data_6KE9
# 
_entry.id   6KE9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.325 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KE9         
WWPDB D_1300012829 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KE9 
_pdbx_database_status.recvd_initial_deposition_date   2019-07-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Soman, A.'        1 0000-0003-3522-3661 
'Liew, C.W.'       2 0000-0002-4343-818X 
'Teo, H.L.'        3 ?                   
'Berezhnoy, N.'    4 ?                   
'Korolev, N.'      5 ?                   
'Rhodes, D.'       6 ?                   
'Nordenskiold, L.' 7 0000-0002-3681-209X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            48 
_citation.language                  ? 
_citation.page_first                5383 
_citation.page_last                 5396 
_citation.title                     'The human telomeric nucleosome displays distinct structural and dynamic properties.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkaa289 
_citation.pdbx_database_id_PubMed   32374876 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Soman, A.'        1 ? 
primary 'Liew, C.W.'       2 ? 
primary 'Teo, H.L.'        3 ? 
primary 'Berezhnoy, N.V.'  4 ? 
primary 'Olieric, V.'      5 ? 
primary 'Korolev, N.'      6 ? 
primary 'Rhodes, D.'       7 ? 
primary 'Nordenskiold, L.' 8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KE9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     106.133 
_cell.length_a_esd                 ? 
_cell.length_b                     109.319 
_cell.length_b_esd                 ? 
_cell.length_c                     176.969 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KE9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.1'                  11269.213 2 ? ? ? ? 
2 polymer     man 'Histone H4'                    9990.770  2 ? ? ? ? 
3 polymer     man 'Histone H2A type 1-B/E'        11508.419 2 ? ? ? ? 
4 polymer     man 'Histone H2B type 1-K'          10607.174 2 ? ? ? ? 
5 polymer     man 'Human telomeric DNA (145-MER)' 46024.258 1 ? ? ? ? 
6 polymer     man 'Human Telomeric DNA (145-MER)' 43478.914 1 ? ? ? ? 
7 non-polymer syn 'MANGANESE (II) ION'            54.938    4 ? ? ? ? 
8 water       nat water                           18.015    6 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'Histone H2A' 
4 'Histone H2B' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
;
;RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL
NKLLGRVTIAQGGVLPNIQAVLLPK
;
;AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL
NKLLGRVTIAQGGVLPNIQAVLLPK
;
C,G ? 
4 'polypeptide(L)'        no no 
;RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSAK
;
;RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)
(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)
(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)
(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)
(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)
(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)
(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)
(DG)(DT)(DG)(DA)(DT)
;
;ATCTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGG
GTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)
(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)
(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)
(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)
(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)
(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)
(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)
(DA)(DA)(DG)(DA)(DT)
;
;ATCACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCT
AACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAAGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   TYR n 
1 3   ARG n 
1 4   PRO n 
1 5   GLY n 
1 6   THR n 
1 7   VAL n 
1 8   ALA n 
1 9   LEU n 
1 10  ARG n 
1 11  GLU n 
1 12  ILE n 
1 13  ARG n 
1 14  ARG n 
1 15  TYR n 
1 16  GLN n 
1 17  LYS n 
1 18  SER n 
1 19  THR n 
1 20  GLU n 
1 21  LEU n 
1 22  LEU n 
1 23  ILE n 
1 24  ARG n 
1 25  LYS n 
1 26  LEU n 
1 27  PRO n 
1 28  PHE n 
1 29  GLN n 
1 30  ARG n 
1 31  LEU n 
1 32  VAL n 
1 33  ARG n 
1 34  GLU n 
1 35  ILE n 
1 36  ALA n 
1 37  GLN n 
1 38  ASP n 
1 39  PHE n 
1 40  LYS n 
1 41  THR n 
1 42  ASP n 
1 43  LEU n 
1 44  ARG n 
1 45  PHE n 
1 46  GLN n 
1 47  SER n 
1 48  SER n 
1 49  ALA n 
1 50  VAL n 
1 51  MET n 
1 52  ALA n 
1 53  LEU n 
1 54  GLN n 
1 55  GLU n 
1 56  ALA n 
1 57  CYS n 
1 58  GLU n 
1 59  ALA n 
1 60  TYR n 
1 61  LEU n 
1 62  VAL n 
1 63  GLY n 
1 64  LEU n 
1 65  PHE n 
1 66  GLU n 
1 67  ASP n 
1 68  THR n 
1 69  ASN n 
1 70  LEU n 
1 71  CYS n 
1 72  ALA n 
1 73  ILE n 
1 74  HIS n 
1 75  ALA n 
1 76  LYS n 
1 77  ARG n 
1 78  VAL n 
1 79  THR n 
1 80  ILE n 
1 81  MET n 
1 82  PRO n 
1 83  LYS n 
1 84  ASP n 
1 85  ILE n 
1 86  GLN n 
1 87  LEU n 
1 88  ALA n 
1 89  ARG n 
1 90  ARG n 
1 91  ILE n 
1 92  ARG n 
1 93  GLY n 
1 94  GLU n 
1 95  ARG n 
1 96  ALA n 
2 1   LYS n 
2 2   ARG n 
2 3   HIS n 
2 4   ARG n 
2 5   LYS n 
2 6   VAL n 
2 7   LEU n 
2 8   ARG n 
2 9   ASP n 
2 10  ASN n 
2 11  ILE n 
2 12  GLN n 
2 13  GLY n 
2 14  ILE n 
2 15  THR n 
2 16  LYS n 
2 17  PRO n 
2 18  ALA n 
2 19  ILE n 
2 20  ARG n 
2 21  ARG n 
2 22  LEU n 
2 23  ALA n 
2 24  ARG n 
2 25  ARG n 
2 26  GLY n 
2 27  GLY n 
2 28  VAL n 
2 29  LYS n 
2 30  ARG n 
2 31  ILE n 
2 32  SER n 
2 33  GLY n 
2 34  LEU n 
2 35  ILE n 
2 36  TYR n 
2 37  GLU n 
2 38  GLU n 
2 39  THR n 
2 40  ARG n 
2 41  GLY n 
2 42  VAL n 
2 43  LEU n 
2 44  LYS n 
2 45  VAL n 
2 46  PHE n 
2 47  LEU n 
2 48  GLU n 
2 49  ASN n 
2 50  VAL n 
2 51  ILE n 
2 52  ARG n 
2 53  ASP n 
2 54  ALA n 
2 55  VAL n 
2 56  THR n 
2 57  TYR n 
2 58  THR n 
2 59  GLU n 
2 60  HIS n 
2 61  ALA n 
2 62  LYS n 
2 63  ARG n 
2 64  LYS n 
2 65  THR n 
2 66  VAL n 
2 67  THR n 
2 68  ALA n 
2 69  MET n 
2 70  ASP n 
2 71  VAL n 
2 72  VAL n 
2 73  TYR n 
2 74  ALA n 
2 75  LEU n 
2 76  LYS n 
2 77  ARG n 
2 78  GLN n 
2 79  GLY n 
2 80  ARG n 
2 81  THR n 
2 82  LEU n 
2 83  TYR n 
2 84  GLY n 
2 85  PHE n 
2 86  GLY n 
2 87  GLY n 
3 1   ALA n 
3 2   LYS n 
3 3   THR n 
3 4   ARG n 
3 5   SER n 
3 6   SER n 
3 7   ARG n 
3 8   ALA n 
3 9   GLY n 
3 10  LEU n 
3 11  GLN n 
3 12  PHE n 
3 13  PRO n 
3 14  VAL n 
3 15  GLY n 
3 16  ARG n 
3 17  VAL n 
3 18  HIS n 
3 19  ARG n 
3 20  LEU n 
3 21  LEU n 
3 22  ARG n 
3 23  LYS n 
3 24  GLY n 
3 25  ASN n 
3 26  TYR n 
3 27  SER n 
3 28  GLU n 
3 29  ARG n 
3 30  VAL n 
3 31  GLY n 
3 32  ALA n 
3 33  GLY n 
3 34  ALA n 
3 35  PRO n 
3 36  VAL n 
3 37  TYR n 
3 38  LEU n 
3 39  ALA n 
3 40  ALA n 
3 41  VAL n 
3 42  LEU n 
3 43  GLU n 
3 44  TYR n 
3 45  LEU n 
3 46  THR n 
3 47  ALA n 
3 48  GLU n 
3 49  ILE n 
3 50  LEU n 
3 51  GLU n 
3 52  LEU n 
3 53  ALA n 
3 54  GLY n 
3 55  ASN n 
3 56  ALA n 
3 57  ALA n 
3 58  ARG n 
3 59  ASP n 
3 60  ASN n 
3 61  LYS n 
3 62  LYS n 
3 63  THR n 
3 64  ARG n 
3 65  ILE n 
3 66  ILE n 
3 67  PRO n 
3 68  ARG n 
3 69  HIS n 
3 70  LEU n 
3 71  GLN n 
3 72  LEU n 
3 73  ALA n 
3 74  ILE n 
3 75  ARG n 
3 76  ASN n 
3 77  ASP n 
3 78  GLU n 
3 79  GLU n 
3 80  LEU n 
3 81  ASN n 
3 82  LYS n 
3 83  LEU n 
3 84  LEU n 
3 85  GLY n 
3 86  ARG n 
3 87  VAL n 
3 88  THR n 
3 89  ILE n 
3 90  ALA n 
3 91  GLN n 
3 92  GLY n 
3 93  GLY n 
3 94  VAL n 
3 95  LEU n 
3 96  PRO n 
3 97  ASN n 
3 98  ILE n 
3 99  GLN n 
3 100 ALA n 
3 101 VAL n 
3 102 LEU n 
3 103 LEU n 
3 104 PRO n 
3 105 LYS n 
4 1   ARG n 
4 2   SER n 
4 3   ARG n 
4 4   LYS n 
4 5   GLU n 
4 6   SER n 
4 7   TYR n 
4 8   SER n 
4 9   VAL n 
4 10  TYR n 
4 11  VAL n 
4 12  TYR n 
4 13  LYS n 
4 14  VAL n 
4 15  LEU n 
4 16  LYS n 
4 17  GLN n 
4 18  VAL n 
4 19  HIS n 
4 20  PRO n 
4 21  ASP n 
4 22  THR n 
4 23  GLY n 
4 24  ILE n 
4 25  SER n 
4 26  SER n 
4 27  LYS n 
4 28  ALA n 
4 29  MET n 
4 30  GLY n 
4 31  ILE n 
4 32  MET n 
4 33  ASN n 
4 34  SER n 
4 35  PHE n 
4 36  VAL n 
4 37  ASN n 
4 38  ASP n 
4 39  ILE n 
4 40  PHE n 
4 41  GLU n 
4 42  ARG n 
4 43  ILE n 
4 44  ALA n 
4 45  GLY n 
4 46  GLU n 
4 47  ALA n 
4 48  SER n 
4 49  ARG n 
4 50  LEU n 
4 51  ALA n 
4 52  HIS n 
4 53  TYR n 
4 54  ASN n 
4 55  LYS n 
4 56  ARG n 
4 57  SER n 
4 58  THR n 
4 59  ILE n 
4 60  THR n 
4 61  SER n 
4 62  ARG n 
4 63  GLU n 
4 64  ILE n 
4 65  GLN n 
4 66  THR n 
4 67  ALA n 
4 68  VAL n 
4 69  ARG n 
4 70  LEU n 
4 71  LEU n 
4 72  LEU n 
4 73  PRO n 
4 74  GLY n 
4 75  GLU n 
4 76  LEU n 
4 77  ALA n 
4 78  LYS n 
4 79  HIS n 
4 80  ALA n 
4 81  VAL n 
4 82  SER n 
4 83  GLU n 
4 84  GLY n 
4 85  THR n 
4 86  LYS n 
4 87  ALA n 
4 88  VAL n 
4 89  THR n 
4 90  LYS n 
4 91  TYR n 
4 92  THR n 
4 93  SER n 
4 94  ALA n 
4 95  LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DT  n 
5 5   DT  n 
5 6   DA  n 
5 7   DG  n 
5 8   DG  n 
5 9   DG  n 
5 10  DT  n 
5 11  DT  n 
5 12  DA  n 
5 13  DG  n 
5 14  DG  n 
5 15  DG  n 
5 16  DT  n 
5 17  DT  n 
5 18  DA  n 
5 19  DG  n 
5 20  DG  n 
5 21  DG  n 
5 22  DT  n 
5 23  DT  n 
5 24  DA  n 
5 25  DG  n 
5 26  DG  n 
5 27  DG  n 
5 28  DT  n 
5 29  DT  n 
5 30  DA  n 
5 31  DG  n 
5 32  DG  n 
5 33  DG  n 
5 34  DT  n 
5 35  DT  n 
5 36  DA  n 
5 37  DG  n 
5 38  DG  n 
5 39  DG  n 
5 40  DT  n 
5 41  DT  n 
5 42  DA  n 
5 43  DG  n 
5 44  DG  n 
5 45  DG  n 
5 46  DT  n 
5 47  DT  n 
5 48  DA  n 
5 49  DG  n 
5 50  DG  n 
5 51  DG  n 
5 52  DT  n 
5 53  DT  n 
5 54  DA  n 
5 55  DG  n 
5 56  DG  n 
5 57  DG  n 
5 58  DT  n 
5 59  DT  n 
5 60  DA  n 
5 61  DG  n 
5 62  DG  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DA  n 
5 67  DG  n 
5 68  DG  n 
5 69  DG  n 
5 70  DT  n 
5 71  DT  n 
5 72  DA  n 
5 73  DG  n 
5 74  DG  n 
5 75  DG  n 
5 76  DT  n 
5 77  DT  n 
5 78  DA  n 
5 79  DG  n 
5 80  DG  n 
5 81  DG  n 
5 82  DT  n 
5 83  DT  n 
5 84  DA  n 
5 85  DG  n 
5 86  DG  n 
5 87  DG  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DG  n 
5 92  DG  n 
5 93  DG  n 
5 94  DT  n 
5 95  DT  n 
5 96  DA  n 
5 97  DG  n 
5 98  DG  n 
5 99  DG  n 
5 100 DT  n 
5 101 DT  n 
5 102 DA  n 
5 103 DG  n 
5 104 DG  n 
5 105 DG  n 
5 106 DT  n 
5 107 DT  n 
5 108 DA  n 
5 109 DG  n 
5 110 DG  n 
5 111 DG  n 
5 112 DT  n 
5 113 DT  n 
5 114 DA  n 
5 115 DG  n 
5 116 DG  n 
5 117 DG  n 
5 118 DT  n 
5 119 DT  n 
5 120 DA  n 
5 121 DG  n 
5 122 DG  n 
5 123 DG  n 
5 124 DT  n 
5 125 DT  n 
5 126 DA  n 
5 127 DG  n 
5 128 DG  n 
5 129 DG  n 
5 130 DT  n 
5 131 DT  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DG  n 
5 136 DT  n 
5 137 DT  n 
5 138 DA  n 
5 139 DG  n 
5 140 DG  n 
5 141 DG  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DC  n 
6 6   DC  n 
6 7   DC  n 
6 8   DT  n 
6 9   DA  n 
6 10  DA  n 
6 11  DC  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DA  n 
6 16  DA  n 
6 17  DC  n 
6 18  DC  n 
6 19  DC  n 
6 20  DT  n 
6 21  DA  n 
6 22  DA  n 
6 23  DC  n 
6 24  DC  n 
6 25  DC  n 
6 26  DT  n 
6 27  DA  n 
6 28  DA  n 
6 29  DC  n 
6 30  DC  n 
6 31  DC  n 
6 32  DT  n 
6 33  DA  n 
6 34  DA  n 
6 35  DC  n 
6 36  DC  n 
6 37  DC  n 
6 38  DT  n 
6 39  DA  n 
6 40  DA  n 
6 41  DC  n 
6 42  DC  n 
6 43  DC  n 
6 44  DT  n 
6 45  DA  n 
6 46  DA  n 
6 47  DC  n 
6 48  DC  n 
6 49  DC  n 
6 50  DT  n 
6 51  DA  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DC  n 
6 56  DT  n 
6 57  DA  n 
6 58  DA  n 
6 59  DC  n 
6 60  DC  n 
6 61  DC  n 
6 62  DT  n 
6 63  DA  n 
6 64  DA  n 
6 65  DC  n 
6 66  DC  n 
6 67  DC  n 
6 68  DT  n 
6 69  DA  n 
6 70  DA  n 
6 71  DC  n 
6 72  DC  n 
6 73  DC  n 
6 74  DT  n 
6 75  DA  n 
6 76  DA  n 
6 77  DC  n 
6 78  DC  n 
6 79  DC  n 
6 80  DT  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DC  n 
6 85  DC  n 
6 86  DT  n 
6 87  DA  n 
6 88  DA  n 
6 89  DC  n 
6 90  DC  n 
6 91  DC  n 
6 92  DT  n 
6 93  DA  n 
6 94  DA  n 
6 95  DC  n 
6 96  DC  n 
6 97  DC  n 
6 98  DT  n 
6 99  DA  n 
6 100 DA  n 
6 101 DC  n 
6 102 DC  n 
6 103 DC  n 
6 104 DT  n 
6 105 DA  n 
6 106 DA  n 
6 107 DC  n 
6 108 DC  n 
6 109 DC  n 
6 110 DT  n 
6 111 DA  n 
6 112 DA  n 
6 113 DC  n 
6 114 DC  n 
6 115 DC  n 
6 116 DT  n 
6 117 DA  n 
6 118 DA  n 
6 119 DC  n 
6 120 DC  n 
6 121 DC  n 
6 122 DT  n 
6 123 DA  n 
6 124 DA  n 
6 125 DC  n 
6 126 DC  n 
6 127 DC  n 
6 128 DT  n 
6 129 DA  n 
6 130 DA  n 
6 131 DC  n 
6 132 DC  n 
6 133 DC  n 
6 134 DT  n 
6 135 DA  n 
6 136 DA  n 
6 137 DC  n 
6 138 DC  n 
6 139 DC  n 
6 140 DT  n 
6 141 DA  n 
6 142 DA  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 96  Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 87  Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 105 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 95  Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 145 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 145 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H31_HUMAN   P68431 ? 1 
;RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
;
41 
2 UNP H4_HUMAN    P62805 ? 2 
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
17 
3 UNP H2A1B_HUMAN P04908 ? 3 
;AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL
NKLLGRVTIAQGGVLPNIQAVLLPK
;
15 
4 UNP H2B1K_HUMAN O60814 ? 4 
;RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSAK
;
32 
5 PDB 6KE9        6KE9   ? 5 ? 1  
6 PDB 6KE9        6KE9   ? 6 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6KE9 A 1 ? 96  ? P68431 41  ? 136 ? 40  135 
2  2 6KE9 B 1 ? 87  ? P62805 17  ? 103 ? 16  102 
3  3 6KE9 C 1 ? 105 ? P04908 15  ? 119 ? 14  118 
4  4 6KE9 D 1 ? 95  ? O60814 32  ? 126 ? 28  122 
5  1 6KE9 E 1 ? 96  ? P68431 41  ? 136 ? 40  135 
6  2 6KE9 F 1 ? 87  ? P62805 17  ? 103 ? 16  102 
7  3 6KE9 G 1 ? 105 ? P04908 15  ? 119 ? 14  118 
8  4 6KE9 H 1 ? 95  ? O60814 32  ? 126 ? 28  122 
9  5 6KE9 I 1 ? 145 ? 6KE9   -72 ? 72  ? -72 72  
10 6 6KE9 J 1 ? 145 ? 6KE9   -72 ? 72  ? -72 72  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KE9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.94 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.15 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Manganase chloride, potassium chloride, potassium cacodylate, MPD and trehalose' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             100 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-03-03 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            62.230 
_reflns.entry_id                         6KE9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.18 
_reflns.d_resolution_low                 93.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       53570 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.2 
_reflns.pdbx_Rmerge_I_obs                0.050 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            26.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.012 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.18 
_reflns_shell.d_res_low                   2.22 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5306 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.23 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.343 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.81 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            11.0167 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -26.0055 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            14.9888 
_refine.B_iso_max                                249.580 
_refine.B_iso_mean                               128.2600 
_refine.B_iso_min                                11.870 
_refine.correlation_coeff_Fo_to_Fc               0.9020 
_refine.correlation_coeff_Fo_to_Fc_free          0.9080 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KE9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.2200 
_refine.ls_d_res_low                             42.0100 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     43634 
_refine.ls_number_reflns_R_free                  2337 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    42.1 
_refine.ls_percent_reflns_R_free                 5.3600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2050 
_refine.ls_R_factor_R_free                       0.2300 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2040 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3LZ0 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.3500 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6KE9 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.380 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.2200 
_refine_hist.d_res_low                        42.0100 
_refine_hist.number_atoms_solvent             6 
_refine_hist.number_atoms_total               11931 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       1043 
_refine_hist.pdbx_B_iso_mean_ligand           142.42 
_refine_hist.pdbx_B_iso_mean_solvent          30.34 
_refine_hist.pdbx_number_atoms_protein        5982 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? ?      ? 3707  ? t_dihedral_angle_d        2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_trig_c_planes           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 1308  ? t_gen_planes              5.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 12721 ? t_it                      20.000 HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 1     ? t_nbd                     5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_improper_torsion        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_pseud_angle             ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 1667  ? t_chiral_improper_torsion 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_sum_occupancies         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_distance        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_angle           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_torsion         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 12801 ? t_ideal_dist_contact      4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 0.010  ? 12721 ? t_bond_d                  2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 0.940  ? 18420 ? t_angle_deg               2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 2.760  ? ?     ? t_omega_torsion           ?      ?            
'X-RAY DIFFRACTION' ? 24.310 ? ?     ? t_other_torsion           ?      ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.2200 
_refine_ls_shell.d_res_low                        2.4200 
_refine_ls_shell.number_reflns_all                873 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             45 
_refine_ls_shell.number_reflns_R_work             828 
_refine_ls_shell.percent_reflns_obs               5.7 
_refine_ls_shell.percent_reflns_R_free            5.1500 
_refine_ls_shell.R_factor_all                     0.2515 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3739 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2451 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6KE9 
_struct.title                        'The Human Telomeric Nucleosome Displays Distinct Structural and Dynamic Properties' 
_struct.pdbx_descriptor              'Histone H3.1, Histone H4, Histone H2A type 1-B/E, Histone H2B type 1-K/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KE9 
_struct_keywords.text            'Telomeric DNA, Nucleosome Core Particle, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 8 ? 
R N N 8 ? 
S N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 5  ? LYS A 17 ? GLY A 44  LYS A 56  1 ? 13 
HELX_P HELX_P2  AA2 ARG A 24 ? ASP A 38 ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN A 46 ? ALA A 75 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 81 ? ARG A 92 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASP B 9  ? ILE B 14 ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  AA6 THR B 15 ? GLY B 26 ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 34 ? ALA B 61 ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 67 ? GLN B 78 ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 ARG C 4  ? GLY C 9  ? ARG C 17  GLY C 22  1 ? 6  
HELX_P HELX_P10 AB1 PRO C 13 ? GLY C 24 ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 GLY C 33 ? ASN C 60 ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 AB3 ILE C 66 ? ASP C 77 ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP C 77 ? LEU C 84 ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 TYR D 7  ? HIS D 19 ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P15 AB6 SER D 25 ? ASN D 54 ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P16 AB7 THR D 60 ? LEU D 72 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P17 AB8 GLU D 75 ? ALA D 94 ? GLU D 102 ALA D 121 1 ? 20 
HELX_P HELX_P18 AB9 GLY E 5  ? LYS E 17 ? GLY E 44  LYS E 56  1 ? 13 
HELX_P HELX_P19 AC1 ARG E 24 ? ASP E 38 ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P20 AC2 GLN E 46 ? ALA E 75 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P21 AC3 MET E 81 ? ARG E 92 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P22 AC4 ASN F 10 ? ILE F 14 ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P23 AC5 THR F 15 ? GLY F 26 ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P24 AC6 LEU F 34 ? ALA F 61 ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P25 AC7 THR F 67 ? GLN F 78 ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P26 AC8 THR G 3  ? GLY G 9  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P27 AC9 PRO G 13 ? LYS G 23 ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P28 AD1 GLY G 33 ? ASN G 60 ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P29 AD2 ILE G 66 ? ASP G 77 ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P30 AD3 ASP G 77 ? LEU G 84 ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P31 AD4 TYR H 7  ? HIS H 19 ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P32 AD5 SER H 25 ? ASN H 54 ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P33 AD6 THR H 60 ? LEU H 72 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P34 AD7 PRO H 73 ? ALA H 94 ? PRO H 100 ALA H 121 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? I DG 80  N7 ? ? ? 1_555 N MN .   MN ? ? I DG 7   I MN 104 1_555 ? ? ? ? ? ? ?                       2.005 ? 
metalc2   metalc ? ? I DG 111 N7 ? ? ? 1_555 K MN .   MN ? ? I DG 38  I MN 101 1_555 ? ? ? ? ? ? ?                       2.792 ? 
metalc3   metalc ? ? I DG 123 N7 ? ? ? 1_555 M MN .   MN ? ? I DG 50  I MN 103 1_555 ? ? ? ? ? ? ?                       2.583 ? 
hydrog1   hydrog ? ? I DA 1   N1 ? ? ? 1_555 J DT 145 N3 ? ? I DA -72 J DT 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog2   hydrog ? ? I DA 1   N6 ? ? ? 1_555 J DT 145 O4 ? ? I DA -72 J DT 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog3   hydrog ? ? I DT 2   N3 ? ? ? 1_555 J DA 144 N1 ? ? I DT -71 J DA 71  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog4   hydrog ? ? I DC 3   N3 ? ? ? 1_555 J DG 143 N1 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ?     ? 
hydrog5   hydrog ? ? I DT 4   N3 ? ? ? 1_555 J DA 142 N1 ? ? I DT -69 J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog6   hydrog ? ? I DT 4   O4 ? ? ? 1_555 J DA 142 N6 ? ? I DT -69 J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog7   hydrog ? ? I DT 5   N3 ? ? ? 1_555 J DA 141 N1 ? ? I DT -68 J DA 68  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog8   hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 140 N3 ? ? I DA -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog9   hydrog ? ? I DA 6   N6 ? ? ? 1_555 J DT 140 O4 ? ? I DA -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog10  hydrog ? ? I DG 7   N2 ? ? ? 1_555 J DC 139 N3 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog11  hydrog ? ? I DG 8   O6 ? ? ? 1_555 J DC 137 N4 ? ? I DG -65 J DC 64  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog12  hydrog ? ? I DG 8   N2 ? ? ? 1_555 J DC 138 N3 ? ? I DG -65 J DC 65  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog13  hydrog ? ? I DG 9   N2 ? ? ? 1_555 J DC 137 O2 ? ? I DG -64 J DC 64  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog14  hydrog ? ? I DT 10  N3 ? ? ? 1_555 J DA 136 N1 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog15  hydrog ? ? I DT 10  O4 ? ? ? 1_555 J DA 136 N6 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog16  hydrog ? ? I DT 11  N3 ? ? ? 1_555 J DA 135 N1 ? ? I DT -62 J DA 62  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog17  hydrog ? ? I DG 13  N1 ? ? ? 1_555 J DC 133 N3 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog18  hydrog ? ? I DG 13  N2 ? ? ? 1_555 J DC 133 O2 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog19  hydrog ? ? I DG 13  O6 ? ? ? 1_555 J DC 133 N4 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog20  hydrog ? ? I DG 14  N2 ? ? ? 1_555 J DC 132 N3 ? ? I DG -59 J DC 59  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog21  hydrog ? ? I DG 15  N1 ? ? ? 1_555 J DC 131 N3 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog22  hydrog ? ? I DG 15  N2 ? ? ? 1_555 J DC 131 O2 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog23  hydrog ? ? I DG 15  O6 ? ? ? 1_555 J DC 131 N4 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog24  hydrog ? ? I DT 16  N3 ? ? ? 1_555 J DA 130 N1 ? ? I DT -57 J DA 57  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog25  hydrog ? ? I DT 17  N3 ? ? ? 1_555 J DA 129 N1 ? ? I DT -56 J DA 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog26  hydrog ? ? I DT 17  O4 ? ? ? 1_555 J DA 129 N6 ? ? I DT -56 J DA 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog27  hydrog ? ? I DA 18  N1 ? ? ? 1_555 J DT 128 N3 ? ? I DA -55 J DT 55  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ?     ? 
hydrog28  hydrog ? ? I DG 19  N1 ? ? ? 1_555 J DC 127 N3 ? ? I DG -54 J DC 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog29  hydrog ? ? I DG 19  N2 ? ? ? 1_555 J DC 127 O2 ? ? I DG -54 J DC 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog30  hydrog ? ? I DG 19  O6 ? ? ? 1_555 J DC 127 N4 ? ? I DG -54 J DC 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog31  hydrog ? ? I DG 20  O6 ? ? ? 1_555 J DC 125 N4 ? ? I DG -53 J DC 52  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog32  hydrog ? ? I DG 20  N2 ? ? ? 1_555 J DC 126 N3 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog33  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DC 125 N3 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog34  hydrog ? ? I DG 21  N2 ? ? ? 1_555 J DC 125 O2 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog35  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DC 125 N4 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog36  hydrog ? ? I DT 22  N3 ? ? ? 1_555 J DA 124 N1 ? ? I DT -51 J DA 51  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog37  hydrog ? ? I DT 23  N3 ? ? ? 1_555 J DA 123 N1 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog38  hydrog ? ? I DT 23  O4 ? ? ? 1_555 J DA 123 N6 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog39  hydrog ? ? I DA 24  N1 ? ? ? 1_555 J DT 122 N3 ? ? I DA -49 J DT 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog40  hydrog ? ? I DA 24  N6 ? ? ? 1_555 J DT 122 O4 ? ? I DA -49 J DT 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog41  hydrog ? ? I DG 25  N2 ? ? ? 1_555 J DC 121 O2 ? ? I DG -48 J DC 48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog42  hydrog ? ? I DG 26  N1 ? ? ? 1_555 J DC 120 N3 ? ? I DG -47 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog43  hydrog ? ? I DG 26  N2 ? ? ? 1_555 J DC 120 O2 ? ? I DG -47 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog44  hydrog ? ? I DG 26  O6 ? ? ? 1_555 J DC 120 N4 ? ? I DG -47 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog45  hydrog ? ? I DG 27  N2 ? ? ? 1_555 J DC 119 O2 ? ? I DG -46 J DC 46  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog46  hydrog ? ? I DT 28  N3 ? ? ? 1_555 J DA 118 N1 ? ? I DT -45 J DA 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog47  hydrog ? ? I DT 28  O4 ? ? ? 1_555 J DA 118 N6 ? ? I DT -45 J DA 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog48  hydrog ? ? I DT 29  N3 ? ? ? 1_555 J DA 117 N1 ? ? I DT -44 J DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog49  hydrog ? ? I DT 29  O4 ? ? ? 1_555 J DA 117 N6 ? ? I DT -44 J DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog50  hydrog ? ? I DA 30  N1 ? ? ? 1_555 J DT 116 N3 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog51  hydrog ? ? I DA 30  N6 ? ? ? 1_555 J DT 116 O4 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog52  hydrog ? ? I DG 31  N1 ? ? ? 1_555 J DC 115 N3 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog53  hydrog ? ? I DG 31  N2 ? ? ? 1_555 J DC 115 O2 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog54  hydrog ? ? I DG 31  O6 ? ? ? 1_555 J DC 115 N4 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog55  hydrog ? ? I DG 32  N1 ? ? ? 1_555 J DC 114 O2 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog56  hydrog ? ? I DG 32  N2 ? ? ? 1_555 J DC 114 N3 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog57  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DA 112 N1 ? ? I DG -40 J DA 39  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog58  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DA 112 N6 ? ? I DG -40 J DA 39  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog59  hydrog ? ? I DT 34  N3 ? ? ? 1_555 J DA 112 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog60  hydrog ? ? I DT 34  O4 ? ? ? 1_555 J DA 112 N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog61  hydrog ? ? I DA 36  N1 ? ? ? 1_555 J DT 110 N3 ? ? I DA -37 J DT 37  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog62  hydrog ? ? I DA 36  N6 ? ? ? 1_555 J DT 110 O4 ? ? I DA -37 J DT 37  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog63  hydrog ? ? I DG 37  N1 ? ? ? 1_555 J DC 109 N3 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog64  hydrog ? ? I DG 37  N2 ? ? ? 1_555 J DC 109 O2 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog65  hydrog ? ? I DG 37  O6 ? ? ? 1_555 J DC 109 N4 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog66  hydrog ? ? I DG 38  N1 ? ? ? 1_555 J DC 108 N3 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog67  hydrog ? ? I DG 38  N2 ? ? ? 1_555 J DC 108 O2 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog68  hydrog ? ? I DG 38  O6 ? ? ? 1_555 J DC 108 N4 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog69  hydrog ? ? I DG 39  N1 ? ? ? 1_555 J DA 106 N1 ? ? I DG -34 J DA 33  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog70  hydrog ? ? I DG 39  O6 ? ? ? 1_555 J DA 106 N6 ? ? I DG -34 J DA 33  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog71  hydrog ? ? I DT 40  N3 ? ? ? 1_555 J DA 106 N1 ? ? I DT -33 J DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog72  hydrog ? ? I DT 40  O4 ? ? ? 1_555 J DA 106 N6 ? ? I DT -33 J DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog73  hydrog ? ? I DT 41  N3 ? ? ? 1_555 J DA 105 N1 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog74  hydrog ? ? I DT 41  O4 ? ? ? 1_555 J DA 105 N6 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog75  hydrog ? ? I DA 42  N1 ? ? ? 1_555 J DC 103 N4 ? ? I DA -31 J DC 30  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR'         ?     ? 
hydrog76  hydrog ? ? I DG 43  N2 ? ? ? 1_555 J DC 102 N3 ? ? I DG -30 J DC 29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog77  hydrog ? ? I DG 43  N2 ? ? ? 1_555 J DC 103 N3 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog78  hydrog ? ? I DG 44  N2 ? ? ? 1_555 J DC 102 O2 ? ? I DG -29 J DC 29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog79  hydrog ? ? I DG 45  N2 ? ? ? 1_555 J DC 101 O2 ? ? I DG -28 J DC 28  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog80  hydrog ? ? I DT 46  N3 ? ? ? 1_555 J DA 100 N1 ? ? I DT -27 J DA 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog81  hydrog ? ? I DT 46  O4 ? ? ? 1_555 J DA 100 N6 ? ? I DT -27 J DA 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog82  hydrog ? ? I DT 47  N3 ? ? ? 1_555 J DA 99  N1 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog83  hydrog ? ? I DT 47  O4 ? ? ? 1_555 J DA 99  N6 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog84  hydrog ? ? I DA 48  N1 ? ? ? 1_555 J DT 98  N3 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog85  hydrog ? ? I DA 48  N6 ? ? ? 1_555 J DT 98  O4 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog86  hydrog ? ? I DG 49  N1 ? ? ? 1_555 J DC 97  N3 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog87  hydrog ? ? I DG 49  N2 ? ? ? 1_555 J DC 97  O2 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog88  hydrog ? ? I DG 49  O6 ? ? ? 1_555 J DC 97  N4 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog89  hydrog ? ? I DG 50  N1 ? ? ? 1_555 J DC 96  N3 ? ? I DG -23 J DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog90  hydrog ? ? I DG 50  N2 ? ? ? 1_555 J DC 96  O2 ? ? I DG -23 J DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog91  hydrog ? ? I DG 50  O6 ? ? ? 1_555 J DC 96  N4 ? ? I DG -23 J DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog92  hydrog ? ? I DG 51  N1 ? ? ? 1_555 J DC 95  N3 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog93  hydrog ? ? I DG 51  N2 ? ? ? 1_555 J DC 95  O2 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog94  hydrog ? ? I DG 51  O6 ? ? ? 1_555 J DC 95  N4 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog95  hydrog ? ? I DT 52  N3 ? ? ? 1_555 J DA 94  N1 ? ? I DT -21 J DA 21  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog96  hydrog ? ? I DT 53  N3 ? ? ? 1_555 J DA 93  N1 ? ? I DT -20 J DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog97  hydrog ? ? I DT 53  O4 ? ? ? 1_555 J DA 93  N6 ? ? I DT -20 J DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog98  hydrog ? ? I DA 54  N1 ? ? ? 1_555 J DT 92  N3 ? ? I DA -19 J DT 19  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ?     ? 
hydrog99  hydrog ? ? I DG 55  N1 ? ? ? 1_555 J DC 91  N3 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog100 hydrog ? ? I DG 55  N2 ? ? ? 1_555 J DC 91  O2 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog101 hydrog ? ? I DG 55  O6 ? ? ? 1_555 J DC 91  N4 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog102 hydrog ? ? I DG 56  N1 ? ? ? 1_555 J DC 90  N3 ? ? I DG -17 J DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog103 hydrog ? ? I DG 56  N2 ? ? ? 1_555 J DC 90  O2 ? ? I DG -17 J DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog104 hydrog ? ? I DG 56  O6 ? ? ? 1_555 J DC 90  N4 ? ? I DG -17 J DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog105 hydrog ? ? I DG 57  N2 ? ? ? 1_555 J DC 89  O2 ? ? I DG -16 J DC 16  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog106 hydrog ? ? I DG 57  N2 ? ? ? 1_555 J DC 90  O2 ? ? I DG -16 J DC 17  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog107 hydrog ? ? I DT 58  N3 ? ? ? 1_555 J DA 88  N1 ? ? I DT -15 J DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog108 hydrog ? ? I DT 58  O4 ? ? ? 1_555 J DA 88  N6 ? ? I DT -15 J DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog109 hydrog ? ? I DT 59  N3 ? ? ? 1_555 J DA 87  N1 ? ? I DT -14 J DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog110 hydrog ? ? I DT 59  O4 ? ? ? 1_555 J DA 87  N6 ? ? I DT -14 J DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog111 hydrog ? ? I DA 60  N1 ? ? ? 1_555 J DT 86  N3 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog112 hydrog ? ? I DA 60  N6 ? ? ? 1_555 J DT 86  O4 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog113 hydrog ? ? I DG 61  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG -12 J DC 11  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog114 hydrog ? ? I DG 61  N2 ? ? ? 1_555 J DC 85  O2 ? ? I DG -12 J DC 12  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog115 hydrog ? ? I DG 62  N1 ? ? ? 1_555 J DC 84  N3 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog116 hydrog ? ? I DG 62  N2 ? ? ? 1_555 J DC 84  O2 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog117 hydrog ? ? I DG 62  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog118 hydrog ? ? I DG 63  N1 ? ? ? 1_555 J DC 83  N3 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog119 hydrog ? ? I DG 63  N2 ? ? ? 1_555 J DC 83  O2 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog120 hydrog ? ? I DG 63  O6 ? ? ? 1_555 J DC 83  N4 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog121 hydrog ? ? I DT 64  N3 ? ? ? 1_555 J DA 82  N1 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog122 hydrog ? ? I DT 64  O4 ? ? ? 1_555 J DA 82  N6 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog123 hydrog ? ? I DT 65  N3 ? ? ? 1_555 J DA 81  N1 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog124 hydrog ? ? I DT 65  O4 ? ? ? 1_555 J DA 81  N6 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog125 hydrog ? ? I DA 66  N1 ? ? ? 1_555 J DT 80  N3 ? ? I DA -7  J DT 7   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ?     ? 
hydrog126 hydrog ? ? I DG 67  N1 ? ? ? 1_555 J DC 79  N3 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog127 hydrog ? ? I DG 67  N2 ? ? ? 1_555 J DC 79  O2 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog128 hydrog ? ? I DG 67  O6 ? ? ? 1_555 J DC 79  N4 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog129 hydrog ? ? I DG 68  N1 ? ? ? 1_555 J DC 78  O2 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog130 hydrog ? ? I DG 69  N1 ? ? ? 1_555 J DA 76  N1 ? ? I DG -4  J DA 3   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog131 hydrog ? ? I DG 69  O6 ? ? ? 1_555 J DA 76  N6 ? ? I DG -4  J DA 3   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog132 hydrog ? ? I DG 69  N1 ? ? ? 1_555 J DC 77  N3 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog133 hydrog ? ? I DG 69  N2 ? ? ? 1_555 J DC 77  O2 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog134 hydrog ? ? I DG 69  O6 ? ? ? 1_555 J DC 77  N4 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog135 hydrog ? ? I DT 70  N3 ? ? ? 1_555 J DA 76  N1 ? ? I DT -3  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog136 hydrog ? ? I DT 70  O4 ? ? ? 1_555 J DA 76  N6 ? ? I DT -3  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog137 hydrog ? ? I DA 72  N1 ? ? ? 1_555 J DT 74  N3 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ?     ? 
hydrog138 hydrog ? ? I DG 73  O6 ? ? ? 1_555 J DC 72  N4 ? ? I DG 0   J DC -1  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog139 hydrog ? ? I DG 73  N2 ? ? ? 1_555 J DC 73  O2 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog140 hydrog ? ? I DG 74  N2 ? ? ? 1_555 J DC 72  N3 ? ? I DG 1   J DC -1  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog141 hydrog ? ? I DG 75  N1 ? ? ? 1_555 J DC 71  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog142 hydrog ? ? I DG 75  N2 ? ? ? 1_555 J DC 71  O2 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog143 hydrog ? ? I DG 75  O6 ? ? ? 1_555 J DC 71  N4 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog144 hydrog ? ? I DT 76  N3 ? ? ? 1_555 J DA 70  N1 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog145 hydrog ? ? I DT 76  O4 ? ? ? 1_555 J DA 70  N6 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog146 hydrog ? ? I DT 77  N3 ? ? ? 1_555 J DA 69  N1 ? ? I DT 4   J DA -4  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog147 hydrog ? ? I DT 77  O4 ? ? ? 1_555 J DA 69  N6 ? ? I DT 4   J DA -4  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog148 hydrog ? ? I DA 78  N1 ? ? ? 1_555 J DT 68  N3 ? ? I DA 5   J DT -5  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog149 hydrog ? ? I DA 78  N6 ? ? ? 1_555 J DT 68  O4 ? ? I DA 5   J DT -5  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog150 hydrog ? ? I DG 79  N1 ? ? ? 1_555 J DC 67  N3 ? ? I DG 6   J DC -6  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog151 hydrog ? ? I DG 79  N2 ? ? ? 1_555 J DC 67  O2 ? ? I DG 6   J DC -6  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog152 hydrog ? ? I DG 79  O6 ? ? ? 1_555 J DC 67  N4 ? ? I DG 6   J DC -6  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog153 hydrog ? ? I DG 80  N2 ? ? ? 1_555 J DC 66  N3 ? ? I DG 7   J DC -7  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog154 hydrog ? ? I DG 81  N1 ? ? ? 1_555 J DC 65  N3 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog155 hydrog ? ? I DG 81  N2 ? ? ? 1_555 J DC 65  O2 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog156 hydrog ? ? I DG 81  O6 ? ? ? 1_555 J DC 65  N4 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog157 hydrog ? ? I DT 82  N3 ? ? ? 1_555 J DA 64  N1 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog158 hydrog ? ? I DT 82  O4 ? ? ? 1_555 J DA 64  N6 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog159 hydrog ? ? I DA 84  N1 ? ? ? 1_555 J DT 62  N3 ? ? I DA 11  J DT -11 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog160 hydrog ? ? I DA 84  N6 ? ? ? 1_555 J DT 62  O4 ? ? I DA 11  J DT -11 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog161 hydrog ? ? I DG 85  O6 ? ? ? 1_555 J DC 60  N4 ? ? I DG 12  J DC -13 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog162 hydrog ? ? I DG 85  N2 ? ? ? 1_555 J DC 61  N3 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog163 hydrog ? ? I DG 86  O6 ? ? ? 1_555 J DC 59  N4 ? ? I DG 13  J DC -14 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog164 hydrog ? ? I DG 86  N2 ? ? ? 1_555 J DC 60  O2 ? ? I DG 13  J DC -13 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog165 hydrog ? ? I DG 87  N2 ? ? ? 1_555 J DA 58  N1 ? ? I DG 14  J DA -15 1_555 ? ? ? ? ? ? TYPE_10_PAIR            ?     ? 
hydrog166 hydrog ? ? I DG 87  N3 ? ? ? 1_555 J DA 58  N6 ? ? I DG 14  J DA -15 1_555 ? ? ? ? ? ? TYPE_10_PAIR            ?     ? 
hydrog167 hydrog ? ? I DT 89  N3 ? ? ? 1_555 J DA 57  N1 ? ? I DT 16  J DA -16 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog168 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 56  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog169 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 56  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog170 hydrog ? ? I DG 91  N1 ? ? ? 1_555 J DC 55  N3 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog171 hydrog ? ? I DG 91  N2 ? ? ? 1_555 J DC 55  O2 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog172 hydrog ? ? I DG 91  O6 ? ? ? 1_555 J DC 55  N4 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog173 hydrog ? ? I DG 92  N1 ? ? ? 1_555 J DC 54  N3 ? ? I DG 19  J DC -19 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog174 hydrog ? ? I DG 92  N2 ? ? ? 1_555 J DC 54  O2 ? ? I DG 19  J DC -19 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog175 hydrog ? ? I DG 92  O6 ? ? ? 1_555 J DC 54  N4 ? ? I DG 19  J DC -19 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog176 hydrog ? ? I DG 93  N1 ? ? ? 1_555 J DC 53  N3 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog177 hydrog ? ? I DG 93  N2 ? ? ? 1_555 J DC 53  O2 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog178 hydrog ? ? I DG 93  O6 ? ? ? 1_555 J DC 53  N4 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog179 hydrog ? ? I DT 95  N3 ? ? ? 1_555 J DA 51  N1 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog180 hydrog ? ? I DT 95  O4 ? ? ? 1_555 J DA 51  N6 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog181 hydrog ? ? I DA 96  N1 ? ? ? 1_555 J DT 50  N3 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog182 hydrog ? ? I DA 96  N6 ? ? ? 1_555 J DT 50  O4 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog183 hydrog ? ? I DG 97  O6 ? ? ? 1_555 J DC 48  N4 ? ? I DG 24  J DC -25 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog184 hydrog ? ? I DG 97  N2 ? ? ? 1_555 J DC 49  O2 ? ? I DG 24  J DC -24 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog185 hydrog ? ? I DG 98  N2 ? ? ? 1_555 J DC 48  O2 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog186 hydrog ? ? I DG 99  O6 ? ? ? 1_555 J DC 47  N4 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog187 hydrog ? ? I DT 100 N3 ? ? ? 1_555 J DA 46  N1 ? ? I DT 27  J DA -27 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog188 hydrog ? ? I DT 100 O4 ? ? ? 1_555 J DA 46  N6 ? ? I DT 27  J DA -27 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog189 hydrog ? ? I DT 101 N3 ? ? ? 1_555 J DA 45  N1 ? ? I DT 28  J DA -28 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog190 hydrog ? ? I DT 101 O4 ? ? ? 1_555 J DA 45  N6 ? ? I DT 28  J DA -28 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog191 hydrog ? ? I DA 102 N1 ? ? ? 1_555 J DT 44  N3 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ?     ? 
hydrog192 hydrog ? ? I DG 103 N1 ? ? ? 1_555 J DC 43  N3 ? ? I DG 30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog193 hydrog ? ? I DG 103 N2 ? ? ? 1_555 J DC 43  O2 ? ? I DG 30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog194 hydrog ? ? I DG 103 O6 ? ? ? 1_555 J DC 43  N4 ? ? I DG 30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog195 hydrog ? ? I DG 104 N1 ? ? ? 1_555 J DC 42  N3 ? ? I DG 31  J DC -31 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog196 hydrog ? ? I DG 104 N2 ? ? ? 1_555 J DC 42  O2 ? ? I DG 31  J DC -31 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog197 hydrog ? ? I DG 104 O6 ? ? ? 1_555 J DC 42  N4 ? ? I DG 31  J DC -31 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog198 hydrog ? ? I DG 105 N1 ? ? ? 1_555 J DA 40  N1 ? ? I DG 32  J DA -33 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog199 hydrog ? ? I DG 105 O6 ? ? ? 1_555 J DA 40  N6 ? ? I DG 32  J DA -33 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog200 hydrog ? ? I DT 106 N3 ? ? ? 1_555 J DA 40  N1 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog201 hydrog ? ? I DT 107 N3 ? ? ? 1_555 J DA 39  N1 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog202 hydrog ? ? I DT 107 O4 ? ? ? 1_555 J DA 39  N6 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog203 hydrog ? ? I DA 108 N1 ? ? ? 1_555 J DT 38  N3 ? ? I DA 35  J DT -35 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog204 hydrog ? ? I DA 108 N6 ? ? ? 1_555 J DT 38  O4 ? ? I DA 35  J DT -35 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog205 hydrog ? ? I DG 109 N1 ? ? ? 1_555 J DC 37  N3 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog206 hydrog ? ? I DG 109 N2 ? ? ? 1_555 J DC 37  O2 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog207 hydrog ? ? I DG 109 O6 ? ? ? 1_555 J DC 37  N4 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog208 hydrog ? ? I DG 110 N1 ? ? ? 1_555 J DC 36  N3 ? ? I DG 37  J DC -37 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog209 hydrog ? ? I DG 110 N2 ? ? ? 1_555 J DC 36  O2 ? ? I DG 37  J DC -37 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog210 hydrog ? ? I DG 110 O6 ? ? ? 1_555 J DC 36  N4 ? ? I DG 37  J DC -37 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog211 hydrog ? ? I DG 111 N1 ? ? ? 1_555 J DC 35  N3 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog212 hydrog ? ? I DG 111 N2 ? ? ? 1_555 J DC 35  O2 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog213 hydrog ? ? I DG 111 O6 ? ? ? 1_555 J DC 35  N4 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog214 hydrog ? ? I DT 112 N3 ? ? ? 1_555 J DA 34  N1 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog215 hydrog ? ? I DT 112 O4 ? ? ? 1_555 J DA 34  N6 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog216 hydrog ? ? I DT 113 N3 ? ? ? 1_555 J DA 33  N1 ? ? I DT 40  J DA -40 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog217 hydrog ? ? I DT 113 O4 ? ? ? 1_555 J DA 33  N6 ? ? I DT 40  J DA -40 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog218 hydrog ? ? I DA 114 N1 ? ? ? 1_555 J DT 32  N3 ? ? I DA 41  J DT -41 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ?     ? 
hydrog219 hydrog ? ? I DG 115 N1 ? ? ? 1_555 J DC 31  N3 ? ? I DG 42  J DC -42 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog220 hydrog ? ? I DG 115 N2 ? ? ? 1_555 J DC 31  O2 ? ? I DG 42  J DC -42 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog221 hydrog ? ? I DG 115 O6 ? ? ? 1_555 J DC 31  N4 ? ? I DG 42  J DC -42 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog222 hydrog ? ? I DG 116 N1 ? ? ? 1_555 J DC 30  N3 ? ? I DG 43  J DC -43 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog223 hydrog ? ? I DG 116 N2 ? ? ? 1_555 J DC 30  O2 ? ? I DG 43  J DC -43 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog224 hydrog ? ? I DG 116 O6 ? ? ? 1_555 J DC 30  N4 ? ? I DG 43  J DC -43 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog225 hydrog ? ? I DG 117 N1 ? ? ? 1_555 J DC 29  N3 ? ? I DG 44  J DC -44 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog226 hydrog ? ? I DG 117 N2 ? ? ? 1_555 J DC 29  O2 ? ? I DG 44  J DC -44 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog227 hydrog ? ? I DG 117 O6 ? ? ? 1_555 J DC 29  N4 ? ? I DG 44  J DC -44 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog228 hydrog ? ? I DT 118 N3 ? ? ? 1_555 J DA 28  N1 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog229 hydrog ? ? I DT 118 O4 ? ? ? 1_555 J DA 28  N6 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog230 hydrog ? ? I DT 119 N3 ? ? ? 1_555 J DA 27  N1 ? ? I DT 46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog231 hydrog ? ? I DT 119 O4 ? ? ? 1_555 J DA 27  N6 ? ? I DT 46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog232 hydrog ? ? I DA 120 N1 ? ? ? 1_555 J DT 26  N3 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog233 hydrog ? ? I DA 120 N6 ? ? ? 1_555 J DT 26  O4 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog234 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 25  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog235 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 25  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog236 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 25  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog237 hydrog ? ? I DG 122 N1 ? ? ? 1_555 J DC 24  N3 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog238 hydrog ? ? I DG 122 N2 ? ? ? 1_555 J DC 24  O2 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog239 hydrog ? ? I DG 122 O6 ? ? ? 1_555 J DC 24  N4 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog240 hydrog ? ? I DG 123 N1 ? ? ? 1_555 J DC 23  N3 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog241 hydrog ? ? I DT 124 O4 ? ? ? 1_555 J DA 21  N6 ? ? I DT 51  J DA -52 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog242 hydrog ? ? I DT 124 N3 ? ? ? 1_555 J DA 22  N1 ? ? I DT 51  J DA -51 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog243 hydrog ? ? I DT 125 N3 ? ? ? 1_555 J DA 21  N1 ? ? I DT 52  J DA -52 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog244 hydrog ? ? I DT 125 O4 ? ? ? 1_555 J DA 21  N6 ? ? I DT 52  J DA -52 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog245 hydrog ? ? I DA 126 N1 ? ? ? 1_555 J DT 20  N3 ? ? I DA 53  J DT -53 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog246 hydrog ? ? I DA 126 N6 ? ? ? 1_555 J DT 20  O4 ? ? I DA 53  J DT -53 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog247 hydrog ? ? I DG 127 N2 ? ? ? 1_555 J DC 19  O2 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog248 hydrog ? ? I DG 128 N2 ? ? ? 1_555 J DC 18  O2 ? ? I DG 55  J DC -55 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog249 hydrog ? ? I DG 129 N1 ? ? ? 1_555 J DC 17  N3 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog250 hydrog ? ? I DG 129 N2 ? ? ? 1_555 J DC 17  O2 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog251 hydrog ? ? I DG 129 O6 ? ? ? 1_555 J DC 17  N4 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog252 hydrog ? ? I DT 130 N3 ? ? ? 1_555 J DA 16  N1 ? ? I DT 57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog253 hydrog ? ? I DT 130 O4 ? ? ? 1_555 J DA 16  N6 ? ? I DT 57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog254 hydrog ? ? I DT 131 N3 ? ? ? 1_555 J DA 15  N1 ? ? I DT 58  J DA -58 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ?     ? 
hydrog255 hydrog ? ? I DA 132 N6 ? ? ? 1_555 J DC 13  N3 ? ? I DA 59  J DC -60 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR'         ?     ? 
hydrog256 hydrog ? ? I DA 132 N1 ? ? ? 1_555 J DT 14  N3 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ?     ? 
hydrog257 hydrog ? ? I DG 133 O6 ? ? ? 1_555 J DC 12  N4 ? ? I DG 60  J DC -61 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog258 hydrog ? ? I DG 133 N2 ? ? ? 1_555 J DC 13  O2 ? ? I DG 60  J DC -60 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     ? 
hydrog259 hydrog ? ? I DG 134 N1 ? ? ? 1_555 J DC 12  N3 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog260 hydrog ? ? I DG 134 N2 ? ? ? 1_555 J DC 12  O2 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog261 hydrog ? ? I DG 134 O6 ? ? ? 1_555 J DC 12  N4 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog262 hydrog ? ? I DG 135 N1 ? ? ? 1_555 J DA 10  N1 ? ? I DG 62  J DA -63 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog263 hydrog ? ? I DG 135 O6 ? ? ? 1_555 J DA 10  N6 ? ? I DG 62  J DA -63 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog264 hydrog ? ? I DT 136 N3 ? ? ? 1_555 J DA 10  N1 ? ? I DT 63  J DA -63 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog265 hydrog ? ? I DT 136 O4 ? ? ? 1_555 J DA 10  N6 ? ? I DT 63  J DA -63 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog266 hydrog ? ? I DT 137 N3 ? ? ? 1_555 J DA 9   N1 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog267 hydrog ? ? I DT 137 O4 ? ? ? 1_555 J DA 9   N6 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog268 hydrog ? ? I DA 138 N1 ? ? ? 1_555 J DT 8   N3 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog269 hydrog ? ? I DA 138 N6 ? ? ? 1_555 J DT 8   O4 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog270 hydrog ? ? I DG 139 N1 ? ? ? 1_555 J DC 7   N3 ? ? I DG 66  J DC -66 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog271 hydrog ? ? I DG 139 N2 ? ? ? 1_555 J DC 7   O2 ? ? I DG 66  J DC -66 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog272 hydrog ? ? I DG 139 O6 ? ? ? 1_555 J DC 7   N4 ? ? I DG 66  J DC -66 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog273 hydrog ? ? I DG 141 N1 ? ? ? 1_555 J DA 4   N1 ? ? I DG 68  J DA -69 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog274 hydrog ? ? I DG 141 O6 ? ? ? 1_555 J DA 4   N6 ? ? I DG 68  J DA -69 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog275 hydrog ? ? I DT 142 N3 ? ? ? 1_555 J DA 4   N1 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog276 hydrog ? ? I DT 142 O4 ? ? ? 1_555 J DA 4   N6 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog277 hydrog ? ? I DG 143 N1 ? ? ? 1_555 J DC 3   N3 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog278 hydrog ? ? I DG 143 N2 ? ? ? 1_555 J DC 3   O2 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog279 hydrog ? ? I DG 143 O6 ? ? ? 1_555 J DC 3   N4 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog280 hydrog ? ? I DA 144 N1 ? ? ? 1_555 J DT 2   N3 ? ? I DA 71  J DT -71 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog281 hydrog ? ? I DA 144 N6 ? ? ? 1_555 J DT 2   O4 ? ? I DA 71  J DT -71 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog282 hydrog ? ? I DT 145 N3 ? ? ? 1_555 J DA 1   N1 ? ? I DT 72  J DA -72 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog283 hydrog ? ? I DT 145 O4 ? ? ? 1_555 J DA 1   N6 ? ? I DT 72  J DA -72 1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 44 ? PHE A 45 ? ARG A 83  PHE A 84  
AA1 2 THR B 65 ? VAL B 66 ? THR B 80  VAL B 81  
AA2 1 THR A 79 ? ILE A 80 ? THR A 118 ILE A 119 
AA2 2 ARG B 30 ? ILE B 31 ? ARG B 45  ILE B 46  
AA3 1 THR B 81 ? TYR B 83 ? THR B 96  TYR B 98  
AA3 2 VAL G 87 ? ILE G 89 ? VAL G 100 ILE G 102 
AA4 1 ARG C 29 ? VAL C 30 ? ARG C 42  VAL C 43  
AA4 2 THR D 58 ? ILE D 59 ? THR D 85  ILE D 86  
AA5 1 ARG C 64 ? ILE C 65 ? ARG C 77  ILE C 78  
AA5 2 GLY D 23 ? ILE D 24 ? GLY D 50  ILE D 51  
AA6 1 VAL C 87 ? ILE C 89 ? VAL C 100 ILE C 102 
AA6 2 THR F 81 ? TYR F 83 ? THR F 96  TYR F 98  
AA7 1 ARG E 44 ? PHE E 45 ? ARG E 83  PHE E 84  
AA7 2 THR F 65 ? VAL F 66 ? THR F 80  VAL F 81  
AA8 1 THR E 79 ? ILE E 80 ? THR E 118 ILE E 119 
AA8 2 ARG F 30 ? ILE F 31 ? ARG F 45  ILE F 46  
AA9 1 ARG G 29 ? VAL G 30 ? ARG G 42  VAL G 43  
AA9 2 THR H 58 ? ILE H 59 ? THR H 85  ILE H 86  
AB1 1 ARG G 64 ? ILE G 65 ? ARG G 77  ILE G 78  
AB1 2 GLY H 23 ? ILE H 24 ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 44 ? N ARG A 83  O VAL B 66 ? O VAL B 81  
AA2 1 2 N ILE A 80 ? N ILE A 119 O ARG B 30 ? O ARG B 45  
AA3 1 2 N TYR B 83 ? N TYR B 98  O THR G 88 ? O THR G 101 
AA4 1 2 N ARG C 29 ? N ARG C 42  O ILE D 59 ? O ILE D 86  
AA5 1 2 N ILE C 65 ? N ILE C 78  O GLY D 23 ? O GLY D 50  
AA6 1 2 N THR C 88 ? N THR C 101 O TYR F 83 ? O TYR F 98  
AA7 1 2 N ARG E 44 ? N ARG E 83  O VAL F 66 ? O VAL F 81  
AA8 1 2 N ILE E 80 ? N ILE E 119 O ARG F 30 ? O ARG F 45  
AA9 1 2 N ARG G 29 ? N ARG G 42  O ILE H 59 ? O ILE H 86  
AB1 1 2 N ILE G 65 ? N ILE G 78  O GLY H 23 ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software I MN 101 ? 1 'binding site for residue MN I 101' 
AC2 Software I MN 102 ? 1 'binding site for residue MN I 102' 
AC3 Software I MN 103 ? 2 'binding site for residue MN I 103' 
AC4 Software I MN 104 ? 1 'binding site for residue MN I 104' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 1 DG I 111 ? DG I 38 . ? 1_555 ? 
