1974 0.1803 0.1935 -0.0086 -0.0000 0.0166  469 GLU E OE1 
1926 O OE2 . GLU E 19  ? 0.1839 0.1793 0.2038 -0.0073 0.0056  0.0140  469 GLU E OE2 
1927 N N   . ALA E 20  ? 0.1376 0.1534 0.2040 -0.0000 -0.0024 0.0236  470 ALA E N   
1928 C CA  . ALA E 20  ? 0.1539 0.1690 0.2317 0.0019  -0.0001 0.0234  470 ALA E CA  
1929 C C   . ALA E 20  ? 0.1971 0.2146 0.2854 0.0032  -0.0043 0.0294  470 ALA E C   
1930 O O   . ALA E 20  ? 0.1922 0.2103 0.2929 0.0063  -0.0026 0.0301  470 ALA E O   
1931 C CB  . ALA E 20  ? 0.1921 0.2035 0.2629 0.0013  0.0014  0.0212  470 ALA E CB  
1932 N N   . GLN E 21  ? 0.2297 0.1959 0.4394 0.0662  -0.0290 0.0933  471 GLN E N   
1933 C CA  . GLN E 21  ? 0.2377 0.1982 0.4351 0.0704  -0.0406 0.0881  471 GLN E CA  
1934 C C   . GLN E 21  ? 0.2476 0.2039 0.4591 0.0597  -0.0529 0.0781  471 GLN E C   
1935 O O   . GLN E 21  ? 0.2792 0.2442 0.5015 0.0502  -0.0609 0.0781  471 GLN E O   
1936 C CB  . GLN E 21  ? 0.3006 0.2401 0.4592 0.0992  -0.0414 0.0861  471 GLN E CB  
1937 C CG  . GLN E 21  ? 0.4092 0.3472 0.5526 0.1087  -0.0525 0.0832  471 GLN E CG  
1938 C CD  . GLN E 21  ? 0.5106 0.4220 0.6095 0.1432  -0.0551 0.0769  471 GLN E CD  
1939 O OE1 . GLN E 21  ? 0.5958 0.4969 0.6767 0.1584  -0.0584 0.0743  471 GLN E OE1 
1940 N NE2 . GLN E 21  ? 0.5690 0.4729 0.6696 0.1462  -0.0586 0.0735  471 GLN E NE2 
1941 N N   . GLU E 22  ? 0.2924 0.2359 0.5083 0.0608  -0.0544 0.0718  472 GLU E N   
1942 C CA  . GLU E 22  ? 0.2915 0.2341 0.5268 0.0494  -0.0683 0.0643  472 GLU E CA  
1943 C C   . GLU E 22  ? 0.2927 0.2572 0.5611 0.0281  -0.0683 0.0674  472 GLU E C   
1944 O O   . GLU E 22  ? 0.3446 0.3126 0.6298 0.0184  -0.0789 0.0649  472 GLU E O   
1945 C CB  . GLU E 22  ? 0.4767 0.3955 0.7100 0.0578  -0.0716 0.0573  472 GLU E CB  
1946 C CG  . GLU E 22  ? 0.6047 0.4913 0.7988 0.0826  -0.0710 0.0523  472 GLU E CG  
1947 C CD  . GLU E 22  ? 0.7080 0.5571 0.8922 0.0947  -0.0635 0.0471  472 GLU E CD  
1948 O OE1 . GLU E 22  ? 0.7438 0.5880 0.9558 0.0818  -0.0715 0.0426  472 GLU E OE1 
1949 O OE2 . GLU E 22  ? 0.7809 0.6027 0.9287 0.1186  -0.0483 0.0490  472 GLU E OE2 
1950 N N   . LEU E 23  ? 0.2039 0.1814 0.4798 0.0227  -0.0563 0.0741  473 LEU E N   
1951 C CA  . LEU E 23  ? 0.1601 0.1527 0.4584 0.0080  -0.0550 0.0767  473 LEU E CA  
1952 C C   . LEU E 23  ? 0.1919 0.1892 0.4894 0.0031  -0.0574 0.0781  473 LEU E C   
1953 O O   . LEU E 23  ? 0.2024 0.2046 0.5130 -0.0041 -0.0585 0.0784  473 LEU E O   
1954 C CB  . LEU E 23  ? 0.1508 0.1531 0.4558 0.0065  -0.0420 0.0840  473 LEU E CB  
1955 C CG  . LEU E 23  ? 0.1572 0.1587 0.4749 0.0092  -0.0366 0.0871  473 LEU E CG  
1956 C CD1 . LEU E 23  ? 0.1577 0.1696 0.4780 0.0113  -0.0206 0.0988  473 LEU E CD1 
1957 C CD2 . LEU E 23  ? 0.1824 0.1900 0.5246 -0.0005 -0.0422 0.0868  473 LEU E CD2 
1958 N N   . LEU E 24  ? 0.1609 0.1556 0.4439 0.0095  -0.0571 0.0807  474 LEU E N   
1959 C CA  . LEU E 24  ? 0.1575 0.1571 0.4461 0.0053  -0.0584 0.0850  474 LEU E CA  
1960 C C   . LEU E 24  ? 0.1702 0.1655 0.4552 0.0096  -0.0660 0.0860  474 LEU E C   
1961 O O   . LEU E 24  ? 0.2159 0.2065 0.4827 0.0210  -0.0673 0.0877  474 LEU E O   
1962 C CB  . LEU E 24  ? 0.1858 0.1905 0.4686 0.0084  -0.0516 0.0929  474 LEU E CB  
1963 C CG  . LEU E 24  ? 0.2045 0.2159 0.4913 0.0053  -0.0435 0.0959  474 LEU E CG  
1964 C CD1 . LEU E 24  ? 0.2082 0.2266 0.4896 0.0107  -0.0357 0.1073  474 LEU E CD1 
1965 C CD2 . LEU E 24  ? 0.1730 0.1879 0.4750 -0.0046 -0.0466 0.0937  474 LEU E CD2 
1966 N N   . LYS E 25  ? 0.1683 0.1658 0.4684 0.0042  -0.0699 0.0871  475 LYS E N   
1967 C CA  . LYS E 25  ? 0.1818 0.1781 0.4818 0.0089  -0.0764 0.0913  475 LYS E CA  
1968 C C   . LYS E 25  ? 0.2290 0.2316 0.5439 0.0090  -0.0753 0.1014  475 LYS E C   
1969 O O   . LYS E 25  ? 0.2084 0.2154 0.5222 0.0158  -0.0782 0.1110  475 LYS E O   
1970 C CB  . LYS E 25  ? 0.2090 0.2027 0.5167 0.0056  -0.0822 0.0872  475 LYS E CB  
1971 C CG  . LYS E 25  ? 0.2542 0.2400 0.5532 0.0072  -0.0865 0.0786  475 LYS E CG  
1972 C CD  . LYS E 25  ? 0.2686 0.2535 0.5852 0.0007  -0.0939 0.0777  475 LYS E CD  
1973 C CE  . LYS E 25  ? 0.3033 0.2788 0.6181 0.0023  -0.1004 0.0694  475 LYS E CE  
1974 N NZ  . LYS E 25  ? 0.3802 0.3575 0.7217 -0.0073 -0.1075 0.0712  475 LYS E NZ  
1975 N N   . LYS E 26  ? 0.1575 0.1492 0.4414 0.0073  -0.0588 0.0348  476 LYS E N   
1976 C CA  . LYS E 26  ? 0.1708 0.1696 0.4660 0.0126  -0.0467 0.0337  476 LYS E CA  
1977 C C   . LYS E 26  ? 0.1486 0.1461 0.4244 0.0168  -0.0308 0.0269  476 LYS E C   
1978 O O   . LYS E 26  ? 0.1571 0.1541 0.4224 0.0144  -0.0253 0.0245  476 LYS E O   
1979 C CB  . LYS E 26  ? 0.2262 0.2406 0.5582 0.0112  -0.0379 0.0412  476 LYS E CB  
1980 C CG  . LYS E 26  ? 0.3387 0.3579 0.6968 0.0089  -0.0519 0.0514  476 LYS E CG  
1981 C CD  . LYS E 26  ? 0.3975 0.4101 0.7669 -0.0016 -0.0707 0.0602  476 LYS E CD  
1982 C CE  . LYS E 26  ? 0.4235 0.4388 0.8211 -0.0059 -0.0881 0.0723  476 LYS E CE  
1983 N NZ  . LYS E 26  ? 0.4531 0.4510 0.8558 -0.0173 -0.1130 0.0807  476 LYS E NZ  
1984 N N   . GLN E 27  ? 0.1523 0.1482 0.4257 0.0228  -0.0251 0.0249  477 GLN E N   
1985 C CA  . GLN E 27  ? 0.1311 0.1227 0.3926 0.0250  -0.0142 0.0203  477 GLN E CA  
1986 C C   . GLN E 27  ? 0.1490 0.1450 0.4203 0.0220  -0.0036 0.0159  477 GLN E C   
1987 O O   . GLN E 27  ? 0.1693 0.1731 0.4580 0.0247  0.0032  0.0158  477 GLN E O   
1988 C CB  . GLN E 27  ? 0.1735 0.1623 0.4395 0.0318  -0.0103 0.0196  477 GLN E CB  
1989 C CG  . GLN E 27  ? 0.1777 0.1581 0.4370 0.0331  -0.0026 0.0158  477 GLN E CG  
1990 C CD  . GLN E 27  ? 0.2100 0.1827 0.4498 0.0341  -0.0059 0.0203  477 GLN E CD  
1991 O OE1 . GLN E 27  ? 0.1935 0.1662 0.4160 0.0344  -0.0112 0.0242  477 GLN E OE1 
1992 N NE2 . GLN E 27  ? 0.2346 0.1990 0.4756 0.0368  -0.0025 0.0209  477 GLN E NE2 
1993 N N   . GLY E 28  ? 0.1544 0.1467 0.4125 0.0189  -0.0018 0.0135  478 GLY E N   
1994 C CA  . GLY E 28  ? 0.1204 0.1137 0.3830 0.0177  0.0068  0.0071  478 GLY E CA  
1995 C C   . GLY E 28  ? 0.1517 0.1524 0.4161 0.0147  0.0084  0.0082  478 GLY E C   
1996 O O   . GLY E 28  ? 0.1466 0.1490 0.4104 0.0161  0.0168  0.0020  478 GLY E O   
1997 N N   . ASP E 29  ? 0.1242 0.1274 0.3896 0.0118  -0.0004 0.0153  479 ASP E N   
1998 C CA  . ASP E 29  ? 0.1132 0.1208 0.3798 0.0086  -0.0011 0.0183  479 ASP E CA  
1999 C C   . ASP E 29  ? 0.1198 0.1237 0.3659 0.0077  0.0003  0.0153  479 ASP E C   
2000 O O   . ASP E 29  ? 0.1336 0.1312 0.3615 0.0091  -0.0048 0.0170  479 ASP E O   
2001 C CB  . ASP E 29  ? 0.1433 0.1480 0.4132 0.0051  -0.0174 0.0262  479 ASP E CB  
2002 C CG  . ASP E 29  ? 0.1669 0.1781 0.4651 0.0039  -0.0207 0.0338  479 ASP E CG  
2003 O OD1 . ASP E 29  ? 0.1752 0.1982 0.4864 0.0084  -0.0070 0.0338  479 ASP E OD1 
2004 O OD2 . ASP E 29  ? 0.1727 0.1782 0.4780 -0.0008 -0.0385 0.0403  479 ASP E OD2 
2005 N N   . PHE E 30  ? 0.1210 0.1319 0.3668 0.0073  0.0084  0.0128  480 PHE E N   
2006 C CA  . PHE E 30  ? 0.0991 0.1094 0.3277 0.0070  0.0095  0.0111  480 PHE E CA  
2007 C C   . PHE E 30  ? 0.1058 0.1266 0.3269 0.0039  0.0144  0.0118  480 PHE E C   
2008 O O   . PHE E 30  ? 0.1043 0.1356 0.3365 0.0030  0.0215  0.0125  480 PHE E O   
2009 C CB  . PHE E 30  ? 0.1440 0.1532 0.3738 0.0078  0.0158  0.0027  480 PHE E CB  
2010 C CG  . PHE E 30  ? 0.1274 0.1418 0.3577 0.0092  0.0266  -0.0081 480 PHE E CG  
2011 C CD1 . PHE E 30  ? 0.1437 0.1565 0.3884 0.0162  0.0322  -0.0125 480 PHE E CD1 
2012 C CD2 . PHE E 30  ? 0.1524 0.1715 0.3623 0.0070  0.0315  -0.0132 480 PHE E CD2 
2013 C CE1 . PHE E 30  ? 0.1468 0.1612 0.3855 0.0248  0.0437  -0.0218 480 PHE E CE1 
2014 C CE2 . PHE E 30  ? 0.1600 0.1800 0.3627 0.0135  0.0412  -0.0234 480 PHE E CE2 
2015 C CZ  . PHE E 30  ? 0.1600 0.1764 0.3751 0.0237  0.0477  -0.0277 480 PHE E CZ  
2016 N N   . LEU E 31  ? 0.0890 0.1049 0.2824 0.0031  0.0116  0.0139  481 LEU E N   
2017 C CA  . LEU E 31  ? 0.0866 0.1085 0.2618 0.0004  0.0168  0.0140  481 LEU E CA  
2018 C C   . LEU E 31  ? 0.0864 0.1080 0.2347 0.0018  0.0174  0.0143  481 LEU E C   
2019 O O   . LEU E 31  ? 0.0961 0.1133 0.2414 0.0051  0.0125  0.0191  481 LEU E O   
2020 C CB  . LEU E 31  ? 0.1161 0.1297 0.2872 -0.0016 0.0070  0.0230  481 LEU E CB  
2021 C CG  . LEU E 31  ? 0.1387 0.1288 0.2880 0.0041  -0.0102 0.0296  481 LEU E CG  
2022 C CD1 . LEU E 31  ? 0.1354 0.1172 0.2434 0.0106  -0.0100 0.0326  481 LEU E CD1 
2023 C CD2 . LEU E 31  ? 0.1725 0.1483 0.3316 -0.0000 -0.0270 0.0359  481 LEU E CD2 
2024 N N   . VAL E 32  ? 0.0818 0.1111 0.2127 0.0005  0.0242  0.0119  482 VAL E N   
2025 C CA  . VAL E 32  ? 0.0881 0.1218 0.1944 0.0023  0.0245  0.0150  482 VAL E CA  
2026 C C   . VAL E 32  ? 0.0956 0.1229 0.1738 0.0064  0.0232  0.0222  482 VAL E C   
2027 O O   . VAL E 32  ? 0.1057 0.1310 0.1849 0.0036  0.0258  0.0212  482 VAL E O   
2028 C CB  . VAL E 32  ? 0.0868 0.1320 0.1921 -0.0011 0.0307  0.0049  482 VAL E CB  
2029 C CG1 . VAL E 32  ? 0.1350 0.1900 0.2186 -0.0001 0.0298  0.0106  482 VAL E CG1 
2030 C CG2 . VAL E 32  ? 0.1133 0.1549 0.2403 -0.0046 0.0269  -0.0019 482 VAL E CG2 
2031 N N   . ARG E 33  ? 0.1040 0.1258 0.1479 -0.0213 0.0298  -0.0087 483 ARG E N   
2032 C CA  . ARG E 33  ? 0.1113 0.1267 0.1385 -0.0161 0.0300  -0.0050 483 ARG E CA  
2033 C C   . ARG E 33  ? 0.1136 0.1382 0.1303 -0.0096 0.0208  -0.0037 483 ARG E C   
2034 O O   . ARG E 33  ? 0.1219 0.1604 0.1516 -0.0112 0.0153  -0.0084 483 ARG E O   
2035 C CB  . ARG E 33  ? 0.1013 0.1239 0.1444 -0.0174 0.0296  -0.0054 483 ARG E CB  
2036 C CG  . ARG E 33  ? 0.1166 0.1570 0.1695 -0.0146 0.0211  -0.0009 483 ARG E CG  
2037 C CD  . ARG E 33  ? 0.0962 0.1515 0.1588 -0.0103 0.0176  -0.0047 483 ARG E CD  
2038 N NE  . ARG E 33  ? 0.0945 0.1631 0.1559 -0.0018 0.0128  0.0043  483 ARG E NE  
2039 C CZ  . ARG E 33  ? 0.0946 0.1691 0.1467 0.0023  0.0110  0.0095  483 ARG E CZ  
2040 N NH1 . ARG E 33  ? 0.1025 0.1742 0.1495 -0.0017 0.0103  0.0049  483 ARG E NH1 
2041 N NH2 . ARG E 33  ? 0.1047 0.1853 0.1519 0.0123  0.0129  0.0209  483 ARG E NH2 
2042 N N   . GLU E 34  ? 0.1255 0.1417 0.1246 -0.0020 0.0221  0.0007  484 GLU E N   
2043 C CA  . GLU E 34  ? 0.1354 0.1619 0.1272 0.0066  0.0125  0.0008  484 GLU E CA  
2044 C C   . GLU E 34  ? 0.1637 0.1993 0.1727 0.0023  0.0104  0.0024  484 GLU E C   
2045 O O   . GLU E 34  ? 0.1866 0.2155 0.1989 0.0002  0.0169  0.0041  484 GLU E O   
2046 C CB  . GLU E 34  ? 0.1768 0.1858 0.1382 0.0217  0.0177  0.0083  484 GLU E CB  
2047 C CG  . GLU E 34  ? 0.2887 0.2819 0.2213 0.0304  0.0258  0.0109  484 GLU E CG  
2048 C CD  . GLU E 34  ? 0.4683 0.4763 0.3731 0.0504  0.0123  0.0065  484 GLU E CD  
2049 O OE1 . GLU E 34  ? 0.5582 0.5517 0.4251 0.0662  0.0197  0.0122  484 GLU E OE1 
2050 O OE2 . GLU E 34  ? 0.4869 0.5234 0.4082 0.0524  -0.0050 -0.0049 484 GLU E OE2 
2051 N N   . SER E 35  ? 0.1069 0.1591 0.1296 0.0012  0.0037  -0.0014 485 SER E N   
2052 C CA  . SER E 35  ? 0.1026 0.1629 0.1372 -0.0016 0.0048  0.0012  485 SER E CA  
2053 C C   . SER E 35  ? 0.1007 0.1595 0.1288 0.0033  0.0040  0.0020  485 SER E C   
2054 O O   . SER E 35  ? 0.1139 0.1687 0.1321 0.0117  0.0008  0.0015  485 SER E O   
2055 C CB  . SER E 35  ? 0.1073 0.1798 0.1612 -0.0041 0.0052  -0.0035 485 SER E CB  
2056 O OG  . SER E 35  ? 0.0969 0.1735 0.1563 -0.0045 0.0105  0.0015  485 SER E OG  
2057 N N   . HIS E 36  ? 0.0935 0.1576 0.1270 0.0008  0.0070  0.0020  486 HIS E N   
2058 C CA  . HIS E 36  ? 0.0918 0.1592 0.1280 0.0031  0.0081  -0.0011 486 HIS E CA  
2059 C C   . HIS E 36  ? 0.0896 0.1707 0.1330 0.0029  0.0068  -0.0018 486 HIS E C   
2060 O O   . HIS E 36  ? 0.1088 0.1923 0.1574 0.0057  0.0058  -0.0051 486 HIS E O   
2061 C CB  . HIS E 36  ? 0.0957 0.1661 0.1385 0.0006  0.0134  -0.0087 486 HIS E CB  
2062 C CG  . HIS E 36  ? 0.1072 0.1584 0.1520 -0.0004 0.0233  -0.0109 486 HIS E CG  
2063 N ND1 . HIS E 36  ? 0.1535 0.1978 0.1981 -0.0035 0.0263  -0.0112 486 HIS E ND1 
2064 C CD2 . HIS E 36  ? 0.1414 0.1743 0.1900 0.0021  0.0360  -0.0116 486 HIS E CD2 
2065 C CE1 . HIS E 36  ? 0.1566 0.1786 0.2041 -0.0038 0.0418  -0.0126 486 HIS E CE1 
2066 N NE2 . HIS E 36  ? 0.1925 0.2051 0.2417 0.0004  0.0494  -0.0113 486 HIS E NE2 
2067 N N   . GLY E 37  ? 0.0894 0.1769 0.1337 0.0016  0.0102  0.0024  487 GLY E N   
2068 C CA  . GLY E 37  ? 0.1088 0.2029 0.1593 0.0020  0.0169  0.0040  487 GLY E CA  
2069 C C   . GLY E 37  ? 0.0957 0.1900 0.1660 -0.0011 0.0181  -0.0021 487 GLY E C   
2070 O O   . GLY E 37  ? 0.1222 0.2225 0.2060 -0.0020 0.0236  -0.0071 487 GLY E O   
2071 N N   . LYS E 38  ? 0.1508 0.1534 0.1346 0.0350  0.0100  0.0261  488 LYS E N   
2072 C CA  . LYS E 38  ? 0.1371 0.1502 0.1369 0.0328  0.0164  0.0252  488 LYS E CA  
2073 C C   . LYS E 38  ? 0.1272 0.1397 0.1289 0.0286  0.0128  0.0163  488 LYS E C   
2074 O O   . LYS E 38  ? 0.1238 0.1391 0.1404 0.0233  0.0122  0.0130  488 LYS E O   
2075 C CB  . LYS E 38  ? 0.1383 0.1587 0.1623 0.0287  0.0208  0.0303  488 LYS E CB  
2076 C CG  . LYS E 38  ? 0.1589 0.1818 0.1814 0.0341  0.0264  0.0418  488 LYS E CG  
2077 C CD  . LYS E 38  ? 0.2416 0.2696 0.2895 0.0295  0.0297  0.0485  488 LYS E CD  
2078 C CE  . LYS E 38  ? 0.3376 0.3691 0.3823 0.0363  0.0369  0.0624  488 LYS E CE  
2079 N NZ  . LYS E 38  ? 0.3768 0.4177 0.4203 0.0423  0.0447  0.0683  488 LYS E NZ  
2080 N N   . PRO E 39  ? 0.1317 0.1401 0.1173 0.0321  0.0104  0.0126  489 PRO E N   
2081 C CA  . PRO E 39  ? 0.1345 0.1414 0.1194 0.0289  0.0070  0.0060  489 PRO E CA  
2082 C C   . PRO E 39  ? 0.1360 0.1519 0.1375 0.0260  0.0100  0.0021  489 PRO E C   
2083 O O   . PRO E 39  ? 0.1451 0.1682 0.1565 0.0273  0.0135  0.0031  489 PRO E O   
2084 C CB  . PRO E 39  ? 0.1553 0.1568 0.1213 0.0346  0.0048  0.0040  489 PRO E CB  
2085 C CG  . PRO E 39  ? 0.1839 0.1792 0.1352 0.0410  0.0037  0.0083  489 PRO E CG  
2086 C CD  . PRO E 39  ? 0.1508 0.1543 0.1157 0.0406  0.0102  0.0147  489 PRO E CD  
2087 N N   . GLY E 40  ? 0.1170 0.1325 0.1221 0.0230  0.0080  -0.0020 490 GLY E N   
2088 C CA  . GLY E 40  ? 0.1282 0.1494 0.1448 0.0223  0.0088  -0.0076 490 GLY E CA  
2089 C C   . GLY E 40  ? 0.1185 0.1423 0.1523 0.0198  0.0095  -0.0078 490 GLY E C   
2090 O O   . GLY E 40  ? 0.1349 0.1610 0.1763 0.0205  0.0082  -0.0141 490 GLY E O   
2091 N N   . GLU E 41  ? 0.1110 0.1335 0.1500 0.0181  0.0107  -0.0014 491 GLU E N   
2092 C CA  . GLU E 41  ? 0.1000 0.1235 0.1558 0.0159  0.0109  -0.0007 491 GLU E CA  
2093 C C   . GLU E 41  ? 0.1023 0.1232 0.1560 0.0151  0.0099  -0.0003 491 GLU E C   
2094 O O   . GLU E 41  ? 0.1208 0.1385 0.1630 0.0149  0.0086  0.0028  491 GLU E O   
2095 C CB  . GLU E 41  ? 0.1289 0.1532 0.1925 0.0152  0.0133  0.0079  491 GLU E CB  
2096 C CG  . GLU E 41  ? 0.2171 0.2467 0.2846 0.0168  0.0164  0.0116  491 GLU E CG  
2097 C CD  . GLU E 41  ? 0.2717 0.3063 0.3622 0.0145  0.0151  0.0085  491 GLU E CD  
2098 O OE1 . GLU E 41  ? 0.2900 0.3309 0.3887 0.0153  0.0172  0.0121  491 GLU E OE1 
2099 O OE2 . GLU E 41  ? 0.2530 0.2849 0.3541 0.0126  0.0111  0.0024  491 GLU E OE2 
2100 N N   . TYR E 42  ? 0.0987 0.1205 0.1653 0.0150  0.0097  -0.0031 492 TYR E N   
2101 C CA  . TYR E 42  ? 0.0986 0.1201 0.1678 0.0149  0.0098  -0.0013 492 TYR E CA  
2102 C C   . TYR E 42  ? 0.0988 0.1183 0.1784 0.0129  0.0093  0.0050  492 TYR E C   
2103 O O   . TYR E 42  ? 0.1010 0.1201 0.1904 0.0120  0.0096  0.0066  492 TYR E O   
2104 C CB  . TYR E 42  ? 0.1161 0.1399 0.1905 0.0188  0.0104  -0.0086 492 TYR E CB  
2105 C CG  . TYR E 42  ? 0.1201 0.1462 0.1820 0.0227  0.0115  -0.0134 492 TYR E CG  
2106 C CD1 . TYR E 42  ? 0.1379 0.1637 0.1961 0.0251  0.0095  -0.0208 492 TYR E CD1 
2107 C CD2 . TYR E 42  ? 0.1334 0.1627 0.1893 0.0243  0.0145  -0.0097 492 TYR E CD2 
2108 C CE1 . TYR E 42  ? 0.1612 0.1887 0.2062 0.0299  0.0103  -0.0249 492 TYR E CE1 
2109 C CE2 . TYR E 42  ? 0.1447 0.1767 0.1893 0.0287  0.0166  -0.0122 492 TYR E CE2 
2110 C CZ  . TYR E 42  ? 0.1831 0.2137 0.2204 0.0319  0.0145  -0.0202 492 TYR E CZ  
2111 O OH  . TYR E 42  ? 0.1978 0.2306 0.2218 0.0375  0.0164  -0.0223 492 TYR E OH  
2112 N N   . VAL E 43  ? 0.0992 0.1181 0.1788 0.0122  0.0083  0.0095  493 VAL E N   
2113 C CA  . VAL E 43  ? 0.1012 0.1175 0.1878 0.0110  0.0069  0.0161  493 VAL E CA  
2114 C C   . VAL E 43  ? 0.1002 0.1190 0.1990 0.0119  0.0068  0.0157  493 VAL E C   
2115 O O   . VAL E 43  ? 0.1027 0.1252 0.2003 0.0128  0.0074  0.0151  493 VAL E O   
2116 C CB  . VAL E 43  ? 0.1059 0.1180 0.1797 0.0105  0.0033  0.0222  493 VAL E CB  
2117 C CG1 . VAL E 43  ? 0.1376 0.1467 0.2161 0.0108  0.0013  0.0291  493 VAL E CG1 
2118 C CG2 . VAL E 43  ? 0.1396 0.1496 0.1986 0.0119  0.0039  0.0220  493 VAL E CG2 
2119 N N   . LEU E 44  ? 0.1017 0.1187 0.2133 0.0122  0.0066  0.0173  494 LEU E N   
2120 C CA  . LEU E 44  ? 0.1025 0.1210 0.2256 0.0138  0.0060  0.0188  494 LEU E CA  
2121 C C   . LEU E 44  ? 0.1053 0.1209 0.2281 0.0119  0.0025  0.0278  494 LEU E C   
2122 O O   . LEU E 44  ? 0.1281 0.1395 0.2512 0.0114  0.0020  0.0324  494 LEU E O   
2123 C CB  . LEU E 44  ? 0.1137 0.1299 0.2511 0.0162  0.0063  0.0142  494 LEU E CB  
2124 C CG  . LEU E 44  ? 0.1141 0.1307 0.2642 0.0189  0.0055  0.0164  494 LEU E CG  
2125 C CD1 . LEU E 44  ? 0.1330 0.1570 0.2827 0.0234  0.0084  0.0137  494 LEU E CD1 
2126 C CD2 . LEU E 44  ? 0.1446 0.1551 0.3087 0.0209  0.0037  0.0123  494 LEU E CD2 
2127 N N   . SER E 45  ? 0.1077 0.1258 0.2304 0.0114  -0.0004 0.0312  495 SER E N   
2128 C CA  . SER E 45  ? 0.1159 0.1302 0.2372 0.0106  -0.0065 0.0385  495 SER E CA  
2129 C C   . SER E 45  ? 0.1504 0.1683 0.2893 0.0120  -0.0074 0.0412  495 SER E C   
2130 O O   . SER E 45  ? 0.1272 0.1527 0.2760 0.0131  -0.0049 0.0396  495 SER E O   
2131 C CB  . SER E 45  ? 0.1439 0.1568 0.2548 0.0087  -0.0123 0.0402  495 SER E CB  
2132 O OG  . SER E 45  ? 0.1385 0.1469 0.2316 0.0087  -0.0119 0.0376  495 SER E OG  
2133 N N   . VAL E 46  ? 0.1536 0.1670 0.2964 0.0130  -0.0101 0.0462  496 VAL E N   
2134 C CA  . VAL E 46  ? 0.1791 0.1950 0.3393 0.0151  -0.0111 0.0487  496 VAL E CA  
2135 C C   . VAL E 46  ? 0.1931 0.2043 0.3512 0.0154  -0.0189 0.0567  496 VAL E C   
2136 O O   . VAL E 46  ? 0.3205 0.3245 0.4644 0.0160  -0.0209 0.0603  496 VAL E O   
2137 C CB  . VAL E 46  ? 0.1843 0.1973 0.3546 0.0173  -0.0068 0.0459  496 VAL E CB  
2138 C CG1 . VAL E 46  ? 0.2211 0.2373 0.4092 0.0211  -0.0071 0.0461  496 VAL E CG1 
2139 C CG2 . VAL E 46  ? 0.1858 0.1996 0.3533 0.0176  -0.0018 0.0371  496 VAL E CG2 
2140 N N   . TYR E 47  ? 0.1476 0.1634 0.3199 0.0162  -0.0232 0.0599  497 TYR E N   
2141 C CA  . TYR E 47  ? 0.1517 0.1628 0.3252 0.0178  -0.0314 0.0669  497 TYR E CA  
2142 C C   . TYR E 47  ? 0.1540 0.1635 0.3399 0.0210  -0.0279 0.0688  497 TYR E C   
2143 O O   . TYR E 47  ? 0.1521 0.1676 0.3550 0.0228  -0.0238 0.0658  497 TYR E O   
2144 C CB  . TYR E 47  ? 0.1572 0.1747 0.3439 0.0168  -0.0394 0.0700  497 TYR E CB  
2145 C CG  . TYR E 47  ? 0.1473 0.1585 0.3319 0.0187  -0.0513 0.0763  497 TYR E CG  
2146 C CD1 . TYR E 47  ? 0.1512 0.1625 0.3485 0.0223  -0.0523 0.0807  497 TYR E CD1 
2147 C CD2 . TYR E 47  ? 0.2379 0.2416 0.4066 0.0182  -0.0629 0.0771  497 TYR E CD2 
2148 C CE1 . TYR E 47  ? 0.1871 0.1924 0.3789 0.0243  -0.0633 0.0854  497 TYR E CE1 
2149 C CE2 . TYR E 47  ? 0.2371 0.2336 0.4010 0.0216  -0.0757 0.0818  497 TYR E CE2 
2150 C CZ  . TYR E 47  ? 0.2317 0.2297 0.4053 0.0240  -0.0746 0.0852  497 TYR E CZ  
2151 O OH  . TYR E 47  ? 0.3003 0.2914 0.4639 0.0270  -0.0853 0.0873  497 TYR E OH  
2152 N N   . SER E 48  ? 0.1461 0.1472 0.3236 0.0226  -0.0292 0.0744  498 SER E N   
2153 C CA  . SER E 48  ? 0.1496 0.1474 0.3404 0.0250  -0.0264 0.0775  498 SER E CA  
2154 C C   . SER E 48  ? 0.1637 0.1540 0.3461 0.0281  -0.0313 0.0879  498 SER E C   
2155 O O   . SER E 48  ? 0.2021 0.1878 0.3650 0.0290  -0.0310 0.0921  498 SER E O   
2156 C CB  . SER E 48  ? 0.1561 0.1514 0.3492 0.0235  -0.0186 0.0734  498 SER E CB  
2157 O OG  . SER E 48  ? 0.1973 0.1878 0.4068 0.0254  -0.0176 0.0759  498 SER E OG  
2158 N N   . ASP E 49  ? 0.1694 0.1593 0.3635 0.0303  -0.0347 0.0912  499 ASP E N   
2159 C CA  . ASP E 49  ? 0.2066 0.1903 0.3904 0.0332  -0.0383 0.0993  499 ASP E CA  
2160 C C   . ASP E 49  ? 0.2323 0.2122 0.3911 0.0360  -0.0455 0.1026  499 ASP E C   
2161 O O   . ASP E 49  ? 0.2828 0.2566 0.4224 0.0399  -0.0438 0.1091  499 ASP E O   
2162 C CB  . ASP E 49  ? 0.2346 0.2135 0.4208 0.0332  -0.0308 0.1046  499 ASP E CB  
2163 C CG  . ASP E 49  ? 0.3005 0.2801 0.5105 0.0313  -0.0274 0.0997  499 ASP E CG  
2164 O OD1 . ASP E 49  ? 0.2789 0.2617 0.5002 0.0327  -0.0309 0.0959  499 ASP E OD1 
2165 O OD2 . ASP E 49  ? 0.3588 0.3357 0.5765 0.0290  -0.0219 0.0994  499 ASP E OD2 
2166 N N   . GLY E 50  ? 0.2199 0.2033 0.3789 0.0347  -0.0536 0.0979  500 GLY E N   
2167 C CA  . GLY E 50  ? 0.2723 0.2502 0.4094 0.0377  -0.0646 0.0984  500 GLY E CA  
2168 C C   . GLY E 50  ? 0.2746 0.2482 0.3906 0.0385  -0.0647 0.0965  500 GLY E C   
2169 O O   . GLY E 50  ? 0.3214 0.2881 0.4160 0.0423  -0.0752 0.0952  500 GLY E O   
2170 N N   . GLN E 51  ? 0.2672 0.2793 0.3053 0.0814  -0.0651 0.1131  501 GLN E N   
2171 C CA  . GLN E 51  ? 0.2878 0.3106 0.3129 0.0684  -0.0538 0.1085  501 GLN E CA  
2172 C C   . GLN E 51  ? 0.2712 0.2920 0.3105 0.0629  -0.0422 0.0948  501 GLN E C   
2173 O O   . GLN E 51  ? 0.2427 0.2504 0.2949 0.0670  -0.0398 0.0921  501 GLN E O   
2174 C CB  . GLN E 51  ? 0.3381 0.3547 0.3396 0.0590  -0.0503 0.1254  501 GLN E CB  
2175 C CG  . GLN E 51  ? 0.4370 0.4613 0.4191 0.0611  -0.0615 0.1444  501 GLN E CG  
2176 C CD  . GLN E 51  ? 0.5509 0.5785 0.5116 0.0463  -0.0566 0.1644  501 GLN E CD  
2177 O OE1 . GLN E 51  ? 0.5668 0.6027 0.5264 0.0368  -0.0448 0.1647  501 GLN E OE1 
2178 N NE2 . GLN E 51  ? 0.6254 0.6500 0.5704 0.0426  -0.0654 0.1799  501 GLN E NE2 
2179 N N   . ARG E 52  ? 0.2671 0.2993 0.3019 0.0554  -0.0381 0.0849  502 ARG E N   
2180 C CA  . ARG E 52  ? 0.2386 0.2669 0.2815 0.0481  -0.0287 0.0753  502 ARG E CA  
2181 C C   . ARG E 52  ? 0.2265 0.2434 0.2560 0.0426  -0.0197 0.0789  502 ARG E C   
2182 O O   . ARG E 52  ? 0.3183 0.3444 0.3298 0.0416  -0.0199 0.0820  502 ARG E O   
2183 C CB  . ARG E 52  ? 0.2815 0.3192 0.3257 0.0417  -0.0345 0.0649  502 ARG E CB  
2184 C CG  . ARG E 52  ? 0.3413 0.3966 0.4063 0.0387  -0.0422 0.0638  502 ARG E CG  
2185 C CD  . ARG E 52  ? 0.3757 0.4404 0.4368 0.0415  -0.0579 0.0637  502 ARG E CD  
2186 N NE  . ARG E 52  ? 0.3683 0.4575 0.4531 0.0354  -0.0666 0.0652  502 ARG E NE  
2187 C CZ  . ARG E 52  ? 0.3394 0.4439 0.4290 0.0390  -0.0805 0.0666  502 ARG E CZ  
2188 N NH1 . ARG E 52  ? 0.3982 0.4934 0.4669 0.0499  -0.0870 0.0664  502 ARG E NH1 
2189 N NH2 . ARG E 52  ? 0.3603 0.4960 0.4756 0.0305  -0.0881 0.0696  502 ARG E NH2 
2190 N N   . ARG E 53  ? 0.2046 0.2083 0.2431 0.0397  -0.0125 0.0774  503 ARG E N   
2191 C CA  . ARG E 53  ? 0.2388 0.2329 0.2694 0.0321  -0.0056 0.0824  503 ARG E CA  
2192 C C   . ARG E 53  ? 0.2324 0.2252 0.2687 0.0277  0.0018  0.0699  503 ARG E C   
2193 O O   . ARG E 53  ? 0.2343 0.2261 0.2829 0.0300  0.0028  0.0622  503 ARG E O   
2194 C CB  . ARG E 53  ? 0.2766 0.2470 0.3104 0.0318  -0.0105 0.0949  503 ARG E CB  
2195 C CG  . ARG E 53  ? 0.3579 0.3263 0.3832 0.0348  -0.0213 0.1115  503 ARG E CG  
2196 C CD  . ARG E 53  ? 0.3911 0.3246 0.4212 0.0374  -0.0348 0.1232  503 ARG E CD  
2197 N NE  . ARG E 53  ? 0.4264 0.3570 0.4524 0.0465  -0.0484 0.1341  503 ARG E NE  
2198 C CZ  . ARG E 53  ? 0.4912 0.4266 0.4977 0.0368  -0.0529 0.1522  503 ARG E CZ  
2199 N NH1 . ARG E 53  ? 0.5395 0.4898 0.5331 0.0184  -0.0448 0.1650  503 ARG E NH1 
2200 N NH2 . ARG E 53  ? 0.4472 0.3793 0.4480 0.0462  -0.0651 0.1568  503 ARG E NH2 
2201 N N   . HIS E 54  ? 0.1864 0.1863 0.2133 0.0223  0.0065  0.0682  504 HIS E N   
2202 C CA  . HIS E 54  ? 0.1552 0.1543 0.1843 0.0197  0.0103  0.0562  504 HIS E CA  
2203 C C   . HIS E 54  ? 0.1628 0.1598 0.1919 0.0127  0.0169  0.0596  504 HIS E C   
2204 O O   . HIS E 54  ? 0.1949 0.2096 0.2161 0.0091  0.0194  0.0664  504 HIS E O   
2205 C CB  . HIS E 54  ? 0.1870 0.1972 0.2059 0.0242  0.0039  0.0457  504 HIS E CB  
2206 C CG  . HIS E 54  ? 0.1657 0.1755 0.1852 0.0278  -0.0072 0.0435  504 HIS E CG  
2207 N ND1 . HIS E 54  ? 0.1721 0.1748 0.2030 0.0224  -0.0132 0.0416  504 HIS E ND1 
2208 C CD2 . HIS E 54  ? 0.1693 0.1891 0.1802 0.0341  -0.0146 0.0449  504 HIS E CD2 
2209 C CE1 . HIS E 54  ? 0.1742 0.1812 0.2060 0.0236  -0.0247 0.0419  504 HIS E CE1 
2210 N NE2 . HIS E 54  ? 0.1832 0.1981 0.2022 0.0324  -0.0262 0.0421  504 HIS E NE2 
2211 N N   . PHE E 55  ? 0.1492 0.1312 0.1874 0.0103  0.0193  0.0550  505 PHE E N   
2212 C CA  . PHE E 55  ? 0.1849 0.1608 0.2257 0.0023  0.0221  0.0573  505 PHE E CA  
2213 C C   . PHE E 55  ? 0.1573 0.1389 0.1980 0.0018  0.0254  0.0448  505 PHE E C   
2214 O O   . PHE E 55  ? 0.1624 0.1384 0.2054 0.0052  0.0249  0.0365  505 PHE E O   
2215 C CB  . PHE E 55  ? 0.1994 0.1492 0.2487 0.0035  0.0173  0.0573  505 PHE E CB  
2216 C CG  . PHE E 55  ? 0.1990 0.1337 0.2489 0.0063  0.0085  0.0691  505 PHE E CG  
2217 C CD1 . PHE E 55  ? 0.2352 0.1556 0.2836 -0.0058 0.0008  0.0870  505 PHE E CD1 
2218 C CD2 . PHE E 55  ? 0.2271 0.1632 0.2802 0.0194  0.0053  0.0647  505 PHE E CD2 
2219 C CE1 . PHE E 55  ? 0.2597 0.1595 0.3069 -0.0038 -0.0120 0.1008  505 PHE E CE1 
2220 C CE2 . PHE E 55  ? 0.2412 0.1615 0.2949 0.0250  -0.0059 0.0747  505 PHE E CE2 
2221 C CZ  . PHE E 55  ? 0.2745 0.1725 0.3238 0.0138  -0.0156 0.0930  505 PHE E CZ  
2222 N N   . ILE E 56  ? 0.1396 0.1376 0.1781 -0.0029 0.0280  0.0451  506 ILE E N   
2223 C CA  . ILE E 56  ? 0.1418 0.1421 0.1815 -0.0024 0.0286  0.0337  506 ILE E CA  
2224 C C   . ILE E 56  ? 0.1385 0.1200 0.1857 -0.0085 0.0286  0.0327  506 ILE E C   
2225 O O   . ILE E 56  ? 0.1681 0.1409 0.2209 -0.0170 0.0265  0.0417  506 ILE E O   
2226 C CB  . ILE E 56  ? 0.1328 0.1652 0.1707 -0.0024 0.0305  0.0318  506 ILE E CB  
2227 C CG1 . ILE E 56  ? 0.1518 0.2035 0.1789 0.0110  0.0269  0.0246  506 ILE E CG1 
2228 C CG2 . ILE E 56  ? 0.1506 0.1842 0.1919 -0.0014 0.0291  0.0204  506 ILE E CG2 
2229 C CD1 . ILE E 56  ? 0.1689 0.2008 0.1905 0.0219  0.0160  0.0096  506 ILE E CD1 
2230 N N   . ILE E 57  ? 0.1545 0.1284 0.2005 -0.0047 0.0279  0.0225  507 ILE E N   
2231 C CA  . ILE E 57  ? 0.1746 0.1363 0.2243 -0.0065 0.0268  0.0163  507 ILE E CA  
2232 C C   . ILE E 57  ? 0.2219 0.1929 0.2737 -0.0128 0.0260  0.0132  507 ILE E C   
2233 O O   . ILE E 57  ? 0.2133 0.1942 0.2603 -0.0092 0.0253  0.0071  507 ILE E O   
2234 C CB  . ILE E 57  ? 0.1775 0.1399 0.2227 -0.0002 0.0275  0.0086  507 ILE E CB  
2235 C CG1 . ILE E 57  ? 0.1877 0.1539 0.2347 0.0056  0.0286  0.0122  507 ILE E CG1 
2236 C CG2 . ILE E 57  ? 0.2358 0.1915 0.2813 0.0021  0.0255  -0.0020 507 ILE E CG2 
2237 C CD1 . ILE E 57  ? 0.1799 0.1638 0.2245 0.0081  0.0306  0.0096  507 ILE E CD1 
2238 N N   . GLN E 58  ? 0.1921 0.1594 0.2520 -0.0231 0.0230  0.0186  508 GLN E N   
2239 C CA  . GLN E 58  ? 0.2010 0.1868 0.2670 -0.0314 0.0219  0.0175  508 GLN E CA  
2240 C C   . GLN E 58  ? 0.1992 0.1759 0.2627 -0.0273 0.0183  0.0031  508 GLN E C   
2241 O O   . GLN E 58  ? 0.2086 0.1629 0.2691 -0.0234 0.0143  -0.0042 508 GLN E O   
2242 C CB  . GLN E 58  ? 0.2082 0.1927 0.2858 -0.0499 0.0162  0.0317  508 GLN E CB  
2243 C CG  . GLN E 58  ? 0.3280 0.3421 0.4166 -0.0622 0.0147  0.0328  508 GLN E CG  
2244 C CD  . GLN E 58  ? 0.4335 0.4537 0.5358 -0.0879 0.0071  0.0541  508 GLN E CD  
2245 O OE1 . GLN E 58  ? 0.4846 0.4620 0.5902 -0.0976 -0.0068 0.0592  508 GLN E OE1 
2246 N NE2 . GLN E 58  ? 0.4655 0.5414 0.5759 -0.0990 0.0137  0.0669  508 GLN E NE2 
2247 N N   . TYR E 59  ? 0.1722 0.1698 0.2357 -0.0253 0.0182  -0.0026 509 TYR E N   
2248 C CA  . TYR E 59  ? 0.1721 0.1651 0.2321 -0.0226 0.0131  -0.0141 509 TYR E CA  
2249 C C   . TYR E 59  ? 0.1789 0.1944 0.2521 -0.0320 0.0091  -0.0147 509 TYR E C   
2250 O O   . TYR E 59  ? 0.2062 0.2536 0.2837 -0.0282 0.0105  -0.0153 509 TYR E O   
2251 C CB  . TYR E 59  ? 0.1882 0.1821 0.2350 -0.0113 0.0117  -0.0189 509 TYR E CB  
2252 C CG  . TYR E 59  ? 0.1844 0.1760 0.2245 -0.0093 0.0052  -0.0272 509 TYR E CG  
2253 C CD1 . TYR E 59  ? 0.2073 0.1876 0.2399 -0.0094 0.0049  -0.0321 509 TYR E CD1 
2254 C CD2 . TYR E 59  ? 0.2190 0.2236 0.2592 -0.0044 -0.0021 -0.0322 509 TYR E CD2 
2255 C CE1 . TYR E 59  ? 0.2302 0.2133 0.2535 -0.0073 -0.0013 -0.0394 509 TYR E CE1 
2256 C CE2 . TYR E 59  ? 0.2143 0.2166 0.2469 -0.0027 -0.0099 -0.0383 509 TYR E CE2 
2257 C CZ  . TYR E 59  ? 0.2315 0.2234 0.2546 -0.0055 -0.0088 -0.0407 509 TYR E CZ  
2258 O OH  . TYR E 59  ? 0.2846 0.2788 0.2969 -0.0033 -0.0167 -0.0465 509 TYR E OH  
2259 N N   . VAL E 60  ? 0.1897 0.1913 0.2703 -0.0430 0.0017  -0.0163 510 VAL E N   
2260 C CA  . VAL E 60  ? 0.2248 0.2486 0.3222 -0.0580 -0.0049 -0.0138 510 VAL E CA  
2261 C C   . VAL E 60  ? 0.2570 0.2560 0.3528 -0.0599 -0.0174 -0.0268 510 VAL E C   
2262 O O   . VAL E 60  ? 0.2410 0.2039 0.3283 -0.0553 -0.0231 -0.0337 510 VAL E O   
2263 C CB  . VAL E 60  ? 0.2927 0.3258 0.4056 -0.0795 -0.0064 0.0063  510 VAL E CB  
2264 C CG1 . VAL E 60  ? 0.3337 0.4108 0.4482 -0.0771 0.0061  0.0173  510 VAL E CG1 
2265 C CG2 . VAL E 60  ? 0.3544 0.3382 0.4623 -0.0823 -0.0136 0.0107  510 VAL E CG2 
2266 N N   . ASP E 61  ? 0.2910 0.3132 0.3948 -0.0637 -0.0233 -0.0330 511 ASP E N   
2267 C CA  . ASP E 61  ? 0.3312 0.3343 0.4338 -0.0660 -0.0379 -0.0469 511 ASP E CA  
2268 C C   . ASP E 61  ? 0.2764 0.2538 0.3540 -0.0461 -0.0373 -0.0624 511 ASP E C   
2269 O O   . ASP E 61  ? 0.2971 0.2479 0.3682 -0.0432 -0.0486 -0.0756 511 ASP E O   
2270 C CB  . ASP E 61  ? 0.4109 0.3892 0.5288 -0.0874 -0.0541 -0.0413 511 ASP E CB  
2271 C CG  . ASP E 61  ? 0.5201 0.5348 0.6639 -0.1138 -0.0549 -0.0192 511 ASP E CG  
2272 O OD1 . ASP E 61  ? 0.5133 0.5796 0.6677 -0.1148 -0.0488 -0.0181 511 ASP E OD1 
2273 O OD2 . ASP E 61  ? 0.5741 0.5694 0.7275 -0.1334 -0.0630 -0.0020 511 ASP E OD2 
2274 N N   . ASN E 62  ? 0.2312 0.2483 0.3218 -0.0449 0.0044  -0.0227 512 ASN E N   
2275 C CA  . ASN E 62  ? 0.2849 0.2790 0.3483 -0.0437 0.0005  -0.0264 512 ASN E CA  
2276 C C   . ASN E 62  ? 0.2762 0.2501 0.3247 -0.0468 0.0103  -0.0287 512 ASN E C   
2277 O O   . ASN E 62  ? 0.3380 0.2950 0.3663 -0.0492 0.0088  -0.0329 512 ASN E O   
2278 C CB  . ASN E 62  ? 0.3771 0.3674 0.4317 -0.0505 -0.0139 -0.0298 512 ASN E CB  
2279 C CG  . ASN E 62  ? 0.4451 0.4582 0.5194 -0.0471 -0.0259 -0.0269 512 ASN E CG  
2280 O OD1 . ASN E 62  ? 0.4727 0.4905 0.5478 -0.0355 -0.0292 -0.0240 512 ASN E OD1 
2281 N ND2 . ASN E 62  ? 0.4728 0.5000 0.5646 -0.0573 -0.0336 -0.0278 512 ASN E ND2 
2282 N N   . MET E 63  ? 0.2095 0.1856 0.2673 -0.0461 0.0204  -0.0257 513 MET E N   
2283 C CA  . MET E 63  ? 0.2303 0.1888 0.2782 -0.0472 0.0284  -0.0270 513 MET E CA  
2284 C C   . MET E 63  ? 0.2112 0.1719 0.2602 -0.0389 0.0363  -0.0220 513 MET E C   
2285 O O   . MET E 63  ? 0.2277 0.2028 0.2871 -0.0352 0.0388  -0.0176 513 MET E O   
2286 C CB  . MET E 63  ? 0.2254 0.1776 0.2812 -0.0568 0.0301  -0.0275 513 MET E CB  
2287 C CG  . MET E 63  ? 0.3018 0.2466 0.3531 -0.0667 0.0209  -0.0343 513 MET E CG  
2288 S SD  . MET E 63  ? 0.3420 0.2748 0.4032 -0.0795 0.0215  -0.0346 513 MET E SD  
2289 C CE  . MET E 63  ? 0.3427 0.3069 0.4338 -0.0858 0.0197  -0.0252 513 MET E CE  
2290 N N   . TYR E 64  ? 0.1826 0.1302 0.2205 -0.0359 0.0403  -0.0232 514 TYR E N   
2291 C CA  . TYR E 64  ? 0.1699 0.1171 0.2077 -0.0296 0.0457  -0.0188 514 TYR E CA  
2292 C C   . TYR E 64  ? 0.1808 0.1199 0.2230 -0.0320 0.0509  -0.0163 514 TYR E C   
2293 O O   . TYR E 64  ? 0.2086 0.1353 0.2488 -0.0356 0.0515  -0.0204 514 TYR E O   
2294 C CB  . TYR E 64  ? 0.1961 0.1368 0.2233 -0.0256 0.0453  -0.0204 514 TYR E CB  
2295 C CG  . TYR E 64  ? 0.1741 0.1175 0.1944 -0.0235 0.0392  -0.0211 514 TYR E CG  
2296 C CD1 . TYR E 64  ? 0.1791 0.1263 0.1990 -0.0172 0.0371  -0.0187 514 TYR E CD1 
2297 C CD2 . TYR E 64  ? 0.1912 0.1302 0.2027 -0.0275 0.0347  -0.0241 514 TYR E CD2 
2298 C CE1 . TYR E 64  ? 0.1785 0.1231 0.1915 -0.0143 0.0302  -0.0192 514 TYR E CE1 
2299 C CE2 . TYR E 64  ? 0.1840 0.1220 0.1878 -0.0255 0.0276  -0.0229 514 TYR E CE2 
2300 C CZ  . TYR E 64  ? 0.1736 0.1135 0.1794 -0.0186 0.0251  -0.0204 514 TYR E CZ  
2301 O OH  . TYR E 64  ? 0.2050 0.1391 0.2025 -0.0157 0.0169  -0.0191 514 TYR E OH  
2302 N N   . ARG E 65  ? 0.1789 0.1224 0.2246 -0.0294 0.0545  -0.0096 515 ARG E N   
2303 C CA  . ARG E 65  ? 0.1804 0.1141 0.2293 -0.0320 0.0581  -0.0047 515 ARG E CA  
2304 C C   . ARG E 65  ? 0.1930 0.1303 0.2383 -0.0269 0.0610  0.0032  515 ARG E C   
2305 O O   . ARG E 65  ? 0.1958 0.1440 0.2366 -0.0221 0.0610  0.0036  515 ARG E O   
2306 C CB  . ARG E 65  ? 0.2373 0.1720 0.2957 -0.0422 0.0584  -0.0029 515 ARG E CB  
2307 C CG  . ARG E 65  ? 0.2349 0.1911 0.3017 -0.0442 0.0607  0.0022  515 ARG E CG  
2308 C CD  . ARG E 65  ? 0.3295 0.2909 0.4106 -0.0569 0.0602  0.0046  515 ARG E CD  
2309 N NE  . ARG E 65  ? 0.3958 0.3415 0.4776 -0.0641 0.0633  0.0118  515 ARG E NE  
2310 C CZ  . ARG E 65  ? 0.4539 0.4066 0.5389 -0.0675 0.0701  0.0230  515 ARG E CZ  
2311 N NH1 . ARG E 65  ? 0.4391 0.4165 0.5269 -0.0631 0.0760  0.0266  515 ARG E NH1 
2312 N NH2 . ARG E 65  ? 0.5170 0.4507 0.6007 -0.0748 0.0713  0.0308  515 ARG E NH2 
2313 N N   . PHE E 66  ? 0.2351 0.1603 0.2802 -0.0273 0.0626  0.0093  516 PHE E N   
2314 C CA  . PHE E 66  ? 0.2589 0.1854 0.2976 -0.0249 0.0648  0.0190  516 PHE E CA  
2315 C C   . PHE E 66  ? 0.3169 0.2416 0.3604 -0.0342 0.0692  0.0270  516 PHE E C   
2316 O O   . PHE E 66  ? 0.3409 0.2824 0.3890 -0.0388 0.0735  0.0285  516 PHE E O   
2317 C CB  . PHE E 66  ? 0.2607 0.1754 0.2948 -0.0181 0.0612  0.0222  516 PHE E CB  
2318 C CG  . PHE E 66  ? 0.2160 0.1363 0.2480 -0.0113 0.0569  0.0162  516 PHE E CG  
2319 C CD1 . PHE E 66  ? 0.2180 0.1477 0.2404 -0.0082 0.0551  0.0157  516 PHE E CD1 
2320 C CD2 . PHE E 66  ? 0.2192 0.1348 0.2586 -0.0086 0.0552  0.0109  516 PHE E CD2 
2321 C CE1 . PHE E 66  ? 0.2198 0.1520 0.2406 -0.0045 0.0498  0.0109  516 PHE E CE1 
2322 C CE2 . PHE E 66  ? 0.2162 0.1392 0.2559 -0.0049 0.0519  0.0071  516 PHE E CE2 
2323 C CZ  . PHE E 66  ? 0.2174 0.1476 0.2481 -0.0039 0.0483  0.0076  516 PHE E CZ  
2324 N N   . GLU E 67  ? 0.3091 0.2146 0.3537 -0.0375 0.0683  0.0326  517 GLU E N   
2325 C CA  . GLU E 67  ? 0.3534 0.2531 0.4019 -0.0487 0.0717  0.0423  517 GLU E CA  
2326 C C   . GLU E 67  ? 0.3659 0.2491 0.4240 -0.0577 0.0685  0.0374  517 GLU E C   
2327 O O   . GLU E 67  ? 0.3763 0.2516 0.4392 -0.0696 0.0698  0.0455  517 GLU E O   
2328 C CB  . GLU E 67  ? 0.4005 0.2844 0.4385 -0.0469 0.0716  0.0556  517 GLU E CB  
2329 C CG  . GLU E 67  ? 0.4601 0.3579 0.4839 -0.0423 0.0752  0.0632  517 GLU E CG  
2330 C CD  . GLU E 67  ? 0.4778 0.3578 0.4882 -0.0416 0.0734  0.0778  517 GLU E CD  
2331 O OE1 . GLU E 67  ? 0.5183 0.3741 0.5328 -0.0418 0.0679  0.0811  517 GLU E OE1 
2332 O OE2 . GLU E 67  ? 0.5134 0.4022 0.5073 -0.0400 0.0769  0.0859  517 GLU E OE2 
2333 N N   . GLY E 68  ? 0.3478 0.2239 0.4071 -0.0532 0.0644  0.0247  518 GLY E N   
2334 C CA  . GLY E 68  ? 0.3759 0.2312 0.4390 -0.0604 0.0607  0.0183  518 GLY E CA  
2335 C C   . GLY E 68  ? 0.3416 0.2044 0.4062 -0.0631 0.0576  0.0048  518 GLY E C   
2336 O O   . GLY E 68  ? 0.3058 0.1900 0.3767 -0.0692 0.0570  0.0046  518 GLY E O   
2337 N N   . THR E 69  ? 0.3414 0.1868 0.3997 -0.0576 0.0556  -0.0062 519 THR E N   
2338 C CA  . THR E 69  ? 0.3651 0.2125 0.4187 -0.0603 0.0522  -0.0192 519 THR E CA  
2339 C C   . THR E 69  ? 0.2782 0.1517 0.3301 -0.0554 0.0527  -0.0204 519 THR E C   
2340 O O   . THR E 69  ? 0.3094 0.1926 0.3603 -0.0463 0.0561  -0.0161 519 THR E O   