2 AC2 1 DG I 69  ? DG I -4 . ? 1_555 ? 
3 AC3 2 DG I 122 ? DG I 49 . ? 1_555 ? 
4 AC3 2 DG I 123 ? DG I 50 . ? 1_555 ? 
5 AC4 1 DG I 80  ? DG I 7  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6KE9 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009422 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009148 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005651 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A 1 1   ? -5.916  33.887 -83.093 1.00 135.17 ? 40  ARG A N     1 
ATOM   2     C  CA    . ARG A 1 1   ? -4.836  33.125 -82.470 1.00 134.92 ? 40  ARG A CA    1 
ATOM   3     C  C     . ARG A 1 1   ? -3.685  34.043 -82.041 1.00 139.51 ? 40  ARG A C     1 
ATOM   4     O  O     . ARG A 1 1   ? -3.150  34.776 -82.877 1.00 139.53 ? 40  ARG A O     1 
ATOM   5     C  CB    . ARG A 1 1   ? -4.338  32.018 -83.425 1.00 134.48 ? 40  ARG A CB    1 
ATOM   6     C  CG    . ARG A 1 1   ? -2.970  31.428 -83.064 1.00 144.79 ? 40  ARG A CG    1 
ATOM   7     C  CD    . ARG A 1 1   ? -2.915  29.917 -83.199 1.00 152.39 ? 40  ARG A CD    1 
ATOM   8     N  NE    . ARG A 1 1   ? -3.297  29.235 -81.959 1.00 152.54 ? 40  ARG A NE    1 
ATOM   9     C  CZ    . ARG A 1 1   ? -3.259  27.918 -81.782 1.00 160.58 ? 40  ARG A CZ    1 
ATOM   10    N  NH1   . ARG A 1 1   ? -2.855  27.119 -82.763 1.00 153.13 ? 40  ARG A NH1   1 
ATOM   11    N  NH2   . ARG A 1 1   ? -3.633  27.388 -80.627 1.00 137.62 ? 40  ARG A NH2   1 
ATOM   12    N  N     . TYR A 1 2   ? -3.288  33.974 -80.749 1.00 135.71 ? 41  TYR A N     1 
ATOM   13    C  CA    . TYR A 1 2   ? -2.183  34.766 -80.194 1.00 135.29 ? 41  TYR A CA    1 
ATOM   14    C  C     . TYR A 1 2   ? -0.823  34.102 -80.441 1.00 139.28 ? 41  TYR A C     1 
ATOM   15    O  O     . TYR A 1 2   ? -0.728  32.867 -80.430 1.00 138.59 ? 41  TYR A O     1 
ATOM   16    C  CB    . TYR A 1 2   ? -2.367  35.009 -78.681 1.00 136.20 ? 41  TYR A CB    1 
ATOM   17    C  CG    . TYR A 1 2   ? -3.465  35.985 -78.323 1.00 137.61 ? 41  TYR A CG    1 
ATOM   18    C  CD1   . TYR A 1 2   ? -3.356  37.337 -78.643 1.00 139.61 ? 41  TYR A CD1   1 
ATOM   19    C  CD2   . TYR A 1 2   ? -4.580  35.575 -77.598 1.00 138.11 ? 41  TYR A CD2   1 
ATOM   20    C  CE1   . TYR A 1 2   ? -4.367  38.243 -78.309 1.00 140.00 ? 41  TYR A CE1   1 
ATOM   21    C  CE2   . TYR A 1 2   ? -5.595  36.470 -77.259 1.00 138.77 ? 41  TYR A CE2   1 
ATOM   22    C  CZ    . TYR A 1 2   ? -5.484  37.803 -77.615 1.00 144.57 ? 41  TYR A CZ    1 
ATOM   23    O  OH    . TYR A 1 2   ? -6.492  38.669 -77.270 1.00 143.66 ? 41  TYR A OH    1 
ATOM   24    N  N     . ARG A 1 3   ? 0.230   34.929 -80.649 1.00 135.57 ? 42  ARG A N     1 
ATOM   25    C  CA    . ARG A 1 3   ? 1.618   34.483 -80.872 1.00 134.96 ? 42  ARG A CA    1 
ATOM   26    C  C     . ARG A 1 3   ? 2.193   33.823 -79.603 1.00 136.49 ? 42  ARG A C     1 
ATOM   27    O  O     . ARG A 1 3   ? 1.794   34.212 -78.506 1.00 136.24 ? 42  ARG A O     1 
ATOM   28    C  CB    . ARG A 1 3   ? 2.518   35.652 -81.326 1.00 136.27 ? 42  ARG A CB    1 
ATOM   29    C  CG    . ARG A 1 3   ? 2.160   36.211 -82.707 1.00 150.40 ? 42  ARG A CG    1 
ATOM   30    C  CD    . ARG A 1 3   ? 3.071   37.357 -83.102 1.00 164.97 ? 42  ARG A CD    1 
ATOM   31    N  NE    . ARG A 1 3   ? 4.304   36.876 -83.729 1.00 177.71 ? 42  ARG A NE    1 
ATOM   32    C  CZ    . ARG A 1 3   ? 5.423   37.585 -83.840 1.00 195.26 ? 42  ARG A CZ    1 
ATOM   33    N  NH1   . ARG A 1 3   ? 5.486   38.820 -83.356 1.00 183.92 ? 42  ARG A NH1   1 
ATOM   34    N  NH2   . ARG A 1 3   ? 6.491   37.062 -84.426 1.00 184.03 ? 42  ARG A NH2   1 
ATOM   35    N  N     . PRO A 1 4   ? 3.108   32.827 -79.710 1.00 131.12 ? 43  PRO A N     1 
ATOM   36    C  CA    . PRO A 1 4   ? 3.626   32.171 -78.495 1.00 129.96 ? 43  PRO A CA    1 
ATOM   37    C  C     . PRO A 1 4   ? 4.437   33.102 -77.614 1.00 130.71 ? 43  PRO A C     1 
ATOM   38    O  O     . PRO A 1 4   ? 5.473   33.625 -78.035 1.00 130.33 ? 43  PRO A O     1 
ATOM   39    C  CB    . PRO A 1 4   ? 4.471   31.008 -79.030 1.00 131.99 ? 43  PRO A CB    1 
ATOM   40    C  CG    . PRO A 1 4   ? 4.061   30.842 -80.447 1.00 137.12 ? 43  PRO A CG    1 
ATOM   41    C  CD    . PRO A 1 4   ? 3.676   32.210 -80.921 1.00 132.80 ? 43  PRO A CD    1 
ATOM   42    N  N     . GLY A 1 5   ? 3.921   33.311 -76.405 1.00 124.75 ? 44  GLY A N     1 
ATOM   43    C  CA    . GLY A 1 5   ? 4.519   34.166 -75.391 1.00 123.36 ? 44  GLY A CA    1 
ATOM   44    C  C     . GLY A 1 5   ? 3.629   35.306 -74.957 1.00 125.20 ? 44  GLY A C     1 
ATOM   45    O  O     . GLY A 1 5   ? 3.867   35.895 -73.901 1.00 124.91 ? 44  GLY A O     1 
ATOM   46    N  N     . THR A 1 6   ? 2.606   35.638 -75.779 1.00 120.29 ? 45  THR A N     1 
ATOM   47    C  CA    . THR A 1 6   ? 1.660   36.740 -75.553 1.00 118.96 ? 45  THR A CA    1 
ATOM   48    C  C     . THR A 1 6   ? 0.724   36.480 -74.378 1.00 121.80 ? 45  THR A C     1 
ATOM   49    O  O     . THR A 1 6   ? 0.639   37.318 -73.476 1.00 120.89 ? 45  THR A O     1 
ATOM   50    C  CB    . THR A 1 6   ? 0.905   37.062 -76.838 1.00 121.10 ? 45  THR A CB    1 
ATOM   51    O  OG1   . THR A 1 6   ? 1.851   37.120 -77.907 1.00 116.62 ? 45  THR A OG1   1 
ATOM   52    C  CG2   . THR A 1 6   ? 0.095   38.353 -76.729 1.00 118.85 ? 45  THR A CG2   1 
ATOM   53    N  N     . VAL A 1 7   ? 0.013   35.325 -74.399 1.00 117.95 ? 46  VAL A N     1 
ATOM   54    C  CA    . VAL A 1 7   ? -0.896  34.894 -73.330 1.00 116.59 ? 46  VAL A CA    1 
ATOM   55    C  C     . VAL A 1 7   ? -0.036  34.691 -72.058 1.00 114.86 ? 46  VAL A C     1 
ATOM   56    O  O     . VAL A 1 7   ? -0.453  35.070 -70.963 1.00 112.15 ? 46  VAL A O     1 
ATOM   57    C  CB    . VAL A 1 7   ? -1.716  33.619 -73.728 1.00 121.00 ? 46  VAL A CB    1 
ATOM   58    C  CG1   . VAL A 1 7   ? -2.639  33.169 -72.603 1.00 120.88 ? 46  VAL A CG1   1 
ATOM   59    C  CG2   . VAL A 1 7   ? -2.521  33.839 -75.007 1.00 120.68 ? 46  VAL A CG2   1 
ATOM   60    N  N     . ALA A 1 8   ? 1.195   34.160 -72.245 1.00 109.87 ? 47  ALA A N     1 
ATOM   61    C  CA    . ALA A 1 8   ? 2.181   33.917 -71.195 1.00 108.93 ? 47  ALA A CA    1 
ATOM   62    C  C     . ALA A 1 8   ? 2.537   35.209 -70.459 1.00 108.48 ? 47  ALA A C     1 
ATOM   63    O  O     . ALA A 1 8   ? 2.423   35.246 -69.235 1.00 107.51 ? 47  ALA A O     1 
ATOM   64    C  CB    . ALA A 1 8   ? 3.426   33.256 -71.778 1.00 109.94 ? 47  ALA A CB    1 
ATOM   65    N  N     . LEU A 1 9   ? 2.902   36.275 -71.198 1.00 103.41 ? 48  LEU A N     1 
ATOM   66    C  CA    . LEU A 1 9   ? 3.237   37.584 -70.616 1.00 102.22 ? 48  LEU A CA    1 
ATOM   67    C  C     . LEU A 1 9   ? 2.038   38.214 -69.911 1.00 103.42 ? 48  LEU A C     1 
ATOM   68    O  O     . LEU A 1 9   ? 2.193   38.768 -68.829 1.00 102.91 ? 48  LEU A O     1 
ATOM   69    C  CB    . LEU A 1 9   ? 3.818   38.543 -71.661 1.00 102.19 ? 48  LEU A CB    1 
ATOM   70    C  CG    . LEU A 1 9   ? 5.300   38.350 -71.962 1.00 107.40 ? 48  LEU A CG    1 
ATOM   71    C  CD1   . LEU A 1 9   ? 5.637   38.787 -73.365 1.00 108.25 ? 48  LEU A CD1   1 
ATOM   72    C  CD2   . LEU A 1 9   ? 6.171   39.094 -70.954 1.00 109.33 ? 48  LEU A CD2   1 
ATOM   73    N  N     . ARG A 1 10  ? 0.839   38.059 -70.500 1.00 98.69  ? 49  ARG A N     1 
ATOM   74    C  CA    . ARG A 1 10  ? -0.449  38.505 -69.971 1.00 98.04  ? 49  ARG A CA    1 
ATOM   75    C  C     . ARG A 1 10  ? -0.727  37.801 -68.626 1.00 99.89  ? 49  ARG A C     1 
ATOM   76    O  O     . ARG A 1 10  ? -1.156  38.457 -67.676 1.00 99.84  ? 49  ARG A O     1 
ATOM   77    C  CB    . ARG A 1 10  ? -1.560  38.183 -70.991 1.00 98.69  ? 49  ARG A CB    1 
ATOM   78    C  CG    . ARG A 1 10  ? -2.859  38.953 -70.779 1.00 113.53 ? 49  ARG A CG    1 
ATOM   79    C  CD    . ARG A 1 10  ? -3.671  39.047 -72.064 1.00 127.21 ? 49  ARG A CD    1 
ATOM   80    N  NE    . ARG A 1 10  ? -4.273  37.767 -72.443 1.00 135.76 ? 49  ARG A NE    1 
ATOM   81    C  CZ    . ARG A 1 10  ? -4.366  37.327 -73.693 1.00 145.22 ? 49  ARG A CZ    1 
ATOM   82    N  NH1   . ARG A 1 10  ? -3.894  38.057 -74.698 1.00 133.71 ? 49  ARG A NH1   1 
ATOM   83    N  NH2   . ARG A 1 10  ? -4.932  36.153 -73.948 1.00 122.98 ? 49  ARG A NH2   1 
ATOM   84    N  N     . GLU A 1 11  ? -0.455  36.471 -68.554 1.00 94.63  ? 50  GLU A N     1 
ATOM   85    C  CA    . GLU A 1 11  ? -0.636  35.631 -67.364 1.00 92.25  ? 50  GLU A CA    1 
ATOM   86    C  C     . GLU A 1 11  ? 0.239   36.123 -66.197 1.00 91.21  ? 50  GLU A C     1 
ATOM   87    O  O     . GLU A 1 11  ? -0.257  36.211 -65.073 1.00 90.40  ? 50  GLU A O     1 
ATOM   88    C  CB    . GLU A 1 11  ? -0.407  34.134 -67.680 1.00 93.07  ? 50  GLU A CB    1 
ATOM   89    C  CG    . GLU A 1 11  ? -1.607  33.433 -68.310 1.00 103.04 ? 50  GLU A CG    1 
ATOM   90    C  CD    . GLU A 1 11  ? -1.489  31.985 -68.788 1.00 126.84 ? 50  GLU A CD    1 
ATOM   91    O  OE1   . GLU A 1 11  ? -2.472  31.500 -69.398 1.00 106.15 ? 50  GLU A OE1   1 
ATOM   92    O  OE2   . GLU A 1 11  ? -0.448  31.328 -68.534 1.00 119.42 ? 50  GLU A OE2   1 
ATOM   93    N  N     . ILE A 1 12  ? 1.518   36.484 -66.476 1.00 83.62  ? 51  ILE A N     1 
ATOM   94    C  CA    . ILE A 1 12  ? 2.467   37.010 -65.490 1.00 81.65  ? 51  ILE A CA    1 
ATOM   95    C  C     . ILE A 1 12  ? 1.861   38.274 -64.864 1.00 84.65  ? 51  ILE A C     1 
ATOM   96    O  O     . ILE A 1 12  ? 1.755   38.367 -63.649 1.00 83.76  ? 51  ILE A O     1 
ATOM   97    C  CB    . ILE A 1 12  ? 3.854   37.289 -66.135 1.00 84.05  ? 51  ILE A CB    1 
ATOM   98    C  CG1   . ILE A 1 12  ? 4.544   35.994 -66.542 1.00 84.14  ? 51  ILE A CG1   1 
ATOM   99    C  CG2   . ILE A 1 12  ? 4.753   38.100 -65.204 1.00 84.58  ? 51  ILE A CG2   1 
ATOM   100   C  CD1   . ILE A 1 12  ? 5.491   36.135 -67.695 1.00 93.22  ? 51  ILE A CD1   1 
ATOM   101   N  N     . ARG A 1 13  ? 1.389   39.199 -65.704 1.00 81.19  ? 52  ARG A N     1 
ATOM   102   C  CA    . ARG A 1 13  ? 0.766   40.451 -65.264 1.00 80.72  ? 52  ARG A CA    1 
ATOM   103   C  C     . ARG A 1 13  ? -0.479  40.197 -64.405 1.00 84.76  ? 52  ARG A C     1 
ATOM   104   O  O     . ARG A 1 13  ? -0.685  40.913 -63.420 1.00 87.33  ? 52  ARG A O     1 
ATOM   105   C  CB    . ARG A 1 13  ? 0.421   41.354 -66.455 1.00 76.97  ? 52  ARG A CB    1 
ATOM   106   C  CG    . ARG A 1 13  ? 1.611   41.674 -67.355 1.00 82.89  ? 52  ARG A CG    1 
ATOM   107   C  CD    . ARG A 1 13  ? 1.442   42.979 -68.126 1.00 93.31  ? 52  ARG A CD    1 
ATOM   108   N  NE    . ARG A 1 13  ? 2.465   43.090 -69.165 1.00 99.39  ? 52  ARG A NE    1 
ATOM   109   C  CZ    . ARG A 1 13  ? 2.288   42.755 -70.437 1.00 120.97 ? 52  ARG A CZ    1 
ATOM   110   N  NH1   . ARG A 1 13  ? 1.139   42.218 -70.840 1.00 104.12 ? 52  ARG A NH1   1 
ATOM   111   N  NH2   . ARG A 1 13  ? 3.284   42.876 -71.303 1.00 116.63 ? 52  ARG A NH2   1 
ATOM   112   N  N     . ARG A 1 14  ? -1.280  39.159 -64.764 1.00 76.80  ? 53  ARG A N     1 
ATOM   113   C  CA    . ARG A 1 14  ? -2.519  38.783 -64.082 1.00 74.02  ? 53  ARG A CA    1 
ATOM   114   C  C     . ARG A 1 14  ? -2.272  38.346 -62.666 1.00 79.14  ? 53  ARG A C     1 
ATOM   115   O  O     . ARG A 1 14  ? -2.812  38.932 -61.732 1.00 80.02  ? 53  ARG A O     1 
ATOM   116   C  CB    . ARG A 1 14  ? -3.251  37.685 -64.861 1.00 64.98  ? 53  ARG A CB    1 
ATOM   117   C  CG    . ARG A 1 14  ? -4.373  36.994 -64.086 1.00 64.96  ? 53  ARG A CG    1 
ATOM   118   C  CD    . ARG A 1 14  ? -5.173  36.132 -65.035 1.00 82.03  ? 53  ARG A CD    1 
ATOM   119   N  NE    . ARG A 1 14  ? -6.058  35.208 -64.335 1.00 96.55  ? 53  ARG A NE    1 
ATOM   120   C  CZ    . ARG A 1 14  ? -6.917  34.401 -64.942 1.00 116.61 ? 53  ARG A CZ    1 
ATOM   121   N  NH1   . ARG A 1 14  ? -7.028  34.410 -66.266 1.00 106.12 ? 53  ARG A NH1   1 
ATOM   122   N  NH2   . ARG A 1 14  ? -7.679  33.582 -64.232 1.00 112.23 ? 53  ARG A NH2   1 
ATOM   123   N  N     . TYR A 1 15  ? -1.463  37.301 -62.522 1.00 75.97  ? 54  TYR A N     1 
ATOM   124   C  CA    . TYR A 1 15  ? -1.161  36.673 -61.260 1.00 74.77  ? 54  TYR A CA    1 
ATOM   125   C  C     . TYR A 1 15  ? -0.211  37.500 -60.419 1.00 77.17  ? 54  TYR A C     1 
ATOM   126   O  O     . TYR A 1 15  ? -0.351  37.466 -59.199 1.00 76.61  ? 54  TYR A O     1 
ATOM   127   C  CB    . TYR A 1 15  ? -0.687  35.234 -61.490 1.00 75.55  ? 54  TYR A CB    1 
ATOM   128   C  CG    . TYR A 1 15  ? -1.779  34.364 -62.086 1.00 76.82  ? 54  TYR A CG    1 
ATOM   129   C  CD1   . TYR A 1 15  ? -2.912  34.032 -61.349 1.00 79.04  ? 54  TYR A CD1   1 
ATOM   130   C  CD2   . TYR A 1 15  ? -1.702  33.909 -63.398 1.00 76.85  ? 54  TYR A CD2   1 
ATOM   131   C  CE1   . TYR A 1 15  ? -3.940  33.264 -61.900 1.00 79.50  ? 54  TYR A CE1   1 
ATOM   132   C  CE2   . TYR A 1 15  ? -2.730  33.154 -63.967 1.00 77.36  ? 54  TYR A CE2   1 
ATOM   133   C  CZ    . TYR A 1 15  ? -3.846  32.821 -63.210 1.00 83.82  ? 54  TYR A CZ    1 
ATOM   134   O  OH    . TYR A 1 15  ? -4.839  32.023 -63.748 1.00 81.18  ? 54  TYR A OH    1 
ATOM   135   N  N     . GLN A 1 16  ? 0.671   38.330 -61.047 1.00 72.80  ? 55  GLN A N     1 
ATOM   136   C  CA    . GLN A 1 16  ? 1.595   39.195 -60.289 1.00 71.29  ? 55  GLN A CA    1 
ATOM   137   C  C     . GLN A 1 16  ? 0.848   40.289 -59.560 1.00 77.96  ? 55  GLN A C     1 
ATOM   138   O  O     . GLN A 1 16  ? 1.194   40.606 -58.420 1.00 80.28  ? 55  GLN A O     1 
ATOM   139   C  CB    . GLN A 1 16  ? 2.725   39.764 -61.152 1.00 70.96  ? 55  GLN A CB    1 
ATOM   140   C  CG    . GLN A 1 16  ? 3.848   38.769 -61.298 1.00 66.97  ? 55  GLN A CG    1 
ATOM   141   C  CD    . GLN A 1 16  ? 5.155   39.290 -61.795 1.00 76.17  ? 55  GLN A CD    1 
ATOM   142   O  OE1   . GLN A 1 16  ? 5.246   40.328 -62.451 1.00 71.49  ? 55  GLN A OE1   1 
ATOM   143   N  NE2   . GLN A 1 16  ? 6.205   38.537 -61.500 1.00 69.06  ? 55  GLN A NE2   1 
ATOM   144   N  N     . LYS A 1 17  ? -0.247  40.773 -60.188 1.00 72.84  ? 56  LYS A N     1 
ATOM   145   C  CA    . LYS A 1 17  ? -1.127  41.818 -59.694 1.00 72.71  ? 56  LYS A CA    1 
ATOM   146   C  C     . LYS A 1 17  ? -2.082  41.372 -58.558 1.00 75.00  ? 56  LYS A C     1 
ATOM   147   O  O     . LYS A 1 17  ? -2.677  42.226 -57.909 1.00 77.81  ? 56  LYS A O     1 
ATOM   148   C  CB    . LYS A 1 17  ? -1.902  42.429 -60.878 1.00 75.59  ? 56  LYS A CB    1 
ATOM   149   C  CG    . LYS A 1 17  ? -1.884  43.927 -60.931 1.00 106.09 ? 56  LYS A CG    1 
ATOM   150   C  CD    . LYS A 1 17  ? -0.603  44.543 -61.539 1.00 122.17 ? 56  LYS A CD    1 
ATOM   151   C  CE    . LYS A 1 17  ? -0.662  46.069 -61.528 1.00 115.47 ? 56  LYS A CE    1 
ATOM   152   N  NZ    . LYS A 1 17  ? 0.618   46.693 -61.961 1.00 114.98 ? 56  LYS A NZ    1 
ATOM   153   N  N     . SER A 1 18  ? -2.227  40.066 -58.322 1.00 68.97  ? 57  SER A N     1 
ATOM   154   C  CA    . SER A 1 18  ? -3.104  39.495 -57.288 1.00 66.19  ? 57  SER A CA    1 
ATOM   155   C  C     . SER A 1 18  ? -2.377  38.723 -56.158 1.00 67.63  ? 57  SER A C     1 
ATOM   156   O  O     . SER A 1 18  ? -1.125  38.629 -56.096 1.00 64.75  ? 57  SER A O     1 
ATOM   157   C  CB    . SER A 1 18  ? -4.182  38.625 -57.910 1.00 64.86  ? 57  SER A CB    1 
ATOM   158   O  OG    . SER A 1 18  ? -3.512  37.730 -58.774 1.00 75.64  ? 57  SER A OG    1 
ATOM   159   N  N     . THR A 1 19  ? -3.217  38.243 -55.216 1.00 63.69  ? 58  THR A N     1 
ATOM   160   C  CA    . THR A 1 19  ? -2.818  37.602 -53.971 1.00 63.00  ? 58  THR A CA    1 
ATOM   161   C  C     . THR A 1 19  ? -3.463  36.233 -53.739 1.00 68.11  ? 58  THR A C     1 
ATOM   162   O  O     . THR A 1 19  ? -2.928  35.435 -52.945 1.00 68.93  ? 58  THR A O     1 
ATOM   163   C  CB    . THR A 1 19  ? -3.105  38.531 -52.786 1.00 64.53  ? 58  THR A CB    1 
ATOM   164   O  OG1   . THR A 1 19  ? -4.462  38.369 -52.371 1.00 64.47  ? 58  THR A OG1   1 
ATOM   165   C  CG2   . THR A 1 19  ? -2.802  39.986 -53.077 1.00 55.96  ? 58  THR A CG2   1 
ATOM   166   N  N     . GLU A 1 20  ? -4.606  35.960 -54.424 1.00 62.64  ? 59  GLU A N     1 
ATOM   167   C  CA    . GLU A 1 20  ? -5.347  34.696 -54.300 1.00 60.64  ? 59  GLU A CA    1 
ATOM   168   C  C     . GLU A 1 20  ? -4.449  33.512 -54.386 1.00 62.38  ? 59  GLU A C     1 
ATOM   169   O  O     . GLU A 1 20  ? -3.447  33.555 -55.115 1.00 63.58  ? 59  GLU A O     1 
ATOM   170   C  CB    . GLU A 1 20  ? -6.510  34.551 -55.306 1.00 61.74  ? 59  GLU A CB    1 
ATOM   171   C  CG    . GLU A 1 20  ? -6.494  35.512 -56.484 1.00 83.33  ? 59  GLU A CG    1 
ATOM   172   C  CD    . GLU A 1 20  ? -5.840  35.041 -57.766 1.00 107.70 ? 59  GLU A CD    1 
ATOM   173   O  OE1   . GLU A 1 20  ? -6.269  35.493 -58.855 1.00 116.56 ? 59  GLU A OE1   1 
ATOM   174   O  OE2   . GLU A 1 20  ? -4.883  34.243 -57.683 1.00 96.54  ? 59  GLU A OE2   1 
ATOM   175   N  N     . LEU A 1 21  ? -4.788  32.444 -53.645 1.00 54.62  ? 60  LEU A N     1 
ATOM   176   C  CA    . LEU A 1 21  ? -3.966  31.233 -53.721 1.00 51.82  ? 60  LEU A CA    1 
ATOM   177   C  C     . LEU A 1 21  ? -4.158  30.577 -55.094 1.00 56.18  ? 60  LEU A C     1 
ATOM   178   O  O     . LEU A 1 21  ? -5.210  30.761 -55.737 1.00 56.74  ? 60  LEU A O     1 
ATOM   179   C  CB    . LEU A 1 21  ? -4.141  30.289 -52.522 1.00 49.88  ? 60  LEU A CB    1 
ATOM   180   C  CG    . LEU A 1 21  ? -3.605  30.822 -51.184 1.00 51.33  ? 60  LEU A CG    1 
ATOM   181   C  CD1   . LEU A 1 21  ? -4.207  30.105 -50.029 1.00 50.72  ? 60  LEU A CD1   1 
ATOM   182   C  CD2   . LEU A 1 21  ? -2.090  30.797 -51.122 1.00 51.21  ? 60  LEU A CD2   1 
ATOM   183   N  N     . LEU A 1 22  ? -3.076  29.964 -55.594 1.00 50.08  ? 61  LEU A N     1 
ATOM   184   C  CA    . LEU A 1 22  ? -2.996  29.426 -56.939 1.00 49.01  ? 61  LEU A CA    1 
ATOM   185   C  C     . LEU A 1 22  ? -3.147  27.905 -57.039 1.00 51.07  ? 61  LEU A C     1 
ATOM   186   O  O     . LEU A 1 22  ? -3.440  27.412 -58.125 1.00 49.85  ? 61  LEU A O     1 
ATOM   187   C  CB    . LEU A 1 22  ? -1.706  29.902 -57.619 1.00 48.71  ? 61  LEU A CB    1 
ATOM   188   C  CG    . LEU A 1 22  ? -1.477  31.400 -57.679 1.00 51.36  ? 61  LEU A CG    1 
ATOM   189   C  CD1   . LEU A 1 22  ? -0.117  31.695 -58.203 1.00 51.15  ? 61  LEU A CD1   1 
ATOM   190   C  CD2   . LEU A 1 22  ? -2.488  32.072 -58.544 1.00 53.74  ? 61  LEU A CD2   1 
ATOM   191   N  N     . ILE A 1 23  ? -2.973  27.181 -55.922 1.00 47.72  ? 62  ILE A N     1 
ATOM   192   C  CA    . ILE A 1 23  ? -3.179  25.731 -55.824 1.00 47.05  ? 62  ILE A CA    1 
ATOM   193   C  C     . ILE A 1 23  ? -4.632  25.577 -55.317 1.00 56.34  ? 62  ILE A C     1 
ATOM   194   O  O     . ILE A 1 23  ? -5.102  26.437 -54.573 1.00 59.39  ? 62  ILE A O     1 
ATOM   195   C  CB    . ILE A 1 23  ? -2.142  25.111 -54.836 1.00 48.37  ? 62  ILE A CB    1 
ATOM   196   C  CG1   . ILE A 1 23  ? -0.695  25.282 -55.350 1.00 47.27  ? 62  ILE A CG1   1 
ATOM   197   C  CG2   . ILE A 1 23  ? -2.456  23.615 -54.504 1.00 48.59  ? 62  ILE A CG2   1 
ATOM   198   C  CD1   . ILE A 1 23  ? 0.452   24.832 -54.334 1.00 40.72  ? 62  ILE A CD1   1 
ATOM   199   N  N     . ARG A 1 24  ? -5.350  24.535 -55.719 1.00 56.31  ? 63  ARG A N     1 
ATOM   200   C  CA    . ARG A 1 24  ? -6.705  24.371 -55.197 1.00 58.21  ? 63  ARG A CA    1 
ATOM   201   C  C     . ARG A 1 24  ? -6.673  23.862 -53.766 1.00 66.67  ? 63  ARG A C     1 
ATOM   202   O  O     . ARG A 1 24  ? -5.830  23.034 -53.432 1.00 66.67  ? 63  ARG A O     1 
ATOM   203   C  CB    . ARG A 1 24  ? -7.603  23.538 -56.113 1.00 57.52  ? 63  ARG A CB    1 
ATOM   204   C  CG    . ARG A 1 24  ? -8.243  24.354 -57.260 1.00 80.87  ? 63  ARG A CG    1 
ATOM   205   C  CD    . ARG A 1 24  ? -7.391  24.358 -58.530 1.00 98.25  ? 63  ARG A CD    1 
ATOM   206   N  NE    . ARG A 1 24  ? -7.159  23.004 -59.062 1.00 98.96  ? 63  ARG A NE    1 
ATOM   207   C  CZ    . ARG A 1 24  ? -6.031  22.297 -58.927 1.00 106.92 ? 63  ARG A CZ    1 
ATOM   208   N  NH1   . ARG A 1 24  ? -4.973  22.822 -58.298 1.00 54.39  ? 63  ARG A NH1   1 
ATOM   209   N  NH2   . ARG A 1 24  ? -5.959  21.052 -59.404 1.00 100.96 ? 63  ARG A NH2   1 
ATOM   210   N  N     . LYS A 1 25  ? -7.532  24.436 -52.909 1.00 66.11  ? 64  LYS A N     1 
ATOM   211   C  CA    . LYS A 1 25  ? -7.602  24.220 -51.460 1.00 66.89  ? 64  LYS A CA    1 
ATOM   212   C  C     . LYS A 1 25  ? -7.814  22.756 -51.034 1.00 72.59  ? 64  LYS A C     1 
ATOM   213   O  O     . LYS A 1 25  ? -7.057  22.285 -50.188 1.00 75.83  ? 64  LYS A O     1 
ATOM   214   C  CB    . LYS A 1 25  ? -8.648  25.158 -50.812 1.00 68.84  ? 64  LYS A CB    1 
ATOM   215   C  CG    . LYS A 1 25  ? -8.200  26.627 -50.818 1.00 89.53  ? 64  LYS A CG    1 
ATOM   216   C  CD    . LYS A 1 25  ? -9.127  27.500 -50.005 1.00 102.26 ? 64  LYS A CD    1 
ATOM   217   C  CE    . LYS A 1 25  ? -8.863  28.968 -50.195 1.00 105.37 ? 64  LYS A CE    1 
ATOM   218   N  NZ    . LYS A 1 25  ? -9.572  29.794 -49.175 1.00 107.06 ? 64  LYS A NZ    1 
ATOM   219   N  N     . LEU A 1 26  ? -8.791  22.038 -51.601 1.00 66.57  ? 65  LEU A N     1 
ATOM   220   C  CA    . LEU A 1 26  ? -9.014  20.638 -51.225 1.00 65.04  ? 65  LEU A CA    1 
ATOM   221   C  C     . LEU A 1 26  ? -7.842  19.701 -51.682 1.00 65.99  ? 65  LEU A C     1 
ATOM   222   O  O     . LEU A 1 26  ? -7.321  18.981 -50.812 1.00 63.10  ? 65  LEU A O     1 
ATOM   223   C  CB    . LEU A 1 26  ? -10.402 20.095 -51.649 1.00 65.20  ? 65  LEU A CB    1 
ATOM   224   C  CG    . LEU A 1 26  ? -10.735 18.650 -51.180 1.00 71.08  ? 65  LEU A CG    1 
ATOM   225   C  CD1   . LEU A 1 26  ? -10.796 18.535 -49.648 1.00 70.64  ? 65  LEU A CD1   1 
ATOM   226   C  CD2   . LEU A 1 26  ? -12.022 18.145 -51.813 1.00 76.21  ? 65  LEU A CD2   1 
ATOM   227   N  N     . PRO A 1 27  ? -7.361  19.732 -52.966 1.00 60.80  ? 66  PRO A N     1 
ATOM   228   C  CA    . PRO A 1 27  ? -6.194  18.916 -53.330 1.00 60.33  ? 66  PRO A CA    1 
ATOM   229   C  C     . PRO A 1 27  ? -4.981  19.124 -52.397 1.00 63.68  ? 66  PRO A C     1 
ATOM   230   O  O     . PRO A 1 27  ? -4.306  18.146 -52.035 1.00 69.55  ? 66  PRO A O     1 
ATOM   231   C  CB    . PRO A 1 27  ? -5.873  19.401 -54.749 1.00 61.63  ? 66  PRO A CB    1 
ATOM   232   C  CG    . PRO A 1 27  ? -7.138  19.827 -55.282 1.00 65.28  ? 66  PRO A CG    1 
ATOM   233   C  CD    . PRO A 1 27  ? -7.822  20.500 -54.138 1.00 60.82  ? 66  PRO A CD    1 
ATOM   234   N  N     . PHE A 1 28  ? -4.722  20.378 -52.000 1.00 53.21  ? 67  PHE A N     1 
ATOM   235   C  CA    . PHE A 1 28  ? -3.656  20.788 -51.093 1.00 49.21  ? 67  PHE A CA    1 
ATOM   236   C  C     . PHE A 1 28  ? -3.899  20.250 -49.669 1.00 55.21  ? 67  PHE A C     1 
ATOM   237   O  O     . PHE A 1 28  ? -2.990  19.637 -49.106 1.00 55.33  ? 67  PHE A O     1 
ATOM   238   C  CB    . PHE A 1 28  ? -3.412  22.307 -51.142 1.00 47.56  ? 67  PHE A CB    1 
ATOM   239   C  CG    . PHE A 1 28  ? -2.193  22.685 -50.323 1.00 46.85  ? 67  PHE A CG    1 
ATOM   240   C  CD1   . PHE A 1 28  ? -2.303  22.969 -48.962 1.00 46.83  ? 67  PHE A CD1   1 
ATOM   241   C  CD2   . PHE A 1 28  ? -0.934  22.714 -50.894 1.00 46.73  ? 67  PHE A CD2   1 
ATOM   242   C  CE1   . PHE A 1 28  ? -1.176  23.237 -48.192 1.00 44.99  ? 67  PHE A CE1   1 
ATOM   243   C  CE2   . PHE A 1 28  ? 0.187   23.017 -50.122 1.00 47.21  ? 67  PHE A CE2   1 
ATOM   244   C  CZ    . PHE A 1 28  ? 0.057   23.251 -48.775 1.00 44.10  ? 67  PHE A CZ    1 
ATOM   245   N  N     . GLN A 1 29  ? -5.119  20.413 -49.115 1.00 52.72  ? 68  GLN A N     1 
ATOM   246   C  CA    . GLN A 1 29  ? -5.458  19.856 -47.804 1.00 53.79  ? 68  GLN A CA    1 
ATOM   247   C  C     . GLN A 1 29  ? -5.228  18.326 -47.761 1.00 60.11  ? 68  GLN A C     1 
ATOM   248   O  O     . GLN A 1 29  ? -4.774  17.790 -46.744 1.00 62.72  ? 68  GLN A O     1 
ATOM   249   C  CB    . GLN A 1 29  ? -6.900  20.192 -47.410 1.00 55.41  ? 68  GLN A CB    1 
ATOM   250   C  CG    . GLN A 1 29  ? -7.210  19.828 -45.954 1.00 77.37  ? 68  GLN A CG    1 
ATOM   251   C  CD    . GLN A 1 29  ? -8.584  20.241 -45.517 1.00 106.01 ? 68  GLN A CD    1 
ATOM   252   O  OE1   . GLN A 1 29  ? -9.585  19.584 -45.838 1.00 108.92 ? 68  GLN A OE1   1 
ATOM   253   N  NE2   . GLN A 1 29  ? -8.659  21.329 -44.751 1.00 85.68  ? 68  GLN A NE2   1 
ATOM   254   N  N     . ARG A 1 30  ? -5.501  17.629 -48.874 1.00 55.05  ? 69  ARG A N     1 
ATOM   255   C  CA    . ARG A 1 30  ? -5.302  16.174 -48.964 1.00 52.14  ? 69  ARG A CA    1 
ATOM   256   C  C     . ARG A 1 30  ? -3.826  15.819 -48.868 1.00 50.85  ? 69  ARG A C     1 
ATOM   257   O  O     . ARG A 1 30  ? -3.473  14.890 -48.141 1.00 50.38  ? 69  ARG A O     1 
ATOM   258   C  CB    . ARG A 1 30  ? -5.912  15.617 -50.250 1.00 49.31  ? 69  ARG A CB    1 
ATOM   259   C  CG    . ARG A 1 30  ? -7.366  15.332 -50.096 1.00 53.49  ? 69  ARG A CG    1 
ATOM   260   C  CD    . ARG A 1 30  ? -7.834  14.376 -51.169 1.00 57.11  ? 69  ARG A CD    1 
ATOM   261   N  NE    . ARG A 1 30  ? -8.708  15.030 -52.138 1.00 63.45  ? 69  ARG A NE    1 
ATOM   262   C  CZ    . ARG A 1 30  ? -8.315  15.510 -53.315 1.00 66.93  ? 69  ARG A CZ    1 
ATOM   263   N  NH1   . ARG A 1 30  ? -7.034  15.449 -53.673 1.00 45.73  ? 69  ARG A NH1   1 
ATOM   264   N  NH2   . ARG A 1 30  ? -9.181  16.089 -54.119 1.00 49.83  ? 69  ARG A NH2   1 
ATOM   265   N  N     . LEU A 1 31  ? -2.967  16.571 -49.591 1.00 42.35  ? 70  LEU A N     1 
ATOM   266   C  CA    . LEU A 1 31  ? -1.518  16.387 -49.617 1.00 40.75  ? 70  LEU A CA    1 
ATOM   267   C  C     . LEU A 1 31  ? -0.937  16.525 -48.222 1.00 45.08  ? 70  LEU A C     1 
ATOM   268   O  O     . LEU A 1 31  ? -0.080  15.748 -47.851 1.00 44.75  ? 70  LEU A O     1 
ATOM   269   C  CB    . LEU A 1 31  ? -0.862  17.399 -50.591 1.00 40.40  ? 70  LEU A CB    1 
ATOM   270   C  CG    . LEU A 1 31  ? 0.648   17.255 -50.850 1.00 43.07  ? 70  LEU A CG    1 
ATOM   271   C  CD1   . LEU A 1 31  ? 1.005   15.876 -51.286 1.00 41.54  ? 70  LEU A CD1   1 
ATOM   272   C  CD2   . LEU A 1 31  ? 1.065   18.151 -51.939 1.00 42.73  ? 70  LEU A CD2   1 
ATOM   273   N  N     . VAL A 1 32  ? -1.441  17.506 -47.451 1.00 44.26  ? 71  VAL A N     1 
ATOM   274   C  CA    . VAL A 1 32  ? -1.079  17.839 -46.075 1.00 43.70  ? 71  VAL A CA    1 
ATOM   275   C  C     . VAL A 1 32  ? -1.410  16.673 -45.153 1.00 50.73  ? 71  VAL A C     1 
ATOM   276   O  O     . VAL A 1 32  ? -0.516  16.182 -44.459 1.00 50.57  ? 71  VAL A O     1 
ATOM   277   C  CB    . VAL A 1 32  ? -1.753  19.164 -45.672 1.00 47.21  ? 71  VAL A CB    1 
ATOM   278   C  CG1   . VAL A 1 32  ? -1.752  19.377 -44.167 1.00 47.94  ? 71  VAL A CG1   1 
ATOM   279   C  CG2   . VAL A 1 32  ? -1.070  20.322 -46.367 1.00 46.44  ? 71  VAL A CG2   1 
ATOM   280   N  N     . ARG A 1 33  ? -2.667  16.169 -45.206 1.00 47.24  ? 72  ARG A N     1 
ATOM   281   C  CA    . ARG A 1 33  ? -3.103  15.044 -44.366 1.00 45.46  ? 72  ARG A CA    1 
ATOM   282   C  C     . ARG A 1 33  ? -2.361  13.796 -44.700 1.00 44.23  ? 72  ARG A C     1 
ATOM   283   O  O     . ARG A 1 33  ? -2.036  13.070 -43.774 1.00 40.77  ? 72  ARG A O     1 
ATOM   284   C  CB    . ARG A 1 33  ? -4.609  14.813 -44.440 1.00 45.14  ? 72  ARG A CB    1 
ATOM   285   C  CG    . ARG A 1 33  ? -5.412  16.053 -44.157 1.00 56.54  ? 72  ARG A CG    1 
ATOM   286   C  CD    . ARG A 1 33  ? -6.890  15.777 -44.126 1.00 75.93  ? 72  ARG A CD    1 
ATOM   287   N  NE    . ARG A 1 33  ? -7.617  16.981 -43.748 1.00 92.55  ? 72  ARG A NE    1 
ATOM   288   C  CZ    . ARG A 1 33  ? -7.827  17.372 -42.496 1.00 110.77 ? 72  ARG A CZ    1 
ATOM   289   N  NH1   . ARG A 1 33  ? -7.379  16.640 -41.478 1.00 92.96  ? 72  ARG A NH1   1 
ATOM   290   N  NH2   . ARG A 1 33  ? -8.483  18.492 -42.249 1.00 107.87 ? 72  ARG A NH2   1 
ATOM   291   N  N     . GLU A 1 34  ? -2.030  13.592 -46.015 1.00 41.42  ? 73  GLU A N     1 
ATOM   292   C  CA    . GLU A 1 34  ? -1.281  12.431 -46.553 1.00 41.08  ? 73  GLU A CA    1 
ATOM   293   C  C     . GLU A 1 34  ? 0.070   12.430 -45.906 1.00 41.02  ? 73  GLU A C     1 
ATOM   294   O  O     . GLU A 1 34  ? 0.315   11.568 -45.083 1.00 41.99  ? 73  GLU A O     1 
ATOM   295   C  CB    . GLU A 1 34  ? -1.135  12.483 -48.101 1.00 42.56  ? 73  GLU A CB    1 
ATOM   296   C  CG    . GLU A 1 34  ? -0.546  11.219 -48.713 1.00 42.75  ? 73  GLU A CG    1 
ATOM   297   C  CD    . GLU A 1 34  ? -0.008  11.312 -50.135 1.00 70.95  ? 73  GLU A CD    1 
ATOM   298   O  OE1   . GLU A 1 34  ? -0.819  11.502 -51.067 1.00 79.86  ? 73  GLU A OE1   1 
ATOM   299   O  OE2   . GLU A 1 34  ? 1.221   11.164 -50.328 1.00 61.32  ? 73  GLU A OE2   1 
ATOM   300   N  N     . ILE A 1 35  ? 0.894   13.454 -46.206 1.00 35.50  ? 74  ILE A N     1 
ATOM   301   C  CA    . ILE A 1 35  ? 2.239   13.669 -45.661 1.00 35.29  ? 74  ILE A CA    1 
ATOM   302   C  C     . ILE A 1 35  ? 2.265   13.567 -44.120 1.00 44.33  ? 74  ILE A C     1 
ATOM   303   O  O     . ILE A 1 35  ? 3.121   12.871 -43.607 1.00 44.76  ? 74  ILE A O     1 
ATOM   304   C  CB    . ILE A 1 35  ? 2.865   14.999 -46.197 1.00 36.03  ? 74  ILE A CB    1 
ATOM   305   C  CG1   . ILE A 1 35  ? 3.169   14.890 -47.701 1.00 35.35  ? 74  ILE A CG1   1 
ATOM   306   C  CG2   . ILE A 1 35  ? 4.107   15.439 -45.419 1.00 34.35  ? 74  ILE A CG2   1 
ATOM   307   C  CD1   . ILE A 1 35  ? 3.450   16.281 -48.399 1.00 36.95  ? 74  ILE A CD1   1 
ATOM   308   N  N     . ALA A 1 36  ? 1.337   14.224 -43.404 1.00 45.14  ? 75  ALA A N     1 
ATOM   309   C  CA    . ALA A 1 36  ? 1.276   14.280 -41.943 1.00 46.00  ? 75  ALA A CA    1 
ATOM   310   C  C     . ALA A 1 36  ? 1.030   12.975 -41.313 1.00 53.47  ? 75  ALA A C     1 
ATOM   311   O  O     . ALA A 1 36  ? 1.750   12.569 -40.396 1.00 54.78  ? 75  ALA A O     1 
ATOM   312   C  CB    . ALA A 1 36  ? 0.210   15.267 -41.496 1.00 46.95  ? 75  ALA A CB    1 
ATOM   313   N  N     . GLN A 1 37  ? -0.051  12.334 -41.770 1.00 50.80  ? 76  GLN A N     1 
ATOM   314   C  CA    . GLN A 1 37  ? -0.575  11.030 -41.281 1.00 48.92  ? 76  GLN A CA    1 
ATOM   315   C  C     . GLN A 1 37  ? 0.456   9.947  -41.554 1.00 52.84  ? 76  GLN A C     1 
ATOM   316   O  O     . GLN A 1 37  ? 0.636   9.099  -40.698 1.00 47.81  ? 76  GLN A O     1 
ATOM   317   C  CB    . GLN A 1 37  ? -1.915  10.700 -41.938 1.00 50.00  ? 76  GLN A CB    1 
ATOM   318   C  CG    . GLN A 1 37  ? -2.126  9.225  -42.230 1.00 57.74  ? 76  GLN A CG    1 
ATOM   319   C  CD    . GLN A 1 37  ? -2.852  8.987  -43.525 1.00 69.05  ? 76  GLN A CD    1 
ATOM   320   O  OE1   . GLN A 1 37  ? -2.293  9.074  -44.604 1.00 51.74  ? 76  GLN A OE1   1 
ATOM   321   N  NE2   . GLN A 1 37  ? -4.117  8.653  -43.423 1.00 73.89  ? 76  GLN A NE2   1 
ATOM   322   N  N     . ASP A 1 38  ? 1.240   10.101 -42.621 1.00 48.94  ? 77  ASP A N     1 
ATOM   323   C  CA    . ASP A 1 38  ? 2.320   9.139  -42.964 1.00 46.26  ? 77  ASP A CA    1 
ATOM   324   C  C     . ASP A 1 38  ? 3.638   9.567  -42.233 1.00 53.07  ? 77  ASP A C     1 
ATOM   325   O  O     . ASP A 1 38  ? 4.686   9.289  -42.778 1.00 47.26  ? 77  ASP A O     1 
ATOM   326   C  CB    . ASP A 1 38  ? 2.235   8.706  -44.467 1.00 45.81  ? 77  ASP A CB    1 
ATOM   327   C  CG    . ASP A 1 38  ? 1.169   7.659  -44.940 1.00 42.38  ? 77  ASP A CG    1 
ATOM   328   O  OD1   . ASP A 1 38  ? 0.680   6.880  -44.128 1.00 34.15  ? 77  ASP A OD1   1 
ATOM   329   O  OD2   . ASP A 1 38  ? 0.831   7.587  -46.143 1.00 32.73  ? 77  ASP A OD2   1 
ATOM   330   N  N     . PHE A 1 39  ? 3.577   10.252 -41.058 1.00 59.73  ? 78  PHE A N     1 
ATOM   331   C  CA    . PHE A 1 39  ? 4.621   10.673 -40.061 1.00 60.70  ? 78  PHE A CA    1 
ATOM   332   C  C     . PHE A 1 39  ? 4.013   10.458 -38.669 1.00 69.33  ? 78  PHE A C     1 
ATOM   333   O  O     . PHE A 1 39  ? 4.777   10.185 -37.759 1.00 68.25  ? 78  PHE A O     1 
ATOM   334   C  CB    . PHE A 1 39  ? 4.844   12.172 -39.827 1.00 61.54  ? 78  PHE A CB    1 
ATOM   335   C  CG    . PHE A 1 39  ? 5.805   12.928 -40.699 1.00 63.37  ? 78  PHE A CG    1 
ATOM   336   C  CD1   . PHE A 1 39  ? 7.150   12.631 -40.707 1.00 66.39  ? 78  PHE A CD1   1 
ATOM   337   C  CD2   . PHE A 1 39  ? 5.362   13.979 -41.477 1.00 65.09  ? 78  PHE A CD2   1 
ATOM   338   C  CE1   . PHE A 1 39  ? 8.016   13.327 -41.528 1.00 66.76  ? 78  PHE A CE1   1 
ATOM   339   C  CE2   . PHE A 1 39  ? 6.229   14.671 -42.297 1.00 67.47  ? 78  PHE A CE2   1 
ATOM   340   C  CZ    . PHE A 1 39  ? 7.555   14.344 -42.318 1.00 65.43  ? 78  PHE A CZ    1 
ATOM   341   N  N     . LYS A 1 40  ? 2.710   10.737 -38.497 1.00 67.64  ? 79  LYS A N     1 
ATOM   342   C  CA    . LYS A 1 40  ? 1.999   10.427 -37.250 1.00 66.38  ? 79  LYS A CA    1 
ATOM   343   C  C     . LYS A 1 40  ? 0.470   10.308 -37.534 1.00 70.51  ? 79  LYS A C     1 
ATOM   344   O  O     . LYS A 1 40  ? -0.155  11.216 -38.081 1.00 70.07  ? 79  LYS A O     1 
ATOM   345   C  CB    . LYS A 1 40  ? 2.317   11.479 -36.175 1.00 68.41  ? 79  LYS A CB    1 
ATOM   346   C  CG    . LYS A 1 40  ? 2.240   10.963 -34.752 1.00 76.54  ? 79  LYS A CG    1 
ATOM   347   C  CD    . LYS A 1 40  ? 0.934   11.365 -34.062 1.00 89.19  ? 79  LYS A CD    1 
ATOM   348   C  CE    . LYS A 1 40  ? 0.765   10.742 -32.690 1.00 107.72 ? 79  LYS A CE    1 
ATOM   349   N  NZ    . LYS A 1 40  ? 1.505   11.481 -31.629 1.00 116.84 ? 79  LYS A NZ    1 
ATOM   350   N  N     . THR A 1 41  ? -0.108  9.175  -37.182 1.00 69.20  ? 80  THR A N     1 
ATOM   351   C  CA    . THR A 1 41  ? -1.511  8.826  -37.387 1.00 70.42  ? 80  THR A CA    1 
ATOM   352   C  C     . THR A 1 41  ? -2.453  9.549  -36.412 1.00 78.94  ? 80  THR A C     1 
ATOM   353   O  O     . THR A 1 41  ? -2.006  10.119 -35.406 1.00 78.01  ? 80  THR A O     1 
ATOM   354   C  CB    . THR A 1 41  ? -1.667  7.300  -37.347 1.00 82.81  ? 80  THR A CB    1 
ATOM   355   O  OG1   . THR A 1 41  ? -1.013  6.814  -36.176 1.00 87.63  ? 80  THR A OG1   1 
ATOM   356   C  CG2   . THR A 1 41  ? -1.099  6.608  -38.611 1.00 75.61  ? 80  THR A CG2   1 
ATOM   357   N  N     . ASP A 1 42  ? -3.765  9.552  -36.752 1.00 78.88  ? 81  ASP A N     1 
ATOM   358   C  CA    . ASP A 1 42  ? -4.869  10.193 -36.015 1.00 79.70  ? 81  ASP A CA    1 
ATOM   359   C  C     . ASP A 1 42  ? -4.637  11.687 -35.705 1.00 81.36  ? 81  ASP A C     1 
ATOM   360   O  O     . ASP A 1 42  ? -4.976  12.162 -34.608 1.00 83.97  ? 81  ASP A O     1 
ATOM   361   C  CB    . ASP A 1 42  ? -5.239  9.411  -34.744 1.00 83.50  ? 81  ASP A CB    1 
ATOM   362   C  CG    . ASP A 1 42  ? -6.288  8.348  -34.991 1.00 107.90 ? 81  ASP A CG    1 
ATOM   363   O  OD1   . ASP A 1 42  ? -7.427  8.713  -35.379 1.00 111.87 ? 81  ASP A OD1   1 
ATOM   364   O  OD2   . ASP A 1 42  ? -5.979  7.154  -34.796 1.00 116.37 ? 81  ASP A OD2   1 
ATOM   365   N  N     . LEU A 1 43  ? -4.102  12.443 -36.693 1.00 70.63  ? 82  LEU A N     1 
ATOM   366   C  CA    . LEU A 1 43  ? -3.877  13.873 -36.527 1.00 65.05  ? 82  LEU A CA    1 
ATOM   367   C  C     . LEU A 1 43  ? -5.038  14.643 -37.085 1.00 67.42  ? 82  LEU A C     1 
ATOM   368   O  O     . LEU A 1 43  ? -5.634  14.249 -38.097 1.00 66.87  ? 82  LEU A O     1 
ATOM   369   C  CB    . LEU A 1 43  ? -2.575  14.372 -37.188 1.00 62.75  ? 82  LEU A CB    1 
ATOM   370   C  CG    . LEU A 1 43  ? -1.273  14.065 -36.486 1.00 63.85  ? 82  LEU A CG    1 
ATOM   371   C  CD1   . LEU A 1 43  ? -0.146  14.396 -37.351 1.00 64.08  ? 82  LEU A CD1   1 
ATOM   372   C  CD2   . LEU A 1 43  ? -1.143  14.790 -35.184 1.00 60.30  ? 82  LEU A CD2   1 
ATOM   373   N  N     . ARG A 1 44  ? -5.339  15.770 -36.421 1.00 61.10  ? 83  ARG A N     1 
ATOM   374   C  CA    . ARG A 1 44  ? -6.353  16.712 -36.829 1.00 58.61  ? 83  ARG A CA    1 
ATOM   375   C  C     . ARG A 1 44  ? -5.643  17.992 -37.224 1.00 57.72  ? 83  ARG A C     1 
ATOM   376   O  O     . ARG A 1 44  ? -4.534  18.244 -36.769 1.00 55.88  ? 83  ARG A O     1 
ATOM   377   C  CB    . ARG A 1 44  ? -7.367  16.956 -35.703 1.00 58.71  ? 83  ARG A CB    1 
ATOM   378   C  CG    . ARG A 1 44  ? -8.272  15.762 -35.435 1.00 67.26  ? 83  ARG A CG    1 
ATOM   379   C  CD    . ARG A 1 44  ? -9.434  16.203 -34.586 1.00 93.78  ? 83  ARG A CD    1 
ATOM   380   N  NE    . ARG A 1 44  ? -10.653 15.455 -34.908 1.00 116.44 ? 83  ARG A NE    1 
ATOM   381   C  CZ    . ARG A 1 44  ? -11.881 15.935 -34.752 1.00 137.61 ? 83  ARG A CZ    1 
ATOM   382   N  NH1   . ARG A 1 44  ? -12.072 17.157 -34.272 1.00 132.61 ? 83  ARG A NH1   1 
ATOM   383   N  NH2   . ARG A 1 44  ? -12.930 15.195 -35.081 1.00 123.23 ? 83  ARG A NH2   1 
ATOM   384   N  N     . PHE A 1 45  ? -6.264  18.785 -38.090 1.00 51.65  ? 84  PHE A N     1 
ATOM   385   C  CA    . PHE A 1 45  ? -5.731  20.062 -38.536 1.00 48.89  ? 84  PHE A CA    1 
ATOM   386   C  C     . PHE A 1 45  ? -6.749  21.148 -38.366 1.00 55.43  ? 84  PHE A C     1 
ATOM   387   O  O     . PHE A 1 45  ? -7.882  21.004 -38.860 1.00 55.58  ? 84  PHE A O     1 
ATOM   388   C  CB    . PHE A 1 45  ? -5.341  19.994 -40.012 1.00 49.57  ? 84  PHE A CB    1 
ATOM   389   C  CG    . PHE A 1 45  ? -3.985  19.384 -40.249 1.00 50.69  ? 84  PHE A CG    1 
ATOM   390   C  CD1   . PHE A 1 45  ? -2.828  20.155 -40.158 1.00 53.26  ? 84  PHE A CD1   1 
ATOM   391   C  CD2   . PHE A 1 45  ? -3.862  18.033 -40.574 1.00 49.56  ? 84  PHE A CD2   1 
ATOM   392   C  CE1   . PHE A 1 45  ? -1.571  19.583 -40.367 1.00 52.96  ? 84  PHE A CE1   1 
ATOM   393   C  CE2   . PHE A 1 45  ? -2.609  17.481 -40.821 1.00 51.58  ? 84  PHE A CE2   1 
ATOM   394   C  CZ    . PHE A 1 45  ? -1.475  18.254 -40.694 1.00 50.15  ? 84  PHE A CZ    1 
ATOM   395   N  N     . GLN A 1 46  ? -6.350  22.286 -37.731 1.00 52.20  ? 85  GLN A N     1 
ATOM   396   C  CA    . GLN A 1 46  ? -7.231  23.443 -37.651 1.00 52.22  ? 85  GLN A CA    1 
ATOM   397   C  C     . GLN A 1 46  ? -7.299  23.959 -39.094 1.00 58.24  ? 85  GLN A C     1 
ATOM   398   O  O     . GLN A 1 46  ? -6.292  23.863 -39.804 1.00 60.02  ? 85  GLN A O     1 
ATOM   399   C  CB    . GLN A 1 46  ? -6.624  24.522 -36.751 1.00 54.08  ? 85  GLN A CB    1 
ATOM   400   C  CG    . GLN A 1 46  ? -6.618  24.203 -35.265 1.00 66.62  ? 85  GLN A CG    1 
ATOM   401   C  CD    . GLN A 1 46  ? -6.328  25.455 -34.469 1.00 77.73  ? 85  GLN A CD    1 
ATOM   402   O  OE1   . GLN A 1 46  ? -5.492  26.277 -34.851 1.00 72.23  ? 85  GLN A OE1   1 
ATOM   403   N  NE2   . GLN A 1 46  ? -7.032  25.654 -33.356 1.00 76.05  ? 85  GLN A NE2   1 
ATOM   404   N  N     . SER A 1 47  ? -8.464  24.448 -39.550 1.00 54.16  ? 86  SER A N     1 
ATOM   405   C  CA    . SER A 1 47  ? -8.631  24.953 -40.916 1.00 54.29  ? 86  SER A CA    1 
ATOM   406   C  C     . SER A 1 47  ? -7.483  25.912 -41.268 1.00 60.79  ? 86  SER A C     1 
ATOM   407   O  O     . SER A 1 47  ? -6.877  25.785 -42.336 1.00 60.95  ? 86  SER A O     1 
ATOM   408   C  CB    . SER A 1 47  ? -9.959  25.684 -41.026 1.00 59.14  ? 86  SER A CB    1 
ATOM   409   O  OG    . SER A 1 47  ? -9.956  26.792 -40.133 1.00 78.08  ? 86  SER A OG    1 
ATOM   410   N  N     . SER A 1 48  ? -7.169  26.847 -40.328 1.00 58.05  ? 87  SER A N     1 
ATOM   411   C  CA    . SER A 1 48  ? -6.120  27.855 -40.463 1.00 57.27  ? 87  SER A CA    1 
ATOM   412   C  C     . SER A 1 48  ? -4.726  27.259 -40.524 1.00 60.07  ? 87  SER A C     1 
ATOM   413   O  O     . SER A 1 48  ? -3.872  27.890 -41.148 1.00 62.69  ? 87  SER A O     1 
ATOM   414   C  CB    . SER A 1 48  ? -6.196  28.888 -39.343 1.00 59.52  ? 87  SER A CB    1 
ATOM   415   O  OG    . SER A 1 48  ? -6.029  28.307 -38.061 1.00 69.99  ? 87  SER A OG    1 
ATOM   416   N  N     . ALA A 1 49  ? -4.478  26.081 -39.866 1.00 50.96  ? 88  ALA A N     1 
ATOM   417   C  CA    . ALA A 1 49  ? -3.171  25.408 -39.869 1.00 49.05  ? 88  ALA A CA    1 
ATOM   418   C  C     . ALA A 1 49  ? -2.798  25.013 -41.292 1.00 50.50  ? 88  ALA A C     1 
ATOM   419   O  O     . ALA A 1 49  ? -1.637  25.174 -41.692 1.00 50.74  ? 88  ALA A O     1 
ATOM   420   C  CB    . ALA A 1 49  ? -3.189  24.171 -38.976 1.00 49.00  ? 88  ALA A CB    1 
ATOM   421   N  N     . VAL A 1 50  ? -3.801  24.569 -42.075 1.00 43.74  ? 89  VAL A N     1 
ATOM   422   C  CA    . VAL A 1 50  ? -3.629  24.167 -43.473 1.00 42.88  ? 89  VAL A CA    1 
ATOM   423   C  C     . VAL A 1 50  ? -3.409  25.434 -44.317 1.00 49.79  ? 89  VAL A C     1 
ATOM   424   O  O     . VAL A 1 50  ? -2.498  25.471 -45.145 1.00 48.73  ? 89  VAL A O     1 
ATOM   425   C  CB    . VAL A 1 50  ? -4.798  23.265 -43.984 1.00 44.68  ? 89  VAL A CB    1 
ATOM   426   C  CG1   . VAL A 1 50  ? -4.659  22.926 -45.459 1.00 44.41  ? 89  VAL A CG1   1 
ATOM   427   C  CG2   . VAL A 1 50  ? -4.936  22.003 -43.153 1.00 43.20  ? 89  VAL A CG2   1 
ATOM   428   N  N     . MET A 1 51  ? -4.205  26.477 -44.072 1.00 50.92  ? 90  MET A N     1 
ATOM   429   C  CA    . MET A 1 51  ? -4.088  27.760 -44.771 1.00 53.72  ? 90  MET A CA    1 
ATOM   430   C  C     . MET A 1 51  ? -2.727  28.413 -44.580 1.00 52.55  ? 90  MET A C     1 
ATOM   431   O  O     . MET A 1 51  ? -2.158  28.921 -45.548 1.00 52.42  ? 90  MET A O     1 
ATOM   432   C  CB    . MET A 1 51  ? -5.218  28.692 -44.365 1.00 59.05  ? 90  MET A CB    1 
ATOM   433   C  CG    . MET A 1 51  ? -6.559  28.206 -44.859 1.00 67.62  ? 90  MET A CG    1 
ATOM   434   S  SD    . MET A 1 51  ? -6.529  27.792 -46.637 1.00 75.66  ? 90  MET A SD    1 
ATOM   435   C  CE    . MET A 1 51  ? -6.633  29.535 -47.284 1.00 71.48  ? 90  MET A CE    1 
ATOM   436   N  N     . ALA A 1 52  ? -2.188  28.347 -43.338 1.00 44.26  ? 91  ALA A N     1 
ATOM   437   C  CA    . ALA A 1 52  ? -0.867  28.823 -42.955 1.00 41.31  ? 91  ALA A CA    1 
ATOM   438   C  C     . ALA A 1 52  ? 0.179   28.059 -43.781 1.00 41.19  ? 91  ALA A C     1 
ATOM   439   O  O     . ALA A 1 52  ? 1.059   28.684 -44.351 1.00 42.18  ? 91  ALA A O     1 
ATOM   440   C  CB    . ALA A 1 52  ? -0.653  28.609 -41.471 1.00 41.80  ? 91  ALA A CB    1 
ATOM   441   N  N     . LEU A 1 53  ? 0.044   26.724 -43.898 1.00 34.86  ? 92  LEU A N     1 
ATOM   442   C  CA    . LEU A 1 53  ? 0.924   25.884 -44.711 1.00 31.20  ? 92  LEU A CA    1 
ATOM   443   C  C     . LEU A 1 53  ? 0.856   26.257 -46.214 1.00 33.65  ? 92  LEU A C     1 
ATOM   444   O  O     . LEU A 1 53  ? 1.903   26.389 -46.847 1.00 32.86  ? 92  LEU A O     1 
ATOM   445   C  CB    . LEU A 1 53  ? 0.569   24.405 -44.514 1.00 29.40  ? 92  LEU A CB    1 
ATOM   446   C  CG    . LEU A 1 53  ? 1.275   23.705 -43.348 1.00 31.54  ? 92  LEU A CG    1 
ATOM   447   C  CD1   . LEU A 1 53  ? 0.521   22.539 -42.862 1.00 29.15  ? 92  LEU A CD1   1 
ATOM   448   C  CD2   . LEU A 1 53  ? 2.648   23.285 -43.701 1.00 29.64  ? 92  LEU A CD2   1 
ATOM   449   N  N     . GLN A 1 54  ? -0.377  26.430 -46.777 1.00 26.50  ? 93  GLN A N     1 
ATOM   450   C  CA    . GLN A 1 54  ? -0.573  26.743 -48.183 1.00 23.69  ? 93  GLN A CA    1 
ATOM   451   C  C     . GLN A 1 54  ? 0.058   28.083 -48.573 1.00 38.02  ? 93  GLN A C     1 
ATOM   452   O  O     . GLN A 1 54  ? 0.746   28.165 -49.603 1.00 41.91  ? 93  GLN A O     1 
ATOM   453   C  CB    . GLN A 1 54  ? -2.033  26.676 -48.556 1.00 21.77  ? 93  GLN A CB    1 
ATOM   454   C  CG    . GLN A 1 54  ? -2.150  26.444 -50.041 1.00 22.13  ? 93  GLN A CG    1 
ATOM   455   C  CD    . GLN A 1 54  ? -3.544  26.360 -50.574 1.00 47.92  ? 93  GLN A CD    1 
ATOM   456   O  OE1   . GLN A 1 54  ? -4.538  26.283 -49.841 1.00 49.20  ? 93  GLN A OE1   1 
ATOM   457   N  NE2   . GLN A 1 54  ? -3.625  26.380 -51.883 1.00 42.94  ? 93  GLN A NE2   1 
ATOM   458   N  N     . GLU A 1 55  ? -0.169  29.128 -47.735 1.00 32.73  ? 94  GLU A N     1 
ATOM   459   C  CA    . GLU A 1 55  ? 0.424   30.456 -47.857 1.00 30.77  ? 94  GLU A CA    1 
ATOM   460   C  C     . GLU A 1 55  ? 1.955   30.352 -47.891 1.00 31.60  ? 94  GLU A C     1 
ATOM   461   O  O     . GLU A 1 55  ? 2.581   30.939 -48.752 1.00 31.67  ? 94  GLU A O     1 
ATOM   462   C  CB    . GLU A 1 55  ? -0.017  31.332 -46.673 1.00 31.61  ? 94  GLU A CB    1 
ATOM   463   C  CG    . GLU A 1 55  ? -1.445  31.845 -46.782 1.00 34.63  ? 94  GLU A CG    1 
ATOM   464   C  CD    . GLU A 1 55  ? -1.717  32.891 -47.842 1.00 59.55  ? 94  GLU A CD    1 
ATOM   465   O  OE1   . GLU A 1 55  ? -2.912  33.219 -48.037 1.00 61.77  ? 94  GLU A OE1   1 
ATOM   466   O  OE2   . GLU A 1 55  ? -0.743  33.421 -48.432 1.00 48.95  ? 94  GLU A OE2   1 
ATOM   467   N  N     . ALA A 1 56  ? 2.530   29.538 -46.998 1.00 25.64  ? 95  ALA A N     1 
ATOM   468   C  CA    . ALA A 1 56  ? 3.950   29.292 -46.857 1.00 24.72  ? 95  ALA A CA    1 
ATOM   469   C  C     . ALA A 1 56  ? 4.558   28.634 -48.078 1.00 32.52  ? 95  ALA A C     1 
ATOM   470   O  O     . ALA A 1 56  ? 5.649   29.038 -48.502 1.00 30.86  ? 95  ALA A O     1 
ATOM   471   C  CB    . ALA A 1 56  ? 4.204   28.448 -45.619 1.00 25.20  ? 95  ALA A CB    1 
ATOM   472   N  N     . CYS A 1 57  ? 3.875   27.588 -48.612 1.00 35.44  ? 96  CYS A N     1 
ATOM   473   C  CA    . CYS A 1 57  ? 4.268   26.769 -49.764 1.00 35.70  ? 96  CYS A CA    1 
ATOM   474   C  C     . CYS A 1 57  ? 4.317   27.593 -51.007 1.00 38.48  ? 96  CYS A C     1 
ATOM   475   O  O     . CYS A 1 57  ? 5.316   27.563 -51.723 1.00 40.87  ? 96  CYS A O     1 
ATOM   476   C  CB    . CYS A 1 57  ? 3.305   25.607 -49.935 1.00 36.86  ? 96  CYS A CB    1 
ATOM   477   S  SG    . CYS A 1 57  ? 3.691   24.215 -48.882 1.00 42.82  ? 96  CYS A SG    1 
ATOM   478   N  N     . GLU A 1 58  ? 3.207   28.273 -51.291 1.00 29.92  ? 97  GLU A N     1 
ATOM   479   C  CA    . GLU A 1 58  ? 3.065   29.091 -52.458 1.00 30.05  ? 97  GLU A CA    1 
ATOM   480   C  C     . GLU A 1 58  ? 4.042   30.271 -52.397 1.00 35.15  ? 97  GLU A C     1 
ATOM   481   O  O     . GLU A 1 58  ? 4.707   30.545 -53.399 1.00 37.77  ? 97  GLU A O     1 
ATOM   482   C  CB    . GLU A 1 58  ? 1.622   29.531 -52.610 1.00 31.36  ? 97  GLU A CB    1 
ATOM   483   C  CG    . GLU A 1 58  ? 0.740   28.344 -52.961 1.00 42.16  ? 97  GLU A CG    1 
ATOM   484   C  CD    . GLU A 1 58  ? -0.599  28.733 -53.567 1.00 77.40  ? 97  GLU A CD    1 
ATOM   485   O  OE1   . GLU A 1 58  ? -0.630  29.687 -54.377 1.00 53.80  ? 97  GLU A OE1   1 
ATOM   486   O  OE2   . GLU A 1 58  ? -1.619  28.085 -53.231 1.00 81.68  ? 97  GLU A OE2   1 
ATOM   487   N  N     . ALA A 1 59  ? 4.225   30.906 -51.210 1.00 27.36  ? 98  ALA A N     1 
ATOM   488   C  CA    . ALA A 1 59  ? 5.198   31.980 -51.084 1.00 24.94  ? 98  ALA A CA    1 
ATOM   489   C  C     . ALA A 1 59  ? 6.569   31.392 -51.405 1.00 32.93  ? 98  ALA A C     1 
ATOM   490   O  O     . ALA A 1 59  ? 7.216   31.877 -52.307 1.00 36.48  ? 98  ALA A O     1 
ATOM   491   C  CB    . ALA A 1 59  ? 5.154   32.595 -49.707 1.00 24.15  ? 98  ALA A CB    1 
ATOM   492   N  N     . TYR A 1 60  ? 6.946   30.273 -50.790 1.00 33.83  ? 99  TYR A N     1 
ATOM   493   C  CA    . TYR A 1 60  ? 8.215   29.578 -51.070 1.00 34.31  ? 99  TYR A CA    1 
ATOM   494   C  C     . TYR A 1 60  ? 8.456   29.319 -52.572 1.00 40.49  ? 99  TYR A C     1 
ATOM   495   O  O     . TYR A 1 60  ? 9.514   29.718 -53.087 1.00 44.11  ? 99  TYR A O     1 
ATOM   496   C  CB    . TYR A 1 60  ? 8.317   28.252 -50.294 1.00 32.14  ? 99  TYR A CB    1 
ATOM   497   C  CG    . TYR A 1 60  ? 9.456   27.377 -50.768 1.00 30.93  ? 99  TYR A CG    1 
ATOM   498   C  CD1   . TYR A 1 60  ? 10.778  27.682 -50.449 1.00 30.66  ? 99  TYR A CD1   1 
ATOM   499   C  CD2   . TYR A 1 60  ? 9.213   26.222 -51.510 1.00 32.51  ? 99  TYR A CD2   1 
ATOM   500   C  CE1   . TYR A 1 60  ? 11.830  26.887 -50.896 1.00 28.85  ? 99  TYR A CE1   1 
ATOM   501   C  CE2   . TYR A 1 60  ? 10.259  25.398 -51.933 1.00 32.55  ? 99  TYR A CE2   1 
ATOM   502   C  CZ    . TYR A 1 60  ? 11.564  25.752 -51.644 1.00 34.86  ? 99  TYR A CZ    1 
ATOM   503   O  OH    . TYR A 1 60  ? 12.588  24.985 -52.099 1.00 35.51  ? 99  TYR A OH    1 
ATOM   504   N  N     . LEU A 1 61  ? 7.482   28.650 -53.237 1.00 31.35  ? 100 LEU A N     1 
ATOM   505   C  CA    . LEU A 1 61  ? 7.532   28.226 -54.630 1.00 29.80  ? 100 LEU A CA    1 
ATOM   506   C  C     . LEU A 1 61  ? 7.641   29.353 -55.597 1.00 41.09  ? 100 LEU A C     1 
ATOM   507   O  O     . LEU A 1 61  ? 8.434   29.240 -56.526 1.00 45.11  ? 100 LEU A O     1 
ATOM   508   C  CB    . LEU A 1 61  ? 6.362   27.295 -55.023 1.00 28.06  ? 100 LEU A CB    1 
ATOM   509   C  CG    . LEU A 1 61  ? 6.355   25.852 -54.476 1.00 29.36  ? 100 LEU A CG    1 
ATOM   510   C  CD1   . LEU A 1 61  ? 5.155   25.126 -54.967 1.00 27.86  ? 100 LEU A CD1   1 
ATOM   511   C  CD2   . LEU A 1 61  ? 7.586   25.049 -54.908 1.00 26.05  ? 100 LEU A CD2   1 
ATOM   512   N  N     . VAL A 1 62  ? 6.874   30.445 -55.395 1.00 37.09  ? 101 VAL A N     1 
ATOM   513   C  CA    . VAL A 1 62  ? 6.904   31.626 -56.247 1.00 36.91  ? 101 VAL A CA    1 
ATOM   514   C  C     . VAL A 1 62  ? 8.298   32.302 -56.175 1.00 47.00  ? 101 VAL A C     1 
ATOM   515   O  O     . VAL A 1 62  ? 8.889   32.600 -57.200 1.00 51.43  ? 101 VAL A O     1 
ATOM   516   C  CB    . VAL A 1 62  ? 5.742   32.599 -55.925 1.00 39.13  ? 101 VAL A CB    1 
ATOM   517   C  CG1   . VAL A 1 62  ? 5.928   33.950 -56.626 1.00 38.69  ? 101 VAL A CG1   1 
ATOM   518   C  CG2   . VAL A 1 62  ? 4.387   31.991 -56.279 1.00 37.75  ? 101 VAL A CG2   1 
ATOM   519   N  N     . GLY A 1 63  ? 8.823   32.480 -54.978 1.00 42.44  ? 102 GLY A N     1 
ATOM   520   C  CA    . GLY A 1 63  ? 10.167  32.989 -54.768 1.00 41.93  ? 102 GLY A CA    1 
ATOM   521   C  C     . GLY A 1 63  ? 11.234  32.075 -55.348 1.00 47.60  ? 102 GLY A C     1 
ATOM   522   O  O     . GLY A 1 63  ? 12.297  32.557 -55.746 1.00 48.55  ? 102 GLY A O     1 
ATOM   523   N  N     . LEU A 1 64  ? 10.974  30.746 -55.414 1.00 43.89  ? 103 LEU A N     1 
ATOM   524   C  CA    . LEU A 1 64  ? 11.912  29.802 -56.030 1.00 41.57  ? 103 LEU A CA    1 
ATOM   525   C  C     . LEU A 1 64  ? 11.870  29.972 -57.542 1.00 46.86  ? 103 LEU A C     1 
ATOM   526   O  O     . LEU A 1 64  ? 12.929  29.979 -58.161 1.00 47.37  ? 103 LEU A O     1 
ATOM   527   C  CB    . LEU A 1 64  ? 11.642  28.370 -55.631 1.00 40.43  ? 103 LEU A CB    1 
ATOM   528   C  CG    . LEU A 1 64  ? 12.636  27.312 -56.160 1.00 44.02  ? 103 LEU A CG    1 
ATOM   529   C  CD1   . LEU A 1 64  ? 14.017  27.466 -55.557 1.00 43.39  ? 103 LEU A CD1   1 
ATOM   530   C  CD2   . LEU A 1 64  ? 12.151  25.958 -55.876 1.00 44.20  ? 103 LEU A CD2   1 
ATOM   531   N  N     . PHE A 1 65  ? 10.664  30.191 -58.123 1.00 43.81  ? 104 PHE A N     1 
ATOM   532   C  CA    . PHE A 1 65  ? 10.482  30.402 -59.554 1.00 45.17  ? 104 PHE A CA    1 
ATOM   533   C  C     . PHE A 1 65  ? 11.131  31.723 -59.998 1.00 53.71  ? 104 PHE A C     1 
ATOM   534   O  O     . PHE A 1 65  ? 11.491  31.887 -61.158 1.00 55.34  ? 104 PHE A O     1 
ATOM   535   C  CB    . PHE A 1 65  ? 8.998   30.347 -59.924 1.00 47.48  ? 104 PHE A CB    1 
ATOM   536   C  CG    . PHE A 1 65  ? 8.478   28.935 -60.126 1.00 50.36  ? 104 PHE A CG    1 
ATOM   537   C  CD1   . PHE A 1 65  ? 9.099   28.065 -61.014 1.00 53.69  ? 104 PHE A CD1   1 
ATOM   538   C  CD2   . PHE A 1 65  ? 7.344   28.489 -59.457 1.00 52.76  ? 104 PHE A CD2   1 
ATOM   539   C  CE1   . PHE A 1 65  ? 8.616   26.765 -61.201 1.00 53.58  ? 104 PHE A CE1   1 
ATOM   540   C  CE2   . PHE A 1 65  ? 6.862   27.200 -59.650 1.00 54.57  ? 104 PHE A CE2   1 
ATOM   541   C  CZ    . PHE A 1 65  ? 7.494   26.349 -60.530 1.00 52.65  ? 104 PHE A CZ    1 
ATOM   542   N  N     . GLU A 1 66  ? 11.319  32.645 -59.060 1.00 49.48  ? 105 GLU A N     1 
ATOM   543   C  CA    . GLU A 1 66  ? 11.992  33.885 -59.304 1.00 49.26  ? 105 GLU A CA    1 
ATOM   544   C  C     . GLU A 1 66  ? 13.473  33.596 -59.540 1.00 52.51  ? 105 GLU A C     1 
ATOM   545   O  O     . GLU A 1 66  ? 13.982  33.914 -60.601 1.00 52.85  ? 105 GLU A O     1 
ATOM   546   C  CB    . GLU A 1 66  ? 11.752  34.866 -58.143 1.00 51.55  ? 105 GLU A CB    1 
ATOM   547   C  CG    . GLU A 1 66  ? 10.344  35.438 -58.179 1.00 66.62  ? 105 GLU A CG    1 
ATOM   548   C  CD    . GLU A 1 66  ? 9.868   36.389 -57.099 1.00 72.84  ? 105 GLU A CD    1 
ATOM   549   O  OE1   . GLU A 1 66  ? 10.532  36.501 -56.041 1.00 31.67  ? 105 GLU A OE1   1 
ATOM   550   O  OE2   . GLU A 1 66  ? 8.800   37.010 -57.321 1.00 65.41  ? 105 GLU A OE2   1 
ATOM   551   N  N     . ASP A 1 67  ? 14.134  32.906 -58.596 1.00 49.62  ? 106 ASP A N     1 
ATOM   552   C  CA    . ASP A 1 67  ? 15.552  32.543 -58.673 1.00 49.02  ? 106 ASP A CA    1 
ATOM   553   C  C     . ASP A 1 67  ? 15.793  31.601 -59.826 1.00 53.82  ? 106 ASP A C     1 
ATOM   554   O  O     . ASP A 1 67  ? 16.831  31.696 -60.476 1.00 52.95  ? 106 ASP A O     1 
ATOM   555   C  CB    . ASP A 1 67  ? 16.064  31.926 -57.358 1.00 50.10  ? 106 ASP A CB    1 
ATOM   556   C  CG    . ASP A 1 67  ? 15.873  32.747 -56.093 1.00 57.41  ? 106 ASP A CG    1 
ATOM   557   O  OD1   . ASP A 1 67  ? 15.480  33.935 -56.200 1.00 59.71  ? 106 ASP A OD1   1 
ATOM   558   O  OD2   . ASP A 1 67  ? 16.107  32.201 -54.993 1.00 60.57  ? 106 ASP A OD2   1 
ATOM   559   N  N     . THR A 1 68  ? 14.829  30.706 -60.092 1.00 52.28  ? 107 THR A N     1 
ATOM   560   C  CA    . THR A 1 68  ? 14.910  29.735 -61.180 1.00 52.42  ? 107 THR A CA    1 
ATOM   561   C  C     . THR A 1 68  ? 15.015  30.481 -62.505 1.00 59.19  ? 107 THR A C     1 
ATOM   562   O  O     . THR A 1 68  ? 15.931  30.209 -63.279 1.00 58.99  ? 107 THR A O     1 
ATOM   563   C  CB    . THR A 1 68  ? 13.761  28.715 -61.089 1.00 57.83  ? 107 THR A CB    1 
ATOM   564   O  OG1   . THR A 1 68  ? 13.885  28.000 -59.861 1.00 53.84  ? 107 THR A OG1   1 
ATOM   565   C  CG2   . THR A 1 68  ? 13.781  27.709 -62.216 1.00 60.18  ? 107 THR A CG2   1 
ATOM   566   N  N     . ASN A 1 69  ? 14.128  31.471 -62.722 1.00 57.43  ? 108 ASN A N     1 
ATOM   567   C  CA    . ASN A 1 69  ? 14.074  32.291 -63.932 1.00 56.86  ? 108 ASN A CA    1 
ATOM   568   C  C     . ASN A 1 69  ? 15.377  33.080 -64.087 1.00 61.87  ? 108 ASN A C     1 
ATOM   569   O  O     . ASN A 1 69  ? 15.926  33.131 -65.182 1.00 61.69  ? 108 ASN A O     1 
ATOM   570   C  CB    . ASN A 1 69  ? 12.845  33.196 -63.890 1.00 51.57  ? 108 ASN A CB    1 
ATOM   571   C  CG    . ASN A 1 69  ? 12.369  33.735 -65.218 1.00 86.37  ? 108 ASN A CG    1 
ATOM   572   O  OD1   . ASN A 1 69  ? 12.151  33.020 -66.215 1.00 80.12  ? 108 ASN A OD1   1 
ATOM   573   N  ND2   . ASN A 1 69  ? 12.150  35.030 -65.239 1.00 85.55  ? 108 ASN A ND2   1 
ATOM   574   N  N     . LEU A 1 70  ? 15.930  33.593 -62.976 1.00 58.96  ? 109 LEU A N     1 
ATOM   575   C  CA    . LEU A 1 70  ? 17.209  34.309 -62.970 1.00 58.53  ? 109 LEU A CA    1 
ATOM   576   C  C     . LEU A 1 70  ? 18.317  33.390 -63.492 1.00 63.13  ? 109 LEU A C     1 
ATOM   577   O  O     . LEU A 1 70  ? 19.147  33.816 -64.292 1.00 62.52  ? 109 LEU A O     1 
ATOM   578   C  CB    . LEU A 1 70  ? 17.535  34.810 -61.551 1.00 57.94  ? 109 LEU A CB    1 
ATOM   579   C  CG    . LEU A 1 70  ? 16.973  36.161 -61.054 1.00 62.21  ? 109 LEU A CG    1 
ATOM   580   C  CD1   . LEU A 1 70  ? 17.926  37.271 -61.322 1.00 61.60  ? 109 LEU A CD1   1 
ATOM   581   C  CD2   . LEU A 1 70  ? 15.579  36.564 -61.591 1.00 64.91  ? 109 LEU A CD2   1 
ATOM   582   N  N     . CYS A 1 71  ? 18.267  32.105 -63.100 1.00 60.84  ? 110 CYS A N     1 
ATOM   583   C  CA    . CYS A 1 71  ? 19.197  31.077 -63.555 1.00 61.09  ? 110 CYS A CA    1 
ATOM   584   C  C     . CYS A 1 71  ? 19.010  30.740 -65.037 1.00 68.87  ? 110 CYS A C     1 
ATOM   585   O  O     . CYS A 1 71  ? 20.012  30.654 -65.746 1.00 69.31  ? 110 CYS A O     1 
ATOM   586   C  CB    . CYS A 1 71  ? 19.112  29.837 -62.677 1.00 60.46  ? 110 CYS A CB    1 
ATOM   587   S  SG    . CYS A 1 71  ? 19.809  30.070 -61.029 1.00 63.74  ? 110 CYS A SG    1 
ATOM   588   N  N     . ALA A 1 72  ? 17.750  30.564 -65.521 1.00 66.66  ? 111 ALA A N     1 
ATOM   589   C  CA    . ALA A 1 72  ? 17.486  30.283 -66.937 1.00 67.18  ? 111 ALA A CA    1 
ATOM   590   C  C     . ALA A 1 72  ? 17.991  31.465 -67.788 1.00 77.74  ? 111 ALA A C     1 
ATOM   591   O  O     . ALA A 1 72  ? 18.723  31.232 -68.745 1.00 80.36  ? 111 ALA A O     1 
ATOM   592   C  CB    . ALA A 1 72  ? 16.006  30.048 -67.166 1.00 67.41  ? 111 ALA A CB    1 
ATOM   593   N  N     . ILE A 1 73  ? 17.704  32.722 -67.375 1.00 74.86  ? 112 ILE A N     1 
ATOM   594   C  CA    . ILE A 1 73  ? 18.175  33.932 -68.047 1.00 75.42  ? 112 ILE A CA    1 
ATOM   595   C  C     . ILE A 1 73  ? 19.716  34.008 -68.033 1.00 82.90  ? 112 ILE A C     1 
ATOM   596   O  O     . ILE A 1 73  ? 20.304  34.429 -69.032 1.00 83.63  ? 112 ILE A O     1 
ATOM   597   C  CB    . ILE A 1 73  ? 17.483  35.231 -67.504 1.00 77.54  ? 112 ILE A CB    1 
ATOM   598   C  CG1   . ILE A 1 73  ? 15.946  35.132 -67.632 1.00 77.18  ? 112 ILE A CG1   1 
ATOM   599   C  CG2   . ILE A 1 73  ? 17.967  36.470 -68.249 1.00 78.49  ? 112 ILE A CG2   1 
ATOM   600   C  CD1   . ILE A 1 73  ? 15.152  36.061 -66.810 1.00 81.05  ? 112 ILE A CD1   1 
ATOM   601   N  N     . HIS A 1 74  ? 20.361  33.571 -66.932 1.00 81.16  ? 113 HIS A N     1 
ATOM   602   C  CA    . HIS A 1 74  ? 21.822  33.564 -66.786 1.00 81.96  ? 113 HIS A CA    1 
ATOM   603   C  C     . HIS A 1 74  ? 22.504  32.747 -67.869 1.00 87.96  ? 113 HIS A C     1 
ATOM   604   O  O     . HIS A 1 74  ? 23.556  33.161 -68.376 1.00 87.83  ? 113 HIS A O     1 
ATOM   605   C  CB    . HIS A 1 74  ? 22.224  33.006 -65.418 1.00 82.95  ? 113 HIS A CB    1 
ATOM   606   C  CG    . HIS A 1 74  ? 23.693  33.066 -65.167 1.00 86.40  ? 113 HIS A CG    1 
ATOM   607   N  ND1   . HIS A 1 74  ? 24.315  34.254 -64.844 1.00 88.28  ? 113 HIS A ND1   1 
ATOM   608   C  CD2   . HIS A 1 74  ? 24.614  32.080 -65.195 1.00 87.94  ? 113 HIS A CD2   1 
ATOM   609   C  CE1   . HIS A 1 74  ? 25.591  33.956 -64.685 1.00 87.63  ? 113 HIS A CE1   1 
ATOM   610   N  NE2   . HIS A 1 74  ? 25.817  32.658 -64.879 1.00 87.89  ? 113 HIS A NE2   1 
ATOM   611   N  N     . ALA A 1 75  ? 21.893  31.582 -68.208 1.00 85.54  ? 114 ALA A N     1 
ATOM   612   C  CA    . ALA A 1 75  ? 22.331  30.615 -69.215 1.00 85.55  ? 114 ALA A CA    1 
ATOM   613   C  C     . ALA A 1 75  ? 21.841  31.008 -70.629 1.00 91.95  ? 114 ALA A C     1 
ATOM   614   O  O     . ALA A 1 75  ? 21.929  30.208 -71.563 1.00 92.42  ? 114 ALA A O     1 
ATOM   615   C  CB    . ALA A 1 75  ? 21.830  29.227 -68.835 1.00 85.90  ? 114 ALA A CB    1 
ATOM   616   N  N     . LYS A 1 76  ? 21.368  32.262 -70.782 1.00 89.93  ? 115 LYS A N     1 
ATOM   617   C  CA    . LYS A 1 76  ? 20.831  32.881 -72.007 1.00 90.98  ? 115 LYS A CA    1 
ATOM   618   C  C     . LYS A 1 76  ? 19.560  32.168 -72.520 1.00 94.87  ? 115 LYS A C     1 
ATOM   619   O  O     . LYS A 1 76  ? 19.270  32.209 -73.719 1.00 95.81  ? 115 LYS A O     1 
ATOM   620   C  CB    . LYS A 1 76  ? 21.874  33.065 -73.147 1.00 94.94  ? 115 LYS A CB    1 
ATOM   621   C  CG    . LYS A 1 76  ? 23.263  33.601 -72.792 1.00 118.37 ? 115 LYS A CG    1 
ATOM   622   C  CD    . LYS A 1 76  ? 24.305  32.453 -72.763 1.00 136.77 ? 115 LYS A CD    1 
ATOM   623   C  CE    . LYS A 1 76  ? 24.573  31.673 -74.060 1.00 148.64 ? 115 LYS A CE    1 
ATOM   624   N  NZ    . LYS A 1 76  ? 24.190  30.231 -73.915 1.00 150.13 ? 115 LYS A NZ    1 
ATOM   625   N  N     . ARG A 1 77  ? 18.799  31.541 -71.610 1.00 89.73  ? 116 ARG A N     1 
ATOM   626   C  CA    . ARG A 1 77  ? 17.525  30.891 -71.918 1.00 88.89  ? 116 ARG A CA    1 
ATOM   627   C  C     . ARG A 1 77  ? 16.370  31.766 -71.395 1.00 94.75  ? 116 ARG A C     1 
ATOM   628   O  O     . ARG A 1 77  ? 16.580  32.697 -70.606 1.00 92.92  ? 116 ARG A O     1 
ATOM   629   C  CB    . ARG A 1 77  ? 17.457  29.476 -71.332 1.00 87.16  ? 116 ARG A CB    1 
ATOM   630   C  CG    . ARG A 1 77  ? 18.241  28.444 -72.121 1.00 94.40  ? 116 ARG A CG    1 
ATOM   631   C  CD    . ARG A 1 77  ? 18.115  27.041 -71.540 1.00 95.00  ? 116 ARG A CD    1 
ATOM   632   N  NE    . ARG A 1 77  ? 19.004  26.834 -70.398 1.00 92.94  ? 116 ARG A NE    1 
ATOM   633   C  CZ    . ARG A 1 77  ? 18.613  26.863 -69.127 1.00 97.52  ? 116 ARG A CZ    1 
ATOM   634   N  NH1   . ARG A 1 77  ? 17.339  27.076 -68.821 1.00 77.56  ? 116 ARG A NH1   1 
ATOM   635   N  NH2   . ARG A 1 77  ? 19.491  26.671 -68.154 1.00 79.25  ? 116 ARG A NH2   1 
ATOM   636   N  N     . VAL A 1 78  ? 15.157  31.466 -71.863 1.00 94.15  ? 117 VAL A N     1 
ATOM   637   C  CA    . VAL A 1 78  ? 13.918  32.177 -71.540 1.00 95.43  ? 117 VAL A CA    1 
ATOM   638   C  C     . VAL A 1 78  ? 13.033  31.231 -70.730 1.00 95.84  ? 117 VAL A C     1 
ATOM   639   O  O     . VAL A 1 78  ? 12.328  31.673 -69.808 1.00 95.40  ? 117 VAL A O     1 
ATOM   640   C  CB    . VAL A 1 78  ? 13.248  32.653 -72.873 1.00 101.87 ? 117 VAL A CB    1 
ATOM   641   C  CG1   . VAL A 1 78  ? 11.745  32.909 -72.727 1.00 102.24 ? 117 VAL A CG1   1 
ATOM   642   C  CG2   . VAL A 1 78  ? 13.958  33.885 -73.445 1.00 101.91 ? 117 VAL A CG2   1 
ATOM   643   N  N     . THR A 1 79  ? 13.105  29.927 -71.084 1.00 89.62  ? 118 THR A N     1 
ATOM   644   C  CA    . THR A 1 79  ? 12.378  28.810 -70.475 1.00 88.10  ? 118 THR A CA    1 
ATOM   645   C  C     . THR A 1 79  ? 13.184  28.117 -69.364 1.00 88.33  ? 118 THR A C     1 
ATOM   646   O  O     . THR A 1 79  ? 14.338  27.716 -69.569 1.00 88.05  ? 118 THR A O     1 
ATOM   647   C  CB    . THR A 1 79  ? 11.817  27.794 -71.516 1.00 94.38  ? 118 THR A CB    1 
ATOM   648   O  OG1   . THR A 1 79  ? 11.924  26.449 -71.039 1.00 95.67  ? 118 THR A OG1   1 
ATOM   649   C  CG2   . THR A 1 79  ? 12.416  27.930 -72.908 1.00 91.90  ? 118 THR A CG2   1 
ATOM   650   N  N     . ILE A 1 80  ? 12.525  27.962 -68.195 1.00 81.34  ? 119 ILE A N     1 
ATOM   651   C  CA    . ILE A 1 80  ? 13.031  27.330 -66.975 1.00 79.18  ? 119 ILE A CA    1 
ATOM   652   C  C     . ILE A 1 80  ? 13.130  25.811 -67.146 1.00 82.86  ? 119 ILE A C     1 
ATOM   653   O  O     . ILE A 1 80  ? 12.238  25.187 -67.720 1.00 82.08  ? 119 ILE A O     1 
ATOM   654   C  CB    . ILE A 1 80  ? 12.219  27.746 -65.716 1.00 81.20  ? 119 ILE A CB    1 
ATOM   655   C  CG1   . ILE A 1 80  ? 10.712  27.422 -65.849 1.00 80.65  ? 119 ILE A CG1   1 
ATOM   656   C  CG2   . ILE A 1 80  ? 12.448  29.214 -65.409 1.00 82.80  ? 119 ILE A CG2   1 
ATOM   657   C  CD1   . ILE A 1 80  ? 9.945   27.343 -64.555 1.00 81.60  ? 119 ILE A CD1   1 
ATOM   658   N  N     . MET A 1 81  ? 14.225  25.229 -66.644 1.00 78.69  ? 120 MET A N     1 
ATOM   659   C  CA    . MET A 1 81  ? 14.551  23.812 -66.735 1.00 77.60  ? 120 MET A CA    1 
ATOM   660   C  C     . MET A 1 81  ? 14.890  23.260 -65.347 1.00 77.99  ? 120 MET A C     1 
ATOM   661   O  O     . MET A 1 81  ? 15.239  24.053 -64.474 1.00 76.40  ? 120 MET A O     1 
ATOM   662   C  CB    . MET A 1 81  ? 15.763  23.641 -67.661 1.00 80.46  ? 120 MET A CB    1 
ATOM   663   C  CG    . MET A 1 81  ? 15.439  23.816 -69.111 1.00 85.38  ? 120 MET A CG    1 
ATOM   664   S  SD    . MET A 1 81  ? 16.947  23.710 -70.077 1.00 91.55  ? 120 MET A SD    1 
ATOM   665   C  CE    . MET A 1 81  ? 16.266  23.336 -71.681 1.00 88.88  ? 120 MET A CE    1 
ATOM   666   N  N     . PRO A 1 82  ? 14.839  21.916 -65.108 1.00 73.79  ? 121 PRO A N     1 
ATOM   667   C  CA    . PRO A 1 82  ? 15.206  21.396 -63.772 1.00 72.89  ? 121 PRO A CA    1 
ATOM   668   C  C     . PRO A 1 82  ? 16.579  21.854 -63.247 1.00 74.50  ? 121 PRO A C     1 
ATOM   669   O  O     . PRO A 1 82  ? 16.702  22.176 -62.067 1.00 71.94  ? 121 PRO A O     1 
ATOM   670   C  CB    . PRO A 1 82  ? 15.136  19.879 -63.955 1.00 74.29  ? 121 PRO A CB    1 
ATOM   671   C  CG    . PRO A 1 82  ? 14.204  19.685 -65.075 1.00 78.69  ? 121 PRO A CG    1 
ATOM   672   C  CD    . PRO A 1 82  ? 14.459  20.806 -66.011 1.00 74.75  ? 121 PRO A CD    1 
ATOM   673   N  N     . LYS A 1 83  ? 17.587  21.941 -64.144 1.00 71.54  ? 122 LYS A N     1 
ATOM   674   C  CA    . LYS A 1 83  ? 18.956  22.366 -63.835 1.00 70.48  ? 122 LYS A CA    1 
ATOM   675   C  C     . LYS A 1 83  ? 19.019  23.767 -63.228 1.00 69.01  ? 122 LYS A C     1 
ATOM   676   O  O     . LYS A 1 83  ? 19.947  24.035 -62.459 1.00 68.94  ? 122 LYS A O     1 
ATOM   677   C  CB    . LYS A 1 83  ? 19.900  22.217 -65.050 1.00 73.92  ? 122 LYS A CB    1 
ATOM   678   C  CG    . LYS A 1 83  ? 19.566  23.018 -66.314 1.00 88.25  ? 122 LYS A CG    1 
ATOM   679   C  CD    . LYS A 1 83  ? 20.396  22.458 -67.471 1.00 98.26  ? 122 LYS A CD    1 
ATOM   680   C  CE    . LYS A 1 83  ? 20.763  23.479 -68.520 1.00 105.96 ? 122 LYS A CE    1 
ATOM   681   N  NZ    . LYS A 1 83  ? 21.882  23.005 -69.377 1.00 109.03 ? 122 LYS A NZ    1 
ATOM   682   N  N     . ASP A 1 84  ? 18.003  24.621 -63.527 1.00 60.79  ? 123 ASP A N     1 
ATOM   683   C  CA    . ASP A 1 84  ? 17.839  25.978 -62.977 1.00 58.70  ? 123 ASP A CA    1 
ATOM   684   C  C     . ASP A 1 84  ? 17.269  25.919 -61.545 1.00 59.28  ? 123 ASP A C     1 
ATOM   685   O  O     . ASP A 1 84  ? 17.805  26.593 -60.662 1.00 59.00  ? 123 ASP A O     1 
ATOM   686   C  CB    . ASP A 1 84  ? 16.951  26.856 -63.877 1.00 59.85  ? 123 ASP A CB    1 
ATOM   687   C  CG    . ASP A 1 84  ? 17.389  26.938 -65.328 1.00 64.92  ? 123 ASP A CG    1 
ATOM   688   O  OD1   . ASP A 1 84  ? 18.580  27.226 -65.575 1.00 65.41  ? 123 ASP A OD1   1 
ATOM   689   O  OD2   . ASP A 1 84  ? 16.532  26.741 -66.218 1.00 63.72  ? 123 ASP A OD2   1 
ATOM   690   N  N     . ILE A 1 85  ? 16.198  25.100 -61.316 1.00 52.70  ? 124 ILE A N     1 
ATOM   691   C  CA    . ILE A 1 85  ? 15.588  24.850 -59.999 1.00 49.91  ? 124 ILE A CA    1 
ATOM   692   C  C     . ILE A 1 85  ? 16.703  24.318 -59.083 1.00 50.30  ? 124 ILE A C     1 
ATOM   693   O  O     . ILE A 1 85  ? 16.862  24.787 -57.957 1.00 48.77  ? 124 ILE A O     1 
ATOM   694   C  CB    . ILE A 1 85  ? 14.378  23.845 -60.057 1.00 52.07  ? 124 ILE A CB    1 
ATOM   695   C  CG1   . ILE A 1 85  ? 13.163  24.460 -60.774 1.00 52.69  ? 124 ILE A CG1   1 
ATOM   696   C  CG2   . ILE A 1 85  ? 13.977  23.381 -58.649 1.00 51.57  ? 124 ILE A CG2   1 
ATOM   697   C  CD1   . ILE A 1 85  ? 11.924  23.538 -60.930 1.00 53.81  ? 124 ILE A CD1   1 
ATOM   698   N  N     . GLN A 1 86  ? 17.485  23.359 -59.595 1.00 46.37  ? 125 GLN A N     1 
ATOM   699   C  CA    . GLN A 1 86  ? 18.588  22.704 -58.892 1.00 46.12  ? 125 GLN A CA    1 
ATOM   700   C  C     . GLN A 1 86  ? 19.700  23.666 -58.489 1.00 47.95  ? 125 GLN A C     1 
ATOM   701   O  O     . GLN A 1 86  ? 20.177  23.593 -57.350 1.00 46.60  ? 125 GLN A O     1 
ATOM   702   C  CB    . GLN A 1 86  ? 19.150  21.567 -59.743 1.00 47.91  ? 125 GLN A CB    1 
ATOM   703   C  CG    . GLN A 1 86  ? 18.275  20.326 -59.784 1.00 64.09  ? 125 GLN A CG    1 
ATOM   704   C  CD    . GLN A 1 86  ? 18.649  19.429 -60.932 1.00 78.71  ? 125 GLN A CD    1 
ATOM   705   O  OE1   . GLN A 1 86  ? 19.819  19.338 -61.343 1.00 77.33  ? 125 GLN A OE1   1 
ATOM   706   N  NE2   . GLN A 1 86  ? 17.658  18.733 -61.470 1.00 64.06  ? 125 GLN A NE2   1 
ATOM   707   N  N     . LEU A 1 87  ? 20.115  24.562 -59.413 1.00 44.12  ? 126 LEU A N     1 
ATOM   708   C  CA    . LEU A 1 87  ? 21.169  25.538 -59.124 1.00 43.48  ? 126 LEU A CA    1 
ATOM   709   C  C     . LEU A 1 87  ? 20.695  26.560 -58.098 1.00 45.59  ? 126 LEU A C     1 
ATOM   710   O  O     . LEU A 1 87  ? 21.472  26.916 -57.204 1.00 45.05  ? 126 LEU A O     1 
ATOM   711   C  CB    . LEU A 1 87  ? 21.672  26.217 -60.408 1.00 43.57  ? 126 LEU A CB    1 
ATOM   712   C  CG    . LEU A 1 87  ? 22.778  27.280 -60.269 1.00 48.37  ? 126 LEU A CG    1 
ATOM   713   C  CD1   . LEU A 1 87  ? 24.124  26.686 -59.932 1.00 48.32  ? 126 LEU A CD1   1 
ATOM   714   C  CD2   . LEU A 1 87  ? 22.927  28.042 -61.524 1.00 51.91  ? 126 LEU A CD2   1 
ATOM   715   N  N     . ALA A 1 88  ? 19.433  27.042 -58.233 1.00 40.88  ? 127 ALA A N     1 
ATOM   716   C  CA    . ALA A 1 88  ? 18.827  28.002 -57.294 1.00 39.33  ? 127 ALA A CA    1 
ATOM   717   C  C     . ALA A 1 88  ? 18.811  27.369 -55.894 1.00 45.10  ? 127 ALA A C     1 
ATOM   718   O  O     . ALA A 1 88  ? 19.204  28.029 -54.937 1.00 45.61  ? 127 ALA A O     1 
ATOM   719   C  CB    . ALA A 1 88  ? 17.411  28.358 -57.727 1.00 39.10  ? 127 ALA A CB    1 
ATOM   720   N  N     . ARG A 1 89  ? 18.444  26.060 -55.791 1.00 40.58  ? 128 ARG A N     1 
ATOM   721   C  CA    . ARG A 1 89  ? 18.367  25.351 -54.521 1.00 39.27  ? 128 ARG A CA    1 
ATOM   722   C  C     . ARG A 1 89  ? 19.728  25.073 -53.946 1.00 42.92  ? 128 ARG A C     1 
ATOM   723   O  O     . ARG A 1 89  ? 19.878  25.106 -52.728 1.00 41.82  ? 128 ARG A O     1 
ATOM   724   C  CB    . ARG A 1 89  ? 17.517  24.092 -54.649 1.00 36.96  ? 128 ARG A CB    1 
ATOM   725   C  CG    . ARG A 1 89  ? 16.042  24.418 -54.839 1.00 40.81  ? 128 ARG A CG    1 
ATOM   726   C  CD    . ARG A 1 89  ? 15.177  23.176 -54.783 1.00 45.82  ? 128 ARG A CD    1 
ATOM   727   N  NE    . ARG A 1 89  ? 15.006  22.734 -53.411 1.00 45.34  ? 128 ARG A NE    1 
ATOM   728   C  CZ    . ARG A 1 89  ? 15.460  21.585 -52.931 1.00 59.44  ? 128 ARG A CZ    1 
ATOM   729   N  NH1   . ARG A 1 89  ? 16.122  20.748 -53.714 1.00 42.93  ? 128 ARG A NH1   1 
ATOM   730   N  NH2   . ARG A 1 89  ? 15.230  21.250 -51.668 1.00 51.57  ? 128 ARG A NH2   1 
ATOM   731   N  N     . ARG A 1 90  ? 20.736  24.897 -54.821 1.00 40.47  ? 129 ARG A N     1 
ATOM   732   C  CA    . ARG A 1 90  ? 22.125  24.677 -54.429 1.00 41.14  ? 129 ARG A CA    1 
ATOM   733   C  C     . ARG A 1 90  ? 22.706  25.940 -53.763 1.00 45.69  ? 129 ARG A C     1 
ATOM   734   O  O     . ARG A 1 90  ? 23.209  25.876 -52.631 1.00 43.85  ? 129 ARG A O     1 
ATOM   735   C  CB    . ARG A 1 90  ? 22.979  24.279 -55.648 1.00 42.75  ? 129 ARG A CB    1 
ATOM   736   C  CG    . ARG A 1 90  ? 23.719  22.980 -55.459 1.00 62.29  ? 129 ARG A CG    1 
ATOM   737   C  CD    . ARG A 1 90  ? 25.237  23.110 -55.492 1.00 87.30  ? 129 ARG A CD    1 
ATOM   738   N  NE    . ARG A 1 90  ? 25.845  22.101 -56.382 1.00 109.88 ? 129 ARG A NE    1 
ATOM   739   C  CZ    . ARG A 1 90  ? 27.107  21.670 -56.310 1.00 125.63 ? 129 ARG A CZ    1 
ATOM   740   N  NH1   . ARG A 1 90  ? 27.561  20.777 -57.182 1.00 108.53 ? 129 ARG A NH1   1 
ATOM   741   N  NH2   . ARG A 1 90  ? 27.922  22.128 -55.365 1.00 116.45 ? 129 ARG A NH2   1 
ATOM   742   N  N     . ILE A 1 91  ? 22.608  27.087 -54.470 1.00 44.26  ? 130 ILE A N     1 
ATOM   743   C  CA    . ILE A 1 91  ? 23.112  28.391 -54.018 1.00 44.69  ? 130 ILE A CA    1 
ATOM   744   C  C     . ILE A 1 91  ? 22.369  28.869 -52.772 1.00 48.67  ? 130 ILE A C     1 
ATOM   745   O  O     . ILE A 1 91  ? 23.002  29.432 -51.873 1.00 49.60  ? 130 ILE A O     1 
ATOM   746   C  CB    . ILE A 1 91  ? 23.124  29.422 -55.176 1.00 48.09  ? 130 ILE A CB    1 
ATOM   747   C  CG1   . ILE A 1 91  ? 24.063  28.919 -56.303 1.00 49.18  ? 130 ILE A CG1   1 
ATOM   748   C  CG2   . ILE A 1 91  ? 23.523  30.818 -54.690 1.00 48.14  ? 130 ILE A CG2   1 
ATOM   749   C  CD1   . ILE A 1 91  ? 23.863  29.550 -57.566 1.00 59.65  ? 130 ILE A CD1   1 
ATOM   750   N  N     . ARG A 1 92  ? 21.050  28.574 -52.692 1.00 42.99  ? 131 ARG A N     1 
ATOM   751   C  CA    . ARG A 1 92  ? 20.178  28.873 -51.558 1.00 41.53  ? 131 ARG A CA    1 
ATOM   752   C  C     . ARG A 1 92  ? 20.613  28.010 -50.321 1.00 46.12  ? 131 ARG A C     1 
ATOM   753   O  O     . ARG A 1 92  ? 20.221  28.278 -49.187 1.00 45.82  ? 131 ARG A O     1 
ATOM   754   C  CB    . ARG A 1 92  ? 18.720  28.557 -51.949 1.00 37.55  ? 131 ARG A CB    1 
ATOM   755   C  CG    . ARG A 1 92  ? 17.876  29.724 -52.485 1.00 40.20  ? 131 ARG A CG    1 
ATOM   756   C  CD    . ARG A 1 92  ? 16.583  29.162 -53.067 1.00 41.40  ? 131 ARG A CD    1 
ATOM   757   N  NE    . ARG A 1 92  ? 15.487  30.128 -53.261 1.00 38.65  ? 131 ARG A NE    1 
ATOM   758   C  CZ    . ARG A 1 92  ? 14.254  29.958 -52.786 1.00 41.89  ? 131 ARG A CZ    1 
ATOM   759   N  NH1   . ARG A 1 92  ? 13.973  28.927 -52.009 1.00 37.42  ? 131 ARG A NH1   1 
ATOM   760   N  NH2   . ARG A 1 92  ? 13.305  30.836 -53.051 1.00 19.67  ? 131 ARG A NH2   1 
ATOM   761   N  N     . GLY A 1 93  ? 21.408  26.978 -50.562 1.00 44.02  ? 132 GLY A N     1 
ATOM   762   C  CA    . GLY A 1 93  ? 21.884  26.082 -49.516 1.00 44.38  ? 132 GLY A CA    1 
ATOM   763   C  C     . GLY A 1 93  ? 20.820  25.121 -49.032 1.00 50.67  ? 132 GLY A C     1 
ATOM   764   O  O     . GLY A 1 93  ? 20.810  24.727 -47.858 1.00 50.82  ? 132 GLY A O     1 
ATOM   765   N  N     . GLU A 1 94  ? 19.916  24.743 -49.944 1.00 47.83  ? 133 GLU A N     1 
ATOM   766   C  CA    . GLU A 1 94  ? 18.843  23.813 -49.652 1.00 47.36  ? 133 GLU A CA    1 
ATOM   767   C  C     . GLU A 1 94  ? 19.281  22.401 -49.914 1.00 53.56  ? 133 GLU A C     1 
ATOM   768   O  O     . GLU A 1 94  ? 18.842  21.524 -49.167 1.00 53.61  ? 133 GLU A O     1 
ATOM   769   C  CB    . GLU A 1 94  ? 17.580  24.161 -50.461 1.00 48.08  ? 133 GLU A CB    1 
ATOM   770   C  CG    . GLU A 1 94  ? 16.922  25.439 -49.978 1.00 52.34  ? 133 GLU A CG    1 
ATOM   771   C  CD    . GLU A 1 94  ? 15.737  25.936 -50.770 1.00 59.72  ? 133 GLU A CD    1 
ATOM   772   O  OE1   . GLU A 1 94  ? 15.239  25.181 -51.634 1.00 44.08  ? 133 GLU A OE1   1 
ATOM   773   O  OE2   . GLU A 1 94  ? 15.302  27.085 -50.518 1.00 51.55  ? 133 GLU A OE2   1 
ATOM   774   N  N     . ARG A 1 95  ? 20.172  22.198 -50.947 1.00 52.00  ? 134 ARG A N     1 
ATOM   775   C  CA    . ARG A 1 95  ? 20.798  20.979 -51.507 1.00 84.15  ? 134 ARG A CA    1 
ATOM   776   C  C     . ARG A 1 95  ? 19.855  19.737 -51.549 1.00 124.10 ? 134 ARG A C     1 
ATOM   777   O  O     . ARG A 1 95  ? 19.299  19.274 -50.542 1.00 81.97  ? 134 ARG A O     1 
ATOM   778   C  CB    . ARG A 1 95  ? 22.141  20.655 -50.809 1.00 85.33  ? 134 ARG A CB    1 
ATOM   779   C  CG    . ARG A 1 95  ? 23.307  20.267 -51.748 1.00 96.86  ? 134 ARG A CG    1 
ATOM   780   C  CD    . ARG A 1 95  ? 24.214  21.455 -52.073 1.00 109.17 ? 134 ARG A CD    1 
ATOM   781   N  NE    . ARG A 1 95  ? 25.649  21.169 -51.902 1.00 112.38 ? 134 ARG A NE    1 
ATOM   782   C  CZ    . ARG A 1 95  ? 26.625  22.081 -51.982 1.00 117.02 ? 134 ARG A CZ    1 
ATOM   783   N  NH1   . ARG A 1 95  ? 26.339  23.353 -52.249 1.00 106.63 ? 134 ARG A NH1   1 
ATOM   784   N  NH2   . ARG A 1 95  ? 27.889  21.729 -51.791 1.00 86.66  ? 134 ARG A NH2   1 
ATOM   785   N  N     . LYS B 2 1   ? -17.199 6.862  -36.069 1.00 147.76 ? 16  LYS B N     1 
ATOM   786   C  CA    . LYS B 2 1   ? -17.476 5.593  -35.353 1.00 147.68 ? 16  LYS B CA    1 
ATOM   787   C  C     . LYS B 2 1   ? -16.755 4.435  -36.052 1.00 151.64 ? 16  LYS B C     1 
ATOM   788   O  O     . LYS B 2 1   ? -16.782 3.326  -35.496 1.00 151.87 ? 16  LYS B O     1 
ATOM   789   C  CB    . LYS B 2 1   ? -18.986 5.343  -35.313 1.00 150.02 ? 16  LYS B CB    1 
ATOM   790   C  CG    . LYS B 2 1   ? -19.669 5.248  -36.671 1.00 157.36 ? 16  LYS B CG    1 
ATOM   791   C  CD    . LYS B 2 1   ? -20.352 3.922  -36.915 1.00 161.30 ? 16  LYS B CD    1 
ATOM   792   C  CE    . LYS B 2 1   ? -21.360 3.972  -38.041 1.00 165.33 ? 16  LYS B CE    1 
ATOM   793   N  NZ    . LYS B 2 1   ? -22.744 4.097  -37.530 1.00 168.16 ? 16  LYS B NZ    1 
ATOM   794   N  N     . ARG B 2 2   ? -16.121 4.691  -37.205 1.00 145.88 ? 17  ARG B N     1 
ATOM   795   C  CA    . ARG B 2 2   ? -15.433 3.615  -37.970 1.00 144.26 ? 17  ARG B CA    1 
ATOM   796   C  C     . ARG B 2 2   ? -14.342 4.194  -38.888 1.00 143.69 ? 17  ARG B C     1 
ATOM   797   O  O     . ARG B 2 2   ? -14.189 5.415  -38.945 1.00 142.16 ? 17  ARG B O     1 
ATOM   798   C  CB    . ARG B 2 2   ? -16.481 2.709  -38.640 1.00 144.61 ? 17  ARG B CB    1 
ATOM   799   C  CG    . ARG B 2 2   ? -16.766 2.942  -40.120 1.00 158.87 ? 17  ARG B CG    1 
ATOM   800   C  CD    . ARG B 2 2   ? -18.073 3.591  -40.524 1.00 174.92 ? 17  ARG B CD    1 
ATOM   801   N  NE    . ARG B 2 2   ? -17.798 4.845  -41.206 1.00 186.41 ? 17  ARG B NE    1 
ATOM   802   C  CZ    . ARG B 2 2   ? -18.674 5.524  -41.929 1.00 200.15 ? 17  ARG B CZ    1 
ATOM   803   N  NH1   . ARG B 2 2   ? -18.318 6.657  -42.504 1.00 185.16 ? 17  ARG B NH1   1 
ATOM   804   N  NH2   . ARG B 2 2   ? -19.903 5.069  -42.078 1.00 186.64 ? 17  ARG B NH2   1 
ATOM   805   N  N     . HIS B 2 3   ? -13.613 3.299  -39.560 1.00 137.75 ? 18  HIS B N     1 
ATOM   806   C  CA    . HIS B 2 3   ? -12.495 3.480  -40.527 1.00 134.99 ? 18  HIS B CA    1 
ATOM   807   C  C     . HIS B 2 3   ? -12.516 4.446  -41.717 1.00 125.27 ? 18  HIS B C     1 
ATOM   808   O  O     . HIS B 2 3   ? -13.414 4.374  -42.565 1.00 123.83 ? 18  HIS B O     1 
ATOM   809   C  CB    . HIS B 2 3   ? -12.397 2.194  -41.365 1.00 136.93 ? 18  HIS B CB    1 
ATOM   810   C  CG    . HIS B 2 3   ? -11.176 2.057  -42.212 1.00 141.30 ? 18  HIS B CG    1 
ATOM   811   N  ND1   . HIS B 2 3   ? -11.213 1.463  -43.450 1.00 143.62 ? 18  HIS B ND1   1 
ATOM   812   C  CD2   . HIS B 2 3   ? -9.894  2.427  -42.006 1.00 143.22 ? 18  HIS B CD2   1 
ATOM   813   C  CE1   . HIS B 2 3   ? -10.005 1.467  -43.972 1.00 143.20 ? 18  HIS B CE1   1 
ATOM   814   N  NE2   . HIS B 2 3   ? -9.181  2.080  -43.114 1.00 143.42 ? 18  HIS B NE2   1 
ATOM   815   N  N     . ARG B 2 4   ? -11.457 5.249  -41.784 1.00 113.08 ? 19  ARG B N     1 
ATOM   816   C  CA    . ARG B 2 4   ? -11.217 6.356  -42.735 1.00 109.18 ? 19  ARG B CA    1 
ATOM   817   C  C     . ARG B 2 4   ? -10.823 5.775  -44.102 1.00 105.18 ? 19  ARG B C     1 
ATOM   818   O  O     . ARG B 2 4   ? -10.793 4.569  -44.233 1.00 107.66 ? 19  ARG B O     1 
ATOM   819   C  CB    . ARG B 2 4   ? -10.002 7.111  -42.201 1.00 111.07 ? 19  ARG B CB    1 
ATOM   820   C  CG    . ARG B 2 4   ? -9.787  6.964  -40.701 1.00 126.51 ? 19  ARG B CG    1 
ATOM   821   C  CD    . ARG B 2 4   ? -8.485  6.300  -40.312 1.00 145.08 ? 19  ARG B CD    1 
ATOM   822   N  NE    . ARG B 2 4   ? -8.123  6.548  -38.925 1.00 159.74 ? 19  ARG B NE    1 
ATOM   823   C  CZ    . ARG B 2 4   ? -7.068  6.020  -38.314 1.00 174.39 ? 19  ARG B CZ    1 
ATOM   824   N  NH1   . ARG B 2 4   ? -6.811  6.314  -37.050 1.00 157.91 ? 19  ARG B NH1   1 
ATOM   825   N  NH2   . ARG B 2 4   ? -6.268  5.203  -38.972 1.00 162.39 ? 19  ARG B NH2   1 
ATOM   826   N  N     . LYS B 2 5   ? -10.563 6.623  -45.093 1.00 94.20  ? 20  LYS B N     1 
ATOM   827   C  CA    . LYS B 2 5   ? -10.086 6.277  -46.448 1.00 90.46  ? 20  LYS B CA    1 
ATOM   828   C  C     . LYS B 2 5   ? -8.567  6.415  -46.600 1.00 84.59  ? 20  LYS B C     1 
ATOM   829   O  O     . LYS B 2 5   ? -7.965  7.377  -46.095 1.00 80.76  ? 20  LYS B O     1 
ATOM   830   C  CB    . LYS B 2 5   ? -10.808 7.106  -47.538 1.00 93.93  ? 20  LYS B CB    1 
ATOM   831   C  CG    . LYS B 2 5   ? -10.282 6.964  -48.996 1.00 100.15 ? 20  LYS B CG    1 
ATOM   832   C  CD    . LYS B 2 5   ? -10.369 5.536  -49.603 1.00 96.50  ? 20  LYS B CD    1 
ATOM   833   C  CE    . LYS B 2 5   ? -11.333 5.406  -50.761 1.00 95.99  ? 20  LYS B CE    1 
ATOM   834   N  NZ    . LYS B 2 5   ? -10.929 6.201  -51.953 1.00 103.83 ? 20  LYS B NZ    1 
ATOM   835   N  N     . VAL B 2 6   ? -7.951  5.447  -47.330 1.00 75.53  ? 21  VAL B N     1 
ATOM   836   C  CA    . VAL B 2 6   ? -6.511  5.462  -47.579 1.00 71.71  ? 21  VAL B CA    1 
ATOM   837   C  C     . VAL B 2 6   ? -6.159  6.694  -48.466 1.00 68.70  ? 21  VAL B C     1 
ATOM   838   O  O     . VAL B 2 6   ? -6.944  7.097  -49.309 1.00 67.92  ? 21  VAL B O     1 
ATOM   839   C  CB    . VAL B 2 6   ? -5.940  4.095  -48.054 1.00 74.02  ? 21  VAL B CB    1 
ATOM   840   C  CG1   . VAL B 2 6   ? -6.718  3.498  -49.211 1.00 74.24  ? 21  VAL B CG1   1 
ATOM   841   C  CG2   . VAL B 2 6   ? -4.452  4.153  -48.351 1.00 73.11  ? 21  VAL B CG2   1 
ATOM   842   N  N     . LEU B 2 7   ? -5.047  7.353  -48.155 1.00 60.42  ? 22  LEU B N     1 
ATOM   843   C  CA    . LEU B 2 7   ? -4.554  8.520  -48.889 1.00 58.19  ? 22  LEU B CA    1 
ATOM   844   C  C     . LEU B 2 7   ? -3.320  8.135  -49.706 1.00 63.05  ? 22  LEU B C     1 
ATOM   845   O  O     . LEU B 2 7   ? -2.428  7.462  -49.172 1.00 65.06  ? 22  LEU B O     1 
ATOM   846   C  CB    . LEU B 2 7   ? -4.274  9.646  -47.895 1.00 56.99  ? 22  LEU B CB    1 
ATOM   847   C  CG    . LEU B 2 7   ? -5.514  10.490 -47.516 1.00 59.94  ? 22  LEU B CG    1 
ATOM   848   C  CD1   . LEU B 2 7   ? -5.259  11.356 -46.307 1.00 60.23  ? 22  LEU B CD1   1 
ATOM   849   C  CD2   . LEU B 2 7   ? -5.985  11.316 -48.676 1.00 55.58  ? 22  LEU B CD2   1 
ATOM   850   N  N     . ARG B 2 8   ? -3.338  8.403  -51.029 1.00 57.42  ? 23  ARG B N     1 
ATOM   851   C  CA    . ARG B 2 8   ? -2.260  8.003  -51.960 1.00 57.20  ? 23  ARG B CA    1 
ATOM   852   C  C     . ARG B 2 8   ? -2.193  8.932  -53.159 1.00 63.54  ? 23  ARG B C     1 
ATOM   853   O  O     . ARG B 2 8   ? -3.241  9.364  -53.631 1.00 64.64  ? 23  ARG B O     1 
ATOM   854   C  CB    . ARG B 2 8   ? -2.499  6.589  -52.546 1.00 56.35  ? 23  ARG B CB    1 
ATOM   855   C  CG    . ARG B 2 8   ? -2.919  5.494  -51.601 1.00 64.84  ? 23  ARG B CG    1 
ATOM   856   C  CD    . ARG B 2 8   ? -3.982  4.604  -52.199 1.00 75.54  ? 23  ARG B CD    1 
ATOM   857   N  NE    . ARG B 2 8   ? -3.463  3.874  -53.353 1.00 66.90  ? 23  ARG B NE    1 
ATOM   858   C  CZ    . ARG B 2 8   ? -4.210  3.402  -54.336 1.00 58.41  ? 23  ARG B CZ    1 
ATOM   859   N  NH1   . ARG B 2 8   ? -5.537  3.521  -54.296 1.00 50.85  ? 23  ARG B NH1   1 
ATOM   860   N  NH2   . ARG B 2 8   ? -3.645  2.830  -55.374 1.00 50.56  ? 23  ARG B NH2   1 
ATOM   861   N  N     . ASP B 2 9   ? -0.979  9.132  -53.726 1.00 61.42  ? 24  ASP B N     1 
ATOM   862   C  CA    . ASP B 2 9   ? -0.662  9.971  -54.910 1.00 61.68  ? 24  ASP B CA    1 
ATOM   863   C  C     . ASP B 2 9   ? -1.295  11.380 -54.911 1.00 64.42  ? 24  ASP B C     1 
ATOM   864   O  O     . ASP B 2 9   ? -1.678  11.876 -55.974 1.00 67.08  ? 24  ASP B O     1 
ATOM   865   C  CB    . ASP B 2 9   ? -1.017  9.215  -56.208 1.00 64.11  ? 24  ASP B CB    1 
ATOM   866   C  CG    . ASP B 2 9   ? -0.151  9.496  -57.431 1.00 80.36  ? 24  ASP B CG    1 
ATOM   867   O  OD1   . ASP B 2 9   ? 0.977   9.997  -57.257 1.00 82.76  ? 24  ASP B OD1   1 
ATOM   868   O  OD2   . ASP B 2 9   ? -0.603  9.191  -58.571 1.00 85.92  ? 24  ASP B OD2   1 
ATOM   869   N  N     . ASN B 2 10  ? -1.354  12.063 -53.754 1.00 57.43  ? 25  ASN B N     1 
ATOM   870   C  CA    . ASN B 2 10  ? -1.998  13.386 -53.671 1.00 53.67  ? 25  ASN B CA    1 
ATOM   871   C  C     . ASN B 2 10  ? -1.128  14.580 -54.160 1.00 56.57  ? 25  ASN B C     1 
ATOM   872   O  O     . ASN B 2 10  ? -1.669  15.685 -54.376 1.00 55.90  ? 25  ASN B O     1 
ATOM   873   C  CB    . ASN B 2 10  ? -2.559  13.629 -52.283 1.00 46.40  ? 25  ASN B CB    1 
ATOM   874   C  CG    . ASN B 2 10  ? -3.819  12.839 -52.082 1.00 66.26  ? 25  ASN B CG    1 
ATOM   875   O  OD1   . ASN B 2 10  ? -4.814  13.041 -52.791 1.00 66.64  ? 25  ASN B OD1   1 
ATOM   876   N  ND2   . ASN B 2 10  ? -3.799  11.884 -51.149 1.00 48.40  ? 25  ASN B ND2   1 
ATOM   877   N  N     . ILE B 2 11  ? 0.173   14.328 -54.438 1.00 51.39  ? 26  ILE B N     1 
ATOM   878   C  CA    . ILE B 2 11  ? 1.124   15.280 -55.022 1.00 49.98  ? 26  ILE B CA    1 
ATOM   879   C  C     . ILE B 2 11  ? 0.678   15.566 -56.475 1.00 57.59  ? 26  ILE B C     1 
ATOM   880   O  O     . ILE B 2 11  ? 1.067   16.578 -57.059 1.00 58.24  ? 26  ILE B O     1 
ATOM   881   C  CB    . ILE B 2 11  ? 2.579   14.723 -54.960 1.00 52.01  ? 26  ILE B CB    1 
ATOM   882   C  CG1   . ILE B 2 11  ? 3.632   15.817 -55.103 1.00 53.01  ? 26  ILE B CG1   1 
ATOM   883   C  CG2   . ILE B 2 11  ? 2.814   13.646 -56.006 1.00 51.96  ? 26  ILE B CG2   1 
ATOM   884   C  CD1   . ILE B 2 11  ? 3.817   16.743 -53.902 1.00 66.37  ? 26  ILE B CD1   1 
ATOM   885   N  N     . GLN B 2 12  ? -0.126  14.654 -57.067 1.00 56.81  ? 27  GLN B N     1 
ATOM   886   C  CA    . GLN B 2 12  ? -0.621  14.853 -58.420 1.00 57.00  ? 27  GLN B CA    1 
ATOM   887   C  C     . GLN B 2 12  ? -1.810  15.813 -58.415 1.00 61.92  ? 27  GLN B C     1 
ATOM   888   O  O     . GLN B 2 12  ? -2.305  16.187 -59.502 1.00 63.00  ? 27  GLN B O     1 
ATOM   889   C  CB    . GLN B 2 12  ? -0.898  13.525 -59.123 1.00 58.14  ? 27  GLN B CB    1 
ATOM   890   C  CG    . GLN B 2 12  ? 0.348   12.642 -59.252 1.00 67.90  ? 27  GLN B CG    1 
ATOM   891   C  CD    . GLN B 2 12  ? 1.435   13.202 -60.143 1.00 84.02  ? 27  GLN B CD    1 
ATOM   892   O  OE1   . GLN B 2 12  ? 1.207   13.626 -61.290 1.00 77.55  ? 27  GLN B OE1   1 
ATOM   893   N  NE2   . GLN B 2 12  ? 2.651   13.190 -59.632 1.00 76.24  ? 27  GLN B NE2   1 
ATOM   894   N  N     . GLY B 2 13  ? -2.205  16.243 -57.196 1.00 56.50  ? 28  GLY B N     1 
ATOM   895   C  CA    . GLY B 2 13  ? -3.265  17.212 -56.952 1.00 56.96  ? 28  GLY B CA    1 
ATOM   896   C  C     . GLY B 2 13  ? -2.770  18.626 -57.243 1.00 64.52  ? 28  GLY B C     1 
ATOM   897   O  O     . GLY B 2 13  ? -3.560  19.564 -57.423 1.00 66.41  ? 28  GLY B O     1 
ATOM   898   N  N     . ILE B 2 14  ? -1.429  18.789 -57.226 1.00 58.66  ? 29  ILE B N     1 
ATOM   899   C  CA    . ILE B 2 14  ? -0.711  20.005 -57.547 1.00 56.21  ? 29  ILE B CA    1 
ATOM   900   C  C     . ILE B 2 14  ? -0.518  19.789 -59.044 1.00 61.33  ? 29  ILE B C     1 
ATOM   901   O  O     . ILE B 2 14  ? 0.409   19.094 -59.479 1.00 61.29  ? 29  ILE B O     1 
ATOM   902   C  CB    . ILE B 2 14  ? 0.621   20.053 -56.754 1.00 58.02  ? 29  ILE B CB    1 
ATOM   903   C  CG1   . ILE B 2 14  ? 0.431   19.715 -55.252 1.00 56.80  ? 29  ILE B CG1   1 
ATOM   904   C  CG2   . ILE B 2 14  ? 1.354   21.369 -56.961 1.00 59.22  ? 29  ILE B CG2   1 
ATOM   905   C  CD1   . ILE B 2 14  ? -0.656  20.452 -54.432 1.00 47.33  ? 29  ILE B CD1   1 
ATOM   906   N  N     . THR B 2 15  ? -1.522  20.235 -59.804 1.00 58.80  ? 30  THR B N     1 
ATOM   907   C  CA    . THR B 2 15  ? -1.636  20.070 -61.254 1.00 59.14  ? 30  THR B CA    1 
ATOM   908   C  C     . THR B 2 15  ? -0.665  20.972 -62.045 1.00 64.10  ? 30  THR B C     1 
ATOM   909   O  O     . THR B 2 15  ? -0.067  21.884 -61.478 1.00 64.92  ? 30  THR B O     1 
ATOM   910   C  CB    . THR B 2 15  ? -3.117  20.262 -61.695 1.00 65.54  ? 30  THR B CB    1 
ATOM   911   O  OG1   . THR B 2 15  ? -3.523  21.580 -61.379 1.00 70.80  ? 30  THR B OG1   1 
ATOM   912   C  CG2   . THR B 2 15  ? -4.077  19.300 -61.030 1.00 60.15  ? 30  THR B CG2   1 
ATOM   913   N  N     . LYS B 2 16  ? -0.518  20.704 -63.356 1.00 61.22  ? 31  LYS B N     1 
ATOM   914   C  CA    . LYS B 2 16  ? 0.296   21.481 -64.284 1.00 61.86  ? 31  LYS B CA    1 
ATOM   915   C  C     . LYS B 2 16  ? -0.263  22.902 -64.335 1.00 69.08  ? 31  LYS B C     1 
ATOM   916   O  O     . LYS B 2 16  ? 0.536   23.825 -64.178 1.00 70.45  ? 31  LYS B O     1 
ATOM   917   C  CB    . LYS B 2 16  ? 0.327   20.828 -65.685 1.00 64.92  ? 31  LYS B CB    1 
ATOM   918   C  CG    . LYS B 2 16  ? 0.766   21.757 -66.830 1.00 80.91  ? 31  LYS B CG    1 
ATOM   919   C  CD    . LYS B 2 16  ? 0.664   21.077 -68.190 1.00 89.88  ? 31  LYS B CD    1 
ATOM   920   C  CE    . LYS B 2 16  ? 1.373   21.840 -69.283 1.00 97.69  ? 31  LYS B CE    1 
ATOM   921   N  NZ    . LYS B 2 16  ? 1.581   20.989 -70.488 1.00 98.55  ? 31  LYS B NZ    1 
ATOM   922   N  N     . PRO B 2 17  ? -1.605  23.133 -64.460 1.00 66.53  ? 32  PRO B N     1 
ATOM   923   C  CA    . PRO B 2 17  ? -2.090  24.513 -64.474 1.00 66.67  ? 32  PRO B CA    1 
ATOM   924   C  C     . PRO B 2 17  ? -1.818  25.299 -63.191 1.00 68.96  ? 32  PRO B C     1 
ATOM   925   O  O     . PRO B 2 17  ? -1.506  26.476 -63.270 1.00 68.75  ? 32  PRO B O     1 
ATOM   926   C  CB    . PRO B 2 17  ? -3.590  24.360 -64.782 1.00 68.57  ? 32  PRO B CB    1 
ATOM   927   C  CG    . PRO B 2 17  ? -3.933  23.032 -64.388 1.00 72.68  ? 32  PRO B CG    1 
ATOM   928   C  CD    . PRO B 2 17  ? -2.729  22.198 -64.678 1.00 68.62  ? 32  PRO B CD    1 
ATOM   929   N  N     . ALA B 2 18  ? -1.927  24.649 -62.034 1.00 64.70  ? 33  ALA B N     1 
ATOM   930   C  CA    . ALA B 2 18  ? -1.667  25.267 -60.744 1.00 64.34  ? 33  ALA B CA    1 
ATOM   931   C  C     . ALA B 2 18  ? -0.178  25.635 -60.629 1.00 67.50  ? 33  ALA B C     1 
ATOM   932   O  O     . ALA B 2 18  ? 0.127   26.708 -60.110 1.00 70.86  ? 33  ALA B O     1 
ATOM   933   C  CB    . ALA B 2 18  ? -2.072  24.315 -59.625 1.00 65.66  ? 33  ALA B CB    1 
ATOM   934   N  N     . ILE B 2 19  ? 0.737   24.774 -61.152 1.00 60.23  ? 34  ILE B N     1 
ATOM   935   C  CA    . ILE B 2 19  ? 2.190   24.990 -61.152 1.00 58.12  ? 34  ILE B CA    1 
ATOM   936   C  C     . ILE B 2 19  ? 2.535   26.128 -62.116 1.00 62.51  ? 34  ILE B C     1 
ATOM   937   O  O     . ILE B 2 19  ? 3.374   26.956 -61.769 1.00 62.97  ? 34  ILE B O     1 
ATOM   938   C  CB    . ILE B 2 19  ? 3.004   23.663 -61.369 1.00 59.83  ? 34  ILE B CB    1 
ATOM   939   C  CG1   . ILE B 2 19  ? 2.916   22.775 -60.115 1.00 59.52  ? 34  ILE B CG1   1 
ATOM   940   C  CG2   . ILE B 2 19  ? 4.489   23.914 -61.712 1.00 59.50  ? 34  ILE B CG2   1 
ATOM   941   C  CD1   . ILE B 2 19  ? 3.189   21.301 -60.322 1.00 61.82  ? 34  ILE B CD1   1 
ATOM   942   N  N     . ARG B 2 20  ? 1.838   26.220 -63.268 1.00 60.18  ? 35  ARG B N     1 
ATOM   943   C  CA    . ARG B 2 20  ? 2.034   27.313 -64.230 1.00 62.03  ? 35  ARG B CA    1 
ATOM   944   C  C     . ARG B 2 20  ? 1.780   28.651 -63.563 1.00 66.06  ? 35  ARG B C     1 
ATOM   945   O  O     . ARG B 2 20  ? 2.602   29.574 -63.676 1.00 66.70  ? 35  ARG B O     1 
ATOM   946   C  CB    . ARG B 2 20  ? 1.060   27.206 -65.406 1.00 68.59  ? 35  ARG B CB    1 
ATOM   947   C  CG    . ARG B 2 20  ? 1.358   26.084 -66.367 1.00 91.56  ? 35  ARG B CG    1 
ATOM   948   C  CD    . ARG B 2 20  ? 0.443   26.208 -67.559 1.00 115.84 ? 35  ARG B CD    1 
ATOM   949   N  NE    . ARG B 2 20  ? 1.069   25.642 -68.748 1.00 135.01 ? 35  ARG B NE    1 
ATOM   950   C  CZ    . ARG B 2 20  ? 1.819   26.339 -69.593 1.00 154.62 ? 35  ARG B CZ    1 
ATOM   951   N  NH1   . ARG B 2 20  ? 2.357   25.749 -70.651 1.00 150.18 ? 35  ARG B NH1   1 
ATOM   952   N  NH2   . ARG B 2 20  ? 2.031   27.634 -69.392 1.00 136.14 ? 35  ARG B NH2   1 
ATOM   953   N  N     . ARG B 2 21  ? 0.625   28.756 -62.860 1.00 60.87  ? 36  ARG B N     1 
ATOM   954   C  CA    . ARG B 2 21  ? 0.194   29.977 -62.165 1.00 58.90  ? 36  ARG B CA    1 
ATOM   955   C  C     . ARG B 2 21  ? 1.285   30.442 -61.214 1.00 60.60  ? 36  ARG B C     1 
ATOM   956   O  O     . ARG B 2 21  ? 1.578   31.623 -61.184 1.00 59.71  ? 36  ARG B O     1 
ATOM   957   C  CB    . ARG B 2 21  ? -1.088  29.725 -61.367 1.00 57.19  ? 36  ARG B CB    1 
ATOM   958   C  CG    . ARG B 2 21  ? -2.310  29.515 -62.201 1.00 60.34  ? 36  ARG B CG    1 
ATOM   959   C  CD    . ARG B 2 21  ? -3.540  29.718 -61.355 1.00 67.79  ? 36  ARG B CD    1 