2341 C CB  . THR E 69  ? 0.4107 0.2373 0.4540 -0.0518 0.0525  -0.0301 519 THR E CB  
2342 O OG1 . THR E 69  ? 0.4930 0.2968 0.5352 -0.0532 0.0483  -0.0285 519 THR E OG1 
2343 C CG2 . THR E 69  ? 0.4566 0.2825 0.4888 -0.0547 0.0497  -0.0435 519 THR E CG2 
2344 N N   . GLY E 70  ? 0.2560 0.1387 0.3073 -0.0621 0.0475  -0.0260 520 GLY E N   
2345 C CA  . GLY E 70  ? 0.2533 0.1548 0.3008 -0.0573 0.0461  -0.0278 520 GLY E CA  
2346 C C   . GLY E 70  ? 0.2893 0.1817 0.3212 -0.0533 0.0455  -0.0378 520 GLY E C   
2347 O O   . GLY E 70  ? 0.2949 0.1693 0.3178 -0.0564 0.0445  -0.0463 520 GLY E O   
2348 N N   . PHE E 71  ? 0.2445 0.1481 0.2712 -0.0468 0.0465  -0.0367 521 PHE E N   
2349 C CA  . PHE E 71  ? 0.2183 0.1168 0.2298 -0.0439 0.0480  -0.0434 521 PHE E CA  
2350 C C   . PHE E 71  ? 0.2236 0.1334 0.2282 -0.0449 0.0419  -0.0421 521 PHE E C   
2351 O O   . PHE E 71  ? 0.2225 0.1451 0.2358 -0.0427 0.0389  -0.0358 521 PHE E O   
2352 C CB  . PHE E 71  ? 0.2209 0.1192 0.2337 -0.0352 0.0560  -0.0416 521 PHE E CB  
2353 C CG  . PHE E 71  ? 0.2219 0.1074 0.2415 -0.0315 0.0608  -0.0427 521 PHE E CG  
2354 C CD1 . PHE E 71  ? 0.2593 0.1447 0.2907 -0.0304 0.0604  -0.0344 521 PHE E CD1 
2355 C CD2 . PHE E 71  ? 0.2405 0.1127 0.2530 -0.0282 0.0660  -0.0519 521 PHE E CD2 
2356 C CE1 . PHE E 71  ? 0.2674 0.1376 0.3040 -0.0266 0.0630  -0.0339 521 PHE E CE1 
2357 C CE2 . PHE E 71  ? 0.2532 0.1109 0.2728 -0.0226 0.0694  -0.0532 521 PHE E CE2 
2358 C CZ  . PHE E 71  ? 0.2801 0.1357 0.3120 -0.0220 0.0669  -0.0435 521 PHE E CZ  
2359 N N   . SER E 72  ? 0.2384 0.1415 0.2252 -0.0473 0.0401  -0.0482 522 SER E N   
2360 C CA  A SER E 72  ? 0.2348 0.1442 0.2117 -0.0488 0.0324  -0.0460 522 SER E CA  
2361 C CA  B SER E 72  ? 0.2315 0.1410 0.2085 -0.0488 0.0323  -0.0459 522 SER E CA  
2362 C C   . SER E 72  ? 0.2498 0.1658 0.2274 -0.0431 0.0348  -0.0392 522 SER E C   
2363 O O   . SER E 72  ? 0.2747 0.1959 0.2511 -0.0420 0.0271  -0.0348 522 SER E O   
2364 C CB  A SER E 72  ? 0.2853 0.1836 0.2374 -0.0534 0.0306  -0.0531 522 SER E CB  
2365 C CB  B SER E 72  ? 0.2882 0.1866 0.2406 -0.0536 0.0301  -0.0531 522 SER E CB  
2366 O OG  A SER E 72  ? 0.3032 0.1925 0.2516 -0.0599 0.0250  -0.0606 522 SER E OG  
2367 O OG  B SER E 72  ? 0.3025 0.1948 0.2437 -0.0505 0.0417  -0.0563 522 SER E OG  
2368 N N   . ASN E 73  ? 0.2138 0.1290 0.1943 -0.0393 0.0440  -0.0384 523 ASN E N   
2369 C CA  . ASN E 73  ? 0.1998 0.1200 0.1812 -0.0363 0.0447  -0.0323 523 ASN E CA  
2370 C C   . ASN E 73  ? 0.1921 0.1162 0.1876 -0.0315 0.0512  -0.0301 523 ASN E C   
2371 O O   . ASN E 73  ? 0.1942 0.1154 0.1964 -0.0298 0.0565  -0.0331 523 ASN E O   
2372 C CB  . ASN E 73  ? 0.2271 0.1439 0.1912 -0.0401 0.0466  -0.0319 523 ASN E CB  
2373 C CG  . ASN E 73  ? 0.2437 0.1584 0.2022 -0.0407 0.0578  -0.0379 523 ASN E CG  
2374 O OD1 . ASN E 73  ? 0.2642 0.1839 0.2360 -0.0364 0.0657  -0.0381 523 ASN E OD1 
2375 N ND2 . ASN E 73  ? 0.2914 0.1987 0.2292 -0.0451 0.0581  -0.0432 523 ASN E ND2 
2376 N N   . ILE E 74  ? 0.1821 0.1105 0.1810 -0.0294 0.0491  -0.0247 524 ILE E N   
2377 C CA  . ILE E 74  ? 0.1735 0.1063 0.1846 -0.0252 0.0518  -0.0217 524 ILE E CA  
2378 C C   . ILE E 74  ? 0.1867 0.1229 0.2039 -0.0244 0.0597  -0.0231 524 ILE E C   
2379 O O   . ILE E 74  ? 0.1836 0.1209 0.2122 -0.0195 0.0626  -0.0229 524 ILE E O   
2380 C CB  . ILE E 74  ? 0.1764 0.1105 0.1868 -0.0238 0.0453  -0.0171 524 ILE E CB  
2381 C CG1 . ILE E 74  ? 0.1639 0.0975 0.1733 -0.0204 0.0407  -0.0170 524 ILE E CG1 
2382 C CG2 . ILE E 74  ? 0.2086 0.1473 0.2288 -0.0212 0.0460  -0.0140 524 ILE E CG2 
2383 C CD1 . ILE E 74  ? 0.1978 0.1285 0.2020 -0.0173 0.0342  -0.0152 524 ILE E CD1 
2384 N N   . PRO E 75  ? 0.2000 0.1389 0.2105 -0.0283 0.0639  -0.0240 525 PRO E N   
2385 C CA  . PRO E 75  ? 0.1874 0.1342 0.2071 -0.0259 0.0740  -0.0263 525 PRO E CA  
2386 C C   . PRO E 75  ? 0.2320 0.1720 0.2543 -0.0201 0.0799  -0.0336 525 PRO E C   
2387 O O   . PRO E 75  ? 0.2306 0.1757 0.2683 -0.0132 0.0851  -0.0343 525 PRO E O   
2388 C CB  . PRO E 75  ? 0.1998 0.1497 0.2064 -0.0328 0.0789  -0.0260 525 PRO E CB  
2389 C CG  . PRO E 75  ? 0.2266 0.1718 0.2246 -0.0386 0.0683  -0.0194 525 PRO E CG  
2390 C CD  . PRO E 75  ? 0.2151 0.1514 0.2112 -0.0348 0.0599  -0.0212 525 PRO E CD  
2391 N N   . GLN E 76  ? 0.2259 0.1533 0.2347 -0.0227 0.0776  -0.0389 526 GLN E N   
2392 C CA  . GLN E 76  ? 0.2161 0.1317 0.2262 -0.0187 0.0811  -0.0463 526 GLN E CA  
2393 C C   . GLN E 76  ? 0.2227 0.1353 0.2487 -0.0139 0.0777  -0.0415 526 GLN E C   
2394 O O   . GLN E 76  ? 0.2432 0.1491 0.2779 -0.0071 0.0819  -0.0443 526 GLN E O   
2395 C CB  . GLN E 76  ? 0.2641 0.1669 0.2572 -0.0251 0.0762  -0.0522 526 GLN E CB  
2396 C CG  . GLN E 76  ? 0.2799 0.1801 0.2511 -0.0292 0.0797  -0.0586 526 GLN E CG  
2397 C CD  . GLN E 76  ? 0.3934 0.2828 0.3486 -0.0365 0.0701  -0.0627 526 GLN E CD  
2398 O OE1 . GLN E 76  ? 0.3759 0.2672 0.3397 -0.0395 0.0606  -0.0579 526 GLN E OE1 
2399 N NE2 . GLN E 76  ? 0.4349 0.3146 0.3672 -0.0394 0.0725  -0.0717 526 GLN E NE2 
2400 N N   . LEU E 77  ? 0.2188 0.1348 0.2472 -0.0167 0.0701  -0.0344 527 LEU E N   
2401 C CA  . LEU E 77  ? 0.2236 0.1369 0.2624 -0.0133 0.0674  -0.0283 527 LEU E CA  
2402 C C   . LEU E 77  ? 0.2401 0.1606 0.2916 -0.0058 0.0689  -0.0239 527 LEU E C   
2403 O O   . LEU E 77  ? 0.2178 0.1311 0.2778 -0.0001 0.0694  -0.0219 527 LEU E O   
2404 C CB  . LEU E 77  ? 0.2312 0.1500 0.2676 -0.0169 0.0613  -0.0224 527 LEU E CB  
2405 C CG  . LEU E 77  ? 0.2400 0.1587 0.2820 -0.0143 0.0594  -0.0145 527 LEU E CG  
2406 C CD1 . LEU E 77  ? 0.2324 0.1386 0.2777 -0.0162 0.0609  -0.0136 527 LEU E CD1 
2407 C CD2 . LEU E 77  ? 0.2218 0.1488 0.2592 -0.0160 0.0559  -0.0110 527 LEU E CD2 
2408 N N   . ILE E 78  ? 0.2198 0.1537 0.2735 -0.0064 0.0682  -0.0217 528 ILE E N   
2409 C CA  . ILE E 78  ? 0.2282 0.1729 0.2970 -0.0009 0.0673  -0.0170 528 ILE E CA  
2410 C C   . ILE E 78  ? 0.2377 0.1847 0.3191 0.0066  0.0754  -0.0217 528 ILE E C   
2411 O O   . ILE E 78  ? 0.2276 0.1755 0.3236 0.0149  0.0739  -0.0185 528 ILE E O   
2412 C CB  . ILE E 78  ? 0.2054 0.1630 0.2742 -0.0060 0.0638  -0.0139 528 ILE E CB  
2413 C CG1 . ILE E 78  ? 0.2279 0.1800 0.2840 -0.0100 0.0555  -0.0106 528 ILE E CG1 
2414 C CG2 . ILE E 78  ? 0.2158 0.1878 0.3038 -0.0020 0.0616  -0.0093 528 ILE E CG2 
2415 C CD1 . ILE E 78  ? 0.2614 0.2102 0.3182 -0.0058 0.0495  -0.0055 528 ILE E CD1 
2416 N N   . ASP E 79  ? 0.2165 0.1638 0.2910 0.0047  0.0841  -0.0296 529 ASP E N   
2417 C CA  . ASP E 79  ? 0.2641 0.2139 0.3487 0.0136  0.0942  -0.0365 529 ASP E CA  
2418 C C   . ASP E 79  ? 0.2322 0.1610 0.3180 0.0215  0.0935  -0.0401 529 ASP E C   
2419 O O   . ASP E 79  ? 0.2638 0.1935 0.3660 0.0332  0.0971  -0.0416 529 ASP E O   
2420 C CB  . ASP E 79  ? 0.3067 0.2577 0.3760 0.0094  0.1043  -0.0451 529 ASP E CB  
2421 C CG  . ASP E 79  ? 0.4199 0.3825 0.5013 0.0191  0.1179  -0.0518 529 ASP E CG  
2422 O OD1 . ASP E 79  ? 0.4511 0.4370 0.5557 0.0225  0.1199  -0.0460 529 ASP E OD1 
2423 O OD2 . ASP E 79  ? 0.4746 0.4241 0.5433 0.0234  0.1263  -0.0633 529 ASP E OD2 
2424 N N   . HIS E 80  ? 0.1968 0.1532 0.4157 0.0250  0.0797  -0.0539 530 HIS E N   
2425 C CA  . HIS E 80  ? 0.1931 0.1452 0.4248 0.0282  0.0626  -0.0566 530 HIS E CA  
2426 C C   . HIS E 80  ? 0.2169 0.1681 0.4666 0.0256  0.0520  -0.0542 530 HIS E C   
2427 O O   . HIS E 80  ? 0.2232 0.1656 0.4869 0.0301  0.0367  -0.0613 530 HIS E O   
2428 C CB  . HIS E 80  ? 0.2329 0.1840 0.4503 0.0285  0.0622  -0.0492 530 HIS E CB  
2429 C CG  . HIS E 80  ? 0.2476 0.1878 0.4765 0.0277  0.0452  -0.0468 530 HIS E CG  
2430 N ND1 . HIS E 80  ? 0.3047 0.2280 0.5396 0.0311  0.0301  -0.0551 530 HIS E ND1 
2431 C CD2 . HIS E 80  ? 0.2637 0.2001 0.4942 0.0231  0.0396  -0.0353 530 HIS E CD2 
2432 C CE1 . HIS E 80  ? 0.3002 0.2045 0.5365 0.0257  0.0152  -0.0477 530 HIS E CE1 
2433 N NE2 . HIS E 80  ? 0.2970 0.2110 0.5382 0.0204  0.0212  -0.0356 530 HIS E NE2 
2434 N N   . HIS E 81  ? 0.1739 0.1313 0.4196 0.0201  0.0590  -0.0445 531 HIS E N   
2435 C CA  . HIS E 81  ? 0.1981 0.1542 0.4570 0.0199  0.0481  -0.0420 531 HIS E CA  
2436 C C   . HIS E 81  ? 0.1815 0.1411 0.4582 0.0211  0.0458  -0.0531 531 HIS E C   
2437 O O   . HIS E 81  ? 0.2096 0.1628 0.4990 0.0257  0.0299  -0.0571 531 HIS E O   
2438 C CB  . HIS E 81  ? 0.1661 0.1274 0.4132 0.0156  0.0559  -0.0288 531 HIS E CB  
2439 C CG  . HIS E 81  ? 0.2066 0.1643 0.4424 0.0161  0.0526  -0.0177 531 HIS E CG  
2440 N ND1 . HIS E 81  ? 0.2316 0.1759 0.4715 0.0174  0.0354  -0.0117 531 HIS E ND1 
2441 C CD2 . HIS E 81  ? 0.2283 0.1898 0.4465 0.0152  0.0630  -0.0109 531 HIS E CD2 
2442 C CE1 . HIS E 81  ? 0.2286 0.1719 0.4656 0.0145  0.0372  -0.0007 531 HIS E CE1 
2443 N NE2 . HIS E 81  ? 0.2283 0.1860 0.4553 0.0149  0.0552  -0.0014 531 HIS E NE2 
2444 N N   . TYR E 82  ? 0.1896 0.1559 0.4655 0.0175  0.0606  -0.0580 532 TYR E N   
2445 C CA  . TYR E 82  ? 0.1977 0.1692 0.4937 0.0177  0.0598  -0.0698 532 TYR E CA  
2446 C C   . TYR E 82  ? 0.2365 0.2043 0.5459 0.0267  0.0469  -0.0830 532 TYR E C   
2447 O O   . TYR E 82  ? 0.2393 0.2083 0.5670 0.0313  0.0355  -0.0926 532 TYR E O   
2448 C CB  . TYR E 82  ? 0.2506 0.2247 0.5403 0.0105  0.0796  -0.0705 532 TYR E CB  
2449 C CG  . TYR E 82  ? 0.2489 0.2297 0.5621 0.0089  0.0810  -0.0836 532 TYR E CG  
2450 C CD1 . TYR E 82  ? 0.2284 0.2152 0.5579 0.0067  0.0749  -0.0867 532 TYR E CD1 
2451 C CD2 . TYR E 82  ? 0.3184 0.3001 0.6374 0.0107  0.0882  -0.0941 532 TYR E CD2 
2452 C CE1 . TYR E 82  ? 0.2622 0.2571 0.6158 0.0053  0.0756  -0.1012 532 TYR E CE1 
2453 C CE2 . TYR E 82  ? 0.3347 0.3243 0.6773 0.0091  0.0903  -0.1077 532 TYR E CE2 
2454 C CZ  . TYR E 82  ? 0.3010 0.2979 0.6620 0.0059  0.0838  -0.1119 532 TYR E CZ  
2455 O OH  . TYR E 82  ? 0.3334 0.3402 0.7200 0.0043  0.0853  -0.1280 532 TYR E OH  
2456 N N   . THR E 83  ? 0.2373 0.1990 0.5359 0.0309  0.0472  -0.0845 533 THR E N   
2457 C CA  . THR E 83  ? 0.2767 0.2318 0.5840 0.0410  0.0352  -0.0973 533 THR E CA  
2458 C C   . THR E 83  ? 0.2673 0.2056 0.5762 0.0472  0.0128  -0.0966 533 THR E C   
2459 O O   . THR E 83  ? 0.2995 0.2308 0.6197 0.0552  -0.0014 -0.1067 533 THR E O   
2460 C CB  . THR E 83  ? 0.2944 0.2467 0.5872 0.0448  0.0433  -0.1002 533 THR E CB  
2461 O OG1 . THR E 83  ? 0.3652 0.3104 0.6409 0.0433  0.0419  -0.0908 533 THR E OG1 
2462 C CG2 . THR E 83  ? 0.3228 0.2841 0.6091 0.0398  0.0645  -0.0999 533 THR E CG2 
2463 N N   . THR E 84  ? 0.2848 0.2132 0.5805 0.0437  0.0090  -0.0848 534 THR E N   
2464 C CA  . THR E 84  ? 0.2746 0.1777 0.5660 0.0472  -0.0119 -0.0819 534 THR E CA  
2465 C C   . THR E 84  ? 0.3314 0.2269 0.6256 0.0464  -0.0227 -0.0752 534 THR E C   
2466 O O   . THR E 84  ? 0.3404 0.2089 0.6289 0.0498  -0.0416 -0.0738 534 THR E O   
2467 C CB  . THR E 84  ? 0.3084 0.1997 0.5837 0.0420  -0.0122 -0.0720 534 THR E CB  
2468 O OG1 . THR E 84  ? 0.2845 0.1879 0.5540 0.0344  -0.0013 -0.0589 534 THR E OG1 
2469 C CG2 . THR E 84  ? 0.3110 0.2081 0.5806 0.0446  -0.0030 -0.0794 534 THR E CG2 
2470 N N   . LYS E 85  ? 0.2537 0.1680 0.5531 0.0418  -0.0116 -0.0708 535 LYS E N   
2471 C CA  . LYS E 85  ? 0.2984 0.2070 0.5974 0.0415  -0.0201 -0.0636 535 LYS E CA  
2472 C C   . LYS E 85  ? 0.2653 0.1533 0.5453 0.0371  -0.0275 -0.0470 535 LYS E C   
2473 O O   . LYS E 85  ? 0.3332 0.2067 0.6071 0.0379  -0.0386 -0.0399 535 LYS E O   
2474 C CB  . LYS E 85  ? 0.2824 0.1811 0.5923 0.0506  -0.0370 -0.0745 535 LYS E CB  
2475 C CG  . LYS E 85  ? 0.2754 0.1959 0.6063 0.0539  -0.0301 -0.0913 535 LYS E CG  
2476 C CD  . LYS E 85  ? 0.2434 0.1887 0.5813 0.0448  -0.0104 -0.0896 535 LYS E CD  
2477 C CE  . LYS E 85  ? 0.2565 0.2190 0.6150 0.0453  -0.0033 -0.1061 535 LYS E CE  
2478 N NZ  . LYS E 85  ? 0.2206 0.1995 0.5814 0.0336  0.0179  -0.1035 535 LYS E NZ  
2479 N N   . GLN E 86  ? 0.2600 0.1451 0.5292 0.0319  -0.0217 -0.0407 536 GLN E N   
2480 C CA  . GLN E 86  ? 0.3245 0.1916 0.5759 0.0240  -0.0268 -0.0241 536 GLN E CA  
2481 C C   . GLN E 86  ? 0.3060 0.1896 0.5534 0.0212  -0.0166 -0.0129 536 GLN E C   
2482 O O   . GLN E 86  ? 0.2120 0.1229 0.4662 0.0224  0.0001  -0.0167 536 GLN E O   
2483 C CB  . GLN E 86  ? 0.3194 0.1836 0.5627 0.0184  -0.0220 -0.0223 536 GLN E CB  
2484 C CG  . GLN E 86  ? 0.4197 0.2596 0.6619 0.0198  -0.0352 -0.0315 536 GLN E CG  
2485 C CD  . GLN E 86  ? 0.4548 0.2926 0.6898 0.0141  -0.0307 -0.0324 536 GLN E CD  
2486 O OE1 . GLN E 86  ? 0.4427 0.2931 0.6841 0.0060  -0.0230 -0.0234 536 GLN E OE1 
2487 N NE2 . GLN E 86  ? 0.4795 0.3054 0.7166 0.0190  -0.0377 -0.0449 536 GLN E NE2 
2488 N N   . VAL E 87  ? 0.2625 0.1265 0.4953 0.0161  -0.0265 0.0019  537 VAL E N   
2489 C CA  . VAL E 87  ? 0.2441 0.1208 0.4709 0.0154  -0.0196 0.0128  537 VAL E CA  
2490 C C   . VAL E 87  ? 0.2581 0.1584 0.4857 0.0114  -0.0025 0.0202  537 VAL E C   
2491 O O   . VAL E 87  ? 0.2570 0.1575 0.4907 0.0056  0.0000  0.0233  537 VAL E O   
2492 C CB  . VAL E 87  ? 0.3119 0.1611 0.5223 0.0097  -0.0339 0.0289  537 VAL E CB  
2493 C CG1 . VAL E 87  ? 0.3294 0.1561 0.5416 0.0174  -0.0498 0.0206  537 VAL E CG1 
2494 C CG2 . VAL E 87  ? 0.3741 0.2063 0.5800 -0.0061 -0.0404 0.0434  537 VAL E CG2 
2495 N N   . ILE E 88  ? 0.2005 0.1209 0.4255 0.0150  0.0095  0.0230  538 ILE E N   
2496 C CA  . ILE E 88  ? 0.1980 0.1417 0.4253 0.0140  0.0285  0.0313  538 ILE E CA  
2497 C C   . ILE E 88  ? 0.2193 0.1606 0.4482 0.0059  0.0246  0.0549  538 ILE E C   
2498 O O   . ILE E 88  ? 0.2233 0.1763 0.4578 0.0024  0.0343  0.0624  538 ILE E O   
2499 C CB  . ILE E 88  ? 0.1883 0.1465 0.4028 0.0180  0.0403  0.0298  538 ILE E CB  
2500 C CG1 . ILE E 88  ? 0.2154 0.1770 0.4377 0.0180  0.0451  0.0124  538 ILE E CG1 
2501 C CG2 . ILE E 88  ? 0.1734 0.1496 0.3793 0.0180  0.0614  0.0412  538 ILE E CG2 
2502 C CD1 . ILE E 88  ? 0.1920 0.1580 0.4160 0.0148  0.0560  0.0038  538 ILE E CD1 
2503 N N   . THR E 89  ? 0.2212 0.1490 0.4390 0.0007  0.0106  0.0687  539 THR E N   
2504 C CA  . THR E 89  ? 0.2567 0.1817 0.4634 -0.0155 0.0031  0.0930  539 THR E CA  
2505 C C   . THR E 89  ? 0.3177 0.2072 0.5124 -0.0225 -0.0174 0.0960  539 THR E C   
2506 O O   . THR E 89  ? 0.3094 0.1827 0.5029 -0.0110 -0.0243 0.0830  539 THR E O   
2507 C CB  . THR E 89  ? 0.2597 0.2134 0.4532 -0.0143 0.0130  0.1123  539 THR E CB  
2508 O OG1 . THR E 89  ? 0.2805 0.2249 0.4665 -0.0046 0.0080  0.1101  539 THR E OG1 
2509 C CG2 . THR E 89  ? 0.2401 0.2268 0.4365 -0.0020 0.0356  0.1095  539 THR E CG2 
2510 N N   . LYS E 90  ? 0.3483 0.2274 0.5313 -0.0423 -0.0254 0.1131  540 LYS E N   
2511 C CA  . LYS E 90  ? 0.4354 0.2761 0.6029 -0.0492 -0.0421 0.1184  540 LYS E CA  
2512 C C   . LYS E 90  ? 0.4276 0.2656 0.5815 -0.0405 -0.0445 0.1277  540 LYS E C   
2513 O O   . LYS E 90  ? 0.4389 0.2477 0.5863 -0.0305 -0.0554 0.1201  540 LYS E O   
2514 C CB  . LYS E 90  ? 0.5715 0.4051 0.7280 -0.0754 -0.0467 0.1354  540 LYS E CB  
2515 C CG  . LYS E 90  ? 0.6284 0.4707 0.7973 -0.0867 -0.0436 0.1277  540 LYS E CG  
2516 C CD  . LYS E 90  ? 0.6439 0.4597 0.8232 -0.0734 -0.0507 0.1032  540 LYS E CD  
2517 C CE  . LYS E 90  ? 0.6285 0.4568 0.8211 -0.0812 -0.0462 0.0941  540 LYS E CE  
2518 N NZ  . LYS E 90  ? 0.5372 0.4130 0.7403 -0.0812 -0.0285 0.1006  540 LYS E NZ  
2519 N N   . LYS E 91  ? 0.3796 0.2848 0.4866 -0.0056 0.0550  0.1277  541 LYS E N   
2520 C CA  . LYS E 91  ? 0.4220 0.3172 0.5062 -0.0046 0.0557  0.1320  541 LYS E CA  
2521 C C   . LYS E 91  ? 0.4062 0.2953 0.4865 0.0047  0.0473  0.1258  541 LYS E C   
2522 O O   . LYS E 91  ? 0.4444 0.3175 0.5083 0.0044  0.0385  0.1304  541 LYS E O   
2523 C CB  . LYS E 91  ? 0.4691 0.3788 0.5477 -0.0070 0.0712  0.1333  541 LYS E CB  
2524 C CG  . LYS E 91  ? 0.5469 0.4479 0.6001 -0.0055 0.0743  0.1325  541 LYS E CG  
2525 C CD  . LYS E 91  ? 0.5996 0.5070 0.6405 -0.0120 0.0916  0.1358  541 LYS E CD  
2526 C CE  . LYS E 91  ? 0.5970 0.5270 0.6598 -0.0062 0.1064  0.1298  541 LYS E CE  
2527 N NZ  . LYS E 91  ? 0.6334 0.5667 0.6829 -0.0095 0.1254  0.1292  541 LYS E NZ  
2528 N N   . SER E 92  ? 0.3384 0.2408 0.4341 0.0118  0.0487  0.1165  542 SER E N   
2529 C CA  . SER E 92  ? 0.3572 0.2561 0.4503 0.0194  0.0417  0.1105  542 SER E CA  
2530 C C   . SER E 92  ? 0.3406 0.2291 0.4444 0.0231  0.0285  0.1089  542 SER E C   
2531 O O   . SER E 92  ? 0.3886 0.2689 0.4866 0.0270  0.0191  0.1093  542 SER E O   
2532 C CB  . SER E 92  ? 0.3302 0.2460 0.4360 0.0248  0.0482  0.1021  542 SER E CB  
2533 O OG  . SER E 92  ? 0.2718 0.1961 0.3983 0.0259  0.0455  0.0974  542 SER E OG  
2534 N N   . GLY E 93  ? 0.3225 0.2113 0.4427 0.0214  0.0280  0.1067  543 GLY E N   
2535 C CA  . GLY E 93  ? 0.3465 0.2261 0.4814 0.0260  0.0191  0.1025  543 GLY E CA  
2536 C C   . GLY E 93  ? 0.3186 0.2074 0.4651 0.0337  0.0167  0.0928  543 GLY E C   
2537 O O   . GLY E 93  ? 0.3373 0.2190 0.4958 0.0392  0.0089  0.0904  543 GLY E O   
2538 N N   . VAL E 94  ? 0.2574 0.1622 0.4031 0.0344  0.0235  0.0879  544 VAL E N   
2539 C CA  . VAL E 94  ? 0.2800 0.1932 0.4340 0.0403  0.0214  0.0800  544 VAL E CA  
2540 C C   . VAL E 94  ? 0.2381 0.1571 0.4110 0.0405  0.0227  0.0709  544 VAL E C   
2541 O O   . VAL E 94  ? 0.2326 0.1574 0.4089 0.0344  0.0285  0.0691  544 VAL E O   
2542 C CB  . VAL E 94  ? 0.2551 0.1801 0.4015 0.0405  0.0286  0.0790  544 VAL E CB  
2543 C CG1 . VAL E 94  ? 0.2647 0.1992 0.4213 0.0446  0.0276  0.0708  544 VAL E CG1 
2544 C CG2 . VAL E 94  ? 0.3268 0.2433 0.4521 0.0401  0.0284  0.0845  544 VAL E CG2 
2545 N N   . VAL E 95  ? 0.2504 0.1687 0.4353 0.0461  0.0176  0.0650  545 VAL E N   
2546 C CA  . VAL E 95  ? 0.2096 0.1334 0.4113 0.0458  0.0208  0.0541  545 VAL E CA  
2547 C C   . VAL E 95  ? 0.2181 0.1560 0.4243 0.0483  0.0212  0.0476  545 VAL E C   
2548 O O   . VAL E 95  ? 0.2487 0.1880 0.4502 0.0519  0.0147  0.0488  545 VAL E O   
2549 C CB  . VAL E 95  ? 0.2559 0.1700 0.4670 0.0480  0.0162  0.0503  545 VAL E CB  
2550 C CG1 . VAL E 95  ? 0.2179 0.1376 0.4465 0.0478  0.0224  0.0371  545 VAL E CG1 
2551 C CG2 . VAL E 95  ? 0.2832 0.1816 0.4898 0.0442  0.0161  0.0566  545 VAL E CG2 
2552 N N   . LEU E 96  ? 0.2201 0.1687 0.4320 0.0440  0.0280  0.0406  546 LEU E N   
2553 C CA  . LEU E 96  ? 0.1962 0.1577 0.4126 0.0446  0.0293  0.0352  546 LEU E CA  
2554 C C   . LEU E 96  ? 0.2027 0.1654 0.4365 0.0476  0.0291  0.0256  546 LEU E C   
2555 O O   . LEU E 96  ? 0.2405 0.1996 0.4839 0.0453  0.0344  0.0182  546 LEU E O   
2556 C CB  . LEU E 96  ? 0.1759 0.1496 0.3879 0.0360  0.0357  0.0335  546 LEU E CB  
2557 C CG  . LEU E 96  ? 0.1913 0.1682 0.3926 0.0327  0.0370  0.0432  546 LEU E CG  
2558 C CD1 . LEU E 96  ? 0.1637 0.1555 0.3650 0.0245  0.0404  0.0437  546 LEU E CD1 
2559 C CD2 . LEU E 96  ? 0.1840 0.1579 0.3781 0.0392  0.0349  0.0497  546 LEU E CD2 
2560 N N   . LEU E 97  ? 0.2068 0.1757 0.4409 0.0505  0.0237  0.0247  547 LEU E N   
2561 C CA  . LEU E 97  ? 0.2095 0.1833 0.4594 0.0523  0.0229  0.0169  547 LEU E CA  
2562 C C   . LEU E 97  ? 0.2176 0.2051 0.4739 0.0506  0.0256  0.0116  547 LEU E C   
2563 O O   . LEU E 97  ? 0.2289 0.2235 0.4999 0.0486  0.0328  0.0019  547 LEU E O   
2564 C CB  . LEU E 97  ? 0.2052 0.1735 0.4566 0.0574  0.0119  0.0224  547 LEU E CB  
2565 C CG  . LEU E 97  ? 0.2104 0.1646 0.4593 0.0594  0.0080  0.0280  547 LEU E CG  
2566 C CD1 . LEU E 97  ? 0.2495 0.2007 0.5033 0.0642  -0.0042 0.0349  547 LEU E CD1 
2567 C CD2 . LEU E 97  ? 0.2473 0.1971 0.5095 0.0582  0.0165  0.0197  547 LEU E CD2 
2568 N N   . ASN E 98  ? 0.2001 0.1906 0.4464 0.0507  0.0212  0.0169  548 ASN E N   
2569 C CA  . ASN E 98  ? 0.2086 0.2104 0.4619 0.0492  0.0218  0.0132  548 ASN E CA  
2570 C C   . ASN E 98  ? 0.1912 0.1958 0.4347 0.0461  0.0257  0.0169  548 ASN E C   
2571 O O   . ASN E 98  ? 0.1883 0.1861 0.4185 0.0478  0.0217  0.0234  548 ASN E O   
2572 C CB  . ASN E 98  ? 0.2073 0.2088 0.4630 0.0527  0.0114  0.0165  548 ASN E CB  
2573 C CG  . ASN E 98  ? 0.2389 0.2354 0.5026 0.0569  0.0045  0.0184  548 ASN E CG  
2574 O OD1 . ASN E 98  ? 0.2625 0.2619 0.5412 0.0574  0.0086  0.0124  548 ASN E OD1 
2575 N ND2 . ASN E 98  ? 0.2227 0.2106 0.4773 0.0597  -0.0058 0.0271  548 ASN E ND2 
2576 N N   . PRO E 99  ? 0.1717 0.1857 0.4161 0.0391  0.0331  0.0128  549 PRO E N   
2577 C CA  . PRO E 99  ? 0.1902 0.2074 0.4223 0.0340  0.0345  0.0183  549 PRO E CA  
2578 C C   . PRO E 99  ? 0.1708 0.1902 0.4045 0.0344  0.0311  0.0183  549 PRO E C   
2579 O O   . PRO E 99  ? 0.2200 0.2482 0.4653 0.0319  0.0320  0.0121  549 PRO E O   
2580 C CB  . PRO E 99  ? 0.1780 0.2052 0.4098 0.0241  0.0414  0.0144  549 PRO E CB  
2581 C CG  . PRO E 99  ? 0.2154 0.2464 0.4614 0.0239  0.0457  0.0031  549 PRO E CG  
2582 C CD  . PRO E 99  ? 0.2089 0.2295 0.4632 0.0341  0.0409  0.0034  549 PRO E CD  
2583 N N   . ILE E 100 ? 0.1510 0.1621 0.3736 0.0368  0.0283  0.0245  550 ILE E N   
2584 C CA  . ILE E 100 ? 0.1795 0.1890 0.4007 0.0359  0.0253  0.0242  550 ILE E CA  
2585 C C   . ILE E 100 ? 0.1508 0.1672 0.3723 0.0288  0.0295  0.0260  550 ILE E C   
2586 O O   . ILE E 100 ? 0.1595 0.1746 0.3754 0.0276  0.0325  0.0326  550 ILE E O   
2587 C CB  . ILE E 100 ? 0.2229 0.2175 0.4298 0.0401  0.0227  0.0283  550 ILE E CB  
2588 C CG1 . ILE E 100 ? 0.2871 0.2749 0.4906 0.0447  0.0169  0.0282  550 ILE E CG1 
2589 C CG2 . ILE E 100 ? 0.2522 0.2422 0.4553 0.0371  0.0206  0.0268  550 ILE E CG2 
2590 C CD1 . ILE E 100 ? 0.2961 0.2908 0.5137 0.0449  0.0095  0.0242  550 ILE E CD1 
2591 N N   . PRO E 101 ? 0.1585 0.1834 0.3880 0.0234  0.0293  0.0216  551 PRO E N   
2592 C CA  . PRO E 101 ? 0.1927 0.2241 0.4209 0.0146  0.0329  0.0246  551 PRO E CA  
2593 C C   . PRO E 101 ? 0.2124 0.2325 0.4329 0.0153  0.0314  0.0319  551 PRO E C   
2594 O O   . PRO E 101 ? 0.2000 0.2084 0.4164 0.0197  0.0284  0.0306  551 PRO E O   
2595 C CB  . PRO E 101 ? 0.2308 0.2737 0.4703 0.0089  0.0337  0.0172  551 PRO E CB  
2596 C CG  . PRO E 101 ? 0.2595 0.2986 0.5060 0.0157  0.0275  0.0132  551 PRO E CG  
2597 C CD  . PRO E 101 ? 0.2082 0.2384 0.4498 0.0243  0.0255  0.0149  551 PRO E CD  
2598 N N   . LYS E 102 ? 0.1952 0.2180 0.4138 0.0099  0.0336  0.0397  552 LYS E N   
2599 C CA  . LYS E 102 ? 0.2644 0.2758 0.4804 0.0113  0.0332  0.0480  552 LYS E CA  
2600 C C   . LYS E 102 ? 0.3082 0.3155 0.5250 0.0058  0.0316  0.0457  552 LYS E C   
2601 O O   . LYS E 102 ? 0.3213 0.3394 0.5419 -0.0011 0.0312  0.0398  552 LYS E O   
2602 C CB  . LYS E 102 ? 0.2998 0.3176 0.5174 0.0067  0.0338  0.0598  552 LYS E CB  
2603 C CG  . LYS E 102 ? 0.3311 0.3623 0.5478 -0.0069 0.0333  0.0615  552 LYS E CG  
2604 C CD  . LYS E 102 ? 0.3494 0.3864 0.5659 -0.0132 0.0310  0.0761  552 LYS E CD  
2605 C CE  . LYS E 102 ? 0.3467 0.3911 0.5623 -0.0116 0.0310  0.0780  552 LYS E CE  
2606 N NZ  . LYS E 102 ? 0.3942 0.4459 0.6119 -0.0174 0.0265  0.0944  552 LYS E NZ  
2607 O OXT . LYS E 102 ? 0.3676 0.3602 0.5822 0.0077  0.0316  0.0494  552 LYS E OXT 
2665 N N   . SER G 2   ? 0.6779 0.6484 0.4727 -0.0129 -0.0268 0.0726  452 SER G N   
2666 C CA  . SER G 2   ? 0.6510 0.5877 0.4342 -0.0117 -0.0054 0.0882  452 SER G CA  
2667 C C   . SER G 2   ? 0.5715 0.4968 0.3686 -0.0255 0.0197  0.0700  452 SER G C   
2668 O O   . SER G 2   ? 0.5575 0.4613 0.3621 -0.0287 0.0383  0.0791  452 SER G O   
2669 C CB  . SER G 2   ? 0.7230 0.6520 0.4492 -0.0091 -0.0056 0.1114  452 SER G CB  
2670 O OG  . SER G 2   ? 0.7783 0.7280 0.4626 -0.0190 -0.0120 0.0960  452 SER G OG  
2671 N N   . LYS G 3   ? 0.4633 0.4037 0.2680 -0.0337 0.0205  0.0453  453 LYS G N   
2672 C CA  . LYS G 3   ? 0.4075 0.3426 0.2392 -0.0405 0.0419  0.0300  453 LYS G CA  
2673 C C   . LYS G 3   ? 0.2883 0.2263 0.1707 -0.0347 0.0383  0.0301  453 LYS G C   
2674 O O   . LYS G 3   ? 0.3021 0.2523 0.2017 -0.0276 0.0211  0.0295  453 LYS G O   
2675 C CB  . LYS G 3   ? 0.4665 0.4092 0.2941 -0.0474 0.0448  0.0049  453 LYS G CB  
2676 C CG  . LYS G 3   ? 0.5814 0.5219 0.3507 -0.0540 0.0459  -0.0029 453 LYS G CG  
2677 C CD  . LYS G 3   ? 0.6309 0.5649 0.3953 -0.0613 0.0596  -0.0326 453 LYS G CD  
2678 C CE  . LYS G 3   ? 0.6189 0.5588 0.4185 -0.0650 0.0440  -0.0482 453 LYS G CE  
2679 N NZ  . LYS G 3   ? 0.6787 0.6021 0.4660 -0.0736 0.0555  -0.0788 453 LYS G NZ  
2680 N N   . PRO G 4   ? 0.2758 0.2071 0.1822 -0.0380 0.0538  0.0305  454 PRO G N   
2681 C CA  . PRO G 4   ? 0.2527 0.1890 0.1990 -0.0332 0.0477  0.0276  454 PRO G CA  
2682 C C   . PRO G 4   ? 0.2093 0.1655 0.1817 -0.0305 0.0460  0.0136  454 PRO G C   
2683 O O   . PRO G 4   ? 0.2155 0.1760 0.1891 -0.0342 0.0579  0.0047  454 PRO G O   
2684 C CB  . PRO G 4   ? 0.3332 0.2616 0.2964 -0.0425 0.0632  0.0307  454 PRO G CB  
2685 C CG  . PRO G 4   ? 0.3914 0.3056 0.3211 -0.0500 0.0785  0.0429  454 PRO G CG  
2686 C CD  . PRO G 4   ? 0.3760 0.2986 0.2736 -0.0471 0.0768  0.0355  454 PRO G CD  
2687 N N   . LEU G 5   ? 0.1817 0.1476 0.1740 -0.0219 0.0337  0.0132  455 LEU G N   
2688 C CA  . LEU G 5   ? 0.1667 0.1501 0.1829 -0.0179 0.0332  0.0064  455 LEU G CA  
2689 C C   . LEU G 5   ? 0.1430 0.1345 0.1818 -0.0195 0.0456  0.0021  455 LEU G C   
2690 O O   . LEU G 5   ? 0.1378 0.1349 0.1890 -0.0172 0.0528  -0.0017 455 LEU G O   
2691 C CB  . LEU G 5   ? 0.1633 0.1583 0.1930 -0.0072 0.0218  0.0095  455 LEU G CB  
2692 C CG  . LEU G 5   ? 0.1582 0.1612 0.1828 -0.0026 0.0111  0.0143  455 LEU G CG  
2693 C CD1 . LEU G 5   ? 0.1783 0.1908 0.2125 0.0114  0.0049  0.0182  455 LEU G CD1 
2694 C CD2 . LEU G 5   ? 0.1377 0.1517 0.1741 -0.0083 0.0129  0.0108  455 LEU G CD2 
2695 N N   . ALA G 6   ? 0.1450 0.1377 0.1937 -0.0235 0.0483  0.0031  456 ALA G N   
2696 C CA  . ALA G 6   ? 0.1608 0.1738 0.2399 -0.0244 0.0566  0.0005  456 ALA G CA  
2697 C C   . ALA G 6   ? 0.1778 0.1910 0.2588 -0.0268 0.0763  -0.0014 456 ALA G C   
2698 O O   . ALA G 6   ? 0.2484 0.2825 0.3599 -0.0213 0.0848  -0.0021 456 ALA G O   
2699 C CB  . ALA G 6   ? 0.1846 0.2016 0.2781 -0.0339 0.0536  -0.0005 456 ALA G CB  
2700 N N   . GLU G 7   ? 0.1787 0.1712 0.2262 -0.0325 0.0842  -0.0022 457 GLU G N   
2701 C CA  . GLU G 7   ? 0.2149 0.2043 0.2546 -0.0334 0.1059  -0.0081 457 GLU G CA  
2702 C C   . GLU G 7   ? 0.2021 0.1814 0.2350 -0.0267 0.1078  -0.0190 457 GLU G C   
2703 O O   . GLU G 7   ? 0.2616 0.2333 0.2883 -0.0247 0.1278  -0.0288 457 GLU G O   
2704 C CB  . GLU G 7   ? 0.2555 0.2282 0.2539 -0.0428 0.1153  -0.0043 457 GLU G CB  
2705 C CG  . GLU G 7   ? 0.2838 0.2612 0.2950 -0.0525 0.1239  0.0079  457 GLU G CG  
2706 C CD  . GLU G 7   ? 0.3684 0.3281 0.3361 -0.0604 0.1379  0.0179  457 GLU G CD  
2707 O OE1 . GLU G 7   ? 0.3829 0.3297 0.3043 -0.0574 0.1360  0.0138  457 GLU G OE1 
2708 O OE2 . GLU G 7   ? 0.3820 0.3426 0.3615 -0.0699 0.1482  0.0302  457 GLU G OE2 
2709 N N   . GLN G 8   ? 0.1566 0.1632 0.1382 -0.0239 0.0376  0.0249  458 GLN G N   
2710 C CA  . GLN G 8   ? 0.1419 0.1478 0.1215 -0.0168 0.0393  0.0215  458 GLN G CA  
2711 C C   . GLN G 8   ? 0.1547 0.1729 0.1471 -0.0121 0.0410  0.0197  458 GLN G C   
2712 O O   . GLN G 8   ? 0.1519 0.1743 0.1527 -0.0124 0.0367  0.0195  458 GLN G O   
2713 C CB  . GLN G 8   ? 0.1570 0.1518 0.1306 -0.0144 0.0324  0.0199  458 GLN G CB  
2714 C CG  . GLN G 8   ? 0.2065 0.1890 0.1689 -0.0180 0.0286  0.0225  458 GLN G CG  
2715 C CD  . GLN G 8   ? 0.2711 0.2500 0.2225 -0.0219 0.0335  0.0248  458 GLN G CD  
2716 O OE1 . GLN G 8   ? 0.3096 0.2877 0.2548 -0.0197 0.0371  0.0231  458 GLN G OE1 
2717 N NE2 . GLN G 8   ? 0.2887 0.2639 0.2358 -0.0282 0.0337  0.0286  458 GLN G NE2 
2718 N N   . ASP G 9   ? 0.1647 0.1865 0.1567 -0.0072 0.0471  0.0183  459 ASP G N   
2719 C CA  . ASP G 9   ? 0.1635 0.1959 0.1671 -0.0015 0.0489  0.0172  459 ASP G CA  
2720 C C   . ASP G 9   ? 0.1371 0.1657 0.1431 0.0010  0.0421  0.0152  459 ASP G C   
2721 O O   . ASP G 9   ? 0.1329 0.1706 0.1497 0.0029  0.0405  0.0157  459 ASP G O   
2722 C CB  . ASP G 9   ? 0.2139 0.2448 0.2124 0.0050  0.0562  0.0153  459 ASP G CB  
2723 C CG  . ASP G 9   ? 0.3245 0.3622 0.3213 0.0039  0.0650  0.0173  459 ASP G CG  
2724 O OD1 . ASP G 9   ? 0.3659 0.3955 0.3505 0.0079  0.0710  0.0150  459 ASP G OD1 
2725 O OD2 . ASP G 9   ? 0.3491 0.3996 0.3556 -0.0013 0.0660  0.0212  459 ASP G OD2 
2726 N N   . TRP G 10  ? 0.1261 0.1427 0.1224 0.0008  0.0381  0.0137  460 TRP G N   
2727 C CA  . TRP G 10  ? 0.1135 0.1279 0.1114 0.0030  0.0329  0.0123  460 TRP G CA  
2728 C C   . TRP G 10  ? 0.0983 0.1144 0.1006 0.0008  0.0276  0.0128  460 TRP G C   
2729 O O   . TRP G 10  ? 0.0924 0.1082 0.0960 0.0027  0.0241  0.0118  460 TRP G O   
2730 C CB  . TRP G 10  ? 0.1222 0.1259 0.1091 0.0032  0.0309  0.0111  460 TRP G CB  
2731 C CG  . TRP G 10  ? 0.1221 0.1184 0.0993 -0.0004 0.0301  0.0122  460 TRP G CG  
2732 C CD1 . TRP G 10  ? 0.1465 0.1357 0.1123 -0.0016 0.0336  0.0121  460 TRP G CD1 
2733 C CD2 . TRP G 10  ? 0.1186 0.1124 0.0950 -0.0027 0.0252  0.0139  460 TRP G CD2 
2734 N NE1 . TRP G 10  ? 0.1653 0.1485 0.1236 -0.0055 0.0307  0.0141  460 TRP G NE1 
2735 C CE2 . TRP G 10  ? 0.1329 0.1186 0.0981 -0.0057 0.0254  0.0154  460 TRP G CE2 
2736 C CE3 . TRP G 10  ? 0.1297 0.1260 0.1123 -0.0019 0.0210  0.0142  460 TRP G CE3 
2737 C CZ2 . TRP G 10  ? 0.1566 0.1368 0.1178 -0.0075 0.0208  0.0178  460 TRP G CZ2 
2738 C CZ3 . TRP G 10  ? 0.1277 0.1178 0.1060 -0.0028 0.0173  0.0158  460 TRP G CZ3 
2739 C CH2 . TRP G 10  ? 0.1420 0.1242 0.1103 -0.0054 0.0169  0.0180  460 TRP G CH2 
2740 N N   . TYR G 11  ? 0.1035 0.1200 0.1065 -0.0033 0.0271  0.0142  461 TYR G N   
2741 C CA  . TYR G 11  ? 0.0993 0.1131 0.1030 -0.0049 0.0222  0.0139  461 TYR G CA  
2742 C C   . TYR G 11  ? 0.0975 0.1205 0.1100 -0.0064 0.0214  0.0141  461 TYR G C   
2743 O O   . TYR G 11  ? 0.1246 0.1552 0.1425 -0.0099 0.0236  0.0163  461 TYR G O   
2744 C CB  . TYR G 11  ? 0.1229 0.1278 0.1196 -0.0094 0.0209  0.0155  461 TYR G CB  
2745 C CG  . TYR G 11  ? 0.1292 0.1276 0.1241 -0.0107 0.0161  0.0147  461 TYR G CG  
2746 C CD1 . TYR G 11  ? 0.1480 0.1410 0.1400 -0.0056 0.0130  0.0125  461 TYR G CD1 
2747 C CD2 . TYR G 11  ? 0.1593 0.1567 0.1545 -0.0172 0.0148  0.0160  461 TYR G CD2 
2748 C CE1 . TYR G 11  ? 0.1929 0.1775 0.1807 -0.0054 0.0096  0.0110  461 TYR G CE1 
2749 C CE2 . TYR G 11  ? 0.1978 0.1850 0.1877 -0.0187 0.0101  0.0146  461 TYR G CE2 
2750 C CZ  . TYR G 11  ? 0.1994 0.1792 0.1847 -0.0120 0.0079  0.0116  461 TYR G CZ  
2751 O OH  . TYR G 11  ? 0.2629 0.2303 0.2405 -0.0123 0.0040  0.0094  461 TYR G OH  
2752 N N   . HIS G 12  ? 0.0913 0.1146 0.1051 -0.0041 0.0180  0.0124  462 HIS G N   
2753 C CA  . HIS G 12  ? 0.0888 0.1202 0.1092 -0.0055 0.0160  0.0128  462 HIS G CA  
2754 C C   . HIS G 12  ? 0.1153 0.1400 0.1307 -0.0089 0.0112  0.0114  462 HIS G C   
2755 O O   . HIS G 12  ? 0.1286 0.1582 0.1468 -0.0106 0.0083  0.0114  462 HIS G O   
2756 C CB  . HIS G 12  ? 0.0860 0.1226 0.1100 -0.0006 0.0159  0.0123  462 HIS G CB  
2757 C CG  . HIS G 12  ? 0.0970 0.1387 0.1254 0.0028  0.0201  0.0135  462 HIS G CG  
2758 N ND1 . HIS G 12  ? 0.1150 0.1661 0.1515 0.0053  0.0205  0.0152  462 HIS G ND1 
2759 C CD2 . HIS G 12  ? 0.0821 0.1189 0.1060 0.0048  0.0239  0.0131  462 HIS G CD2 
2760 C CE1 . HIS G 12  ? 0.1188 0.1696 0.1556 0.0096  0.0250  0.0155  462 HIS G CE1 
2761 N NE2 . HIS G 12  ? 0.1153 0.1569 0.1436 0.0089  0.0272  0.0140  462 HIS G NE2 
2762 N N   . GLY G 13  ? 0.1122 0.1244 0.1188 -0.0098 0.0100  0.0103  463 GLY G N   
2763 C CA  . GLY G 13  ? 0.1297 0.1315 0.1286 -0.0126 0.0057  0.0084  463 GLY G CA  
2764 C C   . GLY G 13  ? 0.1189 0.1201 0.1149 -0.0077 0.0043  0.0053  463 GLY G C   
2765 O O   . GLY G 13  ? 0.1386 0.1430 0.1359 -0.0016 0.0064  0.0046  463 GLY G O   
2766 N N   . ALA G 14  ? 0.1515 0.1491 0.1429 -0.0114 0.0005  0.0038  464 ALA G N   
2767 C CA  . ALA G 14  ? 0.1492 0.1433 0.1338 -0.0071 -0.0004 0.0004  464 ALA G CA  
2768 C C   . ALA G 14  ? 0.1476 0.1552 0.1390 -0.0069 -0.0008 0.0016  464 ALA G C   
2769 O O   . ALA G 14  ? 0.1794 0.1844 0.1638 -0.0072 -0.0032 -0.0004 464 ALA G O   
2770 C CB  . ALA G 14  ? 0.2083 0.1859 0.1788 -0.0106 -0.0045 -0.0029 464 ALA G CB  
2771 N N   . ILE G 15  ? 0.1209 0.1410 0.1237 -0.0057 0.0016  0.0049  465 ILE G N   
2772 C CA  . ILE G 15  ? 0.1205 0.1506 0.1281 -0.0044 0.0008  0.0064  465 ILE G CA  
2773 C C   . ILE G 15  ? 0.1290 0.1564 0.1301 0.0005  0.0022  0.0043  465 ILE G C   
2774 O O   . ILE G 15  ? 0.1491 0.1732 0.1484 0.0045  0.0053  0.0032  465 ILE G O   
2775 C CB  . ILE G 15  ? 0.1272 0.1677 0.1461 -0.0025 0.0034  0.0099  465 ILE G CB  
2776 C CG1 . ILE G 15  ? 0.1308 0.1680 0.1491 0.0018  0.0076  0.0094  465 ILE G CG1 
2777 C CG2 . ILE G 15  ? 0.1183 0.1657 0.1454 -0.0067 0.0030  0.0126  465 ILE G CG2 
2778 C CD1 . ILE G 15  ? 0.1329 0.1759 0.1575 0.0047  0.0100  0.0117  465 ILE G CD1 
2779 N N   . PRO G 16  ? 0.1239 0.1537 0.1213 0.0001  0.0001  0.0043  466 PRO G N   
2780 C CA  . PRO G 16  ? 0.1363 0.1658 0.1276 0.0041  0.0024  0.0030  466 PRO G CA  
2781 C C   . PRO G 16  ? 0.1300 0.1671 0.1285 0.0066  0.0049  0.0063  466 PRO G C   
2782 O O   . PRO G 16  ? 0.1226 0.1639 0.1291 0.0059  0.0044  0.0091  466 PRO G O   
2783 C CB  . PRO G 16  ? 0.1528 0.1824 0.1368 0.0013  -0.0013 0.0029  466 PRO G CB  
2784 C CG  . PRO G 16  ? 0.1490 0.1851 0.1418 -0.0030 -0.0057 0.0064  466 PRO G CG  
2785 C CD  . PRO G 16  ? 0.1398 0.1738 0.1381 -0.0048 -0.0050 0.0061  466 PRO G CD  
2786 N N   . ARG G 17  ? 0.1198 0.1584 0.1146 0.0094  0.0078  0.0059  467 ARG G N   
2787 C CA  . ARG G 17  ? 0.1099 0.1544 0.1095 0.0100  0.0094  0.0093  467 ARG G CA  
2788 C C   . ARG G 17  ? 0.1133 0.1601 0.1152 0.0079  0.0067  0.0128  467 ARG G C   
2789 O O   . ARG G 17  ? 0.1103 0.1570 0.1169 0.0080  0.0069  0.0153  467 ARG G O   
2790 C CB  . ARG G 17  ? 0.1356 0.1846 0.1310 0.0119  0.0124  0.0093  467 ARG G CB  
2791 C CG  . ARG G 17  ? 0.1343 0.1894 0.1335 0.0102  0.0133  0.0137  467 ARG G CG  
2792 C CD  . ARG G 17  ? 0.1331 0.1966 0.1299 0.0114  0.0169  0.0146  467 ARG G CD  
2793 N NE  . ARG G 17  ? 0.1309 0.1977 0.1312 0.0156  0.0196  0.0130  467 ARG G NE  
2794 C CZ  . ARG G 17  ? 0.1240 0.2014 0.1298 0.0159  0.0217  0.0161  467 ARG G CZ  
2795 N NH1 . ARG G 17  ? 0.1490 0.2337 0.1564 0.0109  0.0216  0.0209  467 ARG G NH1 
2796 N NH2 . ARG G 17  ? 0.1149 0.1957 0.1248 0.0207  0.0234  0.0150  467 ARG G NH2 
2797 N N   . ILE G 18  ? 0.0975 0.1447 0.0947 0.0063  0.0038  0.0131  468 ILE G N   
2798 C CA  . ILE G 18  ? 0.1126 0.1621 0.1120 0.0052  0.0005  0.0173  468 ILE G CA  
2799 C C   . ILE G 18  ? 0.1137 0.1644 0.1229 0.0063  -0.0009 0.0189  468 ILE G C   
2800 O O   . ILE G 18  ? 0.1431 0.1940 0.1559 0.0080  -0.0018 0.0224  468 ILE G O   
2801 C CB  . ILE G 18  ? 0.1115 0.1615 0.1028 0.0028  -0.0033 0.0177  468 ILE G CB  
2802 C CG1 . ILE G 18  ? 0.1526 0.2045 0.1450 0.0023  -0.0070 0.0233  468 ILE G CG1 
2803 C CG2 . ILE G 18  ? 0.1360 0.1849 0.1271 0.0005  -0.0069 0.0154  468 ILE G CG2 
2804 C CD1 . ILE G 18  ? 0.1660 0.2167 0.1554 0.0024  -0.0046 0.0263  468 ILE G CD1 
2805 N N   . GLU G 19  ? 0.0894 0.1404 0.1024 0.0056  -0.0006 0.0165  469 GLU G N   
2806 C CA  . GLU G 19  ? 0.1146 0.1692 0.1375 0.0069  -0.0003 0.0183  469 GLU G CA  
2807 C C   . GLU G 19  ? 0.1305 0.1812 0.1552 0.0097  0.0042  0.0178  469 GLU G C   
2808 O O   . GLU G 19  ? 0.1277 0.1792 0.1576 0.0128  0.0054  0.0198  469 GLU G O   
2809 C CB  . GLU G 19  ? 0.1156 0.1726 0.1413 0.0034  -0.0017 0.0168  469 GLU G CB  
2810 C CG  . GLU G 19  ? 0.1368 0.1982 0.1616 -0.0006 -0.0076 0.0183  469 GLU G CG  
2811 C CD  . GLU G 19  ? 0.1690 0.2324 0.1963 -0.0061 -0.0101 0.0177  469 GLU G CD  
2812 O OE1 . GLU G 19  ? 0.1630 0.2267 0.1857 -0.0113 -0.0159 0.0180  469 GLU G OE1 
2813 O OE2 . GLU G 19  ? 0.1548 0.2186 0.1872 -0.0062 -0.0067 0.0174  469 GLU G OE2 
2814 N N   . ALA G 20  ? 0.2006 0.1922 0.1142 -0.0287 0.0073  -0.0338 470 ALA G N   