ATOM   960   N  NE    . ARG B 2 21  ? -3.968  28.528 -60.610 1.00 69.86  ? 36  ARG B NE    1 
ATOM   961   C  CZ    . ARG B 2 21  ? -4.791  27.597 -61.081 1.00 81.27  ? 36  ARG B CZ    1 
ATOM   962   N  NH1   . ARG B 2 21  ? -5.219  27.652 -62.335 1.00 91.73  ? 36  ARG B NH1   1 
ATOM   963   N  NH2   . ARG B 2 21  ? -5.177  26.599 -60.312 1.00 53.00  ? 36  ARG B NH2   1 
ATOM   964   N  N     . LEU B 2 22  ? 1.897   29.501 -60.441 1.00 56.99  ? 37  LEU B N     1 
ATOM   965   C  CA    . LEU B 2 22  ? 2.960   29.834 -59.496 1.00 55.11  ? 37  LEU B CA    1 
ATOM   966   C  C     . LEU B 2 22  ? 4.196   30.363 -60.219 1.00 61.46  ? 37  LEU B C     1 
ATOM   967   O  O     . LEU B 2 22  ? 4.811   31.319 -59.756 1.00 61.85  ? 37  LEU B O     1 
ATOM   968   C  CB    . LEU B 2 22  ? 3.294   28.639 -58.601 1.00 53.32  ? 37  LEU B CB    1 
ATOM   969   C  CG    . LEU B 2 22  ? 2.185   28.175 -57.644 1.00 54.38  ? 37  LEU B CG    1 
ATOM   970   C  CD1   . LEU B 2 22  ? 2.380   26.691 -57.249 1.00 51.48  ? 37  LEU B CD1   1 
ATOM   971   C  CD2   . LEU B 2 22  ? 2.087   29.069 -56.403 1.00 51.24  ? 37  LEU B CD2   1 
ATOM   972   N  N     . ALA B 2 23  ? 4.512   29.796 -61.389 1.00 59.18  ? 38  ALA B N     1 
ATOM   973   C  CA    . ALA B 2 23  ? 5.639   30.248 -62.189 1.00 58.95  ? 38  ALA B CA    1 
ATOM   974   C  C     . ALA B 2 23  ? 5.377   31.624 -62.769 1.00 65.33  ? 38  ALA B C     1 
ATOM   975   O  O     . ALA B 2 23  ? 6.321   32.396 -62.887 1.00 68.24  ? 38  ALA B O     1 
ATOM   976   C  CB    . ALA B 2 23  ? 5.930   29.254 -63.300 1.00 59.40  ? 38  ALA B CB    1 
ATOM   977   N  N     . ARG B 2 24  ? 4.106   31.946 -63.125 1.00 59.98  ? 39  ARG B N     1 
ATOM   978   C  CA    . ARG B 2 24  ? 3.725   33.250 -63.691 1.00 57.83  ? 39  ARG B CA    1 
ATOM   979   C  C     . ARG B 2 24  ? 3.865   34.358 -62.642 1.00 62.83  ? 39  ARG B C     1 
ATOM   980   O  O     . ARG B 2 24  ? 4.333   35.454 -62.964 1.00 64.68  ? 39  ARG B O     1 
ATOM   981   C  CB    . ARG B 2 24  ? 2.306   33.226 -64.297 1.00 53.32  ? 39  ARG B CB    1 
ATOM   982   C  CG    . ARG B 2 24  ? 2.123   32.282 -65.481 1.00 66.57  ? 39  ARG B CG    1 
ATOM   983   C  CD    . ARG B 2 24  ? 2.841   32.715 -66.743 1.00 77.45  ? 39  ARG B CD    1 
ATOM   984   N  NE    . ARG B 2 24  ? 2.361   31.972 -67.912 1.00 88.21  ? 39  ARG B NE    1 
ATOM   985   C  CZ    . ARG B 2 24  ? 3.118   31.161 -68.647 1.00 96.67  ? 39  ARG B CZ    1 
ATOM   986   N  NH1   . ARG B 2 24  ? 4.397   30.980 -68.343 1.00 79.91  ? 39  ARG B NH1   1 
ATOM   987   N  NH2   . ARG B 2 24  ? 2.600   30.526 -69.695 1.00 76.49  ? 39  ARG B NH2   1 
ATOM   988   N  N     . ARG B 2 25  ? 3.498   34.076 -61.384 1.00 57.96  ? 40  ARG B N     1 
ATOM   989   C  CA    . ARG B 2 25  ? 3.666   35.048 -60.305 1.00 57.35  ? 40  ARG B CA    1 
ATOM   990   C  C     . ARG B 2 25  ? 5.173   35.259 -60.055 1.00 63.31  ? 40  ARG B C     1 
ATOM   991   O  O     . ARG B 2 25  ? 5.589   36.380 -59.755 1.00 67.18  ? 40  ARG B O     1 
ATOM   992   C  CB    . ARG B 2 25  ? 2.946   34.569 -59.042 1.00 56.06  ? 40  ARG B CB    1 
ATOM   993   C  CG    . ARG B 2 25  ? 2.707   35.674 -58.026 1.00 49.10  ? 40  ARG B CG    1 
ATOM   994   C  CD    . ARG B 2 25  ? 1.710   35.258 -56.987 1.00 48.35  ? 40  ARG B CD    1 
ATOM   995   N  NE    . ARG B 2 25  ? 0.393   35.643 -57.463 1.00 52.24  ? 40  ARG B NE    1 
ATOM   996   C  CZ    . ARG B 2 25  ? -0.772  35.267 -56.944 1.00 63.27  ? 40  ARG B CZ    1 
ATOM   997   N  NH1   . ARG B 2 25  ? -0.810  34.441 -55.910 1.00 34.72  ? 40  ARG B NH1   1 
ATOM   998   N  NH2   . ARG B 2 25  ? -1.911  35.721 -57.455 1.00 56.84  ? 40  ARG B NH2   1 
ATOM   999   N  N     . GLY B 2 26  ? 5.966   34.199 -60.254 1.00 58.18  ? 41  GLY B N     1 
ATOM   1000  C  CA    . GLY B 2 26  ? 7.422   34.195 -60.191 1.00 57.67  ? 41  GLY B CA    1 
ATOM   1001  C  C     . GLY B 2 26  ? 8.035   34.859 -61.412 1.00 66.17  ? 41  GLY B C     1 
ATOM   1002  O  O     . GLY B 2 26  ? 9.251   35.039 -61.481 1.00 67.87  ? 41  GLY B O     1 
ATOM   1003  N  N     . GLY B 2 27  ? 7.185   35.262 -62.358 1.00 65.41  ? 42  GLY B N     1 
ATOM   1004  C  CA    . GLY B 2 27  ? 7.570   35.985 -63.571 1.00 66.39  ? 42  GLY B CA    1 
ATOM   1005  C  C     . GLY B 2 27  ? 8.300   35.130 -64.579 1.00 72.89  ? 42  GLY B C     1 
ATOM   1006  O  O     . GLY B 2 27  ? 9.344   35.539 -65.093 1.00 72.48  ? 42  GLY B O     1 
ATOM   1007  N  N     . VAL B 2 28  ? 7.753   33.928 -64.858 1.00 70.62  ? 43  VAL B N     1 
ATOM   1008  C  CA    . VAL B 2 28  ? 8.347   32.953 -65.776 1.00 70.71  ? 43  VAL B CA    1 
ATOM   1009  C  C     . VAL B 2 28  ? 7.613   32.995 -67.117 1.00 75.32  ? 43  VAL B C     1 
ATOM   1010  O  O     . VAL B 2 28  ? 6.390   32.810 -67.146 1.00 73.41  ? 43  VAL B O     1 
ATOM   1011  C  CB    . VAL B 2 28  ? 8.394   31.527 -65.146 1.00 73.77  ? 43  VAL B CB    1 
ATOM   1012  C  CG1   . VAL B 2 28  ? 8.752   30.477 -66.181 1.00 74.36  ? 43  VAL B CG1   1 
ATOM   1013  C  CG2   . VAL B 2 28  ? 9.352   31.454 -63.958 1.00 72.84  ? 43  VAL B CG2   1 
ATOM   1014  N  N     . LYS B 2 29  ? 8.365   33.232 -68.218 1.00 73.31  ? 44  LYS B N     1 
ATOM   1015  C  CA    . LYS B 2 29  ? 7.784   33.318 -69.558 1.00 74.35  ? 44  LYS B CA    1 
ATOM   1016  C  C     . LYS B 2 29  ? 7.522   31.959 -70.200 1.00 82.34  ? 44  LYS B C     1 
ATOM   1017  O  O     . LYS B 2 29  ? 6.537   31.812 -70.943 1.00 83.80  ? 44  LYS B O     1 
ATOM   1018  C  CB    . LYS B 2 29  ? 8.655   34.181 -70.485 1.00 77.09  ? 44  LYS B CB    1 
ATOM   1019  C  CG    . LYS B 2 29  ? 7.926   34.716 -71.731 1.00 89.13  ? 44  LYS B CG    1 
ATOM   1020  C  CD    . LYS B 2 29  ? 8.865   35.503 -72.637 1.00 96.41  ? 44  LYS B CD    1 
ATOM   1021  C  CE    . LYS B 2 29  ? 8.371   35.631 -74.059 1.00 101.33 ? 44  LYS B CE    1 
ATOM   1022  N  NZ    . LYS B 2 29  ? 9.343   36.371 -74.902 1.00 110.30 ? 44  LYS B NZ    1 
ATOM   1023  N  N     . ARG B 2 30  ? 8.434   30.988 -69.990 1.00 78.72  ? 45  ARG B N     1 
ATOM   1024  C  CA    . ARG B 2 30  ? 8.290   29.668 -70.606 1.00 78.45  ? 45  ARG B CA    1 
ATOM   1025  C  C     . ARG B 2 30  ? 8.718   28.555 -69.626 1.00 80.46  ? 45  ARG B C     1 
ATOM   1026  O  O     . ARG B 2 30  ? 9.650   28.728 -68.844 1.00 79.73  ? 45  ARG B O     1 
ATOM   1027  C  CB    . ARG B 2 30  ? 9.011   29.630 -71.975 1.00 80.18  ? 45  ARG B CB    1 
ATOM   1028  C  CG    . ARG B 2 30  ? 8.424   28.639 -72.962 1.00 91.67  ? 45  ARG B CG    1 
ATOM   1029  C  CD    . ARG B 2 30  ? 9.016   28.762 -74.351 1.00 103.77 ? 45  ARG B CD    1 
ATOM   1030  N  NE    . ARG B 2 30  ? 8.322   27.898 -75.308 1.00 127.77 ? 45  ARG B NE    1 
ATOM   1031  C  CZ    . ARG B 2 30  ? 7.544   28.331 -76.303 1.00 159.88 ? 45  ARG B CZ    1 
ATOM   1032  N  NH1   . ARG B 2 30  ? 7.359   29.635 -76.496 1.00 152.82 ? 45  ARG B NH1   1 
ATOM   1033  N  NH2   . ARG B 2 30  ? 6.959   27.462 -77.124 1.00 152.19 ? 45  ARG B NH2   1 
ATOM   1034  N  N     . ILE B 2 31  ? 7.965   27.453 -69.614 1.00 76.07  ? 46  ILE B N     1 
ATOM   1035  C  CA    . ILE B 2 31  ? 8.145   26.335 -68.701 1.00 75.15  ? 46  ILE B CA    1 
ATOM   1036  C  C     . ILE B 2 31  ? 8.415   25.003 -69.433 1.00 83.26  ? 46  ILE B C     1 
ATOM   1037  O  O     . ILE B 2 31  ? 7.561   24.526 -70.195 1.00 84.44  ? 46  ILE B O     1 
ATOM   1038  C  CB    . ILE B 2 31  ? 6.889   26.239 -67.779 1.00 76.94  ? 46  ILE B CB    1 
ATOM   1039  C  CG1   . ILE B 2 31  ? 6.706   27.493 -66.910 1.00 75.84  ? 46  ILE B CG1   1 
ATOM   1040  C  CG2   . ILE B 2 31  ? 6.907   24.975 -66.914 1.00 78.02  ? 46  ILE B CG2   1 
ATOM   1041  C  CD1   . ILE B 2 31  ? 5.277   27.840 -66.650 1.00 74.50  ? 46  ILE B CD1   1 
ATOM   1042  N  N     . SER B 2 32  ? 9.566   24.360 -69.121 1.00 81.10  ? 47  SER B N     1 
ATOM   1043  C  CA    . SER B 2 32  ? 9.944   23.032 -69.629 1.00 81.15  ? 47  SER B CA    1 
ATOM   1044  C  C     . SER B 2 32  ? 8.935   21.989 -69.112 1.00 85.94  ? 47  SER B C     1 
ATOM   1045  O  O     . SER B 2 32  ? 8.272   22.219 -68.101 1.00 85.63  ? 47  SER B O     1 
ATOM   1046  C  CB    . SER B 2 32  ? 11.352  22.666 -69.156 1.00 85.30  ? 47  SER B CB    1 
ATOM   1047  O  OG    . SER B 2 32  ? 11.780  21.390 -69.605 1.00 100.06 ? 47  SER B OG    1 
ATOM   1048  N  N     . GLY B 2 33  ? 8.839   20.853 -69.799 1.00 83.45  ? 48  GLY B N     1 
ATOM   1049  C  CA    . GLY B 2 33  ? 7.938   19.766 -69.424 1.00 82.55  ? 48  GLY B CA    1 
ATOM   1050  C  C     . GLY B 2 33  ? 8.360   19.037 -68.169 1.00 84.35  ? 48  GLY B C     1 
ATOM   1051  O  O     . GLY B 2 33  ? 7.524   18.450 -67.473 1.00 85.78  ? 48  GLY B O     1 
ATOM   1052  N  N     . LEU B 2 34  ? 9.665   19.065 -67.875 1.00 77.47  ? 49  LEU B N     1 
ATOM   1053  C  CA    . LEU B 2 34  ? 10.216  18.362 -66.722 1.00 76.50  ? 49  LEU B CA    1 
ATOM   1054  C  C     . LEU B 2 34  ? 10.044  19.127 -65.432 1.00 75.90  ? 49  LEU B C     1 
ATOM   1055  O  O     . LEU B 2 34  ? 10.213  18.550 -64.361 1.00 77.38  ? 49  LEU B O     1 
ATOM   1056  C  CB    . LEU B 2 34  ? 11.692  17.984 -66.958 1.00 76.89  ? 49  LEU B CB    1 
ATOM   1057  C  CG    . LEU B 2 34  ? 12.020  17.262 -68.279 1.00 81.20  ? 49  LEU B CG    1 
ATOM   1058  C  CD1   . LEU B 2 34  ? 13.429  17.586 -68.739 1.00 81.61  ? 49  LEU B CD1   1 
ATOM   1059  C  CD2   . LEU B 2 34  ? 11.729  15.754 -68.202 1.00 80.69  ? 49  LEU B CD2   1 
ATOM   1060  N  N     . ILE B 2 35  ? 9.685   20.410 -65.533 1.00 67.78  ? 50  ILE B N     1 
ATOM   1061  C  CA    . ILE B 2 35  ? 9.483   21.334 -64.405 1.00 65.46  ? 50  ILE B CA    1 
ATOM   1062  C  C     . ILE B 2 35  ? 8.363   20.864 -63.485 1.00 68.59  ? 50  ILE B C     1 
ATOM   1063  O  O     . ILE B 2 35  ? 8.485   20.997 -62.270 1.00 69.43  ? 50  ILE B O     1 
ATOM   1064  C  CB    . ILE B 2 35  ? 9.221   22.791 -64.921 1.00 66.29  ? 50  ILE B CB    1 
ATOM   1065  C  CG1   . ILE B 2 35  ? 10.490  23.434 -65.519 1.00 65.66  ? 50  ILE B CG1   1 
ATOM   1066  C  CG2   . ILE B 2 35  ? 8.565   23.687 -63.883 1.00 64.30  ? 50  ILE B CG2   1 
ATOM   1067  C  CD1   . ILE B 2 35  ? 11.585  23.830 -64.575 1.00 63.80  ? 50  ILE B CD1   1 
ATOM   1068  N  N     . TYR B 2 36  ? 7.269   20.352 -64.061 1.00 62.79  ? 51  TYR B N     1 
ATOM   1069  C  CA    . TYR B 2 36  ? 6.094   19.961 -63.299 1.00 61.98  ? 51  TYR B CA    1 
ATOM   1070  C  C     . TYR B 2 36  ? 6.394   18.879 -62.263 1.00 64.33  ? 51  TYR B C     1 
ATOM   1071  O  O     . TYR B 2 36  ? 6.060   19.079 -61.091 1.00 64.31  ? 51  TYR B O     1 
ATOM   1072  C  CB    . TYR B 2 36  ? 4.929   19.604 -64.233 1.00 62.98  ? 51  TYR B CB    1 
ATOM   1073  C  CG    . TYR B 2 36  ? 4.665   20.693 -65.256 1.00 64.60  ? 51  TYR B CG    1 
ATOM   1074  C  CD1   . TYR B 2 36  ? 4.188   21.942 -64.868 1.00 67.31  ? 51  TYR B CD1   1 
ATOM   1075  C  CD2   . TYR B 2 36  ? 4.951   20.496 -66.600 1.00 65.67  ? 51  TYR B CD2   1 
ATOM   1076  C  CE1   . TYR B 2 36  ? 3.988   22.964 -65.796 1.00 70.35  ? 51  TYR B CE1   1 
ATOM   1077  C  CE2   . TYR B 2 36  ? 4.729   21.498 -67.543 1.00 67.90  ? 51  TYR B CE2   1 
ATOM   1078  C  CZ    . TYR B 2 36  ? 4.237   22.731 -67.140 1.00 81.44  ? 51  TYR B CZ    1 
ATOM   1079  O  OH    . TYR B 2 36  ? 4.034   23.730 -68.074 1.00 87.33  ? 51  TYR B OH    1 
ATOM   1080  N  N     . GLU B 2 37  ? 7.092   17.791 -62.652 1.00 60.38  ? 52  GLU B N     1 
ATOM   1081  C  CA    . GLU B 2 37  ? 7.480   16.736 -61.701 1.00 58.99  ? 52  GLU B CA    1 
ATOM   1082  C  C     . GLU B 2 37  ? 8.537   17.245 -60.715 1.00 58.08  ? 52  GLU B C     1 
ATOM   1083  O  O     . GLU B 2 37  ? 8.537   16.797 -59.573 1.00 59.47  ? 52  GLU B O     1 
ATOM   1084  C  CB    . GLU B 2 37  ? 7.995   15.455 -62.405 1.00 60.86  ? 52  GLU B CB    1 
ATOM   1085  C  CG    . GLU B 2 37  ? 7.191   14.154 -62.236 1.00 73.24  ? 52  GLU B CG    1 
ATOM   1086  C  CD    . GLU B 2 37  ? 6.305   13.934 -61.013 1.00 92.74  ? 52  GLU B CD    1 
ATOM   1087  O  OE1   . GLU B 2 37  ? 6.793   14.047 -59.858 1.00 76.34  ? 52  GLU B OE1   1 
ATOM   1088  O  OE2   . GLU B 2 37  ? 5.109   13.625 -61.227 1.00 80.59  ? 52  GLU B OE2   1 
ATOM   1089  N  N     . GLU B 2 38  ? 9.421   18.172 -61.143 1.00 49.48  ? 53  GLU B N     1 
ATOM   1090  C  CA    . GLU B 2 38  ? 10.491  18.726 -60.319 1.00 47.58  ? 53  GLU B CA    1 
ATOM   1091  C  C     . GLU B 2 38  ? 9.939   19.634 -59.206 1.00 50.46  ? 53  GLU B C     1 
ATOM   1092  O  O     . GLU B 2 38  ? 10.401  19.563 -58.070 1.00 49.07  ? 53  GLU B O     1 
ATOM   1093  C  CB    . GLU B 2 38  ? 11.488  19.461 -61.206 1.00 48.82  ? 53  GLU B CB    1 
ATOM   1094  C  CG    . GLU B 2 38  ? 12.782  19.840 -60.530 1.00 58.87  ? 53  GLU B CG    1 
ATOM   1095  C  CD    . GLU B 2 38  ? 13.830  18.753 -60.439 1.00 68.15  ? 53  GLU B CD    1 
ATOM   1096  O  OE1   . GLU B 2 38  ? 13.613  17.662 -61.012 1.00 75.90  ? 53  GLU B OE1   1 
ATOM   1097  O  OE2   . GLU B 2 38  ? 14.896  19.010 -59.834 1.00 58.25  ? 53  GLU B OE2   1 
ATOM   1098  N  N     . THR B 2 39  ? 8.936   20.468 -59.535 1.00 47.43  ? 54  THR B N     1 
ATOM   1099  C  CA    . THR B 2 39  ? 8.226   21.347 -58.599 1.00 46.32  ? 54  THR B CA    1 
ATOM   1100  C  C     . THR B 2 39  ? 7.533   20.451 -57.573 1.00 49.07  ? 54  THR B C     1 
ATOM   1101  O  O     . THR B 2 39  ? 7.598   20.751 -56.386 1.00 49.22  ? 54  THR B O     1 
ATOM   1102  C  CB    . THR B 2 39  ? 7.239   22.261 -59.356 1.00 54.81  ? 54  THR B CB    1 
ATOM   1103  O  OG1   . THR B 2 39  ? 7.958   22.999 -60.340 1.00 57.58  ? 54  THR B OG1   1 
ATOM   1104  C  CG2   . THR B 2 39  ? 6.545   23.254 -58.454 1.00 55.61  ? 54  THR B CG2   1 
ATOM   1105  N  N     . ARG B 2 40  ? 6.930   19.321 -58.025 1.00 43.11  ? 55  ARG B N     1 
ATOM   1106  C  CA    . ARG B 2 40  ? 6.264   18.339 -57.165 1.00 41.97  ? 55  ARG B CA    1 
ATOM   1107  C  C     . ARG B 2 40  ? 7.246   17.738 -56.136 1.00 44.14  ? 55  ARG B C     1 
ATOM   1108  O  O     . ARG B 2 40  ? 6.901   17.631 -54.956 1.00 44.52  ? 55  ARG B O     1 
ATOM   1109  C  CB    . ARG B 2 40  ? 5.572   17.245 -58.001 1.00 39.28  ? 55  ARG B CB    1 
ATOM   1110  C  CG    . ARG B 2 40  ? 4.238   17.686 -58.579 1.00 49.19  ? 55  ARG B CG    1 
ATOM   1111  C  CD    . ARG B 2 40  ? 3.543   16.586 -59.359 1.00 55.60  ? 55  ARG B CD    1 
ATOM   1112  N  NE    . ARG B 2 40  ? 2.422   17.127 -60.132 1.00 70.86  ? 55  ARG B NE    1 
ATOM   1113  C  CZ    . ARG B 2 40  ? 2.394   17.205 -61.458 1.00 94.13  ? 55  ARG B CZ    1 
ATOM   1114  N  NH1   . ARG B 2 40  ? 3.411   16.747 -62.180 1.00 93.47  ? 55  ARG B NH1   1 
ATOM   1115  N  NH2   . ARG B 2 40  ? 1.335   17.705 -62.076 1.00 81.28  ? 55  ARG B NH2   1 
ATOM   1116  N  N     . GLY B 2 41  ? 8.457   17.395 -56.596 1.00 36.45  ? 56  GLY B N     1 
ATOM   1117  C  CA    . GLY B 2 41  ? 9.526   16.875 -55.760 1.00 34.25  ? 56  GLY B CA    1 
ATOM   1118  C  C     . GLY B 2 41  ? 9.938   17.844 -54.679 1.00 38.96  ? 56  GLY B C     1 
ATOM   1119  O  O     . GLY B 2 41  ? 9.976   17.472 -53.503 1.00 37.18  ? 56  GLY B O     1 
ATOM   1120  N  N     . VAL B 2 42  ? 10.169  19.130 -55.086 1.00 37.14  ? 57  VAL B N     1 
ATOM   1121  C  CA    . VAL B 2 42  ? 10.583  20.273 -54.254 1.00 36.51  ? 57  VAL B CA    1 
ATOM   1122  C  C     . VAL B 2 42  ? 9.498   20.682 -53.248 1.00 39.59  ? 57  VAL B C     1 
ATOM   1123  O  O     . VAL B 2 42  ? 9.820   20.951 -52.101 1.00 39.62  ? 57  VAL B O     1 
ATOM   1124  C  CB    . VAL B 2 42  ? 11.067  21.439 -55.150 1.00 40.29  ? 57  VAL B CB    1 
ATOM   1125  C  CG1   . VAL B 2 42  ? 11.255  22.723 -54.367 1.00 39.39  ? 57  VAL B CG1   1 
ATOM   1126  C  CG2   . VAL B 2 42  ? 12.368  21.055 -55.849 1.00 40.63  ? 57  VAL B CG2   1 
ATOM   1127  N  N     . LEU B 2 43  ? 8.230   20.692 -53.665 1.00 36.56  ? 58  LEU B N     1 
ATOM   1128  C  CA    . LEU B 2 43  ? 7.091   21.020 -52.807 1.00 36.84  ? 58  LEU B CA    1 
ATOM   1129  C  C     . LEU B 2 43  ? 6.895   19.980 -51.700 1.00 42.77  ? 58  LEU B C     1 
ATOM   1130  O  O     . LEU B 2 43  ? 6.616   20.356 -50.558 1.00 44.31  ? 58  LEU B O     1 
ATOM   1131  C  CB    . LEU B 2 43  ? 5.804   21.230 -53.641 1.00 36.43  ? 58  LEU B CB    1 
ATOM   1132  C  CG    . LEU B 2 43  ? 4.475   21.397 -52.896 1.00 39.44  ? 58  LEU B CG    1 
ATOM   1133  C  CD1   . LEU B 2 43  ? 4.407   22.681 -52.147 1.00 38.87  ? 58  LEU B CD1   1 
ATOM   1134  C  CD2   . LEU B 2 43  ? 3.354   21.371 -53.830 1.00 39.35  ? 58  LEU B CD2   1 
ATOM   1135  N  N     . LYS B 2 44  ? 7.057   18.690 -52.036 1.00 40.21  ? 59  LYS B N     1 
ATOM   1136  C  CA    . LYS B 2 44  ? 6.925   17.561 -51.102 1.00 39.06  ? 59  LYS B CA    1 
ATOM   1137  C  C     . LYS B 2 44  ? 7.967   17.657 -50.019 1.00 41.01  ? 59  LYS B C     1 
ATOM   1138  O  O     . LYS B 2 44  ? 7.631   17.442 -48.867 1.00 41.43  ? 59  LYS B O     1 
ATOM   1139  C  CB    . LYS B 2 44  ? 6.986   16.178 -51.805 1.00 40.95  ? 59  LYS B CB    1 
ATOM   1140  C  CG    . LYS B 2 44  ? 6.112   15.118 -51.107 1.00 50.44  ? 59  LYS B CG    1 
ATOM   1141  C  CD    . LYS B 2 44  ? 6.394   13.670 -51.526 1.00 63.73  ? 59  LYS B CD    1 
ATOM   1142  C  CE    . LYS B 2 44  ? 5.403   12.690 -50.902 1.00 79.07  ? 59  LYS B CE    1 
ATOM   1143  N  NZ    . LYS B 2 44  ? 4.754   11.739 -51.889 1.00 74.88  ? 59  LYS B NZ    1 
ATOM   1144  N  N     . VAL B 2 45  ? 9.221   18.003 -50.382 1.00 35.48  ? 60  VAL B N     1 
ATOM   1145  C  CA    . VAL B 2 45  ? 10.349  18.142 -49.447 1.00 32.41  ? 60  VAL B CA    1 
ATOM   1146  C  C     . VAL B 2 45  ? 10.036  19.305 -48.513 1.00 33.43  ? 60  VAL B C     1 
ATOM   1147  O  O     . VAL B 2 45  ? 10.160  19.155 -47.301 1.00 35.61  ? 60  VAL B O     1 
ATOM   1148  C  CB    . VAL B 2 45  ? 11.697  18.357 -50.170 1.00 33.12  ? 60  VAL B CB    1 
ATOM   1149  C  CG1   . VAL B 2 45  ? 12.816  18.687 -49.192 1.00 33.09  ? 60  VAL B CG1   1 
ATOM   1150  C  CG2   . VAL B 2 45  ? 12.056  17.177 -51.029 1.00 30.73  ? 60  VAL B CG2   1 
ATOM   1151  N  N     . PHE B 2 46  ? 9.570   20.426 -49.070 1.00 26.11  ? 61  PHE B N     1 
ATOM   1152  C  CA    . PHE B 2 46  ? 9.209   21.624 -48.312 1.00 23.74  ? 61  PHE B CA    1 
ATOM   1153  C  C     . PHE B 2 46  ? 8.133   21.277 -47.280 1.00 30.19  ? 61  PHE B C     1 
ATOM   1154  O  O     . PHE B 2 46  ? 8.297   21.608 -46.108 1.00 33.23  ? 61  PHE B O     1 
ATOM   1155  C  CB    . PHE B 2 46  ? 8.744   22.756 -49.253 1.00 24.26  ? 61  PHE B CB    1 
ATOM   1156  C  CG    . PHE B 2 46  ? 8.430   24.042 -48.536 1.00 22.97  ? 61  PHE B CG    1 
ATOM   1157  C  CD1   . PHE B 2 46  ? 7.173   24.265 -47.991 1.00 23.92  ? 61  PHE B CD1   1 
ATOM   1158  C  CD2   . PHE B 2 46  ? 9.415   24.992 -48.322 1.00 22.64  ? 61  PHE B CD2   1 
ATOM   1159  C  CE1   . PHE B 2 46  ? 6.919   25.412 -47.237 1.00 23.11  ? 61  PHE B CE1   1 
ATOM   1160  C  CE2   . PHE B 2 46  ? 9.159   26.130 -47.565 1.00 23.16  ? 61  PHE B CE2   1 
ATOM   1161  C  CZ    . PHE B 2 46  ? 7.919   26.329 -47.026 1.00 21.18  ? 61  PHE B CZ    1 
ATOM   1162  N  N     . LEU B 2 47  ? 7.043   20.617 -47.704 1.00 25.03  ? 62  LEU B N     1 
ATOM   1163  C  CA    . LEU B 2 47  ? 5.994   20.226 -46.783 1.00 23.96  ? 62  LEU B CA    1 
ATOM   1164  C  C     . LEU B 2 47  ? 6.492   19.185 -45.753 1.00 31.76  ? 62  LEU B C     1 
ATOM   1165  O  O     . LEU B 2 47  ? 6.121   19.266 -44.580 1.00 31.04  ? 62  LEU B O     1 
ATOM   1166  C  CB    . LEU B 2 47  ? 4.796   19.674 -47.536 1.00 22.99  ? 62  LEU B CB    1 
ATOM   1167  C  CG    . LEU B 2 47  ? 3.779   20.636 -48.023 1.00 28.81  ? 62  LEU B CG    1 
ATOM   1168  C  CD1   . LEU B 2 47  ? 2.654   19.916 -48.741 1.00 27.29  ? 62  LEU B CD1   1 
ATOM   1169  C  CD2   . LEU B 2 47  ? 3.140   21.360 -46.897 1.00 39.56  ? 62  LEU B CD2   1 
ATOM   1170  N  N     . GLU B 2 48  ? 7.316   18.206 -46.170 1.00 31.86  ? 63  GLU B N     1 
ATOM   1171  C  CA    . GLU B 2 48  ? 7.743   17.173 -45.236 1.00 33.14  ? 63  GLU B CA    1 
ATOM   1172  C  C     . GLU B 2 48  ? 8.435   17.860 -44.101 1.00 38.86  ? 63  GLU B C     1 
ATOM   1173  O  O     . GLU B 2 48  ? 7.979   17.733 -42.971 1.00 41.08  ? 63  GLU B O     1 
ATOM   1174  C  CB    . GLU B 2 48  ? 8.651   16.135 -45.891 1.00 35.34  ? 63  GLU B CB    1 
ATOM   1175  C  CG    . GLU B 2 48  ? 7.926   15.125 -46.751 1.00 43.50  ? 63  GLU B CG    1 
ATOM   1176  C  CD    . GLU B 2 48  ? 8.799   14.414 -47.767 1.00 63.29  ? 63  GLU B CD    1 
ATOM   1177  O  OE1   . GLU B 2 48  ? 9.994   14.792 -47.898 1.00 54.65  ? 63  GLU B OE1   1 
ATOM   1178  O  OE2   . GLU B 2 48  ? 8.279   13.484 -48.437 1.00 49.94  ? 63  GLU B OE2   1 
ATOM   1179  N  N     . ASN B 2 49  ? 9.436   18.689 -44.418 1.00 34.98  ? 64  ASN B N     1 
ATOM   1180  C  CA    . ASN B 2 49  ? 10.197  19.492 -43.461 1.00 34.68  ? 64  ASN B CA    1 
ATOM   1181  C  C     . ASN B 2 49  ? 9.332   20.355 -42.526 1.00 34.42  ? 64  ASN B C     1 
ATOM   1182  O  O     . ASN B 2 49  ? 9.472   20.238 -41.312 1.00 34.56  ? 64  ASN B O     1 
ATOM   1183  C  CB    . ASN B 2 49  ? 11.237  20.337 -44.194 1.00 37.03  ? 64  ASN B CB    1 
ATOM   1184  C  CG    . ASN B 2 49  ? 12.448  19.523 -44.619 1.00 65.98  ? 64  ASN B CG    1 
ATOM   1185  O  OD1   . ASN B 2 49  ? 12.706  19.304 -45.809 1.00 53.20  ? 64  ASN B OD1   1 
ATOM   1186  N  ND2   . ASN B 2 49  ? 13.237  19.076 -43.650 1.00 63.27  ? 64  ASN B ND2   1 
ATOM   1187  N  N     . VAL B 2 50  ? 8.394   21.129 -43.069 1.00 29.30  ? 65  VAL B N     1 
ATOM   1188  C  CA    . VAL B 2 50  ? 7.525   21.992 -42.249 1.00 29.44  ? 65  VAL B CA    1 
ATOM   1189  C  C     . VAL B 2 50  ? 6.580   21.162 -41.348 1.00 37.37  ? 65  VAL B C     1 
ATOM   1190  O  O     . VAL B 2 50  ? 6.576   21.377 -40.131 1.00 40.14  ? 65  VAL B O     1 
ATOM   1191  C  CB    . VAL B 2 50  ? 6.774   23.089 -43.053 1.00 30.95  ? 65  VAL B CB    1 
ATOM   1192  C  CG1   . VAL B 2 50  ? 5.906   23.949 -42.141 1.00 29.25  ? 65  VAL B CG1   1 
ATOM   1193  C  CG2   . VAL B 2 50  ? 7.756   23.970 -43.796 1.00 31.12  ? 65  VAL B CG2   1 
ATOM   1194  N  N     . ILE B 2 51  ? 5.814   20.217 -41.935 1.00 32.19  ? 66  ILE B N     1 
ATOM   1195  C  CA    . ILE B 2 51  ? 4.855   19.388 -41.232 1.00 30.85  ? 66  ILE B CA    1 
ATOM   1196  C  C     . ILE B 2 51  ? 5.547   18.528 -40.167 1.00 37.05  ? 66  ILE B C     1 
ATOM   1197  O  O     . ILE B 2 51  ? 4.991   18.339 -39.095 1.00 40.16  ? 66  ILE B O     1 
ATOM   1198  C  CB    . ILE B 2 51  ? 4.024   18.557 -42.238 1.00 33.09  ? 66  ILE B CB    1 
ATOM   1199  C  CG1   . ILE B 2 51  ? 3.190   19.459 -43.138 1.00 32.40  ? 66  ILE B CG1   1 
ATOM   1200  C  CG2   . ILE B 2 51  ? 3.150   17.477 -41.539 1.00 33.48  ? 66  ILE B CG2   1 
ATOM   1201  C  CD1   . ILE B 2 51  ? 2.800   18.806 -44.419 1.00 36.04  ? 66  ILE B CD1   1 
ATOM   1202  N  N     . ARG B 2 52  ? 6.749   18.021 -40.444 1.00 30.76  ? 67  ARG B N     1 
ATOM   1203  C  CA    . ARG B 2 52  ? 7.500   17.227 -39.472 1.00 29.01  ? 67  ARG B CA    1 
ATOM   1204  C  C     . ARG B 2 52  ? 7.658   18.036 -38.180 1.00 32.10  ? 67  ARG B C     1 
ATOM   1205  O  O     . ARG B 2 52  ? 7.245   17.582 -37.116 1.00 31.72  ? 67  ARG B O     1 
ATOM   1206  C  CB    . ARG B 2 52  ? 8.873   16.832 -40.039 1.00 26.67  ? 67  ARG B CB    1 
ATOM   1207  C  CG    . ARG B 2 52  ? 9.683   15.875 -39.170 1.00 34.20  ? 67  ARG B CG    1 
ATOM   1208  C  CD    . ARG B 2 52  ? 11.092  15.682 -39.707 1.00 55.62  ? 67  ARG B CD    1 
ATOM   1209  N  NE    . ARG B 2 52  ? 11.078  15.032 -41.023 1.00 81.21  ? 67  ARG B NE    1 
ATOM   1210  C  CZ    . ARG B 2 52  ? 11.514  15.599 -42.144 1.00 93.24  ? 67  ARG B CZ    1 
ATOM   1211  N  NH1   . ARG B 2 52  ? 12.049  16.816 -42.114 1.00 71.14  ? 67  ARG B NH1   1 
ATOM   1212  N  NH2   . ARG B 2 52  ? 11.439  14.943 -43.302 1.00 77.23  ? 67  ARG B NH2   1 
ATOM   1213  N  N     . ASP B 2 53  ? 8.182   19.269 -38.303 1.00 28.06  ? 68  ASP B N     1 
ATOM   1214  C  CA    . ASP B 2 53  ? 8.419   20.169 -37.192 1.00 25.30  ? 68  ASP B CA    1 
ATOM   1215  C  C     . ASP B 2 53  ? 7.109   20.595 -36.530 1.00 29.16  ? 68  ASP B C     1 
ATOM   1216  O  O     . ASP B 2 53  ? 7.041   20.604 -35.300 1.00 29.40  ? 68  ASP B O     1 
ATOM   1217  C  CB    . ASP B 2 53  ? 9.230   21.356 -37.674 1.00 26.01  ? 68  ASP B CB    1 
ATOM   1218  C  CG    . ASP B 2 53  ? 10.728  21.148 -37.815 1.00 34.21  ? 68  ASP B CG    1 
ATOM   1219  O  OD1   . ASP B 2 53  ? 11.157  19.983 -37.941 1.00 31.09  ? 68  ASP B OD1   1 
ATOM   1220  O  OD2   . ASP B 2 53  ? 11.480  22.177 -37.837 1.00 42.58  ? 68  ASP B OD2   1 
ATOM   1221  N  N     . ALA B 2 54  ? 6.059   20.895 -37.328 1.00 25.81  ? 69  ALA B N     1 
ATOM   1222  C  CA    . ALA B 2 54  ? 4.759   21.319 -36.803 1.00 25.91  ? 69  ALA B CA    1 
ATOM   1223  C  C     . ALA B 2 54  ? 4.187   20.216 -35.913 1.00 34.48  ? 69  ALA B C     1 
ATOM   1224  O  O     . ALA B 2 54  ? 3.790   20.473 -34.776 1.00 36.62  ? 69  ALA B O     1 
ATOM   1225  C  CB    . ALA B 2 54  ? 3.800   21.631 -37.938 1.00 26.10  ? 69  ALA B CB    1 
ATOM   1226  N  N     . VAL B 2 55  ? 4.210   18.972 -36.414 1.00 30.17  ? 70  VAL B N     1 
ATOM   1227  C  CA    . VAL B 2 55  ? 3.707   17.785 -35.734 1.00 27.81  ? 70  VAL B CA    1 
ATOM   1228  C  C     . VAL B 2 55  ? 4.548   17.506 -34.475 1.00 32.50  ? 70  VAL B C     1 
ATOM   1229  O  O     . VAL B 2 55  ? 3.971   17.174 -33.443 1.00 30.99  ? 70  VAL B O     1 
ATOM   1230  C  CB    . VAL B 2 55  ? 3.576   16.608 -36.719 1.00 28.79  ? 70  VAL B CB    1 
ATOM   1231  C  CG1   . VAL B 2 55  ? 3.258   15.316 -36.000 1.00 29.10  ? 70  VAL B CG1   1 
ATOM   1232  C  CG2   . VAL B 2 55  ? 2.511   16.907 -37.769 1.00 27.63  ? 70  VAL B CG2   1 
ATOM   1233  N  N     . THR B 2 56  ? 5.875   17.756 -34.523 1.00 31.41  ? 71  THR B N     1 
ATOM   1234  C  CA    . THR B 2 56  ? 6.748   17.643 -33.348 1.00 32.48  ? 71  THR B CA    1 
ATOM   1235  C  C     . THR B 2 56  ? 6.240   18.628 -32.251 1.00 39.65  ? 71  THR B C     1 
ATOM   1236  O  O     . THR B 2 56  ? 6.143   18.219 -31.096 1.00 42.56  ? 71  THR B O     1 
ATOM   1237  C  CB    . THR B 2 56  ? 8.219   17.891 -33.710 1.00 40.49  ? 71  THR B CB    1 
ATOM   1238  O  OG1   . THR B 2 56  ? 8.587   17.103 -34.837 1.00 35.73  ? 71  THR B OG1   1 
ATOM   1239  C  CG2   . THR B 2 56  ? 9.160   17.569 -32.566 1.00 36.99  ? 71  THR B CG2   1 
ATOM   1240  N  N     . TYR B 2 57  ? 5.849   19.875 -32.625 1.00 32.47  ? 72  TYR B N     1 
ATOM   1241  C  CA    . TYR B 2 57  ? 5.256   20.843 -31.689 1.00 31.06  ? 72  TYR B CA    1 
ATOM   1242  C  C     . TYR B 2 57  ? 3.919   20.351 -31.127 1.00 39.57  ? 72  TYR B C     1 
ATOM   1243  O  O     . TYR B 2 57  ? 3.746   20.361 -29.900 1.00 40.15  ? 72  TYR B O     1 
ATOM   1244  C  CB    . TYR B 2 57  ? 5.078   22.248 -32.312 1.00 29.19  ? 72  TYR B CB    1 
ATOM   1245  C  CG    . TYR B 2 57  ? 6.353   23.045 -32.395 1.00 23.92  ? 72  TYR B CG    1 
ATOM   1246  C  CD1   . TYR B 2 57  ? 7.071   23.358 -31.247 1.00 25.65  ? 72  TYR B CD1   1 
ATOM   1247  C  CD2   . TYR B 2 57  ? 6.864   23.456 -33.621 1.00 21.15  ? 72  TYR B CD2   1 
ATOM   1248  C  CE1   . TYR B 2 57  ? 8.251   24.087 -31.315 1.00 27.33  ? 72  TYR B CE1   1 
ATOM   1249  C  CE2   . TYR B 2 57  ? 8.077   24.122 -33.705 1.00 20.49  ? 72  TYR B CE2   1 
ATOM   1250  C  CZ    . TYR B 2 57  ? 8.747   24.467 -32.543 1.00 25.00  ? 72  TYR B CZ    1 
ATOM   1251  O  OH    . TYR B 2 57  ? 9.933   25.133 -32.563 1.00 19.95  ? 72  TYR B OH    1 
ATOM   1252  N  N     . THR B 2 58  ? 2.994   19.896 -32.024 1.00 37.74  ? 73  THR B N     1 
ATOM   1253  C  CA    . THR B 2 58  ? 1.682   19.350 -31.678 1.00 38.44  ? 73  THR B CA    1 
ATOM   1254  C  C     . THR B 2 58  ? 1.896   18.265 -30.631 1.00 46.09  ? 73  THR B C     1 
ATOM   1255  O  O     . THR B 2 58  ? 1.308   18.339 -29.551 1.00 46.11  ? 73  THR B O     1 
ATOM   1256  C  CB    . THR B 2 58  ? 1.010   18.794 -32.929 1.00 44.67  ? 73  THR B CB    1 
ATOM   1257  O  OG1   . THR B 2 58  ? 1.069   19.786 -33.939 1.00 39.88  ? 73  THR B OG1   1 
ATOM   1258  C  CG2   . THR B 2 58  ? -0.428  18.382 -32.698 1.00 43.38  ? 73  THR B CG2   1 
ATOM   1259  N  N     . GLU B 2 59  ? 2.804   17.312 -30.922 1.00 44.77  ? 74  GLU B N     1 
ATOM   1260  C  CA    . GLU B 2 59  ? 3.164   16.229 -30.021 1.00 45.97  ? 74  GLU B CA    1 
ATOM   1261  C  C     . GLU B 2 59  ? 3.667   16.749 -28.689 1.00 50.33  ? 74  GLU B C     1 
ATOM   1262  O  O     . GLU B 2 59  ? 3.156   16.330 -27.668 1.00 48.72  ? 74  GLU B O     1 
ATOM   1263  C  CB    . GLU B 2 59  ? 4.189   15.281 -30.661 1.00 48.57  ? 74  GLU B CB    1 
ATOM   1264  C  CG    . GLU B 2 59  ? 3.579   14.177 -31.511 1.00 67.50  ? 74  GLU B CG    1 
ATOM   1265  C  CD    . GLU B 2 59  ? 4.517   13.019 -31.811 1.00 104.19 ? 74  GLU B CD    1 
ATOM   1266  O  OE1   . GLU B 2 59  ? 5.492   13.225 -32.575 1.00 97.18  ? 74  GLU B OE1   1 
ATOM   1267  O  OE2   . GLU B 2 59  ? 4.279   11.906 -31.282 1.00 104.19 ? 74  GLU B OE2   1 
ATOM   1268  N  N     . HIS B 2 60  ? 4.610   17.701 -28.677 1.00 51.10  ? 75  HIS B N     1 
ATOM   1269  C  CA    . HIS B 2 60  ? 5.095   18.263 -27.405 1.00 51.89  ? 75  HIS B CA    1 
ATOM   1270  C  C     . HIS B 2 60  ? 3.940   18.822 -26.547 1.00 59.22  ? 75  HIS B C     1 
ATOM   1271  O  O     . HIS B 2 60  ? 3.859   18.505 -25.356 1.00 58.54  ? 75  HIS B O     1 
ATOM   1272  C  CB    . HIS B 2 60  ? 6.216   19.299 -27.598 1.00 51.81  ? 75  HIS B CB    1 
ATOM   1273  C  CG    . HIS B 2 60  ? 6.949   19.560 -26.325 1.00 55.10  ? 75  HIS B CG    1 
ATOM   1274  N  ND1   . HIS B 2 60  ? 6.764   20.731 -25.620 1.00 57.01  ? 75  HIS B ND1   1 
ATOM   1275  C  CD2   . HIS B 2 60  ? 7.770   18.749 -25.616 1.00 57.10  ? 75  HIS B CD2   1 
ATOM   1276  C  CE1   . HIS B 2 60  ? 7.518   20.628 -24.535 1.00 56.64  ? 75  HIS B CE1   1 
ATOM   1277  N  NE2   . HIS B 2 60  ? 8.151   19.454 -24.491 1.00 57.11  ? 75  HIS B NE2   1 
ATOM   1278  N  N     . ALA B 2 61  ? 2.987   19.551 -27.191 1.00 57.12  ? 76  ALA B N     1 
ATOM   1279  C  CA    . ALA B 2 61  ? 1.793   20.113 -26.545 1.00 57.44  ? 76  ALA B CA    1 
ATOM   1280  C  C     . ALA B 2 61  ? 0.817   19.037 -25.999 1.00 66.67  ? 76  ALA B C     1 
ATOM   1281  O  O     . ALA B 2 61  ? -0.159  19.375 -25.311 1.00 68.67  ? 76  ALA B O     1 
ATOM   1282  C  CB    . ALA B 2 61  ? 1.064   21.008 -27.520 1.00 57.57  ? 76  ALA B CB    1 
ATOM   1283  N  N     . LYS B 2 62  ? 1.095   17.749 -26.297 1.00 63.02  ? 77  LYS B N     1 
ATOM   1284  C  CA    . LYS B 2 62  ? 0.269   16.597 -25.925 1.00 63.62  ? 77  LYS B CA    1 
ATOM   1285  C  C     . LYS B 2 62  ? -1.115  16.717 -26.605 1.00 68.15  ? 77  LYS B C     1 
ATOM   1286  O  O     . LYS B 2 62  ? -2.135  16.282 -26.059 1.00 70.21  ? 77  LYS B O     1 
ATOM   1287  C  CB    . LYS B 2 62  ? 0.208   16.384 -24.393 1.00 65.37  ? 77  LYS B CB    1 
ATOM   1288  C  CG    . LYS B 2 62  ? 1.437   15.679 -23.833 1.00 74.27  ? 77  LYS B CG    1 
ATOM   1289  C  CD    . LYS B 2 62  ? 1.623   16.002 -22.347 1.00 87.12  ? 77  LYS B CD    1 
ATOM   1290  C  CE    . LYS B 2 62  ? 2.655   15.126 -21.673 1.00 99.60  ? 77  LYS B CE    1 
ATOM   1291  N  NZ    . LYS B 2 62  ? 3.128   15.723 -20.390 1.00 109.04 ? 77  LYS B NZ    1 
ATOM   1292  N  N     . ARG B 2 63  ? -1.112  17.300 -27.824 1.00 60.50  ? 78  ARG B N     1 
ATOM   1293  C  CA    . ARG B 2 63  ? -2.277  17.514 -28.668 1.00 58.73  ? 78  ARG B CA    1 
ATOM   1294  C  C     . ARG B 2 63  ? -2.320  16.560 -29.865 1.00 63.15  ? 78  ARG B C     1 
ATOM   1295  O  O     . ARG B 2 63  ? -1.290  16.034 -30.281 1.00 63.35  ? 78  ARG B O     1 
ATOM   1296  C  CB    . ARG B 2 63  ? -2.271  18.949 -29.177 1.00 55.35  ? 78  ARG B CB    1 
ATOM   1297  C  CG    . ARG B 2 63  ? -2.792  19.940 -28.166 1.00 59.04  ? 78  ARG B CG    1 
ATOM   1298  C  CD    . ARG B 2 63  ? -3.086  21.272 -28.809 1.00 51.89  ? 78  ARG B CD    1 
ATOM   1299  N  NE    . ARG B 2 63  ? -1.912  22.147 -28.841 1.00 52.54  ? 78  ARG B NE    1 
ATOM   1300  C  CZ    . ARG B 2 63  ? -1.101  22.276 -29.887 1.00 59.31  ? 78  ARG B CZ    1 
ATOM   1301  N  NH1   . ARG B 2 63  ? -1.298  21.555 -30.981 1.00 50.89  ? 78  ARG B NH1   1 
ATOM   1302  N  NH2   . ARG B 2 63  ? -0.078  23.116 -29.839 1.00 40.70  ? 78  ARG B NH2   1 
ATOM   1303  N  N     . LYS B 2 64  ? -3.525  16.341 -30.417 1.00 60.65  ? 79  LYS B N     1 
ATOM   1304  C  CA    . LYS B 2 64  ? -3.791  15.505 -31.611 1.00 61.38  ? 79  LYS B CA    1 
ATOM   1305  C  C     . LYS B 2 64  ? -4.023  16.433 -32.816 1.00 64.09  ? 79  LYS B C     1 
ATOM   1306  O  O     . LYS B 2 64  ? -3.851  16.015 -33.958 1.00 63.04  ? 79  LYS B O     1 
ATOM   1307  C  CB    . LYS B 2 64  ? -5.048  14.605 -31.427 1.00 64.81  ? 79  LYS B CB    1 
ATOM   1308  C  CG    . LYS B 2 64  ? -4.911  13.446 -30.453 1.00 81.82  ? 79  LYS B CG    1 
ATOM   1309  C  CD    . LYS B 2 64  ? -5.432  12.160 -31.063 1.00 102.51 ? 79  LYS B CD    1 
ATOM   1310  C  CE    . LYS B 2 64  ? -5.674  11.112 -30.004 1.00 122.50 ? 79  LYS B CE    1 
ATOM   1311  N  NZ    . LYS B 2 64  ? -5.927  9.757  -30.585 1.00 132.16 ? 79  LYS B NZ    1 
ATOM   1312  N  N     . THR B 2 65  ? -4.433  17.694 -32.539 1.00 60.38  ? 80  THR B N     1 
ATOM   1313  C  CA    . THR B 2 65  ? -4.749  18.745 -33.503 1.00 58.49  ? 80  THR B CA    1 
ATOM   1314  C  C     . THR B 2 65  ? -3.576  19.683 -33.701 1.00 58.88  ? 80  THR B C     1 
ATOM   1315  O  O     . THR B 2 65  ? -3.128  20.327 -32.748 1.00 58.15  ? 80  THR B O     1 
ATOM   1316  C  CB    . THR B 2 65  ? -5.997  19.524 -33.049 1.00 67.10  ? 80  THR B CB    1 
ATOM   1317  O  OG1   . THR B 2 65  ? -7.030  18.616 -32.625 1.00 74.71  ? 80  THR B OG1   1 
ATOM   1318  C  CG2   . THR B 2 65  ? -6.496  20.514 -34.103 1.00 62.61  ? 80  THR B CG2   1 
ATOM   1319  N  N     . VAL B 2 66  ? -3.096  19.756 -34.958 1.00 52.75  ? 81  VAL B N     1 
ATOM   1320  C  CA    . VAL B 2 66  ? -2.035  20.640 -35.448 1.00 49.80  ? 81  VAL B CA    1 
ATOM   1321  C  C     . VAL B 2 66  ? -2.694  22.027 -35.600 1.00 51.38  ? 81  VAL B C     1 
ATOM   1322  O  O     . VAL B 2 66  ? -3.661  22.201 -36.357 1.00 51.37  ? 81  VAL B O     1 
ATOM   1323  C  CB    . VAL B 2 66  ? -1.391  20.136 -36.782 1.00 51.90  ? 81  VAL B CB    1 
ATOM   1324  C  CG1   . VAL B 2 66  ? -0.338  21.109 -37.296 1.00 50.78  ? 81  VAL B CG1   1 
ATOM   1325  C  CG2   . VAL B 2 66  ? -0.791  18.746 -36.628 1.00 51.05  ? 81  VAL B CG2   1 
ATOM   1326  N  N     . THR B 2 67  ? -2.193  23.000 -34.822 1.00 44.67  ? 82  THR B N     1 
ATOM   1327  C  CA    . THR B 2 67  ? -2.714  24.343 -34.822 1.00 42.26  ? 82  THR B CA    1 
ATOM   1328  C  C     . THR B 2 67  ? -1.918  25.227 -35.788 1.00 44.26  ? 82  THR B C     1 
ATOM   1329  O  O     . THR B 2 67  ? -0.860  24.824 -36.276 1.00 44.11  ? 82  THR B O     1 
ATOM   1330  C  CB    . THR B 2 67  ? -2.814  24.889 -33.389 1.00 44.27  ? 82  THR B CB    1 
ATOM   1331  O  OG1   . THR B 2 67  ? -1.525  25.144 -32.844 1.00 47.21  ? 82  THR B OG1   1 
ATOM   1332  C  CG2   . THR B 2 67  ? -3.590  23.988 -32.474 1.00 39.39  ? 82  THR B CG2   1 
ATOM   1333  N  N     . ALA B 2 68  ? -2.471  26.400 -36.108 1.00 38.50  ? 83  ALA B N     1 
ATOM   1334  C  CA    . ALA B 2 68  ? -1.871  27.437 -36.932 1.00 38.63  ? 83  ALA B CA    1 
ATOM   1335  C  C     . ALA B 2 68  ? -0.520  27.828 -36.332 1.00 43.82  ? 83  ALA B C     1 
ATOM   1336  O  O     . ALA B 2 68  ? 0.455   27.905 -37.067 1.00 43.68  ? 83  ALA B O     1 
ATOM   1337  C  CB    . ALA B 2 68  ? -2.780  28.637 -36.956 1.00 38.97  ? 83  ALA B CB    1 
ATOM   1338  N  N     . MET B 2 69  ? -0.450  27.989 -34.992 1.00 41.75  ? 84  MET B N     1 
ATOM   1339  C  CA    . MET B 2 69  ? 0.776   28.304 -34.251 1.00 42.80  ? 84  MET B CA    1 
ATOM   1340  C  C     . MET B 2 69  ? 1.847   27.268 -34.424 1.00 43.95  ? 84  MET B C     1 
ATOM   1341  O  O     . MET B 2 69  ? 2.995   27.643 -34.542 1.00 45.88  ? 84  MET B O     1 
ATOM   1342  C  CB    . MET B 2 69  ? 0.506   28.499 -32.757 1.00 46.83  ? 84  MET B CB    1 
ATOM   1343  C  CG    . MET B 2 69  ? -0.081  29.846 -32.427 1.00 53.12  ? 84  MET B CG    1 
ATOM   1344  S  SD    . MET B 2 69  ? 0.946   31.194 -33.039 1.00 59.30  ? 84  MET B SD    1 
ATOM   1345  C  CE    . MET B 2 69  ? 1.088   32.165 -31.536 1.00 57.60  ? 84  MET B CE    1 
ATOM   1346  N  N     . ASP B 2 70  ? 1.493   25.974 -34.440 1.00 35.79  ? 85  ASP B N     1 
ATOM   1347  C  CA    . ASP B 2 70  ? 2.456   24.890 -34.648 1.00 34.09  ? 85  ASP B CA    1 
ATOM   1348  C  C     . ASP B 2 70  ? 3.120   25.039 -35.989 1.00 34.84  ? 85  ASP B C     1 
ATOM   1349  O  O     . ASP B 2 70  ? 4.317   24.804 -36.087 1.00 36.69  ? 85  ASP B O     1 
ATOM   1350  C  CB    . ASP B 2 70  ? 1.801   23.501 -34.529 1.00 35.20  ? 85  ASP B CB    1 
ATOM   1351  C  CG    . ASP B 2 70  ? 1.214   23.214 -33.170 1.00 44.59  ? 85  ASP B CG    1 
ATOM   1352  O  OD1   . ASP B 2 70  ? 1.741   23.756 -32.162 1.00 47.82  ? 85  ASP B OD1   1 
ATOM   1353  O  OD2   . ASP B 2 70  ? 0.234   22.466 -33.105 1.00 47.98  ? 85  ASP B OD2   1 
ATOM   1354  N  N     . VAL B 2 71  ? 2.348   25.457 -37.009 1.00 26.46  ? 86  VAL B N     1 
ATOM   1355  C  CA    . VAL B 2 71  ? 2.811   25.691 -38.380 1.00 23.97  ? 86  VAL B CA    1 
ATOM   1356  C  C     . VAL B 2 71  ? 3.652   26.932 -38.416 1.00 25.82  ? 86  VAL B C     1 
ATOM   1357  O  O     . VAL B 2 71  ? 4.702   26.938 -39.053 1.00 26.12  ? 86  VAL B O     1 
ATOM   1358  C  CB    . VAL B 2 71  ? 1.636   25.742 -39.375 1.00 26.44  ? 86  VAL B CB    1 
ATOM   1359  C  CG1   . VAL B 2 71  ? 2.062   26.271 -40.734 1.00 24.83  ? 86  VAL B CG1   1 
ATOM   1360  C  CG2   . VAL B 2 71  ? 0.992   24.358 -39.495 1.00 26.14  ? 86  VAL B CG2   1 
ATOM   1361  N  N     . VAL B 2 72  ? 3.216   27.965 -37.687 1.00 21.98  ? 87  VAL B N     1 
ATOM   1362  C  CA    . VAL B 2 72  ? 3.897   29.247 -37.558 1.00 21.35  ? 87  VAL B CA    1 
ATOM   1363  C  C     . VAL B 2 72  ? 5.265   29.036 -36.861 1.00 31.40  ? 87  VAL B C     1 
ATOM   1364  O  O     . VAL B 2 72  ? 6.282   29.471 -37.376 1.00 33.54  ? 87  VAL B O     1 
ATOM   1365  C  CB    . VAL B 2 72  ? 2.959   30.284 -36.886 1.00 23.64  ? 87  VAL B CB    1 
ATOM   1366  C  CG1   . VAL B 2 72  ? 3.716   31.405 -36.209 1.00 23.11  ? 87  VAL B CG1   1 
ATOM   1367  C  CG2   . VAL B 2 72  ? 1.962   30.853 -37.876 1.00 22.80  ? 87  VAL B CG2   1 
ATOM   1368  N  N     . TYR B 2 73  ? 5.300   28.282 -35.773 1.00 32.04  ? 88  TYR B N     1 
ATOM   1369  C  CA    . TYR B 2 73  ? 6.527   27.956 -35.049 1.00 32.52  ? 88  TYR B CA    1 
ATOM   1370  C  C     . TYR B 2 73  ? 7.504   27.155 -35.884 1.00 32.50  ? 88  TYR B C     1 
ATOM   1371  O  O     . TYR B 2 73  ? 8.714   27.407 -35.776 1.00 32.01  ? 88  TYR B O     1 
ATOM   1372  C  CB    . TYR B 2 73  ? 6.232   27.229 -33.732 1.00 34.96  ? 88  TYR B CB    1 
ATOM   1373  C  CG    . TYR B 2 73  ? 5.518   28.082 -32.718 1.00 40.65  ? 88  TYR B CG    1 
ATOM   1374  C  CD1   . TYR B 2 73  ? 5.700   29.462 -32.680 1.00 43.89  ? 88  TYR B CD1   1 
ATOM   1375  C  CD2   . TYR B 2 73  ? 4.633   27.518 -31.814 1.00 43.75  ? 88  TYR B CD2   1 
ATOM   1376  C  CE1   . TYR B 2 73  ? 5.020   30.259 -31.762 1.00 45.78  ? 88  TYR B CE1   1 
ATOM   1377  C  CE2   . TYR B 2 73  ? 3.931   28.306 -30.900 1.00 45.85  ? 88  TYR B CE2   1 
ATOM   1378  C  CZ    . TYR B 2 73  ? 4.148   29.671 -30.859 1.00 54.93  ? 88  TYR B CZ    1 
ATOM   1379  O  OH    . TYR B 2 73  ? 3.504   30.423 -29.907 1.00 58.22  ? 88  TYR B OH    1 
ATOM   1380  N  N     . ALA B 2 74  ? 6.977   26.186 -36.697 1.00 24.16  ? 89  ALA B N     1 
ATOM   1381  C  CA    . ALA B 2 74  ? 7.747   25.335 -37.594 1.00 22.30  ? 89  ALA B CA    1 
ATOM   1382  C  C     . ALA B 2 74  ? 8.425   26.184 -38.641 1.00 29.74  ? 89  ALA B C     1 
ATOM   1383  O  O     . ALA B 2 74  ? 9.626   26.025 -38.814 1.00 33.89  ? 89  ALA B O     1 
ATOM   1384  C  CB    . ALA B 2 74  ? 6.856   24.309 -38.267 1.00 22.59  ? 89  ALA B CB    1 
ATOM   1385  N  N     . LEU B 2 75  ? 7.684   27.086 -39.332 1.00 22.48  ? 90  LEU B N     1 
ATOM   1386  C  CA    . LEU B 2 75  ? 8.192   27.975 -40.368 1.00 21.31  ? 90  LEU B CA    1 
ATOM   1387  C  C     . LEU B 2 75  ? 9.284   28.880 -39.799 1.00 30.56  ? 90  LEU B C     1 
ATOM   1388  O  O     . LEU B 2 75  ? 10.343  28.958 -40.399 1.00 32.30  ? 90  LEU B O     1 
ATOM   1389  C  CB    . LEU B 2 75  ? 7.048   28.804 -41.017 1.00 19.41  ? 90  LEU B CB    1 
ATOM   1390  C  CG    . LEU B 2 75  ? 6.046   27.995 -41.854 1.00 22.72  ? 90  LEU B CG    1 
ATOM   1391  C  CD1   . LEU B 2 75  ? 4.759   28.746 -42.016 1.00 21.37  ? 90  LEU B CD1   1 
ATOM   1392  C  CD2   . LEU B 2 75  ? 6.620   27.590 -43.198 1.00 21.89  ? 90  LEU B CD2   1 
ATOM   1393  N  N     . LYS B 2 76  ? 9.083   29.482 -38.609 1.00 29.15  ? 91  LYS B N     1 
ATOM   1394  C  CA    . LYS B 2 76  ? 10.104  30.340 -37.992 1.00 30.45  ? 91  LYS B CA    1 
ATOM   1395  C  C     . LYS B 2 76  ? 11.422  29.559 -37.861 1.00 39.59  ? 91  LYS B C     1 
ATOM   1396  O  O     . LYS B 2 76  ? 12.458  30.119 -38.221 1.00 43.97  ? 91  LYS B O     1 
ATOM   1397  C  CB    . LYS B 2 76  ? 9.632   30.930 -36.655 1.00 31.67  ? 91  LYS B CB    1 
ATOM   1398  C  CG    . LYS B 2 76  ? 10.421  32.119 -36.157 1.00 52.45  ? 91  LYS B CG    1 
ATOM   1399  C  CD    . LYS B 2 76  ? 9.700   32.778 -34.984 1.00 74.66  ? 91  LYS B CD    1 
ATOM   1400  C  CE    . LYS B 2 76  ? 10.624  33.450 -33.982 1.00 91.35  ? 91  LYS B CE    1 
ATOM   1401  N  NZ    . LYS B 2 76  ? 10.156  33.296 -32.559 1.00 99.81  ? 91  LYS B NZ    1 
ATOM   1402  N  N     . ARG B 2 77  ? 11.364  28.263 -37.434 1.00 34.38  ? 92  ARG B N     1 
ATOM   1403  C  CA    . ARG B 2 77  ? 12.479  27.325 -37.274 1.00 33.63  ? 92  ARG B CA    1 
ATOM   1404  C  C     . ARG B 2 77  ? 13.182  27.123 -38.607 1.00 38.78  ? 92  ARG B C     1 
ATOM   1405  O  O     . ARG B 2 77  ? 14.405  27.215 -38.656 1.00 40.22  ? 92  ARG B O     1 
ATOM   1406  C  CB    . ARG B 2 77  ? 11.954  25.975 -36.814 1.00 33.96  ? 92  ARG B CB    1 
ATOM   1407  C  CG    . ARG B 2 77  ? 12.137  25.688 -35.358 1.00 41.55  ? 92  ARG B CG    1 
ATOM   1408  C  CD    . ARG B 2 77  ? 12.559  24.254 -35.188 1.00 29.15  ? 92  ARG B CD    1 
ATOM   1409  N  NE    . ARG B 2 77  ? 14.018  24.153 -35.268 1.00 53.04  ? 92  ARG B NE    1 
ATOM   1410  C  CZ    . ARG B 2 77  ? 14.686  23.530 -36.239 1.00 75.90  ? 92  ARG B CZ    1 
ATOM   1411  N  NH1   . ARG B 2 77  ? 14.029  22.904 -37.214 1.00 60.16  ? 92  ARG B NH1   1 
ATOM   1412  N  NH2   . ARG B 2 77  ? 16.014  23.502 -36.228 1.00 64.19  ? 92  ARG B NH2   1 
ATOM   1413  N  N     . GLN B 2 78  ? 12.399  26.871 -39.693 1.00 33.84  ? 93  GLN B N     1 
ATOM   1414  C  CA    . GLN B 2 78  ? 12.848  26.692 -41.079 1.00 31.82  ? 93  GLN B CA    1 
ATOM   1415  C  C     . GLN B 2 78  ? 13.382  28.015 -41.657 1.00 36.80  ? 93  GLN B C     1 
ATOM   1416  O  O     . GLN B 2 78  ? 13.826  28.033 -42.808 1.00 40.46  ? 93  GLN B O     1 
ATOM   1417  C  CB    . GLN B 2 78  ? 11.677  26.225 -41.982 1.00 32.17  ? 93  GLN B CB    1 
ATOM   1418  C  CG    . GLN B 2 78  ? 11.048  24.852 -41.662 1.00 42.85  ? 93  GLN B CG    1 
ATOM   1419  C  CD    . GLN B 2 78  ? 12.016  23.701 -41.531 1.00 64.22  ? 93  GLN B CD    1 
ATOM   1420  O  OE1   . GLN B 2 78  ? 12.918  23.491 -42.370 1.00 62.30  ? 93  GLN B OE1   1 
ATOM   1421  N  NE2   . GLN B 2 78  ? 11.836  22.919 -40.469 1.00 45.04  ? 93  GLN B NE2   1 
ATOM   1422  N  N     . GLY B 2 79  ? 13.279  29.112 -40.905 1.00 28.87  ? 94  GLY B N     1 
ATOM   1423  C  CA    . GLY B 2 79  ? 13.705  30.430 -41.360 1.00 28.11  ? 94  GLY B CA    1 
ATOM   1424  C  C     . GLY B 2 79  ? 12.788  30.950 -42.444 1.00 33.50  ? 94  GLY B C     1 
ATOM   1425  O  O     . GLY B 2 79  ? 13.213  31.641 -43.380 1.00 32.65  ? 94  GLY B O     1 
ATOM   1426  N  N     . ARG B 2 80  ? 11.517  30.593 -42.340 1.00 30.26  ? 95  ARG B N     1 
ATOM   1427  C  CA    . ARG B 2 80  ? 10.511  31.050 -43.321 1.00 30.14  ? 95  ARG B CA    1 
ATOM   1428  C  C     . ARG B 2 80  ? 9.364   31.713 -42.573 1.00 36.18  ? 95  ARG B C     1 
ATOM   1429  O  O     . ARG B 2 80  ? 8.239   31.451 -42.931 1.00 39.73  ? 95  ARG B O     1 
ATOM   1430  C  CB    . ARG B 2 80  ? 9.969   29.914 -44.193 1.00 31.79  ? 95  ARG B CB    1 
ATOM   1431  C  CG    . ARG B 2 80  ? 11.002  28.920 -44.684 1.00 35.48  ? 95  ARG B CG    1 
ATOM   1432  C  CD    . ARG B 2 80  ? 11.504  29.158 -46.074 1.00 40.42  ? 95  ARG B CD    1 
ATOM   1433  N  NE    . ARG B 2 80  ? 10.519  29.906 -46.793 1.00 43.26  ? 95  ARG B NE    1 
ATOM   1434  C  CZ    . ARG B 2 80  ? 10.812  30.667 -47.818 1.00 50.28  ? 95  ARG B CZ    1 
ATOM   1435  N  NH1   . ARG B 2 80  ? 12.060  30.761 -48.213 1.00 39.50  ? 95  ARG B NH1   1 
ATOM   1436  N  NH2   . ARG B 2 80  ? 9.870   31.331 -48.443 1.00 33.51  ? 95  ARG B NH2   1 
ATOM   1437  N  N     . THR B 2 81  ? 9.691   32.565 -41.603 1.00 27.90  ? 96  THR B N     1 
ATOM   1438  C  CA    . THR B 2 81  ? 8.775   33.377 -40.754 1.00 27.14  ? 96  THR B CA    1 
ATOM   1439  C  C     . THR B 2 81  ? 7.533   33.915 -41.475 1.00 29.76  ? 96  THR B C     1 
ATOM   1440  O  O     . THR B 2 81  ? 7.682   34.670 -42.411 1.00 24.29  ? 96  THR B O     1 