2815 C CA  . ALA G 20  ? 0.1753 0.1722 0.1123 -0.0199 0.0106  -0.0281 470 ALA G CA  
2816 C C   . ALA G 20  ? 0.1843 0.1744 0.1090 -0.0201 0.0054  -0.0180 470 ALA G C   
2817 O O   . ALA G 20  ? 0.1916 0.1860 0.1330 -0.0127 0.0002  -0.0119 470 ALA G O   
2818 C CB  . ALA G 20  ? 0.2068 0.2046 0.1579 -0.0181 0.0264  -0.0354 470 ALA G CB  
2819 N N   . GLN G 21  ? 0.2409 0.2150 0.1308 -0.0304 0.0075  -0.0163 471 GLN G N   
2820 C CA  . GLN G 21  ? 0.3104 0.2665 0.1775 -0.0337 0.0038  -0.0057 471 GLN G CA  
2821 C C   . GLN G 21  ? 0.3034 0.2561 0.1733 -0.0228 -0.0201 0.0039  471 GLN G C   
2822 O O   . GLN G 21  ? 0.4034 0.3481 0.2765 -0.0186 -0.0232 0.0118  471 GLN G O   
2823 C CB  . GLN G 21  ? 0.3366 0.2665 0.1523 -0.0502 0.0105  -0.0058 471 GLN G CB  
2824 C CG  . GLN G 21  ? 0.4403 0.3390 0.2181 -0.0589 0.0109  0.0053  471 GLN G CG  
2825 C CD  . GLN G 21  ? 0.5096 0.3754 0.2261 -0.0800 0.0220  0.0040  471 GLN G CD  
2826 O OE1 . GLN G 21  ? 0.5776 0.4528 0.3014 -0.0915 0.0466  -0.0101 471 GLN G OE1 
2827 N NE2 . GLN G 21  ? 0.6202 0.4531 0.2973 -0.0801 0.0016  0.0165  471 GLN G NE2 
2828 N N   . GLU G 22  ? 0.2811 0.2413 0.1543 -0.0180 -0.0369 0.0008  472 GLU G N   
2829 C CA  . GLU G 22  ? 0.2738 0.2374 0.1615 -0.0055 -0.0605 0.0047  472 GLU G CA  
2830 C C   . GLU G 22  ? 0.2650 0.2509 0.1991 0.0039  -0.0556 0.0011  472 GLU G C   
2831 O O   . GLU G 22  ? 0.2715 0.2586 0.2217 0.0143  -0.0689 0.0035  472 GLU G O   
2832 C CB  . GLU G 22  ? 0.3563 0.3311 0.2466 -0.0038 -0.0789 -0.0035 472 GLU G CB  
2833 C CG  . GLU G 22  ? 0.4997 0.4496 0.3374 -0.0133 -0.0892 -0.0008 472 GLU G CG  
2834 C CD  . GLU G 22  ? 0.6219 0.5380 0.4213 -0.0078 -0.1138 0.0129  472 GLU G CD  
2835 O OE1 . GLU G 22  ? 0.7107 0.5951 0.4595 -0.0192 -0.1095 0.0195  472 GLU G OE1 
2836 O OE2 . GLU G 22  ? 0.6323 0.5555 0.4619 0.0082  -0.1308 0.0154  472 GLU G OE2 
2837 N N   . LEU G 23  ? 0.1858 0.1853 0.1385 0.0006  -0.0374 -0.0052 473 LEU G N   
2838 C CA  . LEU G 23  ? 0.1559 0.1700 0.1414 0.0062  -0.0324 -0.0092 473 LEU G CA  
2839 C C   . LEU G 23  ? 0.1634 0.1714 0.1521 0.0082  -0.0239 -0.0033 473 LEU G C   
2840 O O   . LEU G 23  ? 0.1633 0.1777 0.1715 0.0123  -0.0220 -0.0054 473 LEU G O   
2841 C CB  . LEU G 23  ? 0.1314 0.1539 0.1263 0.0012  -0.0207 -0.0183 473 LEU G CB  
2842 C CG  . LEU G 23  ? 0.1667 0.1998 0.1666 -0.0030 -0.0274 -0.0282 473 LEU G CG  
2843 C CD1 . LEU G 23  ? 0.1735 0.2032 0.1697 -0.0109 -0.0133 -0.0355 473 LEU G CD1 
2844 C CD2 . LEU G 23  ? 0.2418 0.2930 0.2730 0.0007  -0.0344 -0.0363 473 LEU G CD2 
2845 N N   . LEU G 24  ? 0.1438 0.1399 0.1138 0.0031  -0.0173 0.0016  474 LEU G N   
2846 C CA  . LEU G 24  ? 0.1365 0.1313 0.1137 0.0028  -0.0086 0.0036  474 LEU G CA  
2847 C C   . LEU G 24  ? 0.1576 0.1341 0.1174 0.0007  -0.0132 0.0117  474 LEU G C   
2848 O O   . LEU G 24  ? 0.1997 0.1592 0.1306 -0.0082 -0.0101 0.0152  474 LEU G O   
2849 C CB  . LEU G 24  ? 0.1471 0.1463 0.1250 -0.0029 0.0050  -0.0024 474 LEU G CB  
2850 C CG  . LEU G 24  ? 0.1560 0.1638 0.1464 0.0009  0.0075  -0.0094 474 LEU G CG  
2851 C CD1 . LEU G 24  ? 0.1836 0.1947 0.1781 -0.0018 0.0188  -0.0178 474 LEU G CD1 
2852 C CD2 . LEU G 24  ? 0.1521 0.1624 0.1579 0.0079  0.0041  -0.0090 474 LEU G CD2 
2853 N N   . LYS G 25  ? 0.1511 0.1258 0.1240 0.0073  -0.0190 0.0142  475 LYS G N   
2854 C CA  . LYS G 25  ? 0.1794 0.1299 0.1349 0.0081  -0.0268 0.0224  475 LYS G CA  
2855 C C   . LYS G 25  ? 0.1751 0.1205 0.1397 0.0065  -0.0199 0.0227  475 LYS G C   
2856 O O   . LYS G 25  ? 0.2063 0.1244 0.1492 0.0023  -0.0210 0.0296  475 LYS G O   
2857 C CB  . LYS G 25  ? 0.2141 0.1627 0.1782 0.0210  -0.0463 0.0230  475 LYS G CB  
2858 C CG  . LYS G 25  ? 0.2782 0.2278 0.2295 0.0223  -0.0590 0.0225  475 LYS G CG  
2859 C CD  . LYS G 25  ? 0.4221 0.3378 0.3233 0.0136  -0.0629 0.0329  475 LYS G CD  
2860 C CE  . LYS G 25  ? 0.4656 0.3794 0.3480 0.0143  -0.0789 0.0319  475 LYS G CE  
2861 N NZ  . LYS G 25  ? 0.5065 0.4288 0.4128 0.0313  -0.1057 0.0286  475 LYS G NZ  
2862 N N   . LYS G 26  ? 0.1455 0.1105 0.1355 0.0085  -0.0139 0.0157  476 LYS G N   
2863 C CA  . LYS G 26  ? 0.1475 0.1091 0.1467 0.0074  -0.0102 0.0139  476 LYS G CA  
2864 C C   . LYS G 26  ? 0.1247 0.1036 0.1367 0.0024  -0.0018 0.0069  476 LYS G C   
2865 O O   . LYS G 26  ? 0.1104 0.1034 0.1290 0.0048  -0.0013 0.0034  476 LYS G O   
2866 C CB  . LYS G 26  ? 0.1784 0.1432 0.1947 0.0169  -0.0160 0.0100  476 LYS G CB  
2867 C CG  . LYS G 26  ? 0.2344 0.1827 0.2482 0.0259  -0.0283 0.0138  476 LYS G CG  
2868 C CD  . LYS G 26  ? 0.2641 0.2250 0.3062 0.0357  -0.0315 0.0038  476 LYS G CD  
2869 C CE  . LYS G 26  ? 0.2620 0.2082 0.3112 0.0489  -0.0477 0.0046  476 LYS G CE  
2870 N NZ  . LYS G 26  ? 0.3065 0.2216 0.3431 0.0498  -0.0489 0.0100  476 LYS G NZ  
2871 N N   . GLN G 27  ? 0.1365 0.1120 0.1522 -0.0038 0.0026  0.0042  477 GLN G N   
2872 C CA  . GLN G 27  ? 0.1264 0.1201 0.1587 -0.0074 0.0057  -0.0046 477 GLN G CA  
2873 C C   . GLN G 27  ? 0.1026 0.1070 0.1420 0.0015  -0.0016 -0.0075 477 GLN G C   
2874 O O   . GLN G 27  ? 0.1235 0.1211 0.1586 0.0052  -0.0051 -0.0068 477 GLN G O   
2875 C CB  . GLN G 27  ? 0.1441 0.1323 0.1808 -0.0144 0.0079  -0.0088 477 GLN G CB  
2876 C CG  . GLN G 27  ? 0.1549 0.1648 0.2130 -0.0189 0.0078  -0.0207 477 GLN G CG  
2877 C CD  . GLN G 27  ? 0.2192 0.2384 0.2873 -0.0316 0.0204  -0.0280 477 GLN G CD  
2878 O OE1 . GLN G 27  ? 0.1777 0.1834 0.2280 -0.0377 0.0299  -0.0223 477 GLN G OE1 
2879 N NE2 . GLN G 27  ? 0.2433 0.2852 0.3392 -0.0373 0.0209  -0.0427 477 GLN G NE2 
2880 N N   . GLY G 28  ? 0.1006 0.1172 0.1228 -0.0059 0.0266  -0.0067 478 GLY G N   
2881 C CA  . GLY G 28  ? 0.0918 0.1236 0.1208 -0.0030 0.0183  -0.0079 478 GLY G CA  
2882 C C   . GLY G 28  ? 0.0933 0.1262 0.1155 0.0010  0.0127  -0.0014 478 GLY G C   
2883 O O   . GLY G 28  ? 0.0839 0.1240 0.1078 0.0028  0.0084  -0.0018 478 GLY G O   
2884 N N   . ASP G 29  ? 0.0886 0.1132 0.1021 0.0030  0.0130  0.0034  479 ASP G N   
2885 C CA  . ASP G 29  ? 0.0782 0.1068 0.0895 0.0058  0.0080  0.0061  479 ASP G CA  
2886 C C   . ASP G 29  ? 0.0708 0.1033 0.0836 0.0038  0.0073  0.0057  479 ASP G C   
2887 O O   . ASP G 29  ? 0.0934 0.1223 0.1050 0.0016  0.0107  0.0046  479 ASP G O   
2888 C CB  . ASP G 29  ? 0.0949 0.1139 0.0955 0.0105  0.0070  0.0086  479 ASP G CB  
2889 C CG  . ASP G 29  ? 0.1118 0.1272 0.1089 0.0160  0.0048  0.0085  479 ASP G CG  
2890 O OD1 . ASP G 29  ? 0.1304 0.1518 0.1351 0.0149  0.0049  0.0068  479 ASP G OD1 
2891 O OD2 . ASP G 29  ? 0.1360 0.1415 0.1208 0.0231  0.0022  0.0096  479 ASP G OD2 
2892 N N   . PHE G 30  ? 0.0683 0.1065 0.0831 0.0041  0.0044  0.0060  480 PHE G N   
2893 C CA  . PHE G 30  ? 0.0653 0.1043 0.0791 0.0031  0.0037  0.0057  480 PHE G CA  
2894 C C   . PHE G 30  ? 0.0639 0.1045 0.0776 0.0026  0.0025  0.0063  480 PHE G C   
2895 O O   . PHE G 30  ? 0.0699 0.1131 0.0867 0.0022  0.0031  0.0053  480 PHE G O   
2896 C CB  . PHE G 30  ? 0.0750 0.1160 0.0900 0.0038  0.0032  0.0029  480 PHE G CB  
2897 C CG  . PHE G 30  ? 0.0755 0.1150 0.0866 0.0058  0.0025  0.0032  480 PHE G CG  
2898 C CD1 . PHE G 30  ? 0.0892 0.1300 0.1017 0.0068  0.0028  0.0019  480 PHE G CD1 
2899 C CD2 . PHE G 30  ? 0.0949 0.1286 0.0983 0.0066  0.0029  0.0045  480 PHE G CD2 
2900 C CE1 . PHE G 30  ? 0.1107 0.1474 0.1162 0.0091  0.0035  0.0023  480 PHE G CE1 
2901 C CE2 . PHE G 30  ? 0.1092 0.1356 0.1037 0.0084  0.0051  0.0052  480 PHE G CE2 
2902 C CZ  . PHE G 30  ? 0.1088 0.1369 0.1039 0.0098  0.0054  0.0042  480 PHE G CZ  
2903 N N   . LEU G 31  ? 0.0648 0.1041 0.0764 0.0020  0.0018  0.0063  481 LEU G N   
2904 C CA  . LEU G 31  ? 0.0816 0.1209 0.0938 0.0002  0.0022  0.0053  481 LEU G CA  
2905 C C   . LEU G 31  ? 0.0812 0.1161 0.0884 0.0003  0.0021  0.0057  481 LEU G C   
2906 O O   . LEU G 31  ? 0.0792 0.1143 0.0853 0.0019  0.0010  0.0056  481 LEU G O   
2907 C CB  . LEU G 31  ? 0.0717 0.1164 0.0886 0.0007  -0.0002 0.0025  481 LEU G CB  
2908 C CG  . LEU G 31  ? 0.0698 0.1123 0.0811 0.0043  -0.0035 0.0033  481 LEU G CG  
2909 C CD1 . LEU G 31  ? 0.0867 0.1278 0.0959 0.0031  -0.0039 0.0025  481 LEU G CD1 
2910 C CD2 . LEU G 31  ? 0.1103 0.1562 0.1219 0.0095  -0.0082 0.0001  481 LEU G CD2 
2911 N N   . VAL G 32  ? 0.0746 0.1048 0.0794 -0.0017 0.0043  0.0049  482 VAL G N   
2912 C CA  . VAL G 32  ? 0.0851 0.1091 0.0838 -0.0008 0.0039  0.0050  482 VAL G CA  
2913 C C   . VAL G 32  ? 0.0805 0.1064 0.0834 -0.0041 0.0043  0.0024  482 VAL G C   
2914 O O   . VAL G 32  ? 0.0813 0.1105 0.0912 -0.0080 0.0068  -0.0011 482 VAL G O   
2915 C CB  . VAL G 32  ? 0.0927 0.1032 0.0788 0.0014  0.0067  0.0062  482 VAL G CB  
2916 C CG1 . VAL G 32  ? 0.1174 0.1184 0.0951 0.0033  0.0065  0.0059  482 VAL G CG1 
2917 C CG2 . VAL G 32  ? 0.1143 0.1255 0.0966 0.0073  0.0034  0.0063  482 VAL G CG2 
2918 N N   . ARG G 33  ? 0.0805 0.1062 0.0813 -0.0026 0.0018  0.0021  483 ARG G N   
2919 C CA  . ARG G 33  ? 0.0887 0.1168 0.0930 -0.0045 0.0008  -0.0015 483 ARG G CA  
2920 C C   . ARG G 33  ? 0.1102 0.1314 0.1079 -0.0034 0.0007  -0.0013 483 ARG G C   
2921 O O   . ARG G 33  ? 0.1060 0.1232 0.0978 0.0002  -0.0000 0.0007  483 ARG G O   
2922 C CB  . ARG G 33  ? 0.0815 0.1178 0.0885 -0.0015 -0.0039 -0.0028 483 ARG G CB  
2923 C CG  . ARG G 33  ? 0.0943 0.1279 0.0942 0.0017  -0.0045 0.0007  483 ARG G CG  
2924 C CD  . ARG G 33  ? 0.1085 0.1420 0.1033 0.0058  -0.0069 0.0008  483 ARG G CD  
2925 N NE  . ARG G 33  ? 0.1040 0.1309 0.0909 0.0066  -0.0031 0.0037  483 ARG G NE  
2926 C CZ  . ARG G 33  ? 0.1129 0.1355 0.0934 0.0071  -0.0013 0.0033  483 ARG G CZ  
2927 N NH1 . ARG G 33  ? 0.1206 0.1448 0.1006 0.0081  -0.0046 0.0008  483 ARG G NH1 
2928 N NH2 . ARG G 33  ? 0.1177 0.1345 0.0935 0.0060  0.0051  0.0041  483 ARG G NH2 
2929 N N   . GLU G 34  ? 0.1117 0.1330 0.1120 -0.0057 0.0007  -0.0053 484 GLU G N   
2930 C CA  . GLU G 34  ? 0.1286 0.1433 0.1230 -0.0046 0.0004  -0.0060 484 GLU G CA  
2931 C C   . GLU G 34  ? 0.1448 0.1664 0.1389 -0.0012 -0.0041 -0.0065 484 GLU G C   
2932 O O   . GLU G 34  ? 0.1640 0.1922 0.1615 -0.0006 -0.0071 -0.0095 484 GLU G O   
2933 C CB  . GLU G 34  ? 0.1533 0.1635 0.1511 -0.0100 0.0040  -0.0114 484 GLU G CB  
2934 C CG  . GLU G 34  ? 0.2690 0.2709 0.2679 -0.0160 0.0122  -0.0128 484 GLU G CG  
2935 C CD  . GLU G 34  ? 0.3585 0.3371 0.3408 -0.0159 0.0191  -0.0096 484 GLU G CD  
2936 O OE1 . GLU G 34  ? 0.3587 0.3303 0.3312 -0.0106 0.0157  -0.0075 484 GLU G OE1 
2937 O OE2 . GLU G 34  ? 0.3853 0.3508 0.3625 -0.0206 0.0283  -0.0097 484 GLU G OE2 
2938 N N   . SER G 35  ? 0.1291 0.1483 0.1182 0.0020  -0.0044 -0.0050 485 SER G N   
2939 C CA  . SER G 35  ? 0.1235 0.1462 0.1103 0.0042  -0.0053 -0.0054 485 SER G CA  
2940 C C   . SER G 35  ? 0.1214 0.1438 0.1056 0.0047  -0.0075 -0.0087 485 SER G C   
2941 O O   . SER G 35  ? 0.1467 0.1658 0.1318 0.0033  -0.0078 -0.0115 485 SER G O   
2942 C CB  . SER G 35  ? 0.1167 0.1394 0.1029 0.0065  -0.0038 -0.0064 485 SER G CB  
2943 O OG  . SER G 35  ? 0.1239 0.1483 0.1079 0.0069  -0.0013 -0.0078 485 SER G OG  
2944 N N   . HIS G 36  ? 0.1257 0.1487 0.1038 0.0076  -0.0085 -0.0087 486 HIS G N   
2945 C CA  . HIS G 36  ? 0.1270 0.1484 0.0986 0.0104  -0.0111 -0.0121 486 HIS G CA  
2946 C C   . HIS G 36  ? 0.1539 0.1707 0.1181 0.0115  -0.0068 -0.0115 486 HIS G C   
2947 O O   . HIS G 36  ? 0.1555 0.1713 0.1180 0.0123  -0.0079 -0.0147 486 HIS G O   
2948 C CB  . HIS G 36  ? 0.1585 0.1797 0.1221 0.0159  -0.0158 -0.0138 486 HIS G CB  
2949 C CG  . HIS G 36  ? 0.1742 0.2044 0.1494 0.0153  -0.0212 -0.0192 486 HIS G CG  
2950 N ND1 . HIS G 36  ? 0.2247 0.2614 0.2066 0.0159  -0.0264 -0.0282 486 HIS G ND1 
2951 C CD2 . HIS G 36  ? 0.1764 0.2117 0.1602 0.0135  -0.0213 -0.0189 486 HIS G CD2 
2952 C CE1 . HIS G 36  ? 0.2042 0.2507 0.2002 0.0137  -0.0287 -0.0343 486 HIS G CE1 
2953 N NE2 . HIS G 36  ? 0.2256 0.2711 0.2222 0.0125  -0.0257 -0.0283 486 HIS G NE2 
2954 N N   . GLY G 37  ? 0.1463 0.1608 0.1077 0.0109  -0.0009 -0.0088 487 GLY G N   
2955 C CA  . GLY G 37  ? 0.1665 0.1783 0.1241 0.0104  0.0056  -0.0107 487 GLY G CA  
2956 C C   . GLY G 37  ? 0.1465 0.1650 0.1154 0.0095  0.0053  -0.0148 487 GLY G C   
2957 O O   . GLY G 37  ? 0.1809 0.1995 0.1486 0.0101  0.0083  -0.0187 487 GLY G O   
2958 N N   . LYS G 38  ? 0.1306 0.1531 0.1080 0.0093  0.0015  -0.0144 488 LYS G N   
2959 C CA  . LYS G 38  ? 0.1294 0.1542 0.1123 0.0120  -0.0008 -0.0182 488 LYS G CA  
2960 C C   . LYS G 38  ? 0.1151 0.1329 0.0948 0.0125  -0.0052 -0.0158 488 LYS G C   
2961 O O   . LYS G 38  ? 0.1300 0.1454 0.1102 0.0131  -0.0063 -0.0138 488 LYS G O   
2962 C CB  . LYS G 38  ? 0.1492 0.1816 0.1413 0.0130  0.0004  -0.0215 488 LYS G CB  
2963 C CG  . LYS G 38  ? 0.1703 0.2098 0.1692 0.0104  0.0080  -0.0272 488 LYS G CG  
2964 C CD  . LYS G 38  ? 0.1846 0.2347 0.1970 0.0104  0.0092  -0.0334 488 LYS G CD  
2965 C CE  . LYS G 38  ? 0.2449 0.3021 0.2674 0.0052  0.0200  -0.0419 488 LYS G CE  
2966 N NZ  . LYS G 38  ? 0.3080 0.3734 0.3382 0.0079  0.0207  -0.0518 488 LYS G NZ  
2967 N N   . PRO G 39  ? 0.1331 0.1460 0.1085 0.0119  -0.0065 -0.0168 489 PRO G N   
2968 C CA  . PRO G 39  ? 0.1454 0.1502 0.1193 0.0097  -0.0074 -0.0162 489 PRO G CA  
2969 C C   . PRO G 39  ? 0.1453 0.1392 0.1135 0.0130  -0.0070 -0.0153 489 PRO G C   
2970 O O   . PRO G 39  ? 0.1704 0.1626 0.1352 0.0192  -0.0089 -0.0177 489 PRO G O   
2971 C CB  . PRO G 39  ? 0.1644 0.1668 0.1362 0.0090  -0.0084 -0.0203 489 PRO G CB  
2972 C CG  . PRO G 39  ? 0.1551 0.1651 0.1255 0.0107  -0.0090 -0.0210 489 PRO G CG  
2973 C CD  . PRO G 39  ? 0.1366 0.1505 0.1084 0.0125  -0.0061 -0.0195 489 PRO G CD  
2974 N N   . GLY G 40  ? 0.1394 0.1249 0.1050 0.0100  -0.0045 -0.0128 490 GLY G N   
2975 C CA  . GLY G 40  ? 0.1748 0.1440 0.1281 0.0146  -0.0032 -0.0108 490 GLY G CA  
2976 C C   . GLY G 40  ? 0.1684 0.1418 0.1211 0.0193  -0.0054 -0.0088 490 GLY G C   
2977 O O   . GLY G 40  ? 0.1850 0.1427 0.1241 0.0239  -0.0044 -0.0068 490 GLY G O   
2978 N N   . GLU G 41  ? 0.1351 0.1337 0.1082 0.0384  0.0078  -0.0199 491 GLU G N   
2979 C CA  . GLU G 41  ? 0.1187 0.1358 0.1166 0.0346  0.0076  -0.0170 491 GLU G CA  
2980 C C   . GLU G 41  ? 0.1148 0.1355 0.1121 0.0266  0.0016  -0.0167 491 GLU G C   
2981 O O   . GLU G 41  ? 0.1282 0.1425 0.1149 0.0249  -0.0006 -0.0175 491 GLU G O   
2982 C CB  . GLU G 41  ? 0.1419 0.1670 0.1553 0.0382  0.0203  -0.0135 491 GLU G CB  
2983 C CG  . GLU G 41  ? 0.1445 0.1664 0.1676 0.0473  0.0333  -0.0127 491 GLU G CG  
2984 C CD  . GLU G 41  ? 0.1884 0.2212 0.2409 0.0495  0.0253  -0.0132 491 GLU G CD  
2985 O OE1 . GLU G 41  ? 0.2602 0.2891 0.3221 0.0580  0.0342  -0.0132 491 GLU G OE1 
2986 O OE2 . GLU G 41  ? 0.1868 0.2271 0.2498 0.0441  0.0097  -0.0135 491 GLU G OE2 
2987 N N   . TYR G 42  ? 0.1042 0.1315 0.1128 0.0228  -0.0021 -0.0157 492 TYR G N   
2988 C CA  . TYR G 42  ? 0.0965 0.1253 0.1059 0.0167  -0.0030 -0.0149 492 TYR G CA  
2989 C C   . TYR G 42  ? 0.0825 0.1215 0.1046 0.0158  -0.0005 -0.0125 492 TYR G C   
2990 O O   . TYR G 42  ? 0.0841 0.1297 0.1213 0.0183  -0.0002 -0.0114 492 TYR G O   
2991 C CB  . TYR G 42  ? 0.1143 0.1324 0.1163 0.0138  -0.0062 -0.0154 492 TYR G CB  
2992 C CG  . TYR G 42  ? 0.1133 0.1187 0.1054 0.0127  -0.0046 -0.0167 492 TYR G CG  
2993 C CD1 . TYR G 42  ? 0.1413 0.1372 0.1243 0.0163  -0.0079 -0.0177 492 TYR G CD1 
2994 C CD2 . TYR G 42  ? 0.1327 0.1351 0.1303 0.0078  0.0009  -0.0165 492 TYR G CD2 
2995 C CE1 . TYR G 42  ? 0.1705 0.1524 0.1454 0.0144  -0.0052 -0.0185 492 TYR G CE1 
2996 C CE2 . TYR G 42  ? 0.1559 0.1468 0.1534 0.0055  0.0044  -0.0171 492 TYR G CE2 
2997 C CZ  . TYR G 42  ? 0.1687 0.1483 0.1524 0.0084  0.0016  -0.0181 492 TYR G CZ  
2998 O OH  . TYR G 42  ? 0.2092 0.1750 0.1935 0.0053  0.0063  -0.0183 492 TYR G OH  
2999 N N   . VAL G 43  ? 0.0821 0.1223 0.1037 0.0122  0.0012  -0.0115 493 VAL G N   
3000 C CA  . VAL G 43  ? 0.0719 0.1189 0.1032 0.0108  0.0046  -0.0089 493 VAL G CA  
3001 C C   . VAL G 43  ? 0.0774 0.1211 0.1083 0.0061  0.0025  -0.0091 493 VAL G C   
3002 O O   . VAL G 43  ? 0.0757 0.1142 0.1017 0.0046  0.0039  -0.0099 493 VAL G O   
3003 C CB  . VAL G 43  ? 0.0781 0.1221 0.1012 0.0132  0.0098  -0.0070 493 VAL G CB  
3004 C CG1 . VAL G 43  ? 0.1042 0.1517 0.1355 0.0118  0.0160  -0.0034 493 VAL G CG1 
3005 C CG2 . VAL G 43  ? 0.1322 0.1683 0.1432 0.0195  0.0145  -0.0073 493 VAL G CG2 
3006 N N   . LEU G 44  ? 0.0646 0.1092 0.1033 0.0040  -0.0003 -0.0086 494 LEU G N   
3007 C CA  . LEU G 44  ? 0.0690 0.1060 0.1030 0.0005  -0.0006 -0.0087 494 LEU G CA  
3008 C C   . LEU G 44  ? 0.0628 0.1081 0.1077 -0.0005 0.0047  -0.0056 494 LEU G C   
3009 O O   . LEU G 44  ? 0.0651 0.1174 0.1255 -0.0009 0.0060  -0.0036 494 LEU G O   
3010 C CB  . LEU G 44  ? 0.0909 0.1160 0.1213 -0.0012 -0.0116 -0.0106 494 LEU G CB  
3011 C CG  . LEU G 44  ? 0.1079 0.1187 0.1282 -0.0044 -0.0129 -0.0114 494 LEU G CG  
3012 C CD1 . LEU G 44  ? 0.1389 0.1302 0.1336 -0.0036 -0.0036 -0.0124 494 LEU G CD1 
3013 C CD2 . LEU G 44  ? 0.1850 0.1816 0.2042 -0.0061 -0.0304 -0.0139 494 LEU G CD2 
3014 N N   . SER G 45  ? 0.0619 0.1047 0.1019 -0.0005 0.0087  -0.0047 495 SER G N   
3015 C CA  . SER G 45  ? 0.0626 0.1068 0.1062 -0.0004 0.0124  -0.0014 495 SER G CA  
3016 C C   . SER G 45  ? 0.0665 0.1035 0.1103 -0.0035 0.0128  -0.0018 495 SER G C   
3017 O O   . SER G 45  ? 0.0728 0.1019 0.1112 -0.0033 0.0144  -0.0038 495 SER G O   
3018 C CB  . SER G 45  ? 0.0789 0.1209 0.1166 0.0034  0.0115  -0.0003 495 SER G CB  
3019 O OG  . SER G 45  ? 0.0951 0.1357 0.1237 0.0069  0.0107  -0.0005 495 SER G OG  
3020 N N   . VAL G 46  ? 0.0821 0.1188 0.1327 -0.0061 0.0136  0.0002  496 VAL G N   
3021 C CA  . VAL G 46  ? 0.0860 0.1114 0.1338 -0.0093 0.0120  -0.0010 496 VAL G CA  
3022 C C   . VAL G 46  ? 0.1147 0.1399 0.1691 -0.0103 0.0168  0.0032  496 VAL G C   
3023 O O   . VAL G 46  ? 0.1450 0.1764 0.2086 -0.0105 0.0216  0.0071  496 VAL G O   
3024 C CB  . VAL G 46  ? 0.1205 0.1383 0.1700 -0.0132 0.0014  -0.0043 496 VAL G CB  
3025 C CG1 . VAL G 46  ? 0.1969 0.1916 0.2298 -0.0154 -0.0027 -0.0072 496 VAL G CG1 
3026 C CG2 . VAL G 46  ? 0.2108 0.2258 0.2513 -0.0112 -0.0047 -0.0073 496 VAL G CG2 
3027 N N   . TYR G 47  ? 0.0898 0.1039 0.1380 -0.0104 0.0183  0.0029  497 TYR G N   
3028 C CA  . TYR G 47  ? 0.1010 0.1100 0.1528 -0.0118 0.0219  0.0068  497 TYR G CA  
3029 C C   . TYR G 47  ? 0.1122 0.1122 0.1698 -0.0183 0.0167  0.0046  497 TYR G C   
3030 O O   . TYR G 47  ? 0.1434 0.1281 0.1875 -0.0192 0.0108  -0.0004 497 TYR G O   
3031 C CB  . TYR G 47  ? 0.1093 0.1096 0.1547 -0.0074 0.0248  0.0074  497 TYR G CB  
3032 C CG  . TYR G 47  ? 0.1183 0.1116 0.1631 -0.0063 0.0277  0.0126  497 TYR G CG  
3033 C CD1 . TYR G 47  ? 0.1298 0.1104 0.1742 -0.0099 0.0293  0.0127  497 TYR G CD1 
3034 C CD2 . TYR G 47  ? 0.1255 0.1181 0.1639 -0.0012 0.0277  0.0173  497 TYR G CD2 
3035 C CE1 . TYR G 47  ? 0.1379 0.1086 0.1795 -0.0088 0.0331  0.0182  497 TYR G CE1 
3036 C CE2 . TYR G 47  ? 0.1336 0.1118 0.1628 0.0009  0.0303  0.0228  497 TYR G CE2 
3037 C CZ  . TYR G 47  ? 0.1412 0.1102 0.1741 -0.0032 0.0342  0.0236  497 TYR G CZ  
3038 O OH  . TYR G 47  ? 0.1725 0.1241 0.1942 -0.0009 0.0377  0.0297  497 TYR G OH  
3039 N N   . SER G 48  ? 0.1187 0.1230 0.1948 -0.0227 0.0192  0.0084  498 SER G N   
3040 C CA  . SER G 48  ? 0.1505 0.1463 0.2412 -0.0301 0.0100  0.0060  498 SER G CA  
3041 C C   . SER G 48  ? 0.1736 0.1697 0.2848 -0.0345 0.0200  0.0122  498 SER G C   
3042 O O   . SER G 48  ? 0.1611 0.1676 0.2862 -0.0335 0.0332  0.0181  498 SER G O   
3043 C CB  . SER G 48  ? 0.1689 0.1723 0.2788 -0.0333 -0.0028 0.0024  498 SER G CB  
3044 O OG  . SER G 48  ? 0.2620 0.2507 0.3823 -0.0399 -0.0201 -0.0019 498 SER G OG  
3045 N N   . ASP G 49  ? 0.1644 0.1441 0.2737 -0.0388 0.0157  0.0111  499 ASP G N   
3046 C CA  . ASP G 49  ? 0.1922 0.1671 0.3209 -0.0441 0.0254  0.0171  499 ASP G CA  
3047 C C   . ASP G 49  ? 0.1713 0.1460 0.2859 -0.0379 0.0453  0.0256  499 ASP G C   
3048 O O   . ASP G 49  ? 0.2395 0.2147 0.3704 -0.0400 0.0612  0.0327  499 ASP G O   
3049 C CB  . ASP G 49  ? 0.2443 0.2290 0.4214 -0.0534 0.0216  0.0177  499 ASP G CB  
3050 C CG  . ASP G 49  ? 0.3405 0.3152 0.5260 -0.0592 -0.0058 0.0088  499 ASP G CG  
3051 O OD1 . ASP G 49  ? 0.3690 0.3205 0.5188 -0.0578 -0.0162 0.0034  499 ASP G OD1 
3052 O OD2 . ASP G 49  ? 0.3886 0.3754 0.6025 -0.0599 -0.0167 0.0068  499 ASP G OD2 
3053 N N   . GLY G 50  ? 0.1818 0.1515 0.2650 -0.0294 0.0442  0.0249  500 GLY G N   
3054 C CA  . GLY G 50  ? 0.1935 0.1545 0.2552 -0.0219 0.0546  0.0317  500 GLY G CA  
3055 C C   . GLY G 50  ? 0.2125 0.1798 0.2671 -0.0173 0.0618  0.0346  500 GLY G C   
3056 O O   . GLY G 50  ? 0.2859 0.2361 0.3145 -0.0108 0.0699  0.0407  500 GLY G O   
3057 N N   . GLN G 51  ? 0.1724 0.1580 0.2433 -0.0192 0.0580  0.0303  501 GLN G N   
3058 C CA  . GLN G 51  ? 0.1903 0.1799 0.2543 -0.0145 0.0660  0.0324  501 GLN G CA  
3059 C C   . GLN G 51  ? 0.1535 0.1569 0.2135 -0.0114 0.0528  0.0257  501 GLN G C   
3060 O O   . GLN G 51  ? 0.1457 0.1588 0.2183 -0.0151 0.0415  0.0198  501 GLN G O   
3061 C CB  . GLN G 51  ? 0.1995 0.1974 0.2970 -0.0198 0.0799  0.0354  501 GLN G CB  
3062 C CG  . GLN G 51  ? 0.2805 0.2635 0.3861 -0.0227 0.0966  0.0422  501 GLN G CG  
3063 C CD  . GLN G 51  ? 0.3862 0.3767 0.5233 -0.0231 0.1062  0.0420  501 GLN G CD  
3064 O OE1 . GLN G 51  ? 0.3917 0.4017 0.5644 -0.0269 0.0945  0.0370  501 GLN G OE1 
3065 N NE2 . GLN G 51  ? 0.4476 0.4180 0.5703 -0.0180 0.1275  0.0477  501 GLN G NE2 
3066 N N   . ARG G 52  ? 0.1546 0.1530 0.1924 -0.0042 0.0543  0.0268  502 ARG G N   
3067 C CA  . ARG G 52  ? 0.1549 0.1652 0.1916 -0.0018 0.0444  0.0213  502 ARG G CA  
3068 C C   . ARG G 52  ? 0.1396 0.1594 0.1911 -0.0028 0.0523  0.0213  502 ARG G C   
3069 O O   . ARG G 52  ? 0.1969 0.2062 0.2405 0.0004  0.0679  0.0262  502 ARG G O   
3070 C CB  . ARG G 52  ? 0.2389 0.2366 0.2476 0.0060  0.0375  0.0215  502 ARG G CB  
3071 C CG  . ARG G 52  ? 0.3016 0.2960 0.3105 0.0075  0.0265  0.0203  502 ARG G CG  
3072 C CD  . ARG G 52  ? 0.3658 0.3385 0.3489 0.0154  0.0179  0.0232  502 ARG G CD  
3073 N NE  . ARG G 52  ? 0.3060 0.2773 0.3001 0.0175  0.0078  0.0229  502 ARG G NE  
3074 C CZ  . ARG G 52  ? 0.3099 0.2618 0.2902 0.0210  0.0063  0.0275  502 ARG G CZ  
3075 N NH1 . ARG G 52  ? 0.3773 0.3059 0.3273 0.0225  0.0163  0.0335  502 ARG G NH1 
3076 N NH2 . ARG G 52  ? 0.2986 0.2515 0.2958 0.0238  -0.0030 0.0267  502 ARG G NH2 
3077 N N   . ARG G 53  ? 0.1193 0.1354 0.1563 -0.0006 0.0232  0.0031  503 ARG G N   
3078 C CA  . ARG G 53  ? 0.1338 0.1618 0.1885 -0.0042 0.0215  0.0060  503 ARG G CA  
3079 C C   . ARG G 53  ? 0.1189 0.1531 0.1665 -0.0003 0.0209  0.0015  503 ARG G C   
3080 O O   . ARG G 53  ? 0.1268 0.1546 0.1593 0.0016  0.0174  -0.0039 503 ARG G O   
3081 C CB  . ARG G 53  ? 0.1647 0.1864 0.2307 -0.0133 0.0096  0.0075  503 ARG G CB  
3082 C CG  . ARG G 53  ? 0.2022 0.2152 0.2755 -0.0191 0.0092  0.0132  503 ARG G CG  
3083 C CD  . ARG G 53  ? 0.2382 0.2380 0.3175 -0.0306 -0.0068 0.0142  503 ARG G CD  
3084 N NE  . ARG G 53  ? 0.2152 0.2339 0.3252 -0.0373 -0.0130 0.0221  503 ARG G NE  
3085 C CZ  . ARG G 53  ? 0.2480 0.2611 0.3726 -0.0500 -0.0299 0.0268  503 ARG G CZ  
3086 N NH1 . ARG G 53  ? 0.3166 0.2998 0.4215 -0.0578 -0.0425 0.0228  503 ARG G NH1 
3087 N NH2 . ARG G 53  ? 0.2647 0.3003 0.4231 -0.0549 -0.0353 0.0365  503 ARG G NH2 
3088 N N   . HIS G 54  ? 0.0766 0.1215 0.1340 0.0019  0.0259  0.0048  504 HIS G N   
3089 C CA  . HIS G 54  ? 0.0772 0.1242 0.1251 0.0059  0.0264  0.0012  504 HIS G CA  
3090 C C   . HIS G 54  ? 0.0771 0.1316 0.1408 0.0056  0.0236  0.0039  504 HIS G C   
3091 O O   . HIS G 54  ? 0.0933 0.1561 0.1730 0.0084  0.0310  0.0107  504 HIS G O   
3092 C CB  . HIS G 54  ? 0.0891 0.1342 0.1246 0.0111  0.0351  0.0021  504 HIS G CB  
3093 C CG  . HIS G 54  ? 0.0749 0.1149 0.0989 0.0114  0.0361  0.0019  504 HIS G CG  
3094 N ND1 . HIS G 54  ? 0.0788 0.1174 0.0921 0.0113  0.0314  -0.0011 504 HIS G ND1 
3095 C CD2 . HIS G 54  ? 0.1176 0.1547 0.1415 0.0123  0.0414  0.0061  504 HIS G CD2 
3096 C CE1 . HIS G 54  ? 0.1072 0.1433 0.1156 0.0128  0.0330  0.0013  504 HIS G CE1 
3097 N NE2 . HIS G 54  ? 0.1196 0.1530 0.1320 0.0133  0.0387  0.0050  504 HIS G NE2 
3098 N N   . PHE G 55  ? 0.0692 0.1207 0.1285 0.0033  0.0140  0.0000  505 PHE G N   
3099 C CA  . PHE G 55  ? 0.0777 0.1356 0.1518 0.0027  0.0079  0.0032  505 PHE G CA  
3100 C C   . PHE G 55  ? 0.0871 0.1429 0.1496 0.0082  0.0105  0.0006  505 PHE G C   
3101 O O   . PHE G 55  ? 0.1011 0.1485 0.1437 0.0076  0.0083  -0.0049 505 PHE G O   
3102 C CB  . PHE G 55  ? 0.1024 0.1521 0.1730 -0.0040 -0.0070 0.0007  505 PHE G CB  
3103 C CG  . PHE G 55  ? 0.0943 0.1395 0.1729 -0.0113 -0.0136 0.0030  505 PHE G CG  
3104 C CD1 . PHE G 55  ? 0.1022 0.1562 0.2083 -0.0180 -0.0229 0.0113  505 PHE G CD1 
3105 C CD2 . PHE G 55  ? 0.1229 0.1544 0.1832 -0.0119 -0.0114 -0.0017 505 PHE G CD2 
3106 C CE1 . PHE G 55  ? 0.1321 0.1785 0.2451 -0.0273 -0.0315 0.0142  505 PHE G CE1 
3107 C CE2 . PHE G 55  ? 0.1654 0.1870 0.2293 -0.0188 -0.0181 0.0002  505 PHE G CE2 
3108 C CZ  . PHE G 55  ? 0.1338 0.1615 0.2230 -0.0277 -0.0290 0.0078  505 PHE G CZ  
3109 N N   . ILE G 56  ? 0.0785 0.1411 0.1543 0.0138  0.0154  0.0058  506 ILE G N   
3110 C CA  . ILE G 56  ? 0.0971 0.1530 0.1605 0.0187  0.0156  0.0035  506 ILE G CA  
3111 C C   . ILE G 56  ? 0.1093 0.1636 0.1726 0.0145  0.0022  0.0023  506 ILE G C   
3112 O O   . ILE G 56  ? 0.1133 0.1753 0.1955 0.0111  -0.0068 0.0069  506 ILE G O   
3113 C CB  . ILE G 56  ? 0.1065 0.1663 0.1814 0.0289  0.0264  0.0100  506 ILE G CB  
3114 C CG1 . ILE G 56  ? 0.1498 0.2036 0.2136 0.0344  0.0408  0.0104  506 ILE G CG1 
3115 C CG2 . ILE G 56  ? 0.1278 0.1761 0.1882 0.0344  0.0253  0.0078  506 ILE G CG2 
3116 C CD1 . ILE G 56  ? 0.1736 0.2087 0.2038 0.0332  0.0404  0.0024  506 ILE G CD1 
3117 N N   . ILE G 57  ? 0.0956 0.1388 0.1366 0.0136  -0.0004 -0.0030 507 ILE G N   
3118 C CA  . ILE G 57  ? 0.1081 0.1457 0.1427 0.0117  -0.0109 -0.0034 507 ILE G CA  
3119 C C   . ILE G 57  ? 0.1181 0.1555 0.1587 0.0186  -0.0093 0.0005  507 ILE G C   
3120 O O   . ILE G 57  ? 0.1384 0.1653 0.1630 0.0217  -0.0039 -0.0017 507 ILE G O   
3121 C CB  . ILE G 57  ? 0.1226 0.1495 0.1328 0.0085  -0.0114 -0.0082 507 ILE G CB  
3122 C CG1 . ILE G 57  ? 0.1528 0.1796 0.1576 0.0053  -0.0095 -0.0109 507 ILE G CG1 
3123 C CG2 . ILE G 57  ? 0.1651 0.1831 0.1641 0.0074  -0.0206 -0.0077 507 ILE G CG2 
3124 C CD1 . ILE G 57  ? 0.1575 0.1793 0.1448 0.0044  -0.0056 -0.0125 507 ILE G CD1 
3125 N N   . GLN G 58  ? 0.0969 0.1447 0.1610 0.0210  -0.0146 0.0074  508 GLN G N   
3126 C CA  . GLN G 58  ? 0.1090 0.1585 0.1833 0.0309  -0.0104 0.0132  508 GLN G CA  
3127 C C   . GLN G 58  ? 0.1279 0.1625 0.1821 0.0316  -0.0171 0.0110  508 GLN G C   
3128 O O   . GLN G 58  ? 0.1481 0.1775 0.1919 0.0249  -0.0290 0.0092  508 GLN G O   
3129 C CB  . GLN G 58  ? 0.0963 0.1659 0.2081 0.0330  -0.0159 0.0244  508 GLN G CB  
3130 C CG  . GLN G 58  ? 0.1875 0.2738 0.3247 0.0339  -0.0061 0.0303  508 GLN G CG  
3131 C CD  . GLN G 58  ? 0.2106 0.3205 0.3915 0.0328  -0.0142 0.0442  508 GLN G CD  
3132 O OE1 . GLN G 58  ? 0.2349 0.3475 0.4249 0.0322  -0.0278 0.0489  508 GLN G OE1 
3133 N NE2 . GLN G 58  ? 0.2540 0.3744 0.4515 0.0299  -0.0064 0.0493  508 GLN G NE2 
3134 N N   . TYR G 59  ? 0.1833 0.1510 0.1614 0.0449  -0.0577 -0.0153 509 TYR G N   
3135 C CA  . TYR G 59  ? 0.1731 0.1443 0.1611 0.0524  -0.0536 -0.0156 509 TYR G CA  
3136 C C   . TYR G 59  ? 0.1788 0.1719 0.1820 0.0528  -0.0578 -0.0129 509 TYR G C   
3137 O O   . TYR G 59  ? 0.1729 0.1842 0.1942 0.0557  -0.0550 -0.0162 509 TYR G O   
3138 C CB  . TYR G 59  ? 0.1831 0.1570 0.1849 0.0596  -0.0452 -0.0207 509 TYR G CB  
3139 C CG  . TYR G 59  ? 0.1846 0.1543 0.1917 0.0625  -0.0392 -0.0201 509 TYR G CG  
3140 C CD1 . TYR G 59  ? 0.1946 0.1470 0.1849 0.0618  -0.0353 -0.0171 509 TYR G CD1 
3141 C CD2 . TYR G 59  ? 0.1730 0.1501 0.1959 0.0649  -0.0364 -0.0226 509 TYR G CD2 
3142 C CE1 . TYR G 59  ? 0.1951 0.1365 0.1827 0.0619  -0.0292 -0.0137 509 TYR G CE1 
3143 C CE2 . TYR G 59  ? 0.2023 0.1637 0.2234 0.0664  -0.0308 -0.0205 509 TYR G CE2 
3144 C CZ  . TYR G 59  ? 0.1916 0.1349 0.1944 0.0640  -0.0274 -0.0147 509 TYR G CZ  
3145 O OH  . TYR G 59  ? 0.2267 0.1478 0.2207 0.0630  -0.0212 -0.0099 509 TYR G OH  
3146 N N   . VAL G 60  ? 0.1887 0.1823 0.1838 0.0511  -0.0651 -0.0077 510 VAL G N   
3147 C CA  . VAL G 60  ? 0.2094 0.2303 0.2219 0.0554  -0.0721 -0.0044 510 VAL G CA  
3148 C C   . VAL G 60  ? 0.2384 0.2468 0.2398 0.0635  -0.0777 0.0030  510 VAL G C   
3149 O O   . VAL G 60  ? 0.2430 0.2330 0.2181 0.0565  -0.0814 0.0058  510 VAL G O   
3150 C CB  . VAL G 60  ? 0.2426 0.2891 0.2571 0.0409  -0.0809 -0.0040 510 VAL G CB  
3151 C CG1 . VAL G 60  ? 0.2722 0.3595 0.3125 0.0484  -0.0886 -0.0015 510 VAL G CG1 
3152 C CG2 . VAL G 60  ? 0.2759 0.3269 0.2922 0.0303  -0.0747 -0.0084 510 VAL G CG2 
3153 N N   . ASP G 61  ? 0.2553 0.2686 0.2718 0.0788  -0.0778 0.0061  511 ASP G N   
3154 C CA  . ASP G 61  ? 0.2825 0.2797 0.2848 0.0892  -0.0850 0.0166  511 ASP G CA  
3155 C C   . ASP G 61  ? 0.2442 0.2024 0.2135 0.0819  -0.0779 0.0197  511 ASP G C   
3156 O O   . ASP G 61  ? 0.2763 0.2227 0.2183 0.0786  -0.0855 0.0272  511 ASP G O   
3157 C CB  . ASP G 61  ? 0.3085 0.3358 0.3128 0.0900  -0.1036 0.0231  511 ASP G CB  
3158 C CG  . ASP G 61  ? 0.4036 0.4184 0.3959 0.1021  -0.1107 0.0362  511 ASP G CG  
3159 O OD1 . ASP G 61  ? 0.4462 0.4421 0.4450 0.1159  -0.1025 0.0393  511 ASP G OD1 
3160 O OD2 . ASP G 61  ? 0.4827 0.5045 0.4565 0.0957  -0.1241 0.0431  511 ASP G OD2 
3161 N N   . ASN G 62  ? 0.2336 0.1766 0.2059 0.0783  -0.0627 0.0127  512 ASN G N   
3162 C CA  . ASN G 62  ? 0.2499 0.1652 0.2000 0.0714  -0.0509 0.0130  512 ASN G CA  
3163 C C   . ASN G 62  ? 0.2545 0.1668 0.1839 0.0618  -0.0501 0.0094  512 ASN G C   
3164 O O   . ASN G 62  ? 0.2874 0.1808 0.1953 0.0570  -0.0397 0.0093  512 ASN G O   
3165 C CB  . ASN G 62  ? 0.3066 0.1923 0.2343 0.0754  -0.0499 0.0249  512 ASN G CB  
3166 C CG  . ASN G 62  ? 0.3850 0.2600 0.3285 0.0864  -0.0481 0.0268  512 ASN G CG  
3167 O OD1 . ASN G 62  ? 0.4690 0.3358 0.4235 0.0813  -0.0350 0.0189  512 ASN G OD1 
3168 N ND2 . ASN G 62  ? 0.4246 0.3006 0.3693 0.1023  -0.0617 0.0361  512 ASN G ND2 
3169 N N   . MET G 63  ? 0.2423 0.1703 0.1757 0.0577  -0.0588 0.0053  513 MET G N   
3170 C CA  . MET G 63  ? 0.2572 0.1728 0.1660 0.0490  -0.0588 0.0004  513 MET G CA  
3171 C C   . MET G 63  ? 0.2397 0.1594 0.1607 0.0475  -0.0554 -0.0080 513 MET G C   
3172 O O   . MET G 63  ? 0.2374 0.1764 0.1802 0.0474  -0.0598 -0.0080 513 MET G O   
3173 C CB  . MET G 63  ? 0.2758 0.1970 0.1674 0.0409  -0.0754 0.0042  513 MET G CB  
3174 C CG  . MET G 63  ? 0.3176 0.2332 0.1885 0.0433  -0.0837 0.0144  513 MET G CG  
3175 S SD  . MET G 63  ? 0.3964 0.2746 0.2232 0.0390  -0.0695 0.0128  513 MET G SD  
3176 C CE  . MET G 63  ? 0.4719 0.3458 0.2612 0.0354  -0.0887 0.0252  513 MET G CE  
3177 N N   . TYR G 64  ? 0.2081 0.1616 0.1147 0.0577  -0.0531 -0.0170 514 TYR G N   
3178 C CA  . TYR G 64  ? 0.1845 0.1469 0.1102 0.0448  -0.0523 -0.0141 514 TYR G CA  
3179 C C   . TYR G 64  ? 0.1702 0.1597 0.1206 0.0396  -0.0531 -0.0162 514 TYR G C   
3180 O O   . TYR G 64  ? 0.1871 0.1798 0.1418 0.0396  -0.0547 -0.0211 514 TYR G O   
3181 C CB  . TYR G 64  ? 0.1949 0.1367 0.1263 0.0336  -0.0547 -0.0123 514 TYR G CB  
3182 C CG  . TYR G 64  ? 0.1989 0.1130 0.1082 0.0353  -0.0564 -0.0089 514 TYR G CG  
3183 C CD1 . TYR G 64  ? 0.2091 0.1137 0.1106 0.0305  -0.0594 -0.0036 514 TYR G CD1 
3184 C CD2 . TYR G 64  ? 0.2244 0.1196 0.1175 0.0392  -0.0563 -0.0101 514 TYR G CD2 
3185 C CE1 . TYR G 64  ? 0.2343 0.1110 0.1137 0.0308  -0.0632 -0.0012 514 TYR G CE1 
3186 C CE2 . TYR G 64  ? 0.2506 0.1185 0.1243 0.0391  -0.0598 -0.0065 514 TYR G CE2 
3187 C CZ  . TYR G 64  ? 0.2484 0.1069 0.1161 0.0355  -0.0636 -0.0028 514 TYR G CZ  
3188 O OH  . TYR G 64  ? 0.2795 0.1148 0.1322 0.0321  -0.0657 -0.0023 514 TYR G OH  
3189 N N   . ARG G 65  ? 0.1644 0.1720 0.1281 0.0332  -0.0525 -0.0122 515 ARG G N   
3190 C CA  . ARG G 65  ? 0.1535 0.1868 0.1413 0.0270  -0.0548 -0.0130 515 ARG G CA  
3191 C C   . ARG G 65  ? 0.1513 0.1921 0.1527 0.0121  -0.0566 -0.0051 515 ARG G C   
3192 O O   . ARG G 65  ? 0.1612 0.1912 0.1487 0.0079  -0.0550 0.0010  515 ARG G O   
3193 C CB  . ARG G 65  ? 0.1869 0.2463 0.1762 0.0385  -0.0527 -0.0156 515 ARG G CB  
3194 C CG  . ARG G 65  ? 0.2144 0.2890 0.1992 0.0426  -0.0446 -0.0129 515 ARG G CG  
3195 C CD  . ARG G 65  ? 0.3182 0.4175 0.3093 0.0589  -0.0418 -0.0180 515 ARG G CD  
3196 N NE  . ARG G 65  ? 0.3878 0.5113 0.3828 0.0600  -0.0303 -0.0181 515 ARG G NE  
3197 C CZ  . ARG G 65  ? 0.4340 0.5796 0.4370 0.0767  -0.0241 -0.0249 515 ARG G CZ  
3198 N NH1 . ARG G 65  ? 0.4286 0.5714 0.4359 0.0939  -0.0326 -0.0297 515 ARG G NH1 
3199 N NH2 . ARG G 65  ? 0.4665 0.6369 0.4732 0.0756  -0.0096 -0.0272 515 ARG G NH2 
3200 N N   . PHE G 66  ? 0.1493 0.2055 0.1752 0.0024  -0.0618 -0.0048 516 PHE G N   
3201 C CA  . PHE G 66  ? 0.1529 0.2217 0.1914 -0.0131 -0.0647 0.0049  516 PHE G CA  
3202 C C   . PHE G 66  ? 0.1676 0.2727 0.2127 -0.0108 -0.0584 0.0054  516 PHE G C   
3203 O O   . PHE G 66  ? 0.2075 0.3252 0.2388 -0.0060 -0.0482 0.0072  516 PHE G O   
3204 C CB  . PHE G 66  ? 0.1697 0.2289 0.2343 -0.0270 -0.0767 0.0059  516 PHE G CB  
3205 C CG  . PHE G 66  ? 0.1603 0.1884 0.2270 -0.0303 -0.0831 0.0068  516 PHE G CG  
3206 C CD1 . PHE G 66  ? 0.1697 0.1832 0.2230 -0.0377 -0.0861 0.0181  516 PHE G CD1 
3207 C CD2 . PHE G 66  ? 0.1694 0.1839 0.2513 -0.0265 -0.0857 -0.0044 516 PHE G CD2 
3208 C CE1 . PHE G 66  ? 0.2287 0.2148 0.2887 -0.0407 -0.0949 0.0198  516 PHE G CE1 
3209 C CE2 . PHE G 66  ? 0.2050 0.1955 0.2955 -0.0281 -0.0894 -0.0043 516 PHE G CE2 
3210 C CZ  . PHE G 66  ? 0.2299 0.2063 0.3107 -0.0340 -0.0942 0.0086  516 PHE G CZ  
3211 N N   . GLU G 67  ? 0.1813 0.3042 0.2486 -0.0133 -0.0642 0.0021  517 GLU G N   
3212 C CA  . GLU G 67  ? 0.2091 0.3702 0.2909 -0.0112 -0.0606 0.0023  517 GLU G CA  
3213 C C   . GLU G 67  ? 0.1957 0.3648 0.2837 0.0013  -0.0663 -0.0069 517 GLU G C   
3214 O O   . GLU G 67  ? 0.2591 0.4610 0.3658 0.0034  -0.0672 -0.0069 517 GLU G O   
3215 C CB  . GLU G 67  ? 0.2649 0.4450 0.3706 -0.0324 -0.0659 0.0113  517 GLU G CB  
3216 C CG  . GLU G 67  ? 0.3403 0.5302 0.4392 -0.0466 -0.0577 0.0231  517 GLU G CG  
3217 C CD  . GLU G 67  ? 0.3863 0.5947 0.5085 -0.0702 -0.0646 0.0340  517 GLU G CD  
3218 O OE1 . GLU G 67  ? 0.3783 0.5871 0.5228 -0.0743 -0.0775 0.0310  517 GLU G OE1 
3219 O OE2 . GLU G 67  ? 0.4044 0.6253 0.5201 -0.0864 -0.0577 0.0456  517 GLU G OE2 
3220 N N   . GLY G 68  ? 0.1558 0.2971 0.2287 0.0080  -0.0706 -0.0140 518 GLY G N   
3221 C CA  . GLY G 68  ? 0.1735 0.3179 0.2457 0.0148  -0.0784 -0.0214 518 GLY G CA  
3222 C C   . GLY G 68  ? 0.1657 0.2864 0.2094 0.0287  -0.0770 -0.0262 518 GLY G C   
3223 O O   . GLY G 68  ? 0.2416 0.3620 0.2736 0.0419  -0.0719 -0.0243 518 GLY G O   
3224 N N   . THR G 69  ? 0.1672 0.2672 0.1987 0.0248  -0.0811 -0.0332 519 THR G N   
3225 C CA  . THR G 69  ? 0.1986 0.2758 0.1998 0.0337  -0.0802 -0.0363 519 THR G CA  
3226 C C   . THR G 69  ? 0.1647 0.2222 0.1524 0.0386  -0.0711 -0.0327 519 THR G C   
3227 O O   . THR G 69  ? 0.1721 0.2220 0.1691 0.0308  -0.0664 -0.0314 519 THR G O   
3228 C CB  . THR G 69  ? 0.2003 0.2604 0.1904 0.0241  -0.0816 -0.0459 519 THR G CB  
3229 O OG1 . THR G 69  ? 0.1987 0.2732 0.1953 0.0190  -0.0923 -0.0500 519 THR G OG1 
3230 C CG2 . THR G 69  ? 0.2043 0.2406 0.1598 0.0285  -0.0788 -0.0474 519 THR G CG2 