ATOM   1441  C  CB    . THR B 2 81  ? 9.541   34.582 -40.209 1.00 30.27  ? 96  THR B CB    1 
ATOM   1442  O  OG1   . THR B 2 81  ? 10.816  34.108 -39.795 1.00 29.45  ? 96  THR B OG1   1 
ATOM   1443  C  CG2   . THR B 2 81  ? 8.873   35.270 -39.045 1.00 25.72  ? 96  THR B CG2   1 
ATOM   1444  N  N     . LEU B 2 82  ? 6.346   33.557 -40.992 1.00 27.42  ? 97  LEU B N     1 
ATOM   1445  C  CA    . LEU B 2 82  ? 5.082   33.897 -41.675 1.00 23.76  ? 97  LEU B CA    1 
ATOM   1446  C  C     . LEU B 2 82  ? 4.255   34.872 -40.844 1.00 26.41  ? 97  LEU B C     1 
ATOM   1447  O  O     . LEU B 2 82  ? 4.099   34.664 -39.653 1.00 25.84  ? 97  LEU B O     1 
ATOM   1448  C  CB    . LEU B 2 82  ? 4.299   32.609 -41.906 1.00 21.70  ? 97  LEU B CB    1 
ATOM   1449  C  CG    . LEU B 2 82  ? 2.940   32.758 -42.576 1.00 24.57  ? 97  LEU B CG    1 
ATOM   1450  C  CD1   . LEU B 2 82  ? 3.088   33.012 -44.058 1.00 23.17  ? 97  LEU B CD1   1 
ATOM   1451  C  CD2   . LEU B 2 82  ? 2.092   31.531 -42.347 1.00 32.48  ? 97  LEU B CD2   1 
ATOM   1452  N  N     . TYR B 2 83  ? 3.732   35.897 -41.505 1.00 21.98  ? 98  TYR B N     1 
ATOM   1453  C  CA    . TYR B 2 83  ? 2.883   36.877 -40.855 1.00 20.99  ? 98  TYR B CA    1 
ATOM   1454  C  C     . TYR B 2 83  ? 1.421   36.601 -41.194 1.00 22.46  ? 98  TYR B C     1 
ATOM   1455  O  O     . TYR B 2 83  ? 1.086   36.241 -42.334 1.00 17.03  ? 98  TYR B O     1 
ATOM   1456  C  CB    . TYR B 2 83  ? 3.259   38.297 -41.309 1.00 24.40  ? 98  TYR B CB    1 
ATOM   1457  C  CG    . TYR B 2 83  ? 4.472   38.938 -40.665 1.00 26.27  ? 98  TYR B CG    1 
ATOM   1458  C  CD1   . TYR B 2 83  ? 5.261   38.240 -39.754 1.00 26.67  ? 98  TYR B CD1   1 
ATOM   1459  C  CD2   . TYR B 2 83  ? 4.865   40.220 -41.016 1.00 28.82  ? 98  TYR B CD2   1 
ATOM   1460  C  CE1   . TYR B 2 83  ? 6.361   38.838 -39.142 1.00 26.31  ? 98  TYR B CE1   1 
ATOM   1461  C  CE2   . TYR B 2 83  ? 5.957   40.834 -40.401 1.00 31.67  ? 98  TYR B CE2   1 
ATOM   1462  C  CZ    . TYR B 2 83  ? 6.711   40.134 -39.474 1.00 38.78  ? 98  TYR B CZ    1 
ATOM   1463  O  OH    . TYR B 2 83  ? 7.755   40.776 -38.853 1.00 40.50  ? 98  TYR B OH    1 
ATOM   1464  N  N     . GLY B 2 84  ? 0.578   36.755 -40.181 1.00 23.43  ? 99  GLY B N     1 
ATOM   1465  C  CA    . GLY B 2 84  ? -0.857  36.684 -40.333 1.00 25.98  ? 99  GLY B CA    1 
ATOM   1466  C  C     . GLY B 2 84  ? -1.610  35.579 -39.663 1.00 43.16  ? 99  GLY B C     1 
ATOM   1467  O  O     . GLY B 2 84  ? -2.834  35.695 -39.595 1.00 52.07  ? 99  GLY B O     1 
ATOM   1468  N  N     . PHE B 2 85  ? -0.937  34.504 -39.178 1.00 35.56  ? 100 PHE B N     1 
ATOM   1469  C  CA    . PHE B 2 85  ? -1.669  33.377 -38.637 1.00 34.13  ? 100 PHE B CA    1 
ATOM   1470  C  C     . PHE B 2 85  ? -1.520  33.196 -37.152 1.00 44.13  ? 100 PHE B C     1 
ATOM   1471  O  O     . PHE B 2 85  ? -1.797  32.099 -36.604 1.00 44.74  ? 100 PHE B O     1 
ATOM   1472  C  CB    . PHE B 2 85  ? -1.278  32.104 -39.397 1.00 33.69  ? 100 PHE B CB    1 
ATOM   1473  C  CG    . PHE B 2 85  ? -1.812  32.111 -40.804 1.00 32.46  ? 100 PHE B CG    1 
ATOM   1474  C  CD1   . PHE B 2 85  ? -1.095  32.704 -41.833 1.00 32.90  ? 100 PHE B CD1   1 
ATOM   1475  C  CD2   . PHE B 2 85  ? -3.048  31.552 -41.095 1.00 33.44  ? 100 PHE B CD2   1 
ATOM   1476  C  CE1   . PHE B 2 85  ? -1.595  32.714 -43.130 1.00 33.50  ? 100 PHE B CE1   1 
ATOM   1477  C  CE2   . PHE B 2 85  ? -3.555  31.565 -42.398 1.00 34.93  ? 100 PHE B CE2   1 
ATOM   1478  C  CZ    . PHE B 2 85  ? -2.812  32.114 -43.411 1.00 32.47  ? 100 PHE B CZ    1 
ATOM   1479  N  N     . GLY B 2 86  ? -1.166  34.296 -36.518 1.00 43.49  ? 101 GLY B N     1 
ATOM   1480  C  CA    . GLY B 2 86  ? -0.917  34.403 -35.089 1.00 46.30  ? 101 GLY B CA    1 
ATOM   1481  C  C     . GLY B 2 86  ? 0.574   34.522 -34.867 1.00 57.98  ? 101 GLY B C     1 
ATOM   1482  O  O     . GLY B 2 86  ? 1.365   34.385 -35.828 1.00 59.43  ? 101 GLY B O     1 
ATOM   1483  N  N     . GLY B 2 87  ? 0.945   34.812 -33.610 1.00 56.41  ? 102 GLY B N     1 
ATOM   1484  C  CA    . GLY B 2 87  ? 2.346   35.036 -33.208 1.00 60.06  ? 102 GLY B CA    1 
ATOM   1485  C  C     . GLY B 2 87  ? 2.749   36.452 -33.652 1.00 64.77  ? 102 GLY B C     1 
ATOM   1486  O  O     . GLY B 2 87  ? 1.915   37.377 -33.428 1.00 68.80  ? 102 GLY B O     1 
ATOM   1487  O  OXT   . GLY B 2 87  ? 3.858   36.623 -34.247 1.00 62.13  ? 102 GLY B OXT   1 
ATOM   1488  N  N     . THR C 3 3   ? 29.355  12.538 -7.833  1.00 105.09 ? 16  THR C N     1 
ATOM   1489  C  CA    . THR C 3 3   ? 28.872  13.601 -8.722  1.00 104.79 ? 16  THR C CA    1 
ATOM   1490  C  C     . THR C 3 3   ? 27.575  13.177 -9.413  1.00 107.99 ? 16  THR C C     1 
ATOM   1491  O  O     . THR C 3 3   ? 27.276  11.989 -9.466  1.00 106.72 ? 16  THR C O     1 
ATOM   1492  C  CB    . THR C 3 3   ? 29.955  14.043 -9.769  1.00 114.52 ? 16  THR C CB    1 
ATOM   1493  O  OG1   . THR C 3 3   ? 30.155  13.027 -10.764 1.00 113.54 ? 16  THR C OG1   1 
ATOM   1494  C  CG2   . THR C 3 3   ? 31.279  14.447 -9.139  1.00 114.45 ? 16  THR C CG2   1 
ATOM   1495  N  N     . ARG C 3 4   ? 26.817  14.148 -9.961  1.00 105.09 ? 17  ARG C N     1 
ATOM   1496  C  CA    . ARG C 3 4   ? 25.585  13.876 -10.707 1.00 104.65 ? 17  ARG C CA    1 
ATOM   1497  C  C     . ARG C 3 4   ? 25.916  13.182 -12.026 1.00 107.70 ? 17  ARG C C     1 
ATOM   1498  O  O     . ARG C 3 4   ? 25.118  12.372 -12.498 1.00 107.75 ? 17  ARG C O     1 
ATOM   1499  C  CB    . ARG C 3 4   ? 24.808  15.163 -10.965 1.00 105.14 ? 17  ARG C CB    1 
ATOM   1500  C  CG    . ARG C 3 4   ? 23.826  15.529 -9.868  1.00 114.10 ? 17  ARG C CG    1 
ATOM   1501  C  CD    . ARG C 3 4   ? 22.785  16.503 -10.386 1.00 118.93 ? 17  ARG C CD    1 
ATOM   1502  N  NE    . ARG C 3 4   ? 23.332  17.847 -10.551 1.00 116.38 ? 17  ARG C NE    1 
ATOM   1503  C  CZ    . ARG C 3 4   ? 22.615  18.957 -10.436 1.00 126.83 ? 17  ARG C CZ    1 
ATOM   1504  N  NH1   . ARG C 3 4   ? 21.316  18.893 -10.170 1.00 109.97 ? 17  ARG C NH1   1 
ATOM   1505  N  NH2   . ARG C 3 4   ? 23.192  20.143 -10.579 1.00 114.04 ? 17  ARG C NH2   1 
ATOM   1506  N  N     . SER C 3 5   ? 27.109  13.491 -12.602 1.00 103.07 ? 18  SER C N     1 
ATOM   1507  C  CA    . SER C 3 5   ? 27.650  12.907 -13.837 1.00 101.89 ? 18  SER C CA    1 
ATOM   1508  C  C     . SER C 3 5   ? 27.942  11.414 -13.608 1.00 105.11 ? 18  SER C C     1 
ATOM   1509  O  O     . SER C 3 5   ? 27.666  10.595 -14.484 1.00 104.68 ? 18  SER C O     1 
ATOM   1510  C  CB    . SER C 3 5   ? 28.919  13.640 -14.275 1.00 102.70 ? 18  SER C CB    1 
ATOM   1511  O  OG    . SER C 3 5   ? 28.756  15.047 -14.302 1.00 104.43 ? 18  SER C OG    1 
ATOM   1512  N  N     . SER C 3 6   ? 28.453  11.068 -12.408 1.00 100.60 ? 19  SER C N     1 
ATOM   1513  C  CA    . SER C 3 6   ? 28.741  9.698  -12.002 1.00 100.31 ? 19  SER C CA    1 
ATOM   1514  C  C     . SER C 3 6   ? 27.448  8.878  -11.943 1.00 102.64 ? 19  SER C C     1 
ATOM   1515  O  O     . SER C 3 6   ? 27.409  7.765  -12.470 1.00 103.18 ? 19  SER C O     1 
ATOM   1516  C  CB    . SER C 3 6   ? 29.469  9.691  -10.658 1.00 106.49 ? 19  SER C CB    1 
ATOM   1517  O  OG    . SER C 3 6   ? 28.653  9.632  -9.498  1.00 120.82 ? 19  SER C OG    1 
ATOM   1518  N  N     . ARG C 3 7   ? 26.394  9.453  -11.309 1.00 97.72  ? 20  ARG C N     1 
ATOM   1519  C  CA    . ARG C 3 7   ? 25.039  8.902  -11.118 1.00 96.92  ? 20  ARG C CA    1 
ATOM   1520  C  C     . ARG C 3 7   ? 24.311  8.621  -12.468 1.00 99.82  ? 20  ARG C C     1 
ATOM   1521  O  O     . ARG C 3 7   ? 23.487  7.705  -12.527 1.00 97.94  ? 20  ARG C O     1 
ATOM   1522  C  CB    . ARG C 3 7   ? 24.188  9.881  -10.265 1.00 96.77  ? 20  ARG C CB    1 
ATOM   1523  C  CG    . ARG C 3 7   ? 24.154  9.660  -8.753  1.00 103.98 ? 20  ARG C CG    1 
ATOM   1524  C  CD    . ARG C 3 7   ? 25.377  10.170 -7.990  1.00 123.36 ? 20  ARG C CD    1 
ATOM   1525  N  NE    . ARG C 3 7   ? 26.164  9.066  -7.412  1.00 144.63 ? 20  ARG C NE    1 
ATOM   1526  C  CZ    . ARG C 3 7   ? 27.220  9.201  -6.604  1.00 157.56 ? 20  ARG C CZ    1 
ATOM   1527  N  NH1   . ARG C 3 7   ? 27.658  10.410 -6.266  1.00 146.95 ? 20  ARG C NH1   1 
ATOM   1528  N  NH2   . ARG C 3 7   ? 27.844  8.127  -6.133  1.00 135.65 ? 20  ARG C NH2   1 
ATOM   1529  N  N     . ALA C 3 8   ? 24.587  9.441  -13.527 1.00 96.71  ? 21  ALA C N     1 
ATOM   1530  C  CA    . ALA C 3 8   ? 23.985  9.322  -14.865 1.00 96.25  ? 21  ALA C CA    1 
ATOM   1531  C  C     . ALA C 3 8   ? 24.867  8.542  -15.864 1.00 100.61 ? 21  ALA C C     1 
ATOM   1532  O  O     . ALA C 3 8   ? 24.422  8.246  -16.986 1.00 100.86 ? 21  ALA C O     1 
ATOM   1533  C  CB    . ALA C 3 8   ? 23.670  10.696 -15.412 1.00 96.69  ? 21  ALA C CB    1 
ATOM   1534  N  N     . GLY C 3 9   ? 26.086  8.204  -15.427 1.00 95.74  ? 22  GLY C N     1 
ATOM   1535  C  CA    . GLY C 3 9   ? 27.077  7.472  -16.212 1.00 94.63  ? 22  GLY C CA    1 
ATOM   1536  C  C     . GLY C 3 9   ? 27.656  8.300  -17.342 1.00 96.10  ? 22  GLY C C     1 
ATOM   1537  O  O     . GLY C 3 9   ? 27.894  7.784  -18.438 1.00 95.95  ? 22  GLY C O     1 
ATOM   1538  N  N     . LEU C 3 10  ? 27.899  9.592  -17.077 1.00 90.10  ? 23  LEU C N     1 
ATOM   1539  C  CA    . LEU C 3 10  ? 28.414  10.530 -18.063 1.00 88.60  ? 23  LEU C CA    1 
ATOM   1540  C  C     . LEU C 3 10  ? 29.794  11.077 -17.725 1.00 90.41  ? 23  LEU C C     1 
ATOM   1541  O  O     . LEU C 3 10  ? 30.155  11.181 -16.556 1.00 88.50  ? 23  LEU C O     1 
ATOM   1542  C  CB    . LEU C 3 10  ? 27.416  11.703 -18.234 1.00 88.43  ? 23  LEU C CB    1 
ATOM   1543  C  CG    . LEU C 3 10  ? 25.978  11.351 -18.611 1.00 92.65  ? 23  LEU C CG    1 
ATOM   1544  C  CD1   . LEU C 3 10  ? 25.067  12.532 -18.429 1.00 92.64  ? 23  LEU C CD1   1 
ATOM   1545  C  CD2   . LEU C 3 10  ? 25.885  10.862 -20.030 1.00 94.69  ? 23  LEU C CD2   1 
ATOM   1546  N  N     . GLN C 3 11  ? 30.553  11.442 -18.764 1.00 87.50  ? 24  GLN C N     1 
ATOM   1547  C  CA    . GLN C 3 11  ? 31.849  12.101 -18.663 1.00 87.05  ? 24  GLN C CA    1 
ATOM   1548  C  C     . GLN C 3 11  ? 31.591  13.605 -18.542 1.00 89.68  ? 24  GLN C C     1 
ATOM   1549  O  O     . GLN C 3 11  ? 32.247  14.257 -17.726 1.00 90.85  ? 24  GLN C O     1 
ATOM   1550  C  CB    . GLN C 3 11  ? 32.752  11.799 -19.882 1.00 88.38  ? 24  GLN C CB    1 
ATOM   1551  C  CG    . GLN C 3 11  ? 33.188  10.335 -20.040 1.00 98.40  ? 24  GLN C CG    1 
ATOM   1552  C  CD    . GLN C 3 11  ? 33.789  9.733  -18.786 1.00 124.50 ? 24  GLN C CD    1 
ATOM   1553  O  OE1   . GLN C 3 11  ? 34.827  10.173 -18.274 1.00 117.41 ? 24  GLN C OE1   1 
ATOM   1554  N  NE2   . GLN C 3 11  ? 33.136  8.702  -18.268 1.00 125.45 ? 24  GLN C NE2   1 
ATOM   1555  N  N     . PHE C 3 12  ? 30.601  14.133 -19.317 1.00 83.32  ? 25  PHE C N     1 
ATOM   1556  C  CA    . PHE C 3 12  ? 30.188  15.545 -19.355 1.00 81.88  ? 25  PHE C CA    1 
ATOM   1557  C  C     . PHE C 3 12  ? 29.574  16.022 -18.035 1.00 85.75  ? 25  PHE C C     1 
ATOM   1558  O  O     . PHE C 3 12  ? 29.011  15.197 -17.303 1.00 86.71  ? 25  PHE C O     1 
ATOM   1559  C  CB    . PHE C 3 12  ? 29.268  15.828 -20.559 1.00 82.84  ? 25  PHE C CB    1 
ATOM   1560  C  CG    . PHE C 3 12  ? 30.042  16.318 -21.764 1.00 83.30  ? 25  PHE C CG    1 
ATOM   1561  C  CD1   . PHE C 3 12  ? 31.141  15.614 -22.246 1.00 85.51  ? 25  PHE C CD1   1 
ATOM   1562  C  CD2   . PHE C 3 12  ? 29.678  17.484 -22.413 1.00 84.14  ? 25  PHE C CD2   1 
ATOM   1563  C  CE1   . PHE C 3 12  ? 31.862  16.071 -23.351 1.00 85.29  ? 25  PHE C CE1   1 
ATOM   1564  C  CE2   . PHE C 3 12  ? 30.401  17.936 -23.520 1.00 86.27  ? 25  PHE C CE2   1 
ATOM   1565  C  CZ    . PHE C 3 12  ? 31.494  17.230 -23.972 1.00 83.65  ? 25  PHE C CZ    1 
ATOM   1566  N  N     . PRO C 3 13  ? 29.711  17.328 -17.685 1.00 79.91  ? 26  PRO C N     1 
ATOM   1567  C  CA    . PRO C 3 13  ? 29.261  17.777 -16.358 1.00 79.04  ? 26  PRO C CA    1 
ATOM   1568  C  C     . PRO C 3 13  ? 27.794  18.168 -16.223 1.00 81.38  ? 26  PRO C C     1 
ATOM   1569  O  O     . PRO C 3 13  ? 27.384  19.239 -16.653 1.00 81.30  ? 26  PRO C O     1 
ATOM   1570  C  CB    . PRO C 3 13  ? 30.193  18.949 -16.054 1.00 80.90  ? 26  PRO C CB    1 
ATOM   1571  C  CG    . PRO C 3 13  ? 30.477  19.541 -17.399 1.00 86.17  ? 26  PRO C CG    1 
ATOM   1572  C  CD    . PRO C 3 13  ? 30.415  18.410 -18.405 1.00 81.61  ? 26  PRO C CD    1 
ATOM   1573  N  N     . VAL C 3 14  ? 27.028  17.313 -15.542 1.00 77.59  ? 27  VAL C N     1 
ATOM   1574  C  CA    . VAL C 3 14  ? 25.613  17.510 -15.235 1.00 77.02  ? 27  VAL C CA    1 
ATOM   1575  C  C     . VAL C 3 14  ? 25.490  18.748 -14.341 1.00 78.91  ? 27  VAL C C     1 
ATOM   1576  O  O     . VAL C 3 14  ? 24.622  19.589 -14.592 1.00 78.88  ? 27  VAL C O     1 
ATOM   1577  C  CB    . VAL C 3 14  ? 24.986  16.248 -14.573 1.00 81.35  ? 27  VAL C CB    1 
ATOM   1578  C  CG1   . VAL C 3 14  ? 23.552  16.510 -14.121 1.00 81.36  ? 27  VAL C CG1   1 
ATOM   1579  C  CG2   . VAL C 3 14  ? 25.039  15.043 -15.504 1.00 81.13  ? 27  VAL C CG2   1 
ATOM   1580  N  N     . GLY C 3 15  ? 26.392  18.862 -13.359 1.00 73.88  ? 28  GLY C N     1 
ATOM   1581  C  CA    . GLY C 3 15  ? 26.449  19.975 -12.417 1.00 73.47  ? 28  GLY C CA    1 
ATOM   1582  C  C     . GLY C 3 15  ? 26.499  21.339 -13.077 1.00 76.50  ? 28  GLY C C     1 
ATOM   1583  O  O     . GLY C 3 15  ? 25.652  22.193 -12.799 1.00 77.58  ? 28  GLY C O     1 
ATOM   1584  N  N     . ARG C 3 16  ? 27.482  21.526 -13.988 1.00 70.12  ? 29  ARG C N     1 
ATOM   1585  C  CA    . ARG C 3 16  ? 27.739  22.736 -14.775 1.00 67.90  ? 29  ARG C CA    1 
ATOM   1586  C  C     . ARG C 3 16  ? 26.555  23.055 -15.653 1.00 71.26  ? 29  ARG C C     1 
ATOM   1587  O  O     . ARG C 3 16  ? 26.047  24.167 -15.581 1.00 71.50  ? 29  ARG C O     1 
ATOM   1588  C  CB    . ARG C 3 16  ? 29.005  22.547 -15.629 1.00 65.28  ? 29  ARG C CB    1 
ATOM   1589  C  CG    . ARG C 3 16  ? 29.470  23.776 -16.395 1.00 73.11  ? 29  ARG C CG    1 
ATOM   1590  C  CD    . ARG C 3 16  ? 30.894  23.630 -16.912 1.00 81.83  ? 29  ARG C CD    1 
ATOM   1591  N  NE    . ARG C 3 16  ? 31.854  23.676 -15.804 1.00 91.07  ? 29  ARG C NE    1 
ATOM   1592  C  CZ    . ARG C 3 16  ? 33.180  23.696 -15.926 1.00 100.76 ? 29  ARG C CZ    1 
ATOM   1593  N  NH1   . ARG C 3 16  ? 33.951  23.737 -14.843 1.00 82.13  ? 29  ARG C NH1   1 
ATOM   1594  N  NH2   . ARG C 3 16  ? 33.746  23.669 -17.130 1.00 84.63  ? 29  ARG C NH2   1 
ATOM   1595  N  N     . VAL C 3 17  ? 26.103  22.072 -16.460 1.00 67.69  ? 30  VAL C N     1 
ATOM   1596  C  CA    . VAL C 3 17  ? 24.975  22.178 -17.394 1.00 67.41  ? 30  VAL C CA    1 
ATOM   1597  C  C     . VAL C 3 17  ? 23.746  22.782 -16.691 1.00 74.89  ? 30  VAL C C     1 
ATOM   1598  O  O     . VAL C 3 17  ? 23.177  23.737 -17.219 1.00 74.92  ? 30  VAL C O     1 
ATOM   1599  C  CB    . VAL C 3 17  ? 24.683  20.828 -18.139 1.00 69.38  ? 30  VAL C CB    1 
ATOM   1600  C  CG1   . VAL C 3 17  ? 23.393  20.891 -18.938 1.00 69.31  ? 30  VAL C CG1   1 
ATOM   1601  C  CG2   . VAL C 3 17  ? 25.831  20.446 -19.065 1.00 68.27  ? 30  VAL C CG2   1 
ATOM   1602  N  N     . HIS C 3 18  ? 23.415  22.294 -15.471 1.00 74.48  ? 31  HIS C N     1 
ATOM   1603  C  CA    . HIS C 3 18  ? 22.292  22.757 -14.647 1.00 76.44  ? 31  HIS C CA    1 
ATOM   1604  C  C     . HIS C 3 18  ? 22.445  24.229 -14.276 1.00 80.32  ? 31  HIS C C     1 
ATOM   1605  O  O     . HIS C 3 18  ? 21.486  24.995 -14.397 1.00 80.49  ? 31  HIS C O     1 
ATOM   1606  C  CB    . HIS C 3 18  ? 22.179  21.891 -13.385 1.00 79.15  ? 31  HIS C CB    1 
ATOM   1607  C  CG    . HIS C 3 18  ? 20.949  22.125 -12.554 1.00 84.39  ? 31  HIS C CG    1 
ATOM   1608  N  ND1   . HIS C 3 18  ? 19.675  22.036 -13.095 1.00 87.17  ? 31  HIS C ND1   1 
ATOM   1609  C  CD2   . HIS C 3 18  ? 20.840  22.353 -11.220 1.00 87.40  ? 31  HIS C CD2   1 
ATOM   1610  C  CE1   . HIS C 3 18  ? 18.841  22.244 -12.085 1.00 87.01  ? 31  HIS C CE1   1 
ATOM   1611  N  NE2   . HIS C 3 18  ? 19.494  22.437 -10.937 1.00 87.37  ? 31  HIS C NE2   1 
ATOM   1612  N  N     . ARG C 3 19  ? 23.664  24.625 -13.859 1.00 75.43  ? 32  ARG C N     1 
ATOM   1613  C  CA    . ARG C 3 19  ? 24.022  25.990 -13.483 1.00 74.30  ? 32  ARG C CA    1 
ATOM   1614  C  C     . ARG C 3 19  ? 23.932  26.937 -14.678 1.00 78.28  ? 32  ARG C C     1 
ATOM   1615  O  O     . ARG C 3 19  ? 23.455  28.061 -14.520 1.00 78.60  ? 32  ARG C O     1 
ATOM   1616  C  CB    . ARG C 3 19  ? 25.432  26.019 -12.892 1.00 72.23  ? 32  ARG C CB    1 
ATOM   1617  C  CG    . ARG C 3 19  ? 25.764  27.286 -12.105 1.00 75.90  ? 32  ARG C CG    1 
ATOM   1618  C  CD    . ARG C 3 19  ? 26.915  28.043 -12.733 1.00 80.55  ? 32  ARG C CD    1 
ATOM   1619  N  NE    . ARG C 3 19  ? 28.066  27.187 -13.036 1.00 82.23  ? 32  ARG C NE    1 
ATOM   1620  C  CZ    . ARG C 3 19  ? 28.919  27.398 -14.033 1.00 95.34  ? 32  ARG C CZ    1 
ATOM   1621  N  NH1   . ARG C 3 19  ? 28.771  28.447 -14.834 1.00 92.99  ? 32  ARG C NH1   1 
ATOM   1622  N  NH2   . ARG C 3 19  ? 29.929  26.567 -14.232 1.00 76.30  ? 32  ARG C NH2   1 
ATOM   1623  N  N     . LEU C 3 20  ? 24.395  26.486 -15.859 1.00 73.65  ? 33  LEU C N     1 
ATOM   1624  C  CA    . LEU C 3 20  ? 24.361  27.263 -17.094 1.00 72.67  ? 33  LEU C CA    1 
ATOM   1625  C  C     . LEU C 3 20  ? 22.938  27.447 -17.620 1.00 77.94  ? 33  LEU C C     1 
ATOM   1626  O  O     . LEU C 3 20  ? 22.650  28.486 -18.214 1.00 79.36  ? 33  LEU C O     1 
ATOM   1627  C  CB    . LEU C 3 20  ? 25.264  26.648 -18.173 1.00 72.21  ? 33  LEU C CB    1 
ATOM   1628  C  CG    . LEU C 3 20  ? 26.758  26.540 -17.877 1.00 76.00  ? 33  LEU C CG    1 
ATOM   1629  C  CD1   . LEU C 3 20  ? 27.446  25.704 -18.928 1.00 75.67  ? 33  LEU C CD1   1 
ATOM   1630  C  CD2   . LEU C 3 20  ? 27.405  27.897 -17.783 1.00 78.24  ? 33  LEU C CD2   1 
ATOM   1631  N  N     . LEU C 3 21  ? 22.049  26.470 -17.380 1.00 75.05  ? 34  LEU C N     1 
ATOM   1632  C  CA    . LEU C 3 21  ? 20.650  26.531 -17.799 1.00 75.53  ? 34  LEU C CA    1 
ATOM   1633  C  C     . LEU C 3 21  ? 19.865  27.563 -16.999 1.00 84.60  ? 34  LEU C C     1 
ATOM   1634  O  O     . LEU C 3 21  ? 19.150  28.362 -17.600 1.00 85.40  ? 34  LEU C O     1 
ATOM   1635  C  CB    . LEU C 3 21  ? 19.975  25.158 -17.667 1.00 74.97  ? 34  LEU C CB    1 
ATOM   1636  C  CG    . LEU C 3 21  ? 20.245  24.147 -18.764 1.00 78.50  ? 34  LEU C CG    1 
ATOM   1637  C  CD1   . LEU C 3 21  ? 19.922  22.762 -18.276 1.00 78.47  ? 34  LEU C CD1   1 
ATOM   1638  C  CD2   . LEU C 3 21  ? 19.489  24.483 -20.041 1.00 79.58  ? 34  LEU C CD2   1 
ATOM   1639  N  N     . ARG C 3 22  ? 19.947  27.552 -15.652 1.00 83.93  ? 35  ARG C N     1 
ATOM   1640  C  CA    . ARG C 3 22  ? 19.185  28.539 -14.866 1.00 84.80  ? 35  ARG C CA    1 
ATOM   1641  C  C     . ARG C 3 22  ? 19.806  29.931 -14.937 1.00 90.00  ? 35  ARG C C     1 
ATOM   1642  O  O     . ARG C 3 22  ? 19.062  30.911 -14.956 1.00 91.73  ? 35  ARG C O     1 
ATOM   1643  C  CB    . ARG C 3 22  ? 18.912  28.098 -13.416 1.00 87.47  ? 35  ARG C CB    1 
ATOM   1644  C  CG    . ARG C 3 22  ? 20.071  27.408 -12.717 1.00 104.86 ? 35  ARG C CG    1 
ATOM   1645  C  CD    . ARG C 3 22  ? 19.581  26.493 -11.608 1.00 119.01 ? 35  ARG C CD    1 
ATOM   1646  N  NE    . ARG C 3 22  ? 20.642  25.641 -11.060 1.00 131.41 ? 35  ARG C NE    1 
ATOM   1647  C  CZ    . ARG C 3 22  ? 21.519  26.020 -10.131 1.00 150.67 ? 35  ARG C CZ    1 
ATOM   1648  N  NH1   . ARG C 3 22  ? 21.502  27.264 -9.655  1.00 132.80 ? 35  ARG C NH1   1 
ATOM   1649  N  NH2   . ARG C 3 22  ? 22.431  25.165 -9.683  1.00 143.85 ? 35  ARG C NH2   1 
ATOM   1650  N  N     . LYS C 3 23  ? 21.150  30.021 -15.042 1.00 85.25  ? 36  LYS C N     1 
ATOM   1651  C  CA    . LYS C 3 23  ? 21.885  31.292 -15.168 1.00 84.68  ? 36  LYS C CA    1 
ATOM   1652  C  C     . LYS C 3 23  ? 21.624  31.957 -16.531 1.00 83.22  ? 36  LYS C C     1 
ATOM   1653  O  O     . LYS C 3 23  ? 21.592  33.192 -16.645 1.00 83.44  ? 36  LYS C O     1 
ATOM   1654  C  CB    . LYS C 3 23  ? 23.407  31.043 -15.004 1.00 89.53  ? 36  LYS C CB    1 
ATOM   1655  C  CG    . LYS C 3 23  ? 24.309  32.297 -14.983 1.00 119.45 ? 36  LYS C CG    1 
ATOM   1656  C  CD    . LYS C 3 23  ? 25.683  32.024 -15.619 1.00 132.35 ? 36  LYS C CD    1 
ATOM   1657  C  CE    . LYS C 3 23  ? 26.846  32.296 -14.687 1.00 141.27 ? 36  LYS C CE    1 
ATOM   1658  N  NZ    . LYS C 3 23  ? 27.047  31.212 -13.685 1.00 140.23 ? 36  LYS C NZ    1 
ATOM   1659  N  N     . GLY C 3 24  ? 21.460  31.114 -17.538 1.00 75.07  ? 37  GLY C N     1 
ATOM   1660  C  CA    . GLY C 3 24  ? 21.323  31.504 -18.927 1.00 72.87  ? 37  GLY C CA    1 
ATOM   1661  C  C     . GLY C 3 24  ? 20.042  32.171 -19.356 1.00 71.53  ? 37  GLY C C     1 
ATOM   1662  O  O     . GLY C 3 24  ? 19.957  32.553 -20.528 1.00 69.59  ? 37  GLY C O     1 
ATOM   1663  N  N     . ASN C 3 25  ? 19.046  32.317 -18.431 1.00 66.31  ? 38  ASN C N     1 
ATOM   1664  C  CA    . ASN C 3 25  ? 17.731  32.939 -18.706 1.00 66.07  ? 38  ASN C CA    1 
ATOM   1665  C  C     . ASN C 3 25  ? 16.935  32.211 -19.817 1.00 66.90  ? 38  ASN C C     1 
ATOM   1666  O  O     . ASN C 3 25  ? 16.619  32.801 -20.877 1.00 66.76  ? 38  ASN C O     1 
ATOM   1667  C  CB    . ASN C 3 25  ? 17.838  34.456 -19.005 1.00 70.20  ? 38  ASN C CB    1 
ATOM   1668  C  CG    . ASN C 3 25  ? 18.366  35.240 -17.849 1.00 100.41 ? 38  ASN C CG    1 
ATOM   1669  O  OD1   . ASN C 3 25  ? 17.676  35.477 -16.856 1.00 103.18 ? 38  ASN C OD1   1 
ATOM   1670  N  ND2   . ASN C 3 25  ? 19.588  35.680 -17.941 1.00 87.85  ? 38  ASN C ND2   1 
ATOM   1671  N  N     . TYR C 3 26  ? 16.630  30.918 -19.555 1.00 59.35  ? 39  TYR C N     1 
ATOM   1672  C  CA    . TYR C 3 26  ? 15.874  30.067 -20.454 1.00 56.72  ? 39  TYR C CA    1 
ATOM   1673  C  C     . TYR C 3 26  ? 14.480  29.770 -19.900 1.00 61.63  ? 39  TYR C C     1 
ATOM   1674  O  O     . TYR C 3 26  ? 13.537  29.577 -20.667 1.00 60.14  ? 39  TYR C O     1 
ATOM   1675  C  CB    . TYR C 3 26  ? 16.648  28.786 -20.743 1.00 55.43  ? 39  TYR C CB    1 
ATOM   1676  C  CG    . TYR C 3 26  ? 17.986  29.001 -21.401 1.00 53.96  ? 39  TYR C CG    1 
ATOM   1677  C  CD1   . TYR C 3 26  ? 18.074  29.369 -22.733 1.00 55.07  ? 39  TYR C CD1   1 
ATOM   1678  C  CD2   . TYR C 3 26  ? 19.167  28.748 -20.718 1.00 54.72  ? 39  TYR C CD2   1 
ATOM   1679  C  CE1   . TYR C 3 26  ? 19.307  29.554 -23.352 1.00 55.94  ? 39  TYR C CE1   1 
ATOM   1680  C  CE2   . TYR C 3 26  ? 20.408  28.896 -21.334 1.00 55.42  ? 39  TYR C CE2   1 
ATOM   1681  C  CZ    . TYR C 3 26  ? 20.474  29.310 -22.650 1.00 60.77  ? 39  TYR C CZ    1 
ATOM   1682  O  OH    . TYR C 3 26  ? 21.692  29.461 -23.268 1.00 59.36  ? 39  TYR C OH    1 
ATOM   1683  N  N     . SER C 3 27  ? 14.352  29.728 -18.563 1.00 60.61  ? 40  SER C N     1 
ATOM   1684  C  CA    . SER C 3 27  ? 13.089  29.473 -17.852 1.00 61.32  ? 40  SER C CA    1 
ATOM   1685  C  C     . SER C 3 27  ? 13.255  29.752 -16.378 1.00 67.75  ? 40  SER C C     1 
ATOM   1686  O  O     . SER C 3 27  ? 14.375  29.654 -15.860 1.00 67.10  ? 40  SER C O     1 
ATOM   1687  C  CB    . SER C 3 27  ? 12.637  28.024 -18.031 1.00 62.72  ? 40  SER C CB    1 
ATOM   1688  O  OG    . SER C 3 27  ? 13.630  27.105 -17.602 1.00 66.40  ? 40  SER C OG    1 
ATOM   1689  N  N     . GLU C 3 28  ? 12.139  30.051 -15.695 1.00 66.84  ? 41  GLU C N     1 
ATOM   1690  C  CA    . GLU C 3 28  ? 12.126  30.281 -14.257 1.00 69.07  ? 41  GLU C CA    1 
ATOM   1691  C  C     . GLU C 3 28  ? 12.728  29.032 -13.497 1.00 77.61  ? 41  GLU C C     1 
ATOM   1692  O  O     . GLU C 3 28  ? 13.612  29.203 -12.653 1.00 79.70  ? 41  GLU C O     1 
ATOM   1693  C  CB    . GLU C 3 28  ? 10.676  30.591 -13.803 1.00 70.87  ? 41  GLU C CB    1 
ATOM   1694  C  CG    . GLU C 3 28  ? 10.519  31.199 -12.410 1.00 87.03  ? 41  GLU C CG    1 
ATOM   1695  C  CD    . GLU C 3 28  ? 9.401   30.629 -11.537 1.00 122.20 ? 41  GLU C CD    1 
ATOM   1696  O  OE1   . GLU C 3 28  ? 8.208   30.865 -11.844 1.00 118.34 ? 41  GLU C OE1   1 
ATOM   1697  O  OE2   . GLU C 3 28  ? 9.725   29.940 -10.541 1.00 119.51 ? 41  GLU C OE2   1 
ATOM   1698  N  N     . ARG C 3 29  ? 12.296  27.791 -13.848 1.00 73.29  ? 42  ARG C N     1 
ATOM   1699  C  CA    . ARG C 3 29  ? 12.773  26.543 -13.230 1.00 72.69  ? 42  ARG C CA    1 
ATOM   1700  C  C     . ARG C 3 29  ? 13.399  25.534 -14.248 1.00 73.40  ? 42  ARG C C     1 
ATOM   1701  O  O     . ARG C 3 29  ? 13.065  25.551 -15.435 1.00 71.92  ? 42  ARG C O     1 
ATOM   1702  C  CB    . ARG C 3 29  ? 11.625  25.857 -12.467 1.00 76.63  ? 42  ARG C CB    1 
ATOM   1703  C  CG    . ARG C 3 29  ? 10.756  26.763 -11.561 1.00 97.37  ? 42  ARG C CG    1 
ATOM   1704  C  CD    . ARG C 3 29  ? 9.389   26.122 -11.253 1.00 122.98 ? 42  ARG C CD    1 
ATOM   1705  N  NE    . ARG C 3 29  ? 9.375   25.217 -10.101 1.00 142.93 ? 42  ARG C NE    1 
ATOM   1706  C  CZ    . ARG C 3 29  ? 8.540   24.187 -9.969  1.00 167.64 ? 42  ARG C CZ    1 
ATOM   1707  N  NH1   . ARG C 3 29  ? 7.666   23.903 -10.928 1.00 156.85 ? 42  ARG C NH1   1 
ATOM   1708  N  NH2   . ARG C 3 29  ? 8.590   23.419 -8.888  1.00 162.47 ? 42  ARG C NH2   1 
ATOM   1709  N  N     . VAL C 3 30  ? 14.301  24.660 -13.764 1.00 69.36  ? 43  VAL C N     1 
ATOM   1710  C  CA    . VAL C 3 30  ? 14.973  23.597 -14.537 1.00 69.00  ? 43  VAL C CA    1 
ATOM   1711  C  C     . VAL C 3 30  ? 14.721  22.237 -13.852 1.00 76.55  ? 43  VAL C C     1 
ATOM   1712  O  O     . VAL C 3 30  ? 15.033  22.065 -12.670 1.00 77.26  ? 43  VAL C O     1 
ATOM   1713  C  CB    . VAL C 3 30  ? 16.503  23.855 -14.730 1.00 71.43  ? 43  VAL C CB    1 
ATOM   1714  C  CG1   . VAL C 3 30  ? 17.203  22.679 -15.432 1.00 71.10  ? 43  VAL C CG1   1 
ATOM   1715  C  CG2   . VAL C 3 30  ? 16.756  25.152 -15.481 1.00 70.63  ? 43  VAL C CG2   1 
ATOM   1716  N  N     . GLY C 3 31  ? 14.206  21.277 -14.610 1.00 74.98  ? 44  GLY C N     1 
ATOM   1717  C  CA    . GLY C 3 31  ? 13.964  19.921 -14.122 1.00 75.49  ? 44  GLY C CA    1 
ATOM   1718  C  C     . GLY C 3 31  ? 15.232  19.178 -13.752 1.00 80.16  ? 44  GLY C C     1 
ATOM   1719  O  O     . GLY C 3 31  ? 16.310  19.511 -14.250 1.00 79.85  ? 44  GLY C O     1 
ATOM   1720  N  N     . ALA C 3 32  ? 15.117  18.174 -12.861 1.00 76.74  ? 45  ALA C N     1 
ATOM   1721  C  CA    . ALA C 3 32  ? 16.252  17.370 -12.396 1.00 75.90  ? 45  ALA C CA    1 
ATOM   1722  C  C     . ALA C 3 32  ? 16.890  16.561 -13.527 1.00 79.59  ? 45  ALA C C     1 
ATOM   1723  O  O     . ALA C 3 32  ? 18.098  16.306 -13.488 1.00 80.83  ? 45  ALA C O     1 
ATOM   1724  C  CB    . ALA C 3 32  ? 15.808  16.446 -11.284 1.00 76.34  ? 45  ALA C CB    1 
ATOM   1725  N  N     . GLY C 3 33  ? 16.067  16.185 -14.511 1.00 73.42  ? 46  GLY C N     1 
ATOM   1726  C  CA    . GLY C 3 33  ? 16.466  15.384 -15.658 1.00 72.06  ? 46  GLY C CA    1 
ATOM   1727  C  C     . GLY C 3 33  ? 17.013  16.164 -16.828 1.00 74.03  ? 46  GLY C C     1 
ATOM   1728  O  O     . GLY C 3 33  ? 17.834  15.634 -17.580 1.00 73.83  ? 46  GLY C O     1 
ATOM   1729  N  N     . ALA C 3 34  ? 16.556  17.414 -17.006 1.00 69.11  ? 47  ALA C N     1 
ATOM   1730  C  CA    . ALA C 3 34  ? 17.005  18.271 -18.107 1.00 68.19  ? 47  ALA C CA    1 
ATOM   1731  C  C     . ALA C 3 34  ? 18.545  18.385 -18.238 1.00 70.76  ? 47  ALA C C     1 
ATOM   1732  O  O     . ALA C 3 34  ? 19.026  18.091 -19.336 1.00 69.44  ? 47  ALA C O     1 
ATOM   1733  C  CB    . ALA C 3 34  ? 16.357  19.650 -18.023 1.00 69.00  ? 47  ALA C CB    1 
ATOM   1734  N  N     . PRO C 3 35  ? 19.350  18.736 -17.174 1.00 67.44  ? 48  PRO C N     1 
ATOM   1735  C  CA    . PRO C 3 35  ? 20.813  18.850 -17.371 1.00 66.40  ? 48  PRO C CA    1 
ATOM   1736  C  C     . PRO C 3 35  ? 21.503  17.542 -17.696 1.00 68.50  ? 48  PRO C C     1 
ATOM   1737  O  O     . PRO C 3 35  ? 22.514  17.554 -18.398 1.00 68.07  ? 48  PRO C O     1 
ATOM   1738  C  CB    . PRO C 3 35  ? 21.312  19.438 -16.050 1.00 67.99  ? 48  PRO C CB    1 
ATOM   1739  C  CG    . PRO C 3 35  ? 20.276  19.082 -15.058 1.00 72.65  ? 48  PRO C CG    1 
ATOM   1740  C  CD    . PRO C 3 35  ? 18.983  19.123 -15.791 1.00 68.81  ? 48  PRO C CD    1 
ATOM   1741  N  N     . VAL C 3 36  ? 20.935  16.420 -17.190 1.00 63.32  ? 49  VAL C N     1 
ATOM   1742  C  CA    . VAL C 3 36  ? 21.380  15.043 -17.391 1.00 61.33  ? 49  VAL C CA    1 
ATOM   1743  C  C     . VAL C 3 36  ? 21.219  14.686 -18.889 1.00 65.04  ? 49  VAL C C     1 
ATOM   1744  O  O     . VAL C 3 36  ? 22.185  14.251 -19.527 1.00 65.47  ? 49  VAL C O     1 
ATOM   1745  C  CB    . VAL C 3 36  ? 20.562  14.081 -16.488 1.00 63.29  ? 49  VAL C CB    1 
ATOM   1746  C  CG1   . VAL C 3 36  ? 20.824  12.635 -16.851 1.00 62.57  ? 49  VAL C CG1   1 
ATOM   1747  C  CG2   . VAL C 3 36  ? 20.831  14.327 -15.014 1.00 62.60  ? 49  VAL C CG2   1 
ATOM   1748  N  N     . TYR C 3 37  ? 19.989  14.866 -19.428 1.00 58.99  ? 50  TYR C N     1 
ATOM   1749  C  CA    . TYR C 3 37  ? 19.640  14.596 -20.815 1.00 57.39  ? 50  TYR C CA    1 
ATOM   1750  C  C     . TYR C 3 37  ? 20.497  15.462 -21.731 1.00 61.74  ? 50  TYR C C     1 
ATOM   1751  O  O     . TYR C 3 37  ? 21.050  14.935 -22.691 1.00 64.27  ? 50  TYR C O     1 
ATOM   1752  C  CB    . TYR C 3 37  ? 18.152  14.886 -21.044 1.00 57.06  ? 50  TYR C CB    1 
ATOM   1753  C  CG    . TYR C 3 37  ? 17.560  14.258 -22.284 1.00 57.26  ? 50  TYR C CG    1 
ATOM   1754  C  CD1   . TYR C 3 37  ? 17.933  14.686 -23.558 1.00 58.62  ? 50  TYR C CD1   1 
ATOM   1755  C  CD2   . TYR C 3 37  ? 16.574  13.282 -22.187 1.00 58.14  ? 50  TYR C CD2   1 
ATOM   1756  C  CE1   . TYR C 3 37  ? 17.376  14.120 -24.707 1.00 58.74  ? 50  TYR C CE1   1 
ATOM   1757  C  CE2   . TYR C 3 37  ? 16.024  12.690 -23.330 1.00 58.81  ? 50  TYR C CE2   1 
ATOM   1758  C  CZ    . TYR C 3 37  ? 16.413  13.126 -24.587 1.00 64.13  ? 50  TYR C CZ    1 
ATOM   1759  O  OH    . TYR C 3 37  ? 15.821  12.601 -25.710 1.00 59.41  ? 50  TYR C OH    1 
ATOM   1760  N  N     . LEU C 3 38  ? 20.627  16.767 -21.424 1.00 55.19  ? 51  LEU C N     1 
ATOM   1761  C  CA    . LEU C 3 38  ? 21.424  17.710 -22.216 1.00 53.77  ? 51  LEU C CA    1 
ATOM   1762  C  C     . LEU C 3 38  ? 22.913  17.334 -22.217 1.00 58.11  ? 51  LEU C C     1 
ATOM   1763  O  O     . LEU C 3 38  ? 23.451  17.155 -23.313 1.00 57.85  ? 51  LEU C O     1 
ATOM   1764  C  CB    . LEU C 3 38  ? 21.177  19.180 -21.793 1.00 52.79  ? 51  LEU C CB    1 
ATOM   1765  C  CG    . LEU C 3 38  ? 21.900  20.324 -22.569 1.00 55.42  ? 51  LEU C CG    1 
ATOM   1766  C  CD1   . LEU C 3 38  ? 21.623  20.266 -24.065 1.00 55.05  ? 51  LEU C CD1   1 
ATOM   1767  C  CD2   . LEU C 3 38  ? 21.471  21.670 -22.048 1.00 54.36  ? 51  LEU C CD2   1 
ATOM   1768  N  N     . ALA C 3 39  ? 23.551  17.132 -21.010 1.00 54.02  ? 52  ALA C N     1 
ATOM   1769  C  CA    . ALA C 3 39  ? 24.968  16.731 -20.863 1.00 53.63  ? 52  ALA C CA    1 
ATOM   1770  C  C     . ALA C 3 39  ? 25.288  15.481 -21.687 1.00 57.73  ? 52  ALA C C     1 
ATOM   1771  O  O     . ALA C 3 39  ? 26.354  15.407 -22.301 1.00 56.33  ? 52  ALA C O     1 
ATOM   1772  C  CB    . ALA C 3 39  ? 25.314  16.484 -19.403 1.00 54.38  ? 52  ALA C CB    1 
ATOM   1773  N  N     . ALA C 3 40  ? 24.316  14.531 -21.728 1.00 55.49  ? 53  ALA C N     1 
ATOM   1774  C  CA    . ALA C 3 40  ? 24.324  13.258 -22.458 1.00 55.42  ? 53  ALA C CA    1 
ATOM   1775  C  C     . ALA C 3 40  ? 24.360  13.448 -23.968 1.00 59.18  ? 53  ALA C C     1 
ATOM   1776  O  O     . ALA C 3 40  ? 25.094  12.716 -24.648 1.00 60.44  ? 53  ALA C O     1 
ATOM   1777  C  CB    . ALA C 3 40  ? 23.099  12.452 -22.083 1.00 56.00  ? 53  ALA C CB    1 
ATOM   1778  N  N     . VAL C 3 41  ? 23.523  14.390 -24.487 1.00 52.96  ? 54  VAL C N     1 
ATOM   1779  C  CA    . VAL C 3 41  ? 23.394  14.738 -25.899 1.00 51.70  ? 54  VAL C CA    1 
ATOM   1780  C  C     . VAL C 3 41  ? 24.678  15.442 -26.333 1.00 58.02  ? 54  VAL C C     1 
ATOM   1781  O  O     . VAL C 3 41  ? 25.224  15.129 -27.394 1.00 57.69  ? 54  VAL C O     1 
ATOM   1782  C  CB    . VAL C 3 41  ? 22.128  15.592 -26.170 1.00 54.43  ? 54  VAL C CB    1 
ATOM   1783  C  CG1   . VAL C 3 41  ? 22.172  16.231 -27.550 1.00 54.38  ? 54  VAL C CG1   1 
ATOM   1784  C  CG2   . VAL C 3 41  ? 20.853  14.764 -26.018 1.00 54.09  ? 54  VAL C CG2   1 
ATOM   1785  N  N     . LEU C 3 42  ? 25.168  16.382 -25.493 1.00 55.72  ? 55  LEU C N     1 
ATOM   1786  C  CA    . LEU C 3 42  ? 26.392  17.138 -25.754 1.00 54.85  ? 55  LEU C CA    1 
ATOM   1787  C  C     . LEU C 3 42  ? 27.574  16.194 -25.800 1.00 60.92  ? 55  LEU C C     1 
ATOM   1788  O  O     . LEU C 3 42  ? 28.352  16.269 -26.744 1.00 62.01  ? 55  LEU C O     1 
ATOM   1789  C  CB    . LEU C 3 42  ? 26.604  18.278 -24.750 1.00 54.05  ? 55  LEU C CB    1 
ATOM   1790  C  CG    . LEU C 3 42  ? 25.548  19.405 -24.742 1.00 56.94  ? 55  LEU C CG    1 
ATOM   1791  C  CD1   . LEU C 3 42  ? 25.810  20.363 -23.621 1.00 56.08  ? 55  LEU C CD1   1 
ATOM   1792  C  CD2   . LEU C 3 42  ? 25.489  20.157 -26.071 1.00 56.44  ? 55  LEU C CD2   1 
ATOM   1793  N  N     . GLU C 3 43  ? 27.642  15.238 -24.858 1.00 58.07  ? 56  GLU C N     1 
ATOM   1794  C  CA    . GLU C 3 43  ? 28.687  14.203 -24.794 1.00 58.24  ? 56  GLU C CA    1 
ATOM   1795  C  C     . GLU C 3 43  ? 28.607  13.236 -25.995 1.00 64.74  ? 56  GLU C C     1 
ATOM   1796  O  O     . GLU C 3 43  ? 29.646  12.802 -26.504 1.00 65.72  ? 56  GLU C O     1 
ATOM   1797  C  CB    . GLU C 3 43  ? 28.565  13.403 -23.490 1.00 59.08  ? 56  GLU C CB    1 
ATOM   1798  C  CG    . GLU C 3 43  ? 29.676  12.382 -23.297 1.00 67.14  ? 56  GLU C CG    1 
ATOM   1799  C  CD    . GLU C 3 43  ? 29.607  11.584 -22.019 1.00 84.23  ? 56  GLU C CD    1 
ATOM   1800  O  OE1   . GLU C 3 43  ? 29.234  12.175 -20.980 1.00 73.87  ? 56  GLU C OE1   1 
ATOM   1801  O  OE2   . GLU C 3 43  ? 29.928  10.373 -22.054 1.00 80.65  ? 56  GLU C OE2   1 
ATOM   1802  N  N     . TYR C 3 44  ? 27.380  12.865 -26.412 1.00 60.62  ? 57  TYR C N     1 
ATOM   1803  C  CA    . TYR C 3 44  ? 27.194  11.976 -27.552 1.00 59.51  ? 57  TYR C CA    1 
ATOM   1804  C  C     . TYR C 3 44  ? 27.753  12.611 -28.823 1.00 62.71  ? 57  TYR C C     1 
ATOM   1805  O  O     . TYR C 3 44  ? 28.478  11.952 -29.571 1.00 63.41  ? 57  TYR C O     1 
ATOM   1806  C  CB    . TYR C 3 44  ? 25.718  11.613 -27.748 1.00 60.38  ? 57  TYR C CB    1 
ATOM   1807  C  CG    . TYR C 3 44  ? 25.425  11.095 -29.137 1.00 62.22  ? 57  TYR C CG    1 
ATOM   1808  C  CD1   . TYR C 3 44  ? 25.840  9.832  -29.527 1.00 64.17  ? 57  TYR C CD1   1 
ATOM   1809  C  CD2   . TYR C 3 44  ? 24.761  11.882 -30.073 1.00 63.57  ? 57  TYR C CD2   1 
ATOM   1810  C  CE1   . TYR C 3 44  ? 25.594  9.357  -30.811 1.00 65.79  ? 57  TYR C CE1   1 
ATOM   1811  C  CE2   . TYR C 3 44  ? 24.521  11.423 -31.365 1.00 65.01  ? 57  TYR C CE2   1 
ATOM   1812  C  CZ    . TYR C 3 44  ? 24.946  10.160 -31.733 1.00 71.95  ? 57  TYR C CZ    1 
ATOM   1813  O  OH    . TYR C 3 44  ? 24.707  9.698  -33.006 1.00 73.66  ? 57  TYR C OH    1 
ATOM   1814  N  N     . LEU C 3 45  ? 27.371  13.870 -29.085 1.00 57.62  ? 58  LEU C N     1 
ATOM   1815  C  CA    . LEU C 3 45  ? 27.788  14.606 -30.269 1.00 56.83  ? 58  LEU C CA    1 
ATOM   1816  C  C     . LEU C 3 45  ? 29.282  14.860 -30.280 1.00 64.48  ? 58  LEU C C     1 
ATOM   1817  O  O     . LEU C 3 45  ? 29.879  14.831 -31.358 1.00 65.27  ? 58  LEU C O     1 
ATOM   1818  C  CB    . LEU C 3 45  ? 27.001  15.905 -30.418 1.00 55.82  ? 58  LEU C CB    1 
ATOM   1819  C  CG    . LEU C 3 45  ? 25.520  15.769 -30.730 1.00 59.24  ? 58  LEU C CG    1 
ATOM   1820  C  CD1   . LEU C 3 45  ? 24.856  17.120 -30.737 1.00 58.93  ? 58  LEU C CD1   1 
ATOM   1821  C  CD2   . LEU C 3 45  ? 25.286  15.054 -32.058 1.00 60.76  ? 58  LEU C CD2   1 
ATOM   1822  N  N     . THR C 3 46  ? 29.903  15.064 -29.093 1.00 61.77  ? 59  THR C N     1 
ATOM   1823  C  CA    . THR C 3 46  ? 31.344  15.270 -28.941 1.00 61.37  ? 59  THR C CA    1 
ATOM   1824  C  C     . THR C 3 46  ? 32.012  13.975 -29.385 1.00 66.24  ? 59  THR C C     1 
ATOM   1825  O  O     . THR C 3 46  ? 32.941  14.006 -30.184 1.00 65.58  ? 59  THR C O     1 
ATOM   1826  C  CB    . THR C 3 46  ? 31.663  15.592 -27.478 1.00 67.47  ? 59  THR C CB    1 
ATOM   1827  O  OG1   . THR C 3 46  ? 30.951  16.751 -27.127 1.00 67.69  ? 59  THR C OG1   1 
ATOM   1828  C  CG2   . THR C 3 46  ? 33.112  15.891 -27.243 1.00 68.79  ? 59  THR C CG2   1 
ATOM   1829  N  N     . ALA C 3 47  ? 31.471  12.834 -28.926 1.00 64.03  ? 60  ALA C N     1 
ATOM   1830  C  CA    . ALA C 3 47  ? 31.990  11.500 -29.223 1.00 64.09  ? 60  ALA C CA    1 
ATOM   1831  C  C     . ALA C 3 47  ? 31.909  11.195 -30.706 1.00 68.98  ? 60  ALA C C     1 
ATOM   1832  O  O     . ALA C 3 47  ? 32.864  10.646 -31.268 1.00 69.99  ? 60  ALA C O     1 
ATOM   1833  C  CB    . ALA C 3 47  ? 31.235  10.455 -28.421 1.00 64.65  ? 60  ALA C CB    1 
ATOM   1834  N  N     . GLU C 3 48  ? 30.781  11.583 -31.341 1.00 64.06  ? 61  GLU C N     1 
ATOM   1835  C  CA    . GLU C 3 48  ? 30.541  11.387 -32.760 1.00 63.59  ? 61  GLU C CA    1 
ATOM   1836  C  C     . GLU C 3 48  ? 31.557  12.149 -33.614 1.00 67.94  ? 61  GLU C C     1 
ATOM   1837  O  O     . GLU C 3 48  ? 32.149  11.567 -34.530 1.00 67.87  ? 61  GLU C O     1 
ATOM   1838  C  CB    . GLU C 3 48  ? 29.102  11.755 -33.116 1.00 64.73  ? 61  GLU C CB    1 
ATOM   1839  C  CG    . GLU C 3 48  ? 28.552  10.940 -34.276 1.00 78.10  ? 61  GLU C CG    1 
ATOM   1840  C  CD    . GLU C 3 48  ? 28.490  9.448  -34.028 1.00 112.78 ? 61  GLU C CD    1 
ATOM   1841  O  OE1   . GLU C 3 48  ? 27.504  9.006  -33.401 1.00 114.11 ? 61  GLU C OE1   1 
ATOM   1842  O  OE2   . GLU C 3 48  ? 29.426  8.724  -34.443 1.00 116.74 ? 61  GLU C OE2   1 
ATOM   1843  N  N     . ILE C 3 49  ? 31.810  13.418 -33.276 1.00 64.93  ? 62  ILE C N     1 
ATOM   1844  C  CA    . ILE C 3 49  ? 32.780  14.239 -33.997 1.00 64.83  ? 62  ILE C CA    1 
ATOM   1845  C  C     . ILE C 3 49  ? 34.204  13.675 -33.815 1.00 73.17  ? 62  ILE C C     1 
ATOM   1846  O  O     . ILE C 3 49  ? 34.854  13.346 -34.812 1.00 73.64  ? 62  ILE C O     1 
ATOM   1847  C  CB    . ILE C 3 49  ? 32.628  15.725 -33.627 1.00 66.60  ? 62  ILE C CB    1 
ATOM   1848  C  CG1   . ILE C 3 49  ? 31.326  16.239 -34.229 1.00 67.33  ? 62  ILE C CG1   1 
ATOM   1849  C  CG2   . ILE C 3 49  ? 33.838  16.566 -34.060 1.00 65.61  ? 62  ILE C CG2   1 
ATOM   1850  C  CD1   . ILE C 3 49  ? 31.077  17.686 -34.059 1.00 81.56  ? 62  ILE C CD1   1 
ATOM   1851  N  N     . LEU C 3 50  ? 34.651  13.506 -32.548 1.00 71.13  ? 63  LEU C N     1 
ATOM   1852  C  CA    . LEU C 3 50  ? 35.976  12.990 -32.188 1.00 71.58  ? 63  LEU C CA    1 
ATOM   1853  C  C     . LEU C 3 50  ? 36.290  11.646 -32.856 1.00 79.44  ? 63  LEU C C     1 
ATOM   1854  O  O     . LEU C 3 50  ? 37.451  11.392 -33.211 1.00 79.30  ? 63  LEU C O     1 
ATOM   1855  C  CB    . LEU C 3 50  ? 36.150  12.921 -30.653 1.00 71.02  ? 63  LEU C CB    1 
ATOM   1856  C  CG    . LEU C 3 50  ? 36.225  14.270 -29.920 1.00 73.62  ? 63  LEU C CG    1 
ATOM   1857  C  CD1   . LEU C 3 50  ? 36.088  14.099 -28.434 1.00 73.35  ? 63  LEU C CD1   1 
ATOM   1858  C  CD2   . LEU C 3 50  ? 37.500  14.984 -30.223 1.00 73.49  ? 63  LEU C CD2   1 
ATOM   1859  N  N     . GLU C 3 51  ? 35.242  10.821 -33.075 1.00 78.23  ? 64  GLU C N     1 
ATOM   1860  C  CA    . GLU C 3 51  ? 35.358  9.525  -33.720 1.00 79.51  ? 64  GLU C CA    1 
ATOM   1861  C  C     . GLU C 3 51  ? 35.811  9.672  -35.166 1.00 84.09  ? 64  GLU C C     1 
ATOM   1862  O  O     . GLU C 3 51  ? 36.858  9.128  -35.530 1.00 84.13  ? 64  GLU C O     1 
ATOM   1863  C  CB    . GLU C 3 51  ? 34.039  8.737  -33.625 1.00 81.33  ? 64  GLU C CB    1 
ATOM   1864  C  CG    . GLU C 3 51  ? 34.182  7.268  -34.007 1.00 96.06  ? 64  GLU C CG    1 
ATOM   1865  C  CD    . GLU C 3 51  ? 33.338  6.311  -33.192 1.00 122.61 ? 64  GLU C CD    1 
ATOM   1866  O  OE1   . GLU C 3 51  ? 33.909  5.322  -32.677 1.00 115.09 ? 64  GLU C OE1   1 
ATOM   1867  O  OE2   . GLU C 3 51  ? 32.113  6.549  -33.057 1.00 121.70 ? 64  GLU C OE2   1 
ATOM   1868  N  N     . LEU C 3 52  ? 35.032  10.413 -35.975 1.00 80.07  ? 65  LEU C N     1 
ATOM   1869  C  CA    . LEU C 3 52  ? 35.305  10.612 -37.397 1.00 80.01  ? 65  LEU C CA    1 
ATOM   1870  C  C     . LEU C 3 52  ? 36.577  11.418 -37.644 1.00 85.66  ? 65  LEU C C     1 
ATOM   1871  O  O     . LEU C 3 52  ? 37.304  11.121 -38.598 1.00 83.93  ? 65  LEU C O     1 
ATOM   1872  C  CB    . LEU C 3 52  ? 34.089  11.244 -38.092 1.00 79.95  ? 65  LEU C CB    1 
ATOM   1873  C  CG    . LEU C 3 52  ? 32.795  10.453 -37.987 1.00 84.27  ? 65  LEU C CG    1 
ATOM   1874  C  CD1   . LEU C 3 52  ? 31.640  11.348 -37.973 1.00 84.26  ? 65  LEU C CD1   1 
ATOM   1875  C  CD2   . LEU C 3 52  ? 32.659  9.544  -39.137 1.00 87.47  ? 65  LEU C CD2   1 
ATOM   1876  N  N     . ALA C 3 53  ? 36.849  12.421 -36.774 1.00 85.36  ? 66  ALA C N     1 
ATOM   1877  C  CA    . ALA C 3 53  ? 38.033  13.281 -36.849 1.00 86.98  ? 66  ALA C CA    1 
ATOM   1878  C  C     . ALA C 3 53  ? 39.288  12.494 -36.510 1.00 96.66  ? 66  ALA C C     1 
ATOM   1879  O  O     . ALA C 3 53  ? 40.265  12.586 -37.251 1.00 97.95  ? 66  ALA C O     1 
ATOM   1880  C  CB    . ALA C 3 53  ? 37.889  14.479 -35.928 1.00 87.58  ? 66  ALA C CB    1 
ATOM   1881  N  N     . GLY C 3 54  ? 39.236  11.696 -35.438 1.00 95.49  ? 67  GLY C N     1 
ATOM   1882  C  CA    . GLY C 3 54  ? 40.346  10.843 -35.034 1.00 96.66  ? 67  GLY C CA    1 
ATOM   1883  C  C     . GLY C 3 54  ? 40.696  9.867  -36.138 1.00 104.89 ? 67  GLY C C     1 
ATOM   1884  O  O     . GLY C 3 54  ? 41.873  9.572  -36.361 1.00 105.58 ? 67  GLY C O     1 
ATOM   1885  N  N     . ASN C 3 55  ? 39.665  9.387  -36.858 1.00 103.84 ? 68  ASN C N     1 
ATOM   1886  C  CA    . ASN C 3 55  ? 39.820  8.475  -37.986 1.00 104.69 ? 68  ASN C CA    1 
ATOM   1887  C  C     . ASN C 3 55  ? 40.491  9.187  -39.148 1.00 111.28 ? 68  ASN C C     1 
ATOM   1888  O  O     . ASN C 3 55  ? 41.367  8.596  -39.771 1.00 111.91 ? 68  ASN C O     1 
ATOM   1889  C  CB    . ASN C 3 55  ? 38.477  7.871  -38.401 1.00 104.90 ? 68  ASN C CB    1 
ATOM   1890  C  CG    . ASN C 3 55  ? 37.975  6.808  -37.451 1.00 126.04 ? 68  ASN C CG    1 
ATOM   1891  O  OD1   . ASN C 3 55  ? 38.745  5.958  -36.943 1.00 129.45 ? 68  ASN C OD1   1 
ATOM   1892  N  ND2   . ASN C 3 55  ? 36.665  6.826  -37.204 1.00 106.23 ? 68  ASN C ND2   1 
ATOM   1893  N  N     . ALA C 3 56  ? 40.127  10.468 -39.396 1.00 108.38 ? 69  ALA C N     1 
ATOM   1894  C  CA    . ALA C 3 56  ? 40.713  11.306 -40.444 1.00 108.38 ? 69  ALA C CA    1 
ATOM   1895  C  C     . ALA C 3 56  ? 42.155  11.687 -40.098 1.00 113.77 ? 69  ALA C C     1 
ATOM   1896  O  O     . ALA C 3 56  ? 42.964  11.854 -41.010 1.00 113.36 ? 69  ALA C O     1 
ATOM   1897  C  CB    . ALA C 3 56  ? 39.875  12.554 -40.643 1.00 109.00 ? 69  ALA C CB    1 
ATOM   1898  N  N     . ALA C 3 57  ? 42.473  11.812 -38.783 1.00 111.82 ? 70  ALA C N     1 
ATOM   1899  C  CA    . ALA C 3 57  ? 43.807  12.126 -38.252 1.00 112.74 ? 70  ALA C CA    1 
ATOM   1900  C  C     . ALA C 3 57  ? 44.708  10.909 -38.445 1.00 122.00 ? 70  ALA C C     1 
ATOM   1901  O  O     . ALA C 3 57  ? 45.873  11.057 -38.814 1.00 121.93 ? 70  ALA C O     1 
ATOM   1902  C  CB    . ALA C 3 57  ? 43.714  12.480 -36.774 1.00 113.14 ? 70  ALA C CB    1 
ATOM   1903  N  N     . ARG C 3 58  ? 44.141  9.700  -38.213 1.00 121.99 ? 71  ARG C N     1 
ATOM   1904  C  CA    . ARG C 3 58  ? 44.763  8.395  -38.401 1.00 123.24 ? 71  ARG C CA    1 
ATOM   1905  C  C     . ARG C 3 58  ? 45.162  8.292  -39.891 1.00 130.72 ? 71  ARG C C     1 
ATOM   1906  O  O     . ARG C 3 58  ? 46.314  7.974  -40.187 1.00 130.97 ? 71  ARG C O     1 
ATOM   1907  C  CB    . ARG C 3 58  ? 43.756  7.274  -38.023 1.00 124.72 ? 71  ARG C CB    1 
ATOM   1908  C  CG    . ARG C 3 58  ? 44.178  6.312  -36.891 1.00 136.13 ? 71  ARG C CG    1 
ATOM   1909  C  CD    . ARG C 3 58  ? 43.639  6.717  -35.514 1.00 144.73 ? 71  ARG C CD    1 
ATOM   1910  N  NE    . ARG C 3 58  ? 42.675  5.763  -34.943 1.00 145.32 ? 71  ARG C NE    1 
ATOM   1911  C  CZ    . ARG C 3 58  ? 42.907  4.965  -33.897 1.00 153.79 ? 71  ARG C CZ    1 
ATOM   1912  N  NH1   . ARG C 3 58  ? 41.954  4.160  -33.445 1.00 138.02 ? 71  ARG C NH1   1 
ATOM   1913  N  NH2   . ARG C 3 58  ? 44.094  4.970  -33.295 1.00 136.79 ? 71  ARG C NH2   1 
ATOM   1914  N  N     . ASP C 3 59  ? 44.229  8.639  -40.814 1.00 129.61 ? 72  ASP C N     1 
ATOM   1915  C  CA    . ASP C 3 59  ? 44.407  8.629  -42.276 1.00 130.78 ? 72  ASP C CA    1 
ATOM   1916  C  C     . ASP C 3 59  ? 45.556  9.511  -42.778 1.00 136.21 ? 72  ASP C C     1 
ATOM   1917  O  O     . ASP C 3 59  ? 46.195  9.156  -43.767 1.00 135.93 ? 72  ASP C O     1 
ATOM   1918  C  CB    . ASP C 3 59  ? 43.110  9.062  -42.990 1.00 133.33 ? 72  ASP C CB    1 
ATOM   1919  C  CG    . ASP C 3 59  ? 41.884  8.195  -42.751 1.00 148.52 ? 72  ASP C CG    1 
ATOM   1920  O  OD1   . ASP C 3 59  ? 42.050  6.958  -42.546 1.00 149.42 ? 72  ASP C OD1   1 
ATOM   1921  O  OD2   . ASP C 3 59  ? 40.752  8.747  -42.779 1.00 154.75 ? 72  ASP C OD2   1 