3231 N N   . GLY G 70  ? 0.1907 0.2374 0.1567 0.0513  -0.0716 -0.0305 520 GLY G N   
3232 C CA  . GLY G 70  ? 0.1848 0.2078 0.1332 0.0556  -0.0655 -0.0277 520 GLY G CA  
3233 C C   . GLY G 70  ? 0.2012 0.1971 0.1262 0.0513  -0.0648 -0.0300 520 GLY G C   
3234 O O   . GLY G 70  ? 0.2308 0.2226 0.1399 0.0513  -0.0703 -0.0318 520 GLY G O   
3235 N N   . PHE G 71  ? 0.2153 0.1933 0.1376 0.0460  -0.0584 -0.0292 521 PHE G N   
3236 C CA  . PHE G 71  ? 0.2384 0.1936 0.1421 0.0403  -0.0548 -0.0307 521 PHE G CA  
3237 C C   . PHE G 71  ? 0.2603 0.1933 0.1480 0.0454  -0.0544 -0.0243 521 PHE G C   
3238 O O   . PHE G 71  ? 0.2418 0.1758 0.1359 0.0500  -0.0549 -0.0210 521 PHE G O   
3239 C CB  . PHE G 71  ? 0.2515 0.2078 0.1757 0.0271  -0.0476 -0.0380 521 PHE G CB  
3240 C CG  . PHE G 71  ? 0.2337 0.2073 0.1734 0.0214  -0.0485 -0.0469 521 PHE G CG  
3241 C CD1 . PHE G 71  ? 0.1961 0.1862 0.1646 0.0194  -0.0526 -0.0469 521 PHE G CD1 
3242 C CD2 . PHE G 71  ? 0.3000 0.2709 0.2219 0.0159  -0.0461 -0.0550 521 PHE G CD2 
3243 C CE1 . PHE G 71  ? 0.2397 0.2421 0.2226 0.0133  -0.0556 -0.0553 521 PHE G CE1 
3244 C CE2 . PHE G 71  ? 0.3055 0.2888 0.2383 0.0100  -0.0481 -0.0651 521 PHE G CE2 
3245 C CZ  . PHE G 71  ? 0.2760 0.2746 0.2412 0.0093  -0.0535 -0.0654 521 PHE G CZ  
3246 N N   . SER G 72  ? 0.3002 0.2185 0.2235 0.0426  -0.0952 0.0291  522 SER G N   
3247 C CA  . SER G 72  ? 0.2672 0.1879 0.1884 0.0406  -0.0834 0.0356  522 SER G CA  
3248 C C   . SER G 72  ? 0.2482 0.1907 0.1816 0.0323  -0.0592 0.0386  522 SER G C   
3249 O O   . SER G 72  ? 0.2321 0.1853 0.1764 0.0292  -0.0479 0.0423  522 SER G O   
3250 C CB  . SER G 72  ? 0.3396 0.2294 0.2163 0.0408  -0.0803 0.0384  522 SER G CB  
3251 O OG  . SER G 72  ? 0.3550 0.2303 0.1991 0.0369  -0.0680 0.0398  522 SER G OG  
3252 N N   . ASN G 73  ? 0.2130 0.1610 0.1445 0.0291  -0.0522 0.0367  523 ASN G N   
3253 C CA  . ASN G 73  ? 0.2044 0.1688 0.1435 0.0225  -0.0315 0.0387  523 ASN G CA  
3254 C C   . ASN G 73  ? 0.1757 0.1556 0.1337 0.0205  -0.0306 0.0344  523 ASN G C   
3255 O O   . ASN G 73  ? 0.1897 0.1619 0.1432 0.0236  -0.0429 0.0303  523 ASN G O   
3256 C CB  . ASN G 73  ? 0.2555 0.2003 0.1572 0.0201  -0.0186 0.0414  523 ASN G CB  
3257 C CG  . ASN G 73  ? 0.3249 0.2466 0.1954 0.0223  -0.0244 0.0386  523 ASN G CG  
3258 O OD1 . ASN G 73  ? 0.2848 0.2126 0.1566 0.0198  -0.0167 0.0358  523 ASN G OD1 
3259 N ND2 . ASN G 73  ? 0.3659 0.2592 0.2073 0.0274  -0.0395 0.0388  523 ASN G ND2 
3260 N N   . ILE G 74  ? 0.1395 0.1390 0.1169 0.0156  -0.0167 0.0353  524 ILE G N   
3261 C CA  . ILE G 74  ? 0.1248 0.1381 0.1202 0.0134  -0.0151 0.0317  524 ILE G CA  
3262 C C   . ILE G 74  ? 0.1389 0.1414 0.1128 0.0140  -0.0129 0.0293  524 ILE G C   
3263 O O   . ILE G 74  ? 0.1404 0.1441 0.1202 0.0150  -0.0205 0.0252  524 ILE G O   
3264 C CB  . ILE G 74  ? 0.1023 0.1348 0.1206 0.0086  -0.0030 0.0334  524 ILE G CB  
3265 C CG1 . ILE G 74  ? 0.0915 0.1337 0.1336 0.0078  -0.0065 0.0339  524 ILE G CG1 
3266 C CG2 . ILE G 74  ? 0.0997 0.1403 0.1281 0.0066  -0.0006 0.0301  524 ILE G CG2 
3267 C CD1 . ILE G 74  ? 0.1020 0.1577 0.1609 0.0028  0.0050  0.0360  524 ILE G CD1 
3268 N N   . PRO G 75  ? 0.1458 0.1378 0.0962 0.0128  -0.0017 0.0308  525 PRO G N   
3269 C CA  . PRO G 75  ? 0.1905 0.1712 0.1212 0.0132  0.0015  0.0272  525 PRO G CA  
3270 C C   . PRO G 75  ? 0.1907 0.1517 0.1011 0.0173  -0.0137 0.0247  525 PRO G C   
3271 O O   . PRO G 75  ? 0.2097 0.1686 0.1172 0.0179  -0.0161 0.0207  525 PRO G O   
3272 C CB  . PRO G 75  ? 0.2113 0.1817 0.1207 0.0105  0.0173  0.0286  525 PRO G CB  
3273 C CG  . PRO G 75  ? 0.1928 0.1796 0.1227 0.0078  0.0248  0.0322  525 PRO G CG  
3274 C CD  . PRO G 75  ? 0.1701 0.1614 0.1139 0.0102  0.0109  0.0346  525 PRO G CD  
3275 N N   . GLN G 76  ? 0.2088 0.1542 0.1053 0.0207  -0.0258 0.0265  526 GLN G N   
3276 C CA  . GLN G 76  ? 0.2367 0.1617 0.1142 0.0254  -0.0435 0.0233  526 GLN G CA  
3277 C C   . GLN G 76  ? 0.2176 0.1599 0.1274 0.0266  -0.0560 0.0188  526 GLN G C   
3278 O O   . GLN G 76  ? 0.2353 0.1683 0.1361 0.0285  -0.0649 0.0145  526 GLN G O   
3279 C CB  . GLN G 76  ? 0.2832 0.1857 0.1390 0.0298  -0.0561 0.0257  526 GLN G CB  
3280 C CG  . GLN G 76  ? 0.3529 0.2261 0.1788 0.0352  -0.0753 0.0225  526 GLN G CG  
3281 C CD  . GLN G 76  ? 0.4298 0.2802 0.2363 0.0385  -0.0851 0.0233  526 GLN G CD  
3282 O OE1 . GLN G 76  ? 0.4551 0.3099 0.2671 0.0379  -0.0801 0.0273  526 GLN G OE1 
3283 N NE2 . GLN G 76  ? 0.4437 0.2699 0.2300 0.0416  -0.0981 0.0185  526 GLN G NE2 
3284 N N   . LEU G 77  ? 0.1949 0.1609 0.1416 0.0250  -0.0557 0.0191  527 LEU G N   
3285 C CA  . LEU G 77  ? 0.1794 0.1616 0.1586 0.0244  -0.0640 0.0141  527 LEU G CA  
3286 C C   . LEU G 77  ? 0.1590 0.1489 0.1421 0.0210  -0.0552 0.0119  527 LEU G C   
3287 O O   . LEU G 77  ? 0.1745 0.1624 0.1615 0.0218  -0.0644 0.0069  527 LEU G O   
3288 C CB  . LEU G 77  ? 0.1513 0.1544 0.1657 0.0218  -0.0606 0.0149  527 LEU G CB  
3289 C CG  . LEU G 77  ? 0.1487 0.1691 0.1993 0.0189  -0.0640 0.0092  527 LEU G CG  
3290 C CD1 . LEU G 77  ? 0.1865 0.2006 0.2455 0.0232  -0.0841 0.0022  527 LEU G CD1 
3291 C CD2 . LEU G 77  ? 0.1489 0.1865 0.2287 0.0149  -0.0556 0.0103  527 LEU G CD2 
3292 N N   . ILE G 78  ? 0.1446 0.1430 0.1277 0.0175  -0.0385 0.0151  528 ILE G N   
3293 C CA  . ILE G 78  ? 0.1429 0.1477 0.1303 0.0152  -0.0311 0.0128  528 ILE G CA  
3294 C C   . ILE G 78  ? 0.1778 0.1649 0.1374 0.0176  -0.0335 0.0099  528 ILE G C   
3295 O O   . ILE G 78  ? 0.1615 0.1488 0.1250 0.0176  -0.0377 0.0058  528 ILE G O   
3296 C CB  . ILE G 78  ? 0.1175 0.1338 0.1118 0.0120  -0.0152 0.0160  528 ILE G CB  
3297 C CG1 . ILE G 78  ? 0.1277 0.1588 0.1468 0.0091  -0.0130 0.0186  528 ILE G CG1 
3298 C CG2 . ILE G 78  ? 0.1474 0.1675 0.1445 0.0110  -0.0098 0.0129  528 ILE G CG2 
3299 C CD1 . ILE G 78  ? 0.1948 0.2345 0.2374 0.0067  -0.0182 0.0155  528 ILE G CD1 
3300 N N   . ASP G 79  ? 0.1912 0.1603 0.1206 0.0192  -0.0299 0.0117  529 ASP G N   
3301 C CA  . ASP G 79  ? 0.2257 0.1737 0.1242 0.0208  -0.0303 0.0086  529 ASP G CA  
3302 C C   . ASP G 79  ? 0.2476 0.1838 0.1403 0.0242  -0.0495 0.0049  529 ASP G C   
3303 O O   . ASP G 79  ? 0.2480 0.1757 0.1297 0.0248  -0.0517 0.0008  529 ASP G O   
3304 C CB  . ASP G 79  ? 0.2870 0.2126 0.1502 0.0210  -0.0229 0.0111  529 ASP G CB  
3305 C CG  . ASP G 79  ? 0.3423 0.2779 0.2104 0.0171  -0.0024 0.0127  529 ASP G CG  
3306 O OD1 . ASP G 79  ? 0.3585 0.3166 0.2547 0.0153  0.0045  0.0116  529 ASP G OD1 
3307 O OD2 . ASP G 79  ? 0.4325 0.3515 0.2754 0.0158  0.0063  0.0146  529 ASP G OD2 
3308 N N   . HIS G 80  ? 0.2335 0.1688 0.1347 0.0266  -0.0643 0.0054  530 HIS G N   
3309 C CA  . HIS G 80  ? 0.2475 0.1736 0.1493 0.0302  -0.0848 0.0004  530 HIS G CA  
3310 C C   . HIS G 80  ? 0.2418 0.1852 0.1716 0.0277  -0.0859 -0.0043 530 HIS G C   
3311 O O   . HIS G 80  ? 0.2583 0.1903 0.1764 0.0290  -0.0939 -0.0088 530 HIS G O   
3312 C CB  . HIS G 80  ? 0.2706 0.1982 0.1874 0.0334  -0.1001 0.0004  530 HIS G CB  
3313 C CG  . HIS G 80  ? 0.3381 0.2635 0.2693 0.0367  -0.1219 -0.0066 530 HIS G CG  
3314 N ND1 . HIS G 80  ? 0.3765 0.2754 0.2794 0.0405  -0.1346 -0.0100 530 HIS G ND1 
3315 C CD2 . HIS G 80  ? 0.3366 0.2833 0.3107 0.0353  -0.1289 -0.0119 530 HIS G CD2 
3316 C CE1 . HIS G 80  ? 0.3887 0.2943 0.3191 0.0411  -0.1466 -0.0170 530 HIS G CE1 
3317 N NE2 . HIS G 80  ? 0.3776 0.3121 0.3512 0.0376  -0.1423 -0.0185 530 HIS G NE2 
3318 N N   . HIS G 81  ? 0.1941 0.1623 0.1578 0.0236  -0.0770 -0.0034 531 HIS G N   
3319 C CA  . HIS G 81  ? 0.1954 0.1765 0.1830 0.0204  -0.0768 -0.0077 531 HIS G CA  
3320 C C   . HIS G 81  ? 0.1812 0.1579 0.1532 0.0194  -0.0667 -0.0082 531 HIS G C   
3321 O O   . HIS G 81  ? 0.1848 0.1597 0.1600 0.0188  -0.0716 -0.0129 531 HIS G O   
3322 C CB  . HIS G 81  ? 0.1731 0.1759 0.1951 0.0158  -0.0693 -0.0065 531 HIS G CB  
3323 C CG  . HIS G 81  ? 0.1651 0.1746 0.2120 0.0162  -0.0807 -0.0097 531 HIS G CG  
3324 N ND1 . HIS G 81  ? 0.1643 0.1794 0.2358 0.0144  -0.0902 -0.0171 531 HIS G ND1 
3325 C CD2 . HIS G 81  ? 0.2071 0.2182 0.2597 0.0183  -0.0844 -0.0076 531 HIS G CD2 
3326 C CE1 . HIS G 81  ? 0.2286 0.2501 0.3231 0.0155  -0.0990 -0.0201 531 HIS G CE1 
3327 N NE2 . HIS G 81  ? 0.2096 0.2284 0.2924 0.0183  -0.0963 -0.0142 531 HIS G NE2 
3328 N N   . TYR G 82  ? 0.1808 0.1558 0.1377 0.0193  -0.0527 -0.0043 532 TYR G N   
3329 C CA  . TYR G 82  ? 0.1989 0.1709 0.1452 0.0190  -0.0430 -0.0062 532 TYR G CA  
3330 C C   . TYR G 82  ? 0.2275 0.1774 0.1441 0.0218  -0.0493 -0.0100 532 TYR G C   
3331 O O   . TYR G 82  ? 0.2512 0.1986 0.1661 0.0218  -0.0490 -0.0140 532 TYR G O   
3332 C CB  . TYR G 82  ? 0.1990 0.1755 0.1409 0.0181  -0.0267 -0.0029 532 TYR G CB  
3333 C CG  . TYR G 82  ? 0.2206 0.1954 0.1561 0.0184  -0.0165 -0.0063 532 TYR G CG  
3334 C CD1 . TYR G 82  ? 0.1825 0.1682 0.1368 0.0177  -0.0154 -0.0085 532 TYR G CD1 
3335 C CD2 . TYR G 82  ? 0.2891 0.2494 0.1993 0.0194  -0.0074 -0.0080 532 TYR G CD2 
3336 C CE1 . TYR G 82  ? 0.2123 0.1963 0.1629 0.0190  -0.0075 -0.0124 532 TYR G CE1 
3337 C CE2 . TYR G 82  ? 0.3221 0.2822 0.2308 0.0199  0.0027  -0.0126 532 TYR G CE2 
3338 C CZ  . TYR G 82  ? 0.2913 0.2642 0.2217 0.0203  0.0016  -0.0149 532 TYR G CZ  
3339 O OH  . TYR G 82  ? 0.3584 0.3310 0.2894 0.0218  0.0102  -0.0203 532 TYR G OH  
3340 N N   . THR G 83  ? 0.2510 0.1815 0.1409 0.0242  -0.0552 -0.0089 533 THR G N   
3341 C CA  . THR G 83  ? 0.2898 0.1940 0.1447 0.0265  -0.0600 -0.0123 533 THR G CA  
3342 C C   . THR G 83  ? 0.3416 0.2386 0.1989 0.0287  -0.0805 -0.0169 533 THR G C   
3343 O O   . THR G 83  ? 0.3813 0.2649 0.2223 0.0295  -0.0835 -0.0212 533 THR G O   
3344 C CB  . THR G 83  ? 0.3486 0.2277 0.1660 0.0279  -0.0576 -0.0096 533 THR G CB  
3345 O OG1 . THR G 83  ? 0.4148 0.2909 0.2353 0.0303  -0.0725 -0.0071 533 THR G OG1 
3346 C CG2 . THR G 83  ? 0.3769 0.2622 0.1924 0.0249  -0.0357 -0.0067 533 THR G CG2 
3347 N N   . THR G 84  ? 0.2927 0.1982 0.1716 0.0296  -0.0946 -0.0169 534 THR G N   
3348 C CA  . THR G 84  ? 0.3305 0.2306 0.2168 0.0316  -0.1152 -0.0228 534 THR G CA  
3349 C C   . THR G 84  ? 0.2779 0.1999 0.2011 0.0278  -0.1147 -0.0270 534 THR G C   
3350 O O   . THR G 84  ? 0.2829 0.2006 0.2130 0.0284  -0.1294 -0.0332 534 THR G O   
3351 C CB  . THR G 84  ? 0.3274 0.2253 0.2228 0.0350  -0.1325 -0.0232 534 THR G CB  
3352 O OG1 . THR G 84  ? 0.3115 0.2370 0.2466 0.0319  -0.1259 -0.0213 534 THR G OG1 
3353 C CG2 . THR G 84  ? 0.3759 0.2476 0.2314 0.0385  -0.1330 -0.0187 534 THR G CG2 
3354 N N   . LYS G 85  ? 0.2466 0.1893 0.1921 0.0237  -0.0988 -0.0240 535 LYS G N   
3355 C CA  . LYS G 85  ? 0.2202 0.1802 0.1973 0.0191  -0.0961 -0.0271 535 LYS G CA  
3356 C C   . LYS G 85  ? 0.2018 0.1728 0.2114 0.0173  -0.1080 -0.0315 535 LYS G C   
3357 O O   . LYS G 85  ? 0.2222 0.2011 0.2546 0.0131  -0.1094 -0.0367 535 LYS G O   
3358 C CB  . LYS G 85  ? 0.2280 0.1795 0.1947 0.0186  -0.0963 -0.0314 535 LYS G CB  
3359 C CG  . LYS G 85  ? 0.2291 0.1716 0.1693 0.0203  -0.0833 -0.0290 535 LYS G CG  
3360 C CD  . LYS G 85  ? 0.2052 0.1629 0.1575 0.0182  -0.0670 -0.0241 535 LYS G CD  
3361 C CE  . LYS G 85  ? 0.2255 0.1759 0.1571 0.0202  -0.0545 -0.0237 535 LYS G CE  
3362 N NZ  . LYS G 85  ? 0.2192 0.1828 0.1612 0.0193  -0.0410 -0.0193 535 LYS G NZ  
3363 N N   . GLN G 86  ? 0.2102 0.1809 0.2233 0.0202  -0.1161 -0.0304 536 GLN G N   
3364 C CA  . GLN G 86  ? 0.2145 0.1986 0.2645 0.0186  -0.1255 -0.0355 536 GLN G CA  
3365 C C   . GLN G 86  ? 0.1999 0.2048 0.2803 0.0115  -0.1093 -0.0341 536 GLN G C   
3366 O O   . GLN G 86  ? 0.1678 0.1772 0.2409 0.0102  -0.0946 -0.0271 536 GLN G O   
3367 C CB  . GLN G 86  ? 0.2690 0.2465 0.3129 0.0236  -0.1328 -0.0330 536 GLN G CB  
3368 C CG  . GLN G 86  ? 0.2961 0.2826 0.3735 0.0231  -0.1366 -0.0380 536 GLN G CG  
3369 C CD  . GLN G 86  ? 0.3337 0.3087 0.3999 0.0289  -0.1451 -0.0362 536 GLN G CD  
3370 O OE1 . GLN G 86  ? 0.4362 0.3903 0.4654 0.0337  -0.1516 -0.0327 536 GLN G OE1 
3371 N NE2 . GLN G 86  ? 0.3404 0.3267 0.4363 0.0281  -0.1441 -0.0388 536 GLN G NE2 
3372 N N   . VAL G 87  ? 0.1772 0.2023 0.3088 -0.0097 -0.0947 -0.0626 537 VAL G N   
3373 C CA  . VAL G 87  ? 0.1609 0.2022 0.3031 -0.0164 -0.0765 -0.0665 537 VAL G CA  
3374 C C   . VAL G 87  ? 0.1575 0.2082 0.3255 -0.0094 -0.0706 -0.0703 537 VAL G C   
3375 O O   . VAL G 87  ? 0.1737 0.2233 0.3628 -0.0021 -0.0807 -0.0717 537 VAL G O   
3376 C CB  . VAL G 87  ? 0.1706 0.2238 0.3201 -0.0261 -0.0753 -0.0707 537 VAL G CB  
3377 C CG1 . VAL G 87  ? 0.2315 0.2712 0.3558 -0.0349 -0.0788 -0.0688 537 VAL G CG1 
3378 C CG2 . VAL G 87  ? 0.1927 0.2546 0.3670 -0.0222 -0.0874 -0.0749 537 VAL G CG2 
3379 N N   . ILE G 88  ? 0.1447 0.2030 0.3107 -0.0114 -0.0554 -0.0725 538 ILE G N   
3380 C CA  . ILE G 88  ? 0.1185 0.1824 0.3054 -0.0054 -0.0490 -0.0798 538 ILE G CA  
3381 C C   . ILE G 88  ? 0.1218 0.1965 0.3356 -0.0036 -0.0513 -0.0893 538 ILE G C   
3382 O O   . ILE G 88  ? 0.1388 0.2093 0.3771 0.0038  -0.0566 -0.0943 538 ILE G O   
3383 C CB  . ILE G 88  ? 0.1106 0.1830 0.2866 -0.0087 -0.0340 -0.0831 538 ILE G CB  
3384 C CG1 . ILE G 88  ? 0.1704 0.2332 0.3258 -0.0093 -0.0328 -0.0741 538 ILE G CG1 
3385 C CG2 . ILE G 88  ? 0.1784 0.2561 0.3753 -0.0035 -0.0282 -0.0959 538 ILE G CG2 
3386 C CD1 . ILE G 88  ? 0.1719 0.2209 0.3373 -0.0023 -0.0411 -0.0700 538 ILE G CD1 
3387 N N   . THR G 89  ? 0.1422 0.2306 0.3552 -0.0109 -0.0474 -0.0918 539 THR G N   
3388 C CA  . THR G 89  ? 0.1331 0.2347 0.3724 -0.0107 -0.0507 -0.0997 539 THR G CA  
3389 C C   . THR G 89  ? 0.1817 0.2896 0.4139 -0.0206 -0.0551 -0.0944 539 THR G C   
3390 O O   . THR G 89  ? 0.1954 0.2981 0.4039 -0.0283 -0.0518 -0.0876 539 THR G O   
3391 C CB  . THR G 89  ? 0.1782 0.2963 0.4315 -0.0113 -0.0376 -0.1128 539 THR G CB  
3392 O OG1 . THR G 89  ? 0.1555 0.2837 0.3912 -0.0203 -0.0272 -0.1108 539 THR G OG1 
3393 C CG2 . THR G 89  ? 0.1912 0.3017 0.4502 -0.0037 -0.0327 -0.1215 539 THR G CG2 
3394 N N   . LYS G 90  ? 0.1762 0.2947 0.4316 -0.0210 -0.0634 -0.0983 540 LYS G N   
3395 C CA  . LYS G 90  ? 0.2242 0.3495 0.4773 -0.0321 -0.0685 -0.0949 540 LYS G CA  
3396 C C   . LYS G 90  ? 0.1965 0.3358 0.4484 -0.0427 -0.0547 -0.0954 540 LYS G C   
3397 O O   . LYS G 90  ? 0.2097 0.3451 0.4478 -0.0537 -0.0551 -0.0893 540 LYS G O   
3398 C CB  . LYS G 90  ? 0.3008 0.4387 0.5832 -0.0303 -0.0810 -0.0993 540 LYS G CB  
3399 C CG  . LYS G 90  ? 0.3748 0.5002 0.6605 -0.0194 -0.0975 -0.0972 540 LYS G CG  
3400 C CD  . LYS G 90  ? 0.4492 0.5841 0.7500 -0.0214 -0.1150 -0.0976 540 LYS G CD  
3401 C CE  . LYS G 90  ? 0.4642 0.5879 0.7667 -0.0094 -0.1335 -0.0934 540 LYS G CE  
3402 N NZ  . LYS G 90  ? 0.4720 0.6026 0.7765 -0.0120 -0.1535 -0.0925 540 LYS G NZ  
3403 N N   . LYS G 91  ? 0.2270 0.3819 0.4947 -0.0395 -0.0427 -0.1041 541 LYS G N   
3404 C CA  . LYS G 91  ? 0.2807 0.4534 0.5502 -0.0489 -0.0297 -0.1050 541 LYS G CA  
3405 C C   . LYS G 91  ? 0.2923 0.4538 0.5313 -0.0535 -0.0228 -0.0964 541 LYS G C   
3406 O O   . LYS G 91  ? 0.3284 0.4967 0.5649 -0.0645 -0.0178 -0.0903 541 LYS G O   
3407 C CB  . LYS G 91  ? 0.3293 0.5214 0.6184 -0.0435 -0.0187 -0.1190 541 LYS G CB  
3408 C CG  . LYS G 91  ? 0.3597 0.5725 0.6461 -0.0517 -0.0036 -0.1198 541 LYS G CG  
3409 C CD  . LYS G 91  ? 0.4073 0.6385 0.7075 -0.0460 0.0067  -0.1368 541 LYS G CD  
3410 C CE  . LYS G 91  ? 0.4417 0.6895 0.7787 -0.0432 0.0034  -0.1460 541 LYS G CE  
3411 N NZ  . LYS G 91  ? 0.4628 0.7356 0.8152 -0.0412 0.0160  -0.1628 541 LYS G NZ  
3412 N N   . SER G 92  ? 0.2354 0.3809 0.4556 -0.0453 -0.0224 -0.0958 542 SER G N   
3413 C CA  . SER G 92  ? 0.2210 0.3597 0.4163 -0.0483 -0.0155 -0.0893 542 SER G CA  
3414 C C   . SER G 92  ? 0.1825 0.3008 0.3592 -0.0537 -0.0241 -0.0783 542 SER G C   
3415 O O   . SER G 92  ? 0.2693 0.3854 0.4342 -0.0612 -0.0191 -0.0725 542 SER G O   
3416 C CB  . SER G 92  ? 0.2293 0.3620 0.4145 -0.0386 -0.0111 -0.0940 542 SER G CB  
3417 O OG  . SER G 92  ? 0.1769 0.2901 0.3571 -0.0317 -0.0211 -0.0895 542 SER G OG  
3418 N N   . GLY G 93  ? 0.1613 0.2649 0.3356 -0.0499 -0.0369 -0.0769 543 GLY G N   
3419 C CA  . GLY G 93  ? 0.1950 0.2769 0.3470 -0.0538 -0.0453 -0.0706 543 GLY G CA  
3420 C C   . GLY G 93  ? 0.1751 0.2430 0.3039 -0.0500 -0.0412 -0.0660 543 GLY G C   
3421 O O   . GLY G 93  ? 0.2140 0.2635 0.3226 -0.0544 -0.0449 -0.0624 543 GLY G O   
3422 N N   . VAL G 94  ? 0.1728 0.2480 0.3045 -0.0420 -0.0338 -0.0676 544 VAL G N   
3423 C CA  . VAL G 94  ? 0.1311 0.1989 0.2452 -0.0393 -0.0288 -0.0637 544 VAL G CA  
3424 C C   . VAL G 94  ? 0.1527 0.2021 0.2564 -0.0325 -0.0382 -0.0607 544 VAL G C   
3425 O O   . VAL G 94  ? 0.1360 0.1849 0.2528 -0.0254 -0.0447 -0.0628 544 VAL G O   
3426 C CB  . VAL G 94  ? 0.1423 0.2267 0.2643 -0.0346 -0.0177 -0.0688 544 VAL G CB  
3427 C CG1 . VAL G 94  ? 0.1173 0.1960 0.2265 -0.0302 -0.0149 -0.0656 544 VAL G CG1 
3428 C CG2 . VAL G 94  ? 0.1990 0.3024 0.3238 -0.0417 -0.0073 -0.0719 544 VAL G CG2 
3429 N N   . VAL G 95  ? 0.1408 0.1744 0.2224 -0.0338 -0.0393 -0.0567 545 VAL G N   
3430 C CA  . VAL G 95  ? 0.1510 0.1648 0.2183 -0.0262 -0.0489 -0.0543 545 VAL G CA  
3431 C C   . VAL G 95  ? 0.1477 0.1616 0.2090 -0.0226 -0.0425 -0.0520 545 VAL G C   
3432 O O   . VAL G 95  ? 0.1481 0.1665 0.1998 -0.0271 -0.0326 -0.0510 545 VAL G O   
3433 C CB  . VAL G 95  ? 0.1826 0.1705 0.2231 -0.0279 -0.0580 -0.0542 545 VAL G CB  
3434 C CG1 . VAL G 95  ? 0.2418 0.2031 0.2540 -0.0163 -0.0685 -0.0499 545 VAL G CG1 
3435 C CG2 . VAL G 95  ? 0.2075 0.2002 0.2594 -0.0318 -0.0660 -0.0580 545 VAL G CG2 
3436 N N   . LEU G 96  ? 0.1233 0.1336 0.1914 -0.0143 -0.0476 -0.0492 546 LEU G N   
3437 C CA  . LEU G 96  ? 0.1232 0.1343 0.1829 -0.0088 -0.0364 -0.0399 546 LEU G CA  
3438 C C   . LEU G 96  ? 0.1601 0.1447 0.1770 -0.0007 -0.0328 -0.0255 546 LEU G C   
3439 O O   . LEU G 96  ? 0.1915 0.1548 0.1882 0.0063  -0.0415 -0.0201 546 LEU G O   
3440 C CB  . LEU G 96  ? 0.1264 0.1417 0.2123 -0.0032 -0.0400 -0.0382 546 LEU G CB  
3441 C CG  . LEU G 96  ? 0.1020 0.1356 0.2235 -0.0060 -0.0397 -0.0502 546 LEU G CG  
3442 C CD1 . LEU G 96  ? 0.1036 0.1341 0.2505 -0.0004 -0.0419 -0.0473 546 LEU G CD1 
3443 C CD2 . LEU G 96  ? 0.1182 0.1692 0.2349 -0.0109 -0.0251 -0.0562 546 LEU G CD2 
3444 N N   . LEU G 97  ? 0.1299 0.1175 0.1323 -0.0003 -0.0202 -0.0195 547 LEU G N   
3445 C CA  . LEU G 97  ? 0.1524 0.1164 0.1168 0.0090  -0.0143 -0.0071 547 LEU G CA  
3446 C C   . LEU G 97  ? 0.1455 0.1175 0.1079 0.0162  -0.0027 0.0050  547 LEU G C   
3447 O O   . LEU G 97  ? 0.2031 0.1587 0.1432 0.0270  0.0007  0.0165  547 LEU G O   
3448 C CB  . LEU G 97  ? 0.1859 0.1398 0.1320 0.0048  -0.0099 -0.0084 547 LEU G CB  
3449 C CG  . LEU G 97  ? 0.1878 0.1288 0.1330 -0.0034 -0.0205 -0.0189 547 LEU G CG  
3450 C CD1 . LEU G 97  ? 0.2182 0.1468 0.1495 -0.0080 -0.0134 -0.0169 547 LEU G CD1 
3451 C CD2 . LEU G 97  ? 0.2416 0.1578 0.1654 0.0039  -0.0329 -0.0204 547 LEU G CD2 
3452 N N   . ASN G 98  ? 0.1290 0.1287 0.1137 0.0109  0.0038  0.0024  548 ASN G N   
3453 C CA  . ASN G 98  ? 0.1293 0.1406 0.1137 0.0166  0.0140  0.0133  548 ASN G CA  
3454 C C   . ASN G 98  ? 0.1009 0.1403 0.1237 0.0106  0.0131  0.0063  548 ASN G C   
3455 O O   . ASN G 98  ? 0.0857 0.1507 0.1262 0.0023  0.0130  -0.0058 548 ASN G O   
3456 C CB  . ASN G 98  ? 0.1450 0.1642 0.1151 0.0169  0.0222  0.0176  548 ASN G CB  
3457 C CG  . ASN G 98  ? 0.1694 0.1600 0.1102 0.0189  0.0219  0.0195  548 ASN G CG  
3458 O OD1 . ASN G 98  ? 0.2205 0.1826 0.1372 0.0275  0.0213  0.0242  548 ASN G OD1 
3459 N ND2 . ASN G 98  ? 0.1687 0.1671 0.1120 0.0107  0.0228  0.0155  548 ASN G ND2 
3460 N N   . PRO G 99  ? 0.0985 0.1341 0.1355 0.0143  0.0129  0.0130  549 PRO G N   
3461 C CA  . PRO G 99  ? 0.0647 0.1240 0.1428 0.0077  0.0122  0.0049  549 PRO G CA  
3462 C C   . PRO G 99  ? 0.0706 0.1559 0.1535 0.0065  0.0197  0.0070  549 PRO G C   
3463 O O   . PRO G 99  ? 0.0972 0.1789 0.1650 0.0143  0.0274  0.0234  549 PRO G O   
3464 C CB  . PRO G 99  ? 0.0867 0.1297 0.1755 0.0129  0.0119  0.0179  549 PRO G CB  
3465 C CG  . PRO G 99  ? 0.1703 0.1899 0.2166 0.0245  0.0171  0.0360  549 PRO G CG  
3466 C CD  . PRO G 99  ? 0.1484 0.1581 0.1646 0.0246  0.0138  0.0284  549 PRO G CD  
3467 N N   . ILE G 100 ? 0.0430 0.1545 0.1443 -0.0022 0.0170  -0.0091 550 ILE G N   
3468 C CA  . ILE G 100 ? 0.0469 0.1691 0.1423 -0.0028 0.0190  -0.0067 550 ILE G CA  
3469 C C   . ILE G 100 ? 0.0473 0.1756 0.1691 -0.0055 0.0169  -0.0045 550 ILE G C   
3470 O O   . ILE G 100 ? 0.0555 0.1815 0.1886 -0.0115 0.0104  -0.0169 550 ILE G O   
3471 C CB  . ILE G 100 ? 0.0575 0.1882 0.1396 -0.0079 0.0148  -0.0190 550 ILE G CB  
3472 C CG1 . ILE G 100 ? 0.0979 0.2257 0.1566 -0.0064 0.0176  -0.0158 550 ILE G CG1 
3473 C CG2 . ILE G 100 ? 0.0774 0.2256 0.1555 -0.0080 0.0148  -0.0183 550 ILE G CG2 
3474 C CD1 . ILE G 100 ? 0.1657 0.2865 0.2013 0.0024  0.0246  0.0028  550 ILE G CD1 
3475 N N   . PRO G 101 ? 0.0536 0.1845 0.1823 -0.0029 0.0231  0.0003  551 PRO G N   
3476 C CA  . PRO G 101 ? 0.0904 0.2412 0.2292 -0.0076 0.0193  0.0005  551 PRO G CA  
3477 C C   . PRO G 101 ? 0.1762 0.3367 0.3366 -0.0130 0.0134  -0.0002 551 PRO G C   
3478 O O   . PRO G 101 ? 0.1118 0.2761 0.2603 -0.0123 0.0125  -0.0092 551 PRO G O   
3479 C CB  . PRO G 101 ? 0.1257 0.2676 0.2655 -0.0009 0.0289  0.0146  551 PRO G CB  
3480 C CG  . PRO G 101 ? 0.1141 0.2532 0.2230 0.0064  0.0313  0.0225  551 PRO G CG  
3481 C CD  . PRO G 101 ? 0.0952 0.2252 0.1903 0.0059  0.0289  0.0161  551 PRO G CD  
3482 N N   . LYS G 102 ? 0.2625 0.4273 0.4414 -0.0203 0.0097  -0.0093 552 LYS G N   
3483 C CA  . LYS G 102 ? 0.3285 0.5041 0.5222 -0.0269 0.0037  -0.0242 552 LYS G CA  
3484 C C   . LYS G 102 ? 0.3856 0.5840 0.5892 -0.0266 0.0042  -0.0123 552 LYS G C   
3485 O O   . LYS G 102 ? 0.3969 0.5975 0.5968 -0.0208 0.0106  0.0076  552 LYS G O   
3486 C CB  . LYS G 102 ? 0.3575 0.5213 0.5778 -0.0330 0.0016  -0.0378 552 LYS G CB  
3544 N N   . LYS I 3   ? 0.3775 0.3410 0.5342 0.0639  -0.0493 -0.1444 453 LYS I N   
3545 C CA  . LYS I 3   ? 0.3385 0.3502 0.5044 0.0605  -0.0317 -0.1564 453 LYS I CA  
3546 C C   . LYS I 3   ? 0.3066 0.3254 0.4511 0.0494  -0.0215 -0.1454 453 LYS I C   
3547 O O   . LYS I 3   ? 0.3182 0.3133 0.4507 0.0470  -0.0274 -0.1279 453 LYS I O   
3548 C CB  . LYS I 3   ? 0.3628 0.4020 0.5510 0.0672  -0.0314 -0.1609 453 LYS I CB  
3549 C CG  . LYS I 3   ? 0.4772 0.5302 0.6941 0.0767  -0.0366 -0.1825 453 LYS I CG  
3550 C CD  . LYS I 3   ? 0.5490 0.5668 0.7753 0.0899  -0.0597 -0.1761 453 LYS I CD  
3551 C CE  . LYS I 3   ? 0.5562 0.5785 0.7877 0.0925  -0.0665 -0.1647 453 LYS I CE  
3552 N NZ  . LYS I 3   ? 0.5855 0.5651 0.8123 0.1002  -0.0908 -0.1508 453 LYS I NZ  
3553 N N   . PRO I 4   ? 0.1949 0.2466 0.3327 0.0412  -0.0069 -0.1561 454 PRO I N   
3554 C CA  . PRO I 4   ? 0.1747 0.2368 0.2872 0.0287  -0.0010 -0.1367 454 PRO I CA  
3555 C C   . PRO I 4   ? 0.1823 0.2513 0.2927 0.0290  0.0007  -0.1189 454 PRO I C   
3556 O O   . PRO I 4   ? 0.1808 0.2599 0.3085 0.0356  0.0018  -0.1258 454 PRO I O   
3557 C CB  . PRO I 4   ? 0.1920 0.2875 0.2943 0.0183  0.0106  -0.1500 454 PRO I CB  
3558 C CG  . PRO I 4   ? 0.2795 0.3768 0.4002 0.0231  0.0121  -0.1779 454 PRO I CG  
3559 C CD  . PRO I 4   ? 0.2031 0.2832 0.3492 0.0377  0.0020  -0.1768 454 PRO I CD  
3560 N N   . LEU I 5   ? 0.1556 0.2208 0.2465 0.0219  0.0007  -0.0982 455 LEU I N   
3561 C CA  . LEU I 5   ? 0.1352 0.2020 0.2203 0.0209  0.0027  -0.0812 455 LEU I CA  
3562 C C   . LEU I 5   ? 0.1654 0.2597 0.2473 0.0157  0.0125  -0.0872 455 LEU I C   
3563 O O   . LEU I 5   ? 0.1396 0.2377 0.2279 0.0164  0.0149  -0.0844 455 LEU I O   
3564 C CB  . LEU I 5   ? 0.1573 0.2184 0.2252 0.0160  0.0009  -0.0632 455 LEU I CB  
3565 C CG  . LEU I 5   ? 0.1357 0.1735 0.2059 0.0161  -0.0051 -0.0557 455 LEU I CG  
3566 C CD1 . LEU I 5   ? 0.1682 0.2125 0.2303 0.0125  -0.0060 -0.0480 455 LEU I CD1 
3567 C CD2 . LEU I 5   ? 0.1394 0.1615 0.2132 0.0179  -0.0064 -0.0458 455 LEU I CD2 
3568 N N   . ALA I 6   ? 0.1723 0.2865 0.2407 0.0067  0.0186  -0.0960 456 ALA I N   
3569 C CA  . ALA I 6   ? 0.2402 0.3798 0.2967 -0.0055 0.0296  -0.1024 456 ALA I CA  
3570 C C   . ALA I 6   ? 0.2580 0.4189 0.3433 -0.0017 0.0370  -0.1259 456 ALA I C   
3571 O O   . ALA I 6   ? 0.3201 0.5051 0.3987 -0.0143 0.0481  -0.1322 456 ALA I O   
3572 C CB  . ALA I 6   ? 0.2858 0.4414 0.3183 -0.0194 0.0338  -0.1092 456 ALA I CB  
3573 N N   . GLU I 7   ? 0.1756 0.3281 0.2925 0.0145  0.0299  -0.1399 457 GLU I N   
3574 C CA  . GLU I 7   ? 0.1766 0.3451 0.3255 0.0220  0.0298  -0.1600 457 GLU I CA  
3575 C C   . GLU I 7   ? 0.1900 0.3428 0.3547 0.0331  0.0192  -0.1485 457 GLU I C   
3576 O O   . GLU I 7   ? 0.2179 0.3813 0.4047 0.0379  0.0146  -0.1600 457 GLU I O   
3577 C CB  . GLU I 7   ? 0.2274 0.3884 0.3954 0.0303  0.0221  -0.1777 457 GLU I CB  
3578 C CG  . GLU I 7   ? 0.3092 0.4970 0.4694 0.0163  0.0342  -0.1958 457 GLU I CG  
3579 C CD  . GLU I 7   ? 0.3889 0.5623 0.5593 0.0229  0.0281  -0.2078 457 GLU I CD  
3580 O OE1 . GLU I 7   ? 0.4017 0.5803 0.5517 0.0117  0.0350  -0.2104 457 GLU I OE1 
3581 O OE2 . GLU I 7   ? 0.4100 0.5654 0.6057 0.0383  0.0154  -0.2136 457 GLU I OE2 
3582 N N   . GLN I 8   ? 0.1345 0.2604 0.2842 0.0342  0.0132  -0.1241 458 GLN I N   
3583 C CA  . GLN I 8   ? 0.1357 0.2459 0.2950 0.0408  0.0033  -0.1118 458 GLN I CA  
3584 C C   . GLN I 8   ? 0.1477 0.2803 0.2992 0.0291  0.0140  -0.1060 458 GLN I C   
3585 O O   . GLN I 8   ? 0.1323 0.2656 0.2537 0.0148  0.0236  -0.0930 458 GLN I O   
3586 C CB  . GLN I 8   ? 0.1360 0.2061 0.2745 0.0396  -0.0059 -0.0873 458 GLN I CB  
3587 C CG  . GLN I 8   ? 0.1582 0.2026 0.2957 0.0445  -0.0150 -0.0909 458 GLN I CG  
3588 C CD  . GLN I 8   ? 0.1764 0.2011 0.3369 0.0586  -0.0312 -0.1024 458 GLN I CD  
3589 O OE1 . GLN I 8   ? 0.2308 0.2557 0.4023 0.0630  -0.0395 -0.0995 458 GLN I OE1 
3590 N NE2 . GLN I 8   ? 0.1918 0.1982 0.3494 0.0600  -0.0372 -0.1098 458 GLN I NE2 
3591 N N   . ASP I 9   ? 0.1188 0.2673 0.2963 0.0348  0.0103  -0.1154 459 ASP I N   
3592 C CA  . ASP I 9   ? 0.1180 0.2900 0.2885 0.0206  0.0214  -0.1127 459 ASP I CA  
3593 C C   . ASP I 9   ? 0.1299 0.2714 0.2654 0.0100  0.0221  -0.0826 459 ASP I C   
3594 O O   . ASP I 9   ? 0.1654 0.3147 0.2771 -0.0069 0.0341  -0.0757 459 ASP I O   
3595 C CB  . ASP I 9   ? 0.1452 0.3299 0.3436 0.0282  0.0121  -0.1232 459 ASP I CB  
3596 C CG  . ASP I 9   ? 0.2755 0.4767 0.4957 0.0356  0.0083  -0.1492 459 ASP I CG  
3597 O OD1 . ASP I 9   ? 0.3087 0.5066 0.5530 0.0488  -0.0071 -0.1563 459 ASP I OD1 
3598 O OD2 . ASP I 9   ? 0.2599 0.4777 0.4737 0.0275  0.0195  -0.1632 459 ASP I OD2 
3599 N N   . TRP I 10  ? 0.1087 0.2141 0.2391 0.0179  0.0097  -0.0661 460 TRP I N   
3600 C CA  . TRP I 10  ? 0.1279 0.2070 0.2324 0.0096  0.0106  -0.0427 460 TRP I CA  
3601 C C   . TRP I 10  ? 0.1094 0.1728 0.1881 0.0053  0.0151  -0.0310 460 TRP I C   
3602 O O   . TRP I 10  ? 0.1137 0.1559 0.1757 0.0011  0.0155  -0.0152 460 TRP I O   
3603 C CB  . TRP I 10  ? 0.1356 0.1870 0.2452 0.0154  -0.0033 -0.0332 460 TRP I CB  
3604 C CG  . TRP I 10  ? 0.1214 0.1571 0.2423 0.0267  -0.0159 -0.0395 460 TRP I CG  
3605 C CD1 . TRP I 10  ? 0.1458 0.1808 0.2910 0.0389  -0.0305 -0.0514 460 TRP I CD1 
3606 C CD2 . TRP I 10  ? 0.1190 0.1352 0.2266 0.0262  -0.0165 -0.0352 460 TRP I CD2 
3607 N NE1 . TRP I 10  ? 0.1718 0.1812 0.3149 0.0446  -0.0400 -0.0531 460 TRP I NE1 
3608 C CE2 . TRP I 10  ? 0.1351 0.1356 0.2550 0.0353  -0.0302 -0.0440 460 TRP I CE2 
3609 C CE3 . TRP I 10  ? 0.1105 0.1218 0.1989 0.0194  -0.0083 -0.0263 460 TRP I CE3 
3610 C CZ2 . TRP I 10  ? 0.1543 0.1342 0.2637 0.0336  -0.0332 -0.0437 460 TRP I CZ2 
3611 C CZ3 . TRP I 10  ? 0.1177 0.1161 0.2016 0.0198  -0.0118 -0.0279 460 TRP I CZ3 
3612 C CH2 . TRP I 10  ? 0.1306 0.1135 0.2230 0.0247  -0.0228 -0.0363 460 TRP I CH2 
3613 N N   . TYR I 11  ? 0.1621 0.1511 0.1836 -0.0061 -0.0135 -0.0087 461 TYR I N   
3614 C CA  . TYR I 11  ? 0.1581 0.1397 0.1762 -0.0031 -0.0184 -0.0110 461 TYR I CA  
3615 C C   . TYR I 11  ? 0.1972 0.1652 0.2017 -0.0022 -0.0187 -0.0114 461 TYR I C   
3616 O O   . TYR I 11  ? 0.2053 0.1651 0.2012 -0.0016 -0.0162 -0.0100 461 TYR I O   
3617 C CB  . TYR I 11  ? 0.1611 0.1415 0.1824 -0.0004 -0.0216 -0.0120 461 TYR I CB  
3618 C CG  . TYR I 11  ? 0.1647 0.1375 0.1844 0.0034  -0.0281 -0.0158 461 TYR I CG  
3619 C CD1 . TYR I 11  ? 0.1758 0.1537 0.2053 0.0039  -0.0305 -0.0182 461 TYR I CD1 
3620 C CD2 . TYR I 11  ? 0.1774 0.1369 0.1854 0.0073  -0.0321 -0.0173 461 TYR I CD2 
3621 C CE1 . TYR I 11  ? 0.2034 0.1748 0.2336 0.0076  -0.0373 -0.0226 461 TYR I CE1 
3622 C CE2 . TYR I 11  ? 0.2072 0.1587 0.2134 0.0120  -0.0398 -0.0219 461 TYR I CE2 
3623 C CZ  . TYR I 11  ? 0.2323 0.1906 0.2510 0.0118  -0.0426 -0.0247 461 TYR I CZ  
3624 O OH  . TYR I 11  ? 0.3525 0.3036 0.3717 0.0167  -0.0509 -0.0301 461 TYR I OH  
3625 N N   . HIS I 12  ? 0.1741 0.1385 0.1759 -0.0016 -0.0211 -0.0132 462 HIS I N   
3626 C CA  . HIS I 12  ? 0.1877 0.1382 0.1757 -0.0006 -0.0203 -0.0133 462 HIS I CA  
3627 C C   . HIS I 12  ? 0.1985 0.1369 0.1773 0.0047  -0.0270 -0.0163 462 HIS I C   
3628 O O   . HIS I 12  ? 0.2486 0.1735 0.2139 0.0065  -0.0270 -0.0166 462 HIS I O   
3629 C CB  . HIS I 12  ? 0.1853 0.1389 0.1754 -0.0039 -0.0176 -0.0131 462 HIS I CB  
3630 C CG  . HIS I 12  ? 0.2145 0.1762 0.2116 -0.0082 -0.0118 -0.0113 462 HIS I CG  
3631 N ND1 . HIS I 12  ? 0.2294 0.1856 0.2236 -0.0108 -0.0066 -0.0106 462 HIS I ND1 
3632 C CD2 . HIS I 12  ? 0.2047 0.1791 0.2125 -0.0099 -0.0107 -0.0105 462 HIS I CD2 
3633 C CE1 . HIS I 12  ? 0.2609 0.2270 0.2655 -0.0139 -0.0033 -0.0101 462 HIS I CE1 
3634 N NE2 . HIS I 12  ? 0.2075 0.1843 0.2191 -0.0131 -0.0061 -0.0100 462 HIS I NE2 
3635 N N   . GLY I 13  ? 0.2028 0.1449 0.1890 0.0075  -0.0328 -0.0189 463 GLY I N   
3636 C CA  . GLY I 13  ? 0.2063 0.1361 0.1847 0.0136  -0.0407 -0.0229 463 GLY I CA  
3637 C C   . GLY I 13  ? 0.2094 0.1364 0.1865 0.0147  -0.0443 -0.0256 463 GLY I C   
3638 O O   . GLY I 13  ? 0.2058 0.1448 0.1958 0.0117  -0.0435 -0.0260 463 GLY I O   
3639 N N   . ALA I 14  ? 0.2396 0.1491 0.1992 0.0195  -0.0481 -0.0273 464 ALA I N   
3640 C CA  . ALA I 14  ? 0.2322 0.1367 0.1895 0.0223  -0.0538 -0.0310 464 ALA I CA  
3641 C C   . ALA I 14  ? 0.2389 0.1409 0.1893 0.0189  -0.0483 -0.0284 464 ALA I C   
3642 O O   . ALA I 14  ? 0.2586 0.1516 0.2011 0.0220  -0.0525 -0.0310 464 ALA I O   
3643 C CB  . ALA I 14  ? 0.3504 0.2358 0.2916 0.0309  -0.0625 -0.0353 464 ALA I CB  
3644 N N   . ILE I 15  ? 0.2268 0.1363 0.1807 0.0129  -0.0396 -0.0241 465 ILE I N   
3645 C CA  . ILE I 15  ? 0.2583 0.1648 0.2074 0.0099  -0.0351 -0.0225 465 ILE I CA  
3646 C C   . ILE I 15  ? 0.2599 0.1752 0.2188 0.0094  -0.0393 -0.0253 465 ILE I C   
3647 O O   . ILE I 15  ? 0.2360 0.1656 0.2105 0.0083  -0.0412 -0.0264 465 ILE I O   
3648 C CB  . ILE I 15  ? 0.2294 0.1438 0.1845 0.0038  -0.0262 -0.0187 465 ILE I CB  
3649 C CG1 . ILE I 15  ? 0.2483 0.1827 0.2220 0.0003  -0.0260 -0.0185 465 ILE I CG1 
3650 C CG2 . ILE I 15  ? 0.2324 0.1365 0.1774 0.0045  -0.0208 -0.0160 465 ILE I CG2 
3651 C CD1 . ILE I 15  ? 0.2290 0.1713 0.2096 -0.0049 -0.0195 -0.0163 465 ILE I CD1 
3652 N N   . PRO I 16  ? 0.2306 0.1370 0.1807 0.0103  -0.0402 -0.0262 466 PRO I N   
3653 C CA  . PRO I 16  ? 0.2237 0.1378 0.1825 0.0101  -0.0442 -0.0289 466 PRO I CA  
3654 C C   . PRO I 16  ? 0.2107 0.1389 0.1809 0.0046  -0.0391 -0.0270 466 PRO I C   
3655 O O   . PRO I 16  ? 0.2089 0.1394 0.1797 0.0008  -0.0331 -0.0241 466 PRO I O   
3656 C CB  . PRO I 16  ? 0.2500 0.1474 0.1925 0.0132  -0.0463 -0.0302 466 PRO I CB  
3657 C CG  . PRO I 16  ? 0.2774 0.1624 0.2064 0.0118  -0.0389 -0.0265 466 PRO I CG  
3658 C CD  . PRO I 16  ? 0.2594 0.1463 0.1898 0.0122  -0.0373 -0.0249 466 PRO I CD  
3659 N N   . ARG I 17  ? 0.2032 0.1401 0.1826 0.0048  -0.0421 -0.0291 467 ARG I N   
3660 C CA  . ARG I 17  ? 0.1944 0.1428 0.1824 0.0013  -0.0387 -0.0280 467 ARG I CA  
3661 C C   . ARG I 17  ? 0.1985 0.1421 0.1805 -0.0020 -0.0348 -0.0265 467 ARG I C   
3662 O O   . ARG I 17  ? 0.1922 0.1437 0.1805 -0.0052 -0.0310 -0.0251 467 ARG I O   
3663 C CB  . ARG I 17  ? 0.2272 0.1806 0.2212 0.0031  -0.0422 -0.0307 467 ARG I CB  
3664 C CG  . ARG I 17  ? 0.2051 0.1675 0.2044 0.0009  -0.0395 -0.0298 467 ARG I CG  
3665 C CD  . ARG I 17  ? 0.2261 0.1921 0.2299 0.0033  -0.0419 -0.0322 467 ARG I CD  
3666 N NE  . ARG I 17  ? 0.2415 0.2144 0.2561 0.0053  -0.0416 -0.0328 467 ARG I NE  
3667 C CZ  . ARG I 17  ? 0.2023 0.1823 0.2244 0.0066  -0.0393 -0.0330 467 ARG I CZ  
3668 N NH1 . ARG I 17  ? 0.2013 0.1827 0.2199 0.0066  -0.0384 -0.0328 467 ARG I NH1 
3669 N NH2 . ARG I 17  ? 0.1905 0.1755 0.2239 0.0082  -0.0376 -0.0336 467 ARG I NH2 
3670 N N   . ILE I 18  ? 0.2111 0.1412 0.1815 -0.0008 -0.0356 -0.0273 468 ILE I N   
3671 C CA  . ILE I 18  ? 0.2166 0.1413 0.1834 -0.0041 -0.0310 -0.0262 468 ILE I CA  
3672 C C   . ILE I 18  ? 0.2254 0.1492 0.1935 -0.0073 -0.0243 -0.0236 468 ILE I C   
3673 O O   . ILE I 18  ? 0.2480 0.1756 0.2229 -0.0112 -0.0202 -0.0233 468 ILE I O   
3674 C CB  . ILE I 18  ? 0.2321 0.1401 0.1846 -0.0017 -0.0323 -0.0272 468 ILE I CB  
3675 C CG1 . ILE I 18  ? 0.2759 0.1792 0.2280 -0.0056 -0.0270 -0.0265 468 ILE I CG1 
3676 C CG2 . ILE I 18  ? 0.2613 0.1532 0.1987 0.0021  -0.0320 -0.0262 468 ILE I CG2 
3677 C CD1 . ILE I 18  ? 0.3066 0.2234 0.2714 -0.0081 -0.0288 -0.0284 468 ILE I CD1 
3678 N N   . GLU I 19  ? 0.2328 0.1517 0.1955 -0.0054 -0.0235 -0.0221 469 GLU I N   
3679 C CA  . GLU I 19  ? 0.2217 0.1401 0.1861 -0.0082 -0.0167 -0.0195 469 GLU I CA  
3680 C C   . GLU I 19  ? 0.2459 0.1820 0.2258 -0.0108 -0.0165 -0.0193 469 GLU I C   
3681 O O   . GLU I 19  ? 0.2713 0.2115 0.2585 -0.0144 -0.0115 -0.0185 469 GLU I O   
3682 C CB  . GLU I 19  ? 0.2773 0.1826 0.2285 -0.0045 -0.0159 -0.0180 469 GLU I CB  
3683 C CG  . GLU I 19  ? 0.2985 0.1820 0.2309 -0.0016 -0.0133 -0.0174 469 GLU I CG  
3684 C CD  . GLU I 19  ? 0.3527 0.2209 0.2688 0.0036  -0.0131 -0.0161 469 GLU I CD  
3685 O OE1 . GLU I 19  ? 0.3728 0.2216 0.2700 0.0087  -0.0143 -0.0165 469 GLU I OE1 
3686 O OE2 . GLU I 19  ? 0.3109 0.1853 0.2319 0.0033  -0.0122 -0.0150 469 GLU I OE2 
3687 N N   . ALA I 20  ? 0.2086 0.1546 0.1941 -0.0088 -0.0216 -0.0203 470 ALA I N   
3688 C CA  . ALA I 20  ? 0.2362 0.1969 0.2336 -0.0102 -0.0211 -0.0199 470 ALA I CA  
3689 C C   . ALA I 20  ? 0.2347 0.2023 0.2393 -0.0126 -0.0206 -0.0212 470 ALA I C   
3690 O O   . ALA I 20  ? 0.2761 0.2518 0.2887 -0.0143 -0.0188 -0.0211 470 ALA I O   
3691 C CB  . ALA I 20  ? 0.2506 0.2183 0.2524 -0.0073 -0.0252 -0.0207 470 ALA I CB  
3692 N N   . GLN I 21  ? 0.3468 0.1706 0.2956 -0.0036 -0.0904 -0.0006 471 GLN I N   
3693 C CA  . GLN I 21  ? 0.4214 0.2130 0.3583 -0.0098 -0.1007 -0.0096 471 GLN I CA  
3694 C C   . GLN I 21  ? 0.4459 0.2350 0.3885 -0.0389 -0.1053 0.0021  471 GLN I C   
3695 O O   . GLN I 21  ? 0.5044 0.2977 0.4492 -0.0505 -0.1093 -0.0028 471 GLN I O   
3696 C CB  . GLN I 21  ? 0.5499 0.2881 0.4646 0.0040  -0.1120 -0.0143 471 GLN I CB  
3697 C CG  . GLN I 21  ? 0.6590 0.3484 0.5529 -0.0083 -0.1254 -0.0213 471 GLN I CG  
3698 C CD  . GLN I 21  ? 0.7592 0.3982 0.6313 0.0070  -0.1322 -0.0242 471 GLN I CD  
3699 O OE1 . GLN I 21  ? 0.7687 0.4052 0.6372 0.0355  -0.1270 -0.0330 471 GLN I OE1 
3700 N NE2 . GLN I 21  ? 0.8115 0.4222 0.6737 -0.0112 -0.1403 -0.0149 471 GLN I NE2 
3701 N N   . GLU I 22  ? 0.3857 0.1701 0.3307 -0.0518 -0.1053 0.0190  472 GLU I N   
3702 C CA  . GLU I 22  ? 0.4156 0.2008 0.3687 -0.0800 -0.1086 0.0328  472 GLU I CA  
3703 C C   . GLU I 22  ? 0.3776 0.2151 0.3567 -0.0891 -0.0955 0.0370  472 GLU I C   