ATOM   1922  N  N     . ASN C 3 60  ? 45.790  10.668 -42.119 1.00 133.92 ? 73  ASN C N     1 
ATOM   1923  C  CA    . ASN C 3 60  ? 46.830  11.656 -42.454 1.00 133.95 ? 73  ASN C CA    1 
ATOM   1924  C  C     . ASN C 3 60  ? 48.224  11.309 -41.892 1.00 137.30 ? 73  ASN C C     1 
ATOM   1925  O  O     . ASN C 3 60  ? 49.126  12.152 -41.941 1.00 136.51 ? 73  ASN C O     1 
ATOM   1926  C  CB    . ASN C 3 60  ? 46.405  13.041 -41.950 1.00 136.31 ? 73  ASN C CB    1 
ATOM   1927  C  CG    . ASN C 3 60  ? 45.531  13.812 -42.901 1.00 166.50 ? 73  ASN C CG    1 
ATOM   1928  O  OD1   . ASN C 3 60  ? 45.995  14.730 -43.587 1.00 163.66 ? 73  ASN C OD1   1 
ATOM   1929  N  ND2   . ASN C 3 60  ? 44.242  13.474 -42.950 1.00 158.10 ? 73  ASN C ND2   1 
ATOM   1930  N  N     . LYS C 3 61  ? 48.394  10.080 -41.352 1.00 134.15 ? 74  LYS C N     1 
ATOM   1931  C  CA    . LYS C 3 61  ? 49.628  9.559  -40.723 1.00 134.48 ? 74  LYS C CA    1 
ATOM   1932  C  C     . LYS C 3 61  ? 49.937  10.275 -39.366 1.00 137.12 ? 74  LYS C C     1 
ATOM   1933  O  O     . LYS C 3 61  ? 51.007  10.054 -38.766 1.00 136.96 ? 74  LYS C O     1 
ATOM   1934  C  CB    . LYS C 3 61  ? 50.855  9.563  -41.690 1.00 137.40 ? 74  LYS C CB    1 
ATOM   1935  C  CG    . LYS C 3 61  ? 50.666  8.823  -43.024 1.00 149.38 ? 74  LYS C CG    1 
ATOM   1936  C  CD    . LYS C 3 61  ? 51.807  9.148  -44.003 1.00 159.64 ? 74  LYS C CD    1 
ATOM   1937  C  CE    . LYS C 3 61  ? 52.005  8.096  -45.077 1.00 167.69 ? 74  LYS C CE    1 
ATOM   1938  N  NZ    . LYS C 3 61  ? 53.286  8.269  -45.820 1.00 167.84 ? 74  LYS C NZ    1 
ATOM   1939  N  N     . LYS C 3 62  ? 48.949  11.078 -38.873 1.00 131.15 ? 75  LYS C N     1 
ATOM   1940  C  CA    . LYS C 3 62  ? 48.987  11.886 -37.644 1.00 129.59 ? 75  LYS C CA    1 
ATOM   1941  C  C     . LYS C 3 62  ? 48.365  11.212 -36.405 1.00 129.78 ? 75  LYS C C     1 
ATOM   1942  O  O     . LYS C 3 62  ? 47.457  10.377 -36.520 1.00 128.29 ? 75  LYS C O     1 
ATOM   1943  C  CB    . LYS C 3 62  ? 48.304  13.254 -37.876 1.00 131.75 ? 75  LYS C CB    1 
ATOM   1944  C  CG    . LYS C 3 62  ? 49.159  14.272 -38.612 1.00 140.16 ? 75  LYS C CG    1 
ATOM   1945  C  CD    . LYS C 3 62  ? 48.524  15.647 -38.536 1.00 150.65 ? 75  LYS C CD    1 
ATOM   1946  C  CE    . LYS C 3 62  ? 49.377  16.693 -39.204 1.00 162.33 ? 75  LYS C CE    1 
ATOM   1947  N  NZ    . LYS C 3 62  ? 48.953  18.069 -38.838 1.00 168.96 ? 75  LYS C NZ    1 
ATOM   1948  N  N     . THR C 3 63  ? 48.844  11.632 -35.213 1.00 124.37 ? 76  THR C N     1 
ATOM   1949  C  CA    . THR C 3 63  ? 48.363  11.177 -33.908 1.00 123.23 ? 76  THR C CA    1 
ATOM   1950  C  C     . THR C 3 63  ? 47.415  12.235 -33.306 1.00 124.83 ? 76  THR C C     1 
ATOM   1951  O  O     . THR C 3 63  ? 46.422  11.848 -32.699 1.00 125.67 ? 76  THR C O     1 
ATOM   1952  C  CB    . THR C 3 63  ? 49.524  10.883 -32.933 1.00 132.84 ? 76  THR C CB    1 
ATOM   1953  O  OG1   . THR C 3 63  ? 50.062  12.119 -32.464 1.00 135.01 ? 76  THR C OG1   1 
ATOM   1954  C  CG2   . THR C 3 63  ? 50.622  9.984  -33.532 1.00 130.64 ? 76  THR C CG2   1 
ATOM   1955  N  N     . ARG C 3 64  ? 47.734  13.558 -33.447 1.00 117.45 ? 77  ARG C N     1 
ATOM   1956  C  CA    . ARG C 3 64  ? 46.934  14.672 -32.905 1.00 115.00 ? 77  ARG C CA    1 
ATOM   1957  C  C     . ARG C 3 64  ? 45.942  15.205 -33.899 1.00 112.88 ? 77  ARG C C     1 
ATOM   1958  O  O     . ARG C 3 64  ? 46.290  15.462 -35.055 1.00 112.32 ? 77  ARG C O     1 
ATOM   1959  C  CB    . ARG C 3 64  ? 47.812  15.841 -32.420 1.00 117.14 ? 77  ARG C CB    1 
ATOM   1960  C  CG    . ARG C 3 64  ? 48.133  15.829 -30.918 1.00 137.83 ? 77  ARG C CG    1 
ATOM   1961  C  CD    . ARG C 3 64  ? 49.599  15.519 -30.599 1.00 156.31 ? 77  ARG C CD    1 
ATOM   1962  N  NE    . ARG C 3 64  ? 50.514  16.492 -31.204 1.00 173.72 ? 77  ARG C NE    1 
ATOM   1963  C  CZ    . ARG C 3 64  ? 51.717  16.809 -30.730 1.00 194.84 ? 77  ARG C CZ    1 
ATOM   1964  N  NH1   . ARG C 3 64  ? 52.164  16.255 -29.608 1.00 189.33 ? 77  ARG C NH1   1 
ATOM   1965  N  NH2   . ARG C 3 64  ? 52.472  17.698 -31.360 1.00 180.46 ? 77  ARG C NH2   1 
ATOM   1966  N  N     . ILE C 3 65  ? 44.704  15.411 -33.423 1.00 104.76 ? 78  ILE C N     1 
ATOM   1967  C  CA    . ILE C 3 65  ? 43.598  15.971 -34.188 1.00 101.80 ? 78  ILE C CA    1 
ATOM   1968  C  C     . ILE C 3 65  ? 43.857  17.458 -34.294 1.00 102.46 ? 78  ILE C C     1 
ATOM   1969  O  O     . ILE C 3 65  ? 44.098  18.120 -33.283 1.00 102.84 ? 78  ILE C O     1 
ATOM   1970  C  CB    . ILE C 3 65  ? 42.211  15.688 -33.534 1.00 103.85 ? 78  ILE C CB    1 
ATOM   1971  C  CG1   . ILE C 3 65  ? 41.824  14.198 -33.668 1.00 103.39 ? 78  ILE C CG1   1 
ATOM   1972  C  CG2   . ILE C 3 65  ? 41.111  16.618 -34.116 1.00 104.00 ? 78  ILE C CG2   1 
ATOM   1973  C  CD1   . ILE C 3 65  ? 40.970  13.677 -32.557 1.00 106.75 ? 78  ILE C CD1   1 
ATOM   1974  N  N     . ILE C 3 66  ? 43.838  17.967 -35.526 1.00 94.60  ? 79  ILE C N     1 
ATOM   1975  C  CA    . ILE C 3 66  ? 43.983  19.380 -35.841 1.00 91.31  ? 79  ILE C CA    1 
ATOM   1976  C  C     . ILE C 3 66  ? 42.626  19.817 -36.436 1.00 89.24  ? 79  ILE C C     1 
ATOM   1977  O  O     . ILE C 3 66  ? 41.827  18.940 -36.798 1.00 87.72  ? 79  ILE C O     1 
ATOM   1978  C  CB    . ILE C 3 66  ? 45.198  19.668 -36.780 1.00 93.79  ? 79  ILE C CB    1 
ATOM   1979  C  CG1   . ILE C 3 66  ? 44.955  19.168 -38.225 1.00 94.05  ? 79  ILE C CG1   1 
ATOM   1980  C  CG2   . ILE C 3 66  ? 46.493  19.133 -36.185 1.00 94.32  ? 79  ILE C CG2   1 
ATOM   1981  C  CD1   . ILE C 3 66  ? 46.005  19.571 -39.282 1.00 101.33 ? 79  ILE C CD1   1 
ATOM   1982  N  N     . PRO C 3 67  ? 42.338  21.136 -36.552 1.00 81.49  ? 80  PRO C N     1 
ATOM   1983  C  CA    . PRO C 3 67  ? 41.054  21.559 -37.136 1.00 80.17  ? 80  PRO C CA    1 
ATOM   1984  C  C     . PRO C 3 67  ? 40.722  20.983 -38.525 1.00 82.50  ? 80  PRO C C     1 
ATOM   1985  O  O     . PRO C 3 67  ? 39.541  20.794 -38.827 1.00 82.00  ? 80  PRO C O     1 
ATOM   1986  C  CB    . PRO C 3 67  ? 41.174  23.080 -37.156 1.00 81.94  ? 80  PRO C CB    1 
ATOM   1987  C  CG    . PRO C 3 67  ? 42.124  23.380 -36.062 1.00 86.63  ? 80  PRO C CG    1 
ATOM   1988  C  CD    . PRO C 3 67  ? 43.137  22.307 -36.145 1.00 82.14  ? 80  PRO C CD    1 
ATOM   1989  N  N     . ARG C 3 68  ? 41.751  20.669 -39.351 1.00 78.57  ? 81  ARG C N     1 
ATOM   1990  C  CA    . ARG C 3 68  ? 41.558  20.086 -40.679 1.00 78.26  ? 81  ARG C CA    1 
ATOM   1991  C  C     . ARG C 3 68  ? 40.773  18.813 -40.553 1.00 84.41  ? 81  ARG C C     1 
ATOM   1992  O  O     . ARG C 3 68  ? 39.812  18.605 -41.291 1.00 84.78  ? 81  ARG C O     1 
ATOM   1993  C  CB    . ARG C 3 68  ? 42.889  19.750 -41.344 1.00 76.93  ? 81  ARG C CB    1 
ATOM   1994  C  CG    . ARG C 3 68  ? 42.903  20.043 -42.840 1.00 84.85  ? 81  ARG C CG    1 
ATOM   1995  C  CD    . ARG C 3 68  ? 41.918  19.233 -43.650 1.00 86.33  ? 81  ARG C CD    1 
ATOM   1996  N  NE    . ARG C 3 68  ? 42.201  19.216 -45.083 1.00 89.94  ? 81  ARG C NE    1 
ATOM   1997  C  CZ    . ARG C 3 68  ? 41.583  19.976 -45.982 1.00 90.11  ? 81  ARG C CZ    1 
ATOM   1998  N  NH1   . ARG C 3 68  ? 40.676  20.856 -45.601 1.00 63.65  ? 81  ARG C NH1   1 
ATOM   1999  N  NH2   . ARG C 3 68  ? 41.896  19.888 -47.266 1.00 80.44  ? 81  ARG C NH2   1 
ATOM   2000  N  N     . HIS C 3 69  ? 41.168  17.972 -39.593 1.00 81.75  ? 82  HIS C N     1 
ATOM   2001  C  CA    . HIS C 3 69  ? 40.536  16.690 -39.309 1.00 81.14  ? 82  HIS C CA    1 
ATOM   2002  C  C     . HIS C 3 69  ? 39.063  16.841 -38.929 1.00 79.40  ? 82  HIS C C     1 
ATOM   2003  O  O     . HIS C 3 69  ? 38.233  16.078 -39.424 1.00 78.74  ? 82  HIS C O     1 
ATOM   2004  C  CB    . HIS C 3 69  ? 41.333  15.965 -38.236 1.00 82.75  ? 82  HIS C CB    1 
ATOM   2005  C  CG    . HIS C 3 69  ? 42.782  15.825 -38.585 1.00 87.18  ? 82  HIS C CG    1 
ATOM   2006  N  ND1   . HIS C 3 69  ? 43.758  15.827 -37.606 1.00 89.69  ? 82  HIS C ND1   1 
ATOM   2007  C  CD2   . HIS C 3 69  ? 43.376  15.657 -39.791 1.00 89.70  ? 82  HIS C CD2   1 
ATOM   2008  C  CE1   . HIS C 3 69  ? 44.909  15.642 -38.237 1.00 89.32  ? 82  HIS C CE1   1 
ATOM   2009  N  NE2   . HIS C 3 69  ? 44.731  15.553 -39.556 1.00 89.66  ? 82  HIS C NE2   1 
ATOM   2010  N  N     . LEU C 3 70  ? 38.741  17.849 -38.094 1.00 71.43  ? 83  LEU C N     1 
ATOM   2011  C  CA    . LEU C 3 70  ? 37.381  18.158 -37.675 1.00 69.06  ? 83  LEU C CA    1 
ATOM   2012  C  C     . LEU C 3 70  ? 36.576  18.576 -38.891 1.00 73.56  ? 83  LEU C C     1 
ATOM   2013  O  O     . LEU C 3 70  ? 35.468  18.087 -39.082 1.00 73.92  ? 83  LEU C O     1 
ATOM   2014  C  CB    . LEU C 3 70  ? 37.381  19.257 -36.605 1.00 67.84  ? 83  LEU C CB    1 
ATOM   2015  C  CG    . LEU C 3 70  ? 38.111  18.914 -35.325 1.00 70.92  ? 83  LEU C CG    1 
ATOM   2016  C  CD1   . LEU C 3 70  ? 38.405  20.130 -34.544 1.00 69.90  ? 83  LEU C CD1   1 
ATOM   2017  C  CD2   . LEU C 3 70  ? 37.346  17.900 -34.492 1.00 73.27  ? 83  LEU C CD2   1 
ATOM   2018  N  N     . GLN C 3 71  ? 37.174  19.387 -39.764 1.00 69.38  ? 84  GLN C N     1 
ATOM   2019  C  CA    . GLN C 3 71  ? 36.557  19.819 -41.005 1.00 69.16  ? 84  GLN C CA    1 
ATOM   2020  C  C     . GLN C 3 71  ? 36.275  18.636 -41.929 1.00 73.98  ? 84  GLN C C     1 
ATOM   2021  O  O     . GLN C 3 71  ? 35.140  18.500 -42.383 1.00 74.52  ? 84  GLN C O     1 
ATOM   2022  C  CB    . GLN C 3 71  ? 37.441  20.863 -41.682 1.00 70.41  ? 84  GLN C CB    1 
ATOM   2023  C  CG    . GLN C 3 71  ? 36.923  21.417 -43.004 1.00 77.57  ? 84  GLN C CG    1 
ATOM   2024  C  CD    . GLN C 3 71  ? 35.668  22.255 -42.938 1.00 86.00  ? 84  GLN C CD    1 
ATOM   2025  O  OE1   . GLN C 3 71  ? 35.428  23.074 -42.043 1.00 85.46  ? 84  GLN C OE1   1 
ATOM   2026  N  NE2   . GLN C 3 71  ? 34.868  22.102 -43.936 1.00 70.94  ? 84  GLN C NE2   1 
ATOM   2027  N  N     . LEU C 3 72  ? 37.264  17.762 -42.166 1.00 70.22  ? 85  LEU C N     1 
ATOM   2028  C  CA    . LEU C 3 72  ? 37.057  16.598 -43.034 1.00 70.37  ? 85  LEU C CA    1 
ATOM   2029  C  C     . LEU C 3 72  ? 35.976  15.695 -42.486 1.00 75.02  ? 85  LEU C C     1 
ATOM   2030  O  O     . LEU C 3 72  ? 35.139  15.232 -43.258 1.00 76.68  ? 85  LEU C O     1 
ATOM   2031  C  CB    . LEU C 3 72  ? 38.338  15.788 -43.264 1.00 70.21  ? 85  LEU C CB    1 
ATOM   2032  C  CG    . LEU C 3 72  ? 39.524  16.551 -43.776 1.00 74.85  ? 85  LEU C CG    1 
ATOM   2033  C  CD1   . LEU C 3 72  ? 40.785  15.796 -43.515 1.00 75.29  ? 85  LEU C CD1   1 
ATOM   2034  C  CD2   . LEU C 3 72  ? 39.354  16.965 -45.219 1.00 76.99  ? 85  LEU C CD2   1 
ATOM   2035  N  N     . ALA C 3 73  ? 35.970  15.470 -41.158 1.00 69.17  ? 86  ALA C N     1 
ATOM   2036  C  CA    . ALA C 3 73  ? 34.975  14.647 -40.484 1.00 68.02  ? 86  ALA C CA    1 
ATOM   2037  C  C     . ALA C 3 73  ? 33.584  15.263 -40.622 1.00 71.35  ? 86  ALA C C     1 
ATOM   2038  O  O     . ALA C 3 73  ? 32.660  14.536 -40.997 1.00 72.46  ? 86  ALA C O     1 
ATOM   2039  C  CB    . ALA C 3 73  ? 35.327  14.504 -39.023 1.00 68.59  ? 86  ALA C CB    1 
ATOM   2040  N  N     . ILE C 3 74  ? 33.441  16.593 -40.353 1.00 64.77  ? 87  ILE C N     1 
ATOM   2041  C  CA    . ILE C 3 74  ? 32.164  17.313 -40.428 1.00 63.47  ? 87  ILE C CA    1 
ATOM   2042  C  C     . ILE C 3 74  ? 31.605  17.289 -41.846 1.00 66.84  ? 87  ILE C C     1 
ATOM   2043  O  O     . ILE C 3 74  ? 30.435  16.962 -42.022 1.00 67.38  ? 87  ILE C O     1 
ATOM   2044  C  CB    . ILE C 3 74  ? 32.225  18.800 -39.894 1.00 65.98  ? 87  ILE C CB    1 
ATOM   2045  C  CG1   . ILE C 3 74  ? 32.812  18.953 -38.461 1.00 66.02  ? 87  ILE C CG1   1 
ATOM   2046  C  CG2   . ILE C 3 74  ? 30.863  19.531 -39.984 1.00 65.49  ? 87  ILE C CG2   1 
ATOM   2047  C  CD1   . ILE C 3 74  ? 32.375  18.043 -37.416 1.00 72.64  ? 87  ILE C CD1   1 
ATOM   2048  N  N     . ARG C 3 75  ? 32.403  17.681 -42.845 1.00 62.09  ? 88  ARG C N     1 
ATOM   2049  C  CA    . ARG C 3 75  ? 31.915  17.796 -44.218 1.00 61.59  ? 88  ARG C CA    1 
ATOM   2050  C  C     . ARG C 3 75  ? 31.818  16.473 -44.947 1.00 66.92  ? 88  ARG C C     1 
ATOM   2051  O  O     . ARG C 3 75  ? 31.184  16.403 -46.001 1.00 67.78  ? 88  ARG C O     1 
ATOM   2052  C  CB    . ARG C 3 75  ? 32.728  18.818 -45.015 1.00 61.27  ? 88  ARG C CB    1 
ATOM   2053  C  CG    . ARG C 3 75  ? 32.944  20.150 -44.302 1.00 66.18  ? 88  ARG C CG    1 
ATOM   2054  C  CD    . ARG C 3 75  ? 31.670  20.922 -43.992 1.00 69.15  ? 88  ARG C CD    1 
ATOM   2055  N  NE    . ARG C 3 75  ? 31.874  21.937 -42.963 1.00 67.70  ? 88  ARG C NE    1 
ATOM   2056  C  CZ    . ARG C 3 75  ? 30.894  22.606 -42.365 1.00 73.75  ? 88  ARG C CZ    1 
ATOM   2057  N  NH1   . ARG C 3 75  ? 29.628  22.357 -42.673 1.00 43.14  ? 88  ARG C NH1   1 
ATOM   2058  N  NH2   . ARG C 3 75  ? 31.173  23.521 -41.443 1.00 67.10  ? 88  ARG C NH2   1 
ATOM   2059  N  N     . ASN C 3 76  ? 32.378  15.415 -44.388 1.00 63.42  ? 89  ASN C N     1 
ATOM   2060  C  CA    . ASN C 3 76  ? 32.199  14.142 -45.045 1.00 64.01  ? 89  ASN C CA    1 
ATOM   2061  C  C     . ASN C 3 76  ? 30.983  13.392 -44.513 1.00 69.62  ? 89  ASN C C     1 
ATOM   2062  O  O     . ASN C 3 76  ? 30.531  12.461 -45.188 1.00 70.72  ? 89  ASN C O     1 
ATOM   2063  C  CB    . ASN C 3 76  ? 33.451  13.298 -45.057 1.00 63.87  ? 89  ASN C CB    1 
ATOM   2064  C  CG    . ASN C 3 76  ? 34.396  13.724 -46.153 1.00 91.80  ? 89  ASN C CG    1 
ATOM   2065  O  OD1   . ASN C 3 76  ? 34.029  13.848 -47.332 1.00 82.08  ? 89  ASN C OD1   1 
ATOM   2066  N  ND2   . ASN C 3 76  ? 35.646  13.942 -45.791 1.00 91.28  ? 89  ASN C ND2   1 
ATOM   2067  N  N     . ASP C 3 77  ? 30.430  13.804 -43.341 1.00 64.51  ? 90  ASP C N     1 
ATOM   2068  C  CA    . ASP C 3 77  ? 29.216  13.206 -42.781 1.00 63.72  ? 90  ASP C CA    1 
ATOM   2069  C  C     . ASP C 3 77  ? 28.076  14.082 -43.218 1.00 65.67  ? 90  ASP C C     1 
ATOM   2070  O  O     . ASP C 3 77  ? 28.145  15.285 -43.005 1.00 65.24  ? 90  ASP C O     1 
ATOM   2071  C  CB    . ASP C 3 77  ? 29.251  13.113 -41.238 1.00 66.19  ? 90  ASP C CB    1 
ATOM   2072  C  CG    . ASP C 3 77  ? 28.087  12.322 -40.639 1.00 85.37  ? 90  ASP C CG    1 
ATOM   2073  O  OD1   . ASP C 3 77  ? 27.635  11.339 -41.276 1.00 86.42  ? 90  ASP C OD1   1 
ATOM   2074  O  OD2   . ASP C 3 77  ? 27.640  12.675 -39.533 1.00 97.00  ? 90  ASP C OD2   1 
ATOM   2075  N  N     . GLU C 3 78  ? 27.036  13.497 -43.834 1.00 60.95  ? 91  GLU C N     1 
ATOM   2076  C  CA    . GLU C 3 78  ? 25.855  14.221 -44.325 1.00 59.78  ? 91  GLU C CA    1 
ATOM   2077  C  C     . GLU C 3 78  ? 25.139  14.982 -43.204 1.00 59.05  ? 91  GLU C C     1 
ATOM   2078  O  O     . GLU C 3 78  ? 24.869  16.168 -43.353 1.00 58.10  ? 91  GLU C O     1 
ATOM   2079  C  CB    . GLU C 3 78  ? 24.892  13.249 -45.033 1.00 61.69  ? 91  GLU C CB    1 
ATOM   2080  C  CG    . GLU C 3 78  ? 23.763  13.898 -45.827 1.00 78.25  ? 91  GLU C CG    1 
ATOM   2081  C  CD    . GLU C 3 78  ? 22.942  12.928 -46.660 1.00 106.44 ? 91  GLU C CD    1 
ATOM   2082  O  OE1   . GLU C 3 78  ? 21.856  12.506 -46.195 1.00 96.86  ? 91  GLU C OE1   1 
ATOM   2083  O  OE2   . GLU C 3 78  ? 23.392  12.585 -47.778 1.00 105.90 ? 91  GLU C OE2   1 
ATOM   2084  N  N     . GLU C 3 79  ? 24.908  14.309 -42.075 1.00 53.72  ? 92  GLU C N     1 
ATOM   2085  C  CA    . GLU C 3 79  ? 24.208  14.810 -40.893 1.00 52.98  ? 92  GLU C CA    1 
ATOM   2086  C  C     . GLU C 3 79  ? 25.000  15.829 -40.085 1.00 54.29  ? 92  GLU C C     1 
ATOM   2087  O  O     . GLU C 3 79  ? 24.399  16.811 -39.673 1.00 55.52  ? 92  GLU C O     1 
ATOM   2088  C  CB    . GLU C 3 79  ? 23.722  13.642 -40.013 1.00 55.16  ? 92  GLU C CB    1 
ATOM   2089  C  CG    . GLU C 3 79  ? 22.671  12.779 -40.702 1.00 63.57  ? 92  GLU C CG    1 
ATOM   2090  C  CD    . GLU C 3 79  ? 21.926  11.781 -39.852 1.00 87.33  ? 92  GLU C CD    1 
ATOM   2091  O  OE1   . GLU C 3 79  ? 22.469  11.373 -38.800 1.00 102.78 ? 92  GLU C OE1   1 
ATOM   2092  O  OE2   . GLU C 3 79  ? 20.811  11.378 -40.258 1.00 77.31  ? 92  GLU C OE2   1 
ATOM   2093  N  N     . LEU C 3 80  ? 26.324  15.647 -39.877 1.00 49.71  ? 93  LEU C N     1 
ATOM   2094  C  CA    . LEU C 3 80  ? 27.139  16.675 -39.189 1.00 49.52  ? 93  LEU C CA    1 
ATOM   2095  C  C     . LEU C 3 80  ? 27.293  17.876 -40.110 1.00 54.92  ? 93  LEU C C     1 
ATOM   2096  O  O     . LEU C 3 80  ? 27.233  19.021 -39.651 1.00 54.65  ? 93  LEU C O     1 
ATOM   2097  C  CB    . LEU C 3 80  ? 28.527  16.180 -38.748 1.00 49.26  ? 93  LEU C CB    1 
ATOM   2098  C  CG    . LEU C 3 80  ? 28.583  15.099 -37.646 1.00 51.92  ? 93  LEU C CG    1 
ATOM   2099  C  CD1   . LEU C 3 80  ? 29.928  14.473 -37.605 1.00 50.69  ? 93  LEU C CD1   1 
ATOM   2100  C  CD2   . LEU C 3 80  ? 28.256  15.673 -36.282 1.00 54.40  ? 93  LEU C CD2   1 
ATOM   2101  N  N     . ASN C 3 81  ? 27.427  17.625 -41.426 1.00 51.99  ? 94  ASN C N     1 
ATOM   2102  C  CA    . ASN C 3 81  ? 27.498  18.735 -42.371 1.00 51.07  ? 94  ASN C CA    1 
ATOM   2103  C  C     . ASN C 3 81  ? 26.232  19.573 -42.303 1.00 54.44  ? 94  ASN C C     1 
ATOM   2104  O  O     . ASN C 3 81  ? 26.326  20.788 -42.377 1.00 56.42  ? 94  ASN C O     1 
ATOM   2105  C  CB    . ASN C 3 81  ? 27.709  18.261 -43.789 1.00 50.79  ? 94  ASN C CB    1 
ATOM   2106  C  CG    . ASN C 3 81  ? 27.997  19.397 -44.711 1.00 71.82  ? 94  ASN C CG    1 
ATOM   2107  O  OD1   . ASN C 3 81  ? 28.740  20.313 -44.377 1.00 74.12  ? 94  ASN C OD1   1 
ATOM   2108  N  ND2   . ASN C 3 81  ? 27.401  19.381 -45.882 1.00 60.43  ? 94  ASN C ND2   1 
ATOM   2109  N  N     . LYS C 3 82  ? 25.055  18.946 -42.152 1.00 48.99  ? 95  LYS C N     1 
ATOM   2110  C  CA    . LYS C 3 82  ? 23.778  19.656 -42.059 1.00 48.24  ? 95  LYS C CA    1 
ATOM   2111  C  C     . LYS C 3 82  ? 23.738  20.410 -40.742 1.00 51.69  ? 95  LYS C C     1 
ATOM   2112  O  O     . LYS C 3 82  ? 23.457  21.597 -40.749 1.00 51.50  ? 95  LYS C O     1 
ATOM   2113  C  CB    . LYS C 3 82  ? 22.607  18.665 -42.159 1.00 49.56  ? 95  LYS C CB    1 
ATOM   2114  C  CG    . LYS C 3 82  ? 21.231  19.274 -42.370 1.00 58.09  ? 95  LYS C CG    1 
ATOM   2115  C  CD    . LYS C 3 82  ? 20.124  18.141 -42.385 1.00 72.81  ? 95  LYS C CD    1 
ATOM   2116  C  CE    . LYS C 3 82  ? 19.960  17.311 -43.673 1.00 89.31  ? 95  LYS C CE    1 
ATOM   2117  N  NZ    . LYS C 3 82  ? 19.757  15.831 -43.449 1.00 90.33  ? 95  LYS C NZ    1 
ATOM   2118  N  N     . LEU C 3 83  ? 24.091  19.745 -39.625 1.00 46.91  ? 96  LEU C N     1 
ATOM   2119  C  CA    . LEU C 3 83  ? 24.072  20.333 -38.292 1.00 45.29  ? 96  LEU C CA    1 
ATOM   2120  C  C     . LEU C 3 83  ? 25.007  21.510 -38.194 1.00 49.74  ? 96  LEU C C     1 
ATOM   2121  O  O     . LEU C 3 83  ? 24.658  22.495 -37.551 1.00 51.91  ? 96  LEU C O     1 
ATOM   2122  C  CB    . LEU C 3 83  ? 24.361  19.272 -37.204 1.00 45.06  ? 96  LEU C CB    1 
ATOM   2123  C  CG    . LEU C 3 83  ? 24.537  19.750 -35.750 1.00 48.57  ? 96  LEU C CG    1 
ATOM   2124  C  CD1   . LEU C 3 83  ? 23.260  20.327 -35.190 1.00 48.38  ? 96  LEU C CD1   1 
ATOM   2125  C  CD2   . LEU C 3 83  ? 25.048  18.640 -34.873 1.00 50.10  ? 96  LEU C CD2   1 
ATOM   2126  N  N     . LEU C 3 84  ? 26.158  21.457 -38.870 1.00 44.60  ? 97  LEU C N     1 
ATOM   2127  C  CA    . LEU C 3 84  ? 27.136  22.556 -38.835 1.00 43.80  ? 97  LEU C CA    1 
ATOM   2128  C  C     . LEU C 3 84  ? 27.298  23.246 -40.202 1.00 50.52  ? 97  LEU C C     1 
ATOM   2129  O  O     . LEU C 3 84  ? 28.373  23.750 -40.531 1.00 51.42  ? 97  LEU C O     1 
ATOM   2130  C  CB    . LEU C 3 84  ? 28.478  22.068 -38.252 1.00 42.78  ? 97  LEU C CB    1 
ATOM   2131  C  CG    . LEU C 3 84  ? 28.368  21.344 -36.913 1.00 45.86  ? 97  LEU C CG    1 
ATOM   2132  C  CD1   . LEU C 3 84  ? 29.605  20.573 -36.603 1.00 45.96  ? 97  LEU C CD1   1 
ATOM   2133  C  CD2   . LEU C 3 84  ? 27.981  22.288 -35.789 1.00 45.46  ? 97  LEU C CD2   1 
ATOM   2134  N  N     . GLY C 3 85  ? 26.193  23.316 -40.939 1.00 47.38  ? 98  GLY C N     1 
ATOM   2135  C  CA    . GLY C 3 85  ? 26.113  23.886 -42.277 1.00 46.57  ? 98  GLY C CA    1 
ATOM   2136  C  C     . GLY C 3 85  ? 26.312  25.373 -42.375 1.00 49.22  ? 98  GLY C C     1 
ATOM   2137  O  O     . GLY C 3 85  ? 26.692  25.859 -43.447 1.00 51.07  ? 98  GLY C O     1 
ATOM   2138  N  N     . ARG C 3 86  ? 26.028  26.110 -41.289 1.00 43.41  ? 99  ARG C N     1 
ATOM   2139  C  CA    . ARG C 3 86  ? 26.170  27.575 -41.298 1.00 43.08  ? 99  ARG C CA    1 
ATOM   2140  C  C     . ARG C 3 86  ? 27.207  28.036 -40.239 1.00 48.67  ? 99  ARG C C     1 
ATOM   2141  O  O     . ARG C 3 86  ? 27.098  29.125 -39.669 1.00 46.71  ? 99  ARG C O     1 
ATOM   2142  C  CB    . ARG C 3 86  ? 24.805  28.299 -41.189 1.00 37.68  ? 99  ARG C CB    1 
ATOM   2143  C  CG    . ARG C 3 86  ? 23.810  27.945 -42.305 1.00 40.48  ? 99  ARG C CG    1 
ATOM   2144  C  CD    . ARG C 3 86  ? 23.251  29.089 -43.153 1.00 56.70  ? 99  ARG C CD    1 
ATOM   2145  N  NE    . ARG C 3 86  ? 24.111  29.430 -44.288 1.00 72.03  ? 99  ARG C NE    1 
ATOM   2146  C  CZ    . ARG C 3 86  ? 24.828  30.547 -44.380 1.00 91.41  ? 99  ARG C CZ    1 
ATOM   2147  N  NH1   . ARG C 3 86  ? 24.770  31.464 -43.418 1.00 75.75  ? 99  ARG C NH1   1 
ATOM   2148  N  NH2   . ARG C 3 86  ? 25.592  30.767 -45.442 1.00 82.75  ? 99  ARG C NH2   1 
ATOM   2149  N  N     . VAL C 3 87  ? 28.252  27.192 -40.059 1.00 47.24  ? 100 VAL C N     1 
ATOM   2150  C  CA    . VAL C 3 87  ? 29.379  27.279 -39.127 1.00 47.19  ? 100 VAL C CA    1 
ATOM   2151  C  C     . VAL C 3 87  ? 30.682  27.197 -39.939 1.00 52.15  ? 100 VAL C C     1 
ATOM   2152  O  O     . VAL C 3 87  ? 30.725  26.488 -40.946 1.00 51.24  ? 100 VAL C O     1 
ATOM   2153  C  CB    . VAL C 3 87  ? 29.297  26.104 -38.124 1.00 51.19  ? 100 VAL C CB    1 
ATOM   2154  C  CG1   . VAL C 3 87  ? 30.583  25.948 -37.358 1.00 51.51  ? 100 VAL C CG1   1 
ATOM   2155  C  CG2   . VAL C 3 87  ? 28.130  26.262 -37.164 1.00 51.06  ? 100 VAL C CG2   1 
ATOM   2156  N  N     . THR C 3 88  ? 31.729  27.909 -39.505 1.00 51.26  ? 101 THR C N     1 
ATOM   2157  C  CA    . THR C 3 88  ? 33.038  27.865 -40.161 1.00 53.03  ? 101 THR C CA    1 
ATOM   2158  C  C     . THR C 3 88  ? 34.104  27.375 -39.161 1.00 58.35  ? 101 THR C C     1 
ATOM   2159  O  O     . THR C 3 88  ? 34.299  27.987 -38.111 1.00 57.35  ? 101 THR C O     1 
ATOM   2160  C  CB    . THR C 3 88  ? 33.433  29.177 -40.945 1.00 65.74  ? 101 THR C CB    1 
ATOM   2161  O  OG1   . THR C 3 88  ? 32.892  30.345 -40.327 1.00 77.77  ? 101 THR C OG1   1 
ATOM   2162  C  CG2   . THR C 3 88  ? 33.028  29.114 -42.425 1.00 59.64  ? 101 THR C CG2   1 
ATOM   2163  N  N     . ILE C 3 89  ? 34.765  26.246 -39.491 1.00 56.70  ? 102 ILE C N     1 
ATOM   2164  C  CA    . ILE C 3 89  ? 35.854  25.718 -38.670 1.00 57.80  ? 102 ILE C CA    1 
ATOM   2165  C  C     . ILE C 3 89  ? 37.129  26.479 -39.052 1.00 63.03  ? 102 ILE C C     1 
ATOM   2166  O  O     . ILE C 3 89  ? 37.602  26.377 -40.190 1.00 61.44  ? 102 ILE C O     1 
ATOM   2167  C  CB    . ILE C 3 89  ? 35.969  24.157 -38.710 1.00 61.37  ? 102 ILE C CB    1 
ATOM   2168  C  CG1   . ILE C 3 89  ? 34.786  23.512 -37.982 1.00 61.74  ? 102 ILE C CG1   1 
ATOM   2169  C  CG2   . ILE C 3 89  ? 37.301  23.630 -38.141 1.00 61.39  ? 102 ILE C CG2   1 
ATOM   2170  C  CD1   . ILE C 3 89  ? 33.851  22.973 -38.889 1.00 70.29  ? 102 ILE C CD1   1 
ATOM   2171  N  N     . ALA C 3 90  ? 37.605  27.335 -38.138 1.00 62.26  ? 103 ALA C N     1 
ATOM   2172  C  CA    . ALA C 3 90  ? 38.796  28.115 -38.403 1.00 64.33  ? 103 ALA C CA    1 
ATOM   2173  C  C     . ALA C 3 90  ? 39.985  27.155 -38.609 1.00 77.91  ? 103 ALA C C     1 
ATOM   2174  O  O     . ALA C 3 90  ? 40.167  26.205 -37.821 1.00 79.70  ? 103 ALA C O     1 
ATOM   2175  C  CB    . ALA C 3 90  ? 39.058  29.063 -37.261 1.00 64.73  ? 103 ALA C CB    1 
ATOM   2176  N  N     . GLN C 3 91  ? 40.727  27.352 -39.733 1.00 77.28  ? 104 GLN C N     1 
ATOM   2177  C  CA    . GLN C 3 91  ? 41.856  26.521 -40.151 1.00 77.81  ? 104 GLN C CA    1 
ATOM   2178  C  C     . GLN C 3 91  ? 41.412  25.134 -40.676 1.00 83.10  ? 104 GLN C C     1 
ATOM   2179  O  O     . GLN C 3 91  ? 42.215  24.207 -40.788 1.00 83.63  ? 104 GLN C O     1 
ATOM   2180  C  CB    . GLN C 3 91  ? 42.911  26.419 -39.036 1.00 79.56  ? 104 GLN C CB    1 
ATOM   2181  C  CG    . GLN C 3 91  ? 43.772  27.655 -38.900 1.00 109.05 ? 104 GLN C CG    1 
ATOM   2182  C  CD    . GLN C 3 91  ? 44.656  27.861 -40.107 1.00 137.21 ? 104 GLN C CD    1 
ATOM   2183  O  OE1   . GLN C 3 91  ? 44.310  28.605 -41.036 1.00 135.23 ? 104 GLN C OE1   1 
ATOM   2184  N  NE2   . GLN C 3 91  ? 45.824  27.211 -40.115 1.00 125.93 ? 104 GLN C NE2   1 
ATOM   2185  N  N     . GLY C 3 92  ? 40.141  25.022 -41.028 1.00 80.13  ? 105 GLY C N     1 
ATOM   2186  C  CA    . GLY C 3 92  ? 39.577  23.788 -41.546 1.00 80.55  ? 105 GLY C CA    1 
ATOM   2187  C  C     . GLY C 3 92  ? 39.906  23.495 -42.995 1.00 86.56  ? 105 GLY C C     1 
ATOM   2188  O  O     . GLY C 3 92  ? 40.107  22.331 -43.337 1.00 87.51  ? 105 GLY C O     1 
ATOM   2189  N  N     . GLY C 3 93  ? 39.933  24.538 -43.840 1.00 82.98  ? 106 GLY C N     1 
ATOM   2190  C  CA    . GLY C 3 93  ? 40.137  24.419 -45.284 1.00 82.67  ? 106 GLY C CA    1 
ATOM   2191  C  C     . GLY C 3 93  ? 38.855  23.953 -45.961 1.00 86.78  ? 106 GLY C C     1 
ATOM   2192  O  O     . GLY C 3 93  ? 37.787  23.994 -45.340 1.00 85.42  ? 106 GLY C O     1 
ATOM   2193  N  N     . VAL C 3 94  ? 38.932  23.483 -47.230 1.00 84.33  ? 107 VAL C N     1 
ATOM   2194  C  CA    . VAL C 3 94  ? 37.746  22.960 -47.951 1.00 83.93  ? 107 VAL C CA    1 
ATOM   2195  C  C     . VAL C 3 94  ? 37.898  21.468 -48.230 1.00 87.54  ? 107 VAL C C     1 
ATOM   2196  O  O     . VAL C 3 94  ? 38.993  20.923 -48.077 1.00 87.78  ? 107 VAL C O     1 
ATOM   2197  C  CB    . VAL C 3 94  ? 37.388  23.710 -49.267 1.00 87.37  ? 107 VAL C CB    1 
ATOM   2198  C  CG1   . VAL C 3 94  ? 36.929  25.127 -48.995 1.00 86.94  ? 107 VAL C CG1   1 
ATOM   2199  C  CG2   . VAL C 3 94  ? 38.520  23.665 -50.291 1.00 87.16  ? 107 VAL C CG2   1 
ATOM   2200  N  N     . LEU C 3 95  ? 36.832  20.808 -48.689 1.00 82.84  ? 108 LEU C N     1 
ATOM   2201  C  CA    . LEU C 3 95  ? 37.023  19.416 -49.073 1.00 81.77  ? 108 LEU C CA    1 
ATOM   2202  C  C     . LEU C 3 95  ? 37.574  19.434 -50.492 1.00 89.07  ? 108 LEU C C     1 
ATOM   2203  O  O     . LEU C 3 95  ? 37.115  20.239 -51.316 1.00 88.75  ? 108 LEU C O     1 
ATOM   2204  C  CB    . LEU C 3 95  ? 35.725  18.595 -49.083 1.00 80.60  ? 108 LEU C CB    1 
ATOM   2205  C  CG    . LEU C 3 95  ? 35.127  18.150 -47.792 1.00 83.67  ? 108 LEU C CG    1 
ATOM   2206  C  CD1   . LEU C 3 95  ? 34.001  17.209 -48.071 1.00 84.23  ? 108 LEU C CD1   1 
ATOM   2207  C  CD2   . LEU C 3 95  ? 36.140  17.496 -46.892 1.00 83.22  ? 108 LEU C CD2   1 
ATOM   2208  N  N     . PRO C 3 96  ? 38.521  18.548 -50.830 1.00 88.51  ? 109 PRO C N     1 
ATOM   2209  C  CA    . PRO C 3 96  ? 38.973  18.490 -52.218 1.00 89.58  ? 109 PRO C CA    1 
ATOM   2210  C  C     . PRO C 3 96  ? 37.800  18.061 -53.112 1.00 95.38  ? 109 PRO C C     1 
ATOM   2211  O  O     . PRO C 3 96  ? 37.149  17.052 -52.829 1.00 95.44  ? 109 PRO C O     1 
ATOM   2212  C  CB    . PRO C 3 96  ? 40.095  17.432 -52.179 1.00 91.31  ? 109 PRO C CB    1 
ATOM   2213  C  CG    . PRO C 3 96  ? 40.470  17.312 -50.728 1.00 95.26  ? 109 PRO C CG    1 
ATOM   2214  C  CD    . PRO C 3 96  ? 39.177  17.504 -50.019 1.00 90.38  ? 109 PRO C CD    1 
ATOM   2215  N  N     . ASN C 3 97  ? 37.475  18.895 -54.116 1.00 92.58  ? 110 ASN C N     1 
ATOM   2216  C  CA    . ASN C 3 97  ? 36.442  18.670 -55.132 1.00 92.60  ? 110 ASN C CA    1 
ATOM   2217  C  C     . ASN C 3 97  ? 36.660  19.599 -56.328 1.00 96.87  ? 110 ASN C C     1 
ATOM   2218  O  O     . ASN C 3 97  ? 36.583  20.825 -56.191 1.00 96.96  ? 110 ASN C O     1 
ATOM   2219  C  CB    . ASN C 3 97  ? 35.000  18.737 -54.563 1.00 93.07  ? 110 ASN C CB    1 
ATOM   2220  C  CG    . ASN C 3 97  ? 33.891  18.954 -55.587 1.00 111.54 ? 110 ASN C CG    1 
ATOM   2221  O  OD1   . ASN C 3 97  ? 33.244  18.025 -56.105 1.00 102.53 ? 110 ASN C OD1   1 
ATOM   2222  N  ND2   . ASN C 3 97  ? 33.640  20.215 -55.891 1.00 103.06 ? 110 ASN C ND2   1 
ATOM   2223  N  N     . ILE C 3 98  ? 36.992  18.999 -57.481 1.00 93.01  ? 111 ILE C N     1 
ATOM   2224  C  CA    . ILE C 3 98  ? 37.169  19.670 -58.770 1.00 92.73  ? 111 ILE C CA    1 
ATOM   2225  C  C     . ILE C 3 98  ? 35.916  19.289 -59.564 1.00 98.27  ? 111 ILE C C     1 
ATOM   2226  O  O     . ILE C 3 98  ? 35.500  18.126 -59.538 1.00 98.49  ? 111 ILE C O     1 
ATOM   2227  C  CB    . ILE C 3 98  ? 38.506  19.281 -59.513 1.00 95.31  ? 111 ILE C CB    1 
ATOM   2228  C  CG1   . ILE C 3 98  ? 39.775  19.773 -58.763 1.00 95.40  ? 111 ILE C CG1   1 
ATOM   2229  C  CG2   . ILE C 3 98  ? 38.540  19.811 -60.959 1.00 95.10  ? 111 ILE C CG2   1 
ATOM   2230  C  CD1   . ILE C 3 98  ? 40.356  18.844 -57.654 1.00 99.81  ? 111 ILE C CD1   1 
ATOM   2231  N  N     . GLN C 3 99  ? 35.289  20.269 -60.220 1.00 95.56  ? 112 GLN C N     1 
ATOM   2232  C  CA    . GLN C 3 99  ? 34.106  20.030 -61.041 1.00 95.76  ? 112 GLN C CA    1 
ATOM   2233  C  C     . GLN C 3 99  ? 34.561  19.306 -62.313 1.00 102.19 ? 112 GLN C C     1 
ATOM   2234  O  O     . GLN C 3 99  ? 35.476  19.777 -63.001 1.00 101.32 ? 112 GLN C O     1 
ATOM   2235  C  CB    . GLN C 3 99  ? 33.375  21.347 -61.342 1.00 96.46  ? 112 GLN C CB    1 
ATOM   2236  C  CG    . GLN C 3 99  ? 32.842  22.043 -60.090 1.00 94.92  ? 112 GLN C CG    1 
ATOM   2237  C  CD    . GLN C 3 99  ? 31.609  21.374 -59.524 1.00 104.60 ? 112 GLN C CD    1 
ATOM   2238  O  OE1   . GLN C 3 99  ? 30.617  21.140 -60.230 1.00 97.44  ? 112 GLN C OE1   1 
ATOM   2239  N  NE2   . GLN C 3 99  ? 31.638  21.064 -58.229 1.00 93.32  ? 112 GLN C NE2   1 
ATOM   2240  N  N     . ALA C 3 100 ? 33.973  18.117 -62.567 1.00 100.87 ? 113 ALA C N     1 
ATOM   2241  C  CA    . ALA C 3 100 ? 34.295  17.222 -63.692 1.00 101.45 ? 113 ALA C CA    1 
ATOM   2242  C  C     . ALA C 3 100 ? 34.337  17.900 -65.066 1.00 106.51 ? 113 ALA C C     1 
ATOM   2243  O  O     . ALA C 3 100 ? 35.060  17.445 -65.953 1.00 106.41 ? 113 ALA C O     1 
ATOM   2244  C  CB    . ALA C 3 100 ? 33.342  16.035 -63.716 1.00 102.32 ? 113 ALA C CB    1 
ATOM   2245  N  N     . VAL C 3 101 ? 33.581  18.996 -65.225 1.00 104.36 ? 114 VAL C N     1 
ATOM   2246  C  CA    . VAL C 3 101 ? 33.493  19.799 -66.447 1.00 104.82 ? 114 VAL C CA    1 
ATOM   2247  C  C     . VAL C 3 101 ? 34.846  20.497 -66.691 1.00 110.74 ? 114 VAL C C     1 
ATOM   2248  O  O     . VAL C 3 101 ? 35.253  20.661 -67.847 1.00 110.26 ? 114 VAL C O     1 
ATOM   2249  C  CB    . VAL C 3 101 ? 32.313  20.816 -66.367 1.00 108.73 ? 114 VAL C CB    1 
ATOM   2250  C  CG1   . VAL C 3 101 ? 31.935  21.347 -67.745 1.00 108.56 ? 114 VAL C CG1   1 
ATOM   2251  C  CG2   . VAL C 3 101 ? 31.091  20.211 -65.665 1.00 108.69 ? 114 VAL C CG2   1 
ATOM   2252  N  N     . LEU C 3 102 ? 35.549  20.868 -65.590 1.00 109.40 ? 115 LEU C N     1 
ATOM   2253  C  CA    . LEU C 3 102 ? 36.847  21.550 -65.612 1.00 110.54 ? 115 LEU C CA    1 
ATOM   2254  C  C     . LEU C 3 102 ? 38.014  20.619 -65.913 1.00 119.72 ? 115 LEU C C     1 
ATOM   2255  O  O     . LEU C 3 102 ? 39.015  21.084 -66.460 1.00 119.42 ? 115 LEU C O     1 
ATOM   2256  C  CB    . LEU C 3 102 ? 37.102  22.329 -64.310 1.00 110.29 ? 115 LEU C CB    1 
ATOM   2257  C  CG    . LEU C 3 102 ? 36.035  23.346 -63.878 1.00 114.35 ? 115 LEU C CG    1 
ATOM   2258  C  CD1   . LEU C 3 102 ? 36.243  23.761 -62.448 1.00 114.37 ? 115 LEU C CD1   1 
ATOM   2259  C  CD2   . LEU C 3 102 ? 36.002  24.570 -64.792 1.00 116.15 ? 115 LEU C CD2   1 
ATOM   2260  N  N     . LEU C 3 103 ? 37.879  19.306 -65.566 1.00 120.23 ? 116 LEU C N     1 
ATOM   2261  C  CA    . LEU C 3 103 ? 38.867  18.232 -65.790 1.00 121.60 ? 116 LEU C CA    1 
ATOM   2262  C  C     . LEU C 3 103 ? 39.314  18.136 -67.265 1.00 130.58 ? 116 LEU C C     1 
ATOM   2263  O  O     . LEU C 3 103 ? 38.497  18.381 -68.156 1.00 130.02 ? 116 LEU C O     1 
ATOM   2264  C  CB    . LEU C 3 103 ? 38.367  16.867 -65.258 1.00 121.30 ? 116 LEU C CB    1 
ATOM   2265  C  CG    . LEU C 3 103 ? 38.264  16.721 -63.720 1.00 125.41 ? 116 LEU C CG    1 
ATOM   2266  C  CD1   . LEU C 3 103 ? 37.559  15.438 -63.330 1.00 125.18 ? 116 LEU C CD1   1 
ATOM   2267  C  CD2   . LEU C 3 103 ? 39.630  16.762 -63.047 1.00 127.45 ? 116 LEU C CD2   1 
ATOM   2268  N  N     . PRO C 3 104 ? 40.611  17.841 -67.540 1.00 131.57 ? 117 PRO C N     1 
ATOM   2269  C  CA    . PRO C 3 104 ? 41.092  17.857 -68.934 1.00 133.44 ? 117 PRO C CA    1 
ATOM   2270  C  C     . PRO C 3 104 ? 40.524  16.766 -69.858 1.00 141.86 ? 117 PRO C C     1 
ATOM   2271  O  O     . PRO C 3 104 ? 39.919  15.803 -69.383 1.00 142.60 ? 117 PRO C O     1 
ATOM   2272  C  CB    . PRO C 3 104 ? 42.614  17.755 -68.771 1.00 135.19 ? 117 PRO C CB    1 
ATOM   2273  C  CG    . PRO C 3 104 ? 42.813  17.064 -67.470 1.00 138.89 ? 117 PRO C CG    1 
ATOM   2274  C  CD    . PRO C 3 104 ? 41.718  17.562 -66.597 1.00 133.75 ? 117 PRO C CD    1 
ATOM   2275  N  N     . LYS C 3 105 ? 40.731  16.929 -71.187 1.00 139.76 ? 118 LYS C N     1 
ATOM   2276  C  CA    . LYS C 3 105 ? 40.290  16.018 -72.250 1.00 170.12 ? 118 LYS C CA    1 
ATOM   2277  C  C     . LYS C 3 105 ? 41.229  14.816 -72.422 1.00 203.10 ? 118 LYS C C     1 
ATOM   2278  O  O     . LYS C 3 105 ? 41.152  13.831 -71.682 1.00 166.43 ? 118 LYS C O     1 
ATOM   2279  C  CB    . LYS C 3 105 ? 40.218  16.787 -73.584 1.00 172.49 ? 118 LYS C CB    1 
ATOM   2280  C  CG    . LYS C 3 105 ? 39.167  16.276 -74.565 1.00 184.90 ? 118 LYS C CG    1 
ATOM   2281  C  CD    . LYS C 3 105 ? 38.133  17.350 -74.934 1.00 193.11 ? 118 LYS C CD    1 
ATOM   2282  C  CE    . LYS C 3 105 ? 36.978  17.434 -73.953 1.00 200.35 ? 118 LYS C CE    1 
ATOM   2283  N  NZ    . LYS C 3 105 ? 35.953  18.421 -74.380 1.00 206.16 ? 118 LYS C NZ    1 
ATOM   2284  N  N     . ARG D 4 1   ? 43.876  38.201 -12.384 1.00 155.69 ? 28  ARG D N     1 
ATOM   2285  C  CA    . ARG D 4 1   ? 42.901  37.888 -13.437 1.00 155.72 ? 28  ARG D CA    1 
ATOM   2286  C  C     . ARG D 4 1   ? 41.550  37.333 -12.893 1.00 156.52 ? 28  ARG D C     1 
ATOM   2287  O  O     . ARG D 4 1   ? 41.241  37.529 -11.713 1.00 157.05 ? 28  ARG D O     1 
ATOM   2288  C  CB    . ARG D 4 1   ? 43.519  36.947 -14.496 1.00 159.10 ? 28  ARG D CB    1 
ATOM   2289  C  CG    . ARG D 4 1   ? 44.102  37.670 -15.714 1.00 176.00 ? 28  ARG D CG    1 
ATOM   2290  C  CD    . ARG D 4 1   ? 44.536  36.707 -16.810 1.00 193.01 ? 28  ARG D CD    1 
ATOM   2291  N  NE    . ARG D 4 1   ? 45.883  36.175 -16.596 1.00 207.62 ? 28  ARG D NE    1 
ATOM   2292  C  CZ    . ARG D 4 1   ? 46.305  34.979 -17.001 1.00 223.07 ? 28  ARG D CZ    1 
ATOM   2293  N  NH1   . ARG D 4 1   ? 45.478  34.152 -17.631 1.00 208.51 ? 28  ARG D NH1   1 
ATOM   2294  N  NH2   . ARG D 4 1   ? 47.552  34.595 -16.767 1.00 211.59 ? 28  ARG D NH2   1 
ATOM   2295  N  N     . SER D 4 2   ? 40.749  36.682 -13.765 1.00 148.93 ? 29  SER D N     1 
ATOM   2296  C  CA    . SER D 4 2   ? 39.451  36.093 -13.455 1.00 147.09 ? 29  SER D CA    1 
ATOM   2297  C  C     . SER D 4 2   ? 39.304  34.739 -14.167 1.00 147.71 ? 29  SER D C     1 
ATOM   2298  O  O     . SER D 4 2   ? 39.698  34.614 -15.326 1.00 147.46 ? 29  SER D O     1 
ATOM   2299  C  CB    . SER D 4 2   ? 38.323  37.047 -13.851 1.00 149.94 ? 29  SER D CB    1 
ATOM   2300  O  OG    . SER D 4 2   ? 38.205  37.211 -15.254 1.00 156.76 ? 29  SER D OG    1 
ATOM   2301  N  N     . ARG D 4 3   ? 38.722  33.733 -13.461 1.00 141.07 ? 30  ARG D N     1 
ATOM   2302  C  CA    . ARG D 4 3   ? 38.495  32.352 -13.920 1.00 139.02 ? 30  ARG D CA    1 
ATOM   2303  C  C     . ARG D 4 3   ? 37.820  32.217 -15.297 1.00 136.21 ? 30  ARG D C     1 
ATOM   2304  O  O     . ARG D 4 3   ? 36.888  32.958 -15.625 1.00 135.39 ? 30  ARG D O     1 
ATOM   2305  C  CB    . ARG D 4 3   ? 37.715  31.543 -12.873 1.00 141.62 ? 30  ARG D CB    1 
ATOM   2306  C  CG    . ARG D 4 3   ? 38.159  30.073 -12.763 1.00 156.82 ? 30  ARG D CG    1 
ATOM   2307  C  CD    . ARG D 4 3   ? 37.479  29.336 -11.621 1.00 169.60 ? 30  ARG D CD    1 
ATOM   2308  N  NE    . ARG D 4 3   ? 38.329  29.279 -10.430 1.00 182.27 ? 30  ARG D NE    1 
ATOM   2309  C  CZ    . ARG D 4 3   ? 38.885  28.168 -9.954  1.00 197.82 ? 30  ARG D CZ    1 
ATOM   2310  N  NH1   . ARG D 4 3   ? 38.693  27.006 -10.566 1.00 184.65 ? 30  ARG D NH1   1 
ATOM   2311  N  NH2   . ARG D 4 3   ? 39.641  28.212 -8.865  1.00 185.50 ? 30  ARG D NH2   1 
ATOM   2312  N  N     . LYS D 4 4   ? 38.325  31.263 -16.099 1.00 128.17 ? 31  LYS D N     1 
ATOM   2313  C  CA    . LYS D 4 4   ? 37.851  30.937 -17.443 1.00 125.97 ? 31  LYS D CA    1 
ATOM   2314  C  C     . LYS D 4 4   ? 37.410  29.467 -17.466 1.00 124.64 ? 31  LYS D C     1 
ATOM   2315  O  O     . LYS D 4 4   ? 38.200  28.577 -17.149 1.00 123.16 ? 31  LYS D O     1 
ATOM   2316  C  CB    . LYS D 4 4   ? 38.933  31.183 -18.514 1.00 128.82 ? 31  LYS D CB    1 
ATOM   2317  C  CG    . LYS D 4 4   ? 39.561  32.577 -18.477 1.00 150.00 ? 31  LYS D CG    1 
ATOM   2318  C  CD    . LYS D 4 4   ? 40.653  32.759 -19.541 1.00 160.80 ? 31  LYS D CD    1 
ATOM   2319  C  CE    . LYS D 4 4   ? 41.685  33.830 -19.200 1.00 166.09 ? 31  LYS D CE    1 
ATOM   2320  N  NZ    . LYS D 4 4   ? 42.500  33.488 -17.998 1.00 167.51 ? 31  LYS D NZ    1 
ATOM   2321  N  N     . GLU D 4 5   ? 36.142  29.221 -17.838 1.00 118.17 ? 32  GLU D N     1 
ATOM   2322  C  CA    . GLU D 4 5   ? 35.539  27.881 -17.954 1.00 116.15 ? 32  GLU D CA    1 
ATOM   2323  C  C     . GLU D 4 5   ? 35.996  27.233 -19.261 1.00 115.63 ? 32  GLU D C     1 
ATOM   2324  O  O     . GLU D 4 5   ? 36.586  27.924 -20.102 1.00 116.58 ? 32  GLU D O     1 
ATOM   2325  C  CB    . GLU D 4 5   ? 34.008  27.998 -17.993 1.00 117.54 ? 32  GLU D CB    1 
ATOM   2326  C  CG    . GLU D 4 5   ? 33.411  28.697 -16.789 1.00 127.31 ? 32  GLU D CG    1 
ATOM   2327  C  CD    . GLU D 4 5   ? 32.636  27.755 -15.902 1.00 131.77 ? 32  GLU D CD    1 
ATOM   2328  O  OE1   . GLU D 4 5   ? 31.549  27.319 -16.347 1.00 94.43  ? 32  GLU D OE1   1 
ATOM   2329  O  OE2   . GLU D 4 5   ? 33.103  27.460 -14.775 1.00 121.87 ? 32  GLU D OE2   1 
ATOM   2330  N  N     . SER D 4 6   ? 35.666  25.926 -19.459 1.00 106.99 ? 33  SER D N     1 
ATOM   2331  C  CA    . SER D 4 6   ? 35.978  25.129 -20.659 1.00 104.19 ? 33  SER D CA    1 
ATOM   2332  C  C     . SER D 4 6   ? 35.409  23.711 -20.563 1.00 102.14 ? 33  SER D C     1 
ATOM   2333  O  O     . SER D 4 6   ? 35.255  23.191 -19.463 1.00 101.09 ? 33  SER D O     1 
ATOM   2334  C  CB    . SER D 4 6   ? 37.492  25.031 -20.856 1.00 107.26 ? 33  SER D CB    1 
ATOM   2335  O  OG    . SER D 4 6   ? 37.846  25.065 -22.228 1.00 115.02 ? 33  SER D OG    1 
ATOM   2336  N  N     . TYR D 4 7   ? 35.150  23.072 -21.716 1.00 95.93  ? 34  TYR D N     1 
ATOM   2337  C  CA    . TYR D 4 7   ? 34.728  21.669 -21.812 1.00 94.56  ? 34  TYR D CA    1 
ATOM   2338  C  C     . TYR D 4 7   ? 35.955  20.765 -22.082 1.00 100.31 ? 34  TYR D C     1 
ATOM   2339  O  O     . TYR D 4 7   ? 35.811  19.553 -22.301 1.00 100.48 ? 34  TYR D O     1 
ATOM   2340  C  CB    . TYR D 4 7   ? 33.671  21.482 -22.898 1.00 93.96  ? 34  TYR D CB    1 
ATOM   2341  C  CG    . TYR D 4 7   ? 32.341  22.092 -22.536 1.00 93.65  ? 34  TYR D CG    1 
ATOM   2342  C  CD1   . TYR D 4 7   ? 31.408  21.384 -21.787 1.00 95.54  ? 34  TYR D CD1   1 
ATOM   2343  C  CD2   . TYR D 4 7   ? 31.999  23.367 -22.963 1.00 93.33  ? 34  TYR D CD2   1 
ATOM   2344  C  CE1   . TYR D 4 7   ? 30.173  21.940 -21.458 1.00 95.95  ? 34  TYR D CE1   1 
ATOM   2345  C  CE2   . TYR D 4 7   ? 30.767  23.931 -22.644 1.00 93.62  ? 34  TYR D CE2   1 
ATOM   2346  C  CZ    . TYR D 4 7   ? 29.858  23.216 -21.887 1.00 99.20  ? 34  TYR D CZ    1 
ATOM   2347  O  OH    . TYR D 4 7   ? 28.652  23.780 -21.560 1.00 98.37  ? 34  TYR D OH    1 
ATOM   2348  N  N     . SER D 4 8   ? 37.167  21.373 -22.008 1.00 97.49  ? 35  SER D N     1 
ATOM   2349  C  CA    . SER D 4 8   ? 38.481  20.771 -22.239 1.00 97.63  ? 35  SER D CA    1 
ATOM   2350  C  C     . SER D 4 8   ? 38.676  19.440 -21.555 1.00 101.85 ? 35  SER D C     1 
ATOM   2351  O  O     . SER D 4 8   ? 39.092  18.475 -22.195 1.00 101.44 ? 35  SER D O     1 
ATOM   2352  C  CB    . SER D 4 8   ? 39.584  21.731 -21.807 1.00 102.64 ? 35  SER D CB    1 
ATOM   2353  O  OG    . SER D 4 8   ? 39.520  22.963 -22.506 1.00 113.28 ? 35  SER D OG    1 
ATOM   2354  N  N     . VAL D 4 9   ? 38.371  19.406 -20.252 1.00 98.45  ? 36  VAL D N     1 
ATOM   2355  C  CA    . VAL D 4 9   ? 38.503  18.269 -19.351 1.00 98.01  ? 36  VAL D CA    1 
ATOM   2356  C  C     . VAL D 4 9   ? 37.674  17.073 -19.827 1.00 100.10 ? 36  VAL D C     1 
ATOM   2357  O  O     . VAL D 4 9   ? 38.153  15.935 -19.774 1.00 99.64  ? 36  VAL D O     1 
ATOM   2358  C  CB    . VAL D 4 9   ? 38.148  18.735 -17.912 1.00 102.13 ? 36  VAL D CB    1 
ATOM   2359  C  CG1   . VAL D 4 9   ? 37.967  17.564 -16.955 1.00 102.31 ? 36  VAL D CG1   1 
ATOM   2360  C  CG2   . VAL D 4 9   ? 39.202  19.702 -17.381 1.00 101.79 ? 36  VAL D CG2   1 
ATOM   2361  N  N     . TYR D 4 10  ? 36.462  17.350 -20.335 1.00 94.87  ? 37  TYR D N     1 
ATOM   2362  C  CA    . TYR D 4 10  ? 35.496  16.359 -20.799 1.00 94.28  ? 37  TYR D CA    1 
ATOM   2363  C  C     . TYR D 4 10  ? 35.767  15.899 -22.209 1.00 99.54  ? 37  TYR D C     1 
ATOM   2364  O  O     . TYR D 4 10  ? 35.668  14.701 -22.485 1.00 99.10  ? 37  TYR D O     1 
ATOM   2365  C  CB    . TYR D 4 10  ? 34.068  16.891 -20.634 1.00 94.59  ? 37  TYR D CB    1 
ATOM   2366  C  CG    . TYR D 4 10  ? 33.939  17.732 -19.390 1.00 96.07  ? 37  TYR D CG    1 
ATOM   2367  C  CD1   . TYR D 4 10  ? 33.881  17.143 -18.134 1.00 98.61  ? 37  TYR D CD1   1 
ATOM   2368  C  CD2   . TYR D 4 10  ? 34.015  19.117 -19.454 1.00 96.77  ? 37  TYR D CD2   1 
ATOM   2369  C  CE1   . TYR D 4 10  ? 33.851  17.911 -16.974 1.00 100.57 ? 37  TYR D CE1   1 
ATOM   2370  C  CE2   . TYR D 4 10  ? 33.995  19.899 -18.302 1.00 97.74  ? 37  TYR D CE2   1 
ATOM   2371  C  CZ    . TYR D 4 10  ? 33.908  19.293 -17.062 1.00 106.25 ? 37  TYR D CZ    1 
ATOM   2372  O  OH    . TYR D 4 10  ? 33.841  20.064 -15.926 1.00 107.20 ? 37  TYR D OH    1 
ATOM   2373  N  N     . VAL D 4 11  ? 36.145  16.837 -23.097 1.00 96.73  ? 38  VAL D N     1 
ATOM   2374  C  CA    . VAL D 4 11  ? 36.466  16.525 -24.491 1.00 96.67  ? 38  VAL D CA    1 
ATOM   2375  C  C     . VAL D 4 11  ? 37.644  15.528 -24.510 1.00 101.60 ? 38  VAL D C     1 
ATOM   2376  O  O     . VAL D 4 11  ? 37.577  14.525 -25.212 1.00 99.94  ? 38  VAL D O     1 
ATOM   2377  C  CB    . VAL D 4 11  ? 36.677  17.815 -25.336 1.00 99.94  ? 38  VAL D CB    1 
ATOM   2378  C  CG1   . VAL D 4 11  ? 37.185  17.507 -26.741 1.00 99.68  ? 38  VAL D CG1   1 
ATOM   2379  C  CG2   . VAL D 4 11  ? 35.391  18.638 -25.414 1.00 99.36  ? 38  VAL D CG2   1 
ATOM   2380  N  N     . TYR D 4 12  ? 38.653  15.756 -23.649 1.00 100.89 ? 39  TYR D N     1 
ATOM   2381  C  CA    . TYR D 4 12  ? 39.835  14.897 -23.477 1.00 101.49 ? 39  TYR D CA    1 
ATOM   2382  C  C     . TYR D 4 12  ? 39.414  13.503 -22.959 1.00 104.10 ? 39  TYR D C     1 
ATOM   2383  O  O     . TYR D 4 12  ? 39.907  12.491 -23.464 1.00 103.42 ? 39  TYR D O     1 
ATOM   2384  C  CB    . TYR D 4 12  ? 40.802  15.552 -22.487 1.00 104.28 ? 39  TYR D CB    1 
ATOM   2385  C  CG    . TYR D 4 12  ? 42.152  15.958 -23.041 1.00 109.59 ? 39  TYR D CG    1 
ATOM   2386  C  CD1   . TYR D 4 12  ? 43.232  15.073 -23.009 1.00 113.16 ? 39  TYR D CD1   1 
ATOM   2387  C  CD2   . TYR D 4 12  ? 42.405  17.275 -23.424 1.00 111.19 ? 39  TYR D CD2   1 
ATOM   2388  C  CE1   . TYR D 4 12  ? 44.515  15.472 -23.408 1.00 116.71 ? 39  TYR D CE1   1 
ATOM   2389  C  CE2   . TYR D 4 12  ? 43.674  17.682 -23.854 1.00 113.02 ? 39  TYR D CE2   1 
ATOM   2390  C  CZ    . TYR D 4 12  ? 44.735  16.777 -23.836 1.00 125.55 ? 39  TYR D CZ    1 
ATOM   2391  O  OH    . TYR D 4 12  ? 46.012  17.160 -24.229 1.00 126.38 ? 39  TYR D OH    1 
ATOM   2392  N  N     . LYS D 4 13  ? 38.490  13.457 -21.966 1.00 99.10  ? 40  LYS D N     1 
ATOM   2393  C  CA    . LYS D 4 13  ? 37.945  12.218 -21.392 1.00 97.41  ? 40  LYS D CA    1 
ATOM   2394  C  C     . LYS D 4 13  ? 37.250  11.414 -22.499 1.00 97.94  ? 40  LYS D C     1 
ATOM   2395  O  O     . LYS D 4 13  ? 37.660  10.300 -22.767 1.00 98.65  ? 40  LYS D O     1 
ATOM   2396  C  CB    . LYS D 4 13  ? 36.948  12.536 -20.262 1.00 99.72  ? 40  LYS D CB    1 
ATOM   2397  C  CG    . LYS D 4 13  ? 37.573  12.789 -18.903 1.00 102.84 ? 40  LYS D CG    1 
ATOM   2398  C  CD    . LYS D 4 13  ? 36.496  13.098 -17.869 1.00 110.87 ? 40  LYS D CD    1 
ATOM   2399  C  CE    . LYS D 4 13  ? 37.007  12.990 -16.454 1.00 128.24 ? 40  LYS D CE    1 
ATOM   2400  N  NZ    . LYS D 4 13  ? 37.816  14.176 -16.061 1.00 139.16 ? 40  LYS D NZ    1 
ATOM   2401  N  N     . VAL D 4 14  ? 36.253  12.006 -23.179 1.00 91.75  ? 41  VAL D N     1 
ATOM   2402  C  CA    . VAL D 4 14  ? 35.523  11.403 -24.296 1.00 89.88  ? 41  VAL D CA    1 
ATOM   2403  C  C     . VAL D 4 14  ? 36.504  10.965 -25.407 1.00 94.55  ? 41  VAL D C     1 
ATOM   2404  O  O     . VAL D 4 14  ? 36.339  9.878  -25.958 1.00 94.75  ? 41  VAL D O     1 
ATOM   2405  C  CB    . VAL D 4 14  ? 34.380  12.333 -24.800 1.00 91.82  ? 41  VAL D CB    1 
ATOM   2406  C  CG1   . VAL D 4 14  ? 33.665  11.748 -26.005 1.00 90.97  ? 41  VAL D CG1   1 
ATOM   2407  C  CG2   . VAL D 4 14  ? 33.375  12.610 -23.691 1.00 91.31  ? 41  VAL D CG2   1 
ATOM   2408  N  N     . LEU D 4 15  ? 37.555  11.765 -25.678 1.00 91.78  ? 42  LEU D N     1 
ATOM   2409  C  CA    . LEU D 4 15  ? 38.567  11.420 -26.672 1.00 92.08  ? 42  LEU D CA    1 
ATOM   2410  C  C     . LEU D 4 15  ? 39.311  10.181 -26.227 1.00 98.57  ? 42  LEU D C     1 
ATOM   2411  O  O     . LEU D 4 15  ? 39.400  9.247  -27.018 1.00 99.07  ? 42  LEU D O     1 
ATOM   2412  C  CB    . LEU D 4 15  ? 39.540  12.577 -26.954 1.00 92.15  ? 42  LEU D CB    1 
ATOM   2413  C  CG    . LEU D 4 15  ? 40.650  12.287 -27.973 1.00 96.67  ? 42  LEU D CG    1 
ATOM   2414  C  CD1   . LEU D 4 15  ? 40.095  12.170 -29.378 1.00 96.73  ? 42  LEU D CD1   1 
ATOM   2415  C  CD2   . LEU D 4 15  ? 41.754  13.323 -27.896 1.00 99.03  ? 42  LEU D CD2   1 
ATOM   2416  N  N     . LYS D 4 16  ? 39.788  10.139 -24.946 1.00 96.36  ? 43  LYS D N     1 
ATOM   2417  C  CA    . LYS D 4 16  ? 40.491  8.990  -24.323 1.00 95.90  ? 43  LYS D CA    1 
ATOM   2418  C  C     . LYS D 4 16  ? 39.649  7.725  -24.418 1.00 99.54  ? 43  LYS D C     1 
ATOM   2419  O  O     . LYS D 4 16  ? 40.204  6.651  -24.563 1.00 100.41 ? 43  LYS D O     1 
ATOM   2420  C  CB    . LYS D 4 16  ? 40.841  9.272  -22.847 1.00 98.08  ? 43  LYS D CB    1 
ATOM   2421  C  CG    . LYS D 4 16  ? 42.033  10.224 -22.645 1.00 111.14 ? 43  LYS D CG    1 
ATOM   2422  C  CD    . LYS D 4 16  ? 42.046  10.827 -21.219 1.00 123.57 ? 43  LYS D CD    1 
ATOM   2423  C  CE    . LYS D 4 16  ? 43.429  11.052 -20.617 1.00 135.99 ? 43  LYS D CE    1 
ATOM   2424  N  NZ    . LYS D 4 16  ? 43.937  9.879  -19.826 1.00 135.25 ? 43  LYS D NZ    1 
ATOM   2425  N  N     . GLN D 4 17  ? 38.315  7.870  -24.380 1.00 96.26  ? 44  GLN D N     1 
ATOM   2426  C  CA    . GLN D 4 17  ? 37.297  6.826  -24.496 1.00 96.65  ? 44  GLN D CA    1 
ATOM   2427  C  C     . GLN D 4 17  ? 37.117  6.316  -25.949 1.00 103.42 ? 44  GLN D C     1 
ATOM   2428  O  O     . GLN D 4 17  ? 36.966  5.111  -26.132 1.00 104.79 ? 44  GLN D O     1 
ATOM   2429  C  CB    . GLN D 4 17  ? 35.964  7.351  -23.929 1.00 98.09  ? 44  GLN D CB    1 
ATOM   2430  C  CG    . GLN D 4 17  ? 34.910  6.299  -23.576 1.00 117.20 ? 44  GLN D CG    1 
ATOM   2431  C  CD    . GLN D 4 17  ? 33.523  6.866  -23.291 1.00 143.30 ? 44  GLN D CD    1 
ATOM   2432  O  OE1   . GLN D 4 17  ? 32.508  6.194  -23.512 1.00 141.98 ? 44  GLN D OE1   1 
ATOM   2433  N  NE2   . GLN D 4 17  ? 33.428  8.102  -22.790 1.00 133.59 ? 44  GLN D NE2   1 
ATOM   2434  N  N     . VAL D 4 18  ? 37.124  7.206  -26.969 1.00 101.34 ? 45  VAL D N     1 
ATOM   2435  C  CA    . VAL D 4 18  ? 36.931  6.806  -28.380 1.00 101.61 ? 45  VAL D CA    1 
ATOM   2436  C  C     . VAL D 4 18  ? 38.256  6.388  -29.061 1.00 109.27 ? 45  VAL D C     1 
ATOM   2437  O  O     . VAL D 4 18  ? 38.316  5.347  -29.721 1.00 108.11 ? 45  VAL D O     1 
ATOM   2438  C  CB    . VAL D 4 18  ? 36.132  7.842  -29.249 1.00 104.07 ? 45  VAL D CB    1 
ATOM   2439  C  CG1   . VAL D 4 18  ? 34.671  7.924  -28.822 1.00 103.26 ? 45  VAL D CG1   1 
ATOM   2440  C  CG2   . VAL D 4 18  ? 36.779  9.227  -29.264 1.00 103.80 ? 45  VAL D CG2   1 
ATOM   2441  N  N     . HIS D 4 19  ? 39.296  7.223  -28.903 1.00 110.16 ? 46  HIS D N     1 
ATOM   2442  C  CA    . HIS D 4 19  ? 40.636  7.071  -29.465 1.00 112.02 ? 46  HIS D CA    1 
ATOM   2443  C  C     . HIS D 4 19  ? 41.677  7.142  -28.322 1.00 120.45 ? 46  HIS D C     1 
ATOM   2444  O  O     . HIS D 4 19  ? 42.237  8.210  -28.046 1.00 120.78 ? 46  HIS D O     1 
ATOM   2445  C  CB    . HIS D 4 19  ? 40.882  8.169  -30.509 1.00 112.79 ? 46  HIS D CB    1 
ATOM   2446  C  CG    . HIS D 4 19  ? 40.176  7.948  -31.803 1.00 116.04 ? 46  HIS D CG    1 
ATOM   2447  N  ND1   . HIS D 4 19  ? 38.899  8.432  -32.019 1.00 118.06 ? 46  HIS D ND1   1 
ATOM   2448  C  CD2   . HIS D 4 19  ? 40.599  7.310  -32.918 1.00 118.21 ? 46  HIS D CD2   1 
ATOM   2449  C  CE1   . HIS D 4 19  ? 38.583  8.063  -33.249 1.00 117.72 ? 46  HIS D CE1   1 
ATOM   2450  N  NE2   . HIS D 4 19  ? 39.573  7.382  -33.828 1.00 117.70 ? 46  HIS D NE2   1 
ATOM   2451  N  N     . PRO D 4 20  ? 41.936  6.023  -27.622 1.00 119.41 ? 47  PRO D N     1 
ATOM   2452  C  CA    . PRO D 4 20  ? 42.854  6.083  -26.477 1.00 120.80 ? 47  PRO D CA    1 
ATOM   2453  C  C     . PRO D 4 20  ? 44.296  6.419  -26.821 1.00 130.64 ? 47  PRO D C     1 
ATOM   2454  O  O     . PRO D 4 20  ? 45.057  6.772  -25.915 1.00 131.78 ? 47  PRO D O     1 
ATOM   2455  C  CB    . PRO D 4 20  ? 42.712  4.702  -25.831 1.00 122.11 ? 47  PRO D CB    1 
ATOM   2456  C  CG    . PRO D 4 20  ? 41.447  4.138  -26.384 1.00 126.11 ? 47  PRO D CG    1 
ATOM   2457  C  CD    . PRO D 4 20  ? 41.355  4.678  -27.766 1.00 121.35 ? 47  PRO D CD    1 
ATOM   2458  N  N     . ASP D 4 21  ? 44.670  6.332  -28.117 1.00 129.30 ? 48  ASP D N     1 
ATOM   2459  C  CA    . ASP D 4 21  ? 46.035  6.618  -28.581 1.00 129.30 ? 48  ASP D CA    1 
ATOM   2460  C  C     . ASP D 4 21  ? 46.104  7.862  -29.485 1.00 129.61 ? 48  ASP D C     1 
ATOM   2461  O  O     . ASP D 4 21  ? 47.106  8.071  -30.175 1.00 129.24 ? 48  ASP D O     1 
ATOM   2462  C  CB    . ASP D 4 21  ? 46.668  5.373  -29.244 1.00 131.77 ? 48  ASP D CB    1 
ATOM   2463  C  CG    . ASP D 4 21  ? 47.289  4.355  -28.282 1.00 150.82 ? 48  ASP D CG    1 
ATOM   2464  O  OD1   . ASP D 4 21  ? 46.717  4.138  -27.187 1.00 152.89 ? 48  ASP D OD1   1 
ATOM   2465  O  OD2   . ASP D 4 21  ? 48.340  3.751  -28.641 1.00 157.24 ? 48  ASP D OD2   1 
ATOM   2466  N  N     . THR D 4 22  ? 45.048  8.705  -29.435 1.00 122.77 ? 49  THR D N     1 
ATOM   2467  C  CA    . THR D 4 22  ? 44.911  9.945  -30.207 1.00 121.08 ? 49  THR D CA    1 
ATOM   2468  C  C     . THR D 4 22  ? 44.889  11.176 -29.263 1.00 122.13 ? 49  THR D C     1 
ATOM   2469  O  O     . THR D 4 22  ? 44.366  11.099 -28.151 1.00 121.95 ? 49  THR D O     1 
ATOM   2470  C  CB    . THR D 4 22  ? 43.691  9.824  -31.160 1.00 126.35 ? 49  THR D CB    1 
ATOM   2471  O  OG1   . THR D 4 22  ? 43.871  8.717  -32.043 1.00 123.85 ? 49  THR D OG1   1 
ATOM   2472  C  CG2   . THR D 4 22  ? 43.427  11.066 -31.982 1.00 124.66 ? 49  THR D CG2   1 
ATOM   2473  N  N     . GLY D 4 23  ? 45.484  12.277 -29.722 1.00 115.97 ? 50  GLY D N     1 
ATOM   2474  C  CA    . GLY D 4 23  ? 45.564  13.545 -29.003 1.00 114.33 ? 50  GLY D CA    1 
ATOM   2475  C  C     . GLY D 4 23  ? 44.795  14.659 -29.685 1.00 115.74 ? 50  GLY D C     1 
ATOM   2476  O  O     . GLY D 4 23  ? 44.116  14.427 -30.686 1.00 115.77 ? 50  GLY D O     1 
ATOM   2477  N  N     . ILE D 4 24  ? 44.877  15.881 -29.139 1.00 109.58 ? 51  ILE D N     1 
ATOM   2478  C  CA    . ILE D 4 24  ? 44.159  17.042 -29.670 1.00 107.44 ? 51  ILE D CA    1 
ATOM   2479  C  C     . ILE D 4 24  ? 44.997  18.345 -29.542 1.00 109.41 ? 51  ILE D C     1 
ATOM   2480  O  O     . ILE D 4 24  ? 45.611  18.608 -28.500 1.00 108.64 ? 51  ILE D O     1 
ATOM   2481  C  CB    . ILE D 4 24  ? 42.725  17.143 -29.048 1.00 109.72 ? 51  ILE D CB    1 
ATOM   2482  C  CG1   . ILE D 4 24  ? 41.802  18.006 -29.929 1.00 109.45 ? 51  ILE D CG1   1 
ATOM   2483  C  CG2   . ILE D 4 24  ? 42.734  17.589 -27.562 1.00 110.42 ? 51  ILE D CG2   1 
ATOM   2484  C  CD1   . ILE D 4 24  ? 40.372  18.048 -29.548 1.00 114.03 ? 51  ILE D CD1   1 
ATOM   2485  N  N     . SER D 4 25  ? 45.022  19.145 -30.627 1.00 104.59 ? 52  SER D N     1 
ATOM   2486  C  CA    . SER D 4 25  ? 45.732  20.428 -30.688 1.00 103.40 ? 52  SER D CA    1 
ATOM   2487  C  C     . SER D 4 25  ? 44.961  21.506 -29.919 1.00 104.55 ? 52  SER D C     1 
ATOM   2488  O  O     . SER D 4 25  ? 43.754  21.360 -29.714 1.00 104.59 ? 52  SER D O     1 
ATOM   2489  C  CB    . SER D 4 25  ? 45.977  20.846 -32.139 1.00 107.22 ? 52  SER D CB    1 
ATOM   2490  O  OG    . SER D 4 25  ? 44.922  21.604 -32.713 1.00 116.80 ? 52  SER D OG    1 
ATOM   2491  N  N     . SER D 4 26  ? 45.654  22.576 -29.493 1.00 98.15  ? 53  SER D N     1 
ATOM   2492  C  CA    . SER D 4 26  ? 45.068  23.694 -28.749 1.00 96.71  ? 53  SER D CA    1 
ATOM   2493  C  C     . SER D 4 26  ? 43.895  24.313 -29.521 1.00 99.15  ? 53  SER D C     1 
ATOM   2494  O  O     . SER D 4 26  ? 42.845  24.600 -28.937 1.00 98.05  ? 53  SER D O     1 
ATOM   2495  C  CB    . SER D 4 26  ? 46.117  24.765 -28.500 1.00 99.70  ? 53  SER D CB    1 
ATOM   2496  O  OG    . SER D 4 26  ? 45.632  25.717 -27.569 1.00 109.22 ? 53  SER D OG    1 
ATOM   2497  N  N     . LYS D 4 27  ? 44.080  24.488 -30.842 1.00 94.45  ? 54  LYS D N     1 
ATOM   2498  C  CA    . LYS D 4 27  ? 43.090  25.048 -31.759 1.00 92.98  ? 54  LYS D CA    1 
ATOM   2499  C  C     . LYS D 4 27  ? 41.949  24.076 -31.998 1.00 94.22  ? 54  LYS D C     1 
ATOM   2500  O  O     . LYS D 4 27  ? 40.800  24.506 -31.989 1.00 94.66  ? 54  LYS D O     1 
ATOM   2501  C  CB    . LYS D 4 27  ? 43.700  25.522 -33.105 1.00 95.77  ? 54  LYS D CB    1 
ATOM   2502  C  CG    . LYS D 4 27  ? 45.220  25.371 -33.308 1.00 113.96 ? 54  LYS D CG    1 
ATOM   2503  C  CD    . LYS D 4 27  ? 45.610  24.772 -34.683 1.00 122.63 ? 54  LYS D CD    1 
ATOM   2504  C  CE    . LYS D 4 27  ? 46.729  23.751 -34.560 1.00 122.80 ? 54  LYS D CE    1 
ATOM   2505  N  NZ    . LYS D 4 27  ? 46.399  22.492 -35.265 1.00 120.85 ? 54  LYS D NZ    1 
ATOM   2506  N  N     . ALA D 4 28  ? 42.251  22.773 -32.201 1.00 87.78  ? 55  ALA D N     1 
ATOM   2507  C  CA    . ALA D 4 28  ? 41.222  21.750 -32.402 1.00 86.06  ? 55  ALA D CA    1 
ATOM   2508  C  C     . ALA D 4 28  ? 40.318  21.651 -31.176 1.00 87.27  ? 55  ALA D C     1 
ATOM   2509  O  O     . ALA D 4 28  ? 39.107  21.501 -31.328 1.00 86.33  ? 55  ALA D O     1 
ATOM   2510  C  CB    . ALA D 4 28  ? 41.853  20.417 -32.705 1.00 86.46  ? 55  ALA D CB    1 
ATOM   2511  N  N     . MET D 4 29  ? 40.894  21.827 -29.973 1.00 82.31  ? 56  MET D N     1 
ATOM   2512  C  CA    . MET D 4 29  ? 40.142  21.859 -28.724 1.00 82.05  ? 56  MET D CA    1 
ATOM   2513  C  C     . MET D 4 29  ? 39.290  23.124 -28.683 1.00 83.34  ? 56  MET D C     1 
ATOM   2514  O  O     . MET D 4 29  ? 38.142  23.067 -28.241 1.00 84.56  ? 56  MET D O     1 
ATOM   2515  C  CB    . MET D 4 29  ? 41.080  21.794 -27.524 1.00 85.16  ? 56  MET D CB    1 
ATOM   2516  C  CG    . MET D 4 29  ? 40.376  21.863 -26.181 1.00 90.53  ? 56  MET D CG    1 
ATOM   2517  S  SD    . MET D 4 29  ? 39.301  20.452 -25.825 1.00 96.51  ? 56  MET D SD    1 
ATOM   2518  C  CE    . MET D 4 29  ? 37.765  21.195 -25.880 1.00 94.15  ? 56  MET D CE    1 
ATOM   2519  N  N     . GLY D 4 30  ? 39.840  24.237 -29.183 1.00 75.37  ? 57  GLY D N     1 
ATOM   2520  C  CA    . GLY D 4 30  ? 39.136  25.509 -29.317 1.00 72.35  ? 57  GLY D CA    1 
ATOM   2521  C  C     . GLY D 4 30  ? 37.847  25.306 -30.082 1.00 69.47  ? 57  GLY D C     1 
ATOM   2522  O  O     . GLY D 4 30  ? 36.781  25.617 -29.562 1.00 69.50  ? 57  GLY D O     1 
ATOM   2523  N  N     . ILE D 4 31  ? 37.931  24.649 -31.257 1.00 61.71  ? 58  ILE D N     1 
ATOM   2524  C  CA    . ILE D 4 31  ? 36.796  24.268 -32.104 1.00 59.88  ? 58  ILE D CA    1 
ATOM   2525  C  C     . ILE D 4 31  ? 35.829  23.345 -31.367 1.00 62.13  ? 58  ILE D C     1 
ATOM   2526  O  O     . ILE D 4 31  ? 34.620  23.509 -31.503 1.00 60.28  ? 58  ILE D O     1 
ATOM   2527  C  CB    . ILE D 4 31  ? 37.297  23.694 -33.452 1.00 62.30  ? 58  ILE D CB    1 
ATOM   2528  C  CG1   . ILE D 4 31  ? 37.772  24.860 -34.334 1.00 63.30  ? 58  ILE D CG1   1 
ATOM   2529  C  CG2   . ILE D 4 31  ? 36.222  22.921 -34.195 1.00 60.53  ? 58  ILE D CG2   1 
ATOM   2530  C  CD1   . ILE D 4 31  ? 39.061  24.737 -34.812 1.00 67.85  ? 58  ILE D CD1   1 
ATOM   2531  N  N     . MET D 4 32  ? 36.350  22.400 -30.566 1.00 60.28  ? 59  MET D N     1 
ATOM   2532  C  CA    . MET D 4 32  ? 35.493  21.486 -29.811 1.00 60.67  ? 59  MET D CA    1 
ATOM   2533  C  C     . MET D 4 32  ? 34.659  22.220 -28.754 1.00 66.16  ? 59  MET D C     1 
ATOM   2534  O  O     . MET D 4 32  ? 33.458  21.984 -28.666 1.00 66.41  ? 59  MET D O     1 
ATOM   2535  C  CB    . MET D 4 32  ? 36.285  20.322 -29.222 1.00 63.18  ? 59  MET D CB    1 
ATOM   2536  C  CG    . MET D 4 32  ? 36.732  19.286 -30.252 1.00 66.83  ? 59  MET D CG    1 
ATOM   2537  S  SD    . MET D 4 32  ? 35.451  18.663 -31.388 1.00 70.35  ? 59  MET D SD    1 
ATOM   2538  C  CE    . MET D 4 32  ? 34.436  17.675 -30.299 1.00 66.64  ? 59  MET D CE    1 
ATOM   2539  N  N     . ASN D 4 33  ? 35.276  23.160 -28.022 1.00 63.18  ? 60  ASN D N     1 
ATOM   2540  C  CA    . ASN D 4 33  ? 34.620  24.007 -27.027 1.00 62.85  ? 60  ASN D CA    1 
ATOM   2541  C  C     . ASN D 4 33  ? 33.577  24.937 -27.676 1.00 63.51  ? 60  ASN D C     1 
ATOM   2542  O  O     . ASN D 4 33  ? 32.477  25.100 -27.139 1.00 63.50  ? 60  ASN D O     1 
ATOM   2543  C  CB    . ASN D 4 33  ? 35.657  24.832 -26.299 1.00 66.20  ? 60  ASN D CB    1 
ATOM   2544  C  CG    . ASN D 4 33  ? 35.643  24.562 -24.841 1.00 111.97 ? 60  ASN D CG    1 
ATOM   2545  O  OD1   . ASN D 4 33  ? 34.771  25.025 -24.099 1.00 116.47 ? 60  ASN D OD1   1 
ATOM   2546  N  ND2   . ASN D 4 33  ? 36.603  23.795 -24.400 1.00 109.01 ? 60  ASN D ND2   1 
ATOM   2547  N  N     . SER D 4 34  ? 33.928  25.531 -28.837 1.00 56.89  ? 61  SER D N     1 
ATOM   2548  C  CA    . SER D 4 34  ? 33.038  26.379 -29.625 1.00 55.29  ? 61  SER D CA    1 
ATOM   2549  C  C     . SER D 4 34  ? 31.802  25.554 -30.059 1.00 57.82  ? 61  SER D C     1 
ATOM   2550  O  O     . SER D 4 34  ? 30.673  26.046 -29.960 1.00 57.48  ? 61  SER D O     1 
ATOM   2551  C  CB    . SER D 4 34  ? 33.778  26.950 -30.828 1.00 57.50  ? 61  SER D CB    1 
ATOM   2552  O  OG    . SER D 4 34  ? 34.816  27.822 -30.403 1.00 66.24  ? 61  SER D OG    1 
ATOM   2553  N  N     . PHE D 4 35  ? 32.021  24.267 -30.439 1.00 52.36  ? 62  PHE D N     1 
ATOM   2554  C  CA    . PHE D 4 35  ? 30.979  23.340 -30.857 1.00 50.59  ? 62  PHE D CA    1 
ATOM   2555  C  C     . PHE D 4 35  ? 30.010  23.028 -29.718 1.00 54.25  ? 62  PHE D C     1 
ATOM   2556  O  O     . PHE D 4 35  ? 28.802  23.107 -29.931 1.00 53.62  ? 62  PHE D O     1 
ATOM   2557  C  CB    . PHE D 4 35  ? 31.578  22.056 -31.471 1.00 51.64  ? 62  PHE D CB    1 
ATOM   2558  C  CG    . PHE D 4 35  ? 30.566  20.955 -31.685 1.00 52.84  ? 62  PHE D CG    1 
ATOM   2559  C  CD1   . PHE D 4 35  ? 29.625  21.046 -32.695 1.00 55.71  ? 62  PHE D CD1   1 
ATOM   2560  C  CD2   . PHE D 4 35  ? 30.544  19.836 -30.858 1.00 54.88  ? 62  PHE D CD2   1 
ATOM   2561  C  CE1   . PHE D 4 35  ? 28.675  20.052 -32.869 1.00 56.61  ? 62  PHE D CE1   1 
ATOM   2562  C  CE2   . PHE D 4 35  ? 29.604  18.833 -31.043 1.00 57.80  ? 62  PHE D CE2   1 
ATOM   2563  C  CZ    . PHE D 4 35  ? 28.672  18.949 -32.044 1.00 56.16  ? 62  PHE D CZ    1 
ATOM   2564  N  N     . VAL D 4 36  ? 30.536  22.678 -28.519 1.00 50.36  ? 63  VAL D N     1 
ATOM   2565  C  CA    . VAL D 4 36  ? 29.739  22.349 -27.333 1.00 49.99  ? 63  VAL D CA    1 
ATOM   2566  C  C     . VAL D 4 36  ? 28.888  23.535 -26.909 1.00 53.47  ? 63  VAL D C     1 
ATOM   2567  O  O     . VAL D 4 36  ? 27.724  23.346 -26.558 1.00 53.02  ? 63  VAL D O     1 
ATOM   2568  C  CB    . VAL D 4 36  ? 30.585  21.809 -26.159 1.00 55.04  ? 63  VAL D CB    1 
ATOM   2569  C  CG1   . VAL D 4 36  ? 29.692  21.281 -25.041 1.00 55.47  ? 63  VAL D CG1   1 
ATOM   2570  C  CG2   . VAL D 4 36  ? 31.517  20.694 -26.625 1.00 55.07  ? 63  VAL D CG2   1 
ATOM   2571  N  N     . ASN D 4 37  ? 29.450  24.754 -26.972 1.00 49.00  ? 64  ASN D N     1 
ATOM   2572  C  CA    . ASN D 4 37  ? 28.734  25.957 -26.587 1.00 49.05  ? 64  ASN D CA    1 
ATOM   2573  C  C     . ASN D 4 37  ? 27.624  26.319 -27.537 1.00 54.20  ? 64  ASN D C     1 
ATOM   2574  O  O     . ASN D 4 37  ? 26.567  26.780 -27.099 1.00 55.83  ? 64  ASN D O     1 
ATOM   2575  C  CB    . ASN D 4 37  ? 29.681  27.124 -26.380 1.00 49.89  ? 64  ASN D CB    1 
ATOM   2576  C  CG    . ASN D 4 37  ? 30.455  27.008 -25.107 1.00 81.36  ? 64  ASN D CG    1 
ATOM   2577  O  OD1   . ASN D 4 37  ? 29.919  26.633 -24.055 1.00 81.21  ? 64  ASN D OD1   1 
ATOM   2578  N  ND2   . ASN D 4 37  ? 31.736  27.325 -25.175 1.00 75.70  ? 64  ASN D ND2   1 
ATOM   2579  N  N     . ASP D 4 38  ? 27.852  26.118 -28.832 1.00 48.58  ? 65  ASP D N     1 
ATOM   2580  C  CA    . ASP D 4 38  ? 26.857  26.415 -29.849 1.00 46.45  ? 65  ASP D CA    1 
ATOM   2581  C  C     . ASP D 4 38  ? 25.640  25.499 -29.685 1.00 48.73  ? 65  ASP D C     1 
ATOM   2582  O  O     . ASP D 4 38  ? 24.530  26.000 -29.582 1.00 48.92  ? 65  ASP D O     1 
ATOM   2583  C  CB    . ASP D 4 38  ? 27.498  26.309 -31.239 1.00 47.26  ? 65  ASP D CB    1 
ATOM   2584  C  CG    . ASP D 4 38  ? 26.547  26.414 -32.396 1.00 49.85  ? 65  ASP D CG    1 
ATOM   2585  O  OD1   . ASP D 4 38  ? 25.492  27.054 -32.241 1.00 52.02  ? 65  ASP D OD1   1 
ATOM   2586  O  OD2   . ASP D 4 38  ? 26.862  25.874 -33.459 1.00 51.72  ? 65  ASP D OD2   1 
ATOM   2587  N  N     . ILE D 4 39  ? 25.856  24.176 -29.599 1.00 43.86  ? 66  ILE D N     1 
ATOM   2588  C  CA    . ILE D 4 39  ? 24.796  23.198 -29.468 1.00 43.27  ? 66  ILE D CA    1 
ATOM   2589  C  C     . ILE D 4 39  ? 24.106  23.319 -28.099 1.00 49.21  ? 66  ILE D C     1 
ATOM   2590  O  O     . ILE D 4 39  ? 22.883  23.163 -28.016 1.00 49.08  ? 66  ILE D O     1 
ATOM   2591  C  CB    . ILE D 4 39  ? 25.329  21.796 -29.806 1.00 46.34  ? 66  ILE D CB    1 
ATOM   2592  C  CG1   . ILE D 4 39  ? 26.067  21.768 -31.164 1.00 46.23  ? 66  ILE D CG1   1 
ATOM   2593  C  CG2   . ILE D 4 39  ? 24.236  20.757 -29.771 1.00 49.39  ? 66  ILE D CG2   1 
ATOM   2594  C  CD1   . ILE D 4 39  ? 25.292  22.131 -32.443 1.00 51.78  ? 66  ILE D CD1   1 
ATOM   2595  N  N     . PHE D 4 40  ? 24.851  23.674 -27.047 1.00 47.46  ? 67  PHE D N     1 
ATOM   2596  C  CA    . PHE D 4 40  ? 24.224  23.892 -25.751 1.00 48.11  ? 67  PHE D CA    1 
ATOM   2597  C  C     . PHE D 4 40  ? 23.158  24.999 -25.926 1.00 51.65  ? 67  PHE D C     1 
ATOM   2598  O  O     . PHE D 4 40  ? 21.995  24.764 -25.607 1.00 52.54  ? 67  PHE D O     1 
ATOM   2599  C  CB    . PHE D 4 40  ? 25.264  24.320 -24.699 1.00 50.60  ? 67  PHE D CB    1 
ATOM   2600  C  CG    . PHE D 4 40  ? 24.649  24.679 -23.368 1.00 53.70  ? 67  PHE D CG    1 
ATOM   2601  C  CD1   . PHE D 4 40  ? 24.378  23.698 -22.425 1.00 58.29  ? 67  PHE D CD1   1 
ATOM   2602  C  CD2   . PHE D 4 40  ? 24.331  25.997 -23.061 1.00 57.97  ? 67  PHE D CD2   1 
ATOM   2603  C  CE1   . PHE D 4 40  ? 23.805  24.024 -21.194 1.00 59.92  ? 67  PHE D CE1   1 
ATOM   2604  C  CE2   . PHE D 4 40  ? 23.717  26.318 -21.845 1.00 61.84  ? 67  PHE D CE2   1 
ATOM   2605  C  CZ    . PHE D 4 40  ? 23.456  25.324 -20.920 1.00 59.83  ? 67  PHE D CZ    1 
ATOM   2606  N  N     . GLU D 4 41  ? 23.566  26.174 -26.463 1.00 45.88  ? 68  GLU D N     1 
ATOM   2607  C  CA    . GLU D 4 41  ? 22.683  27.315 -26.699 1.00 45.85  ? 68  GLU D CA    1 
ATOM   2608  C  C     . GLU D 4 41  ? 21.534  26.927 -27.610 1.00 47.87  ? 68  GLU D C     1 
ATOM   2609  O  O     . GLU D 4 41  ? 20.389  27.181 -27.250 1.00 48.86  ? 68  GLU D O     1 
ATOM   2610  C  CB    . GLU D 4 41  ? 23.438  28.531 -27.269 1.00 47.76  ? 68  GLU D CB    1 
ATOM   2611  C  CG    . GLU D 4 41  ? 23.817  29.583 -26.228 1.00 66.94  ? 68  GLU D CG    1 
ATOM   2612  C  CD    . GLU D 4 41  ? 25.219  30.199 -26.241 1.00 104.43 ? 68  GLU D CD    1 
ATOM   2613  O  OE1   . GLU D 4 41  ? 26.045  29.854 -27.119 1.00 103.55 ? 68  GLU D OE1   1 
ATOM   2614  O  OE2   . GLU D 4 41  ? 25.490  31.042 -25.354 1.00 105.16 ? 68  GLU D OE2   1 
ATOM   2615  N  N     . ARG D 4 42  ? 21.825  26.276 -28.763 1.00 40.64  ? 69  ARG D N     1 
ATOM   2616  C  CA    . ARG D 4 42  ? 20.807  25.847 -29.719 1.00 38.59  ? 69  ARG D CA    1 
ATOM   2617  C  C     . ARG D 4 42  ? 19.703  25.032 -29.024 1.00 43.35  ? 69  ARG D C     1 
ATOM   2618  O  O     . ARG D 4 42  ? 18.518  25.359 -29.154 1.00 43.98  ? 69  ARG D O     1 
ATOM   2619  C  CB    . ARG D 4 42  ? 21.446  25.003 -30.818 1.00 33.42  ? 69  ARG D CB    1 
ATOM   2620  C  CG    . ARG D 4 42  ? 22.187  25.838 -31.821 1.00 34.85  ? 69  ARG D CG    1 
ATOM   2621  C  CD    . ARG D 4 42  ? 22.388  25.001 -33.046 1.00 36.59  ? 69  ARG D CD    1 
ATOM   2622  N  NE    . ARG D 4 42  ? 23.629  25.318 -33.742 1.00 32.43  ? 69  ARG D NE    1 
ATOM   2623  C  CZ    . ARG D 4 42  ? 23.964  24.772 -34.905 1.00 46.39  ? 69  ARG D CZ    1 
ATOM   2624  N  NH1   . ARG D 4 42  ? 23.145  23.923 -35.505 1.00 27.78  ? 69  ARG D NH1   1 
ATOM   2625  N  NH2   . ARG D 4 42  ? 25.104  25.099 -35.496 1.00 45.78  ? 69  ARG D NH2   1 
ATOM   2626  N  N     . ILE D 4 43  ? 20.091  24.000 -28.245 1.00 38.80  ? 70  ILE D N     1 
ATOM   2627  C  CA    . ILE D 4 43  ? 19.123  23.151 -27.558 1.00 37.80  ? 70  ILE D CA    1 
ATOM   2628  C  C     . ILE D 4 43  ? 18.433  23.910 -26.413 1.00 45.14  ? 70  ILE D C     1 
ATOM   2629  O  O     . ILE D 4 43  ? 17.202  23.911 -26.353 1.00 45.63  ? 70  ILE D O     1 
ATOM   2630  C  CB    . ILE D 4 43  ? 19.719  21.785 -27.133 1.00 39.63  ? 70  ILE D CB    1 
ATOM   2631  C  CG1   . ILE D 4 43  ? 20.300  21.002 -28.341 1.00 38.25  ? 70  ILE D CG1   1 
ATOM   2632  C  CG2   . ILE D 4 43  ? 18.696  20.935 -26.335 1.00 40.05  ? 70  ILE D CG2   1 
ATOM   2633  C  CD1   . ILE D 4 43  ? 21.241  19.895 -27.925 1.00 41.06  ? 70  ILE D CD1   1 
ATOM   2634  N  N     . ALA D 4 44  ? 19.210  24.588 -25.547 1.00 42.74  ? 71  ALA D N     1 
ATOM   2635  C  CA    . ALA D 4 44  ? 18.681  25.312 -24.391 1.00 42.30  ? 71  ALA D CA    1 
ATOM   2636  C  C     . ALA D 4 44  ? 17.685  26.398 -24.773 1.00 45.73  ? 71  ALA D C     1 
ATOM   2637  O  O     . ALA D 4 44  ? 16.672  26.560 -24.090 1.00 47.06  ? 71  ALA D O     1 
ATOM   2638  C  CB    . ALA D 4 44  ? 19.815  25.885 -23.573 1.00 43.21  ? 71  ALA D CB    1 
ATOM   2639  N  N     . GLY D 4 45  ? 17.959  27.088 -25.879 1.00 38.98  ? 72  GLY D N     1 
ATOM   2640  C  CA    . GLY D 4 45  ? 17.106  28.137 -26.419 1.00 36.61  ? 72  GLY D CA    1 
ATOM   2641  C  C     . GLY D 4 45  ? 15.812  27.589 -26.981 1.00 39.72  ? 72  GLY D C     1 
ATOM   2642  O  O     . GLY D 4 45  ? 14.748  28.134 -26.703 1.00 39.27  ? 72  GLY D O     1 
ATOM   2643  N  N     . GLU D 4 46  ? 15.889  26.488 -27.752 1.00 37.02  ? 73  GLU D N     1 
ATOM   2644  C  CA    . GLU D 4 46  ? 14.721  25.842 -28.347 1.00 37.21  ? 73  GLU D CA    1 
ATOM   2645  C  C     . GLU D 4 46  ? 13.782  25.310 -27.261 1.00 43.68  ? 73  GLU D C     1 
ATOM   2646  O  O     . GLU D 4 46  ? 12.562  25.460 -27.366 1.00 44.33  ? 73  GLU D O     1 
ATOM   2647  C  CB    . GLU D 4 46  ? 15.153  24.718 -29.317 1.00 38.60  ? 73  GLU D CB    1 
ATOM   2648  C  CG    . GLU D 4 46  ? 14.011  24.103 -30.122 1.00 47.66  ? 73  GLU D CG    1 
ATOM   2649  C  CD    . GLU D 4 46  ? 13.163  25.085 -30.916 1.00 62.32  ? 73  GLU D CD    1 
ATOM   2650  O  OE1   . GLU D 4 46  ? 11.987  25.291 -30.527 1.00 44.67  ? 73  GLU D OE1   1 
ATOM   2651  O  OE2   . GLU D 4 46  ? 13.671  25.649 -31.918 1.00 42.53  ? 73  GLU D OE2   1 
ATOM   2652  N  N     . ALA D 4 47  ? 14.370  24.712 -26.207 1.00 40.11  ? 74  ALA D N     1 
ATOM   2653  C  CA    . ALA D 4 47  ? 13.670  24.195 -25.047 1.00 39.57  ? 74  ALA D CA    1 
ATOM   2654  C  C     . ALA D 4 47  ? 13.047  25.339 -24.263 1.00 45.02  ? 74  ALA D C     1 
ATOM   2655  O  O     . ALA D 4 47  ? 11.963  25.170 -23.711 1.00 44.47  ? 74  ALA D O     1 
ATOM   2656  C  CB    . ALA D 4 47  ? 14.639  23.429 -24.171 1.00 40.15  ? 74  ALA D CB    1 
ATOM   2657  N  N     . SER D 4 48  ? 13.720  26.508 -24.234 1.00 42.89  ? 75  SER D N     1 
ATOM   2658  C  CA    . SER D 4 48  ? 13.252  27.709 -23.550 1.00 43.39  ? 75  SER D CA    1 
ATOM   2659  C  C     . SER D 4 48  ? 11.938  28.222 -24.182 1.00 48.62  ? 75  SER D C     1 
ATOM   2660  O  O     . SER D 4 48  ? 11.019  28.643 -23.465 1.00 48.92  ? 75  SER D O     1 
ATOM   2661  C  CB    . SER D 4 48  ? 14.341  28.778 -23.594 1.00 47.30  ? 75  SER D CB    1 
ATOM   2662  O  OG    . SER D 4 48  ? 13.868  30.064 -23.236 1.00 59.97  ? 75  SER D OG    1 
ATOM   2663  N  N     . ARG D 4 49  ? 11.876  28.176 -25.527 1.00 43.72  ? 76  ARG D N     1 
ATOM   2664  C  CA    . ARG D 4 49  ? 10.751  28.573 -26.355 1.00 42.21  ? 76  ARG D CA    1 
ATOM   2665  C  C     . ARG D 4 49  ? 9.618   27.560 -26.236 1.00 47.66  ? 76  ARG D C     1 
ATOM   2666  O  O     . ARG D 4 49  ? 8.464   27.962 -26.183 1.00 47.64  ? 76  ARG D O     1 
ATOM   2667  C  CB    . ARG D 4 49  ? 11.201  28.629 -27.805 1.00 39.78  ? 76  ARG D CB    1 
ATOM   2668  C  CG    . ARG D 4 49  ? 11.215  30.018 -28.356 1.00 43.43  ? 76  ARG D CG    1 
ATOM   2669  C  CD    . ARG D 4 49  ? 11.934  30.028 -29.664 1.00 43.38  ? 76  ARG D CD    1 
ATOM   2670  N  NE    . ARG D 4 49  ? 13.352  30.317 -29.478 1.00 52.03  ? 76  ARG D NE    1 
ATOM   2671  C  CZ    . ARG D 4 49  ? 14.335  29.602 -30.015 1.00 70.55  ? 76  ARG D CZ    1 
ATOM   2672  N  NH1   . ARG D 4 49  ? 14.061  28.534 -30.763 1.00 56.16  ? 76  ARG D NH1   1 
ATOM   2673  N  NH2   . ARG D 4 49  ? 15.603  29.951 -29.812 1.00 56.10  ? 76  ARG D NH2   1 
ATOM   2674  N  N     . LEU D 4 50  ? 9.945   26.242 -26.215 1.00 43.98  ? 77  LEU D N     1 
ATOM   2675  C  CA    . LEU D 4 50  ? 8.969   25.150 -26.094 1.00 42.68  ? 77  LEU D CA    1 
ATOM   2676  C  C     . LEU D 4 50  ? 8.150   25.310 -24.802 1.00 50.55  ? 77  LEU D C     1 
ATOM   2677  O  O     . LEU D 4 50  ? 6.915   25.296 -24.843 1.00 50.17  ? 77  LEU D O     1 
ATOM   2678  C  CB    . LEU D 4 50  ? 9.667   23.776 -26.125 1.00 40.96  ? 77  LEU D CB    1 
ATOM   2679  C  CG    . LEU D 4 50  ? 9.967   23.184 -27.496 1.00 42.56  ? 77  LEU D CG    1 
ATOM   2680  C  CD1   . LEU D 4 50  ? 11.042  22.157 -27.412 1.00 41.63  ? 77  LEU D CD1   1 
ATOM   2681  C  CD2   . LEU D 4 50  ? 8.754   22.571 -28.115 1.00 40.36  ? 77  LEU D CD2   1 
ATOM   2682  N  N     . ALA D 4 51  ? 8.847   25.524 -23.670 1.00 49.22  ? 78  ALA D N     1 
ATOM   2683  C  CA    . ALA D 4 51  ? 8.231   25.712 -22.371 1.00 50.13  ? 78  ALA D CA    1 
ATOM   2684  C  C     . ALA D 4 51  ? 7.355   26.959 -22.398 1.00 59.90  ? 78  ALA D C     1 
ATOM   2685  O  O     . ALA D 4 51  ? 6.201   26.929 -21.951 1.00 59.91  ? 78  ALA D O     1 
ATOM   2686  C  CB    . ALA D 4 51  ? 9.313   25.835 -21.312 1.00 50.70  ? 78  ALA D CB    1 
ATOM   2687  N  N     . HIS D 4 52  ? 7.881   28.030 -23.010 1.00 60.77  ? 79  HIS D N     1 
ATOM   2688  C  CA    . HIS D 4 52  ? 7.174   29.285 -23.133 1.00 62.11  ? 79  HIS D CA    1 
ATOM   2689  C  C     . HIS D 4 52  ? 5.880   29.145 -23.943 1.00 61.99  ? 79  HIS D C     1 
ATOM   2690  O  O     . HIS D 4 52  ? 4.828   29.533 -23.435 1.00 61.09  ? 79  HIS D O     1 
ATOM   2691  C  CB    . HIS D 4 52  ? 8.100   30.380 -23.669 1.00 65.30  ? 79  HIS D CB    1 
ATOM   2692  C  CG    . HIS D 4 52  ? 7.517   31.747 -23.549 1.00 70.99  ? 79  HIS D CG    1 
ATOM   2693  N  ND1   . HIS D 4 52  ? 7.284   32.328 -22.302 1.00 74.10  ? 79  HIS D ND1   1 
ATOM   2694  C  CD2   . HIS D 4 52  ? 7.076   32.589 -24.516 1.00 74.30  ? 79  HIS D CD2   1 
ATOM   2695  C  CE1   . HIS D 4 52  ? 6.745   33.521 -22.552 1.00 74.01  ? 79  HIS D CE1   1 
ATOM   2696  N  NE2   . HIS D 4 52  ? 6.605   33.731 -23.869 1.00 74.31  ? 79  HIS D NE2   1 
ATOM   2697  N  N     . TYR D 4 53  ? 5.943   28.530 -25.152 1.00 57.10  ? 80  TYR D N     1 
ATOM   2698  C  CA    . TYR D 4 53  ? 4.797   28.299 -26.050 1.00 56.64  ? 80  TYR D CA    1 
ATOM   2699  C  C     . TYR D 4 53  ? 3.679   27.610 -25.342 1.00 62.12  ? 80  TYR D C     1 
ATOM   2700  O  O     . TYR D 4 53  ? 2.518   27.961 -25.549 1.00 62.64  ? 80  TYR D O     1 
ATOM   2701  C  CB    . TYR D 4 53  ? 5.173   27.386 -27.233 1.00 57.44  ? 80  TYR D CB    1 
ATOM   2702  C  CG    . TYR D 4 53  ? 6.188   27.945 -28.199 1.00 60.70  ? 80  TYR D CG    1 
ATOM   2703  C  CD1   . TYR D 4 53  ? 6.335   29.324 -28.379 1.00 60.75  ? 80  TYR D CD1   1 
ATOM   2704  C  CD2   . TYR D 4 53  ? 6.962   27.100 -28.989 1.00 62.25  ? 80  TYR D CD2   1 
ATOM   2705  C  CE1   . TYR D 4 53  ? 7.248   29.840 -29.290 1.00 58.07  ? 80  TYR D CE1   1 
ATOM   2706  C  CE2   . TYR D 4 53  ? 7.865   27.610 -29.922 1.00 63.30  ? 80  TYR D CE2   1 
ATOM   2707  C  CZ    . TYR D 4 53  ? 7.998   28.979 -30.072 1.00 68.22  ? 80  TYR D CZ    1 
ATOM   2708  O  OH    . TYR D 4 53  ? 8.901   29.475 -30.979 1.00 73.80  ? 80  TYR D OH    1 
ATOM   2709  N  N     . ASN D 4 54  ? 4.039   26.596 -24.527 1.00 58.45  ? 81  ASN D N     1 
ATOM   2710  C  CA    . ASN D 4 54  ? 3.121   25.729 -23.828 1.00 58.19  ? 81  ASN D CA    1 
ATOM   2711  C  C     . ASN D 4 54  ? 2.758   26.240 -22.412 1.00 62.10  ? 81  ASN D C     1 
ATOM   2712  O  O     . ASN D 4 54  ? 2.195   25.489 -21.604 1.00 63.13  ? 81  ASN D O     1 
ATOM   2713  C  CB    . ASN D 4 54  ? 3.681   24.291 -23.845 1.00 62.23  ? 81  ASN D CB    1 
ATOM   2714  C  CG    . ASN D 4 54  ? 3.790   23.711 -25.260 1.00 80.75  ? 81  ASN D CG    1 
ATOM   2715  O  OD1   . ASN D 4 54  ? 2.785   23.491 -25.950 1.00 79.55  ? 81  ASN D OD1   1 
ATOM   2716  N  ND2   . ASN D 4 54  ? 5.007   23.465 -25.745 1.00 62.79  ? 81  ASN D ND2   1 
ATOM   2717  N  N     . LYS D 4 55  ? 3.024   27.534 -22.148 1.00 58.14  ? 82  LYS D N     1 
ATOM   2718  C  CA    . LYS D 4 55  ? 2.732   28.262 -20.901 1.00 58.28  ? 82  LYS D CA    1 
ATOM   2719  C  C     . LYS D 4 55  ? 3.253   27.517 -19.655 1.00 64.65  ? 82  LYS D C     1 
ATOM   2720  O  O     . LYS D 4 55  ? 2.633   27.555 -18.587 1.00 65.36  ? 82  LYS D O     1 
ATOM   2721  C  CB    . LYS D 4 55  ? 1.219   28.595 -20.788 1.00 59.75  ? 82  LYS D CB    1 
ATOM   2722  C  CG    . LYS D 4 55  ? 0.704   29.680 -21.728 1.00 67.73  ? 82  LYS D CG    1 
ATOM   2723  C  CD    . LYS D 4 55  ? -0.716  29.363 -22.232 1.00 77.39  ? 82  LYS D CD    1 
ATOM   2724  C  CE    . LYS D 4 55  ? -1.693  30.517 -22.134 1.00 91.42  ? 82  LYS D CE    1 
ATOM   2725  N  NZ    . LYS D 4 55  ? -2.257  30.685 -20.764 1.00 98.89  ? 82  LYS D NZ    1 
ATOM   2726  N  N     . ARG D 4 56  ? 4.387   26.827 -19.806 1.00 61.98  ? 83  ARG D N     1 
ATOM   2727  C  CA    . ARG D 4 56  ? 4.985   26.033 -18.742 1.00 62.29  ? 83  ARG D CA    1 
ATOM   2728  C  C     . ARG D 4 56  ? 6.273   26.664 -18.250 1.00 68.85  ? 83  ARG D C     1 
ATOM   2729  O  O     . ARG D 4 56  ? 7.188   26.891 -19.031 1.00 70.61  ? 83  ARG D O     1 
ATOM   2730  C  CB    . ARG D 4 56  ? 5.141   24.570 -19.172 1.00 62.42  ? 83  ARG D CB    1 
ATOM   2731  C  CG    . ARG D 4 56  ? 3.862   23.761 -18.902 1.00 81.79  ? 83  ARG D CG    1 
ATOM   2732  C  CD    . ARG D 4 56  ? 4.035   22.246 -18.990 1.00 105.28 ? 83  ARG D CD    1 
ATOM   2733  N  NE    . ARG D 4 56  ? 4.678   21.634 -17.818 1.00 123.82 ? 83  ARG D NE    1 
ATOM   2734  C  CZ    . ARG D 4 56  ? 5.994   21.458 -17.665 1.00 144.85 ? 83  ARG D CZ    1 
ATOM   2735  N  NH1   . ARG D 4 56  ? 6.845   21.893 -18.594 1.00 128.60 ? 83  ARG D NH1   1 
ATOM   2736  N  NH2   . ARG D 4 56  ? 6.470   20.871 -16.574 1.00 136.84 ? 83  ARG D NH2   1 
ATOM   2737  N  N     . SER D 4 57  ? 6.306   27.007 -16.954 1.00 64.49  ? 84  SER D N     1 
ATOM   2738  C  CA    . SER D 4 57  ? 7.382   27.690 -16.235 1.00 63.04  ? 84  SER D CA    1 
ATOM   2739  C  C     . SER D 4 57  ? 8.752   26.931 -16.093 1.00 64.96  ? 84  SER D C     1 
ATOM   2740  O  O     . SER D 4 57  ? 9.729   27.566 -15.712 1.00 65.01  ? 84  SER D O     1 
ATOM   2741  C  CB    . SER D 4 57  ? 6.860   28.076 -14.858 1.00 66.21  ? 84  SER D CB    1 
ATOM   2742  O  OG    . SER D 4 57  ? 7.862   28.693 -14.075 1.00 78.99  ? 84  SER D OG    1 
ATOM   2743  N  N     . THR D 4 58  ? 8.835   25.620 -16.408 1.00 59.80  ? 85  THR D N     1 
ATOM   2744  C  CA    . THR D 4 58  ? 10.059  24.805 -16.239 1.00 58.90  ? 85  THR D CA    1 
ATOM   2745  C  C     . THR D 4 58  ? 10.555  24.143 -17.550 1.00 62.33  ? 85  THR D C     1 
ATOM   2746  O  O     . THR D 4 58  ? 9.725   23.690 -18.359 1.00 63.14  ? 85  THR D O     1 
ATOM   2747  C  CB    . THR D 4 58  ? 9.792   23.658 -15.186 1.00 61.57  ? 85  THR D CB    1 
ATOM   2748  O  OG1   . THR D 4 58  ? 9.119   24.153 -14.034 1.00 61.44  ? 85  THR D OG1   1 
ATOM   2749  C  CG2   . THR D 4 58  ? 11.054  22.915 -14.745 1.00 57.40  ? 85  THR D CG2   1 
ATOM   2750  N  N     . ILE D 4 59  ? 11.914  24.011 -17.709 1.00 56.13  ? 86  ILE D N     1 
ATOM   2751  C  CA    . ILE D 4 59  ? 12.547  23.257 -18.804 1.00 54.05  ? 86  ILE D CA    1 
ATOM   2752  C  C     . ILE D 4 59  ? 12.861  21.900 -18.205 1.00 57.29  ? 86  ILE D C     1 
ATOM   2753  O  O     . ILE D 4 59  ? 13.653  21.812 -17.260 1.00 56.36  ? 86  ILE D O     1 
ATOM   2754  C  CB    . ILE D 4 59  ? 13.817  23.909 -19.428 1.00 55.94  ? 86  ILE D CB    1 
ATOM   2755  C  CG1   . ILE D 4 59  ? 13.438  25.120 -20.292 1.00 56.26  ? 86  ILE D CG1   1 
ATOM   2756  C  CG2   . ILE D 4 59  ? 14.616  22.888 -20.258 1.00 53.23  ? 86  ILE D CG2   1 
ATOM   2757  C  CD1   . ILE D 4 59  ? 14.559  26.014 -20.606 1.00 57.95  ? 86  ILE D CD1   1 
ATOM   2758  N  N     . THR D 4 60  ? 12.214  20.853 -18.741 1.00 53.30  ? 87  THR D N     1 
ATOM   2759  C  CA    . THR D 4 60  ? 12.406  19.472 -18.311 1.00 52.82  ? 87  THR D CA    1 
ATOM   2760  C  C     . THR D 4 60  ? 13.104  18.667 -19.417 1.00 54.50  ? 87  THR D C     1 
ATOM   2761  O  O     . THR D 4 60  ? 13.404  19.205 -20.482 1.00 51.70  ? 87  THR D O     1 
ATOM   2762  C  CB    . THR D 4 60  ? 11.069  18.847 -17.842 1.00 60.38  ? 87  THR D CB    1 
ATOM   2763  O  OG1   . THR D 4 60  ? 10.215  18.603 -18.966 1.00 59.66  ? 87  THR D OG1   1 
ATOM   2764  C  CG2   . THR D 4 60  ? 10.358  19.689 -16.766 1.00 56.34  ? 87  THR D CG2   1 
ATOM   2765  N  N     . SER D 4 61  ? 13.376  17.383 -19.152 1.00 52.94  ? 88  SER D N     1 
ATOM   2766  C  CA    . SER D 4 61  ? 14.002  16.469 -20.113 1.00 52.94  ? 88  SER D CA    1 
ATOM   2767  C  C     . SER D 4 61  ? 13.120  16.317 -21.359 1.00 55.85  ? 88  SER D C     1 
ATOM   2768  O  O     . SER D 4 61  ? 13.627  16.067 -22.448 1.00 54.55  ? 88  SER D O     1 
ATOM   2769  C  CB    . SER D 4 61  ? 14.315  15.123 -19.469 1.00 55.46  ? 88  SER D CB    1 
ATOM   2770  O  OG    . SER D 4 61  ? 13.587  14.976 -18.260 1.00 68.39  ? 88  SER D OG    1 
ATOM   2771  N  N     . ARG D 4 62  ? 11.820  16.561 -21.202 1.00 52.18  ? 89  ARG D N     1 
ATOM   2772  C  CA    . ARG D 4 62  ? 10.853  16.528 -22.279 1.00 51.85  ? 89  ARG D CA    1 
ATOM   2773  C  C     . ARG D 4 62  ? 11.047  17.729 -23.230 1.00 53.68  ? 89  ARG D C     1 
ATOM   2774  O  O     . ARG D 4 62  ? 10.858  17.588 -24.440 1.00 54.02  ? 89  ARG D O     1 
ATOM   2775  C  CB    . ARG D 4 62  ? 9.434   16.486 -21.712 1.00 54.71  ? 89  ARG D CB    1 
ATOM   2776  C  CG    . ARG D 4 62  ? 8.369   16.304 -22.786 1.00 65.86  ? 89  ARG D CG    1 
ATOM   2777  C  CD    . ARG D 4 62  ? 7.121   15.675 -22.243 1.00 76.16  ? 89  ARG D CD    1 
ATOM   2778  N  NE    . ARG D 4 62  ? 6.211   15.346 -23.330 1.00 79.05  ? 89  ARG D NE    1 
ATOM   2779  C  CZ    . ARG D 4 62  ? 5.294   16.178 -23.793 1.00 92.27  ? 89  ARG D CZ    1 
ATOM   2780  N  NH1   . ARG D 4 62  ? 5.158   17.389 -23.257 1.00 73.67  ? 89  ARG D NH1   1 
ATOM   2781  N  NH2   . ARG D 4 62  ? 4.496   15.809 -24.785 1.00 82.40  ? 89  ARG D NH2   1 
ATOM   2782  N  N     . GLU D 4 63  ? 11.422  18.898 -22.692 1.00 47.02  ? 90  GLU D N     1 
ATOM   2783  C  CA    . GLU D 4 63  ? 11.705  20.080 -23.503 1.00 44.97  ? 90  GLU D CA    1 
ATOM   2784  C  C     . GLU D 4 63  ? 13.039  19.887 -24.248 1.00 46.23  ? 90  GLU D C     1 
ATOM   2785  O  O     . GLU D 4 63  ? 13.118  20.187 -25.435 1.00 45.39  ? 90  GLU D O     1 
ATOM   2786  C  CB    . GLU D 4 63  ? 11.714  21.352 -22.644 1.00 46.27  ? 90  GLU D CB    1 
ATOM   2787  C  CG    . GLU D 4 63  ? 10.337  21.965 -22.465 1.00 54.52  ? 90  GLU D CG    1 
ATOM   2788  C  CD    . GLU D 4 63  ? 9.390   21.318 -21.473 1.00 73.15  ? 90  GLU D CD    1 
ATOM   2789  O  OE1   . GLU D 4 63  ? 8.169   21.568 -21.592 1.00 68.21  ? 90  GLU D OE1   1 
ATOM   2790  O  OE2   . GLU D 4 63  ? 9.859   20.633 -20.544 1.00 68.89  ? 90  GLU D OE2   1 
ATOM   2791  N  N     . ILE D 4 64  ? 14.064  19.328 -23.559 1.00 42.44  ? 91  ILE D N     1 
ATOM   2792  C  CA    . ILE D 4 64  ? 15.382  18.966 -24.117 1.00 41.38  ? 91  ILE D CA    1 
ATOM   2793  C  C     . ILE D 4 64  ? 15.151  17.951 -25.247 1.00 44.07  ? 91  ILE D C     1 
ATOM   2794  O  O     . ILE D 4 64  ? 15.694  18.140 -26.333 1.00 44.08  ? 91  ILE D O     1 
ATOM   2795  C  CB    . ILE D 4 64  ? 16.377  18.413 -23.030 1.00 43.60  ? 91  ILE D CB    1 
ATOM   2796  C  CG1   . ILE D 4 64  ? 16.541  19.386 -21.834 1.00 43.67  ? 91  ILE D CG1   1 
ATOM   2797  C  CG2   . ILE D 4 64  ? 17.743  18.062 -23.626 1.00 43.18  ? 91  ILE D CG2   1 
ATOM   2798  C  CD1   . ILE D 4 64  ? 17.197  20.842 -22.163 1.00 48.41  ? 91  ILE D CD1   1 
ATOM   2799  N  N     . GLN D 4 65  ? 14.302  16.917 -24.983 1.00 38.77  ? 92  GLN D N     1 
ATOM   2800  C  CA    . GLN D 4 65  ? 13.899  15.873 -25.925 1.00 39.25  ? 92  GLN D CA    1 
ATOM   2801  C  C     . GLN D 4 65  ? 13.461  16.451 -27.279 1.00 44.01  ? 92  GLN D C     1 
ATOM   2802  O  O     . GLN D 4 65  ? 14.058  16.134 -28.312 1.00 45.06  ? 92  GLN D O     1 
ATOM   2803  C  CB    . GLN D 4 65  ? 12.674  15.098 -25.395 1.00 41.06  ? 92  GLN D CB    1 
ATOM   2804  C  CG    . GLN D 4 65  ? 12.933  13.741 -24.793 1.00 65.44  ? 92  GLN D CG    1 
ATOM   2805  C  CD    . GLN D 4 65  ? 12.576  12.536 -25.619 1.00 69.63  ? 92  GLN D CD    1 
ATOM   2806  O  OE1   . GLN D 4 65  ? 11.660  12.513 -26.455 1.00 72.05  ? 92  GLN D OE1   1 
ATOM   2807  N  NE2   . GLN D 4 65  ? 13.295  11.490 -25.350 1.00 38.19  ? 92  GLN D NE2   1 
ATOM   2808  N  N     . THR D 4 66  ? 12.372  17.242 -27.285 1.00 38.32  ? 93  THR D N     1 
ATOM   2809  C  CA    . THR D 4 66  ? 11.803  17.677 -28.541 1.00 37.98  ? 93  THR D CA    1 
ATOM   2810  C  C     . THR D 4 66  ? 12.653  18.761 -29.199 1.00 41.25  ? 93  THR D C     1 
ATOM   2811  O  O     . THR D 4 66  ? 12.602  18.884 -30.417 1.00 40.65  ? 93  THR D O     1 
ATOM   2812  C  CB    . THR D 4 66  ? 10.328  18.011 -28.412 1.00 48.87  ? 93  THR D CB    1 
ATOM   2813  O  OG1   . THR D 4 66  ? 10.185  19.035 -27.471 1.00 48.97  ? 93  THR D OG1   1 
ATOM   2814  C  CG2   . THR D 4 66  ? 9.502   16.808 -27.973 1.00 50.53  ? 93  THR D CG2   1 
ATOM   2815  N  N     . ALA D 4 67  ? 13.515  19.465 -28.429 1.00 37.55  ? 94  ALA D N     1 
ATOM   2816  C  CA    . ALA D 4 67  ? 14.440  20.459 -28.970 1.00 35.60  ? 94  ALA D CA    1 
ATOM   2817  C  C     . ALA D 4 67  ? 15.468  19.712 -29.835 1.00 38.48  ? 94  ALA D C     1 
ATOM   2818  O  O     . ALA D 4 67  ? 15.747  20.139 -30.954 1.00 37.78  ? 94  ALA D O     1 
ATOM   2819  C  CB    . ALA D 4 67  ? 15.135  21.192 -27.845 1.00 35.75  ? 94  ALA D CB    1 
ATOM   2820  N  N     . VAL D 4 68  ? 15.973  18.561 -29.327 1.00 33.98  ? 95  VAL D N     1 
ATOM   2821  C  CA    . VAL D 4 68  ? 16.945  17.669 -29.975 1.00 34.36  ? 95  VAL D CA    1 
ATOM   2822  C  C     . VAL D 4 68  ? 16.307  17.126 -31.268 1.00 42.78  ? 95  VAL D C     1 
ATOM   2823  O  O     . VAL D 4 68  ? 16.935  17.136 -32.333 1.00 43.96  ? 95  VAL D O     1 
ATOM   2824  C  CB    . VAL D 4 68  ? 17.369  16.530 -29.008 1.00 36.69  ? 95  VAL D CB    1 
ATOM   2825  C  CG1   . VAL D 4 68  ? 18.044  15.383 -29.755 1.00 36.26  ? 95  VAL D CG1   1 
ATOM   2826  C  CG2   . VAL D 4 68  ? 18.268  17.066 -27.895 1.00 35.91  ? 95  VAL D CG2   1 
ATOM   2827  N  N     . ARG D 4 69  ? 15.036  16.697 -31.161 1.00 39.02  ? 96  ARG D N     1 
ATOM   2828  C  CA    . ARG D 4 69  ? 14.238  16.208 -32.273 1.00 38.02  ? 96  ARG D CA    1 
ATOM   2829  C  C     . ARG D 4 69  ? 14.096  17.287 -33.361 1.00 38.67  ? 96  ARG D C     1 
ATOM   2830  O  O     . ARG D 4 69  ? 14.079  16.967 -34.548 1.00 40.11  ? 96  ARG D O     1 
ATOM   2831  C  CB    . ARG D 4 69  ? 12.854  15.795 -31.764 1.00 39.86  ? 96  ARG D CB    1 
ATOM   2832  C  CG    . ARG D 4 69  ? 12.818  14.425 -31.119 1.00 63.87  ? 96  ARG D CG    1 
ATOM   2833  C  CD    . ARG D 4 69  ? 11.668  13.567 -31.652 1.00 95.59  ? 96  ARG D CD    1 
ATOM   2834  N  NE    . ARG D 4 69  ? 10.353  13.939 -31.093 1.00 119.43 ? 96  ARG D NE    1 
ATOM   2835  C  CZ    . ARG D 4 69  ? 9.207   13.985 -31.776 1.00 135.85 ? 96  ARG D CZ    1 
ATOM   2836  N  NH1   . ARG D 4 69  ? 9.178   13.677 -33.069 1.00 122.31 ? 96  ARG D NH1   1 
ATOM   2837  N  NH2   . ARG D 4 69  ? 8.085   14.362 -31.175 1.00 120.81 ? 96  ARG D NH2   1 
ATOM   2838  N  N     . LEU D 4 70  ? 14.009  18.563 -32.951 1.00 30.34  ? 97  LEU D N     1 
ATOM   2839  C  CA    . LEU D 4 70  ? 13.873  19.686 -33.887 1.00 27.15  ? 97  LEU D CA    1 
ATOM   2840  C  C     . LEU D 4 70  ? 15.202  20.122 -34.489 1.00 33.16  ? 97  LEU D C     1 
ATOM   2841  O  O     . LEU D 4 70  ? 15.238  20.496 -35.667 1.00 31.83  ? 97  LEU D O     1 
ATOM   2842  C  CB    . LEU D 4 70  ? 13.220  20.914 -33.213 1.00 24.41  ? 97  LEU D CB    1 
ATOM   2843  C  CG    . LEU D 4 70  ? 11.769  20.814 -32.802 1.00 24.17  ? 97  LEU D CG    1 
ATOM   2844  C  CD1   . LEU D 4 70  ? 11.443  21.888 -31.818 1.00 23.72  ? 97  LEU D CD1   1 
ATOM   2845  C  CD2   . LEU D 4 70  ? 10.801  20.756 -34.014 1.00 21.01  ? 97  LEU D CD2   1 
ATOM   2846  N  N     . LEU D 4 71  ? 16.253  20.062 -33.684 1.00 32.25  ? 98  LEU D N     1 
ATOM   2847  C  CA    . LEU D 4 71  ? 17.564  20.623 -34.076 1.00 34.88  ? 98  LEU D CA    1 
ATOM   2848  C  C     . LEU D 4 71  ? 18.529  19.618 -34.685 1.00 38.84  ? 98  LEU D C     1 
ATOM   2849  O  O     . LEU D 4 71  ? 19.248  20.016 -35.586 1.00 39.29  ? 98  LEU D O     1 
ATOM   2850  C  CB    . LEU D 4 71  ? 18.166  21.311 -32.852 1.00 36.22  ? 98  LEU D CB    1 
ATOM   2851  C  CG    . LEU D 4 71  ? 17.592  22.701 -32.596 1.00 41.96  ? 98  LEU D CG    1 
ATOM   2852  C  CD1   . LEU D 4 71  ? 17.274  22.925 -31.140 1.00 42.63  ? 98  LEU D CD1   1 
ATOM   2853  C  CD2   . LEU D 4 71  ? 18.499  23.778 -33.137 1.00 43.87  ? 98  LEU D CD2   1 
ATOM   2854  N  N     . LEU D 4 72  ? 18.528  18.378 -34.183 1.00 35.16  ? 99  LEU D N     1 
ATOM   2855  C  CA    . LEU D 4 72  ? 19.457  17.312 -34.651 1.00 33.34  ? 99  LEU D CA    1 
ATOM   2856  C  C     . LEU D 4 72  ? 19.001  16.743 -36.000 1.00 39.75  ? 99  LEU D C     1 
ATOM   2857  O  O     . LEU D 4 72  ? 17.840  16.979 -36.390 1.00 39.84  ? 99  LEU D O     1 
ATOM   2858  C  CB    . LEU D 4 72  ? 19.526  16.212 -33.586 1.00 31.90  ? 99  LEU D CB    1 
ATOM   2859  C  CG    . LEU D 4 72  ? 20.493  16.474 -32.433 1.00 34.49  ? 99  LEU D CG    1 
ATOM   2860  C  CD1   . LEU D 4 72  ? 21.533  15.368 -32.337 1.00 34.60  ? 99  LEU D CD1   1 
ATOM   2861  C  CD2   . LEU D 4 72  ? 21.169  17.827 -32.589 1.00 37.81  ? 99  LEU D CD2   1 
ATOM   2862  N  N     . PRO D 4 73  ? 19.865  15.985 -36.714 1.00 38.33  ? 100 PRO D N     1 
ATOM   2863  C  CA    . PRO D 4 73  ? 19.527  15.401 -38.017 1.00 39.66  ? 100 PRO D CA    1 
ATOM   2864  C  C     . PRO D 4 73  ? 18.658  14.137 -37.920 1.00 51.17  ? 100 PRO D C     1 
ATOM   2865  O  O     . PRO D 4 73  ? 18.354  13.703 -36.822 1.00 51.68  ? 100 PRO D O     1 
ATOM   2866  C  CB    . PRO D 4 73  ? 20.888  15.021 -38.627 1.00 40.94  ? 100 PRO D CB    1 
ATOM   2867  C  CG    . PRO D 4 73  ? 21.926  15.590 -37.676 1.00 44.84  ? 100 PRO D CG    1 
ATOM   2868  C  CD    . PRO D 4 73  ? 21.238  15.668 -36.330 1.00 39.98  ? 100 PRO D CD    1 
ATOM   2869  N  N     . GLY D 4 74  ? 18.303  13.572 -39.078 1.00 51.89  ? 101 GLY D N     1 
ATOM   2870  C  CA    . GLY D 4 74  ? 17.458  12.364 -39.152 1.00 52.83  ? 101 GLY D CA    1 
ATOM   2871  C  C     . GLY D 4 74  ? 17.961  11.241 -38.260 1.00 59.40  ? 101 GLY D C     1 
ATOM   2872  O  O     . GLY D 4 74  ? 17.140  10.680 -37.507 1.00 61.15  ? 101 GLY D O     1 
ATOM   2873  N  N     . GLU D 4 75  ? 19.257  10.920 -38.336 1.00 54.61  ? 102 GLU D N     1 
ATOM   2874  C  CA    . GLU D 4 75  ? 19.824  9.813  -37.519 1.00 53.76  ? 102 GLU D CA    1 
ATOM   2875  C  C     . GLU D 4 75  ? 20.531  10.301 -36.262 1.00 55.22  ? 102 GLU D C     1 
ATOM   2876  O  O     . GLU D 4 75  ? 20.513  9.585  -35.296 1.00 55.36  ? 102 GLU D O     1 
ATOM   2877  C  CB    . GLU D 4 75  ? 20.775  8.956  -38.346 1.00 55.62  ? 102 GLU D CB    1 
ATOM   2878  C  CG    . GLU D 4 75  ? 20.069  7.881  -39.146 1.00 68.01  ? 102 GLU D CG    1 
ATOM   2879  C  CD    . GLU D 4 75  ? 19.125  7.006  -38.351 1.00 84.85  ? 102 GLU D CD    1 
ATOM   2880  O  OE1   . GLU D 4 75  ? 17.926  7.030  -38.637 1.00 73.59  ? 102 GLU D OE1   1 
ATOM   2881  O  OE2   . GLU D 4 75  ? 19.597  6.305  -37.461 1.00 78.17  ? 102 GLU D OE2   1 
ATOM   2882  N  N     . LEU D 4 76  ? 21.138  11.478 -36.265 1.00 50.39  ? 103 LEU D N     1 
ATOM   2883  C  CA    . LEU D 4 76  ? 21.803  11.935 -35.024 1.00 49.05  ? 103 LEU D CA    1 
ATOM   2884  C  C     . LEU D 4 76  ? 20.753  12.139 -33.935 1.00 53.28  ? 103 LEU D C     1 