3704 O O   . GLU I 22  ? 0.3729 0.2196 0.3644 -0.1096 -0.0995 0.0447  472 GLU I O   
3705 C CB  . GLU I 22  ? 0.5283 0.2983 0.4762 -0.0905 -0.1092 0.0511  472 GLU I CB  
3706 C CG  . GLU I 22  ? 0.6784 0.3963 0.6023 -0.0810 -0.1225 0.0499  472 GLU I CG  
3707 C CD  . GLU I 22  ? 0.7676 0.4565 0.6796 -0.0880 -0.1336 0.0420  472 GLU I CD  
3708 O OE1 . GLU I 22  ? 0.7956 0.5024 0.7181 -0.1093 -0.1339 0.0479  472 GLU I OE1 
3709 O OE2 . GLU I 22  ? 0.8139 0.4641 0.7061 -0.0713 -0.1410 0.0305  472 GLU I OE2 
3710 N N   . LEU I 23  ? 0.2901 0.1616 0.2783 -0.0745 -0.0803 0.0331  473 LEU I N   
3711 C CA  . LEU I 23  ? 0.2516 0.1683 0.2630 -0.0795 -0.0653 0.0378  473 LEU I CA  
3712 C C   . LEU I 23  ? 0.2897 0.2234 0.3098 -0.0749 -0.0672 0.0272  473 LEU I C   
3713 O O   . LEU I 23  ? 0.3119 0.2800 0.3539 -0.0808 -0.0580 0.0338  473 LEU I O   
3714 C CB  . LEU I 23  ? 0.2702 0.2083 0.2818 -0.0681 -0.0485 0.0379  473 LEU I CB  
3715 C CG  . LEU I 23  ? 0.2934 0.2215 0.2947 -0.0755 -0.0445 0.0506  473 LEU I CG  
3716 C CD1 . LEU I 23  ? 0.2692 0.2118 0.2625 -0.0647 -0.0325 0.0475  473 LEU I CD1 
3717 C CD2 . LEU I 23  ? 0.3999 0.3429 0.4155 -0.0953 -0.0357 0.0668  473 LEU I CD2 
3718 N N   . LEU I 24  ? 0.2520 0.1626 0.2549 -0.0634 -0.0780 0.0118  474 LEU I N   
3719 C CA  . LEU I 24  ? 0.2734 0.1985 0.2782 -0.0581 -0.0796 0.0009  474 LEU I CA  
3720 C C   . LEU I 24  ? 0.2793 0.1766 0.2717 -0.0728 -0.0984 -0.0023 474 LEU I C   
3721 O O   . LEU I 24  ? 0.3365 0.1887 0.3037 -0.0698 -0.1098 -0.0110 474 LEU I O   
3722 C CB  . LEU I 24  ? 0.2907 0.2117 0.2815 -0.0342 -0.0756 -0.0149 474 LEU I CB  
3723 C CG  . LEU I 24  ? 0.2309 0.1772 0.2305 -0.0223 -0.0600 -0.0124 474 LEU I CG  
3724 C CD1 . LEU I 24  ? 0.3027 0.2429 0.2900 -0.0007 -0.0594 -0.0250 474 LEU I CD1 
3725 C CD2 . LEU I 24  ? 0.2102 0.1957 0.2291 -0.0252 -0.0466 -0.0080 474 LEU I CD2 
3726 N N   . LYS I 25  ? 0.2705 0.1932 0.2799 -0.0888 -0.1022 0.0053  475 LYS I N   
3727 C CA  . LYS I 25  ? 0.3349 0.2348 0.3343 -0.1100 -0.1218 0.0066  475 LYS I CA  
3728 C C   . LYS I 25  ? 0.3111 0.2291 0.3091 -0.1121 -0.1273 0.0016  475 LYS I C   
3729 O O   . LYS I 25  ? 0.3758 0.2681 0.3521 -0.1201 -0.1393 -0.0041 475 LYS I O   
3730 C CB  . LYS I 25  ? 0.3533 0.2702 0.3740 -0.1280 -0.1189 0.0280  475 LYS I CB  
3731 C CG  . LYS I 25  ? 0.4226 0.3203 0.4401 -0.1285 -0.1137 0.0355  475 LYS I CG  
3732 C CD  . LYS I 25  ? 0.4930 0.4036 0.5242 -0.1459 -0.1125 0.0540  475 LYS I CD  
3733 C CE  . LYS I 25  ? 0.5209 0.4324 0.5561 -0.1451 -0.1003 0.0649  475 LYS I CE  
3734 N NZ  . LYS I 25  ? 0.5102 0.4628 0.5676 -0.1360 -0.0796 0.0699  475 LYS I NZ  
3735 N N   . LYS I 26  ? 0.2931 0.2543 0.3129 -0.1059 -0.1184 0.0050  476 LYS I N   
3736 C CA  . LYS I 26  ? 0.2989 0.2807 0.3190 -0.1082 -0.1231 0.0042  476 LYS I CA  
3737 C C   . LYS I 26  ? 0.2514 0.2487 0.2668 -0.0900 -0.1160 -0.0068 476 LYS I C   
3738 O O   . LYS I 26  ? 0.2235 0.2309 0.2463 -0.0721 -0.0979 -0.0084 476 LYS I O   
3739 C CB  . LYS I 26  ? 0.3649 0.3908 0.4207 -0.1189 -0.1185 0.0262  476 LYS I CB  
3740 C CG  . LYS I 26  ? 0.4594 0.4786 0.5225 -0.1364 -0.1238 0.0399  476 LYS I CG  
3741 C CD  . LYS I 26  ? 0.4842 0.5311 0.5778 -0.1340 -0.1065 0.0559  476 LYS I CD  
3742 C CE  . LYS I 26  ? 0.5223 0.5588 0.6182 -0.1497 -0.1106 0.0676  476 LYS I CE  
3743 N NZ  . LYS I 26  ? 0.5036 0.5563 0.6176 -0.1441 -0.0915 0.0777  476 LYS I NZ  
3744 N N   . GLN I 27  ? 0.2746 0.2753 0.2753 -0.0906 -0.1231 -0.0131 477 GLN I N   
3745 C CA  . GLN I 27  ? 0.2462 0.2601 0.2365 -0.0750 -0.1173 -0.0230 477 GLN I CA  
3746 C C   . GLN I 27  ? 0.1957 0.2503 0.2187 -0.0624 -0.0967 -0.0111 477 GLN I C   
3747 O O   . GLN I 27  ? 0.2232 0.3118 0.2782 -0.0704 -0.0946 0.0073  477 GLN I O   
3748 C CB  . GLN I 27  ? 0.3055 0.3283 0.2848 -0.0824 -0.1264 -0.0228 477 GLN I CB  
3749 C CG  . GLN I 27  ? 0.2868 0.3239 0.2523 -0.0685 -0.1209 -0.0310 477 GLN I CG  
3750 C CD  . GLN I 27  ? 0.3915 0.3912 0.3134 -0.0558 -0.1197 -0.0551 477 GLN I CD  
3751 O OE1 . GLN I 27  ? 0.3987 0.3599 0.3027 -0.0545 -0.1216 -0.0657 477 GLN I OE1 
3752 N NE2 . GLN I 27  ? 0.4407 0.4523 0.3465 -0.0448 -0.1136 -0.0622 477 GLN I NE2 
3753 N N   . GLY I 28  ? 0.1802 0.2308 0.1952 -0.0429 -0.0814 -0.0212 478 GLY I N   
3754 C CA  . GLY I 28  ? 0.1460 0.2267 0.1836 -0.0321 -0.0624 -0.0132 478 GLY I CA  
3755 C C   . GLY I 28  ? 0.1433 0.2260 0.1986 -0.0314 -0.0499 -0.0053 478 GLY I C   
3756 O O   . GLY I 28  ? 0.1317 0.2326 0.2002 -0.0232 -0.0334 -0.0006 478 GLY I O   
3757 N N   . ASP I 29  ? 0.1499 0.2117 0.2027 -0.0408 -0.0573 -0.0036 479 ASP I N   
3758 C CA  . ASP I 29  ? 0.1497 0.2097 0.2118 -0.0400 -0.0457 0.0028  479 ASP I CA  
3759 C C   . ASP I 29  ? 0.1439 0.1950 0.1912 -0.0239 -0.0364 -0.0085 479 ASP I C   
3760 O O   . ASP I 29  ? 0.1572 0.1906 0.1844 -0.0149 -0.0431 -0.0217 479 ASP I O   
3761 C CB  . ASP I 29  ? 0.1566 0.1893 0.2114 -0.0529 -0.0579 0.0055  479 ASP I CB  
3762 C CG  . ASP I 29  ? 0.1973 0.2446 0.2733 -0.0729 -0.0650 0.0217  479 ASP I CG  
3763 O OD1 . ASP I 29  ? 0.2269 0.3088 0.3269 -0.0748 -0.0598 0.0321  479 ASP I OD1 
3764 O OD2 . ASP I 29  ? 0.2407 0.2653 0.3107 -0.0871 -0.0761 0.0255  479 ASP I OD2 
3765 N N   . PHE I 30  ? 0.1131 0.1762 0.1694 -0.0207 -0.0208 -0.0030 480 PHE I N   
3766 C CA  . PHE I 30  ? 0.1043 0.1635 0.1482 -0.0089 -0.0144 -0.0116 480 PHE I CA  
3767 C C   . PHE I 30  ? 0.1045 0.1630 0.1496 -0.0124 -0.0038 -0.0049 480 PHE I C   
3768 O O   . PHE I 30  ? 0.1140 0.1806 0.1708 -0.0204 0.0056  0.0055  480 PHE I O   
3769 C CB  . PHE I 30  ? 0.1071 0.1852 0.1516 0.0003  -0.0065 -0.0171 480 PHE I CB  
3770 C CG  . PHE I 30  ? 0.0864 0.1832 0.1455 -0.0021 0.0087  -0.0082 480 PHE I CG  
3771 C CD1 . PHE I 30  ? 0.1020 0.2135 0.1768 -0.0055 0.0095  0.0003  480 PHE I CD1 
3772 C CD2 . PHE I 30  ? 0.0884 0.1864 0.1440 -0.0008 0.0218  -0.0080 480 PHE I CD2 
3773 C CE1 . PHE I 30  ? 0.0938 0.2097 0.1779 -0.0040 0.0238  0.0079  480 PHE I CE1 
3774 C CE2 . PHE I 30  ? 0.1070 0.1990 0.1659 -0.0014 0.0342  -0.0009 480 PHE I CE2 
3775 C CZ  . PHE I 30  ? 0.1085 0.2042 0.1799 -0.0022 0.0350  0.0038  480 PHE I CZ  
3776 N N   . LEU I 31  ? 0.1454 0.1178 0.1359 -0.0025 -0.0062 -0.0031 481 LEU I N   
3777 C CA  . LEU I 31  ? 0.1503 0.1210 0.1387 -0.0062 0.0020  0.0034  481 LEU I CA  
3778 C C   . LEU I 31  ? 0.1481 0.1188 0.1250 -0.0058 0.0038  0.0030  481 LEU I C   
3779 O O   . LEU I 31  ? 0.1494 0.1235 0.1209 -0.0028 0.0015  0.0010  481 LEU I O   
3780 C CB  . LEU I 31  ? 0.1517 0.1243 0.1555 -0.0074 0.0046  0.0100  481 LEU I CB  
3781 C CG  . LEU I 31  ? 0.1494 0.1186 0.1667 -0.0083 -0.0006 0.0096  481 LEU I CG  
3782 C CD1 . LEU I 31  ? 0.1761 0.1460 0.1786 -0.0074 0.0038  0.0110  481 LEU I CD1 
3783 C CD2 . LEU I 31  ? 0.1934 0.1663 0.2477 -0.0106 -0.0012 0.0227  481 LEU I CD2 
3784 N N   . VAL I 32  ? 0.1328 0.1030 0.1077 -0.0058 0.0066  0.0034  482 VAL I N   
3785 C CA  . VAL I 32  ? 0.1632 0.1329 0.1359 -0.0059 0.0057  0.0023  482 VAL I CA  
3786 C C   . VAL I 32  ? 0.1386 0.1108 0.1054 -0.0025 0.0070  0.0005  482 VAL I C   
3787 O O   . VAL I 32  ? 0.1644 0.1434 0.1285 0.0030  0.0096  0.0012  482 VAL I O   
3788 C CB  . VAL I 32  ? 0.1298 0.0975 0.1158 -0.0062 0.0015  0.0019  482 VAL I CB  
3789 C CG1 . VAL I 32  ? 0.1536 0.1207 0.1494 -0.0065 -0.0028 0.0002  482 VAL I CG1 
3790 C CG2 . VAL I 32  ? 0.1479 0.1198 0.1421 -0.0077 0.0029  0.0124  482 VAL I CG2 
3791 N N   . ARG I 33  ? 0.1415 0.1133 0.1058 -0.0032 0.0065  0.0006  483 ARG I N   
3792 C CA  . ARG I 33  ? 0.1542 0.1314 0.1127 0.0015  0.0077  0.0017  483 ARG I CA  
3793 C C   . ARG I 33  ? 0.1463 0.1220 0.1050 0.0014  0.0035  -0.0028 483 ARG I C   
3794 O O   . ARG I 33  ? 0.1516 0.1244 0.1191 -0.0030 0.0017  -0.0023 483 ARG I O   
3795 C CB  . ARG I 33  ? 0.1560 0.1342 0.1218 -0.0000 0.0110  0.0111  483 ARG I CB  
3796 C CG  . ARG I 33  ? 0.1693 0.1399 0.1406 -0.0037 0.0067  0.0070  483 ARG I CG  
3797 C CD  . ARG I 33  ? 0.1533 0.1208 0.1458 -0.0045 0.0030  0.0109  483 ARG I CD  
3798 N NE  . ARG I 33  ? 0.1524 0.1154 0.1485 -0.0019 -0.0057 -0.0014 483 ARG I NE  
3799 C CZ  . ARG I 33  ? 0.1472 0.1103 0.1412 0.0012  -0.0082 -0.0058 483 ARG I CZ  
3800 N NH1 . ARG I 33  ? 0.1656 0.1304 0.1558 -0.0003 -0.0031 0.0024  483 ARG I NH1 
3801 N NH2 . ARG I 33  ? 0.1697 0.1346 0.1640 0.0093  -0.0170 -0.0201 483 ARG I NH2 
3802 N N   . GLU I 34  ? 0.1694 0.1518 0.1209 0.0081  0.0025  -0.0039 484 GLU I N   
3803 C CA  . GLU I 34  ? 0.1900 0.1718 0.1445 0.0087  -0.0032 -0.0089 484 GLU I CA  
3804 C C   . GLU I 34  ? 0.2139 0.1945 0.1685 0.0053  0.0010  -0.0012 484 GLU I C   
3805 O O   . GLU I 34  ? 0.3104 0.2944 0.2633 0.0076  0.0051  0.0073  484 GLU I O   
3806 C CB  . GLU I 34  ? 0.2817 0.2750 0.2260 0.0224  -0.0096 -0.0179 484 GLU I CB  
3807 C CG  . GLU I 34  ? 0.3148 0.3133 0.2569 0.0322  -0.0159 -0.0304 484 GLU I CG  
3808 C CD  . GLU I 34  ? 0.4518 0.4451 0.4128 0.0364  -0.0344 -0.0507 484 GLU I CD  
3809 O OE1 . GLU I 34  ? 0.5222 0.5094 0.4997 0.0298  -0.0397 -0.0506 484 GLU I OE1 
3810 O OE2 . GLU I 34  ? 0.5205 0.5167 0.4856 0.0472  -0.0451 -0.0673 484 GLU I OE2 
3811 N N   . SER I 35  ? 0.1562 0.1347 0.1189 0.0014  -0.0005 -0.0020 485 SER I N   
3812 C CA  . SER I 35  ? 0.1485 0.1270 0.1119 0.0012  0.0015  0.0009  485 SER I CA  
3813 C C   . SER I 35  ? 0.1420 0.1225 0.1034 0.0050  -0.0001 0.0027  485 SER I C   
3814 O O   . SER I 35  ? 0.1647 0.1501 0.1231 0.0090  -0.0043 -0.0007 485 SER I O   
3815 C CB  . SER I 35  ? 0.1634 0.1483 0.1346 0.0009  0.0025  0.0023  485 SER I CB  
3816 O OG  . SER I 35  ? 0.1556 0.1446 0.1251 0.0055  0.0032  0.0009  485 SER I OG  
3817 N N   . HIS I 36  ? 0.1590 0.1368 0.1266 0.0056  0.0004  0.0070  486 HIS I N   
3818 C CA  . HIS I 36  ? 0.1485 0.1289 0.1204 0.0091  -0.0012 0.0119  486 HIS I CA  
3819 C C   . HIS I 36  ? 0.1713 0.1507 0.1483 0.0099  -0.0041 0.0051  486 HIS I C   
3820 O O   . HIS I 36  ? 0.1761 0.1597 0.1528 0.0122  -0.0058 0.0057  486 HIS I O   
3821 C CB  . HIS I 36  ? 0.1571 0.1366 0.1464 0.0101  -0.0004 0.0256  486 HIS I CB  
3822 C CG  . HIS I 36  ? 0.1760 0.1684 0.1604 0.0146  0.0059  0.0402  486 HIS I CG  
3823 N ND1 . HIS I 36  ? 0.2111 0.2042 0.1964 0.0126  0.0093  0.0421  486 HIS I ND1 
3824 C CD2 . HIS I 36  ? 0.2271 0.2384 0.2027 0.0252  0.0101  0.0538  486 HIS I CD2 
3825 C CE1 . HIS I 36  ? 0.2207 0.2335 0.1990 0.0220  0.0163  0.0569  486 HIS I CE1 
3826 N NE2 . HIS I 36  ? 0.2482 0.2745 0.2186 0.0314  0.0170  0.0644  486 HIS I NE2 
3827 N N   . GLY I 37  ? 0.1687 0.1468 0.1490 0.0113  -0.0053 -0.0023 487 GLY I N   
3828 C CA  . GLY I 37  ? 0.1842 0.1699 0.1661 0.0179  -0.0067 -0.0089 487 GLY I CA  
3829 C C   . GLY I 37  ? 0.1879 0.1863 0.1673 0.0172  -0.0013 -0.0040 487 GLY I C   
3830 O O   . GLY I 37  ? 0.2019 0.2094 0.1866 0.0218  -0.0010 -0.0037 487 GLY I O   
3831 N N   . LYS I 38  ? 0.1696 0.1693 0.1489 0.0117  0.0015  0.0011  488 LYS I N   
3832 C CA  . LYS I 38  ? 0.1551 0.1657 0.1502 0.0093  0.0034  0.0092  488 LYS I CA  
3833 C C   . LYS I 38  ? 0.1359 0.1364 0.1375 0.0034  -0.0040 0.0059  488 LYS I C   
3834 O O   . LYS I 38  ? 0.1483 0.1463 0.1558 0.0002  -0.0047 0.0070  488 LYS I O   
3835 C CB  . LYS I 38  ? 0.1685 0.1955 0.1688 0.0125  0.0111  0.0197  488 LYS I CB  
3836 C CG  . LYS I 38  ? 0.2363 0.2833 0.2247 0.0270  0.0168  0.0192  488 LYS I CG  
3837 C CD  . LYS I 38  ? 0.2680 0.3346 0.2697 0.0332  0.0210  0.0275  488 LYS I CD  
3838 C CE  . LYS I 38  ? 0.3603 0.4623 0.3519 0.0541  0.0300  0.0329  488 LYS I CE  
3839 N NZ  . LYS I 38  ? 0.3910 0.5253 0.4041 0.0574  0.0431  0.0631  488 LYS I NZ  
3840 N N   . PRO I 39  ? 0.1693 0.1522 0.1756 0.0535  -0.0614 -0.0224 489 PRO I N   
3841 C CA  . PRO I 39  ? 0.1688 0.1426 0.1636 0.0425  -0.0604 -0.0110 489 PRO I CA  
3842 C C   . PRO I 39  ? 0.1585 0.1527 0.1575 0.0364  -0.0506 -0.0095 489 PRO I C   
3843 O O   . PRO I 39  ? 0.1873 0.2045 0.1995 0.0391  -0.0484 -0.0143 489 PRO I O   
3844 C CB  . PRO I 39  ? 0.2226 0.1849 0.2182 0.0472  -0.0752 -0.0093 489 PRO I CB  
3845 C CG  . PRO I 39  ? 0.2215 0.1716 0.2240 0.0595  -0.0877 -0.0172 489 PRO I CG  
3846 C CD  . PRO I 39  ? 0.2019 0.1764 0.2175 0.0666  -0.0773 -0.0299 489 PRO I CD  
3847 N N   . GLY I 40  ? 0.1574 0.1441 0.1455 0.0274  -0.0463 -0.0036 490 GLY I N   
3848 C CA  . GLY I 40  ? 0.1538 0.1505 0.1442 0.0215  -0.0417 -0.0022 490 GLY I CA  
3849 C C   . GLY I 40  ? 0.1559 0.1578 0.1470 0.0185  -0.0354 -0.0024 490 GLY I C   
3850 O O   . GLY I 40  ? 0.1753 0.1767 0.1654 0.0128  -0.0356 0.0001  490 GLY I O   
3851 N N   . GLU I 41  ? 0.1515 0.1555 0.1432 0.0223  -0.0327 -0.0056 491 GLU I N   
3852 C CA  . GLU I 41  ? 0.1372 0.1454 0.1268 0.0188  -0.0284 -0.0051 491 GLU I CA  
3853 C C   . GLU I 41  ? 0.1435 0.1372 0.1266 0.0185  -0.0281 -0.0053 491 GLU I C   
3854 O O   . GLU I 41  ? 0.1574 0.1416 0.1373 0.0199  -0.0295 -0.0060 491 GLU I O   
3855 C CB  . GLU I 41  ? 0.1845 0.2097 0.1783 0.0228  -0.0253 -0.0110 491 GLU I CB  
3856 C CG  . GLU I 41  ? 0.2628 0.3094 0.2681 0.0263  -0.0257 -0.0156 491 GLU I CG  
3857 C CD  . GLU I 41  ? 0.3532 0.4320 0.3626 0.0215  -0.0193 -0.0186 491 GLU I CD  
3858 O OE1 . GLU I 41  ? 0.3696 0.4545 0.3732 0.0217  -0.0154 -0.0224 491 GLU I OE1 
3859 O OE2 . GLU I 41  ? 0.4161 0.5171 0.4338 0.0156  -0.0182 -0.0170 491 GLU I OE2 
3860 N N   . TYR I 42  ? 0.1304 0.1234 0.1118 0.0151  -0.0278 -0.0038 492 TYR I N   
3861 C CA  . TYR I 42  ? 0.1261 0.1118 0.1057 0.0155  -0.0279 -0.0061 492 TYR I CA  
3862 C C   . TYR I 42  ? 0.1345 0.1223 0.1120 0.0166  -0.0269 -0.0078 492 TYR I C   
3863 O O   . TYR I 42  ? 0.1417 0.1386 0.1172 0.0159  -0.0257 -0.0074 492 TYR I O   
3864 C CB  . TYR I 42  ? 0.1482 0.1297 0.1296 0.0141  -0.0326 -0.0060 492 TYR I CB  
3865 C CG  . TYR I 42  ? 0.1515 0.1310 0.1349 0.0148  -0.0347 -0.0088 492 TYR I CG  
3866 C CD1 . TYR I 42  ? 0.1527 0.1299 0.1362 0.0122  -0.0389 -0.0053 492 TYR I CD1 
3867 C CD2 . TYR I 42  ? 0.1668 0.1502 0.1515 0.0166  -0.0327 -0.0158 492 TYR I CD2 
3868 C CE1 . TYR I 42  ? 0.1690 0.1433 0.1531 0.0134  -0.0423 -0.0098 492 TYR I CE1 
3869 C CE2 . TYR I 42  ? 0.2064 0.1921 0.1910 0.0176  -0.0342 -0.0212 492 TYR I CE2 
3870 C CZ  . TYR I 42  ? 0.1858 0.1647 0.1698 0.0170  -0.0397 -0.0186 492 TYR I CZ  
3871 O OH  . TYR I 42  ? 0.2077 0.1877 0.1905 0.0186  -0.0427 -0.0258 492 TYR I OH  
3872 N N   . VAL I 43  ? 0.1258 0.1086 0.1033 0.0169  -0.0271 -0.0106 493 VAL I N   
3873 C CA  . VAL I 43  ? 0.1354 0.1175 0.1105 0.0179  -0.0278 -0.0136 493 VAL I CA  
3874 C C   . VAL I 43  ? 0.1324 0.1139 0.1099 0.0161  -0.0305 -0.0146 493 VAL I C   
3875 O O   . VAL I 43  ? 0.1426 0.1260 0.1260 0.0149  -0.0304 -0.0164 493 VAL I O   
3876 C CB  . VAL I 43  ? 0.1440 0.1179 0.1183 0.0191  -0.0294 -0.0163 493 VAL I CB  
3877 C CG1 . VAL I 43  ? 0.1519 0.1226 0.1238 0.0205  -0.0322 -0.0214 493 VAL I CG1 
3878 C CG2 . VAL I 43  ? 0.1555 0.1277 0.1302 0.0237  -0.0308 -0.0171 493 VAL I CG2 
3879 N N   . LEU I 44  ? 0.1308 0.1131 0.1040 0.0160  -0.0335 -0.0146 494 LEU I N   
3880 C CA  . LEU I 44  ? 0.1336 0.1149 0.1100 0.0156  -0.0386 -0.0169 494 LEU I CA  
3881 C C   . LEU I 44  ? 0.1476 0.1273 0.1218 0.0153  -0.0384 -0.0214 494 LEU I C   
3882 O O   . LEU I 44  ? 0.1608 0.1407 0.1264 0.0168  -0.0381 -0.0235 494 LEU I O   
3883 C CB  . LEU I 44  ? 0.1622 0.1412 0.1320 0.0141  -0.0458 -0.0125 494 LEU I CB  
3884 C CG  . LEU I 44  ? 0.1502 0.1271 0.1223 0.0149  -0.0543 -0.0149 494 LEU I CG  
3885 C CD1 . LEU I 44  ? 0.1665 0.1464 0.1561 0.0192  -0.0585 -0.0209 494 LEU I CD1 
3886 C CD2 . LEU I 44  ? 0.2116 0.1824 0.1702 0.0106  -0.0638 -0.0072 494 LEU I CD2 
3887 N N   . SER I 45  ? 0.1372 0.1176 0.1192 0.0125  -0.0391 -0.0240 495 SER I N   
3888 C CA  . SER I 45  ? 0.1469 0.1218 0.1274 0.0095  -0.0421 -0.0273 495 SER I CA  
3889 C C   . SER I 45  ? 0.1696 0.1508 0.1566 0.0076  -0.0475 -0.0304 495 SER I C   
3890 O O   . SER I 45  ? 0.1473 0.1406 0.1466 0.0067  -0.0476 -0.0319 495 SER I O   
3891 C CB  . SER I 45  ? 0.1627 0.1333 0.1455 0.0025  -0.0409 -0.0249 495 SER I CB  
3892 O OG  . SER I 45  ? 0.1810 0.1423 0.1577 0.0053  -0.0397 -0.0223 495 SER I OG  
3893 N N   . VAL I 46  ? 0.1757 0.1510 0.1556 0.0083  -0.0529 -0.0339 496 VAL I N   
3894 C CA  A VAL I 46  ? 0.1727 0.1531 0.1571 0.0073  -0.0604 -0.0367 496 VAL I CA  
3895 C CA  B VAL I 46  ? 0.1711 0.1517 0.1559 0.0072  -0.0603 -0.0367 496 VAL I CA  
3896 C C   . VAL I 46  ? 0.2049 0.1780 0.1867 0.0033  -0.0659 -0.0417 496 VAL I C   
3897 O O   . VAL I 46  ? 0.2753 0.2361 0.2471 0.0051  -0.0662 -0.0447 496 VAL I O   
3898 C CB  A VAL I 46  ? 0.2004 0.1799 0.1734 0.0114  -0.0652 -0.0344 496 VAL I CB  
3899 C CB  B VAL I 46  ? 0.1989 0.1787 0.1729 0.0113  -0.0655 -0.0345 496 VAL I CB  
3900 C CG1 A VAL I 46  ? 0.2008 0.1836 0.1800 0.0113  -0.0766 -0.0363 496 VAL I CG1 
3901 C CG1 B VAL I 46  ? 0.1821 0.1626 0.1558 0.0135  -0.0631 -0.0282 496 VAL I CG1 
3902 C CG2 A VAL I 46  ? 0.1888 0.1690 0.1611 0.0134  -0.0625 -0.0280 496 VAL I CG2 
3903 C CG2 B VAL I 46  ? 0.2239 0.1994 0.1796 0.0120  -0.0654 -0.0374 496 VAL I CG2 
3904 N N   . TYR I 47  ? 0.2001 0.1810 0.1930 -0.0015 -0.0721 -0.0443 497 TYR I N   
3905 C CA  . TYR I 47  ? 0.2112 0.1840 0.2009 -0.0058 -0.0807 -0.0494 497 TYR I CA  
3906 C C   . TYR I 47  ? 0.2067 0.1802 0.1867 -0.0002 -0.0881 -0.0525 497 TYR I C   
3907 O O   . TYR I 47  ? 0.2166 0.2004 0.2044 0.0018  -0.0924 -0.0507 497 TYR I O   
3908 C CB  . TYR I 47  ? 0.2149 0.2002 0.2229 -0.0172 -0.0839 -0.0499 497 TYR I CB  
3909 C CG  . TYR I 47  ? 0.2353 0.2077 0.2403 -0.0251 -0.0943 -0.0537 497 TYR I CG  
3910 C CD1 . TYR I 47  ? 0.2519 0.2248 0.2552 -0.0229 -0.1046 -0.0599 497 TYR I CD1 
3911 C CD2 . TYR I 47  ? 0.2744 0.2305 0.2766 -0.0357 -0.0968 -0.0505 497 TYR I CD2 
3912 C CE1 . TYR I 47  ? 0.3163 0.2764 0.3168 -0.0299 -0.1142 -0.0638 497 TYR I CE1 
3913 C CE2 . TYR I 47  ? 0.3072 0.2459 0.3064 -0.0438 -0.1100 -0.0540 497 TYR I CE2 
3914 C CZ  . TYR I 47  ? 0.2635 0.2064 0.2626 -0.0398 -0.1162 -0.0607 497 TYR I CZ  
3915 O OH  . TYR I 47  ? 0.3554 0.2833 0.3517 -0.0458 -0.1249 -0.0628 497 TYR I OH  
3916 N N   . SER I 48  ? 0.2249 0.1877 0.1870 0.0029  -0.0911 -0.0580 498 SER I N   
3917 C CA  . SER I 48  ? 0.2566 0.2220 0.2035 0.0054  -0.0979 -0.0601 498 SER I CA  
3918 C C   . SER I 48  ? 0.3397 0.2972 0.2745 0.0064  -0.1021 -0.0703 498 SER I C   
3919 O O   . SER I 48  ? 0.3304 0.2808 0.2601 0.0107  -0.0980 -0.0769 498 SER I O   
3920 C CB  . SER I 48  ? 0.3036 0.2742 0.2350 0.0086  -0.0916 -0.0540 498 SER I CB  
3921 O OG  . SER I 48  ? 0.3301 0.3036 0.2440 0.0067  -0.1000 -0.0519 498 SER I OG  
3922 N N   . ASP I 49  ? 0.3189 0.2783 0.2521 0.0035  -0.1097 -0.0715 499 ASP I N   
3923 C CA  . ASP I 49  ? 0.3756 0.3290 0.2992 0.0042  -0.1138 -0.0811 499 ASP I CA  
3924 C C   . ASP I 49  ? 0.3625 0.3002 0.2941 0.0047  -0.1146 -0.0875 499 ASP I C   
3925 O O   . ASP I 49  ? 0.3938 0.3253 0.3163 0.0118  -0.1132 -0.0970 499 ASP I O   
3926 C CB  . ASP I 49  ? 0.4844 0.4466 0.3830 0.0079  -0.1101 -0.0857 499 ASP I CB  
3927 C CG  . ASP I 49  ? 0.5702 0.5429 0.4576 0.0034  -0.1128 -0.0749 499 ASP I CG  
3928 O OD1 . ASP I 49  ? 0.6270 0.6104 0.4947 0.0022  -0.1071 -0.0720 499 ASP I OD1 
3929 O OD2 . ASP I 49  ? 0.5798 0.5508 0.4793 0.0003  -0.1215 -0.0687 499 ASP I OD2 
3930 N N   . GLY I 50  ? 0.3611 0.2942 0.3110 -0.0039 -0.1180 -0.0818 500 GLY I N   
3931 C CA  . GLY I 50  ? 0.3576 0.2723 0.3142 -0.0089 -0.1230 -0.0831 500 GLY I CA  
3932 C C   . GLY I 50  ? 0.3729 0.2752 0.3286 -0.0051 -0.1190 -0.0818 500 GLY I C   
3933 O O   . GLY I 50  ? 0.4082 0.2906 0.3673 -0.0095 -0.1261 -0.0806 500 GLY I O   
3934 N N   . GLN I 51  ? 0.3060 0.2181 0.2569 0.0022  -0.1096 -0.0807 501 GLN I N   
3935 C CA  . GLN I 51  ? 0.3162 0.2183 0.2664 0.0077  -0.1063 -0.0807 501 GLN I CA  
3936 C C   . GLN I 51  ? 0.2902 0.2035 0.2449 0.0049  -0.0977 -0.0717 501 GLN I C   
3937 O O   . GLN I 51  ? 0.2706 0.2030 0.2264 0.0049  -0.0909 -0.0669 501 GLN I O   
3938 C CB  . GLN I 51  ? 0.3298 0.2370 0.2695 0.0230  -0.1024 -0.0926 501 GLN I CB  
3939 C CG  . GLN I 51  ? 0.4120 0.3116 0.3478 0.0287  -0.1106 -0.1046 501 GLN I CG  
3940 C CD  . GLN I 51  ? 0.4761 0.3478 0.4199 0.0278  -0.1235 -0.1046 501 GLN I CD  
3941 O OE1 . GLN I 51  ? 0.5047 0.3641 0.4537 0.0274  -0.1252 -0.0983 501 GLN I OE1 
3942 N NE2 . GLN I 51  ? 0.5085 0.3682 0.4514 0.0266  -0.1344 -0.1104 501 GLN I NE2 
3943 N N   . ARG I 52  ? 0.2936 0.1959 0.2522 0.0030  -0.0962 -0.0661 502 ARG I N   
3944 C CA  . ARG I 52  ? 0.3012 0.2172 0.2642 0.0031  -0.0836 -0.0563 502 ARG I CA  
3945 C C   . ARG I 52  ? 0.3187 0.2410 0.2741 0.0168  -0.0774 -0.0623 502 ARG I C   
3946 O O   . ARG I 52  ? 0.3542 0.2649 0.3056 0.0257  -0.0832 -0.0725 502 ARG I O   
3947 C CB  . ARG I 52  ? 0.3276 0.2313 0.2952 -0.0069 -0.0854 -0.0468 502 ARG I CB  
3948 C CG  . ARG I 52  ? 0.3678 0.2795 0.3445 -0.0250 -0.0864 -0.0385 502 ARG I CG  
3949 C CD  . ARG I 52  ? 0.4020 0.2933 0.3773 -0.0351 -0.1018 -0.0405 502 ARG I CD  
3950 N NE  . ARG I 52  ? 0.4213 0.3264 0.4064 -0.0564 -0.1017 -0.0315 502 ARG I NE  
3951 C CZ  . ARG I 52  ? 0.4943 0.3890 0.4813 -0.0709 -0.1140 -0.0304 502 ARG I CZ  
3952 N NH1 . ARG I 52  ? 0.5474 0.4182 0.5272 -0.0611 -0.1237 -0.0370 502 ARG I NH1 
3953 N NH2 . ARG I 52  ? 0.5271 0.4441 0.5248 -0.0923 -0.1113 -0.0222 502 ARG I NH2 
3954 N N   . ARG I 53  ? 0.2417 0.2265 0.1779 -0.0056 -0.0823 -0.0689 503 ARG I N   
3955 C CA  . ARG I 53  ? 0.2674 0.2412 0.1798 0.0027  -0.0706 -0.0685 503 ARG I CA  
3956 C C   . ARG I 53  ? 0.2386 0.2197 0.1585 0.0088  -0.0635 -0.0574 503 ARG I C   
3957 O O   . ARG I 53  ? 0.2374 0.2332 0.1700 0.0086  -0.0662 -0.0490 503 ARG I O   
3958 C CB  . ARG I 53  ? 0.3196 0.2943 0.2061 0.0048  -0.0716 -0.0680 503 ARG I CB  
3959 C CG  . ARG I 53  ? 0.3569 0.3235 0.2304 -0.0036 -0.0786 -0.0804 503 ARG I CG  
3960 C CD  . ARG I 53  ? 0.4203 0.3928 0.2689 -0.0045 -0.0855 -0.0786 503 ARG I CD  
3961 N NE  . ARG I 53  ? 0.4930 0.4651 0.3360 -0.0158 -0.0981 -0.0897 503 ARG I NE  
3962 C CZ  . ARG I 53  ? 0.6191 0.5734 0.4393 -0.0211 -0.0936 -0.1054 503 ARG I CZ  
3963 N NH1 . ARG I 53  ? 0.6307 0.5666 0.4344 -0.0149 -0.0756 -0.1108 503 ARG I NH1 
3964 N NH2 . ARG I 53  ? 0.6217 0.5770 0.4378 -0.0328 -0.1064 -0.1165 503 ARG I NH2 
3965 N N   . HIS I 54  ? 0.1992 0.1704 0.1164 0.0130  -0.0513 -0.0554 504 HIS I N   
3966 C CA  . HIS I 54  ? 0.1871 0.1643 0.1157 0.0149  -0.0439 -0.0441 504 HIS I CA  
3967 C C   . HIS I 54  ? 0.2102 0.1825 0.1261 0.0224  -0.0346 -0.0414 504 HIS I C   
3968 O O   . HIS I 54  ? 0.2228 0.1830 0.1337 0.0256  -0.0273 -0.0457 504 HIS I O   
3969 C CB  . HIS I 54  ? 0.1661 0.1390 0.1142 0.0104  -0.0413 -0.0408 504 HIS I CB  
3970 C CG  . HIS I 54  ? 0.1811 0.1563 0.1443 0.0030  -0.0478 -0.0425 504 HIS I CG  
3971 N ND1 . HIS I 54  ? 0.1654 0.1520 0.1396 -0.0012 -0.0495 -0.0353 504 HIS I ND1 
3972 C CD2 . HIS I 54  ? 0.1970 0.1631 0.1683 -0.0014 -0.0509 -0.0509 504 HIS I CD2 
3973 C CE1 . HIS I 54  ? 0.1739 0.1602 0.1647 -0.0076 -0.0535 -0.0374 504 HIS I CE1 
3974 N NE2 . HIS I 54  ? 0.2084 0.1823 0.1986 -0.0083 -0.0556 -0.0473 504 HIS I NE2 
3975 N N   . PHE I 55  ? 0.1668 0.1473 0.0810 0.0252  -0.0324 -0.0342 505 PHE I N   
3976 C CA  . PHE I 55  ? 0.1853 0.1622 0.0915 0.0318  -0.0230 -0.0301 505 PHE I CA  
3977 C C   . PHE I 55  ? 0.1626 0.1431 0.0842 0.0294  -0.0190 -0.0231 505 PHE I C   
3978 O O   . PHE I 55  ? 0.1775 0.1647 0.1042 0.0251  -0.0220 -0.0205 505 PHE I O   
3979 C CB  . PHE I 55  ? 0.1912 0.1732 0.0838 0.0370  -0.0240 -0.0268 505 PHE I CB  
3980 C CG  . PHE I 55  ? 0.2148 0.1955 0.0906 0.0373  -0.0313 -0.0315 505 PHE I CG  
3981 C CD1 . PHE I 55  ? 0.2234 0.1943 0.0790 0.0412  -0.0247 -0.0326 505 PHE I CD1 
3982 C CD2 . PHE I 55  ? 0.2394 0.2292 0.1232 0.0315  -0.0436 -0.0333 505 PHE I CD2 
3983 C CE1 . PHE I 55  ? 0.2742 0.2441 0.1135 0.0380  -0.0320 -0.0365 505 PHE I CE1 
3984 C CE2 . PHE I 55  ? 0.2937 0.2838 0.1655 0.0286  -0.0521 -0.0366 505 PHE I CE2 
3985 C CZ  . PHE I 55  ? 0.2973 0.2772 0.1445 0.0311  -0.0469 -0.0386 505 PHE I CZ  
3986 N N   . ILE I 56  ? 0.1703 0.1458 0.0993 0.0315  -0.0119 -0.0203 506 ILE I N   
3987 C CA  . ILE I 56  ? 0.1540 0.1333 0.0961 0.0281  -0.0107 -0.0140 506 ILE I CA  
3988 C C   . ILE I 56  ? 0.1555 0.1358 0.0914 0.0315  -0.0050 -0.0119 506 ILE I C   
3989 O O   . ILE I 56  ? 0.1812 0.1577 0.1078 0.0390  0.0022  -0.0110 506 ILE I O   
3990 C CB  . ILE I 56  ? 0.1687 0.1451 0.1293 0.0291  -0.0062 -0.0097 506 ILE I CB  
3991 C CG1 . ILE I 56  ? 0.1718 0.1477 0.1450 0.0254  -0.0122 -0.0087 506 ILE I CG1 
3992 C CG2 . ILE I 56  ? 0.2004 0.1813 0.1748 0.0247  -0.0070 -0.0038 506 ILE I CG2 
3993 C CD1 . ILE I 56  ? 0.2277 0.2101 0.2041 0.0163  -0.0235 -0.0041 506 ILE I CD1 
3994 N N   . ILE I 57  ? 0.1605 0.1437 0.0996 0.0260  -0.0068 -0.0109 507 ILE I N   
3995 C CA  . ILE I 57  ? 0.1637 0.1452 0.1034 0.0282  0.0005  -0.0089 507 ILE I CA  
3996 C C   . ILE I 57  ? 0.1854 0.1642 0.1399 0.0254  0.0039  -0.0060 507 ILE I C   
3997 O O   . ILE I 57  ? 0.2301 0.2102 0.1919 0.0163  -0.0030 -0.0067 507 ILE I O   
3998 C CB  . ILE I 57  ? 0.1769 0.1592 0.1141 0.0231  0.0000  -0.0115 507 ILE I CB  
3999 C CG1 . ILE I 57  ? 0.1909 0.1787 0.1228 0.0259  -0.0032 -0.0123 507 ILE I CG1 
4000 C CG2 . ILE I 57  ? 0.1809 0.1581 0.1230 0.0252  0.0098  -0.0101 507 ILE I CG2 
4001 C CD1 . ILE I 57  ? 0.1921 0.1805 0.1255 0.0215  -0.0000 -0.0143 507 ILE I CD1 
4002 N N   . GLN I 58  ? 0.1705 0.1681 0.1474 0.0147  0.0073  -0.0475 508 GLN I N   
4003 C CA  . GLN I 58  ? 0.1563 0.1673 0.1561 0.0196  0.0167  -0.0503 508 GLN I CA  
4004 C C   . GLN I 58  ? 0.1623 0.1813 0.1664 0.0147  0.0143  -0.0374 508 GLN I C   
4005 O O   . GLN I 58  ? 0.1622 0.1767 0.1465 0.0098  0.0128  -0.0290 508 GLN I O   
4006 C CB  . GLN I 58  ? 0.1950 0.2171 0.1843 0.0184  0.0355  -0.0613 508 GLN I CB  
4007 C CG  . GLN I 58  ? 0.3442 0.3555 0.3158 0.0211  0.0393  -0.0791 508 GLN I CG  
4008 C CD  . GLN I 58  ? 0.4675 0.4711 0.4694 0.0349  0.0392  -0.0957 508 GLN I CD  
4009 O OE1 . GLN I 58  ? 0.5423 0.5262 0.5332 0.0380  0.0383  -0.1125 508 GLN I OE1 
4010 N NE2 . GLN I 58  ? 0.4858 0.5031 0.5272 0.0438  0.0380  -0.0919 508 GLN I NE2 
4011 N N   . TYR I 59  ? 0.1641 0.1945 0.1961 0.0170  0.0120  -0.0372 509 TYR I N   
4012 C CA  . TYR I 59  ? 0.1544 0.1902 0.1905 0.0099  0.0089  -0.0298 509 TYR I CA  
4013 C C   . TYR I 59  ? 0.1661 0.2247 0.2307 0.0061  0.0185  -0.0346 509 TYR I C   
4014 O O   . TYR I 59  ? 0.1650 0.2413 0.2627 0.0131  0.0136  -0.0397 509 TYR I O   
4015 C CB  . TYR I 59  ? 0.1364 0.1684 0.1752 0.0110  -0.0080 -0.0244 509 TYR I CB  
4016 C CG  . TYR I 59  ? 0.1350 0.1707 0.1747 0.0030  -0.0121 -0.0227 509 TYR I CG  
4017 C CD1 . TYR I 59  ? 0.1517 0.1737 0.1703 -0.0017 -0.0078 -0.0212 509 TYR I CD1 
4018 C CD2 . TYR I 59  ? 0.1448 0.1962 0.2077 0.0010  -0.0226 -0.0240 509 TYR I CD2 
4019 C CE1 . TYR I 59  ? 0.1589 0.1764 0.1769 -0.0092 -0.0118 -0.0240 509 TYR I CE1 
4020 C CE2 . TYR I 59  ? 0.1622 0.2149 0.2230 -0.0094 -0.0282 -0.0261 509 TYR I CE2 
4021 C CZ  . TYR I 59  ? 0.1545 0.1870 0.1914 -0.0150 -0.0217 -0.0276 509 TYR I CZ  
4022 O OH  . TYR I 59  ? 0.1879 0.2143 0.2214 -0.0256 -0.0275 -0.0339 509 TYR I OH  
4023 N N   . VAL I 60  ? 0.1923 0.2515 0.2463 -0.0053 0.0315  -0.0312 510 VAL I N   
4024 C CA  . VAL I 60  ? 0.1943 0.2795 0.2732 -0.0148 0.0465  -0.0344 510 VAL I CA  
4025 C C   . VAL I 60  ? 0.2320 0.3041 0.3003 -0.0328 0.0483  -0.0242 510 VAL I C   
4026 O O   . VAL I 60  ? 0.2522 0.2956 0.2854 -0.0356 0.0491  -0.0147 510 VAL I O   
4027 C CB  . VAL I 60  ? 0.2625 0.3586 0.3302 -0.0141 0.0679  -0.0408 510 VAL I CB  
4028 C CG1 . VAL I 60  ? 0.2672 0.3963 0.3592 -0.0282 0.0886  -0.0425 510 VAL I CG1 
4029 C CG2 . VAL I 60  ? 0.3063 0.4072 0.3854 0.0045  0.0664  -0.0556 510 VAL I CG2 
4030 N N   . ASP I 61  ? 0.2462 0.3383 0.3474 -0.0449 0.0470  -0.0262 511 ASP I N   
4031 C CA  . ASP I 61  ? 0.2649 0.3399 0.3606 -0.0661 0.0482  -0.0187 511 ASP I CA  
4032 C C   . ASP I 61  ? 0.2592 0.2892 0.3211 -0.0618 0.0344  -0.0143 511 ASP I C   
4033 O O   . ASP I 61  ? 0.2645 0.2613 0.3008 -0.0687 0.0387  -0.0041 511 ASP I O   
4034 C CB  . ASP I 61  ? 0.3643 0.4409 0.4493 -0.0832 0.0712  -0.0090 511 ASP I CB  
4035 C CG  . ASP I 61  ? 0.4808 0.6115 0.6070 -0.0907 0.0895  -0.0168 511 ASP I CG  
4036 O OD1 . ASP I 61  ? 0.5367 0.6835 0.6519 -0.0856 0.1088  -0.0192 511 ASP I OD1 
4037 O OD2 . ASP I 61  ? 0.5010 0.6618 0.6721 -0.1013 0.0844  -0.0226 511 ASP I OD2 
4038 N N   . ASN I 62  ? 0.2120 0.2418 0.2740 -0.0489 0.0181  -0.0213 512 ASN I N   
4039 C CA  . ASN I 62  ? 0.2481 0.2467 0.2840 -0.0427 0.0074  -0.0225 512 ASN I CA  
4040 C C   . ASN I 62  ? 0.1873 0.1656 0.1948 -0.0300 0.0116  -0.0150 512 ASN I C   
4041 O O   . ASN I 62  ? 0.2276 0.1814 0.2185 -0.0238 0.0066  -0.0156 512 ASN I O   
4042 C CB  . ASN I 62  ? 0.2747 0.2478 0.3086 -0.0578 0.0034  -0.0261 512 ASN I CB  
4043 C CG  . ASN I 62  ? 0.3529 0.3499 0.4150 -0.0728 -0.0062 -0.0357 512 ASN I CG  
4044 O OD1 . ASN I 62  ? 0.4412 0.4459 0.5010 -0.0689 -0.0213 -0.0449 512 ASN I OD1 
4045 N ND2 . ASN I 62  ? 0.3884 0.4013 0.4767 -0.0920 0.0019  -0.0326 512 ASN I ND2 
4046 N N   . MET I 63  ? 0.1808 0.1712 0.1838 -0.0252 0.0199  -0.0102 513 MET I N   
4047 C CA  . MET I 63  ? 0.1885 0.1653 0.1653 -0.0160 0.0207  -0.0027 513 MET I CA  
4048 C C   . MET I 63  ? 0.1636 0.1575 0.1398 -0.0064 0.0184  -0.0077 513 MET I C   
4049 O O   . MET I 63  ? 0.1900 0.2017 0.1807 -0.0070 0.0234  -0.0142 513 MET I O   
4050 C CB  . MET I 63  ? 0.2271 0.1950 0.1868 -0.0251 0.0322  0.0091  513 MET I CB  
4051 C CG  . MET I 63  ? 0.3538 0.2929 0.3093 -0.0375 0.0338  0.0190  513 MET I CG  
4052 S SD  . MET I 63  ? 0.4538 0.3521 0.3885 -0.0225 0.0205  0.0278  513 MET I SD  
4053 C CE  . MET I 63  ? 0.4532 0.3387 0.4072 -0.0211 0.0125  0.0106  513 MET I CE  
4054 N N   . TYR I 64  ? 0.1596 0.1482 0.1224 0.0024  0.0109  -0.0056 514 TYR I N   
4055 C CA  . TYR I 64  ? 0.1572 0.1564 0.1161 0.0068  0.0077  -0.0091 514 TYR I CA  
4056 C C   . TYR I 64  ? 0.1701 0.1674 0.1065 0.0059  0.0109  -0.0050 514 TYR I C   
4057 O O   . TYR I 64  ? 0.1888 0.1755 0.1097 0.0067  0.0093  0.0057  514 TYR I O   
4058 C CB  . TYR I 64  ? 0.1496 0.1523 0.1090 0.0122  -0.0016 -0.0088 514 TYR I CB  
4059 C CG  . TYR I 64  ? 0.1220 0.1280 0.0925 0.0110  -0.0052 -0.0123 514 TYR I CG  
4060 C CD1 . TYR I 64  ? 0.1220 0.1336 0.1000 0.0088  -0.0099 -0.0136 514 TYR I CD1 
4061 C CD2 . TYR I 64  ? 0.1367 0.1362 0.1062 0.0121  -0.0055 -0.0145 514 TYR I CD2 
4062 C CE1 . TYR I 64  ? 0.1212 0.1359 0.1019 0.0064  -0.0161 -0.0131 514 TYR I CE1 
4063 C CE2 . TYR I 64  ? 0.1344 0.1386 0.1055 0.0091  -0.0098 -0.0192 514 TYR I CE2 
4064 C CZ  . TYR I 64  ? 0.1184 0.1322 0.0933 0.0056  -0.0157 -0.0166 514 TYR I CZ  
4065 O OH  . TYR I 64  ? 0.1402 0.1587 0.1095 0.0013  -0.0228 -0.0177 514 TYR I OH  
4066 N N   . ARG I 65  ? 0.1652 0.1699 0.0974 0.0046  0.0139  -0.0138 515 ARG I N   
4067 C CA  . ARG I 65  ? 0.1911 0.1959 0.0942 0.0012  0.0170  -0.0133 515 ARG I CA  
4068 C C   . ARG I 65  ? 0.2126 0.2207 0.1112 0.0010  0.0152  -0.0288 515 ARG I C   
4069 O O   . ARG I 65  ? 0.1969 0.2033 0.1178 0.0042  0.0147  -0.0387 515 ARG I O   
4070 C CB  . ARG I 65  ? 0.2399 0.2457 0.1316 -0.0064 0.0336  -0.0102 515 ARG I CB  
4071 C CG  . ARG I 65  ? 0.2827 0.3030 0.2001 -0.0071 0.0481  -0.0245 515 ARG I CG  
4072 C CD  . ARG I 65  ? 0.3850 0.4155 0.2969 -0.0185 0.0678  -0.0202 515 ARG I CD  
4073 N NE  . ARG I 65  ? 0.4855 0.5135 0.3514 -0.0261 0.0754  -0.0149 515 ARG I NE  
4074 C CZ  . ARG I 65  ? 0.5146 0.5561 0.3620 -0.0268 0.0884  -0.0316 515 ARG I CZ  
4075 N NH1 . ARG I 65  ? 0.5026 0.5568 0.3811 -0.0167 0.0945  -0.0545 515 ARG I NH1 
4076 N NH2 . ARG I 65  ? 0.5337 0.5707 0.3412 -0.0316 0.0881  -0.0229 515 ARG I NH2 
4077 N N   . PHE I 66  ? 0.1736 0.1692 0.1109 0.0229  0.0073  -0.0121 516 PHE I N   
4078 C CA  . PHE I 66  ? 0.2011 0.1953 0.1317 0.0294  0.0056  -0.0158 516 PHE I CA  
4079 C C   . PHE I 66  ? 0.2292 0.2324 0.1526 0.0304  0.0107  -0.0162 516 PHE I C   
4080 O O   . PHE I 66  ? 0.3001 0.3173 0.2277 0.0320  0.0150  -0.0182 516 PHE I O   
4081 C CB  . PHE I 66  ? 0.2007 0.1814 0.1262 0.0308  -0.0005 -0.0158 516 PHE I CB  
4082 C CG  . PHE I 66  ? 0.1734 0.1489 0.1068 0.0296  -0.0046 -0.0156 516 PHE I CG  
4083 C CD1 . PHE I 66  ? 0.1732 0.1490 0.1096 0.0324  -0.0061 -0.0182 516 PHE I CD1 
4084 C CD2 . PHE I 66  ? 0.1700 0.1407 0.1073 0.0261  -0.0069 -0.0129 516 PHE I CD2 
4085 C CE1 . PHE I 66  ? 0.1992 0.1704 0.1412 0.0301  -0.0091 -0.0172 516 PHE I CE1 
4086 C CE2 . PHE I 66  ? 0.1808 0.1498 0.1257 0.0247  -0.0094 -0.0127 516 PHE I CE2 
4087 C CZ  . PHE I 66  ? 0.1871 0.1563 0.1339 0.0260  -0.0101 -0.0145 516 PHE I CZ  
4088 N N   . GLU I 67  ? 0.2264 0.2230 0.1390 0.0295  0.0104  -0.0142 517 GLU I N   
4089 C CA  . GLU I 67  ? 0.2436 0.2489 0.1472 0.0296  0.0163  -0.0138 517 GLU I CA  
4090 C C   . GLU I 67  ? 0.2624 0.2633 0.1595 0.0217  0.0183  -0.0075 517 GLU I C   
4091 O O   . GLU I 67  ? 0.2852 0.2895 0.1710 0.0207  0.0225  -0.0060 517 GLU I O   
4092 C CB  . GLU I 67  ? 0.2659 0.2673 0.1574 0.0378  0.0144  -0.0184 517 GLU I CB  
4093 C CG  . GLU I 67  ? 0.2899 0.2735 0.1718 0.0384  0.0073  -0.0175 517 GLU I CG  
4094 C CD  . GLU I 67  ? 0.3270 0.3053 0.1946 0.0463  0.0048  -0.0225 517 GLU I CD  
4095 O OE1 . GLU I 67  ? 0.3317 0.3157 0.1993 0.0535  0.0056  -0.0281 517 GLU I OE1 
4096 O OE2 . GLU I 67  ? 0.2950 0.2624 0.1505 0.0461  0.0012  -0.0211 517 GLU I OE2 
4097 N N   . GLY I 68  ? 0.2611 0.2536 0.1637 0.0164  0.0153  -0.0039 518 GLY I N   
4098 C CA  . GLY I 68  ? 0.2555 0.2402 0.1510 0.0094  0.0156  0.0021  518 GLY I CA  
4099 C C   . GLY I 68  ? 0.2574 0.2464 0.1612 0.0017  0.0183  0.0052  518 GLY I C   
4100 O O   . GLY I 68  ? 0.2850 0.2896 0.1962 -0.0004 0.0235  0.0041  518 GLY I O   
4101 N N   . THR I 69  ? 0.2470 0.2224 0.1500 -0.0018 0.0140  0.0085  519 THR I N   
4102 C CA  . THR I 69  ? 0.2577 0.2331 0.1661 -0.0093 0.0151  0.0113  519 THR I CA  
4103 C C   . THR I 69  ? 0.2195 0.2002 0.1422 -0.0068 0.0137  0.0072  519 THR I C   
4104 O O   . THR I 69  ? 0.2341 0.2158 0.1620 0.0001  0.0114  0.0032  519 THR I O   
4105 C CB  . THR I 69  ? 0.3100 0.2660 0.2094 -0.0128 0.0101  0.0159  519 THR I CB  
4106 O OG1 . THR I 69  ? 0.3187 0.2654 0.2219 -0.0059 0.0038  0.0131  519 THR I OG1 
4107 C CG2 . THR I 69  ? 0.3378 0.2861 0.2203 -0.0152 0.0107  0.0205  519 THR I CG2 
4108 N N   . GLY I 70  ? 0.2365 0.2194 0.1645 -0.0131 0.0148  0.0086  520 GLY I N   
4109 C CA  . GLY I 70  ? 0.2226 0.2108 0.1622 -0.0115 0.0137  0.0050  520 GLY I CA  
4110 C C   . GLY I 70  ? 0.2401 0.2139 0.1802 -0.0109 0.0087  0.0049  520 GLY I C   
4111 O O   . GLY I 70  ? 0.2253 0.1853 0.1577 -0.0142 0.0060  0.0082  520 GLY I O   
4112 N N   . PHE I 71  ? 0.1943 0.1709 0.1423 -0.0062 0.0073  0.0010  521 PHE I N   
4113 C CA  . PHE I 71  ? 0.1704 0.1368 0.1198 -0.0038 0.0035  -0.0002 521 PHE I CA  
4114 C C   . PHE I 71  ? 0.1854 0.1570 0.1415 -0.0048 0.0038  -0.0029 521 PHE I C   
4115 O O   . PHE I 71  ? 0.1771 0.1605 0.1388 -0.0037 0.0058  -0.0048 521 PHE I O   
4116 C CB  . PHE I 71  ? 0.1796 0.1447 0.1311 0.0033  0.0015  -0.0023 521 PHE I CB  
4117 C CG  . PHE I 71  ? 0.1855 0.1440 0.1302 0.0051  -0.0005 -0.0002 521 PHE I CG  
4118 C CD1 . PHE I 71  ? 0.1885 0.1519 0.1295 0.0055  0.0012  0.0003  521 PHE I CD1 
4119 C CD2 . PHE I 71  ? 0.2067 0.1536 0.1478 0.0071  -0.0048 0.0007  521 PHE I CD2 
4120 C CE1 . PHE I 71  ? 0.2026 0.1588 0.1355 0.0072  -0.0014 0.0021  521 PHE I CE1 
4121 C CE2 . PHE I 71  ? 0.2315 0.1717 0.1657 0.0090  -0.0078 0.0026  521 PHE I CE2 
4122 C CZ  . PHE I 71  ? 0.2187 0.1632 0.1484 0.0086  -0.0061 0.0034  521 PHE I CZ  
4123 N N   . SER I 72  ? 0.1845 0.1460 0.1388 -0.0060 0.0009  -0.0034 522 SER I N   
4124 C CA  . SER I 72  ? 0.1792 0.1439 0.1377 -0.0069 0.0004  -0.0061 522 SER I CA  
4125 C C   . SER I 72  ? 0.1599 0.1303 0.1232 -0.0004 0.0011  -0.0094 522 SER I C   
4126 O O   . SER I 72  ? 0.1630 0.1391 0.1295 -0.0005 0.0012  -0.0115 522 SER I O   
4127 C CB  . SER I 72  ? 0.2293 0.1792 0.1823 -0.0088 -0.0035 -0.0066 522 SER I CB  
4128 O OG  . SER I 72  ? 0.3552 0.2962 0.3057 -0.0018 -0.0055 -0.0081 522 SER I OG  
4129 N N   . ASN I 73  ? 0.1567 0.1251 0.1200 0.0047  0.0009  -0.0096 523 ASN I N   
4130 C CA  . ASN I 73  ? 0.1451 0.1184 0.1123 0.0092  0.0017  -0.0118 523 ASN I CA  
4131 C C   . ASN I 73  ? 0.1352 0.1110 0.1039 0.0119  0.0019  -0.0108 523 ASN I C   
4132 O O   . ASN I 73  ? 0.1591 0.1312 0.1253 0.0119  0.0008  -0.0091 523 ASN I O   
4133 C CB  . ASN I 73  ? 0.1777 0.1459 0.1441 0.0121  0.0008  -0.0140 523 ASN I CB  
4134 C CG  . ASN I 73  ? 0.1964 0.1570 0.1610 0.0151  -0.0012 -0.0139 523 ASN I CG  
4135 O OD1 . ASN I 73  ? 0.1812 0.1449 0.1489 0.0181  -0.0012 -0.0134 523 ASN I OD1 
4136 N ND2 . ASN I 73  ? 0.3032 0.2531 0.2624 0.0144  -0.0038 -0.0145 523 ASN I ND2 
4137 N N   . ILE I 74  ? 0.1235 0.1043 0.0950 0.0137  0.0026  -0.0117 524 ILE I N   
4138 C CA  . ILE I 74  ? 0.1291 0.1112 0.1017 0.0153  0.0018  -0.0110 524 ILE I CA  
4139 C C   . ILE I 74  ? 0.1326 0.1130 0.1076 0.0171  0.0004  -0.0106 524 ILE I C   
4140 O O   . ILE I 74  ? 0.1264 0.1053 0.1008 0.0176  -0.0016 -0.0097 524 ILE I O   
4141 C CB  . ILE I 74  ? 0.1185 0.1036 0.0918 0.0158  0.0020  -0.0114 524 ILE I CB  
4142 C CG1 . ILE I 74  ? 0.1345 0.1222 0.1059 0.0159  0.0022  -0.0122 524 ILE I CG1 
4143 C CG2 . ILE I 74  ? 0.1301 0.1142 0.1042 0.0162  0.0002  -0.0106 524 ILE I CG2 
4144 C CD1 . ILE I 74  ? 0.1520 0.1400 0.1221 0.0174  0.0010  -0.0129 524 ILE I CD1 
4145 N N   . PRO I 75  ? 0.1233 0.1045 0.1010 0.0187  0.0011  -0.0118 525 PRO I N   
4146 C CA  . PRO I 75  ? 0.1333 0.1157 0.1151 0.0215  -0.0006 -0.0121 525 PRO I CA  
4147 C C   . PRO I 75  ? 0.1521 0.1274 0.1304 0.0228  -0.0039 -0.0112 525 PRO I C   
4148 O O   . PRO I 75  ? 0.1331 0.1096 0.1139 0.0245  -0.0067 -0.0108 525 PRO I O   
4149 C CB  . PRO I 75  ? 0.1441 0.1289 0.1278 0.0243  0.0014  -0.0145 525 PRO I CB  
4150 C CG  . PRO I 75  ? 0.1411 0.1285 0.1230 0.0217  0.0043  -0.0146 525 PRO I CG  
4151 C CD  . PRO I 75  ? 0.1367 0.1194 0.1141 0.0188  0.0033  -0.0135 525 PRO I CD  
4152 N N   . GLN I 76  ? 0.1365 0.1040 0.1082 0.0211  -0.0042 -0.0105 526 GLN I N   
4153 C CA  . GLN I 76  ? 0.1544 0.1131 0.1201 0.0213  -0.0074 -0.0087 526 GLN I CA  
4154 C C   . GLN I 76  ? 0.1548 0.1144 0.1173 0.0194  -0.0078 -0.0066 526 GLN I C   
4155 O O   . GLN I 76  ? 0.1580 0.1129 0.1170 0.0210  -0.0112 -0.0054 526 GLN I O   
4156 C CB  . GLN I 76  ? 0.1676 0.1166 0.1261 0.0183  -0.0077 -0.0077 526 GLN I CB  
4157 C CG  . GLN I 76  ? 0.2161 0.1576 0.1737 0.0222  -0.0101 -0.0101 526 GLN I CG  
4158 C CD  . GLN I 76  ? 0.2486 0.1859 0.2066 0.0287  -0.0146 -0.0108 526 GLN I CD  
4159 O OE1 . GLN I 76  ? 0.3074 0.2541 0.2738 0.0338  -0.0142 -0.0135 526 GLN I OE1 
4160 N NE2 . GLN I 76  ? 0.2393 0.1628 0.1880 0.0284  -0.0190 -0.0083 526 GLN I NE2 
4161 N N   . LEU I 77  ? 0.1408 0.1061 0.1035 0.0168  -0.0048 -0.0066 527 LEU I N   
4162 C CA  . LEU I 77  ? 0.1540 0.1204 0.1128 0.0166  -0.0051 -0.0058 527 LEU I CA  
4163 C C   . LEU I 77  ? 0.1475 0.1148 0.1096 0.0193  -0.0086 -0.0066 527 LEU I C   
4164 O O   . LEU I 77  ? 0.1511 0.1144 0.1084 0.0204  -0.0118 -0.0059 527 LEU I O   
4165 C CB  . LEU I 77  ? 0.1373 0.1104 0.0969 0.0154  -0.0019 -0.0069 527 LEU I CB  
4166 C CG  . LEU I 77  ? 0.1480 0.1226 0.1034 0.0170  -0.0023 -0.0076 527 LEU I CG  
4167 C CD1 . LEU I 77  ? 0.1919 0.1639 0.1385 0.0162  -0.0017 -0.0059 527 LEU I CD1 
4168 C CD2 . LEU I 77  ? 0.1689 0.1499 0.1262 0.0178  -0.0001 -0.0096 527 LEU I CD2 
4169 N N   . ILE I 78  ? 0.1419 0.1147 0.1118 0.0197  -0.0082 -0.0080 528 ILE I N   
4170 C CA  . ILE I 78  ? 0.1463 0.1217 0.1210 0.0203  -0.0115 -0.0083 528 ILE I CA  
4171 C C   . ILE I 78  ? 0.1360 0.1103 0.1131 0.0229  -0.0154 -0.0082 528 ILE I C   
4172 O O   . ILE I 78  ? 0.1592 0.1322 0.1357 0.0236  -0.0200 -0.0080 528 ILE I O   
4173 C CB  . ILE I 78  ? 0.1438 0.1260 0.1259 0.0187  -0.0095 -0.0088 528 ILE I CB  
4174 C CG1 . ILE I 78  ? 0.1562 0.1372 0.1342 0.0171  -0.0074 -0.0090 528 ILE I CG1 
4175 C CG2 . ILE I 78  ? 0.1698 0.1567 0.1587 0.0176  -0.0128 -0.0086 528 ILE I CG2 
4176 C CD1 . ILE I 78  ? 0.1745 0.1505 0.1465 0.0173  -0.0105 -0.0093 528 ILE I CD1 
4177 N N   . ASP I 79  ? 0.1466 0.1203 0.1254 0.0251  -0.0146 -0.0086 529 ASP I N   
4178 C CA  . ASP I 79  ? 0.1507 0.1234 0.1322 0.0293  -0.0191 -0.0091 529 ASP I CA  
4179 C C   . ASP I 79  ? 0.1718 0.1334 0.1428 0.0302  -0.0235 -0.0072 529 ASP I C   
4180 O O   . ASP I 79  ? 0.1693 0.1300 0.1415 0.0334  -0.0291 -0.0074 529 ASP I O   
4181 C CB  . ASP I 79  ? 0.1656 0.1383 0.1498 0.0330  -0.0179 -0.0109 529 ASP I CB  
4182 C CG  . ASP I 79  ? 0.2350 0.2120 0.2263 0.0392  -0.0225 -0.0127 529 ASP I CG  
4183 O OD1 . ASP I 79  ? 0.2266 0.2157 0.2282 0.0391  -0.0236 -0.0134 529 ASP I OD1 
4184 O OD2 . ASP I 79  ? 0.2377 0.2058 0.2243 0.0440  -0.0255 -0.0135 529 ASP I OD2 
4185 N N   . HIS I 80  ? 0.1572 0.1114 0.1177 0.0271  -0.0210 -0.0053 530 HIS I N   
4186 C CA  . HIS I 80  ? 0.1972 0.1416 0.1457 0.0269  -0.0241 -0.0029 530 HIS I CA  
4187 C C   . HIS I 80  ? 0.1843 0.1308 0.1322 0.0276  -0.0276 -0.0035 530 HIS I C   
4188 O O   . HIS I 80  ? 0.1832 0.1242 0.1266 0.0303  -0.0336 -0.0029 530 HIS I O   
4189 C CB  . HIS I 80  ? 0.1883 0.1288 0.1273 0.0222  -0.0194 -0.0006 530 HIS I CB  
4190 C CG  . HIS I 80  ? 0.1954 0.1292 0.1213 0.0211  -0.0207 0.0019  530 HIS I CG  
4191 N ND1 . HIS I 80  ? 0.2228 0.1442 0.1380 0.0218  -0.0251 0.0048  530 HIS I ND1 
4192 C CD2 . HIS I 80  ? 0.2213 0.1584 0.1416 0.0200  -0.0183 0.0017  530 HIS I CD2 
4193 C CE1 . HIS I 80  ? 0.2256 0.1436 0.1287 0.0204  -0.0248 0.0067  530 HIS I CE1 
4194 N NE2 . HIS I 80  ? 0.2430 0.1710 0.1492 0.0197  -0.0205 0.0045  530 HIS I NE2 
4195 N N   . HIS I 81  ? 0.1616 0.1147 0.1131 0.0257  -0.0251 -0.0049 531 HIS I N   
4196 C CA  . HIS I 81  ? 0.1648 0.1174 0.1140 0.0261  -0.0293 -0.0060 531 HIS I CA  
4197 C C   . HIS I 81  ? 0.1654 0.1231 0.1253 0.0273  -0.0351 -0.0071 531 HIS I C   
4198 O O   . HIS I 81  ? 0.1710 0.1253 0.1276 0.0285  -0.0415 -0.0075 531 HIS I O   
4199 C CB  . HIS I 81  ? 0.1728 0.1284 0.1215 0.0242  -0.0259 -0.0074 531 HIS I CB  
4200 C CG  . HIS I 81  ? 0.1785 0.1315 0.1166 0.0240  -0.0214 -0.0070 531 HIS I CG  
4201 N ND1 . HIS I 81  ? 0.1912 0.1387 0.1167 0.0255  -0.0230 -0.0071 531 HIS I ND1 
4202 C CD2 . HIS I 81  ? 0.1758 0.1328 0.1142 0.0224  -0.0154 -0.0065 531 HIS I CD2 
4203 C CE1 . HIS I 81  ? 0.1952 0.1451 0.1145 0.0248  -0.0171 -0.0066 531 HIS I CE1 
4204 N NE2 . HIS I 81  ? 0.1760 0.1320 0.1038 0.0226  -0.0128 -0.0062 531 HIS I NE2 
4205 N N   . TYR I 82  ? 0.1547 0.1216 0.1274 0.0271  -0.0330 -0.0078 532 TYR I N   
4206 C CA  . TYR I 82  ? 0.1531 0.1292 0.1383 0.0279  -0.0375 -0.0090 532 TYR I CA  
4207 C C   . TYR I 82  ? 0.1611 0.1348 0.1462 0.0332  -0.0434 -0.0091 532 TYR I C   
4208 O O   . TYR I 82  ? 0.1820 0.1605 0.1733 0.0344  -0.0501 -0.0100 532 TYR I O   
4209 C CB  . TYR I 82  ? 0.1863 0.1746 0.1842 0.0266  -0.0324 -0.0097 532 TYR I CB  
4210 C CG  . TYR I 82  ? 0.1972 0.1997 0.2103 0.0262  -0.0355 -0.0107 532 TYR I CG  
4211 C CD1 . TYR I 82  ? 0.1948 0.2013 0.2124 0.0209  -0.0390 -0.0102 532 TYR I CD1 
4212 C CD2 . TYR I 82  ? 0.2788 0.2913 0.3019 0.0312  -0.0352 -0.0123 532 TYR I CD2 
4213 C CE1 . TYR I 82  ? 0.2516 0.2737 0.2848 0.0190  -0.0417 -0.0108 532 TYR I CE1 
4214 C CE2 . TYR I 82  ? 0.2731 0.3028 0.3121 0.0310  -0.0373 -0.0135 532 TYR I CE2 
4215 C CZ  . TYR I 82  ? 0.2756 0.3111 0.3204 0.0241  -0.0404 -0.0124 532 TYR I CZ  
4216 O OH  . TYR I 82  ? 0.4028 0.4578 0.4651 0.0223  -0.0424 -0.0131 532 TYR I OH  
4217 N N   . THR I 83  ? 0.1678 0.1330 0.1451 0.0363  -0.0420 -0.0082 533 THR I N   
4218 C CA  . THR I 83  ? 0.1859 0.1457 0.1612 0.0423  -0.0485 -0.0083 533 THR I CA  
4219 C C   . THR I 83  ? 0.1906 0.1374 0.1511 0.0427  -0.0546 -0.0063 533 THR I C   
4220 O O   . THR I 83  ? 0.2214 0.1676 0.1832 0.0469  -0.0628 -0.0070 533 THR I O   
4221 C CB  . THR I 83  ? 0.2003 0.1528 0.1714 0.0452  -0.0459 -0.0080 533 THR I CB  
4222 O OG1 . THR I 83  ? 0.2118 0.1767 0.1957 0.0459  -0.0408 -0.0106 533 THR I OG1 
4223 C CG2 . THR I 83  ? 0.2161 0.1596 0.1829 0.0524  -0.0538 -0.0082 533 THR I CG2 
4224 N N   . THR I 84  ? 0.1962 0.1338 0.1425 0.0388  -0.0507 -0.0041 534 THR I N   
4225 C CA  . THR I 84  ? 0.2297 0.1545 0.1589 0.0392  -0.0551 -0.0019 534 THR I CA  
4226 C C   . THR I 84  ? 0.2364 0.1631 0.1632 0.0379  -0.0581 -0.0034 534 THR I C   
4227 O O   . THR I 84  ? 0.2378 0.1548 0.1507 0.0393  -0.0634 -0.0025 534 THR I O   
4228 C CB  . THR I 84  ? 0.2159 0.1314 0.1300 0.0355  -0.0487 0.0014  534 THR I CB  
4229 O OG1 . THR I 84  ? 0.2212 0.1444 0.1376 0.0315  -0.0415 0.0003  534 THR I OG1 
4230 C CG2 . THR I 84  ? 0.2394 0.1496 0.1538 0.0356  -0.0466 0.0031  534 THR I CG2 
4231 N N   . LYS I 85  ? 0.1983 0.1353 0.1361 0.0351  -0.0553 -0.0057 535 LYS I N   
4232 C CA  . LYS I 85  ? 0.2012 0.1372 0.1352 0.0333  -0.0584 -0.0075 535 LYS I CA  
4233 C C   . LYS I 85  ? 0.2480 0.1749 0.1636 0.0330  -0.0548 -0.0070 535 LYS I C   
4234 O O   . LYS I 85  ? 0.2422 0.1641 0.1492 0.0335  -0.0587 -0.0089 535 LYS I O   
4235 C CB  . LYS I 85  ? 0.2201 0.1558 0.1565 0.0352  -0.0692 -0.0089 535 LYS I CB  
4236 C CG  . LYS I 85  ? 0.2293 0.1787 0.1864 0.0356  -0.0724 -0.0099 535 LYS I CG  
4237 C CD  . LYS I 85  ? 0.2378 0.1994 0.2094 0.0311  -0.0658 -0.0106 535 LYS I CD  
4238 C CE  . LYS I 85  ? 0.2451 0.2235 0.2375 0.0308  -0.0687 -0.0117 535 LYS I CE  
4239 N NZ  . LYS I 85  ? 0.1843 0.1742 0.1886 0.0266  -0.0608 -0.0115 535 LYS I NZ  
4240 N N   . GLN I 86  ? 0.2307 0.1791 0.1555 0.0829  -0.0304 0.0283  536 GLN I N   
4241 C CA  . GLN I 86  ? 0.2402 0.1764 0.1422 0.0794  -0.0220 0.0316  536 GLN I CA  
4242 C C   . GLN I 86  ? 0.2260 0.1764 0.1319 0.0663  -0.0283 0.0177  536 GLN I C   
4243 O O   . GLN I 86  ? 0.1936 0.1555 0.1213 0.0555  -0.0297 0.0086  536 GLN I O   
4244 C CB  . GLN I 86  ? 0.2694 0.1839 0.1785 0.0726  0.0026  0.0363  536 GLN I CB  
4245 C CG  . GLN I 86  ? 0.4323 0.3176 0.3295 0.0879  0.0162  0.0556  536 GLN I CG  
4246 C CD  . GLN I 86  ? 0.5762 0.4533 0.4320 0.1049  0.0130  0.0726  536 GLN I CD  
4247 O OE1 . GLN I 86  ? 0.6430 0.5133 0.4810 0.0988  0.0239  0.0737  536 GLN I OE1 
4248 N NE2 . GLN I 86  ? 0.6557 0.5474 0.5059 0.1192  -0.0016 0.0784  536 GLN I NE2 
4249 N N   . VAL I 87  ? 0.2266 0.1744 0.1091 0.0691  -0.0304 0.0172  537 VAL I N   
4250 C CA  . VAL I 87  ? 0.2122 0.1664 0.0974 0.0613  -0.0344 0.0060  537 VAL I CA  
4251 C C   . VAL I 87  ? 0.2042 0.1624 0.1060 0.0533  -0.0227 0.0044  537 VAL I C   
4252 O O   . VAL I 87  ? 0.2008 0.1571 0.1069 0.0512  -0.0090 0.0079  537 VAL I O   
4253 C CB  . VAL I 87  ? 0.2542 0.2030 0.1116 0.0672  -0.0362 0.0027  537 VAL I CB  
4254 C CG1 . VAL I 87  ? 0.2571 0.2150 0.1004 0.0732  -0.0508 -0.0012 537 VAL I CG1 
4255 C CG2 . VAL I 87  ? 0.2529 0.1920 0.0939 0.0717  -0.0202 0.0114  537 VAL I CG2 
4256 N N   . ILE I 88  ? 0.1834 0.1494 0.0952 0.0488  -0.0271 -0.0013 538 ILE I N   
4257 C CA  . ILE I 88  ? 0.1659 0.1464 0.0908 0.0457  -0.0200 -0.0024 538 ILE I CA  
4258 C C   . ILE I 88  ? 0.1971 0.1791 0.1145 0.0511  -0.0109 -0.0024 538 ILE I C   
4259 O O   . ILE I 88  ? 0.1776 0.1761 0.1077 0.0470  -0.0007 -0.0049 538 ILE I O   
4260 C CB  . ILE I 88  ? 0.1661 0.1505 0.0952 0.0454  -0.0256 -0.0025 538 ILE I CB  
4261 C CG1 . ILE I 88  ? 0.1588 0.1459 0.0980 0.0373  -0.0309 -0.0040 538 ILE I CG1 
4262 C CG2 . ILE I 88  ? 0.1674 0.1745 0.1051 0.0487  -0.0213 -0.0010 538 ILE I CG2 
4263 C CD1 . ILE I 88  ? 0.1646 0.1689 0.1197 0.0308  -0.0268 -0.0070 538 ILE I CD1 
4264 N N   . THR I 89  ? 0.2160 0.1838 0.1153 0.0587  -0.0127 -0.0032 539 THR I N   
4265 C CA  . THR I 89  ? 0.2235 0.1911 0.1126 0.0647  -0.0023 -0.0046 539 THR I CA  
4266 C C   . THR I 89  ? 0.2343 0.1831 0.0952 0.0691  -0.0052 -0.0063 539 THR I C   
4267 O O   . THR I 89  ? 0.2589 0.1992 0.1129 0.0682  -0.0168 -0.0107 539 THR I O   
4268 C CB  . THR I 89  ? 0.2166 0.1933 0.1134 0.0736  0.0005  -0.0076 539 THR I CB  
4269 O OG1 . THR I 89  ? 0.2547 0.2090 0.1410 0.0785  -0.0057 -0.0101 539 THR I OG1 
4270 C CG2 . THR I 89  ? 0.2105 0.2159 0.1312 0.0729  -0.0010 -0.0057 539 THR I CG2 
4271 N N   . LYS I 90  ? 0.2542 0.2008 0.0984 0.0726  0.0064  -0.0048 540 LYS I N   
4272 C CA  . LYS I 90  ? 0.2852 0.2206 0.0963 0.0783  0.0036  -0.0075 540 LYS I CA  
4273 C C   . LYS I 90  ? 0.3197 0.2485 0.1254 0.0814  -0.0009 -0.0226 540 LYS I C   
4274 O O   . LYS I 90  ? 0.3356 0.2596 0.1237 0.0808  -0.0111 -0.0323 540 LYS I O   
4275 C CB  . LYS I 90  ? 0.3106 0.2445 0.1014 0.0814  0.0212  -0.0013 540 LYS I CB  
4276 C CG  . LYS I 90  ? 0.3541 0.2807 0.1404 0.0794  0.0293  0.0152  540 LYS I CG  
4277 C CD  . LYS I 90  ? 0.4166 0.3362 0.1792 0.0812  0.0520  0.0232  540 LYS I CD  
4278 C CE  . LYS I 90  ? 0.4939 0.3956 0.2533 0.0789  0.0670  0.0422  540 LYS I CE  
4279 N NZ  . LYS I 90  ? 0.5953 0.4886 0.3405 0.0892  0.0498  0.0538  540 LYS I NZ  
4280 N N   . LYS I 91  ? 0.2900 0.2201 0.1125 0.0853  0.0074  -0.0263 541 LYS I N   
4281 C CA  . LYS I 91  ? 0.3183 0.2325 0.1372 0.0906  0.0087  -0.0397 541 LYS I CA  
4282 C C   . LYS I 91  ? 0.3080 0.2076 0.1344 0.0835  -0.0027 -0.0443 541 LYS I C   
4283 O O   . LYS I 91  ? 0.3362 0.2195 0.1514 0.0800  -0.0040 -0.0606 541 LYS I O   
4284 C CB  . LYS I 91  ? 0.3544 0.2745 0.1929 0.1020  0.0203  -0.0380 541 LYS I CB  
4285 C CG  . LYS I 91  ? 0.4177 0.3121 0.2553 0.1112  0.0258  -0.0491 541 LYS I CG  
4286 C CD  . LYS I 91  ? 0.4959 0.4003 0.3497 0.1295  0.0390  -0.0474 541 LYS I CD  
4287 C CE  . LYS I 91  ? 0.5083 0.4303 0.3882 0.1384  0.0344  -0.0313 541 LYS I CE  
4288 N NZ  . LYS I 91  ? 0.5933 0.5152 0.4887 0.1599  0.0435  -0.0285 541 LYS I NZ  
4289 N N   . SER I 92  ? 0.2928 0.1997 0.1389 0.0789  -0.0089 -0.0331 542 SER I N   
4290 C CA  . SER I 92  ? 0.3053 0.1994 0.1605 0.0703  -0.0157 -0.0364 542 SER I CA  
4291 C C   . SER I 92  ? 0.2804 0.1832 0.1294 0.0595  -0.0284 -0.0441 542 SER I C   
4292 O O   . SER I 92  ? 0.3139 0.2079 0.1667 0.0497  -0.0323 -0.0573 542 SER I O   
4293 C CB  . SER I 92  ? 0.2613 0.1638 0.1368 0.0704  -0.0160 -0.0218 542 SER I CB  
4294 O OG  . SER I 92  ? 0.2432 0.1683 0.1258 0.0643  -0.0224 -0.0155 542 SER I OG  
4295 N N   . GLY I 93  ? 0.2695 0.1903 0.1114 0.0619  -0.0335 -0.0361 543 GLY I N   
4296 C CA  . GLY I 93  ? 0.2699 0.2052 0.1086 0.0583  -0.0470 -0.0387 543 GLY I CA  
4297 C C   . GLY I 93  ? 0.2540 0.1964 0.1185 0.0493  -0.0532 -0.0375 543 GLY I C   
4298 O O   . GLY I 93  ? 0.2694 0.2282 0.1381 0.0460  -0.0650 -0.0444 543 GLY I O   
4299 N N   . VAL I 94  ? 0.2387 0.1751 0.1204 0.0465  -0.0457 -0.0294 544 VAL I N   
4300 C CA  . VAL I 94  ? 0.2215 0.1633 0.1241 0.0367  -0.0483 -0.0294 544 VAL I CA  
4301 C C   . VAL I 94  ? 0.2179 0.1795 0.1315 0.0374  -0.0539 -0.0236 544 VAL I C   
4302 O O   . VAL I 94  ? 0.2131 0.1775 0.1254 0.0434  -0.0490 -0.0140 544 VAL I O   
4303 C CB  . VAL I 94  ? 0.2210 0.1531 0.1311 0.0369  -0.0383 -0.0200 544 VAL I CB  
4304 C CG1 . VAL I 94  ? 0.2537 0.1964 0.1810 0.0278  -0.0385 -0.0166 544 VAL I CG1 
4305 C CG2 . VAL I 94  ? 0.2920 0.1964 0.1950 0.0378  -0.0305 -0.0248 544 VAL I CG2 
4306 N N   . VAL I 95  ? 0.1981 0.1734 0.1266 0.0304  -0.0614 -0.0311 545 VAL I N   
4307 C CA  . VAL I 95  ? 0.1983 0.1925 0.1419 0.0335  -0.0659 -0.0275 545 VAL I CA  
4308 C C   . VAL I 95  ? 0.1733 0.1758 0.1407 0.0214  -0.0616 -0.0307 545 VAL I C   
4309 O O   . VAL I 95  ? 0.1991 0.2009 0.1740 0.0095  -0.0608 -0.0401 545 VAL I O   
4310 C CB  . VAL I 95  ? 0.2094 0.2239 0.1508 0.0405  -0.0804 -0.0348 545 VAL I CB  
4311 C CG1 . VAL I 95  ? 0.2045 0.2381 0.1654 0.0483  -0.0841 -0.0299 545 VAL I CG1 
4312 C CG2 . VAL I 95  ? 0.2337 0.2413 0.1438 0.0536  -0.0832 -0.0295 545 VAL I CG2 
4313 N N   . LEU I 96  ? 0.1656 0.1747 0.1444 0.0228  -0.0559 -0.0246 546 LEU I N   
4314 C CA  . LEU I 96  ? 0.1603 0.1812 0.1583 0.0120  -0.0503 -0.0283 546 LEU I CA  
4315 C C   . LEU I 96  ? 0.1583 0.2022 0.1793 0.0116  -0.0568 -0.0376 546 LEU I C   
4316 O O   . LEU I 96  ? 0.1699 0.2215 0.1965 0.0247  -0.0614 -0.0353 546 LEU I O   
4317 C CB  . LEU I 96  ? 0.1706 0.1952 0.1721 0.0122  -0.0410 -0.0238 546 LEU I CB  
4318 C CG  . LEU I 96  ? 0.1352 0.1512 0.1203 0.0147  -0.0361 -0.0170 546 LEU I CG  
4319 C CD1 . LEU I 96  ? 0.1677 0.2000 0.1613 0.0103  -0.0278 -0.0201 546 LEU I CD1 
4320 C CD2 . LEU I 96  ? 0.1648 0.1703 0.1370 0.0128  -0.0352 -0.0122 546 LEU I CD2 
4321 N N   . LEU I 97  ? 0.1510 0.1506 0.2685 0.0269  -0.0412 0.0101  547 LEU I N   
4322 C CA  . LEU I 97  ? 0.1650 0.1971 0.3039 0.0256  -0.0414 0.0051  547 LEU I CA  
4323 C C   . LEU I 97  ? 0.1715 0.2203 0.3180 0.0160  -0.0328 -0.0068 547 LEU I C   
4324 O O   . LEU I 97  ? 0.1973 0.2698 0.3722 0.0226  -0.0266 -0.0102 547 LEU I O   
4325 C CB  . LEU I 97  ? 0.1890 0.2288 0.3124 0.0153  -0.0503 0.0097  547 LEU I CB  
4326 C CG  . LEU I 97  ? 0.1909 0.2177 0.3024 0.0238  -0.0589 0.0209  547 LEU I CG  
4327 C CD1 . LEU I 97  ? 0.2228 0.2588 0.3141 0.0071  -0.0682 0.0211  547 LEU I CD1 
4328 C CD2 . LEU I 97  ? 0.2230 0.2675 0.3678 0.0448  -0.0597 0.0277  547 LEU I CD2 
4329 N N   . ASN I 98  ? 0.1560 0.1932 0.2779 0.0023  -0.0298 -0.0112 548 ASN I N   
4330 C CA  A ASN I 98  ? 0.1858 0.2384 0.3098 -0.0077 -0.0209 -0.0212 548 ASN I CA  
4331 C CA  B ASN I 98  ? 0.1856 0.2383 0.3096 -0.0077 -0.0208 -0.0212 548 ASN I CA  
4332 C C   . ASN I 98  ? 0.1653 0.2005 0.2680 -0.0130 -0.0158 -0.0260 548 ASN I C   
4333 O O   . ASN I 98  ? 0.1732 0.1934 0.2500 -0.0208 -0.0175 -0.0199 548 ASN I O   
4334 C CB  A ASN I 98  ? 0.2178 0.2811 0.3311 -0.0233 -0.0222 -0.0200 548 ASN I CB  
4335 C CB  B ASN I 98  ? 0.2151 0.2797 0.3300 -0.0229 -0.0223 -0.0200 548 ASN I CB  
4336 C CG  A ASN I 98  ? 0.2341 0.3088 0.3542 -0.0241 -0.0330 -0.0129 548 ASN I CG  
4337 C CG  B ASN I 98  ? 0.2372 0.3210 0.3592 -0.0316 -0.0113 -0.0280 548 ASN I CG  
4338 O OD1 A ASN I 98  ? 0.2457 0.3454 0.3953 -0.0139 -0.0361 -0.0098 548 ASN I OD1 
4339 O OD1 B ASN I 98  ? 0.2770 0.3756 0.4209 -0.0235 -0.0026 -0.0337 548 ASN I OD1 
4340 N ND2 A ASN I 98  ? 0.2740 0.3291 0.3645 -0.0364 -0.0376 -0.0093 548 ASN I ND2 
4341 N ND2 B ASN I 98  ? 0.2936 0.3739 0.3963 -0.0473 -0.0087 -0.0279 548 ASN I ND2 
4342 N N   . PRO I 99  ? 0.1508 0.1871 0.2617 -0.0095 -0.0086 -0.0360 549 PRO I N   
4343 C CA  . PRO I 99  ? 0.1632 0.1881 0.2503 -0.0180 -0.0062 -0.0411 549 PRO I CA  
4344 C C   . PRO I 99  ? 0.1737 0.2082 0.2446 -0.0296 0.0013  -0.0446 549 PRO I C   
4345 O O   . PRO I 99  ? 0.1920 0.2421 0.2758 -0.0300 0.0111  -0.0519 549 PRO I O   
4346 C CB  . PRO I 99  ? 0.1776 0.1984 0.2757 -0.0134 0.0011  -0.0542 549 PRO I CB  
4347 C CG  . PRO I 99  ? 0.1698 0.2059 0.2980 -0.0027 0.0100  -0.0565 549 PRO I CG  
4348 C CD  . PRO I 99  ? 0.1511 0.1973 0.2910 0.0021  -0.0007 -0.0424 549 PRO I CD  
4349 N N   . ILE I 100 ? 0.1788 0.2048 0.2238 -0.0375 -0.0011 -0.0364 550 ILE I N   
4350 C CA  . ILE I 100 ? 0.2035 0.2361 0.2317 -0.0476 0.0080  -0.0374 550 ILE I CA  
4351 C C   . ILE I 100 ? 0.2093 0.2449 0.2233 -0.0516 0.0146  -0.0481 550 ILE I C   
4352 O O   . ILE I 100 ? 0.2168 0.2454 0.2147 -0.0536 0.0081  -0.0460 550 ILE I O   
4353 C CB  . ILE I 100 ? 0.2056 0.2255 0.2113 -0.0526 0.0071  -0.0220 550 ILE I CB  
4354 C CG1 . ILE I 100 ? 0.2298 0.2412 0.2419 -0.0520 0.0035  -0.0153 550 ILE I CG1 
4355 C CG2 . ILE I 100 ? 0.2272 0.2524 0.2149 -0.0619 0.0191  -0.0219 550 ILE I CG2 
4356 C CD1 . ILE I 100 ? 0.2414 0.2702 0.2701 -0.0587 0.0072  -0.0231 550 ILE I CD1 
4357 N N   . PRO I 101 ? 0.2224 0.2685 0.2406 -0.0534 0.0275  -0.0590 551 PRO I N   
4358 C CA  . PRO I 101 ? 0.2736 0.3169 0.2722 -0.0571 0.0359  -0.0716 551 PRO I CA  
4359 C C   . PRO I 101 ? 0.2972 0.3406 0.2614 -0.0663 0.0364  -0.0652 551 PRO I C   
4360 O O   . PRO I 101 ? 0.3147 0.3622 0.2740 -0.0691 0.0397  -0.0534 551 PRO I O   
4361 C CB  . PRO I 101 ? 0.2916 0.3455 0.3073 -0.0536 0.0534  -0.0808 551 PRO I CB  
4362 C CG  . PRO I 101 ? 0.2733 0.3424 0.3084 -0.0550 0.0527  -0.0695 551 PRO I CG  
4363 C CD  . PRO I 101 ? 0.2241 0.2863 0.2651 -0.0531 0.0355  -0.0591 551 PRO I CD  
4364 N N   . LYS I 102 ? 0.3494 0.3880 0.2884 -0.0720 0.0336  -0.0724 552 LYS I N   
4365 C CA  . LYS I 102 ? 0.4087 0.4528 0.3129 -0.0803 0.0339  -0.0655 552 LYS I CA  
4366 C C   . LYS I 102 ? 0.4794 0.5268 0.3697 -0.0821 0.0531  -0.0747 552 LYS I C   
4367 O O   . LYS I 102 ? 0.4670 0.5114 0.3731 -0.0777 0.0659  -0.0883 552 LYS I O   
4368 C CB  . LYS I 102 ? 0.4383 0.4805 0.3191 -0.0889 0.0215  -0.0706 552 LYS I CB  
4369 C CG  . LYS I 102 ? 0.4715 0.4994 0.3486 -0.0921 0.0278  -0.0957 552 LYS I CG  
4370 C CD  . LYS I 102 ? 0.5517 0.5761 0.4043 -0.1058 0.0135  -0.1022 552 LYS I CD  
4371 C CE  . LYS I 102 ? 0.6029 0.6035 0.4491 -0.1102 0.0234  -0.1291 552 LYS I CE  
4372 N NZ  . LYS I 102 ? 0.6683 0.6638 0.4911 -0.1282 0.0078  -0.1373 552 LYS I NZ  
4430 N N   . SER K 2   ? 0.4565 0.5669 0.6560 -0.0879 -0.1387 -0.0920 452 SER K N   
4431 C CA  . SER K 2   ? 0.4253 0.5410 0.6250 -0.0800 -0.1087 -0.0760 452 SER K CA  
4432 C C   . SER K 2   ? 0.4081 0.5554 0.6075 -0.0639 -0.0984 -0.0662 452 SER K C   
4433 O O   . SER K 2   ? 0.4353 0.5922 0.6188 -0.0536 -0.1108 -0.0728 452 SER K O   
4434 C CB  . SER K 2   ? 0.4385 0.5167 0.5968 -0.0693 -0.0974 -0.0828 452 SER K CB  
4435 O OG  . SER K 2   ? 0.4672 0.5147 0.6296 -0.0822 -0.0997 -0.0859 452 SER K OG  
4436 N N   . LYS K 3   ? 0.3634 0.5234 0.5768 -0.0603 -0.0763 -0.0504 453 LYS K N   
4437 C CA  . LYS K 3   ? 0.3228 0.5029 0.5315 -0.0431 -0.0657 -0.0412 453 LYS K CA  
4438 C C   . LYS K 3   ? 0.2665 0.4207 0.4306 -0.0288 -0.0577 -0.0448 453 LYS K C   
4439 O O   . LYS K 3   ? 0.2768 0.4035 0.4193 -0.0310 -0.0541 -0.0511 453 LYS K O   
4440 C CB  . LYS K 3   ? 0.3456 0.5430 0.5793 -0.0419 -0.0455 -0.0250 453 LYS K CB  
4441 C CG  . LYS K 3   ? 0.3720 0.6134 0.6551 -0.0498 -0.0497 -0.0149 453 LYS K CG  
4442 C CD  . LYS K 3   ? 0.3752 0.6298 0.6835 -0.0540 -0.0287 0.0011  453 LYS K CD  
4443 C CE  . LYS K 3   ? 0.3809 0.6204 0.6593 -0.0335 -0.0069 0.0062  453 LYS K CE  
4444 N NZ  . LYS K 3   ? 0.4017 0.6531 0.6975 -0.0342 0.0142  0.0214  453 LYS K NZ  
4445 N N   . PRO K 4   ? 0.1938 0.3568 0.3448 -0.0140 -0.0554 -0.0395 454 PRO K N   
4446 C CA  . PRO K 4   ? 0.1651 0.3059 0.2792 -0.0039 -0.0478 -0.0388 454 PRO K CA  
4447 C C   . PRO K 4   ? 0.1650 0.2864 0.2731 -0.0051 -0.0305 -0.0339 454 PRO K C   
4448 O O   . PRO K 4   ? 0.1489 0.2752 0.2771 -0.0084 -0.0212 -0.0282 454 PRO K O   
4449 C CB  . PRO K 4   ? 0.1979 0.3504 0.3069 0.0099  -0.0487 -0.0302 454 PRO K CB  
4450 C CG  . PRO K 4   ? 0.2056 0.3880 0.3403 0.0091  -0.0635 -0.0320 454 PRO K CG  
4451 C CD  . PRO K 4   ? 0.2093 0.4030 0.3787 -0.0061 -0.0627 -0.0336 454 PRO K CD  
4452 N N   . LEU K 5   ? 0.1525 0.2546 0.2324 -0.0019 -0.0264 -0.0351 455 LEU K N   
4453 C CA  . LEU K 5   ? 0.1813 0.2652 0.2530 -0.0027 -0.0134 -0.0313 455 LEU K CA  
4454 C C   . LEU K 5   ? 0.1861 0.2690 0.2629 0.0036  -0.0042 -0.0220 455 LEU K C   
4455 O O   . LEU K 5   ? 0.2001 0.2760 0.2820 0.0023  0.0055  -0.0196 455 LEU K O   
4456 C CB  . LEU K 5   ? 0.2158 0.2882 0.2613 0.0006  -0.0120 -0.0309 455 LEU K CB  
4457 C CG  . LEU K 5   ? 0.2017 0.2685 0.2366 -0.0015 -0.0141 -0.0401 455 LEU K CG  
4458 C CD1 . LEU K 5   ? 0.2095 0.2775 0.2225 0.0040  -0.0116 -0.0359 455 LEU K CD1 
4459 C CD2 . LEU K 5   ? 0.1655 0.2180 0.2070 -0.0066 -0.0070 -0.0420 455 LEU K CD2 
4460 N N   . ALA K 6   ? 0.1585 0.2457 0.2297 0.0129  -0.0076 -0.0169 456 ALA K N   
4461 C CA  . ALA K 6   ? 0.1932 0.2724 0.2614 0.0233  -0.0007 -0.0101 456 ALA K CA  
4462 C C   . ALA K 6   ? 0.1984 0.2959 0.2911 0.0261  0.0071  -0.0079 456 ALA K C   
4463 O O   . ALA K 6   ? 0.2690 0.3578 0.3554 0.0363  0.0165  -0.0039 456 ALA K O   
4464 C CB  . ALA K 6   ? 0.2160 0.2938 0.2735 0.0343  -0.0080 -0.0050 456 ALA K CB  
4465 N N   . GLU K 7   ? 0.1660 0.2885 0.2857 0.0174  0.0030  -0.0098 457 GLU K N   
4466 C CA  . GLU K 7   ? 0.1696 0.3172 0.3199 0.0166  0.0110  -0.0037 457 GLU K CA  
4467 C C   . GLU K 7   ? 0.1904 0.3303 0.3482 0.0036  0.0193  -0.0030 457 GLU K C   
4468 O O   . GLU K 7   ? 0.2218 0.3836 0.4066 0.0002  0.0276  0.0053  457 GLU K O   
4469 C CB  . GLU K 7   ? 0.1534 0.3366 0.3355 0.0122  -0.0008 -0.0033 457 GLU K CB  
4470 C CG  . GLU K 7   ? 0.1954 0.3894 0.3716 0.0281  -0.0087 -0.0018 457 GLU K CG  
4471 C CD  . GLU K 7   ? 0.2360 0.4671 0.4433 0.0238  -0.0236 -0.0022 457 GLU K CD  
4472 O OE1 . GLU K 7   ? 0.2649 0.5216 0.5081 0.0101  -0.0244 0.0003  457 GLU K OE1 
4473 O OE2 . GLU K 7   ? 0.2686 0.5030 0.4648 0.0332  -0.0358 -0.0039 457 GLU K OE2 
4474 N N   . GLN K 8   ? 0.1345 0.2462 0.2703 -0.0029 0.0178  -0.0095 458 GLN K N   
4475 C CA  . GLN K 8   ? 0.1362 0.2354 0.2747 -0.0126 0.0248  -0.0084 458 GLN K CA  
4476 C C   . GLN K 8   ? 0.1531 0.2380 0.2737 -0.0021 0.0393  -0.0023 458 GLN K C   
4477 O O   . GLN K 8   ? 0.1545 0.2216 0.2489 0.0074  0.0387  -0.0051 458 GLN K O   
4478 C CB  . GLN K 8   ? 0.1386 0.2152 0.2600 -0.0200 0.0161  -0.0187 458 GLN K CB  
4479 C CG  . GLN K 8   ? 0.1719 0.2562 0.3001 -0.0267 -0.0003 -0.0279 458 GLN K CG  
4480 C CD  . GLN K 8   ? 0.2045 0.3016 0.3647 -0.0411 -0.0071 -0.0271 458 GLN K CD  
4481 O OE1 . GLN K 8   ? 0.2186 0.3126 0.3936 -0.0492 0.0013  -0.0194 458 GLN K OE1 
4482 N NE2 . GLN K 8   ? 0.2348 0.3463 0.4060 -0.0453 -0.0236 -0.0338 458 GLN K NE2 
4483 N N   . ASP K 9   ? 0.1729 0.2648 0.3068 -0.0046 0.0514  0.0067  459 ASP K N   
4484 C CA  . ASP K 9   ? 0.2016 0.2810 0.3146 0.0084  0.0651  0.0122  459 ASP K CA  
4485 C C   . ASP K 9   ? 0.1865 0.2322 0.2678 0.0091  0.0616  0.0052  459 ASP K C   
4486 O O   . ASP K 9   ? 0.2105 0.2399 0.2660 0.0216  0.0644  0.0044  459 ASP K O   
4487 C CB  . ASP K 9   ? 0.2600 0.3539 0.3913 0.0048  0.0798  0.0257  459 ASP K CB  
4488 C CG  . ASP K 9   ? 0.3373 0.4736 0.5065 0.0038  0.0847  0.0361  459 ASP K CG  
4489 O OD1 . ASP K 9   ? 0.3594 0.5132 0.5598 -0.0121 0.0881  0.0465  459 ASP K OD1 
4490 O OD2 . ASP K 9   ? 0.3628 0.5153 0.5323 0.0185  0.0841  0.0349  459 ASP K OD2 
4491 N N   . TRP K 10  ? 0.1512 0.1862 0.2337 -0.0031 0.0540  -0.0003 460 TRP K N   
4492 C CA  . TRP K 10  ? 0.1533 0.1638 0.2117 -0.0021 0.0514  -0.0052 460 TRP K CA  
4493 C C   . TRP K 10  ? 0.1464 0.1520 0.1908 -0.0000 0.0411  -0.0125 460 TRP K C   
4494 O O   . TRP K 10  ? 0.1655 0.1582 0.1950 0.0001  0.0382  -0.0153 460 TRP K O   
4495 C CB  . TRP K 10  ? 0.1606 0.1610 0.2249 -0.0123 0.0492  -0.0069 460 TRP K CB  
4496 C CG  . TRP K 10  ? 0.1575 0.1677 0.2427 -0.0233 0.0397  -0.0120 460 TRP K CG  
4497 C CD1 . TRP K 10  ? 0.1913 0.2107 0.3026 -0.0347 0.0398  -0.0066 460 TRP K CD1 
4498 C CD2 . TRP K 10  ? 0.1555 0.1674 0.2359 -0.0240 0.0272  -0.0230 460 TRP K CD2 
4499 N NE1 . TRP K 10  ? 0.1789 0.2021 0.3010 -0.0430 0.0252  -0.0160 460 TRP K NE1 
4500 C CE2 . TRP K 10  ? 0.1669 0.1854 0.2674 -0.0346 0.0181  -0.0266 460 TRP K CE2 
4501 C CE3 . TRP K 10  ? 0.1642 0.1743 0.2255 -0.0170 0.0227  -0.0287 460 TRP K CE3 
4502 C CZ2 . TRP K 10  ? 0.1669 0.1871 0.2629 -0.0353 0.0042  -0.0382 460 TRP K CZ2 
4503 C CZ3 . TRP K 10  ? 0.1576 0.1735 0.2164 -0.0176 0.0122  -0.0373 460 TRP K CZ3 
4504 C CH2 . TRP K 10  ? 0.1722 0.1916 0.2453 -0.0251 0.0028  -0.0432 460 TRP K CH2 
4505 N N   . TYR K 11  ? 0.1417 0.1599 0.1920 0.0016  0.0357  -0.0136 461 TYR K N   
4506 C CA  . TYR K 11  ? 0.1572 0.1717 0.1946 0.0025  0.0272  -0.0165 461 TYR K CA  
4507 C C   . TYR K 11  ? 0.1649 0.1661 0.1862 0.0108  0.0269  -0.0130 461 TYR K C   
4508 O O   . TYR K 11  ? 0.1809 0.1850 0.2040 0.0195  0.0295  -0.0105 461 TYR K O   
4509 C CB  . TYR K 11  ? 0.1722 0.2036 0.2202 0.0004  0.0196  -0.0188 461 TYR K CB  
4510 C CG  . TYR K 11  ? 0.1466 0.1763 0.1805 0.0015  0.0128  -0.0180 461 TYR K CG  
4511 C CD1 . TYR K 11  ? 0.1790 0.2077 0.2039 -0.0018 0.0109  -0.0201 461 TYR K CD1 
4512 C CD2 . TYR K 11  ? 0.1615 0.1915 0.1909 0.0071  0.0089  -0.0132 461 TYR K CD2 
4513 C CE1 . TYR K 11  ? 0.2089 0.2417 0.2236 -0.0017 0.0070  -0.0153 461 TYR K CE1 
4514 C CE2 . TYR K 11  ? 0.1890 0.2163 0.2060 0.0062  0.0032  -0.0088 461 TYR K CE2 
4515 C CZ  . TYR K 11  ? 0.2039 0.2349 0.2148 0.0008  0.0030  -0.0088 461 TYR K CZ  
4516 O OH  . TYR K 11  ? 0.3759 0.4100 0.3772 -0.0010 -0.0004 -0.0005 461 TYR K OH  
4517 N N   . HIS K 12  ? 0.1682 0.1272 0.1604 0.0072  0.0012  -0.0133 462 HIS K N   
4518 C CA  . HIS K 12  ? 0.1622 0.1157 0.1524 0.0067  -0.0045 -0.0110 462 HIS K CA  
4519 C C   . HIS K 12  ? 0.1632 0.1257 0.1600 0.0035  -0.0119 -0.0055 462 HIS K C   
4520 O O   . HIS K 12  ? 0.1909 0.1491 0.1879 0.0028  -0.0183 -0.0027 462 HIS K O   
4521 C CB  . HIS K 12  ? 0.1755 0.1215 0.1573 0.0089  -0.0046 -0.0104 462 HIS K CB  
4522 C CG  . HIS K 12  ? 0.1762 0.1139 0.1517 0.0113  0.0013  -0.0138 462 HIS K CG  
4523 N ND1 . HIS K 12  ? 0.2143 0.1453 0.1837 0.0133  0.0003  -0.0154 462 HIS K ND1 
4524 C CD2 . HIS K 12  ? 0.2007 0.1375 0.1760 0.0119  0.0077  -0.0155 462 HIS K CD2 
4525 C CE1 . HIS K 12  ? 0.2598 0.1878 0.2246 0.0146  0.0065  -0.0170 462 HIS K CE1 
4526 N NE2 . HIS K 12  ? 0.2179 0.1484 0.1868 0.0135  0.0108  -0.0165 462 HIS K NE2 
4527 N N   . GLY K 13  ? 0.1703 0.1464 0.1732 0.0013  -0.0119 -0.0034 463 GLY K N   
4528 C CA  . GLY K 13  ? 0.1551 0.1423 0.1651 -0.0027 -0.0193 0.0038  463 GLY K CA  
4529 C C   . GLY K 13  ? 0.1802 0.1714 0.1881 -0.0037 -0.0239 0.0092  463 GLY K C   
4530 O O   . GLY K 13  ? 0.1801 0.1741 0.1828 -0.0016 -0.0206 0.0076  463 GLY K O   
4531 N N   . ALA K 14  ? 0.1820 0.1731 0.1954 -0.0070 -0.0324 0.0158  464 ALA K N   
4532 C CA  . ALA K 14  ? 0.1730 0.1708 0.1868 -0.0092 -0.0379 0.0227  464 ALA K CA  
4533 C C   . ALA K 14  ? 0.1847 0.1668 0.1924 -0.0066 -0.0401 0.0205  464 ALA K C   
4534 O O   . ALA K 14  ? 0.1923 0.1759 0.2032 -0.0090 -0.0475 0.0266  464 ALA K O   
4535 C CB  . ALA K 14  ? 0.2432 0.2530 0.2685 -0.0153 -0.0470 0.0333  464 ALA K CB  
4536 N N   . ILE K 15  ? 0.1834 0.1522 0.1826 -0.0019 -0.0340 0.0124  465 ILE K N   
4537 C CA  . ILE K 15  ? 0.1730 0.1302 0.1659 0.0007  -0.0362 0.0105  465 ILE K CA  
4538 C C   . ILE K 15  ? 0.1757 0.1399 0.1651 0.0004  -0.0368 0.0145  465 ILE K C   
4539 O O   . ILE K 15  ? 0.1807 0.1551 0.1686 0.0008  -0.0318 0.0144  465 ILE K O   
4540 C CB  . ILE K 15  ? 0.1958 0.1411 0.1797 0.0055  -0.0292 0.0026  465 ILE K CB  
4541 C CG1 . ILE K 15  ? 0.1906 0.1394 0.1694 0.0071  -0.0206 0.0006  465 ILE K CG1 
4542 C CG2 . ILE K 15  ? 0.2159 0.1555 0.2036 0.0062  -0.0294 -0.0021 465 ILE K CG2 
4543 C CD1 . ILE K 15  ? 0.2157 0.1543 0.1854 0.0108  -0.0150 -0.0039 465 ILE K CD1 
4544 N N   . PRO K 16  ? 0.1698 0.1296 0.1585 0.0001  -0.0431 0.0173  466 PRO K N   
4545 C CA  . PRO K 16  ? 0.1708 0.1378 0.1564 -0.0001 -0.0438 0.0209  466 PRO K CA  
4546 C C   . PRO K 16  ? 0.1829 0.1426 0.1575 0.0048  -0.0370 0.0153  466 PRO K C   
4547 O O   . PRO K 16  ? 0.1808 0.1291 0.1497 0.0079  -0.0328 0.0098  466 PRO K O   
4548 C CB  . PRO K 16  ? 0.1914 0.1536 0.1809 -0.0019 -0.0535 0.0250  466 PRO K CB  
4549 C CG  . PRO K 16  ? 0.2144 0.1616 0.2039 0.0006  -0.0554 0.0190  466 PRO K CG  
4550 C CD  . PRO K 16  ? 0.1854 0.1347 0.1783 0.0001  -0.0511 0.0167  466 PRO K CD  
4551 N N   . ARG K 17  ? 0.1795 0.1474 0.1520 0.0052  -0.0365 0.0174  467 ARG K N   
4552 C CA  . ARG K 17  ? 0.1784 0.1399 0.1424 0.0095  -0.0316 0.0134  467 ARG K CA  
4553 C C   . ARG K 17  ? 0.1840 0.1301 0.1404 0.0122  -0.0321 0.0110  467 ARG K C   
4554 O O   . ARG K 17  ? 0.2041 0.1425 0.1541 0.0152  -0.0266 0.0074  467 ARG K O   
4555 C CB  . ARG K 17  ? 0.1927 0.1650 0.1569 0.0096  -0.0336 0.0162  467 ARG K CB  
4556 C CG  . ARG K 17  ? 0.2208 0.1856 0.1775 0.0140  -0.0304 0.0129  467 ARG K CG  
4557 C CD  . ARG K 17  ? 0.2066 0.1828 0.1643 0.0147  -0.0329 0.0146  467 ARG K CD  
4558 N NE  . ARG K 17  ? 0.2192 0.2126 0.1835 0.0147  -0.0310 0.0127  467 ARG K NE  
4559 C CZ  . ARG K 17  ? 0.2045 0.2058 0.1698 0.0181  -0.0300 0.0091  467 ARG K CZ  
4560 N NH1 . ARG K 17  ? 0.2073 0.1996 0.1676 0.0213  -0.0306 0.0081  467 ARG K NH1 
4561 N NH2 . ARG K 17  ? 0.1819 0.2011 0.1541 0.0187  -0.0288 0.0058  467 ARG K NH2 
4562 N N   . ILE K 18  ? 0.1858 0.1285 0.1436 0.0110  -0.0392 0.0130  468 ILE K N   
4563 C CA  . ILE K 18  ? 0.2137 0.1447 0.1643 0.0143  -0.0405 0.0095  468 ILE K CA  
4564 C C   . ILE K 18  ? 0.2117 0.1358 0.1594 0.0165  -0.0360 0.0039  468 ILE K C   
4565 O O   . ILE K 18  ? 0.2298 0.1482 0.1688 0.0199  -0.0324 0.0006  468 ILE K O   
4566 C CB  . ILE K 18  ? 0.1979 0.1272 0.1531 0.0130  -0.0503 0.0115  468 ILE K CB  
4567 C CG1 . ILE K 18  ? 0.2462 0.1660 0.1932 0.0174  -0.0517 0.0065  468 ILE K CG1 
4568 C CG2 . ILE K 18  ? 0.2189 0.1488 0.1855 0.0098  -0.0565 0.0126  468 ILE K CG2 
4569 C CD1 . ILE K 18  ? 0.2937 0.2127 0.2303 0.0202  -0.0471 0.0069  468 ILE K CD1 
4570 N N   . GLU K 19  ? 0.1981 0.1243 0.1531 0.0144  -0.0362 0.0031  469 GLU K N   
4571 C CA  . GLU K 19  ? 0.2063 0.1277 0.1593 0.0165  -0.0318 -0.0025 469 GLU K CA  
4572 C C   . GLU K 19  ? 0.2379 0.1600 0.1857 0.0175  -0.0224 -0.0032 469 GLU K C   
4573 O O   . GLU K 19  ? 0.2344 0.1526 0.1761 0.0199  -0.0178 -0.0065 469 GLU K O   
4574 C CB  . GLU K 19  ? 0.2540 0.1773 0.2174 0.0140  -0.0354 -0.0030 469 GLU K CB  
4575 C CG  . GLU K 19  ? 0.2500 0.1695 0.2202 0.0138  -0.0459 -0.0038 469 GLU K CG  
4576 C CD  . GLU K 19  ? 0.2694 0.1899 0.2516 0.0112  -0.0506 -0.0036 469 GLU K CD  
4577 O OE1 . GLU K 19  ? 0.2403 0.1599 0.2327 0.0089  -0.0610 -0.0006 469 GLU K OE1 
4578 O OE2 . GLU K 19  ? 0.2326 0.1548 0.2152 0.0113  -0.0447 -0.0060 469 GLU K OE2 
4579 N N   . ALA K 20  ? 0.2183 0.1468 0.1697 0.0156  -0.0201 -0.0002 470 ALA K N   
4580 C CA  . ALA K 20  ? 0.2411 0.1692 0.1902 0.0167  -0.0128 -0.0013 470 ALA K CA  
4581 C C   . ALA K 20  ? 0.2819 0.2042 0.2225 0.0193  -0.0108 -0.0006 470 ALA K C   
4582 O O   . ALA K 20  ? 0.2574 0.1761 0.1947 0.0203  -0.0055 -0.0012 470 ALA K O   
4583 C CB  . ALA K 20  ? 0.2809 0.2185 0.2364 0.0153  -0.0122 0.0000  470 ALA K CB  
4584 N N   . GLN K 21  ? 0.2400 0.1422 0.2122 -0.0076 0.0004  0.0355  471 GLN K N   
4585 C CA  . GLN K 21  ? 0.3380 0.2338 0.2927 -0.0070 -0.0106 0.0330  471 GLN K CA  
4586 C C   . GLN K 21  ? 0.3793 0.2406 0.2935 -0.0078 -0.0119 0.0219  471 GLN K C   
4587 O O   . GLN K 21  ? 0.4390 0.2854 0.3229 -0.0036 -0.0132 0.0199  471 GLN K O   
4588 C CB  . GLN K 21  ? 0.4068 0.3188 0.3895 -0.0125 -0.0280 0.0390  471 GLN K CB  
4589 C CG  . GLN K 21  ? 0.4313 0.3754 0.4500 -0.0081 -0.0183 0.0512  471 GLN K CG  
4590 C CD  . GLN K 21  ? 0.4036 0.3708 0.4624 -0.0113 -0.0313 0.0589  471 GLN K CD  
4591 O OE1 . GLN K 21  ? 0.4522 0.4188 0.5321 -0.0223 -0.0473 0.0577  471 GLN K OE1 
4592 N NE2 . GLN K 21  ? 0.2327 0.2203 0.3069 -0.0014 -0.0250 0.0665  471 GLN K NE2 
4593 N N   . GLU K 22  ? 0.3844 0.2281 0.2929 -0.0112 -0.0086 0.0150  472 GLU K N   
4594 C CA  . GLU K 22  ? 0.4089 0.2148 0.2743 -0.0093 -0.0032 0.0039  472 GLU K CA  
4595 C C   . GLU K 22  ? 0.4127 0.2152 0.2707 -0.0018 0.0223  0.0022  472 GLU K C   
4596 O O   . GLU K 22  ? 0.5211 0.2928 0.3411 0.0018  0.0341  -0.0045 472 GLU K O   
4597 C CB  . GLU K 22  ? 0.5188 0.3036 0.3819 -0.0142 -0.0076 -0.0038 472 GLU K CB  
4598 C CG  . GLU K 22  ? 0.5928 0.3856 0.4803 -0.0250 -0.0317 -0.0008 472 GLU K CG  
4599 C CD  . GLU K 22  ? 0.7089 0.4638 0.5603 -0.0306 -0.0542 -0.0120 472 GLU K CD  
4600 O OE1 . GLU K 22  ? 0.7786 0.4966 0.5750 -0.0240 -0.0493 -0.0216 472 GLU K OE1 
4601 O OE2 . GLU K 22  ? 0.7113 0.4700 0.5882 -0.0418 -0.0768 -0.0113 472 GLU K OE2 
4602 N N   . LEU K 23  ? 0.2993 0.1302 0.1924 0.0007  0.0311  0.0083  473 LEU K N   
4603 C CA  . LEU K 23  ? 0.3071 0.1406 0.2079 0.0057  0.0509  0.0070  473 LEU K CA  
4604 C C   . LEU K 23  ? 0.3422 0.1811 0.2358 0.0073  0.0545  0.0115  473 LEU K C   
4605 O O   . LEU K 23  ? 0.3751 0.2109 0.2733 0.0091  0.0716  0.0104  473 LEU K O   
4606 C CB  . LEU K 23  ? 0.2610 0.1171 0.2015 0.0078  0.0518  0.0099  473 LEU K CB  
4607 C CG  . LEU K 23  ? 0.2962 0.1427 0.2459 0.0087  0.0525  0.0059  473 LEU K CG  
4608 C CD1 . LEU K 23  ? 0.3019 0.1673 0.2824 0.0114  0.0460  0.0122  473 LEU K CD1 
4609 C CD2 . LEU K 23  ? 0.4253 0.2541 0.3715 0.0138  0.0722  -0.0024 473 LEU K CD2 
4610 N N   . LEU K 24  ? 0.2994 0.1459 0.1866 0.0067  0.0397  0.0171  474 LEU K N   
4611 C CA  . LEU K 24  ? 0.2797 0.1292 0.1606 0.0097  0.0415  0.0220  474 LEU K CA  
4612 C C   . LEU K 24  ? 0.3624 0.1848 0.2006 0.0110  0.0356  0.0220  474 LEU K C   
4613 O O   . LEU K 24  ? 0.3736 0.1948 0.2042 0.0101  0.0157  0.0228  474 LEU K O   
4614 C CB  . LEU K 24  ? 0.2952 0.1713 0.2006 0.0118  0.0307  0.0288  474 LEU K CB  
4615 C CG  . LEU K 24  ? 0.2725 0.1663 0.2064 0.0123  0.0338  0.0293  474 LEU K CG  
4616 C CD1 . LEU K 24  ? 0.2874 0.1997 0.2350 0.0157  0.0272  0.0368  474 LEU K CD1 
4617 C CD2 . LEU K 24  ? 0.3216 0.2139 0.2634 0.0138  0.0438  0.0262  474 LEU K CD2 
4618 N N   . LYS K 25  ? 0.3491 0.1478 0.1604 0.0129  0.0521  0.0219  475 LYS K N   
4619 C CA  . LYS K 25  ? 0.3994 0.1589 0.1545 0.0157  0.0500  0.0216  475 LYS K CA  
4620 C C   . LYS K 25  ? 0.4699 0.2130 0.2017 0.0197  0.0568  0.0290  475 LYS K C   
4621 O O   . LYS K 25  ? 0.5170 0.2323 0.2040 0.0244  0.0437  0.0322  475 LYS K O   
4622 C CB  . LYS K 25  ? 0.4792 0.2066 0.2040 0.0155  0.0709  0.0144  475 LYS K CB  
4623 C CG  . LYS K 25  ? 0.5147 0.2452 0.2503 0.0130  0.0638  0.0060  475 LYS K CG  
4624 C CD  . LYS K 25  ? 0.6342 0.3351 0.3478 0.0158  0.0917  -0.0014 475 LYS K CD  
4625 C CE  . LYS K 25  ? 0.8102 0.4536 0.4438 0.0207  0.0957  -0.0053 475 LYS K CE  
4626 N NZ  . LYS K 25  ? 0.8879 0.5124 0.4977 0.0240  0.1163  0.0027  475 LYS K NZ  
4627 N N   . LYS K 26  ? 0.3962 0.1521 0.1564 0.0179  0.0747  0.0318  476 LYS K N   
4628 C CA  . LYS K 26  ? 0.4304 0.1659 0.1715 0.0198  0.0860  0.0380  476 LYS K CA  
4629 C C   . LYS K 26  ? 0.3871 0.1472 0.1643 0.0202  0.0797  0.0419  476 LYS K C   
4630 O O   . LYS K 26  ? 0.3516 0.1443 0.1702 0.0185  0.0729  0.0383  476 LYS K O   
4631 C CB  . LYS K 26  ? 0.4810 0.2036 0.2269 0.0160  0.1164  0.0344  476 LYS K CB  
4632 C CG  . LYS K 26  ? 0.6210 0.3111 0.3255 0.0187  0.1269  0.0294  476 LYS K CG  
4633 C CD  . LYS K 26  ? 0.7167 0.3972 0.4371 0.0166  0.1603  0.0274  476 LYS K CD  
4634 C CE  . LYS K 26  ? 0.8466 0.4861 0.5197 0.0217  0.1724  0.0236  476 LYS K CE  
4635 N NZ  . LYS K 26  ? 0.9091 0.5398 0.6038 0.0209  0.2077  0.0236  476 LYS K NZ  
4636 N N   . GLN K 27  ? 0.4078 0.1546 0.1712 0.0235  0.0796  0.0455  477 GLN K N   
4637 C CA  . GLN K 27  ? 0.3983 0.1572 0.1844 0.0257  0.0742  0.0484  477 GLN K CA  
4638 C C   . GLN K 27  ? 0.3830 0.1563 0.2091 0.0182  0.0852  0.0450  477 GLN K C   
4639 O O   . GLN K 27  ? 0.4179 0.1853 0.2578 0.0102  0.1037  0.0428  477 GLN K O   
4640 C CB  . GLN K 27  ? 0.4181 0.1536 0.1824 0.0282  0.0785  0.0515  477 GLN K CB  
4641 C CG  . GLN K 27  ? 0.4079 0.1472 0.1883 0.0314  0.0734  0.0536  477 GLN K CG  
4642 C CD  . GLN K 27  ? 0.4222 0.1710 0.1985 0.0440  0.0524  0.0572  477 GLN K CD  
4643 O OE1 . GLN K 27  ? 0.3970 0.1624 0.1775 0.0480  0.0398  0.0581  477 GLN K OE1 
4644 N NE2 . GLN K 27  ? 0.4534 0.1916 0.2256 0.0506  0.0495  0.0597  477 GLN K NE2 
4645 N N   . GLY K 28  ? 0.3417 0.1420 0.1941 0.0213  0.0707  0.0416  478 GLY K N   
4646 C CA  . GLY K 28  ? 0.3384 0.1537 0.2266 0.0162  0.0714  0.0353  478 GLY K CA  
4647 C C   . GLY K 28  ? 0.2844 0.1209 0.1996 0.0118  0.0717  0.0299  478 GLY K C   
4648 O O   . GLY K 28  ? 0.2762 0.1242 0.2211 0.0088  0.0672  0.0247  478 GLY K O   
4649 N N   . ASP K 29  ? 0.2710 0.1589 0.1740 0.0058  0.0257  0.0272  479 ASP K N   
4650 C CA  . ASP K 29  ? 0.2455 0.1394 0.1536 0.0046  0.0272  0.0195  479 ASP K CA  
4651 C C   . ASP K 29  ? 0.2373 0.1391 0.1602 0.0091  0.0234  0.0182  479 ASP K C   
4652 O O   . ASP K 29  ? 0.2437 0.1481 0.1695 0.0125  0.0178  0.0228  479 ASP K O   
4653 C CB  . ASP K 29  ? 0.2466 0.1395 0.1413 0.0000  0.0246  0.0187  479 ASP K CB  
4654 C CG  . ASP K 29  ? 0.2913 0.1752 0.1689 -0.0067 0.0314  0.0165  479 ASP K CG  
4655 O OD1 . ASP K 29  ? 0.3332 0.2135 0.2117 -0.0070 0.0379  0.0163  479 ASP K OD1 
4656 O OD2 . ASP K 29  ? 0.3204 0.2000 0.1819 -0.0133 0.0309  0.0146  479 ASP K OD2 
4657 N N   . PHE K 30  ? 0.2310 0.1381 0.1644 0.0091  0.0265  0.0133  480 PHE K N   
4658 C CA  . PHE K 30  ? 0.2188 0.1330 0.1637 0.0119  0.0227  0.0124  480 PHE K CA  
4659 C C   . PHE K 30  ? 0.2333 0.1550 0.1879 0.0117  0.0243  0.0091  480 PHE K C   
4660 O O   . PHE K 30  ? 0.2161 0.1390 0.1733 0.0105  0.0302  0.0080  480 PHE K O   
4661 C CB  . PHE K 30  ? 0.2159 0.1282 0.1650 0.0115  0.0242  0.0132  480 PHE K CB  
4662 C CG  . PHE K 30  ? 0.2313 0.1461 0.1838 0.0063  0.0287  0.0111  480 PHE K CG  
4663 C CD1 . PHE K 30  ? 0.2670 0.1751 0.2125 0.0027  0.0337  0.0120  480 PHE K CD1 
4664 C CD2 . PHE K 30  ? 0.2302 0.1560 0.1932 0.0036  0.0274  0.0099  480 PHE K CD2 
4665 C CE1 . PHE K 30  ? 0.2887 0.2022 0.2385 -0.0039 0.0373  0.0111  480 PHE K CE1 
4666 C CE2 . PHE K 30  ? 0.2263 0.1592 0.1941 -0.0031 0.0299  0.0104  480 PHE K CE2 
4667 C CZ  . PHE K 30  ? 0.2580 0.1854 0.2196 -0.0071 0.0350  0.0108  480 PHE K CZ  
4668 N N   . LEU K 31  ? 0.1842 0.1115 0.1457 0.0136  0.0198  0.0087  481 LEU K N   
4669 C CA  . LEU K 31  ? 0.1867 0.1216 0.1596 0.0143  0.0205  0.0079  481 LEU K CA  
4670 C C   . LEU K 31  ? 0.1717 0.1126 0.1507 0.0146  0.0150  0.0086  481 LEU K C   
4671 O O   . LEU K 31  ? 0.1732 0.1115 0.1480 0.0152  0.0120  0.0089  481 LEU K O   
4672 C CB  . LEU K 31  ? 0.2014 0.1312 0.1709 0.0155  0.0236  0.0058  481 LEU K CB  
4673 C CG  . LEU K 31  ? 0.2069 0.1312 0.1654 0.0141  0.0190  0.0043  481 LEU K CG  
4674 C CD1 . LEU K 31  ? 0.2048 0.1349 0.1713 0.0153  0.0140  0.0047  481 LEU K CD1 
4675 C CD2 . LEU K 31  ? 0.2524 0.1650 0.1980 0.0110  0.0251  0.0006  481 LEU K CD2 
4676 N N   . VAL K 32  ? 0.1541 0.1039 0.1442 0.0142  0.0143  0.0100  482 VAL K N   
4677 C CA  . VAL K 32  ? 0.1508 0.1064 0.1452 0.0129  0.0094  0.0108  482 VAL K CA  
4678 C C   . VAL K 32  ? 0.1479 0.1055 0.1482 0.0157  0.0084  0.0118  482 VAL K C   
4679 O O   . VAL K 32  ? 0.1684 0.1262 0.1751 0.0182  0.0127  0.0136  482 VAL K O   
4680 C CB  . VAL K 32  ? 0.1488 0.1133 0.1480 0.0069  0.0083  0.0130  482 VAL K CB  
4681 C CG1 . VAL K 32  ? 0.1590 0.1295 0.1606 0.0039  0.0037  0.0140  482 VAL K CG1 
4682 C CG2 . VAL K 32  ? 0.1806 0.1373 0.1699 0.0028  0.0111  0.0105  482 VAL K CG2 
4683 N N   . ARG K 33  ? 0.1466 0.1041 0.1451 0.0154  0.0042  0.0110  483 ARG K N   
4684 C CA  . ARG K 33  ? 0.1423 0.0990 0.1440 0.0168  0.0034  0.0117  483 ARG K CA  
4685 C C   . ARG K 33  ? 0.1438 0.1066 0.1478 0.0143  -0.0017 0.0128  483 ARG K C   
4686 O O   . ARG K 33  ? 0.1521 0.1174 0.1533 0.0120  -0.0032 0.0117  483 ARG K O   
4687 C CB  . ARG K 33  ? 0.1902 0.1363 0.1812 0.0168  0.0047  0.0081  483 ARG K CB  
4688 C CG  . ARG K 33  ? 0.1657 0.1130 0.1494 0.0150  -0.0001 0.0073  483 ARG K CG  
4689 C CD  . ARG K 33  ? 0.1780 0.1184 0.1494 0.0118  -0.0008 0.0055  483 ARG K CD  
4690 N NE  . ARG K 33  ? 0.1665 0.1132 0.1355 0.0109  -0.0063 0.0086  483 ARG K NE  
4691 C CZ  . ARG K 33  ? 0.1742 0.1291 0.1469 0.0095  -0.0113 0.0109  483 ARG K CZ  
4692 N NH1 . ARG K 33  ? 0.1750 0.1305 0.1507 0.0076  -0.0120 0.0092  483 ARG K NH1 
4693 N NH2 . ARG K 33  ? 0.1751 0.1385 0.1501 0.0104  -0.0152 0.0162  483 ARG K NH2 
4694 N N   . GLU K 34  ? 0.1467 0.1098 0.1552 0.0147  -0.0025 0.0149  484 GLU K N   
4695 C CA  . GLU K 34  ? 0.1688 0.1367 0.1780 0.0117  -0.0069 0.0160  484 GLU K CA  
4696 C C   . GLU K 34  ? 0.2108 0.1740 0.2128 0.0109  -0.0083 0.0124  484 GLU K C   
4697 O O   . GLU K 34  ? 0.2679 0.2229 0.2651 0.0110  -0.0067 0.0106  484 GLU K O   
4698 C CB  . GLU K 34  ? 0.2117 0.1813 0.2289 0.0123  -0.0072 0.0215  484 GLU K CB  
4699 C CG  . GLU K 34  ? 0.2871 0.2644 0.3165 0.0145  -0.0057 0.0288  484 GLU K CG  
4700 C CD  . GLU K 34  ? 0.4162 0.3923 0.4557 0.0180  -0.0041 0.0361  484 GLU K CD  
4701 O OE1 . GLU K 34  ? 0.5281 0.5044 0.5795 0.0239  0.0015  0.0419  484 GLU K OE1 
4702 O OE2 . GLU K 34  ? 0.4741 0.4486 0.5105 0.0153  -0.0073 0.0367  484 GLU K OE2 
4703 N N   . SER K 35  ? 0.1326 0.1013 0.1339 0.0089  -0.0106 0.0117  485 SER K N   
4704 C CA  . SER K 35  ? 0.1486 0.1187 0.1473 0.0081  -0.0126 0.0108  485 SER K CA  
4705 C C   . SER K 35  ? 0.1407 0.1096 0.1382 0.0044  -0.0148 0.0111  485 SER K C   
4706 O O   . SER K 35  ? 0.1519 0.1210 0.1523 0.0030  -0.0150 0.0127  485 SER K O   
4707 C CB  . SER K 35  ? 0.1500 0.1268 0.1520 0.0084  -0.0117 0.0113  485 SER K CB  
4708 O OG  . SER K 35  ? 0.1461 0.1292 0.1506 0.0086  -0.0135 0.0131  485 SER K OG  
4709 N N   . HIS K 36  ? 0.1491 0.1170 0.1411 0.0013  -0.0169 0.0103  486 HIS K N   
4710 C CA  . HIS K 36  ? 0.1545 0.1226 0.1437 -0.0048 -0.0194 0.0104  486 HIS K CA  
4711 C C   . HIS K 36  ? 0.1493 0.1323 0.1447 -0.0068 -0.0228 0.0132  486 HIS K C   
4712 O O   . HIS K 36  ? 0.1576 0.1443 0.1554 -0.0105 -0.0237 0.0139  486 HIS K O   
4713 C CB  . HIS K 36  ? 0.1746 0.1314 0.1509 -0.0108 -0.0191 0.0077  486 HIS K CB  
4714 C CG  . HIS K 36  ? 0.1937 0.1327 0.1653 -0.0089 -0.0123 0.0050  486 HIS K CG  
4715 N ND1 . HIS K 36  ? 0.2192 0.1525 0.1911 -0.0034 -0.0075 0.0041  486 HIS K ND1 
4716 C CD2 . HIS K 36  ? 0.2108 0.1366 0.1797 -0.0108 -0.0079 0.0043  486 HIS K CD2 
4717 C CE1 . HIS K 36  ? 0.2194 0.1382 0.1907 -0.0012 -0.0001 0.0034  486 HIS K CE1 
4718 N NE2 . HIS K 36  ? 0.2406 0.1536 0.2102 -0.0051 0.0001  0.0037  486 HIS K NE2 
4719 N N   . GLY K 37  ? 0.1440 0.1362 0.1437 -0.0038 -0.0239 0.0160  487 GLY K N   
4720 C CA  . GLY K 37  ? 0.1405 0.1489 0.1508 -0.0035 -0.0253 0.0208  487 GLY K CA  
4721 C C   . GLY K 37  ? 0.1409 0.1516 0.1588 0.0002  -0.0198 0.0201  487 GLY K C   
4722 O O   . GLY K 37  ? 0.1763 0.1979 0.2021 -0.0013 -0.0189 0.0226  487 GLY K O   
4723 N N   . LYS K 38  ? 0.1300 0.1309 0.1446 0.0034  -0.0156 0.0167  488 LYS K N   
4724 C CA  . LYS K 38  ? 0.1521 0.1520 0.1678 0.0033  -0.0100 0.0148  488 LYS K CA  
4725 C C   . LYS K 38  ? 0.1358 0.1280 0.1444 -0.0005 -0.0116 0.0127  488 LYS K C   
4726 O O   . LYS K 38  ? 0.1456 0.1325 0.1509 0.0004  -0.0099 0.0114  488 LYS K O   
4727 C CB  . LYS K 38  ? 0.1631 0.1600 0.1811 0.0088  -0.0026 0.0143  488 LYS K CB  
4728 C CG  . LYS K 38  ? 0.1866 0.1934 0.2167 0.0147  -0.0000 0.0199  488 LYS K CG  
4729 C CD  . LYS K 38  ? 0.3018 0.3019 0.3353 0.0210  0.0114  0.0196  488 LYS K CD  
4730 C CE  . LYS K 38  ? 0.4012 0.3996 0.4351 0.0187  0.0210  0.0165  488 LYS K CE  
4731 N NZ  . LYS K 38  ? 0.4682 0.4835 0.5160 0.0196  0.0202  0.0220  488 LYS K NZ  
4732 N N   . PRO K 39  ? 0.1337 0.1262 0.1410 -0.0050 -0.0150 0.0138  489 PRO K N   
4733 C CA  . PRO K 39  ? 0.1321 0.1193 0.1365 -0.0069 -0.0169 0.0153  489 PRO K CA  
4734 C C   . PRO K 39  ? 0.1529 0.1417 0.1546 -0.0099 -0.0152 0.0156  489 PRO K C   
4735 O O   . PRO K 39  ? 0.1580 0.1493 0.1568 -0.0135 -0.0117 0.0137  489 PRO K O   
4736 C CB  . PRO K 39  ? 0.1617 0.1487 0.1655 -0.0116 -0.0192 0.0174  489 PRO K CB  
4737 C CG  . PRO K 39  ? 0.1571 0.1473 0.1616 -0.0125 -0.0201 0.0160  489 PRO K CG  
4738 C CD  . PRO K 39  ? 0.1404 0.1386 0.1498 -0.0087 -0.0172 0.0151  489 PRO K CD  
4739 N N   . GLY K 40  ? 0.1361 0.1238 0.1386 -0.0095 -0.0169 0.0184  490 GLY K N   
4740 C CA  . GLY K 40  ? 0.1475 0.1389 0.1459 -0.0154 -0.0171 0.0199  490 GLY K CA  
4741 C C   . GLY K 40  ? 0.1533 0.1413 0.1478 -0.0148 -0.0129 0.0156  490 GLY K C   
4742 O O   . GLY K 40  ? 0.1570 0.1475 0.1469 -0.0214 -0.0135 0.0169  490 GLY K O   
4743 N N   . GLU K 41  ? 0.1447 0.1278 0.1406 -0.0084 -0.0091 0.0116  491 GLU K N   
4744 C CA  . GLU K 41  ? 0.1399 0.1173 0.1324 -0.0066 -0.0041 0.0084  491 GLU K CA  
4745 C C   . GLU K 41  ? 0.1349 0.1112 0.1310 -0.0021 -0.0062 0.0100  491 GLU K C   
4746 O O   . GLU K 41  ? 0.1604 0.1376 0.1613 0.0018  -0.0092 0.0120  491 GLU K O   
4747 C CB  . GLU K 41  ? 0.1658 0.1397 0.1603 -0.0009 0.0016  0.0061  491 GLU K CB  
4748 C CG  . GLU K 41  ? 0.2090 0.1843 0.2032 -0.0032 0.0064  0.0047  491 GLU K CG  
4749 C CD  . GLU K 41  ? 0.2929 0.2595 0.2756 -0.0105 0.0147  0.0002  491 GLU K CD  
4750 O OE1 . GLU K 41  ? 0.3599 0.3258 0.3396 -0.0142 0.0203  -0.0018 491 GLU K OE1 
4751 O OE2 . GLU K 41  ? 0.2975 0.2570 0.2724 -0.0142 0.0164  -0.0018 491 GLU K OE2 
4752 N N   . TYR K 42  ? 0.1439 0.1161 0.1357 -0.0037 -0.0030 0.0084  492 TYR K N   
4753 C CA  . TYR K 42  ? 0.1373 0.1078 0.1316 0.0003  -0.0030 0.0093  492 TYR K CA  
4754 C C   . TYR K 42  ? 0.1530 0.1155 0.1448 0.0059  0.0011  0.0072  492 TYR K C   
4755 O O   . TYR K 42  ? 0.1518 0.1092 0.1406 0.0063  0.0061  0.0053  492 TYR K O   
4756 C CB  . TYR K 42  ? 0.1466 0.1199 0.1387 -0.0065 -0.0028 0.0106  492 TYR K CB  
4757 C CG  . TYR K 42  ? 0.1385 0.1244 0.1373 -0.0112 -0.0083 0.0169  492 TYR K CG  
4758 C CD1 . TYR K 42  ? 0.1482 0.1398 0.1419 -0.0210 -0.0111 0.0186  492 TYR K CD1 
4759 C CD2 . TYR K 42  ? 0.1626 0.1546 0.1730 -0.0061 -0.0098 0.0224  492 TYR K CD2 
4760 C CE1 . TYR K 42  ? 0.1646 0.1707 0.1661 -0.0256 -0.0175 0.0276  492 TYR K CE1 
4761 C CE2 . TYR K 42  ? 0.1458 0.1512 0.1668 -0.0085 -0.0141 0.0314  492 TYR K CE2 
4762 C CZ  . TYR K 42  ? 0.1555 0.1694 0.1727 -0.0183 -0.0191 0.0349  492 TYR K CZ  
4763 O OH  . TYR K 42  ? 0.1789 0.2089 0.2080 -0.0210 -0.0248 0.0468  492 TYR K OH  
4764 N N   . VAL K 43  ? 0.1409 0.1018 0.1338 0.0103  0.0001  0.0082  493 VAL K N   
4765 C CA  . VAL K 43  ? 0.1469 0.1028 0.1377 0.0151  0.0019  0.0089  493 VAL K CA  
4766 C C   . VAL K 43  ? 0.1510 0.1013 0.1377 0.0151  0.0044  0.0087  493 VAL K C   
4767 O O   . VAL K 43  ? 0.1584 0.1106 0.1462 0.0139  0.0037  0.0087  493 VAL K O   
4768 C CB  . VAL K 43  ? 0.1566 0.1159 0.1483 0.0173  -0.0026 0.0107  493 VAL K CB  
4769 C CG1 . VAL K 43  ? 0.1803 0.1386 0.1701 0.0206  -0.0029 0.0142  493 VAL K CG1 
4770 C CG2 . VAL K 43  ? 0.1775 0.1433 0.1736 0.0160  -0.0053 0.0111  493 VAL K CG2 
4771 N N   . LEU K 44  ? 0.1623 0.1052 0.1453 0.0169  0.0087  0.0092  494 LEU K N   
4772 C CA  . LEU K 44  ? 0.1686 0.1052 0.1465 0.0174  0.0110  0.0100  494 LEU K CA  
4773 C C   . LEU K 44  ? 0.1841 0.1208 0.1605 0.0219  0.0083  0.0143  494 LEU K C   
4774 O O   . LEU K 44  ? 0.1943 0.1313 0.1740 0.0262  0.0087  0.0185  494 LEU K O   
4775 C CB  . LEU K 44  ? 0.1971 0.1230 0.1697 0.0153  0.0180  0.0089  494 LEU K CB  
4776 C CG  . LEU K 44  ? 0.2154 0.1326 0.1819 0.0158  0.0213  0.0106  494 LEU K CG  
4777 C CD1 . LEU K 44  ? 0.2117 0.1335 0.1773 0.0109  0.0203  0.0091  494 LEU K CD1 
4778 C CD2 . LEU K 44  ? 0.2495 0.1515 0.2097 0.0143  0.0299  0.0097  494 LEU K CD2 
4779 N N   . SER K 45  ? 0.1767 0.1138 0.1484 0.0204  0.0061  0.0140  495 SER K N   
4780 C CA  . SER K 45  ? 0.2064 0.1439 0.1720 0.0207  0.0024  0.0181  495 SER K CA  
4781 C C   . SER K 45  ? 0.2066 0.1361 0.1638 0.0200  0.0057  0.0197  495 SER K C   
4782 O O   . SER K 45  ? 0.2032 0.1284 0.1574 0.0176  0.0100  0.0156  495 SER K O   
4783 C CB  . SER K 45  ? 0.1951 0.1344 0.1558 0.0166  -0.0007 0.0153  495 SER K CB  
4784 O OG  . SER K 45  ? 0.1956 0.1418 0.1631 0.0165  -0.0041 0.0147  495 SER K OG  
4785 N N   . VAL K 46  ? 0.2312 0.1600 0.1862 0.0224  0.0040  0.0270  496 VAL K N   
4786 C CA  A VAL K 46  ? 0.2689 0.1890 0.2156 0.0220  0.0073  0.0301  496 VAL K CA  
4787 C CA  B VAL K 46  ? 0.2641 0.1842 0.2109 0.0220  0.0073  0.0302  496 VAL K CA  
4788 C C   . VAL K 46  ? 0.3040 0.2282 0.2433 0.0205  0.0010  0.0390  496 VAL K C   
4789 O O   . VAL K 46  ? 0.3997 0.3348 0.3456 0.0223  -0.0052 0.0460  496 VAL K O   
4790 C CB  A VAL K 46  ? 0.2738 0.1852 0.2254 0.0266  0.0139  0.0323  496 VAL K CB  
4791 C CB  B VAL K 46  ? 0.2709 0.1824 0.2226 0.0267  0.0138  0.0325  496 VAL K CB  
4792 C CG1 A VAL K 46  ? 0.2652 0.1654 0.2071 0.0249  0.0183  0.0347  496 VAL K CG1 
4793 C CG1 B VAL K 46  ? 0.2861 0.1948 0.2416 0.0243  0.0188  0.0242  496 VAL K CG1 
4794 C CG2 A VAL K 46  ? 0.3034 0.2128 0.2597 0.0247  0.0185  0.0243  496 VAL K CG2 
4795 C CG2 B VAL K 46  ? 0.2646 0.1800 0.2263 0.0340  0.0127  0.0415  496 VAL K CG2 
4796 N N   . TYR K 47  ? 0.2758 0.1438 0.2024 0.0236  0.0014  0.0471  497 TYR K N   
4797 C CA  . TYR K 47  ? 0.2962 0.1608 0.2121 0.0260  -0.0001 0.0501  497 TYR K CA  
4798 C C   . TYR K 47  ? 0.2932 0.1500 0.2076 0.0296  0.0006  0.0535  497 TYR K C   
4799 O O   . TYR K 47  ? 0.3018 0.1504 0.2165 0.0269  0.0045  0.0549  497 TYR K O   
4800 C CB  . TYR K 47  ? 0.3082 0.1657 0.2137 0.0241  0.0041  0.0515  497 TYR K CB  
4801 C CG  . TYR K 47  ? 0.2927 0.1473 0.1849 0.0247  0.0014  0.0543  497 TYR K CG  
4802 C CD1 . TYR K 47  ? 0.3255 0.1748 0.2140 0.0278  0.0021  0.0587  497 TYR K CD1 
4803 C CD2 . TYR K 47  ? 0.3554 0.2118 0.2366 0.0208  -0.0023 0.0532  497 TYR K CD2 
4804 C CE1 . TYR K 47  ? 0.3320 0.1805 0.2086 0.0284  -0.0007 0.0623  497 TYR K CE1 
4805 C CE2 . TYR K 47  ? 0.3812 0.2370 0.2493 0.0193  -0.0059 0.0567  497 TYR K CE2 
4806 C CZ  . TYR K 47  ? 0.3521 0.2055 0.2193 0.0238  -0.0050 0.0615  497 TYR K CZ  
4807 O OH  . TYR K 47  ? 0.4195 0.2741 0.2740 0.0224  -0.0089 0.0660  497 TYR K OH  
4808 N N   . SER K 48  ? 0.2821 0.1415 0.1935 0.0355  -0.0028 0.0558  498 SER K N   
4809 C CA  . SER K 48  ? 0.3017 0.1486 0.2073 0.0412  -0.0012 0.0592  498 SER K CA  
4810 C C   . SER K 48  ? 0.3041 0.1565 0.2032 0.0494  -0.0039 0.0647  498 SER K C   
4811 O O   . SER K 48  ? 0.3058 0.1758 0.2097 0.0526  -0.0080 0.0660  498 SER K O   
4812 C CB  . SER K 48  ? 0.3007 0.1427 0.2098 0.0433  -0.0006 0.0567  498 SER K CB  
4813 O OG  . SER K 48  ? 0.3418 0.1644 0.2387 0.0489  0.0021  0.0598  498 SER K OG  
4814 N N   . ASP K 49  ? 0.3223 0.1618 0.2107 0.0524  -0.0016 0.0692  499 ASP K N   
4815 C CA  . ASP K 49  ? 0.3678 0.2122 0.2492 0.0615  -0.0037 0.0763  499 ASP K CA  
4816 C C   . ASP K 49  ? 0.3515 0.2198 0.2363 0.0587  -0.0096 0.0783  499 ASP K C   
4817 O O   . ASP K 49  ? 0.3465 0.2334 0.2345 0.0652  -0.0135 0.0836  499 ASP K O   
4818 C CB  . ASP K 49  ? 0.3982 0.2370 0.2761 0.0745  -0.0018 0.0799  499 ASP K CB  
4819 C CG  . ASP K 49  ? 0.4836 0.2910 0.3494 0.0750  0.0039  0.0786  499 ASP K CG  
4820 O OD1 . ASP K 49  ? 0.4307 0.2245 0.2899 0.0674  0.0057  0.0785  499 ASP K OD1 
4821 O OD2 . ASP K 49  ? 0.5517 0.3506 0.4149 0.0804  0.0064  0.0767  499 ASP K OD2 
4822 N N   . GLY K 50  ? 0.3360 0.2035 0.2184 0.0483  -0.0101 0.0747  500 GLY K N   
4823 C CA  . GLY K 50  ? 0.3602 0.2418 0.2376 0.0421  -0.0157 0.0764  500 GLY K CA  
4824 C C   . GLY K 50  ? 0.3352 0.2326 0.2191 0.0362  -0.0202 0.0731  500 GLY K C   
4825 O O   . GLY K 50  ? 0.3771 0.2851 0.2534 0.0284  -0.0258 0.0751  500 GLY K O   
4826 N N   . GLN K 51  ? 0.3170 0.2151 0.2123 0.0381  -0.0183 0.0686  501 GLN K N   
4827 C CA  . GLN K 51  ? 0.3278 0.2407 0.2289 0.0325  -0.0226 0.0659  501 GLN K CA  
4828 C C   . GLN K 51  ? 0.3240 0.2267 0.2317 0.0296  -0.0185 0.0581  501 GLN K C   
4829 O O   . GLN K 51  ? 0.2964 0.1874 0.2088 0.0337  -0.0135 0.0563  501 GLN K O   
4830 C CB  . GLN K 51  ? 0.3405 0.2758 0.2513 0.0402  -0.0262 0.0714  501 GLN K CB  
4831 C CG  . GLN K 51  ? 0.3705 0.3229 0.2772 0.0448  -0.0305 0.0818  501 GLN K CG  
4832 C CD  . GLN K 51  ? 0.4672 0.4432 0.3843 0.0567  -0.0317 0.0894  501 GLN K CD  
4833 O OE1 . GLN K 51  ? 0.5147 0.5071 0.4408 0.0546  -0.0340 0.0885  501 GLN K OE1 
4834 N NE2 . GLN K 51  ? 0.4944 0.4717 0.4091 0.0706  -0.0292 0.0978  501 GLN K NE2 
4835 N N   . ARG K 52  ? 0.3005 0.2072 0.2064 0.0214  -0.0210 0.0544  502 ARG K N   
4836 C CA  . ARG K 52  ? 0.2917 0.1941 0.2054 0.0197  -0.0182 0.0484  502 ARG K CA  
4837 C C   . ARG K 52  ? 0.2915 0.2085 0.2182 0.0238  -0.0207 0.0486  502 ARG K C   
4838 O O   . ARG K 52  ? 0.3747 0.3100 0.3026 0.0231  -0.0262 0.0522  502 ARG K O   
4839 C CB  . ARG K 52  ? 0.3853 0.2824 0.2881 0.0105  -0.0191 0.0447  502 ARG K CB  
4840 C CG  . ARG K 52  ? 0.4461 0.3233 0.3343 0.0088  -0.0133 0.0434  502 ARG K CG  
4841 C CD  . ARG K 52  ? 0.4771 0.3493 0.3450 0.0026  -0.0167 0.0460  502 ARG K CD  
4842 N NE  . ARG K 52  ? 0.4465 0.2969 0.2977 0.0026  -0.0097 0.0448  502 ARG K NE  
4843 C CZ  . ARG K 52  ? 0.4716 0.3127 0.3042 -0.0008 -0.0102 0.0473  502 ARG K CZ  
4844 N NH1 . ARG K 52  ? 0.5070 0.3612 0.3366 -0.0053 -0.0184 0.0517  502 ARG K NH1 
4845 N NH2 . ARG K 52  ? 0.5569 0.3771 0.3735 0.0010  -0.0022 0.0463  502 ARG K NH2 
4846 N N   . ARG K 53  ? 0.2723 0.1825 0.2076 0.0276  -0.0168 0.0456  503 ARG K N   
4847 C CA  . ARG K 53  ? 0.2668 0.1860 0.2113 0.0326  -0.0178 0.0453  503 ARG K CA  
4848 C C   . ARG K 53  ? 0.2864 0.2021 0.2377 0.0280  -0.0163 0.0395  503 ARG K C   
4849 O O   . ARG K 53  ? 0.2866 0.1912 0.2378 0.0246  -0.0128 0.0372  503 ARG K O   
4850 C CB  . ARG K 53  ? 0.3198 0.2296 0.2626 0.0423  -0.0144 0.0483  503 ARG K CB  
4851 C CG  . ARG K 53  ? 0.3360 0.2491 0.2716 0.0483  -0.0153 0.0552  503 ARG K CG  
4852 C CD  . ARG K 53  ? 0.3715 0.2666 0.2997 0.0575  -0.0106 0.0581  503 ARG K CD  
4853 N NE  . ARG K 53  ? 0.3795 0.2744 0.2997 0.0614  -0.0111 0.0643  503 ARG K NE  
4854 C CZ  . ARG K 53  ? 0.4341 0.3439 0.3531 0.0711  -0.0130 0.0723  503 ARG K CZ  
4855 N NH1 . ARG K 53  ? 0.4495 0.3768 0.3752 0.0787  -0.0139 0.0752  503 ARG K NH1 
4856 N NH2 . ARG K 53  ? 0.3931 0.3025 0.3044 0.0738  -0.0137 0.0783  503 ARG K NH2 
4857 N N   . HIS K 54  ? 0.2171 0.1451 0.1749 0.0282  -0.0189 0.0383  504 HIS K N   
4858 C CA  . HIS K 54  ? 0.2075 0.1350 0.1713 0.0231  -0.0186 0.0332  504 HIS K CA  
4859 C C   . HIS K 54  ? 0.2169 0.1467 0.1869 0.0280  -0.0178 0.0322  504 HIS K C   
4860 O O   . HIS K 54  ? 0.2285 0.1717 0.2006 0.0331  -0.0197 0.0348  504 HIS K O   
4861 C CB  . HIS K 54  ? 0.2045 0.1418 0.1656 0.0158  -0.0227 0.0321  504 HIS K CB  
4862 C CG  . HIS K 54  ? 0.2146 0.1447 0.1630 0.0106  -0.0232 0.0331  504 HIS K CG  
4863 N ND1 . HIS K 54  ? 0.2303 0.1447 0.1720 0.0081  -0.0189 0.0306  504 HIS K ND1 
4864 C CD2 . HIS K 54  ? 0.2237 0.1598 0.1629 0.0079  -0.0271 0.0372  504 HIS K CD2 
4865 C CE1 . HIS K 54  ? 0.2617 0.1687 0.1882 0.0044  -0.0194 0.0320  504 HIS K CE1 
4866 N NE2 . HIS K 54  ? 0.2578 0.1777 0.1824 0.0028  -0.0250 0.0358  504 HIS K NE2 
4867 N N   . PHE K 55  ? 0.2040 0.1217 0.1758 0.0262  -0.0149 0.0292  505 PHE K N   
4868 C CA  . PHE K 55  ? 0.2115 0.1244 0.1840 0.0292  -0.0136 0.0276  505 PHE K CA  
4869 C C   . PHE K 55  ? 0.1954 0.1133 0.1752 0.0227  -0.0149 0.0235  505 PHE K C   
4870 O O   . PHE K 55  ? 0.2164 0.1322 0.1993 0.0163  -0.0144 0.0224  505 PHE K O   
4871 C CB  . PHE K 55  ? 0.2205 0.1126 0.1850 0.0288  -0.0101 0.0279  505 PHE K CB  
4872 C CG  . PHE K 55  ? 0.2450 0.1275 0.1997 0.0358  -0.0081 0.0321  505 PHE K CG  
4873 C CD1 . PHE K 55  ? 0.2660 0.1387 0.2107 0.0462  -0.0055 0.0341  505 PHE K CD1 
4874 C CD2 . PHE K 55  ? 0.2736 0.1555 0.2272 0.0333  -0.0080 0.0344  505 PHE K CD2 
4875 C CE1 . PHE K 55  ? 0.3114 0.1741 0.2458 0.0540  -0.0031 0.0388  505 PHE K CE1 
4876 C CE2 . PHE K 55  ? 0.3317 0.2047 0.2759 0.0396  -0.0063 0.0386  505 PHE K CE2 
4877 C CZ  . PHE K 55  ? 0.3250 0.1885 0.2598 0.0501  -0.0041 0.0410  505 PHE K CZ  
4878 N N   . ILE K 56  ? 0.2080 0.1337 0.1904 0.0254  -0.0160 0.0222  506 ILE K N   
4879 C CA  . ILE K 56  ? 0.2024 0.1302 0.1901 0.0195  -0.0170 0.0185  506 ILE K CA  
4880 C C   . ILE K 56  ? 0.2006 0.1118 0.1837 0.0164  -0.0148 0.0171  506 ILE K C   
4881 O O   . ILE K 56  ? 0.2334 0.1302 0.2061 0.0212  -0.0122 0.0176  506 ILE K O   
4882 C CB  . ILE K 56  ? 0.2277 0.1689 0.2185 0.0229  -0.0185 0.0180  506 ILE K CB  
4883 C CG1 . ILE K 56  ? 0.2115 0.1711 0.2058 0.0209  -0.0222 0.0202  506 ILE K CG1 
4884 C CG2 . ILE K 56  ? 0.2205 0.1607 0.2150 0.0173  -0.0191 0.0140  506 ILE K CG2 
4885 C CD1 . ILE K 56  ? 0.2014 0.1606 0.1968 0.0114  -0.0243 0.0176  506 ILE K CD1 
4886 N N   . ILE K 57  ? 0.1976 0.1099 0.1861 0.0080  -0.0155 0.0162  507 ILE K N   
4887 C CA  . ILE K 57  ? 0.2316 0.1329 0.2162 0.0010  -0.0152 0.0159  507 ILE K CA  
4888 C C   . ILE K 57  ? 0.2472 0.1492 0.2311 0.0001  -0.0164 0.0125  507 ILE K C   
4889 O O   . ILE K 57  ? 0.2392 0.1543 0.2325 -0.0027 -0.0184 0.0113  507 ILE K O   
4890 C CB  . ILE K 57  ? 0.2338 0.1427 0.2265 -0.0069 -0.0155 0.0190  507 ILE K CB  
4891 C CG1 . ILE K 57  ? 0.2890 0.1973 0.2813 -0.0047 -0.0132 0.0226  507 ILE K CG1 
4892 C CG2 . ILE K 57  ? 0.2717 0.1738 0.2603 -0.0173 -0.0166 0.0204  507 ILE K CG2 
4893 C CD1 . ILE K 57  ? 0.2606 0.1795 0.2611 -0.0090 -0.0117 0.0274  507 ILE K CD1 
4894 N N   . GLN K 58  ? 0.1687 0.1611 0.2019 -0.0164 -0.0255 0.0199  508 GLN K N   
4895 C CA  . GLN K 58  ? 0.1626 0.1650 0.2090 -0.0137 -0.0169 0.0013  508 GLN K CA  
4896 C C   . GLN K 58  ? 0.1712 0.1535 0.1984 -0.0181 -0.0092 -0.0043 508 GLN K C   
4897 O O   . GLN K 58  ? 0.1904 0.1544 0.2187 -0.0176 -0.0145 0.0016  508 GLN K O   
4898 C CB  . GLN K 58  ? 0.1929 0.1983 0.2736 0.0031  -0.0224 -0.0048 508 GLN K CB  
4899 C CG  . GLN K 58  ? 0.3227 0.3497 0.4287 0.0145  -0.0372 0.0046  508 GLN K CG  
4900 C CD  . GLN K 58  ? 0.4286 0.4984 0.5461 0.0066  -0.0363 -0.0042 508 GLN K CD  
4901 O OE1 . GLN K 58  ? 0.4693 0.5599 0.5914 0.0071  -0.0533 0.0047  508 GLN K OE1 
4902 N NE2 . GLN K 58  ? 0.4688 0.5508 0.5887 -0.0026 -0.0165 -0.0222 508 GLN K NE2 
4903 N N   . TYR K 59  ? 0.1676 0.1541 0.1775 -0.0230 0.0027  -0.0149 509 TYR K N   
4904 C CA  . TYR K 59  ? 0.1750 0.1446 0.1599 -0.0235 0.0053  -0.0199 509 TYR K CA  
4905 C C   . TYR K 59  ? 0.1946 0.1662 0.1741 -0.0190 0.0148  -0.0379 509 TYR K C   
4906 O O   . TYR K 59  ? 0.2243 0.2063 0.1951 -0.0237 0.0314  -0.0429 509 TYR K O   
4907 C CB  . TYR K 59  ? 0.1950 0.1567 0.1498 -0.0309 0.0130  -0.0115 509 TYR K CB  
4908 C CG  . TYR K 59  ? 0.2090 0.1553 0.1358 -0.0267 0.0104  -0.0133 509 TYR K CG  
4909 C CD1 . TYR K 59  ? 0.2220 0.1654 0.1590 -0.0221 -0.0058 -0.0123 509 TYR K CD1 
4910 C CD2 . TYR K 59  ? 0.2435 0.1791 0.1334 -0.0280 0.0233  -0.0155 509 TYR K CD2 
4911 C CE1 . TYR K 59  ? 0.2446 0.1811 0.1579 -0.0167 -0.0156 -0.0151 509 TYR K CE1 
4912 C CE2 . TYR K 59  ? 0.2647 0.1845 0.1193 -0.0210 0.0161  -0.0143 509 TYR K CE2 
4913 C CZ  . TYR K 59  ? 0.2667 0.1901 0.1342 -0.0143 -0.0066 -0.0150 509 TYR K CZ  
4914 O OH  . TYR K 59  ? 0.3240 0.2386 0.1585 -0.0060 -0.0211 -0.0149 509 TYR K OH  
4915 N N   . VAL K 60  ? 0.2227 0.1830 0.2084 -0.0118 0.0072  -0.0496 510 VAL K N   
4916 C CA  . VAL K 60  ? 0.2617 0.2196 0.2407 -0.0057 0.0181  -0.0712 510 VAL K CA  
4917 C C   . VAL K 60  ? 0.2951 0.2309 0.2522 -0.0048 0.0058  -0.0844 510 VAL K C   
4918 O O   . VAL K 60  ? 0.2665 0.1934 0.2439 -0.0065 -0.0112 -0.0808 510 VAL K O   
4919 C CB  . VAL K 60  ? 0.3095 0.2790 0.3352 0.0055  0.0213  -0.0786 510 VAL K CB  
4920 C CG1 . VAL K 60  ? 0.3793 0.3327 0.4329 0.0106  0.0031  -0.0693 510 VAL K CG1 
4921 C CG2 . VAL K 60  ? 0.3423 0.3073 0.3639 0.0140  0.0376  -0.1049 510 VAL K CG2 
4922 N N   . ASP K 61  ? 0.3068 0.2341 0.2205 -0.0041 0.0148  -0.1003 511 ASP K N   
4923 C CA  . ASP K 61  ? 0.3604 0.2689 0.2451 -0.0041 -0.0005 -0.1183 511 ASP K CA  
4924 C C   . ASP K 61  ? 0.3352 0.2452 0.2218 -0.0095 -0.0267 -0.1048 511 ASP K C   
4925 O O   . ASP K 61  ? 0.3646 0.2689 0.2691 -0.0132 -0.0462 -0.1164 511 ASP K O   
4926 C CB  . ASP K 61  ? 0.4261 0.3207 0.3400 0.0007  -0.0015 -0.1424 511 ASP K CB  
4927 C CG  . ASP K 61  ? 0.5877 0.4611 0.4637 -0.0021 -0.0143 -0.1705 511 ASP K CG  
4928 O OD1 . ASP K 61  ? 0.6621 0.5346 0.4799 -0.0044 -0.0201 -0.1717 511 ASP K OD1 
4929 O OD2 . ASP K 61  ? 0.6193 0.4743 0.5205 -0.0024 -0.0191 -0.1869 511 ASP K OD2 
4930 N N   . ASN K 62  ? 0.3391 0.2574 0.2135 -0.0105 -0.0251 -0.0816 512 ASN K N   
4931 C CA  . ASN K 62  ? 0.3405 0.2653 0.2220 -0.0115 -0.0452 -0.0675 512 ASN K CA  
4932 C C   . ASN K 62  ? 0.2934 0.2273 0.2336 -0.0170 -0.0533 -0.0616 512 ASN K C   
4933 O O   . ASN K 62  ? 0.3392 0.2829 0.3000 -0.0197 -0.0704 -0.0587 512 ASN K O   
4934 C CB  . ASN K 62  ? 0.4642 0.3857 0.3096 -0.0084 -0.0687 -0.0792 512 ASN K CB  
4935 C CG  . ASN K 62  ? 0.5758 0.4804 0.3482 -0.0029 -0.0581 -0.0827 512 ASN K CG  
4936 O OD1 . ASN K 62  ? 0.6804 0.5735 0.4189 -0.0029 -0.0588 -0.1062 512 ASN K OD1 
4937 N ND2 . ASN K 62  ? 0.5969 0.4944 0.3407 0.0010  -0.0447 -0.0597 512 ASN K ND2 
4938 N N   . MET K 63  ? 0.2441 0.1759 0.2125 -0.0183 -0.0407 -0.0584 513 MET K N   
4939 C CA  . MET K 63  ? 0.2317 0.1630 0.2446 -0.0235 -0.0444 -0.0491 513 MET K CA  
4940 C C   . MET K 63  ? 0.2402 0.1759 0.2609 -0.0220 -0.0314 -0.0302 513 MET K C   
4941 O O   . MET K 63  ? 0.2296 0.1703 0.2384 -0.0176 -0.0214 -0.0318 513 MET K O   
4942 C CB  . MET K 63  ? 0.2811 0.1942 0.3175 -0.0245 -0.0479 -0.0658 513 MET K CB  
4943 C CG  . MET K 63  ? 0.3448 0.2513 0.3758 -0.0301 -0.0638 -0.0904 513 MET K CG  
4944 S SD  . MET K 63  ? 0.4081 0.2811 0.4688 -0.0330 -0.0632 -0.1123 513 MET K SD  
4945 C CE  . MET K 63  ? 0.4215 0.2852 0.4492 -0.0170 -0.0470 -0.1317 513 MET K CE  
4946 N N   . TYR K 64  ? 0.1845 0.1203 0.2258 -0.0272 -0.0313 -0.0138 514 TYR K N   
4947 C CA  . TYR K 64  ? 0.1773 0.1142 0.2186 -0.0268 -0.0230 0.0034  514 TYR K CA  
4948 C C   . TYR K 64  ? 0.1882 0.1083 0.2523 -0.0246 -0.0254 0.0098  514 TYR K C   
4949 O O   . TYR K 64  ? 0.2044 0.1091 0.2900 -0.0304 -0.0281 0.0082  514 TYR K O   
4950 C CB  . TYR K 64  ? 0.1972 0.1390 0.2341 -0.0327 -0.0166 0.0184  514 TYR K CB  
4951 C CG  . TYR K 64  ? 0.1588 0.1085 0.1730 -0.0311 -0.0129 0.0161  514 TYR K CG  
4952 C CD1 . TYR K 64  ? 0.1622 0.1125 0.1514 -0.0318 -0.0037 0.0189  514 TYR K CD1 
4953 C CD2 . TYR K 64  ? 0.1646 0.1197 0.1839 -0.0288 -0.0201 0.0115  514 TYR K CD2 
4954 C CE1 . TYR K 64  ? 0.1724 0.1188 0.1391 -0.0306 0.0029  0.0188  514 TYR K CE1 
4955 C CE2 . TYR K 64  ? 0.1709 0.1259 0.1662 -0.0229 -0.0175 0.0139  514 TYR K CE2 
4956 C CZ  . TYR K 64  ? 0.1702 0.1159 0.1375 -0.0240 -0.0036 0.0185  514 TYR K CZ  
4957 O OH  . TYR K 64  ? 0.2024 0.1369 0.1439 -0.0187 0.0024  0.0228  514 TYR K OH  
4958 N N   . ARG K 65  ? 0.1844 0.1355 0.2110 -0.0243 -0.0071 -0.0133 515 ARG K N   
4959 C CA  . ARG K 65  ? 0.1871 0.1356 0.2397 -0.0116 -0.0109 -0.0150 515 ARG K CA  
4960 C C   . ARG K 65  ? 0.1874 0.1451 0.2385 -0.0027 -0.0117 -0.0142 515 ARG K C   
4961 O O   . ARG K 65  ? 0.1817 0.1551 0.2184 -0.0093 -0.0080 -0.0175 515 ARG K O   
4962 C CB  . ARG K 65  ? 0.2229 0.1784 0.2910 -0.0091 -0.0145 -0.0376 515 ARG K CB  
4963 C CG  . ARG K 65  ? 0.2737 0.2600 0.3371 -0.0124 -0.0073 -0.0595 515 ARG K CG  
4964 C CD  . ARG K 65  ? 0.3570 0.3515 0.4287 -0.0107 -0.0067 -0.0851 515 ARG K CD  
4965 N NE  . ARG K 65  ? 0.4564 0.4426 0.5597 0.0088  -0.0181 -0.0946 515 ARG K NE  
4966 C CZ  . ARG K 65  ? 0.4944 0.5030 0.6219 0.0240  -0.0204 -0.1140 515 ARG K CZ  
4967 N NH1 . ARG K 65  ? 0.5015 0.5508 0.6322 0.0186  -0.0088 -0.1272 515 ARG K NH1 
4968 N NH2 . ARG K 65  ? 0.5077 0.4972 0.6587 0.0445  -0.0359 -0.1217 515 ARG K NH2 
4969 N N   . PHE K 66  ? 0.2375 0.1800 0.3015 0.0119  -0.0198 -0.0099 516 PHE K N   
4970 C CA  . PHE K 66  ? 0.2375 0.1877 0.3050 0.0260  -0.0291 -0.0160 516 PHE K CA  
4971 C C   . PHE K 66  ? 0.3104 0.2746 0.4077 0.0378  -0.0378 -0.0411 516 PHE K C   
4972 O O   . PHE K 66  ? 0.3361 0.3389 0.4477 0.0330  -0.0317 -0.0651 516 PHE K O   
4973 C CB  . PHE K 66  ? 0.2980 0.2128 0.3457 0.0367  -0.0355 0.0074  516 PHE K CB  
4974 C CG  . PHE K 66  ? 0.2619 0.1698 0.2806 0.0281  -0.0248 0.0261  516 PHE K CG  
4975 C CD1 . PHE K 66  ? 0.2387 0.1657 0.2440 0.0249  -0.0251 0.0205  516 PHE K CD1 
4976 C CD2 . PHE K 66  ? 0.2648 0.1485 0.2730 0.0227  -0.0139 0.0465  516 PHE K CD2 
4977 C CE1 . PHE K 66  ? 0.2969 0.2133 0.2739 0.0201  -0.0175 0.0345  516 PHE K CE1 
4978 C CE2 . PHE K 66  ? 0.2728 0.1545 0.2577 0.0183  -0.0028 0.0588  516 PHE K CE2 
4979 C CZ  . PHE K 66  ? 0.2660 0.1611 0.2329 0.0190  -0.0061 0.0525  516 PHE K CZ  
4980 N N   . GLU K 67  ? 0.2853 0.2182 0.3917 0.0525  -0.0504 -0.0382 517 GLU K N   
4981 C CA  . GLU K 67  ? 0.3432 0.2836 0.4785 0.0703  -0.0632 -0.0648 517 GLU K CA  
4982 C C   . GLU K 67  ? 0.3795 0.2979 0.5244 0.0683  -0.0643 -0.0715 517 GLU K C   
4983 O O   . GLU K 67  ? 0.4320 0.3540 0.5999 0.0847  -0.0750 -0.0971 517 GLU K O   
4984 C CB  . GLU K 67  ? 0.3931 0.3038 0.5279 0.0954  -0.0869 -0.0598 517 GLU K CB  
4985 C CG  . GLU K 67  ? 0.4895 0.4293 0.6277 0.1056  -0.0956 -0.0674 517 GLU K CG  
4986 C CD  . GLU K 67  ? 0.5392 0.4527 0.6801 0.1351  -0.1258 -0.0715 517 GLU K CD  
4987 O OE1 . GLU K 67  ? 0.5889 0.4491 0.7015 0.1355  -0.1315 -0.0511 517 GLU K OE1 
4988 O OE2 . GLU K 67  ? 0.6180 0.5701 0.7814 0.1471  -0.1380 -0.0932 517 GLU K OE2 
4989 N N   . GLY K 68  ? 0.3501 0.2466 0.4820 0.0505  -0.0559 -0.0525 518 GLY K N   
4990 C CA  . GLY K 68  ? 0.3407 0.2125 0.4848 0.0482  -0.0617 -0.0598 518 GLY K CA  
4991 C C   . GLY K 68  ? 0.2745 0.1566 0.4143 0.0277  -0.0516 -0.0598 518 GLY K C   
4992 O O   . GLY K 68  ? 0.2799 0.1935 0.4112 0.0217  -0.0437 -0.0764 518 GLY K O   
4993 N N   . THR K 69  ? 0.2833 0.1372 0.4279 0.0161  -0.0527 -0.0412 519 THR K N   
4994 C CA  . THR K 69  ? 0.2660 0.1270 0.4139 -0.0002 -0.0504 -0.0429 519 THR K CA  
4995 C C   . THR K 69  ? 0.2566 0.1468 0.3836 -0.0079 -0.0394 -0.0374 519 THR K C   
4996 O O   . THR K 69  ? 0.2560 0.1528 0.3713 -0.0068 -0.0308 -0.0212 519 THR K O   
4997 C CB  . THR K 69  ? 0.3742 0.2126 0.5384 -0.0123 -0.0496 -0.0218 519 THR K CB  
4998 O OG1 . THR K 69  ? 0.4381 0.2495 0.6060 -0.0073 -0.0577 -0.0225 519 THR K OG1 
4999 C CG2 . THR K 69  ? 0.3727 0.2254 0.5489 -0.0254 -0.0524 -0.0272 519 THR K CG2 
5000 N N   . GLY K 70  ? 0.2601 0.1427 0.2713 0.0013  -0.0248 -0.0186 520 GLY K N   
5001 C CA  . GLY K 70  ? 0.2488 0.1580 0.2784 0.0016  -0.0189 -0.0182 520 GLY K CA  
5002 C C   . GLY K 70  ? 0.2303 0.1490 0.2646 -0.0104 -0.0170 -0.0229 520 GLY K C   
5003 O O   . GLY K 70  ? 0.2655 0.1753 0.2939 -0.0171 -0.0201 -0.0281 520 GLY K O   
5004 N N   . PHE K 71  ? 0.1947 0.1323 0.2412 -0.0127 -0.0128 -0.0220 521 PHE K N   
5005 C CA  . PHE K 71  ? 0.1907 0.1428 0.2452 -0.0216 -0.0107 -0.0275 521 PHE K CA  
5006 C C   . PHE K 71  ? 0.1777 0.1477 0.2416 -0.0127 -0.0096 -0.0296 521 PHE K C   
5007 O O   . PHE K 71  ? 0.1978 0.1695 0.2633 -0.0046 -0.0079 -0.0243 521 PHE K O   
5008 C CB  . PHE K 71  ? 0.1732 0.1260 0.2268 -0.0332 -0.0064 -0.0250 521 PHE K CB  
5009 C CG  . PHE K 71  ? 0.1977 0.1271 0.2359 -0.0431 -0.0064 -0.0222 521 PHE K CG  
5010 C CD1 . PHE K 71  ? 0.2666 0.1750 0.2904 -0.0377 -0.0103 -0.0163 521 PHE K CD1 
5011 C CD2 . PHE K 71  ? 0.2012 0.1286 0.2393 -0.0578 -0.0030 -0.0260 521 PHE K CD2 
5012 C CE1 . PHE K 71  ? 0.2765 0.1567 0.2796 -0.0452 -0.0115 -0.0136 521 PHE K CE1 
5013 C CE2 . PHE K 71  ? 0.2510 0.1508 0.2702 -0.0683 -0.0021 -0.0224 521 PHE K CE2 
5014 C CZ  . PHE K 71  ? 0.2649 0.1385 0.2635 -0.0612 -0.0067 -0.0160 521 PHE K CZ  
5015 N N   . SER K 72  ? 0.1720 0.1546 0.2427 -0.0145 -0.0112 -0.0378 522 SER K N   
5016 C CA  A SER K 72  ? 0.1767 0.1710 0.2505 -0.0040 -0.0123 -0.0410 522 SER K CA  
5017 C CA  B SER K 72  ? 0.1757 0.1699 0.2494 -0.0039 -0.0123 -0.0409 522 SER K CA  
5018 C C   . SER K 72  ? 0.1793 0.1825 0.2573 -0.0039 -0.0087 -0.0373 522 SER K C   
5019 O O   . SER K 72  ? 0.1780 0.1816 0.2531 0.0056  -0.0087 -0.0355 522 SER K O   
5020 C CB  A SER K 72  ? 0.1942 0.2009 0.2755 -0.0047 -0.0178 -0.0528 522 SER K CB  
5021 C CB  B SER K 72  ? 0.1918 0.1977 0.2725 -0.0041 -0.0180 -0.0527 522 SER K CB  
5022 O OG  A SER K 72  ? 0.2255 0.2212 0.3021 -0.0050 -0.0237 -0.0574 522 SER K OG  
5023 O OG  B SER K 72  ? 0.1851 0.2065 0.2798 -0.0172 -0.0155 -0.0572 522 SER K OG  
5024 N N   . ASN K 73  ? 0.1282 0.1352 0.2096 -0.0139 -0.0056 -0.0362 523 ASN K N   
5025 C CA  . ASN K 73  ? 0.1114 0.1237 0.1932 -0.0126 -0.0038 -0.0338 523 ASN K CA  
5026 C C   . ASN K 73  ? 0.1243 0.1269 0.2002 -0.0208 -0.0011 -0.0282 523 ASN K C   
5027 O O   . ASN K 73  ? 0.1541 0.1475 0.2252 -0.0289 0.0006  -0.0271 523 ASN K O   
5028 C CB  . ASN K 73  ? 0.1485 0.1798 0.2376 -0.0109 -0.0039 -0.0428 523 ASN K CB  
5029 C CG  . ASN K 73  ? 0.1375 0.1815 0.2361 -0.0221 -0.0000 -0.0492 523 ASN K CG  
5030 O OD1 . ASN K 73  ? 0.1725 0.2127 0.2677 -0.0320 0.0063  -0.0456 523 ASN K OD1 
5031 N ND2 . ASN K 73  ? 0.1557 0.2140 0.2661 -0.0209 -0.0038 -0.0590 523 ASN K ND2 
5032 N N   . ILE K 74  ? 0.1280 0.1286 0.2006 -0.0179 -0.0020 -0.0250 524 ILE K N   
5033 C CA  . ILE K 74  ? 0.1255 0.1127 0.1878 -0.0222 -0.0022 -0.0201 524 ILE K CA  
5034 C C   . ILE K 74  ? 0.1376 0.1261 0.1925 -0.0311 0.0049  -0.0227 524 ILE K C   
5035 O O   . ILE K 74  ? 0.1671 0.1383 0.2088 -0.0373 0.0065  -0.0186 524 ILE K O   
5036 C CB  . ILE K 74  ? 0.1428 0.1256 0.2033 -0.0162 -0.0074 -0.0173 524 ILE K CB  
5037 C CG1 . ILE K 74  ? 0.1366 0.1165 0.2067 -0.0113 -0.0118 -0.0128 524 ILE K CG1 
5038 C CG2 . ILE K 74  ? 0.1573 0.1247 0.2030 -0.0186 -0.0097 -0.0145 524 ILE K CG2 
5039 C CD1 . ILE K 74  ? 0.1388 0.1145 0.2117 -0.0081 -0.0176 -0.0101 524 ILE K CD1 
5040 N N   . PRO K 75  ? 0.1345 0.1425 0.1968 -0.0318 0.0100  -0.0296 525 PRO K N   
5041 C CA  . PRO K 75  ? 0.1536 0.1660 0.2122 -0.0422 0.0204  -0.0315 525 PRO K CA  
5042 C C   . PRO K 75  ? 0.1772 0.1811 0.2358 -0.0547 0.0241  -0.0301 525 PRO K C   
5043 O O   . PRO K 75  ? 0.2051 0.1946 0.2489 -0.0645 0.0318  -0.0261 525 PRO K O   
5044 C CB  . PRO K 75  ? 0.1429 0.1849 0.2178 -0.0385 0.0239  -0.0412 525 PRO K CB  
5045 C CG  . PRO K 75  ? 0.1463 0.1874 0.2193 -0.0243 0.0148  -0.0417 525 PRO K CG  
5046 C CD  . PRO K 75  ? 0.1228 0.1480 0.1945 -0.0223 0.0072  -0.0357 525 PRO K CD  
5047 N N   . GLN K 76  ? 0.1720 0.1794 0.2421 -0.0538 0.0184  -0.0330 526 GLN K N   
5048 C CA  A GLN K 76  ? 0.1641 0.1583 0.2312 -0.0649 0.0193  -0.0321 526 GLN K CA  
5049 C CA  B GLN K 76  ? 0.1639 0.1582 0.2312 -0.0648 0.0191  -0.0322 526 GLN K CA  
5050 C C   . GLN K 76  ? 0.1836 0.1451 0.2272 -0.0651 0.0165  -0.0231 526 GLN K C   
5051 O O   . GLN K 76  ? 0.2352 0.1771 0.2644 -0.0765 0.0211  -0.0199 526 GLN K O   
5052 C CB  A GLN K 76  ? 0.1993 0.1998 0.2787 -0.0602 0.0112  -0.0378 526 GLN K CB  
5053 C CB  B GLN K 76  ? 0.1991 0.1993 0.2783 -0.0594 0.0108  -0.0376 526 GLN K CB  
5054 C CG  A GLN K 76  ? 0.2212 0.2503 0.3232 -0.0620 0.0113  -0.0489 526 GLN K CG  
5055 C CG  B GLN K 76  ? 0.2236 0.2525 0.3250 -0.0604 0.0106  -0.0488 526 GLN K CG  
5056 C CD  A GLN K 76  ? 0.2438 0.2737 0.3509 -0.0527 0.0006  -0.0547 526 GLN K CD  
5057 C CD  B GLN K 76  ? 0.2748 0.3148 0.3878 -0.0782 0.0196  -0.0528 526 GLN K CD  
5058 O OE1 A GLN K 76  ? 0.2539 0.2691 0.3491 -0.0413 -0.0043 -0.0499 526 GLN K OE1 
5059 O OE1 B GLN K 76  ? 0.3631 0.3835 0.4673 -0.0914 0.0224  -0.0490 526 GLN K OE1 
5060 N NE2 A GLN K 76  ? 0.3190 0.3660 0.4440 -0.0573 -0.0029 -0.0655 526 GLN K NE2 
5061 N NE2 B GLN K 76  ? 0.3386 0.4097 0.4713 -0.0788 0.0248  -0.0607 526 GLN K NE2 
5062 N N   . LEU K 77  ? 0.1826 0.1369 0.2223 -0.0526 0.0088  -0.0192 527 LEU K N   
5063 C CA  . LEU K 77  ? 0.2208 0.1479 0.2421 -0.0496 0.0034  -0.0126 527 LEU K CA  
5064 C C   . LEU K 77  ? 0.2443 0.1543 0.2441 -0.0545 0.0075  -0.0085 527 LEU K C   
5065 O O   . LEU K 77  ? 0.2755 0.1572 0.2526 -0.0590 0.0072  -0.0043 527 LEU K O   
5066 C CB  . LEU K 77  ? 0.2075 0.1388 0.2373 -0.0361 -0.0046 -0.0106 527 LEU K CB  
5067 C CG  . LEU K 77  ? 0.2238 0.1342 0.2417 -0.0300 -0.0126 -0.0057 527 LEU K CG  
5068 C CD1 . LEU K 77  ? 0.2573 0.1477 0.2638 -0.0297 -0.0160 -0.0048 527 LEU K CD1 
5069 C CD2 . LEU K 77  ? 0.2368 0.1598 0.2721 -0.0197 -0.0185 -0.0047 527 LEU K CD2 
5070 N N   . ILE K 78  ? 0.2210 0.1438 0.2229 -0.0520 0.0109  -0.0097 528 ILE K N   
5071 C CA  . ILE K 78  ? 0.2819 0.1860 0.2585 -0.0540 0.0150  -0.0061 528 ILE K CA  
5072 C C   . ILE K 78  ? 0.2868 0.1840 0.2516 -0.0690 0.0293  -0.0052 528 ILE K C   
5073 O O   . ILE K 78  ? 0.3086 0.1743 0.2429 -0.0733 0.0323  0.0005  528 ILE K O   
5074 C CB  . ILE K 78  ? 0.2366 0.1547 0.2162 -0.0462 0.0147  -0.0087 528 ILE K CB  
5075 C CG1 . ILE K 78  ? 0.2401 0.1599 0.2305 -0.0345 0.0006  -0.0084 528 ILE K CG1 
5076 C CG2 . ILE K 78  ? 0.2834 0.1797 0.2317 -0.0467 0.0200  -0.0055 528 ILE K CG2 
5077 C CD1 . ILE K 78  ? 0.2716 0.1650 0.2471 -0.0292 -0.0110 -0.0039 528 ILE K CD1 
5078 N N   . ASP K 79  ? 0.2741 0.1996 0.2625 -0.0774 0.0381  -0.0110 529 ASP K N   
5079 C CA  . ASP K 79  ? 0.3069 0.2309 0.2914 -0.0947 0.0534  -0.0106 529 ASP K CA  
5080 C C   . ASP K 79  ? 0.3158 0.2077 0.2838 -0.1047 0.0512  -0.0058 529 ASP K C   
5081 O O   . ASP K 79  ? 0.3458 0.2151 0.2920 -0.1182 0.0626  -0.0007 529 ASP K O   
5082 C CB  . ASP K 79  ? 0.3324 0.2978 0.3527 -0.1009 0.0602  -0.0200 529 ASP K CB  
5083 C CG  . ASP K 79  ? 0.4770 0.4509 0.4999 -0.1189 0.0796  -0.0205 529 ASP K CG  
5084 O OD1 . ASP K 79  ? 0.5267 0.4899 0.5269 -0.1196 0.0915  -0.0157 529 ASP K OD1 
5085 O OD2 . ASP K 79  ? 0.4772 0.4682 0.5248 -0.1325 0.0832  -0.0259 529 ASP K OD2 
5086 N N   . HIS K 80  ? 0.2774 0.2139 0.2607 -0.1060 0.0720  0.0219  530 HIS K N   
5087 C CA  . HIS K 80  ? 0.3047 0.1889 0.2405 -0.1135 0.0766  0.0126  530 HIS K CA  
5088 C C   . HIS K 80  ? 0.3445 0.1882 0.2584 -0.1012 0.0798  0.0111  530 HIS K C   
5089 O O   . HIS K 80  ? 0.3726 0.1807 0.2569 -0.1073 0.0785  0.0076  530 HIS K O   
5090 C CB  . HIS K 80  ? 0.3464 0.2231 0.2682 -0.1156 0.0801  0.0082  530 HIS K CB  
5091 C CG  . HIS K 80  ? 0.3985 0.2199 0.2768 -0.1052 0.0803  -0.0039 530 HIS K CG  
5092 N ND1 . HIS K 80  ? 0.4807 0.2570 0.3210 -0.1217 0.0787  -0.0131 530 HIS K ND1 
5093 C CD2 . HIS K 80  ? 0.3909 0.1945 0.2602 -0.0788 0.0802  -0.0082 530 HIS K CD2 
5094 C CE1 . HIS K 80  ? 0.4973 0.2269 0.3074 -0.1041 0.0774  -0.0239 530 HIS K CE1 
5095 N NE2 . HIS K 80  ? 0.5014 0.2491 0.3297 -0.0772 0.0790  -0.0210 530 HIS K NE2 
5096 N N   . HIS K 81  ? 0.3008 0.1522 0.2306 -0.0835 0.0812  0.0156  531 HIS K N   
5097 C CA  . HIS K 81  ? 0.3407 0.1587 0.2520 -0.0699 0.0808  0.0158  531 HIS K CA  
5098 C C   . HIS K 81  ? 0.3295 0.1552 0.2436 -0.0759 0.0798  0.0176  531 HIS K C   
5099 O O   . HIS K 81  ? 0.3609 0.1567 0.2500 -0.0756 0.0779  0.0173  531 HIS K O   
5100 C CB  . HIS K 81  ? 0.3274 0.1544 0.2558 -0.0495 0.0807  0.0217  531 HIS K CB  
5101 C CG  . HIS K 81  ? 0.3306 0.1505 0.2501 -0.0351 0.0790  0.0183  531 HIS K CG  
5102 N ND1 . HIS K 81  ? 0.3693 0.1444 0.2580 -0.0224 0.0778  0.0127  531 HIS K ND1 
5103 C CD2 . HIS K 81  ? 0.2863 0.1452 0.2252 -0.0299 0.0767  0.0185  531 HIS K CD2 
5104 C CE1 . HIS K 81  ? 0.3494 0.1381 0.2399 -0.0077 0.0768  0.0072  531 HIS K CE1 
5105 N NE2 . HIS K 81  ? 0.3309 0.1718 0.2497 -0.0135 0.0764  0.0111  531 HIS K NE2 
5106 N N   . TYR K 82  ? 0.3097 0.1760 0.2540 -0.0815 0.0809  0.0200  532 TYR K N   
5107 C CA  . TYR K 82  ? 0.3046 0.1785 0.2500 -0.0876 0.0840  0.0205  532 TYR K CA  
5108 C C   . TYR K 82  ? 0.3563 0.2167 0.2797 -0.1050 0.0843  0.0198  532 TYR K C   
5109 O O   . TYR K 82  ? 0.3835 0.2294 0.2887 -0.1107 0.0863  0.0209  532 TYR K O   
5110 C CB  . TYR K 82  ? 0.3266 0.2456 0.3111 -0.0867 0.0856  0.0221  532 TYR K CB  
5111 C CG  . TYR K 82  ? 0.3256 0.2552 0.3119 -0.0928 0.0932  0.0204  532 TYR K CG  
5112 C CD1 . TYR K 82  ? 0.3076 0.2186 0.2783 -0.0879 0.0985  0.0181  532 TYR K CD1 
5113 C CD2 . TYR K 82  ? 0.3684 0.3283 0.3718 -0.1036 0.0956  0.0218  532 TYR K CD2 
5114 C CE1 . TYR K 82  ? 0.3479 0.2705 0.3172 -0.0954 0.1082  0.0150  532 TYR K CE1 
5115 C CE2 . TYR K 82  ? 0.3821 0.3559 0.3876 -0.1092 0.1053  0.0195  532 TYR K CE2 
5116 C CZ  . TYR K 82  ? 0.4031 0.3587 0.3903 -0.1058 0.1125  0.0150  532 TYR K CZ  
5117 O OH  . TYR K 82  ? 0.4615 0.4339 0.4480 -0.1126 0.1241  0.0111  532 TYR K OH  
5118 N N   . THR K 83  ? 0.3788 0.2439 0.3024 -0.1155 0.0815  0.0190  533 THR K N   
5119 C CA  . THR K 83  ? 0.4070 0.2606 0.3113 -0.1339 0.0802  0.0197  533 THR K CA  
5120 C C   . THR K 83  ? 0.4246 0.2249 0.2872 -0.1368 0.0757  0.0171  533 THR K C   
5121 O O   . THR K 83  ? 0.4842 0.2666 0.3269 -0.1475 0.0738  0.0203  533 THR K O   
5122 C CB  . THR K 83  ? 0.4507 0.3300 0.3709 -0.1452 0.0773  0.0205  533 THR K CB  
5123 O OG1 . THR K 83  ? 0.5070 0.3754 0.4210 -0.1417 0.0743  0.0160  533 THR K OG1 
5124 C CG2 . THR K 83  ? 0.3804 0.3119 0.3452 -0.1409 0.0795  0.0257  533 THR K CG2 
5125 N N   . THR K 84  ? 0.4188 0.1931 0.2684 -0.1272 0.0735  0.0120  534 THR K N   
5126 C CA  . THR K 84  ? 0.4677 0.1893 0.2804 -0.1265 0.0676  0.0086  534 THR K CA  
5127 C C   . THR K 84  ? 0.4865 0.1853 0.2901 -0.1105 0.0650  0.0118  534 THR K C   
5128 O O   . THR K 84  ? 0.5187 0.1783 0.2974 -0.1105 0.0576  0.0121  534 THR K O   
5129 C CB  . THR K 84  ? 0.5257 0.2256 0.3260 -0.1206 0.0671  -0.0003 534 THR K CB  
5130 O OG1 . THR K 84  ? 0.4915 0.2019 0.3077 -0.1001 0.0718  -0.0008 534 THR K OG1 
5131 C CG2 . THR K 84  ? 0.5054 0.2288 0.3124 -0.1390 0.0679  -0.0033 534 THR K CG2 
5132 N N   . LYS K 85  ? 0.4568 0.1796 0.2814 -0.0972 0.0690  0.0149  535 LYS K N   
5133 C CA  . LYS K 85  ? 0.4421 0.1498 0.2617 -0.0813 0.0651  0.0187  535 LYS K CA  
5134 C C   . LYS K 85  ? 0.4720 0.1520 0.2826 -0.0625 0.0599  0.0153  535 LYS K C   
5135 O O   . LYS K 85  ? 0.5225 0.1870 0.3284 -0.0503 0.0533  0.0191  535 LYS K O   
5136 C CB  . LYS K 85  ? 0.4903 0.1823 0.2922 -0.0922 0.0611  0.0247  535 LYS K CB  
5137 C CG  . LYS K 85  ? 0.4677 0.1892 0.2777 -0.1094 0.0681  0.0274  535 LYS K CG  
5138 C CD  . LYS K 85  ? 0.4486 0.2070 0.2867 -0.1005 0.0757  0.0258  535 LYS K CD  
5139 C CE  . LYS K 85  ? 0.4414 0.2287 0.2882 -0.1148 0.0839  0.0269  535 LYS K CE  
5140 N NZ  . LYS K 85  ? 0.3947 0.2148 0.2704 -0.1052 0.0911  0.0238  535 LYS K NZ  
5141 N N   . GLN K 86  ? 0.4814 0.1568 0.2903 -0.0600 0.0627  0.0079  536 GLN K N   
5142 C CA  . GLN K 86  ? 0.5072 0.1611 0.3096 -0.0387 0.0601  0.0023  536 GLN K CA  
5143 C C   . GLN K 86  ? 0.4426 0.1218 0.2683 -0.0184 0.0610  0.0080  536 GLN K C   
5144 O O   . GLN K 86  ? 0.4192 0.1320 0.2668 -0.0212 0.0659  0.0129  536 GLN K O   
5145 C CB  . GLN K 86  ? 0.5060 0.1510 0.2983 -0.0423 0.0651  -0.0093 536 GLN K CB  
5146 C CG  . GLN K 86  ? 0.5729 0.1869 0.3388 -0.0603 0.0600  -0.0161 536 GLN K CG  
5147 C CD  . GLN K 86  ? 0.6694 0.2765 0.4221 -0.0679 0.0637  -0.0300 536 GLN K CD  
5148 O OE1 . GLN K 86  ? 0.6645 0.2791 0.4208 -0.0531 0.0699  -0.0388 536 GLN K OE1 
5149 N NE2 . GLN K 86  ? 0.7153 0.3109 0.4517 -0.0917 0.0595  -0.0326 536 GLN K NE2 
5150 N N   . VAL K 87  ? 0.4512 0.1172 0.2757 0.0019  0.0547  0.0082  537 VAL K N   
5151 C CA  . VAL K 87  ? 0.4181 0.1112 0.2656 0.0189  0.0523  0.0158  537 VAL K CA  
5152 C C   . VAL K 87  ? 0.4268 0.1462 0.2908 0.0290  0.0601  0.0152  537 VAL K C   
5153 O O   . VAL K 87  ? 0.4316 0.1402 0.2851 0.0312  0.0674  0.0058  537 VAL K O   
5154 C CB  . VAL K 87  ? 0.4413 0.1194 0.2886 0.0368  0.0433  0.0169  537 VAL K CB  
5155 C CG1 . VAL K 87  ? 0.5152 0.1690 0.3504 0.0257  0.0353  0.0217  537 VAL K CG1 
5156 C CG2 . VAL K 87  ? 0.4958 0.1529 0.3322 0.0518  0.0454  0.0046  537 VAL K CG2 
5157 N N   . ILE K 88  ? 0.3646 0.1188 0.2544 0.0341  0.0578  0.0251  538 ILE K N   
5158 C CA  . ILE K 88  ? 0.3265 0.1117 0.2386 0.0444  0.0629  0.0302  538 ILE K CA  
5159 C C   . ILE K 88  ? 0.3377 0.1240 0.2481 0.0689  0.0645  0.0266  538 ILE K C   
5160 O O   . ILE K 88  ? 0.3303 0.1495 0.2490 0.0696  0.0683  0.0201  538 ILE K O   
5161 C CB  . ILE K 88  ? 0.2993 0.1227 0.2408 0.0437  0.0548  0.0414  538 ILE K CB  
5162 C CG1 . ILE K 88  ? 0.3494 0.1746 0.2929 0.0242  0.0554  0.0402  538 ILE K CG1 
5163 C CG2 . ILE K 88  ? 0.3166 0.1806 0.2879 0.0530  0.0557  0.0515  538 ILE K CG2 
5164 C CD1 . ILE K 88  ? 0.3322 0.1632 0.2813 0.0095  0.0657  0.0383  538 ILE K CD1 
5165 N N   . THR K 89  ? 0.3744 0.1569 0.2847 0.0800  0.0553  0.0275  539 THR K N   
5166 C CA  . THR K 89  ? 0.4018 0.1869 0.3118 0.1032  0.0562  0.0215  539 THR K CA  
5167 C C   . THR K 89  ? 0.4281 0.1789 0.3257 0.1046  0.0474  0.0175  539 THR K C   
5168 O O   . THR K 89  ? 0.4157 0.1571 0.3138 0.0914  0.0391  0.0249  539 THR K O   
5169 C CB  . THR K 89  ? 0.4096 0.2456 0.3503 0.1174  0.0521  0.0336  539 THR K CB  
5170 O OG1 . THR K 89  ? 0.3946 0.2341 0.3463 0.1094  0.0390  0.0432  539 THR K OG1 
5171 C CG2 . THR K 89  ? 0.3798 0.2599 0.3427 0.1140  0.0565  0.0435  539 THR K CG2 
5172 N N   . LYS K 90  ? 0.4685 0.2032 0.3574 0.1214  0.0495  0.0051  540 LYS K N   
5173 C CA  . LYS K 90  ? 0.5110 0.2137 0.3953 0.1259  0.0402  0.0029  540 LYS K CA  
5174 C C   . LYS K 90  ? 0.4966 0.2200 0.4049 0.1311  0.0305  0.0180  540 LYS K C   
5175 O O   . LYS K 90  ? 0.5332 0.2354 0.4405 0.1224  0.0211  0.0249  540 LYS K O   
5176 C CB  . LYS K 90  ? 0.6195 0.3082 0.4975 0.1465  0.0442  -0.0149 540 LYS K CB  
5177 C CG  . LYS K 90  ? 0.7321 0.3888 0.5819 0.1375  0.0498  -0.0331 540 LYS K CG  
5178 C CD  . LYS K 90  ? 0.8564 0.5094 0.7029 0.1593  0.0548  -0.0546 540 LYS K CD  
5179 C CE  . LYS K 90  ? 0.9124 0.5391 0.7296 0.1470  0.0596  -0.0747 540 LYS K CE  
5180 N NZ  . LYS K 90  ? 0.9702 0.5914 0.7828 0.1667  0.0639  -0.0992 540 LYS K NZ  
5181 N N   . LYS K 91  ? 0.3983 0.2514 0.4313 0.1119  0.0442  0.0274  541 LYS K N   
5182 C CA  . LYS K 91  ? 0.4090 0.2667 0.4719 0.1126  0.0357  0.0307  541 LYS K CA  
5183 C C   . LYS K 91  ? 0.3983 0.2455 0.4550 0.0990  0.0247  0.0345  541 LYS K C   
5184 O O   . LYS K 91  ? 0.4348 0.2715 0.4963 0.0998  0.0084  0.0330  541 LYS K O   
5185 C CB  . LYS K 91  ? 0.4386 0.3282 0.5396 0.1191  0.0518  0.0353  541 LYS K CB  
5186 C CG  . LYS K 91  ? 0.4784 0.3805 0.6222 0.1191  0.0447  0.0352  541 LYS K CG  
5187 C CD  . LYS K 91  ? 0.5020 0.4350 0.6865 0.1231  0.0666  0.0409  541 LYS K CD  
5188 C CE  . LYS K 91  ? 0.5271 0.4770 0.7644 0.1208  0.0607  0.0376  541 LYS K CE  
5189 N NZ  . LYS K 91  ? 0.5283 0.5071 0.8104 0.1229  0.0864  0.0441  541 LYS K NZ  
5190 N N   . SER K 92  ? 0.3501 0.2008 0.3942 0.0886  0.0326  0.0386  542 SER K N   
5191 C CA  . SER K 92  ? 0.3393 0.1832 0.3791 0.0767  0.0238  0.0408  542 SER K CA  
5192 C C   . SER K 92  ? 0.3558 0.1719 0.3571 0.0692  0.0136  0.0390  542 SER K C   
5193 O O   . SER K 92  ? 0.4149 0.2200 0.4087 0.0642  0.0015  0.0397  542 SER K O   
5194 C CB  . SER K 92  ? 0.3565 0.2163 0.4034 0.0702  0.0375  0.0462  542 SER K CB  
5195 O OG  . SER K 92  ? 0.3120 0.1681 0.3286 0.0675  0.0449  0.0459  542 SER K OG  
5196 N N   . GLY K 93  ? 0.3531 0.1585 0.3311 0.0683  0.0191  0.0358  543 GLY K N   
5197 C CA  . GLY K 93  ? 0.4007 0.1801 0.3473 0.0586  0.0141  0.0345  543 GLY K CA  
5198 C C   . GLY K 93  ? 0.3856 0.1677 0.3200 0.0456  0.0163  0.0367  543 GLY K C   
5199 O O   . GLY K 93  ? 0.4312 0.1925 0.3420 0.0369  0.0127  0.0374  543 GLY K O   
5200 N N   . VAL K 94  ? 0.3375 0.1437 0.2875 0.0449  0.0240  0.0385  544 VAL K N   
5201 C CA  . VAL K 94  ? 0.3483 0.1581 0.2904 0.0346  0.0253  0.0398  544 VAL K CA  
5202 C C   . VAL K 94  ? 0.3301 0.1388 0.2511 0.0273  0.0322  0.0349  544 VAL K C   
5203 O O   . VAL K 94  ? 0.3324 0.1522 0.2538 0.0325  0.0396  0.0304  544 VAL K O   
5204 C CB  . VAL K 94  ? 0.3195 0.1519 0.2882 0.0375  0.0323  0.0439  544 VAL K CB  
5205 C CG1 . VAL K 94  ? 0.3528 0.1904 0.3129 0.0292  0.0361  0.0439  544 VAL K CG1 
5206 C CG2 . VAL K 94  ? 0.3198 0.1543 0.3149 0.0405  0.0234  0.0448  544 VAL K CG2 
5207 N N   . VAL K 95  ? 0.3482 0.1464 0.2518 0.0162  0.0299  0.0343  545 VAL K N   
5208 C CA  . VAL K 95  ? 0.3385 0.1378 0.2274 0.0070  0.0364  0.0278  545 VAL K CA  
5209 C C   . VAL K 95  ? 0.3430 0.1562 0.2315 0.0015  0.0392  0.0282  545 VAL K C   
5210 O O   . VAL K 95  ? 0.3648 0.1717 0.2507 -0.0015 0.0340  0.0321  545 VAL K O   
5211 C CB  . VAL K 95  ? 0.3778 0.1490 0.2471 -0.0023 0.0348  0.0267  545 VAL K CB  
5212 C CG1 . VAL K 95  ? 0.3683 0.1439 0.2298 -0.0147 0.0430  0.0185  545 VAL K CG1 
5213 C CG2 . VAL K 95  ? 0.4112 0.1667 0.2825 0.0043  0.0326  0.0248  545 VAL K CG2 
5214 N N   . LEU K 96  ? 0.3142 0.1471 0.2046 0.0019  0.0464  0.0225  546 LEU K N   
5215 C CA  . LEU K 96  ? 0.3141 0.1609 0.2052 -0.0011 0.0494  0.0219  546 LEU K CA  
5216 C C   . LEU K 96  ? 0.3346 0.1743 0.2104 -0.0147 0.0506  0.0159  546 LEU K C   
5217 O O   . LEU K 96  ? 0.3701 0.2095 0.2412 -0.0208 0.0542  0.0076  546 LEU K O   
5218 C CB  . LEU K 96  ? 0.2935 0.1649 0.1906 0.0086  0.0559  0.0187  546 LEU K CB  
5219 C CG  . LEU K 96  ? 0.2867 0.1671 0.1960 0.0236  0.0597  0.0264  546 LEU K CG  
5220 C CD1 . LEU K 96  ? 0.2823 0.1857 0.1900 0.0358  0.0669  0.0260  546 LEU K CD1 
5221 C CD2 . LEU K 96  ? 0.2819 0.1549 0.2080 0.0244  0.0587  0.0370  546 LEU K CD2 
5222 N N   . LEU K 97  ? 0.3207 0.1562 0.1910 -0.0195 0.0487  0.0188  547 LEU K N   
5223 C CA  . LEU K 97  ? 0.3566 0.1857 0.2109 -0.0316 0.0525  0.0149  547 LEU K CA  
5224 C C   . LEU K 97  ? 0.3912 0.2391 0.2482 -0.0332 0.0561  0.0099  547 LEU K C   
5225 O O   . LEU K 97  ? 0.3958 0.2534 0.2498 -0.0412 0.0632  0.0019  547 LEU K O   
5226 C CB  . LEU K 97  ? 0.3769 0.1799 0.2125 -0.0348 0.0474  0.0222  547 LEU K CB  
5227 C CG  . LEU K 97  ? 0.4082 0.1871 0.2363 -0.0337 0.0446  0.0274  547 LEU K CG  
5228 C CD1 . LEU K 97  ? 0.4197 0.1732 0.2229 -0.0340 0.0398  0.0357  547 LEU K CD1 
5229 C CD2 . LEU K 97  ? 0.4117 0.1870 0.2407 -0.0423 0.0537  0.0212  547 LEU K CD2 
5230 N N   . ASN K 98  ? 0.3356 0.1892 0.2016 -0.0259 0.0520  0.0129  548 ASN K N   
5231 C CA  . ASN K 98  ? 0.3234 0.1897 0.1908 -0.0266 0.0544  0.0079  548 ASN K CA  
5232 C C   . ASN K 98  ? 0.2863 0.1672 0.1739 -0.0152 0.0552  0.0098  548 ASN K C   
5233 O O   . ASN K 98  ? 0.3071 0.1815 0.2082 -0.0098 0.0510  0.0153  548 ASN K O   
5234 C CB  . ASN K 98  ? 0.3480 0.2011 0.2038 -0.0292 0.0485  0.0085  548 ASN K CB  
5235 C CG  . ASN K 98  ? 0.4335 0.2656 0.2651 -0.0358 0.0473  0.0123  548 ASN K CG  
5236 O OD1 . ASN K 98  ? 0.4456 0.2748 0.2645 -0.0448 0.0562  0.0109  548 ASN K OD1 
5237 N ND2 . ASN K 98  ? 0.4509 0.2679 0.2777 -0.0305 0.0367  0.0171  548 ASN K ND2 
5238 N N   . PRO K 99  ? 0.3157 0.2162 0.2076 -0.0105 0.0608  0.0053  549 PRO K N   
5239 C CA  . PRO K 99  ? 0.3008 0.2113 0.2076 0.0028  0.0634  0.0101  549 PRO K CA  
5240 C C   . PRO K 99  ? 0.2916 0.1991 0.2049 0.0025  0.0622  0.0081  549 PRO K C   
5241 O O   . PRO K 99  ? 0.3468 0.2607 0.2517 -0.0030 0.0628  -0.0012 549 PRO K O   
5242 C CB  . PRO K 99  ? 0.2961 0.2295 0.2000 0.0098  0.0674  0.0036  549 PRO K CB  
5243 C CG  . PRO K 99  ? 0.3529 0.2912 0.2471 -0.0041 0.0676  -0.0088 549 PRO K CG  
5244 C CD  . PRO K 99  ? 0.3445 0.2590 0.2297 -0.0158 0.0651  -0.0048 549 PRO K CD  
5245 N N   . ILE K 100 ? 0.2700 0.1684 0.2013 0.0082  0.0616  0.0154  550 ILE K N   
5246 C CA  . ILE K 100 ? 0.2738 0.1668 0.2168 0.0081  0.0594  0.0111  550 ILE K CA  
5247 C C   . ILE K 100 ? 0.2729 0.1746 0.2267 0.0200  0.0670  0.0140  550 ILE K C   
5248 O O   . ILE K 100 ? 0.2725 0.1735 0.2373 0.0303  0.0738  0.0261  550 ILE K O   
5249 C CB  . ILE K 100 ? 0.2760 0.1545 0.2398 0.0067  0.0541  0.0142  550 ILE K CB  
5250 C CG1 . ILE K 100 ? 0.3222 0.1925 0.2721 -0.0013 0.0446  0.0114  550 ILE K CG1 
5251 C CG2 . ILE K 100 ? 0.2822 0.1557 0.2628 0.0070  0.0510  0.0060  550 ILE K CG2 
5252 C CD1 . ILE K 100 ? 0.3590 0.2282 0.2813 -0.0085 0.0400  0.0018  550 ILE K CD1 
5253 N N   . PRO K 101 ? 0.3023 0.2115 0.2520 0.0209  0.0670  0.0044  551 PRO K N   
5254 C CA  . PRO K 101 ? 0.2972 0.2132 0.2559 0.0350  0.0733  0.0074  551 PRO K CA  
5255 C C   . PRO K 101 ? 0.3124 0.2110 0.2962 0.0389  0.0751  0.0106  551 PRO K C   
5256 O O   . PRO K 101 ? 0.3196 0.2052 0.3155 0.0299  0.0693  0.0058  551 PRO K O   
5257 C CB  . PRO K 101 ? 0.3318 0.2649 0.2776 0.0329  0.0719  -0.0075 551 PRO K CB  
5258 C CG  . PRO K 101 ? 0.3083 0.2337 0.2454 0.0180  0.0661  -0.0171 551 PRO K CG  
5259 C CD  . PRO K 101 ? 0.3221 0.2347 0.2560 0.0105  0.0625  -0.0093 551 PRO K CD  
5260 N N   . LYS K 102 ? 0.3253 0.2237 0.3181 0.0538  0.0828  0.0180  552 LYS K N   
5261 C CA  . LYS K 102 ? 0.3895 0.2683 0.4102 0.0583  0.0873  0.0217  552 LYS K CA  
5262 C C   . LYS K 102 ? 0.4223 0.3000 0.4473 0.0545  0.0807  0.0030  552 LYS K C   
5263 O O   . LYS K 102 ? 0.4247 0.3195 0.4290 0.0523  0.0760  -0.0097 552 LYS K O   
5264 C CB  . LYS K 102 ? 0.4273 0.3018 0.4527 0.0780  0.1000  0.0392  552 LYS K CB  
5265 C CG  . LYS K 102 ? 0.4736 0.3458 0.4970 0.0844  0.1094  0.0593  552 LYS K CG  
5266 C CD  . LYS K 102 ? 0.5416 0.4117 0.5587 0.1082  0.1222  0.0779  552 LYS K CD  
5267 C CE  . LYS K 102 ? 0.6276 0.4753 0.6683 0.1157  0.1299  0.0825  552 LYS K CE  
5268 N NZ  . LYS K 102 ? 0.6755 0.5168 0.7170 0.1286  0.1444  0.1056  552 LYS K NZ  
5269 O OXT . LYS K 102 ? 0.4527 0.3129 0.5037 0.0537  0.0807  -0.0009 552 LYS K OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   451 ?   ?   ?   A . n 
A 1 2   SER 2   452 452 SER SER A . n 
A 1 3   LYS 3   453 453 LYS LYS A . n 
A 1 4   PRO 4   454 454 PRO PRO A . n 
A 1 5   LEU 5   455 455 LEU LEU A . n 
A 1 6   ALA 6   456 456 ALA ALA A . n 
A 1 7   GLU 7   457 457 GLU GLU A . n 
A 1 8   GLN 8   458 458 GLN GLN A . n 
A 1 9   ASP 9   459 459 ASP ASP A . n 
A 1 10  TRP 10  460 460 TRP TRP A . n 
A 1 11  TYR 11  461 461 TYR TYR A . n 
A 1 12  HIS 12  462 462 HIS HIS A . n 
A 1 13  GLY 13  463 463 GLY GLY A . n 
A 1 14  ALA 14  464 464 ALA ALA A . n 
A 1 15  ILE 15  465 465 ILE ILE A . n 
A 1 16  PRO 16  466 466 PRO PRO A . n 
A 1 17  ARG 17  467 467 ARG ARG A . n 
A 1 18  ILE 18  468 468 ILE ILE A . n 
A 1 19  GLU 19  469 469 GLU GLU A . n 
A 1 20  ALA 20  470 470 ALA ALA A . n 
A 1 21  GLN 21  471 471 GLN GLN A . n 
A 1 22  GLU 22  472 472 GLU GLU A . n 
A 1 23  LEU 23  473 473 LEU LEU A . n 
A 1 24  LEU 24  474 474 LEU LEU A . n 
A 1 25  LYS 25  475 475 LYS LYS A . n 
A 1 26  LYS 26  476 476 LYS LYS A . n 
A 1 27  GLN 27  477 477 GLN GLN A . n 
A 1 28  GLY 28  478 478 GLY GLY A . n 
A 1 29  ASP 29  479 479 ASP ASP A . n 
A 1 30  PHE 30  480 480 PHE PHE A . n 
A 1 31  LEU 31  481 481 LEU LEU A . n 
A 1 32  VAL 32  482 482 VAL VAL A . n 
A 1 33  ARG 33  483 483 ARG ARG A . n 
A 1 34  GLU 34  484 484 GLU GLU A . n 
A 1 35  SER 35  485 485 SER SER A . n 
A 1 36  HIS 36  486 486 HIS HIS A . n 
A 1 37  GLY 37  487 487 GLY GLY A . n 
A 1 38  LYS 38  488 488 LYS LYS A . n 
A 1 39  PRO 39  489 489 PRO PRO A . n 
A 1 40  GLY 40  490 490 GLY GLY A . n 
A 1 41  GLU 41  491 491 GLU GLU A . n 
A 1 42  TYR 42  492 492 TYR TYR A . n 
A 1 43  VAL 43  493 493 VAL VAL A . n 
A 1 44  LEU 44  494 494 LEU LEU A . n 
A 1 45  SER 45  495 495 SER SER A . n 
A 1 46  VAL 46  496 496 VAL VAL A . n 
A 1 47  TYR 47  497 497 TYR TYR A . n 
A 1 48  SER 48  498 498 SER SER A . n 
A 1 49  ASP 49  499 499 ASP ASP A . n 
A 1 50  GLY 50  500 500 GLY GLY A . n 
A 1 51  GLN 51  501 501 GLN GLN A . n 
A 1 52  ARG 52  502 502 ARG ARG A . n 
A 1 53  ARG 53  503 503 ARG ARG A . n 
A 1 54  HIS 54  504 504 HIS HIS A . n 
A 1 55  PHE 55  505 505 PHE PHE A . n 
A 1 56  ILE 56  506 506 ILE ILE A . n 
A 1 57  ILE 57  507 507 ILE ILE A . n 
A 1 58  GLN 58  508 508 GLN GLN A . n 
A 1 59  TYR 59  509 509 TYR TYR A . n 
A 1 60  VAL 60  510 510 VAL VAL A . n 
A 1 61  ASP 61  511 511 ASP ASP A . n 
A 1 62  ASN 62  512 512 ASN ASN A . n 
A 1 63  MET 63  513 513 MET MET A . n 
A 1 64  TYR 64  514 514 TYR TYR A . n 
A 1 65  ARG 65  515 515 ARG ARG A . n 
A 1 66  PHE 66  516 516 PHE PHE A . n 
A 1 67  GLU 67  517 517 GLU GLU A . n 
A 1 68  GLY 68  518 518 GLY GLY A . n 
A 1 69  THR 69  519 519 THR THR A . n 
A 1 70  GLY 70  520 520 GLY GLY A . n 
A 1 71  PHE 71  521 521 PHE PHE A . n 
A 1 72  SER 72  522 522 SER SER A . n 
A 1 73  ASN 73  523 523 ASN ASN A . n 
A 1 74  ILE 74  524 524 ILE ILE A . n 
A 1 75  PRO 75  525 525 PRO PRO A . n 
A 1 76  GLN 76  526 526 GLN GLN A . n 
A 1 77  LEU 77  527 527 LEU LEU A . n 
A 1 78  ILE 78  528 528 ILE ILE A . n 
A 1 79  ASP 79  529 529 ASP ASP A . n 
A 1 80  HIS 80  530 530 HIS HIS A . n 
A 1 81  HIS 81  531 531 HIS HIS A . n 
A 1 82  TYR 82  532 532 TYR TYR A . n 
A 1 83  THR 83  533 533 THR THR A . n 
A 1 84  THR 84  534 534 THR THR A . n 
A 1 85  LYS 85  535 535 LYS LYS A . n 
A 1 86  GLN 86  536 536 GLN GLN A . n 
A 1 87  VAL 87  537 537 VAL VAL A . n 
A 1 88  ILE 88  538 538 ILE ILE A . n 
A 1 89  THR 89  539 539 THR THR A . n 
A 1 90  LYS 90  540 540 LYS LYS A . n 
A 1 91  LYS 91  541 541 LYS LYS A . n 
A 1 92  SER 92  542 542 SER SER A . n 
A 1 93  GLY 93  543 543 GLY GLY A . n 
A 1 94  VAL 94  544 544 VAL VAL A . n 
A 1 95  VAL 95  545 545 VAL VAL A . n 
A 1 96  LEU 96  546 546 LEU LEU A . n 
A 1 97  LEU 97  547 547 LEU LEU A . n 
A 1 98  ASN 98  548 548 ASN ASN A . n 
A 1 99  PRO 99  549 549 PRO PRO A . n 
A 1 100 ILE 100 550 550 ILE ILE A . n 
A 1 101 PRO 101 551 551 PRO PRO A . n 
A 1 102 LYS 102 552 552 LYS LYS A . n 
B 2 1   ASP 1   1   1   ASP ASP B . n 
B 2 2   GLU 2   2   2   GLU GLU B . n 
B 2 3   PTR 3   3   3   PTR PTR B . n 
B 2 4   GLU 4   4   4   GLU GLU B . n 
B 2 5   ASN 5   5   5   ASN ASN B . n 
B 2 6   VAL 6   6   6   VAL VAL B . n 
B 2 7   ASP 7   7   ?   ?   ?   B . n 
C 1 1   GLY 1   451 ?   ?   ?   C . n 
C 1 2   SER 2   452 ?   ?   ?   C . n 
C 1 3   LYS 3   453 453 LYS LYS C . n 
C 1 4   PRO 4   454 454 PRO PRO C . n 
C 1 5   LEU 5   455 455 LEU LEU C . n 
C 1 6   ALA 6   456 456 ALA ALA C . n 
C 1 7   GLU 7   457 457 GLU GLU C . n 
C 1 8   GLN 8   458 458 GLN GLN C . n 
C 1 9   ASP 9   459 459 ASP ASP C . n 
C 1 10  TRP 10  460 460 TRP TRP C . n 
C 1 11  TYR 11  461 461 TYR TYR C . n 
C 1 12  HIS 12  462 462 HIS HIS C . n 
C 1 13  GLY 13  463 463 GLY GLY C . n 
C 1 14  ALA 14  464 464 ALA ALA C . n 
C 1 15  ILE 15  465 465 ILE ILE C . n 
C 1 16  PRO 16  466 466 PRO PRO C . n 
C 1 17  ARG 17  467 467 ARG ARG C . n 
C 1 18  ILE 18  468 468 ILE ILE C . n 
C 1 19  GLU 19  469 469 GLU GLU C . n 
C 1 20  ALA 20  470 470 ALA ALA C . n 
C 1 21  GLN 21  471 471 GLN GLN C . n 
C 1 22  GLU 22  472 472 GLU GLU C . n 
C 1 23  LEU 23  473 473 LEU LEU C . n 
C 1 24  LEU 24  474 474 LEU LEU C . n 
C 1 25  LYS 25  475 475 LYS LYS C . n 
C 1 26  LYS 26  476 476 LYS LYS C . n 
C 1 27  GLN 27  477 477 GLN GLN C . n 
C 1 28  GLY 28  478 478 GLY GLY C . n 
C 1 29  ASP 29  479 479 ASP ASP C . n 
C 1 30  PHE 30  480 480 PHE PHE C . n 
C 1 31  LEU 31  481 481 LEU LEU C . n 
C 1 32  VAL 32  482 482 VAL VAL C . n 
C 1 33  ARG 33  483 483 ARG ARG C . n 
C 1 34  GLU 34  484 484 GLU GLU C . n 
C 1 35  SER 35  485 485 SER SER C . n 
C 1 36  HIS 36  486 486 HIS HIS C . n 
C 1 37  GLY 37  487 487 GLY GLY C . n 
C 1 38  LYS 38  488 488 LYS LYS C . n 
C 1 39  PRO 39  489 489 PRO PRO C . n 
C 1 40  GLY 40  490 490 GLY GLY C . n 
C 1 41  GLU 41  491 491 GLU GLU C . n 
C 1 42  TYR 42  492 492 TYR TYR C . n 
C 1 43  VAL 43  493 493 VAL VAL C . n 
C 1 44  LEU 44  494 494 LEU LEU C . n 
C 1 45  SER 45  495 495 SER SER C . n 
C 1 46  VAL 46  496 496 VAL VAL C . n 
C 1 47  TYR 47  497 497 TYR TYR C . n 
C 1 48  SER 48  498 498 SER SER C . n 
C 1 49  ASP 49  499 499 ASP ASP C . n 
C 1 50  GLY 50  500 500 GLY GLY C . n 
C 1 51  GLN 51  501 501 GLN GLN C . n 
C 1 52  ARG 52  502 502 ARG ARG C . n 
C 1 53  ARG 53  503 503 ARG ARG C . n 
C 1 54  HIS 54  504 504 HIS HIS C . n 
C 1 55  PHE 55  505 505 PHE PHE C . n 
C 1 56  ILE 56  506 506 ILE ILE C . n 
C 1 57  ILE 57  507 507 ILE ILE C . n 
C 1 58  GLN 58  508 508 GLN GLN C . n 
C 1 59  TYR 59  509 509 TYR TYR C . n 
C 1 60  VAL 60  510 510 VAL VAL C . n 
C 1 61  ASP 61  511 511 ASP ASP C . n 
C 1 62  ASN 62  512 512 ASN ASN C . n 
C 1 63  MET 63  513 513 MET MET C . n 
C 1 64  TYR 64  514 514 TYR TYR C . n 
C 1 65  ARG 65  515 515 ARG ARG C . n 
C 1 66  PHE 66  516 516 PHE PHE C . n 
C 1 67  GLU 67  517 517 GLU GLU C . n 
C 1 68  GLY 68  518 518 GLY GLY C . n 
C 1 69  THR 69  519 519 THR THR C . n 
C 1 70  GLY 70  520 520 GLY GLY C . n 
C 1 71  PHE 71  521 521 PHE PHE C . n 
C 1 72  SER 72  522 522 SER SER C . n 
C 1 73  ASN 73  523 523 ASN ASN C . n 
C 1 74  ILE 74  524 524 ILE ILE C . n 
C 1 75  PRO 75  525 525 PRO PRO C . n 
C 1 76  GLN 76  526 526 GLN GLN C . n 
C 1 77  LEU 77  527 527 LEU LEU C . n 
C 1 78  ILE 78  528 528 ILE ILE C . n 
C 1 79  ASP 79  529 529 ASP ASP C . n 
C 1 80  HIS 80  530 530 HIS HIS C . n 
C 1 81  HIS 81  531 531 HIS HIS C . n 
C 1 82  TYR 82  532 532 TYR TYR C . n 
C 1 83  THR 83  533 533 THR THR C . n 
C 1 84  THR 84  534 534 THR THR C . n 
C 1 85  LYS 85  535 535 LYS LYS C . n 
C 1 86  GLN 86  536 536 GLN GLN C . n 
C 1 87  VAL 87  537 537 VAL VAL C . n 
C 1 88  ILE 88  538 538 ILE ILE C . n 
C 1 89  THR 89  539 539 THR THR C . n 
C 1 90  LYS 90  540 540 LYS LYS C . n 
C 1 91  LYS 91  541 541 LYS LYS C . n 
C 1 92  SER 92  542 542 SER SER C . n 
C 1 93  GLY 93  543 543 GLY GLY C . n 
C 1 94  VAL 94  544 544 VAL VAL C . n 
C 1 95  VAL 95  545 545 VAL VAL C . n 
C 1 96  LEU 96  546 546 LEU LEU C . n 
C 1 97  LEU 97  547 547 LEU LEU C . n 
C 1 98  ASN 98  548 548 ASN ASN C . n 
C 1 99  PRO 99  549 549 PRO PRO C . n 
C 1 100 ILE 100 550 550 ILE ILE C . n 
C 1 101 PRO 101 551 551 PRO PRO C . n 
C 1 102 LYS 102 552 552 LYS LYS C . n 
D 2 1   ASP 1   1   1   ASP ASP D . n 
D 2 2   GLU 2   2   2   GLU GLU D . n 
D 2 3   PTR 3   3   3   PTR PTR D . n 
D 2 4   GLU 4   4   4   GLU GLU D . n 
D 2 5   ASN 5   5   5   ASN ASN D . n 
D 2 6   VAL 6   6   6   VAL VAL D . n 
D 2 7   ASP 7   7   7   ASP ASP D . n 
E 1 1   GLY 1   451 ?   ?   ?   E . n 
E 1 2   SER 2   452 452 SER SER E . n 
E 1 3   LYS 3   453 453 LYS LYS E . n 
E 1 4   PRO 4   454 454 PRO PRO E . n 
E 1 5   LEU 5   455 455 LEU LEU E . n 
E 1 6   ALA 6   456 456 ALA ALA E . n 
E 1 7   GLU 7   457 457 GLU GLU E . n 
E 1 8   GLN 8   458 458 GLN GLN E . n 
E 1 9   ASP 9   459 459 ASP ASP E . n 
E 1 10  TRP 10  460 460 TRP TRP E . n 
E 1 11  TYR 11  461 461 TYR TYR E . n 
E 1 12  HIS 12  462 462 HIS HIS E . n 
E 1 13  GLY 13  463 463 GLY GLY E . n 
E 1 14  ALA 14  464 464 ALA ALA E . n 
E 1 15  ILE 15  465 465 ILE ILE E . n 
E 1 16  PRO 16  466 466 PRO PRO E . n 
E 1 17  ARG 17  467 467 ARG ARG E . n 
E 1 18  ILE 18  468 468 ILE ILE E . n 
E 1 19  GLU 19  469 469 GLU GLU E . n 
E 1 20  ALA 20  470 470 ALA ALA E . n 
E 1 21  GLN 21  471 471 GLN GLN E . n 
E 1 22  GLU 22  472 472 GLU GLU E . n 
E 1 23  LEU 23  473 473 LEU LEU E . n 
E 1 24  LEU 24  474 474 LEU LEU E . n 
E 1 25  LYS 25  475 475 LYS LYS E . n 
E 1 26  LYS 26  476 476 LYS LYS E . n 
E 1 27  GLN 27  477 477 GLN GLN E . n 
E 1 28  GLY 28  478 478 GLY GLY E . n 
E 1 29  ASP 29  479 479 ASP ASP E . n 
E 1 30  PHE 30  480 480 PHE PHE E . n 
E 1 31  LEU 31  481 481 LEU LEU E . n 
E 1 32  VAL 32  482 482 VAL VAL E . n 
E 1 33  ARG 33  483 483 ARG ARG E . n 
E 1 34  GLU 34  484 484 GLU GLU E . n 
E 1 35  SER 35  485 485 SER SER E . n 
E 1 36  HIS 36  486 486 HIS HIS E . n 
E 1 37  GLY 37  487 487 GLY GLY E . n 
E 1 38  LYS 38  488 488 LYS LYS E . n 
E 1 39  PRO 39  489 489 PRO PRO E . n 
E 1 40  GLY 40  490 490 GLY GLY E . n 
E 1 41  GLU 41  491 491 GLU GLU E . n 
E 1 42  TYR 42  492 492 TYR TYR E . n 
E 1 43  VAL 43  493 493 VAL VAL E . n 
E 1 44  LEU 44  494 494 LEU LEU E . n 
E 1 45  SER 45  495 495 SER SER E . n 
E 1 46  VAL 46  496 496 VAL VAL E . n 
E 1 47  TYR 47  497 497 TYR TYR E . n 
E 1 48  SER 48  498 498 SER SER E . n 
E 1 49  ASP 49  499 499 ASP ASP E . n 
E 1 50  GLY 50  500 500 GLY GLY E . n 
E 1 51  GLN 51  501 501 GLN GLN E . n 
E 1 52  ARG 52  502 502 ARG ARG E . n 
E 1 53  ARG 53  503 503 ARG ARG E . n 
E 1 54  HIS 54  504 504 HIS HIS E . n 
E 1 55  PHE 55  505 505 PHE PHE E . n 
E 1 56  ILE 56  506 506 ILE ILE E . n 
E 1 57  ILE 57  507 507 ILE ILE E . n 
E 1 58  GLN 58  508 508 GLN GLN E . n 
E 1 59  TYR 59  509 509 TYR TYR E . n 
E 1 60  VAL 60  510 510 VAL VAL E . n 
E 1 61  ASP 61  511 511 ASP ASP E . n 
E 1 62  ASN 62  512 512 ASN ASN E . n 
E 1 63  MET 63  513 513 MET MET E . n 
E 1 64  TYR 64  514 514 TYR TYR E . n 
E 1 65  ARG 65  515 515 ARG ARG E . n 
E 1 66  PHE 66  516 516 PHE PHE E . n 
E 1 67  GLU 67  517 517 GLU GLU E . n 
E 1 68  GLY 68  518 518 GLY GLY E . n 
E 1 69  THR 69  519 519 THR THR E . n 
E 1 70  GLY 70  520 520 GLY GLY E . n 
E 1 71  PHE 71  521 521 PHE PHE E . n 
E 1 72  SER 72  522 522 SER SER E . n 
E 1 73  ASN 73  523 523 ASN ASN E . n 
E 1 74  ILE 74  524 524 ILE ILE E . n 
E 1 75  PRO 75  525 525 PRO PRO E . n 
E 1 76  GLN 76  526 526 GLN GLN E . n 
E 1 77  LEU 77  527 527 LEU LEU E . n 
E 1 78  ILE 78  528 528 ILE ILE E . n 
E 1 79  ASP 79  529 529 ASP ASP E . n 
E 1 80  HIS 80  530 530 HIS HIS E . n 
E 1 81  HIS 81  531 531 HIS HIS E . n 
E 1 82  TYR 82  532 532 TYR TYR E . n 
E 1 83  THR 83  533 533 THR THR E . n 
E 1 84  THR 84  534 534 THR THR E . n 
E 1 85  LYS 85  535 535 LYS LYS E . n 
E 1 86  GLN 86  536 536 GLN GLN E . n 
E 1 87  VAL 87  537 537 VAL VAL E . n 
E 1 88  ILE 88  538 538 ILE ILE E . n 
E 1 89  THR 89  539 539 THR THR E . n 
E 1 90  LYS 90  540 540 LYS LYS E . n 
E 1 91  LYS 91  541 541 LYS LYS E . n 
E 1 92  SER 92  542 542 SER SER E . n 
E 1 93  GLY 93  543 543 GLY GLY E . n 
E 1 94  VAL 94  544 544 VAL VAL E . n 
E 1 95  VAL 95  545 545 VAL VAL E . n 
E 1 96  LEU 96  546 546 LEU LEU E . n 
E 1 97  LEU 97  547 547 LEU LEU E . n 
E 1 98  ASN 98  548 548 ASN ASN E . n 
E 1 99  PRO 99  549 549 PRO PRO E . n 
E 1 100 ILE 100 550 550 ILE ILE E . n 
E 1 101 PRO 101 551 551 PRO PRO E . n 
E 1 102 LYS 102 552 552 LYS LYS E . n 
F 2 1   ASP 1   1   1   ASP ASP F . n 
F 2 2   GLU 2   2   2   GLU GLU F . n 
F 2 3   PTR 3   3   3   PTR PTR F . n 
F 2 4   GLU 4   4   4   GLU GLU F . n 
F 2 5   ASN 5   5   5   ASN ASN F . n 
F 2 6   VAL 6   6   6   VAL VAL F . n 
F 2 7   ASP 7   7   ?   ?   ?   F . n 
G 1 1   GLY 1   451 ?   ?   ?   G . n 
G 1 2   SER 2   452 452 SER SER G . n 
G 1 3   LYS 3   453 453 LYS LYS G . n 
G 1 4   PRO 4   454 454 PRO PRO G . n 
G 1 5   LEU 5   455 455 LEU LEU G . n 
G 1 6   ALA 6   456 456 ALA ALA G . n 
G 1 7   GLU 7   457 457 GLU GLU G . n 
G 1 8   GLN 8   458 458 GLN GLN G . n 
G 1 9   ASP 9   459 459 ASP ASP G . n 
G 1 10  TRP 10  460 460 TRP TRP G . n 
G 1 11  TYR 11  461 461 TYR