ATOM   2885  O  O     . LEU D 4 76  ? 21.060  11.874 -32.793 1.00 53.14  ? 103 LEU D O     1 
ATOM   2886  C  CB    . LEU D 4 76  ? 22.501  13.260 -35.307 1.00 48.42  ? 103 LEU D CB    1 
ATOM   2887  C  CG    . LEU D 4 76  ? 23.988  13.187 -35.610 1.00 52.27  ? 103 LEU D CG    1 
ATOM   2888  C  CD1   . LEU D 4 76  ? 24.271  12.087 -36.606 1.00 52.74  ? 103 LEU D CD1   1 
ATOM   2889  C  CD2   . LEU D 4 76  ? 24.455  14.513 -36.157 1.00 53.05  ? 103 LEU D CD2   1 
ATOM   2890  N  N     . ALA D 4 77  ? 19.582  12.665 -34.284 1.00 50.51  ? 104 ALA D N     1 
ATOM   2891  C  CA    . ALA D 4 77  ? 18.505  12.922 -33.305 1.00 50.86  ? 104 ALA D CA    1 
ATOM   2892  C  C     . ALA D 4 77  ? 18.010  11.601 -32.736 1.00 56.88  ? 104 ALA D C     1 
ATOM   2893  O  O     . ALA D 4 77  ? 17.548  11.562 -31.613 1.00 57.89  ? 104 ALA D O     1 
ATOM   2894  C  CB    . ALA D 4 77  ? 17.388  13.657 -33.988 1.00 51.41  ? 104 ALA D CB    1 
ATOM   2895  N  N     . LYS D 4 78  ? 18.083  10.565 -33.542 1.00 53.47  ? 105 LYS D N     1 
ATOM   2896  C  CA    . LYS D 4 78  ? 17.645  9.228  -33.157 1.00 54.31  ? 105 LYS D CA    1 
ATOM   2897  C  C     . LYS D 4 78  ? 18.534  8.688  -32.057 1.00 60.01  ? 105 LYS D C     1 
ATOM   2898  O  O     . LYS D 4 78  ? 18.038  8.146  -31.074 1.00 59.60  ? 105 LYS D O     1 
ATOM   2899  C  CB    . LYS D 4 78  ? 17.713  8.307  -34.386 1.00 56.70  ? 105 LYS D CB    1 
ATOM   2900  C  CG    . LYS D 4 78  ? 16.614  7.275  -34.508 1.00 71.99  ? 105 LYS D CG    1 
ATOM   2901  C  CD    . LYS D 4 78  ? 16.929  6.316  -35.661 1.00 85.36  ? 105 LYS D CD    1 
ATOM   2902  C  CE    . LYS D 4 78  ? 16.525  4.871  -35.416 1.00 99.02  ? 105 LYS D CE    1 
ATOM   2903  N  NZ    . LYS D 4 78  ? 17.392  3.939  -36.177 1.00 100.14 ? 105 LYS D NZ    1 
ATOM   2904  N  N     . HIS D 4 79  ? 19.844  8.849  -32.221 1.00 58.84  ? 106 HIS D N     1 
ATOM   2905  C  CA    . HIS D 4 79  ? 20.836  8.372  -31.269 1.00 59.65  ? 106 HIS D CA    1 
ATOM   2906  C  C     . HIS D 4 79  ? 20.987  9.268  -30.062 1.00 59.21  ? 106 HIS D C     1 
ATOM   2907  O  O     . HIS D 4 79  ? 21.202  8.765  -28.971 1.00 58.53  ? 106 HIS D O     1 
ATOM   2908  C  CB    . HIS D 4 79  ? 22.187  8.142  -31.951 1.00 62.03  ? 106 HIS D CB    1 
ATOM   2909  C  CG    . HIS D 4 79  ? 22.188  7.051  -32.985 1.00 66.08  ? 106 HIS D CG    1 
ATOM   2910  N  ND1   . HIS D 4 79  ? 22.490  7.313  -34.311 1.00 68.47  ? 106 HIS D ND1   1 
ATOM   2911  C  CD2   . HIS D 4 79  ? 21.939  5.729  -32.849 1.00 68.67  ? 106 HIS D CD2   1 
ATOM   2912  C  CE1   . HIS D 4 79  ? 22.403  6.152  -34.938 1.00 68.20  ? 106 HIS D CE1   1 
ATOM   2913  N  NE2   . HIS D 4 79  ? 22.066  5.169  -34.102 1.00 68.87  ? 106 HIS D NE2   1 
ATOM   2914  N  N     . ALA D 4 80  ? 20.898  10.579 -30.248 1.00 54.65  ? 107 ALA D N     1 
ATOM   2915  C  CA    . ALA D 4 80  ? 21.000  11.565 -29.164 1.00 53.88  ? 107 ALA D CA    1 
ATOM   2916  C  C     . ALA D 4 80  ? 19.835  11.401 -28.165 1.00 58.04  ? 107 ALA D C     1 
ATOM   2917  O  O     . ALA D 4 80  ? 20.052  11.422 -26.955 1.00 57.15  ? 107 ALA D O     1 
ATOM   2918  C  CB    . ALA D 4 80  ? 21.020  12.970 -29.738 1.00 54.26  ? 107 ALA D CB    1 
ATOM   2919  N  N     . VAL D 4 81  ? 18.615  11.164 -28.684 1.00 55.82  ? 108 VAL D N     1 
ATOM   2920  C  CA    . VAL D 4 81  ? 17.410  10.900 -27.901 1.00 55.58  ? 108 VAL D CA    1 
ATOM   2921  C  C     . VAL D 4 81  ? 17.588  9.577  -27.105 1.00 62.32  ? 108 VAL D C     1 
ATOM   2922  O  O     . VAL D 4 81  ? 17.214  9.494  -25.931 1.00 61.00  ? 108 VAL D O     1 
ATOM   2923  C  CB    . VAL D 4 81  ? 16.148  10.934 -28.804 1.00 57.43  ? 108 VAL D CB    1 
ATOM   2924  C  CG1   . VAL D 4 81  ? 14.973  10.173 -28.188 1.00 56.56  ? 108 VAL D CG1   1 
ATOM   2925  C  CG2   . VAL D 4 81  ? 15.764  12.370 -29.120 1.00 56.79  ? 108 VAL D CG2   1 
ATOM   2926  N  N     . SER D 4 82  ? 18.245  8.591  -27.731 1.00 62.48  ? 109 SER D N     1 
ATOM   2927  C  CA    . SER D 4 82  ? 18.534  7.311  -27.098 1.00 64.42  ? 109 SER D CA    1 
ATOM   2928  C  C     . SER D 4 82  ? 19.537  7.545  -25.969 1.00 71.28  ? 109 SER D C     1 
ATOM   2929  O  O     . SER D 4 82  ? 19.216  7.242  -24.824 1.00 70.70  ? 109 SER D O     1 
ATOM   2930  C  CB    . SER D 4 82  ? 19.011  6.289  -28.131 1.00 68.58  ? 109 SER D CB    1 
ATOM   2931  O  OG    . SER D 4 82  ? 19.989  5.382  -27.651 1.00 80.80  ? 109 SER D OG    1 
ATOM   2932  N  N     . GLU D 4 83  ? 20.684  8.192  -26.261 1.00 69.43  ? 110 GLU D N     1 
ATOM   2933  C  CA    . GLU D 4 83  ? 21.716  8.446  -25.255 1.00 69.20  ? 110 GLU D CA    1 
ATOM   2934  C  C     . GLU D 4 83  ? 21.226  9.305  -24.099 1.00 69.63  ? 110 GLU D C     1 
ATOM   2935  O  O     . GLU D 4 83  ? 21.590  9.032  -22.954 1.00 69.05  ? 110 GLU D O     1 
ATOM   2936  C  CB    . GLU D 4 83  ? 23.004  8.996  -25.870 1.00 71.10  ? 110 GLU D CB    1 
ATOM   2937  C  CG    . GLU D 4 83  ? 24.154  8.009  -25.689 1.00 91.41  ? 110 GLU D CG    1 
ATOM   2938  C  CD    . GLU D 4 83  ? 24.735  7.942  -24.283 1.00 136.27 ? 110 GLU D CD    1 
ATOM   2939  O  OE1   . GLU D 4 83  ? 25.473  8.878  -23.894 1.00 148.06 ? 110 GLU D OE1   1 
ATOM   2940  O  OE2   . GLU D 4 83  ? 24.453  6.953  -23.567 1.00 136.28 ? 110 GLU D OE2   1 
ATOM   2941  N  N     . GLY D 4 84  ? 20.350  10.255 -24.396 1.00 64.31  ? 111 GLY D N     1 
ATOM   2942  C  CA    . GLY D 4 84  ? 19.725  11.119 -23.402 1.00 63.74  ? 111 GLY D CA    1 
ATOM   2943  C  C     . GLY D 4 84  ? 18.792  10.366 -22.477 1.00 68.88  ? 111 GLY D C     1 
ATOM   2944  O  O     . GLY D 4 84  ? 18.955  10.445 -21.257 1.00 68.02  ? 111 GLY D O     1 
ATOM   2945  N  N     . THR D 4 85  ? 17.828  9.587  -23.055 1.00 66.79  ? 112 THR D N     1 
ATOM   2946  C  CA    . THR D 4 85  ? 16.850  8.765  -22.308 1.00 66.98  ? 112 THR D CA    1 
ATOM   2947  C  C     . THR D 4 85  ? 17.567  7.742  -21.404 1.00 71.71  ? 112 THR D C     1 
ATOM   2948  O  O     . THR D 4 85  ? 17.109  7.463  -20.297 1.00 71.02  ? 112 THR D O     1 
ATOM   2949  C  CB    . THR D 4 85  ? 15.855  8.060  -23.270 1.00 74.67  ? 112 THR D CB    1 
ATOM   2950  O  OG1   . THR D 4 85  ? 15.201  9.023  -24.089 1.00 74.43  ? 112 THR D OG1   1 
ATOM   2951  C  CG2   . THR D 4 85  ? 14.830  7.196  -22.562 1.00 73.29  ? 112 THR D CG2   1 
ATOM   2952  N  N     . LYS D 4 86  ? 18.684  7.199  -21.896 1.00 68.55  ? 113 LYS D N     1 
ATOM   2953  C  CA    . LYS D 4 86  ? 19.563  6.245  -21.231 1.00 68.99  ? 113 LYS D CA    1 
ATOM   2954  C  C     . LYS D 4 86  ? 20.155  6.891  -19.977 1.00 73.81  ? 113 LYS D C     1 
ATOM   2955  O  O     . LYS D 4 86  ? 20.022  6.341  -18.894 1.00 70.65  ? 113 LYS D O     1 
ATOM   2956  C  CB    . LYS D 4 86  ? 20.676  5.861  -22.225 1.00 72.49  ? 113 LYS D CB    1 
ATOM   2957  C  CG    . LYS D 4 86  ? 21.487  4.599  -21.941 1.00 83.29  ? 113 LYS D CG    1 
ATOM   2958  C  CD    . LYS D 4 86  ? 22.361  4.283  -23.153 1.00 91.93  ? 113 LYS D CD    1 
ATOM   2959  C  CE    . LYS D 4 86  ? 23.727  3.718  -22.848 1.00 113.17 ? 113 LYS D CE    1 
ATOM   2960  N  NZ    . LYS D 4 86  ? 24.651  3.876  -24.008 1.00 125.99 ? 113 LYS D NZ    1 
ATOM   2961  N  N     . ALA D 4 87  ? 20.758  8.095  -20.121 1.00 75.41  ? 114 ALA D N     1 
ATOM   2962  C  CA    . ALA D 4 87  ? 21.380  8.852  -19.022 1.00 75.97  ? 114 ALA D CA    1 
ATOM   2963  C  C     . ALA D 4 87  ? 20.397  9.179  -17.894 1.00 82.35  ? 114 ALA D C     1 
ATOM   2964  O  O     . ALA D 4 87  ? 20.740  9.016  -16.722 1.00 81.72  ? 114 ALA D O     1 
ATOM   2965  C  CB    . ALA D 4 87  ? 22.009  10.126 -19.555 1.00 76.28  ? 114 ALA D CB    1 
ATOM   2966  N  N     . VAL D 4 88  ? 19.173  9.616  -18.260 1.00 80.66  ? 115 VAL D N     1 
ATOM   2967  C  CA    . VAL D 4 88  ? 18.120  10.005 -17.319 1.00 81.23  ? 115 VAL D CA    1 
ATOM   2968  C  C     . VAL D 4 88  ? 17.675  8.792  -16.508 1.00 88.08  ? 115 VAL D C     1 
ATOM   2969  O  O     . VAL D 4 88  ? 17.667  8.857  -15.278 1.00 88.43  ? 115 VAL D O     1 
ATOM   2970  C  CB    . VAL D 4 88  ? 16.956  10.782 -18.007 1.00 84.36  ? 115 VAL D CB    1 
ATOM   2971  C  CG1   . VAL D 4 88  ? 15.836  11.113 -17.030 1.00 84.02  ? 115 VAL D CG1   1 
ATOM   2972  C  CG2   . VAL D 4 88  ? 17.468  12.060 -18.651 1.00 84.02  ? 115 VAL D CG2   1 
ATOM   2973  N  N     . THR D 4 89  ? 17.384  7.680  -17.197 1.00 85.92  ? 116 THR D N     1 
ATOM   2974  C  CA    . THR D 4 89  ? 16.979  6.394  -16.628 1.00 86.44  ? 116 THR D CA    1 
ATOM   2975  C  C     . THR D 4 89  ? 18.025  5.899  -15.611 1.00 92.16  ? 116 THR D C     1 
ATOM   2976  O  O     . THR D 4 89  ? 17.653  5.496  -14.509 1.00 91.58  ? 116 THR D O     1 
ATOM   2977  C  CB    . THR D 4 89  ? 16.756  5.409  -17.791 1.00 94.41  ? 116 THR D CB    1 
ATOM   2978  O  OG1   . THR D 4 89  ? 15.694  5.898  -18.611 1.00 99.19  ? 116 THR D OG1   1 
ATOM   2979  C  CG2   . THR D 4 89  ? 16.445  4.010  -17.343 1.00 87.96  ? 116 THR D CG2   1 
ATOM   2980  N  N     . LYS D 4 90  ? 19.324  5.935  -15.992 1.00 90.62  ? 117 LYS D N     1 
ATOM   2981  C  CA    . LYS D 4 90  ? 20.462  5.518  -15.167 1.00 90.75  ? 117 LYS D CA    1 
ATOM   2982  C  C     . LYS D 4 90  ? 20.557  6.410  -13.908 1.00 99.11  ? 117 LYS D C     1 
ATOM   2983  O  O     . LYS D 4 90  ? 20.724  5.891  -12.801 1.00 99.24  ? 117 LYS D O     1 
ATOM   2984  C  CB    . LYS D 4 90  ? 21.763  5.521  -16.001 1.00 92.04  ? 117 LYS D CB    1 
ATOM   2985  C  CG    . LYS D 4 90  ? 23.006  5.107  -15.231 1.00 101.14 ? 117 LYS D CG    1 
ATOM   2986  C  CD    . LYS D 4 90  ? 24.255  4.913  -16.093 1.00 113.88 ? 117 LYS D CD    1 
ATOM   2987  C  CE    . LYS D 4 90  ? 25.325  4.078  -15.393 1.00 136.88 ? 117 LYS D CE    1 
ATOM   2988  N  NZ    . LYS D 4 90  ? 25.787  4.659  -14.096 1.00 147.95 ? 117 LYS D NZ    1 
ATOM   2989  N  N     . TYR D 4 91  ? 20.397  7.744  -14.094 1.00 98.64  ? 118 TYR D N     1 
ATOM   2990  C  CA    . TYR D 4 91  ? 20.404  8.779  -13.057 1.00 99.57  ? 118 TYR D CA    1 
ATOM   2991  C  C     . TYR D 4 91  ? 19.266  8.555  -12.035 1.00 108.67 ? 118 TYR D C     1 
ATOM   2992  O  O     . TYR D 4 91  ? 19.510  8.609  -10.825 1.00 106.80 ? 118 TYR D O     1 
ATOM   2993  C  CB    . TYR D 4 91  ? 20.327  10.185 -13.700 1.00 99.44  ? 118 TYR D CB    1 
ATOM   2994  C  CG    . TYR D 4 91  ? 20.327  11.308 -12.690 1.00 100.27 ? 118 TYR D CG    1 
ATOM   2995  C  CD1   . TYR D 4 91  ? 21.509  11.725 -12.081 1.00 102.13 ? 118 TYR D CD1   1 
ATOM   2996  C  CD2   . TYR D 4 91  ? 19.138  11.920 -12.302 1.00 100.93 ? 118 TYR D CD2   1 
ATOM   2997  C  CE1   . TYR D 4 91  ? 21.505  12.719 -11.101 1.00 103.29 ? 118 TYR D CE1   1 
ATOM   2998  C  CE2   . TYR D 4 91  ? 19.123  12.911 -11.322 1.00 102.00 ? 118 TYR D CE2   1 
ATOM   2999  C  CZ    . TYR D 4 91  ? 20.310  13.315 -10.730 1.00 111.68 ? 118 TYR D CZ    1 
ATOM   3000  O  OH    . TYR D 4 91  ? 20.301  14.304 -9.774  1.00 115.81 ? 118 TYR D OH    1 
ATOM   3001  N  N     . THR D 4 92  ? 18.027  8.296  -12.537 1.00 110.59 ? 119 THR D N     1 
ATOM   3002  C  CA    . THR D 4 92  ? 16.823  8.003  -11.738 1.00 112.57 ? 119 THR D CA    1 
ATOM   3003  C  C     . THR D 4 92  ? 17.040  6.700  -10.926 1.00 121.41 ? 119 THR D C     1 
ATOM   3004  O  O     . THR D 4 92  ? 16.466  6.553  -9.844  1.00 120.26 ? 119 THR D O     1 
ATOM   3005  C  CB    . THR D 4 92  ? 15.560  7.943  -12.644 1.00 119.17 ? 119 THR D CB    1 
ATOM   3006  O  OG1   . THR D 4 92  ? 15.559  9.027  -13.572 1.00 116.71 ? 119 THR D OG1   1 
ATOM   3007  C  CG2   . THR D 4 92  ? 14.259  7.967  -11.849 1.00 118.36 ? 119 THR D CG2   1 
ATOM   3008  N  N     . SER D 4 93  ? 17.884  5.774  -11.450 1.00 122.72 ? 120 SER D N     1 
ATOM   3009  C  CA    . SER D 4 93  ? 18.236  4.523  -10.779 1.00 125.03 ? 120 SER D CA    1 
ATOM   3010  C  C     . SER D 4 93  ? 19.190  4.807  -9.607  1.00 134.98 ? 120 SER D C     1 
ATOM   3011  O  O     . SER D 4 93  ? 18.978  4.292  -8.504  1.00 134.92 ? 120 SER D O     1 
ATOM   3012  C  CB    . SER D 4 93  ? 18.866  3.532  -11.758 1.00 128.57 ? 120 SER D CB    1 
ATOM   3013  O  OG    . SER D 4 93  ? 17.971  3.163  -12.795 1.00 138.38 ? 120 SER D OG    1 
ATOM   3014  N  N     . ALA D 4 94  ? 20.213  5.648  -9.842  1.00 135.81 ? 121 ALA D N     1 
ATOM   3015  C  CA    . ALA D 4 94  ? 21.217  6.022  -8.840  1.00 137.75 ? 121 ALA D CA    1 
ATOM   3016  C  C     . ALA D 4 94  ? 20.891  7.346  -8.061  1.00 146.87 ? 121 ALA D C     1 
ATOM   3017  O  O     . ALA D 4 94  ? 20.923  8.452  -8.647  1.00 146.90 ? 121 ALA D O     1 
ATOM   3018  C  CB    . ALA D 4 94  ? 22.591  6.099  -9.501  1.00 138.44 ? 121 ALA D CB    1 
ATOM   3019  N  N     . LYS D 4 95  ? 20.618  7.233  -6.730  1.00 146.03 ? 122 LYS D N     1 
ATOM   3020  C  CA    . LYS D 4 95  ? 20.308  8.389  -5.858  1.00 153.22 ? 122 LYS D CA    1 
ATOM   3021  C  C     . LYS D 4 95  ? 21.577  9.180  -5.473  1.00 175.09 ? 122 LYS D C     1 
ATOM   3022  O  O     . LYS D 4 95  ? 21.762  10.300 -6.012  1.00 175.54 ? 122 LYS D O     1 
ATOM   3023  C  CB    . LYS D 4 95  ? 19.505  7.962  -4.602  1.00 156.21 ? 122 LYS D CB    1 
ATOM   3024  C  CG    . LYS D 4 95  ? 18.900  9.136  -3.818  1.00 166.69 ? 122 LYS D CG    1 
ATOM   3025  C  CD    . LYS D 4 95  ? 18.090  8.681  -2.611  1.00 171.53 ? 122 LYS D CD    1 
ATOM   3026  C  CE    . LYS D 4 95  ? 18.838  8.862  -1.316  1.00 176.11 ? 122 LYS D CE    1 
ATOM   3027  N  NZ    . LYS D 4 95  ? 17.980  8.535  -0.148  1.00 182.84 ? 122 LYS D NZ    1 
ATOM   3028  O  OXT   . LYS D 4 95  ? 22.373  8.676  -4.639  1.00 199.82 ? 122 LYS D OXT   1 
ATOM   3029  N  N     . ARG E 1 1   ? 56.623  24.320 -71.833 1.00 172.62 ? 40  ARG E N     1 
ATOM   3030  C  CA    . ARG E 1 1   ? 55.546  25.219 -71.406 1.00 172.39 ? 40  ARG E CA    1 
ATOM   3031  C  C     . ARG E 1 1   ? 54.211  24.465 -71.263 1.00 174.83 ? 40  ARG E C     1 
ATOM   3032  O  O     . ARG E 1 1   ? 53.749  23.853 -72.229 1.00 174.17 ? 40  ARG E O     1 
ATOM   3033  C  CB    . ARG E 1 1   ? 55.425  26.407 -72.385 1.00 173.54 ? 40  ARG E CB    1 
ATOM   3034  C  CG    . ARG E 1 1   ? 54.482  27.531 -71.945 1.00 184.94 ? 40  ARG E CG    1 
ATOM   3035  C  CD    . ARG E 1 1   ? 55.093  28.880 -72.271 1.00 197.07 ? 40  ARG E CD    1 
ATOM   3036  N  NE    . ARG E 1 1   ? 54.106  29.960 -72.344 1.00 206.05 ? 40  ARG E NE    1 
ATOM   3037  C  CZ    . ARG E 1 1   ? 53.872  30.689 -73.434 1.00 220.65 ? 40  ARG E CZ    1 
ATOM   3038  N  NH1   . ARG E 1 1   ? 54.544  30.454 -74.557 1.00 208.12 ? 40  ARG E NH1   1 
ATOM   3039  N  NH2   . ARG E 1 1   ? 52.967  31.658 -73.409 1.00 205.92 ? 40  ARG E NH2   1 
ATOM   3040  N  N     . TYR E 1 2   ? 53.604  24.508 -70.054 1.00 170.73 ? 41  TYR E N     1 
ATOM   3041  C  CA    . TYR E 1 2   ? 52.330  23.839 -69.753 1.00 170.43 ? 41  TYR E CA    1 
ATOM   3042  C  C     . TYR E 1 2   ? 51.149  24.421 -70.533 1.00 172.97 ? 41  TYR E C     1 
ATOM   3043  O  O     . TYR E 1 2   ? 51.083  25.635 -70.738 1.00 172.98 ? 41  TYR E O     1 
ATOM   3044  C  CB    . TYR E 1 2   ? 52.021  23.846 -68.242 1.00 171.97 ? 41  TYR E CB    1 
ATOM   3045  C  CG    . TYR E 1 2   ? 52.885  22.914 -67.414 1.00 174.26 ? 41  TYR E CG    1 
ATOM   3046  C  CD1   . TYR E 1 2   ? 52.778  21.529 -67.552 1.00 176.32 ? 41  TYR E CD1   1 
ATOM   3047  C  CD2   . TYR E 1 2   ? 53.749  23.405 -66.444 1.00 175.18 ? 41  TYR E CD2   1 
ATOM   3048  C  CE1   . TYR E 1 2   ? 53.559  20.665 -66.785 1.00 177.17 ? 41  TYR E CE1   1 
ATOM   3049  C  CE2   . TYR E 1 2   ? 54.540  22.552 -65.676 1.00 176.18 ? 41  TYR E CE2   1 
ATOM   3050  C  CZ    . TYR E 1 2   ? 54.435  21.179 -65.846 1.00 183.86 ? 41  TYR E CZ    1 
ATOM   3051  O  OH    . TYR E 1 2   ? 55.194  20.323 -65.085 1.00 185.24 ? 41  TYR E OH    1 
ATOM   3052  N  N     . ARG E 1 3   ? 50.211  23.542 -70.948 1.00 167.74 ? 42  ARG E N     1 
ATOM   3053  C  CA    . ARG E 1 3   ? 49.000  23.894 -71.697 1.00 166.58 ? 42  ARG E CA    1 
ATOM   3054  C  C     . ARG E 1 3   ? 48.054  24.768 -70.842 1.00 167.55 ? 42  ARG E C     1 
ATOM   3055  O  O     . ARG E 1 3   ? 48.040  24.614 -69.614 1.00 167.81 ? 42  ARG E O     1 
ATOM   3056  C  CB    . ARG E 1 3   ? 48.266  22.626 -72.176 1.00 167.35 ? 42  ARG E CB    1 
ATOM   3057  C  CG    . ARG E 1 3   ? 49.003  21.812 -73.241 1.00 177.38 ? 42  ARG E CG    1 
ATOM   3058  C  CD    . ARG E 1 3   ? 48.274  20.517 -73.585 1.00 188.64 ? 42  ARG E CD    1 
ATOM   3059  N  NE    . ARG E 1 3   ? 47.123  20.725 -74.472 1.00 199.82 ? 42  ARG E NE    1 
ATOM   3060  C  CZ    . ARG E 1 3   ? 46.101  19.878 -74.601 1.00 214.41 ? 42  ARG E CZ    1 
ATOM   3061  N  NH1   . ARG E 1 3   ? 46.063  18.758 -73.887 1.00 200.56 ? 42  ARG E NH1   1 
ATOM   3062  N  NH2   . ARG E 1 3   ? 45.104  20.153 -75.432 1.00 201.88 ? 42  ARG E NH2   1 
ATOM   3063  N  N     . PRO E 1 4   ? 47.266  25.691 -71.458 1.00 160.84 ? 43  PRO E N     1 
ATOM   3064  C  CA    . PRO E 1 4   ? 46.371  26.545 -70.661 1.00 159.09 ? 43  PRO E CA    1 
ATOM   3065  C  C     . PRO E 1 4   ? 45.301  25.760 -69.922 1.00 157.96 ? 43  PRO E C     1 
ATOM   3066  O  O     . PRO E 1 4   ? 44.448  25.122 -70.540 1.00 156.99 ? 43  PRO E O     1 
ATOM   3067  C  CB    . PRO E 1 4   ? 45.765  27.501 -71.700 1.00 161.14 ? 43  PRO E CB    1 
ATOM   3068  C  CG    . PRO E 1 4   ? 46.669  27.432 -72.867 1.00 166.17 ? 43  PRO E CG    1 
ATOM   3069  C  CD    . PRO E 1 4   ? 47.168  26.030 -72.890 1.00 162.07 ? 43  PRO E CD    1 
ATOM   3070  N  N     . GLY E 1 5   ? 45.402  25.786 -68.602 1.00 151.79 ? 44  GLY E N     1 
ATOM   3071  C  CA    . GLY E 1 5   ? 44.474  25.111 -67.704 1.00 150.51 ? 44  GLY E CA    1 
ATOM   3072  C  C     . GLY E 1 5   ? 45.092  23.995 -66.887 1.00 151.07 ? 44  GLY E C     1 
ATOM   3073  O  O     . GLY E 1 5   ? 44.389  23.354 -66.105 1.00 150.68 ? 44  GLY E O     1 
ATOM   3074  N  N     . THR E 1 6   ? 46.415  23.775 -67.038 1.00 144.62 ? 45  THR E N     1 
ATOM   3075  C  CA    . THR E 1 6   ? 47.154  22.716 -66.338 1.00 143.11 ? 45  THR E CA    1 
ATOM   3076  C  C     . THR E 1 6   ? 47.691  23.159 -64.967 1.00 144.23 ? 45  THR E C     1 
ATOM   3077  O  O     . THR E 1 6   ? 47.434  22.478 -63.965 1.00 144.24 ? 45  THR E O     1 
ATOM   3078  C  CB    . THR E 1 6   ? 48.236  22.159 -67.234 1.00 148.57 ? 45  THR E CB    1 
ATOM   3079  O  OG1   . THR E 1 6   ? 47.657  21.892 -68.511 1.00 147.87 ? 45  THR E OG1   1 
ATOM   3080  C  CG2   . THR E 1 6   ? 48.866  20.896 -66.670 1.00 146.43 ? 45  THR E CG2   1 
ATOM   3081  N  N     . VAL E 1 7   ? 48.443  24.286 -64.929 1.00 137.68 ? 46  VAL E N     1 
ATOM   3082  C  CA    . VAL E 1 7   ? 48.989  24.880 -63.692 1.00 135.88 ? 46  VAL E CA    1 
ATOM   3083  C  C     . VAL E 1 7   ? 47.795  25.307 -62.815 1.00 135.77 ? 46  VAL E C     1 
ATOM   3084  O  O     . VAL E 1 7   ? 47.823  25.116 -61.601 1.00 134.86 ? 46  VAL E O     1 
ATOM   3085  C  CB    . VAL E 1 7   ? 49.977  26.052 -63.981 1.00 139.66 ? 46  VAL E CB    1 
ATOM   3086  C  CG1   . VAL E 1 7   ? 50.516  26.672 -62.687 1.00 139.32 ? 46  VAL E CG1   1 
ATOM   3087  C  CG2   . VAL E 1 7   ? 51.125  25.600 -64.898 1.00 139.43 ? 46  VAL E CG2   1 
ATOM   3088  N  N     . ALA E 1 8   ? 46.723  25.808 -63.468 1.00 129.71 ? 47  ALA E N     1 
ATOM   3089  C  CA    . ALA E 1 8   ? 45.466  26.228 -62.861 1.00 128.15 ? 47  ALA E CA    1 
ATOM   3090  C  C     . ALA E 1 8   ? 44.822  25.065 -62.097 1.00 130.26 ? 47  ALA E C     1 
ATOM   3091  O  O     . ALA E 1 8   ? 44.522  25.239 -60.914 1.00 130.84 ? 47  ALA E O     1 
ATOM   3092  C  CB    . ALA E 1 8   ? 44.517  26.760 -63.929 1.00 128.66 ? 47  ALA E CB    1 
ATOM   3093  N  N     . LEU E 1 9   ? 44.661  23.871 -62.741 1.00 123.81 ? 48  LEU E N     1 
ATOM   3094  C  CA    . LEU E 1 9   ? 44.080  22.677 -62.097 1.00 121.95 ? 48  LEU E CA    1 
ATOM   3095  C  C     . LEU E 1 9   ? 44.944  22.188 -60.946 1.00 122.53 ? 48  LEU E C     1 
ATOM   3096  O  O     . LEU E 1 9   ? 44.417  21.820 -59.897 1.00 120.60 ? 48  LEU E O     1 
ATOM   3097  C  CB    . LEU E 1 9   ? 43.812  21.555 -63.110 1.00 121.76 ? 48  LEU E CB    1 
ATOM   3098  C  CG    . LEU E 1 9   ? 42.530  21.695 -63.933 1.00 126.20 ? 48  LEU E CG    1 
ATOM   3099  C  CD1   . LEU E 1 9   ? 42.649  20.959 -65.243 1.00 126.15 ? 48  LEU E CD1   1 
ATOM   3100  C  CD2   . LEU E 1 9   ? 41.306  21.207 -63.172 1.00 128.61 ? 48  LEU E CD2   1 
ATOM   3101  N  N     . ARG E 1 10  ? 46.273  22.250 -61.131 1.00 118.60 ? 49  ARG E N     1 
ATOM   3102  C  CA    . ARG E 1 10  ? 47.292  21.892 -60.144 1.00 118.01 ? 49  ARG E CA    1 
ATOM   3103  C  C     . ARG E 1 10  ? 47.171  22.814 -58.906 1.00 119.48 ? 49  ARG E C     1 
ATOM   3104  O  O     . ARG E 1 10  ? 47.244  22.329 -57.773 1.00 119.35 ? 49  ARG E O     1 
ATOM   3105  C  CB    . ARG E 1 10  ? 48.680  22.011 -60.792 1.00 119.20 ? 49  ARG E CB    1 
ATOM   3106  C  CG    . ARG E 1 10  ? 49.789  21.272 -60.063 1.00 132.09 ? 49  ARG E CG    1 
ATOM   3107  C  CD    . ARG E 1 10  ? 50.950  20.943 -60.989 1.00 141.61 ? 49  ARG E CD    1 
ATOM   3108  N  NE    . ARG E 1 10  ? 51.729  22.124 -61.366 1.00 152.35 ? 49  ARG E NE    1 
ATOM   3109  C  CZ    . ARG E 1 10  ? 52.229  22.342 -62.581 1.00 170.71 ? 49  ARG E CZ    1 
ATOM   3110  N  NH1   . ARG E 1 10  ? 52.032  21.462 -63.556 1.00 158.38 ? 49  ARG E NH1   1 
ATOM   3111  N  NH2   . ARG E 1 10  ? 52.921  23.445 -62.832 1.00 159.85 ? 49  ARG E NH2   1 
ATOM   3112  N  N     . GLU E 1 11  ? 46.953  24.133 -59.138 1.00 113.51 ? 50  GLU E N     1 
ATOM   3113  C  CA    . GLU E 1 11  ? 46.783  25.160 -58.101 1.00 112.30 ? 50  GLU E CA    1 
ATOM   3114  C  C     . GLU E 1 11  ? 45.553  24.878 -57.225 1.00 112.73 ? 50  GLU E C     1 
ATOM   3115  O  O     . GLU E 1 11  ? 45.643  24.992 -56.001 1.00 111.86 ? 50  GLU E O     1 
ATOM   3116  C  CB    . GLU E 1 11  ? 46.744  26.584 -58.704 1.00 113.92 ? 50  GLU E CB    1 
ATOM   3117  C  CG    . GLU E 1 11  ? 48.128  27.160 -59.002 1.00 129.33 ? 50  GLU E CG    1 
ATOM   3118  C  CD    . GLU E 1 11  ? 48.254  28.515 -59.679 1.00 164.82 ? 50  GLU E CD    1 
ATOM   3119  O  OE1   . GLU E 1 11  ? 49.400  28.875 -60.042 1.00 166.52 ? 50  GLU E OE1   1 
ATOM   3120  O  OE2   . GLU E 1 11  ? 47.219  29.197 -59.876 1.00 165.04 ? 50  GLU E OE2   1 
ATOM   3121  N  N     . ILE E 1 12  ? 44.423  24.469 -57.853 1.00 107.15 ? 51  ILE E N     1 
ATOM   3122  C  CA    . ILE E 1 12  ? 43.174  24.105 -57.168 1.00 105.63 ? 51  ILE E CA    1 
ATOM   3123  C  C     . ILE E 1 12  ? 43.479  22.967 -56.186 1.00 109.24 ? 51  ILE E C     1 
ATOM   3124  O  O     . ILE E 1 12  ? 43.167  23.085 -55.009 1.00 108.28 ? 51  ILE E O     1 
ATOM   3125  C  CB    . ILE E 1 12  ? 42.062  23.721 -58.185 1.00 107.76 ? 51  ILE E CB    1 
ATOM   3126  C  CG1   . ILE E 1 12  ? 41.612  24.942 -58.998 1.00 107.49 ? 51  ILE E CG1   1 
ATOM   3127  C  CG2   . ILE E 1 12  ? 40.872  23.058 -57.496 1.00 107.84 ? 51  ILE E CG2   1 
ATOM   3128  C  CD1   . ILE E 1 12  ? 41.092  24.619 -60.361 1.00 111.93 ? 51  ILE E CD1   1 
ATOM   3129  N  N     . ARG E 1 13  ? 44.167  21.913 -56.659 1.00 106.21 ? 52  ARG E N     1 
ATOM   3130  C  CA    . ARG E 1 13  ? 44.548  20.764 -55.836 1.00 106.08 ? 52  ARG E CA    1 
ATOM   3131  C  C     . ARG E 1 13  ? 45.442  21.166 -54.660 1.00 110.65 ? 52  ARG E C     1 
ATOM   3132  O  O     . ARG E 1 13  ? 45.277  20.629 -53.563 1.00 109.59 ? 52  ARG E O     1 
ATOM   3133  C  CB    . ARG E 1 13  ? 45.221  19.678 -56.679 1.00 106.32 ? 52  ARG E CB    1 
ATOM   3134  C  CG    . ARG E 1 13  ? 44.388  19.188 -57.845 1.00 117.45 ? 52  ARG E CG    1 
ATOM   3135  C  CD    . ARG E 1 13  ? 44.744  17.758 -58.257 1.00 127.95 ? 52  ARG E CD    1 
ATOM   3136  N  NE    . ARG E 1 13  ? 44.848  17.589 -59.711 1.00 137.91 ? 52  ARG E NE    1 
ATOM   3137  C  CZ    . ARG E 1 13  ? 43.813  17.495 -60.543 1.00 154.37 ? 52  ARG E CZ    1 
ATOM   3138  N  NH1   . ARG E 1 13  ? 42.572  17.435 -60.069 1.00 143.95 ? 52  ARG E NH1   1 
ATOM   3139  N  NH2   . ARG E 1 13  ? 44.013  17.356 -61.848 1.00 139.94 ? 52  ARG E NH2   1 
ATOM   3140  N  N     . ARG E 1 14  ? 46.363  22.131 -54.891 1.00 108.80 ? 53  ARG E N     1 
ATOM   3141  C  CA    . ARG E 1 14  ? 47.318  22.637 -53.900 1.00 109.08 ? 53  ARG E CA    1 
ATOM   3142  C  C     . ARG E 1 14  ? 46.620  23.312 -52.739 1.00 114.03 ? 53  ARG E C     1 
ATOM   3143  O  O     . ARG E 1 14  ? 46.784  22.899 -51.588 1.00 114.30 ? 53  ARG E O     1 
ATOM   3144  C  CB    . ARG E 1 14  ? 48.319  23.606 -54.558 1.00 108.68 ? 53  ARG E CB    1 
ATOM   3145  C  CG    . ARG E 1 14  ? 49.153  24.438 -53.585 1.00 117.41 ? 53  ARG E CG    1 
ATOM   3146  C  CD    . ARG E 1 14  ? 50.242  25.150 -54.344 1.00 129.96 ? 53  ARG E CD    1 
ATOM   3147  N  NE    . ARG E 1 14  ? 50.878  26.207 -53.564 1.00 144.28 ? 53  ARG E NE    1 
ATOM   3148  C  CZ    . ARG E 1 14  ? 51.912  26.928 -53.991 1.00 167.44 ? 53  ARG E CZ    1 
ATOM   3149  N  NH1   . ARG E 1 14  ? 52.438  26.704 -55.191 1.00 156.75 ? 53  ARG E NH1   1 
ATOM   3150  N  NH2   . ARG E 1 14  ? 52.431  27.875 -53.222 1.00 160.25 ? 53  ARG E NH2   1 
ATOM   3151  N  N     . TYR E 1 15  ? 45.858  24.360 -53.053 1.00 109.97 ? 54  TYR E N     1 
ATOM   3152  C  CA    . TYR E 1 15  ? 45.176  25.174 -52.077 1.00 109.69 ? 54  TYR E CA    1 
ATOM   3153  C  C     . TYR E 1 15  ? 43.956  24.484 -51.496 1.00 112.05 ? 54  TYR E C     1 
ATOM   3154  O  O     . TYR E 1 15  ? 43.644  24.762 -50.339 1.00 112.70 ? 54  TYR E O     1 
ATOM   3155  C  CB    . TYR E 1 15  ? 44.871  26.556 -52.656 1.00 111.75 ? 54  TYR E CB    1 
ATOM   3156  C  CG    . TYR E 1 15  ? 46.134  27.322 -52.986 1.00 115.38 ? 54  TYR E CG    1 
ATOM   3157  C  CD1   . TYR E 1 15  ? 46.979  27.781 -51.976 1.00 117.76 ? 54  TYR E CD1   1 
ATOM   3158  C  CD2   . TYR E 1 15  ? 46.512  27.550 -54.306 1.00 116.79 ? 54  TYR E CD2   1 
ATOM   3159  C  CE1   . TYR E 1 15  ? 48.157  28.468 -52.272 1.00 119.20 ? 54  TYR E CE1   1 
ATOM   3160  C  CE2   . TYR E 1 15  ? 47.691  28.232 -54.615 1.00 118.04 ? 54  TYR E CE2   1 
ATOM   3161  C  CZ    . TYR E 1 15  ? 48.509  28.693 -53.592 1.00 127.05 ? 54  TYR E CZ    1 
ATOM   3162  O  OH    . TYR E 1 15  ? 49.661  29.400 -53.854 1.00 130.42 ? 54  TYR E OH    1 
ATOM   3163  N  N     . GLN E 1 16  ? 43.306  23.543 -52.240 1.00 105.90 ? 55  GLN E N     1 
ATOM   3164  C  CA    . GLN E 1 16  ? 42.143  22.806 -51.716 1.00 104.40 ? 55  GLN E CA    1 
ATOM   3165  C  C     . GLN E 1 16  ? 42.527  21.871 -50.591 1.00 108.37 ? 55  GLN E C     1 
ATOM   3166  O  O     . GLN E 1 16  ? 41.773  21.755 -49.624 1.00 108.69 ? 55  GLN E O     1 
ATOM   3167  C  CB    . GLN E 1 16  ? 41.356  22.067 -52.801 1.00 104.73 ? 55  GLN E CB    1 
ATOM   3168  C  CG    . GLN E 1 16  ? 40.374  22.991 -53.498 1.00 102.54 ? 55  GLN E CG    1 
ATOM   3169  C  CD    . GLN E 1 16  ? 39.320  22.298 -54.321 1.00 106.39 ? 55  GLN E CD    1 
ATOM   3170  O  OE1   . GLN E 1 16  ? 39.468  21.163 -54.774 1.00 97.13  ? 55  GLN E OE1   1 
ATOM   3171  N  NE2   . GLN E 1 16  ? 38.221  22.987 -54.549 1.00 98.25  ? 55  GLN E NE2   1 
ATOM   3172  N  N     . LYS E 1 17  ? 43.717  21.257 -50.685 1.00 104.32 ? 56  LYS E N     1 
ATOM   3173  C  CA    . LYS E 1 17  ? 44.262  20.345 -49.675 1.00 103.98 ? 56  LYS E CA    1 
ATOM   3174  C  C     . LYS E 1 17  ? 45.035  21.081 -48.552 1.00 104.98 ? 56  LYS E C     1 
ATOM   3175  O  O     . LYS E 1 17  ? 45.583  20.440 -47.645 1.00 104.04 ? 56  LYS E O     1 
ATOM   3176  C  CB    . LYS E 1 17  ? 45.103  19.243 -50.344 1.00 107.68 ? 56  LYS E CB    1 
ATOM   3177  C  CG    . LYS E 1 17  ? 44.226  18.152 -50.950 1.00 135.81 ? 56  LYS E CG    1 
ATOM   3178  C  CD    . LYS E 1 17  ? 44.796  17.609 -52.254 1.00 154.26 ? 56  LYS E CD    1 
ATOM   3179  C  CE    . LYS E 1 17  ? 43.713  17.223 -53.237 1.00 168.59 ? 56  LYS E CE    1 
ATOM   3180  N  NZ    . LYS E 1 17  ? 43.013  18.413 -53.805 1.00 174.71 ? 56  LYS E NZ    1 
ATOM   3181  N  N     . SER E 1 18  ? 45.015  22.428 -48.592 1.00 99.96  ? 57  SER E N     1 
ATOM   3182  C  CA    . SER E 1 18  ? 45.661  23.307 -47.620 1.00 98.99  ? 57  SER E CA    1 
ATOM   3183  C  C     . SER E 1 18  ? 44.667  24.102 -46.761 1.00 99.71  ? 57  SER E C     1 
ATOM   3184  O  O     . SER E 1 18  ? 43.479  24.173 -47.090 1.00 98.67  ? 57  SER E O     1 
ATOM   3185  C  CB    . SER E 1 18  ? 46.602  24.266 -48.328 1.00 103.41 ? 57  SER E CB    1 
ATOM   3186  O  OG    . SER E 1 18  ? 47.406  24.872 -47.336 1.00 114.51 ? 57  SER E OG    1 
ATOM   3187  N  N     . THR E 1 19  ? 45.161  24.682 -45.646 1.00 94.82  ? 58  THR E N     1 
ATOM   3188  C  CA    . THR E 1 19  ? 44.347  25.478 -44.718 1.00 94.30  ? 58  THR E CA    1 
ATOM   3189  C  C     . THR E 1 19  ? 44.908  26.878 -44.450 1.00 99.64  ? 58  THR E C     1 
ATOM   3190  O  O     . THR E 1 19  ? 44.168  27.763 -43.985 1.00 100.21 ? 58  THR E O     1 
ATOM   3191  C  CB    . THR E 1 19  ? 44.111  24.753 -43.401 1.00 96.12  ? 58  THR E CB    1 
ATOM   3192  O  OG1   . THR E 1 19  ? 45.270  24.877 -42.582 1.00 96.14  ? 58  THR E OG1   1 
ATOM   3193  C  CG2   . THR E 1 19  ? 43.685  23.320 -43.579 1.00 91.93  ? 58  THR E CG2   1 
ATOM   3194  N  N     . GLU E 1 20  ? 46.216  27.078 -44.719 1.00 96.03  ? 59  GLU E N     1 
ATOM   3195  C  CA    . GLU E 1 20  ? 46.884  28.365 -44.505 1.00 95.92  ? 59  GLU E CA    1 
ATOM   3196  C  C     . GLU E 1 20  ? 46.108  29.524 -45.098 1.00 98.99  ? 59  GLU E C     1 
ATOM   3197  O  O     . GLU E 1 20  ? 45.439  29.363 -46.124 1.00 97.67  ? 59  GLU E O     1 
ATOM   3198  C  CB    . GLU E 1 20  ? 48.349  28.386 -45.006 1.00 97.45  ? 59  GLU E CB    1 
ATOM   3199  C  CG    . GLU E 1 20  ? 48.742  27.301 -45.996 1.00 110.24 ? 59  GLU E CG    1 
ATOM   3200  C  CD    . GLU E 1 20  ? 48.606  27.596 -47.480 1.00 136.79 ? 59  GLU E CD    1 
ATOM   3201  O  OE1   . GLU E 1 20  ? 49.431  27.063 -48.258 1.00 139.89 ? 59  GLU E OE1   1 
ATOM   3202  O  OE2   . GLU E 1 20  ? 47.672  28.334 -47.872 1.00 129.18 ? 59  GLU E OE2   1 
ATOM   3203  N  N     . LEU E 1 21  ? 46.184  30.690 -44.446 1.00 95.77  ? 60  LEU E N     1 
ATOM   3204  C  CA    . LEU E 1 21  ? 45.504  31.858 -44.975 1.00 95.89  ? 60  LEU E CA    1 
ATOM   3205  C  C     . LEU E 1 21  ? 46.187  32.311 -46.269 1.00 100.95 ? 60  LEU E C     1 
ATOM   3206  O  O     . LEU E 1 21  ? 47.397  32.082 -46.456 1.00 101.09 ? 60  LEU E O     1 
ATOM   3207  C  CB    . LEU E 1 21  ? 45.320  32.970 -43.931 1.00 96.06  ? 60  LEU E CB    1 
ATOM   3208  C  CG    . LEU E 1 21  ? 44.343  32.634 -42.777 1.00 101.06 ? 60  LEU E CG    1 
ATOM   3209  C  CD1   . LEU E 1 21  ? 44.531  33.563 -41.605 1.00 101.02 ? 60  LEU E CD1   1 
ATOM   3210  C  CD2   . LEU E 1 21  ? 42.877  32.621 -43.234 1.00 104.06 ? 60  LEU E CD2   1 
ATOM   3211  N  N     . LEU E 1 22  ? 45.376  32.825 -47.207 1.00 97.37  ? 61  LEU E N     1 
ATOM   3212  C  CA    . LEU E 1 22  ? 45.796  33.171 -48.561 1.00 97.31  ? 61  LEU E CA    1 
ATOM   3213  C  C     . LEU E 1 22  ? 46.015  34.661 -48.808 1.00 104.40 ? 61  LEU E C     1 
ATOM   3214  O  O     . LEU E 1 22  ? 46.674  35.019 -49.790 1.00 104.87 ? 61  LEU E O     1 
ATOM   3215  C  CB    . LEU E 1 22  ? 44.819  32.582 -49.587 1.00 96.85  ? 61  LEU E CB    1 
ATOM   3216  C  CG    . LEU E 1 22  ? 44.591  31.065 -49.512 1.00 100.81 ? 61  LEU E CG    1 
ATOM   3217  C  CD1   . LEU E 1 22  ? 43.478  30.646 -50.415 1.00 100.99 ? 61  LEU E CD1   1 
ATOM   3218  C  CD2   . LEU E 1 22  ? 45.827  30.297 -49.863 1.00 101.84 ? 61  LEU E CD2   1 
ATOM   3219  N  N     . ILE E 1 23  ? 45.488  35.526 -47.925 1.00 102.00 ? 62  ILE E N     1 
ATOM   3220  C  CA    . ILE E 1 23  ? 45.685  36.981 -47.973 1.00 101.88 ? 62  ILE E CA    1 
ATOM   3221  C  C     . ILE E 1 23  ? 46.873  37.244 -47.026 1.00 107.75 ? 62  ILE E C     1 
ATOM   3222  O  O     . ILE E 1 23  ? 47.023  36.517 -46.037 1.00 107.49 ? 62  ILE E O     1 
ATOM   3223  C  CB    . ILE E 1 23  ? 44.380  37.717 -47.506 1.00 104.36 ? 62  ILE E CB    1 
ATOM   3224  C  CG1   . ILE E 1 23  ? 43.197  37.447 -48.466 1.00 104.21 ? 62  ILE E CG1   1 
ATOM   3225  C  CG2   . ILE E 1 23  ? 44.600  39.226 -47.309 1.00 105.06 ? 62  ILE E CG2   1 
ATOM   3226  C  CD1   . ILE E 1 23  ? 41.801  37.963 -48.002 1.00 109.08 ? 62  ILE E CD1   1 
ATOM   3227  N  N     . ARG E 1 24  ? 47.724  38.243 -47.313 1.00 105.61 ? 63  ARG E N     1 
ATOM   3228  C  CA    . ARG E 1 24  ? 48.814  38.519 -46.381 1.00 106.08 ? 63  ARG E CA    1 
ATOM   3229  C  C     . ARG E 1 24  ? 48.287  39.252 -45.152 1.00 109.43 ? 63  ARG E C     1 
ATOM   3230  O  O     . ARG E 1 24  ? 47.405  40.103 -45.276 1.00 108.66 ? 63  ARG E O     1 
ATOM   3231  C  CB    . ARG E 1 24  ? 49.996  39.219 -47.044 1.00 109.61 ? 63  ARG E CB    1 
ATOM   3232  C  CG    . ARG E 1 24  ? 50.970  38.258 -47.747 1.00 128.44 ? 63  ARG E CG    1 
ATOM   3233  C  CD    . ARG E 1 24  ? 50.626  38.030 -49.212 1.00 149.08 ? 63  ARG E CD    1 
ATOM   3234  N  NE    . ARG E 1 24  ? 50.652  39.271 -49.998 1.00 165.37 ? 63  ARG E NE    1 
ATOM   3235  C  CZ    . ARG E 1 24  ? 49.574  39.948 -50.395 1.00 181.84 ? 63  ARG E CZ    1 
ATOM   3236  N  NH1   . ARG E 1 24  ? 48.352  39.507 -50.097 1.00 166.66 ? 63  ARG E NH1   1 
ATOM   3237  N  NH2   . ARG E 1 24  ? 49.708  41.073 -51.085 1.00 169.16 ? 63  ARG E NH2   1 
ATOM   3238  N  N     . LYS E 1 25  ? 48.770  38.845 -43.962 1.00 106.18 ? 64  LYS E N     1 
ATOM   3239  C  CA    . LYS E 1 25  ? 48.322  39.307 -42.643 1.00 106.07 ? 64  LYS E CA    1 
ATOM   3240  C  C     . LYS E 1 25  ? 48.425  40.825 -42.425 1.00 109.69 ? 64  LYS E C     1 
ATOM   3241  O  O     . LYS E 1 25  ? 47.434  41.406 -41.993 1.00 109.94 ? 64  LYS E O     1 
ATOM   3242  C  CB    . LYS E 1 25  ? 49.014  38.534 -41.502 1.00 108.66 ? 64  LYS E CB    1 
ATOM   3243  C  CG    . LYS E 1 25  ? 48.581  37.067 -41.417 1.00 120.19 ? 64  LYS E CG    1 
ATOM   3244  C  CD    . LYS E 1 25  ? 49.132  36.362 -40.185 1.00 130.61 ? 64  LYS E CD    1 
ATOM   3245  C  CE    . LYS E 1 25  ? 48.939  34.863 -40.266 1.00 141.51 ? 64  LYS E CE    1 
ATOM   3246  N  NZ    . LYS E 1 25  ? 49.235  34.189 -38.974 1.00 150.76 ? 64  LYS E NZ    1 
ATOM   3247  N  N     . LEU E 1 26  ? 49.573  41.470 -42.725 1.00 105.28 ? 65  LEU E N     1 
ATOM   3248  C  CA    . LEU E 1 26  ? 49.705  42.921 -42.539 1.00 104.76 ? 65  LEU E CA    1 
ATOM   3249  C  C     . LEU E 1 26  ? 48.792  43.733 -43.515 1.00 108.74 ? 65  LEU E C     1 
ATOM   3250  O  O     . LEU E 1 26  ? 48.026  44.563 -43.007 1.00 109.32 ? 65  LEU E O     1 
ATOM   3251  C  CB    . LEU E 1 26  ? 51.168  43.408 -42.553 1.00 104.54 ? 65  LEU E CB    1 
ATOM   3252  C  CG    . LEU E 1 26  ? 51.385  44.903 -42.217 1.00 109.30 ? 65  LEU E CG    1 
ATOM   3253  C  CD1   . LEU E 1 26  ? 50.913  45.265 -40.793 1.00 109.03 ? 65  LEU E CD1   1 
ATOM   3254  C  CD2   . LEU E 1 26  ? 52.843  45.311 -42.419 1.00 112.83 ? 65  LEU E CD2   1 
ATOM   3255  N  N     . PRO E 1 27  ? 48.773  43.483 -44.860 1.00 103.15 ? 66  PRO E N     1 
ATOM   3256  C  CA    . PRO E 1 27  ? 47.820  44.201 -45.735 1.00 101.66 ? 66  PRO E CA    1 
ATOM   3257  C  C     . PRO E 1 27  ? 46.365  44.093 -45.252 1.00 101.58 ? 66  PRO E C     1 
ATOM   3258  O  O     . PRO E 1 27  ? 45.616  45.083 -45.313 1.00 101.52 ? 66  PRO E O     1 
ATOM   3259  C  CB    . PRO E 1 27  ? 47.993  43.499 -47.087 1.00 103.46 ? 66  PRO E CB    1 
ATOM   3260  C  CG    . PRO E 1 27  ? 49.344  43.002 -47.064 1.00 108.46 ? 66  PRO E CG    1 
ATOM   3261  C  CD    . PRO E 1 27  ? 49.592  42.553 -45.655 1.00 104.36 ? 66  PRO E CD    1 
ATOM   3262  N  N     . PHE E 1 28  ? 45.995  42.891 -44.726 1.00 94.25  ? 67  PHE E N     1 
ATOM   3263  C  CA    . PHE E 1 28  ? 44.676  42.594 -44.185 1.00 92.37  ? 67  PHE E CA    1 
ATOM   3264  C  C     . PHE E 1 28  ? 44.401  43.408 -42.926 1.00 95.86  ? 67  PHE E C     1 
ATOM   3265  O  O     . PHE E 1 28  ? 43.357  44.066 -42.844 1.00 94.96  ? 67  PHE E O     1 
ATOM   3266  C  CB    . PHE E 1 28  ? 44.481  41.087 -43.924 1.00 93.11  ? 67  PHE E CB    1 
ATOM   3267  C  CG    . PHE E 1 28  ? 43.022  40.749 -43.718 1.00 93.46  ? 67  PHE E CG    1 
ATOM   3268  C  CD1   . PHE E 1 28  ? 42.183  40.531 -44.803 1.00 95.63  ? 67  PHE E CD1   1 
ATOM   3269  C  CD2   . PHE E 1 28  ? 42.468  40.734 -42.444 1.00 94.41  ? 67  PHE E CD2   1 
ATOM   3270  C  CE1   . PHE E 1 28  ? 40.824  40.288 -44.615 1.00 96.18  ? 67  PHE E CE1   1 
ATOM   3271  C  CE2   . PHE E 1 28  ? 41.109  40.492 -42.260 1.00 96.71  ? 67  PHE E CE2   1 
ATOM   3272  C  CZ    . PHE E 1 28  ? 40.298  40.266 -43.344 1.00 94.91  ? 67  PHE E CZ    1 
ATOM   3273  N  N     . GLN E 1 29  ? 45.342  43.377 -41.957 1.00 92.41  ? 68  GLN E N     1 
ATOM   3274  C  CA    . GLN E 1 29  ? 45.234  44.139 -40.709 1.00 91.91  ? 68  GLN E CA    1 
ATOM   3275  C  C     . GLN E 1 29  ? 45.034  45.637 -40.997 1.00 94.83  ? 68  GLN E C     1 
ATOM   3276  O  O     . GLN E 1 29  ? 44.267  46.294 -40.298 1.00 94.65  ? 68  GLN E O     1 
ATOM   3277  C  CB    . GLN E 1 29  ? 46.454  43.915 -39.799 1.00 93.16  ? 68  GLN E CB    1 
ATOM   3278  C  CG    . GLN E 1 29  ? 46.245  44.472 -38.397 1.00 112.12 ? 68  GLN E CG    1 
ATOM   3279  C  CD    . GLN E 1 29  ? 47.376  44.167 -37.461 1.00 141.41 ? 68  GLN E CD    1 
ATOM   3280  O  OE1   . GLN E 1 29  ? 48.437  44.797 -37.514 1.00 145.93 ? 68  GLN E OE1   1 
ATOM   3281  N  NE2   . GLN E 1 29  ? 47.165  43.207 -36.564 1.00 130.08 ? 68  GLN E NE2   1 
ATOM   3282  N  N     . ARG E 1 30  ? 45.688  46.163 -42.043 1.00 90.11  ? 69  ARG E N     1 
ATOM   3283  C  CA    . ARG E 1 30  ? 45.550  47.563 -42.440 1.00 88.93  ? 69  ARG E CA    1 
ATOM   3284  C  C     . ARG E 1 30  ? 44.136  47.875 -42.916 1.00 90.83  ? 69  ARG E C     1 
ATOM   3285  O  O     . ARG E 1 30  ? 43.568  48.888 -42.509 1.00 91.72  ? 69  ARG E O     1 
ATOM   3286  C  CB    . ARG E 1 30  ? 46.565  47.926 -43.520 1.00 88.68  ? 69  ARG E CB    1 
ATOM   3287  C  CG    . ARG E 1 30  ? 47.929  48.251 -42.946 1.00 103.78 ? 69  ARG E CG    1 
ATOM   3288  C  CD    . ARG E 1 30  ? 48.787  49.042 -43.914 1.00 121.85 ? 69  ARG E CD    1 
ATOM   3289  N  NE    . ARG E 1 30  ? 49.000  48.357 -45.195 1.00 134.82 ? 69  ARG E NE    1 
ATOM   3290  C  CZ    . ARG E 1 30  ? 50.044  47.588 -45.480 1.00 150.14 ? 69  ARG E CZ    1 
ATOM   3291  N  NH1   . ARG E 1 30  ? 51.035  47.451 -44.605 1.00 137.72 ? 69  ARG E NH1   1 
ATOM   3292  N  NH2   . ARG E 1 30  ? 50.145  47.007 -46.666 1.00 136.57 ? 69  ARG E NH2   1 
ATOM   3293  N  N     . LEU E 1 31  ? 43.561  46.988 -43.755 1.00 84.23  ? 70  LEU E N     1 
ATOM   3294  C  CA    . LEU E 1 31  ? 42.210  47.126 -44.299 1.00 82.39  ? 70  LEU E CA    1 
ATOM   3295  C  C     . LEU E 1 31  ? 41.182  47.167 -43.180 1.00 85.96  ? 70  LEU E C     1 
ATOM   3296  O  O     . LEU E 1 31  ? 40.253  47.973 -43.234 1.00 86.41  ? 70  LEU E O     1 
ATOM   3297  C  CB    . LEU E 1 31  ? 41.917  45.991 -45.292 1.00 81.81  ? 70  LEU E CB    1 
ATOM   3298  C  CG    . LEU E 1 31  ? 40.589  46.045 -46.063 1.00 85.60  ? 70  LEU E CG    1 
ATOM   3299  C  CD1   . LEU E 1 31  ? 40.404  47.343 -46.780 1.00 85.37  ? 70  LEU E CD1   1 
ATOM   3300  C  CD2   . LEU E 1 31  ? 40.512  44.945 -47.068 1.00 86.74  ? 70  LEU E CD2   1 
ATOM   3301  N  N     . VAL E 1 32  ? 41.388  46.322 -42.150 1.00 81.35  ? 71  VAL E N     1 
ATOM   3302  C  CA    . VAL E 1 32  ? 40.570  46.192 -40.946 1.00 80.62  ? 71  VAL E CA    1 
ATOM   3303  C  C     . VAL E 1 32  ? 40.582  47.499 -40.151 1.00 85.47  ? 71  VAL E C     1 
ATOM   3304  O  O     . VAL E 1 32  ? 39.514  48.046 -39.884 1.00 86.32  ? 71  VAL E O     1 
ATOM   3305  C  CB    . VAL E 1 32  ? 41.033  44.965 -40.127 1.00 83.92  ? 71  VAL E CB    1 
ATOM   3306  C  CG1   . VAL E 1 32  ? 40.494  44.988 -38.700 1.00 83.50  ? 71  VAL E CG1   1 
ATOM   3307  C  CG2   . VAL E 1 32  ? 40.627  43.681 -40.828 1.00 83.73  ? 71  VAL E CG2   1 
ATOM   3308  N  N     . ARG E 1 33  ? 41.778  48.029 -39.841 1.00 81.68  ? 72  ARG E N     1 
ATOM   3309  C  CA    . ARG E 1 33  ? 41.917  49.277 -39.092 1.00 81.94  ? 72  ARG E CA    1 
ATOM   3310  C  C     . ARG E 1 33  ? 41.358  50.445 -39.856 1.00 86.27  ? 72  ARG E C     1 
ATOM   3311  O  O     . ARG E 1 33  ? 40.783  51.321 -39.218 1.00 85.08  ? 72  ARG E O     1 
ATOM   3312  C  CB    . ARG E 1 33  ? 43.366  49.552 -38.689 1.00 82.23  ? 72  ARG E CB    1 
ATOM   3313  C  CG    . ARG E 1 33  ? 43.986  48.404 -37.939 1.00 93.27  ? 72  ARG E CG    1 
ATOM   3314  C  CD    . ARG E 1 33  ? 45.374  48.723 -37.450 1.00 108.76 ? 72  ARG E CD    1 
ATOM   3315  N  NE    . ARG E 1 33  ? 45.900  47.612 -36.663 1.00 117.96 ? 72  ARG E NE    1 
ATOM   3316  C  CZ    . ARG E 1 33  ? 45.656  47.438 -35.371 1.00 131.49 ? 72  ARG E CZ    1 
ATOM   3317  N  NH1   . ARG E 1 33  ? 44.915  48.313 -34.705 1.00 111.87 ? 72  ARG E NH1   1 
ATOM   3318  N  NH2   . ARG E 1 33  ? 46.149  46.386 -34.734 1.00 123.76 ? 72  ARG E NH2   1 
ATOM   3319  N  N     . GLU E 1 34  ? 41.491  50.435 -41.224 1.00 84.27  ? 73  GLU E N     1 
ATOM   3320  C  CA    . GLU E 1 34  ? 40.984  51.465 -42.143 1.00 84.82  ? 73  GLU E CA    1 
ATOM   3321  C  C     . GLU E 1 34  ? 39.482  51.522 -41.981 1.00 90.14  ? 73  GLU E C     1 
ATOM   3322  O  O     . GLU E 1 34  ? 38.978  52.522 -41.468 1.00 90.66  ? 73  GLU E O     1 
ATOM   3323  C  CB    . GLU E 1 34  ? 41.355  51.178 -43.621 1.00 86.28  ? 73  GLU E CB    1 
ATOM   3324  C  CG    . GLU E 1 34  ? 40.992  52.316 -44.578 1.00 100.49 ? 73  GLU E CG    1 
ATOM   3325  C  CD    . GLU E 1 34  ? 40.947  52.000 -46.064 1.00 128.94 ? 73  GLU E CD    1 
ATOM   3326  O  OE1   . GLU E 1 34  ? 42.021  51.715 -46.641 1.00 127.88 ? 73  GLU E OE1   1 
ATOM   3327  O  OE2   . GLU E 1 34  ? 39.844  52.065 -46.659 1.00 123.78 ? 73  GLU E OE2   1 
ATOM   3328  N  N     . ILE E 1 35  ? 38.785  50.420 -42.341 1.00 86.02  ? 74  ILE E N     1 
ATOM   3329  C  CA    . ILE E 1 35  ? 37.328  50.258 -42.246 1.00 85.91  ? 74  ILE E CA    1 
ATOM   3330  C  C     . ILE E 1 35  ? 36.799  50.644 -40.826 1.00 92.66  ? 74  ILE E C     1 
ATOM   3331  O  O     . ILE E 1 35  ? 35.828  51.408 -40.714 1.00 93.54  ? 74  ILE E O     1 
ATOM   3332  C  CB    . ILE E 1 35  ? 36.904  48.829 -42.725 1.00 87.91  ? 74  ILE E CB    1 
ATOM   3333  C  CG1   . ILE E 1 35  ? 37.122  48.683 -44.255 1.00 87.36  ? 74  ILE E CG1   1 
ATOM   3334  C  CG2   . ILE E 1 35  ? 35.455  48.507 -42.350 1.00 88.45  ? 74  ILE E CG2   1 
ATOM   3335  C  CD1   . ILE E 1 35  ? 37.105  47.271 -44.822 1.00 89.78  ? 74  ILE E CD1   1 
ATOM   3336  N  N     . ALA E 1 36  ? 37.511  50.189 -39.773 1.00 89.36  ? 75  ALA E N     1 
ATOM   3337  C  CA    . ALA E 1 36  ? 37.170  50.462 -38.379 1.00 89.36  ? 75  ALA E CA    1 
ATOM   3338  C  C     . ALA E 1 36  ? 37.192  51.935 -37.997 1.00 93.31  ? 75  ALA E C     1 
ATOM   3339  O  O     . ALA E 1 36  ? 36.278  52.369 -37.305 1.00 92.26  ? 75  ALA E O     1 
ATOM   3340  C  CB    . ALA E 1 36  ? 38.065  49.677 -37.453 1.00 90.24  ? 75  ALA E CB    1 
ATOM   3341  N  N     . GLN E 1 37  ? 38.227  52.700 -38.423 1.00 91.44  ? 76  GLN E N     1 
ATOM   3342  C  CA    . GLN E 1 37  ? 38.374  54.137 -38.127 1.00 91.61  ? 76  GLN E CA    1 
ATOM   3343  C  C     . GLN E 1 37  ? 37.196  54.914 -38.716 1.00 97.30  ? 76  GLN E C     1 
ATOM   3344  O  O     . GLN E 1 37  ? 36.734  55.876 -38.101 1.00 97.79  ? 76  GLN E O     1 
ATOM   3345  C  CB    . GLN E 1 37  ? 39.713  54.681 -38.662 1.00 92.92  ? 76  GLN E CB    1 
ATOM   3346  C  CG    . GLN E 1 37  ? 40.165  55.995 -38.014 1.00 112.13 ? 76  GLN E CG    1 
ATOM   3347  C  CD    . GLN E 1 37  ? 41.518  55.912 -37.331 1.00 134.37 ? 76  GLN E CD    1 
ATOM   3348  O  OE1   . GLN E 1 37  ? 41.656  56.198 -36.133 1.00 128.97 ? 76  GLN E OE1   1 
ATOM   3349  N  NE2   . GLN E 1 37  ? 42.556  55.538 -38.072 1.00 128.32 ? 76  GLN E NE2   1 
ATOM   3350  N  N     . ASP E 1 38  ? 36.674  54.446 -39.880 1.00 94.42  ? 77  ASP E N     1 
ATOM   3351  C  CA    . ASP E 1 38  ? 35.506  54.996 -40.584 1.00 94.06  ? 77  ASP E CA    1 
ATOM   3352  C  C     . ASP E 1 38  ? 34.258  54.686 -39.776 1.00 92.87  ? 77  ASP E C     1 
ATOM   3353  O  O     . ASP E 1 38  ? 33.161  55.076 -40.166 1.00 91.97  ? 77  ASP E O     1 
ATOM   3354  C  CB    . ASP E 1 38  ? 35.355  54.370 -41.999 1.00 97.29  ? 77  ASP E CB    1 
ATOM   3355  C  CG    . ASP E 1 38  ? 36.438  54.704 -43.031 1.00 115.06 ? 77  ASP E CG    1 
ATOM   3356  O  OD1   . ASP E 1 38  ? 36.917  55.882 -43.050 1.00 115.68 ? 77  ASP E OD1   1 
ATOM   3357  O  OD2   . ASP E 1 38  ? 36.787  53.799 -43.846 1.00 122.33 ? 77  ASP E OD2   1 
ATOM   3358  N  N     . PHE E 1 39  ? 34.421  53.971 -38.662 1.00 86.86  ? 78  PHE E N     1 
ATOM   3359  C  CA    . PHE E 1 39  ? 33.273  53.599 -37.824 1.00 85.53  ? 78  PHE E CA    1 
ATOM   3360  C  C     . PHE E 1 39  ? 33.328  54.240 -36.447 1.00 89.81  ? 78  PHE E C     1 
ATOM   3361  O  O     . PHE E 1 39  ? 32.300  54.659 -35.916 1.00 87.33  ? 78  PHE E O     1 
ATOM   3362  C  CB    . PHE E 1 39  ? 33.076  52.065 -37.716 1.00 86.31  ? 78  PHE E CB    1 
ATOM   3363  C  CG    . PHE E 1 39  ? 32.392  51.378 -38.880 1.00 86.59  ? 78  PHE E CG    1 
ATOM   3364  C  CD1   . PHE E 1 39  ? 31.129  51.785 -39.311 1.00 89.12  ? 78  PHE E CD1   1 
ATOM   3365  C  CD2   . PHE E 1 39  ? 32.986  50.293 -39.514 1.00 87.83  ? 78  PHE E CD2   1 
ATOM   3366  C  CE1   . PHE E 1 39  ? 30.512  51.176 -40.413 1.00 90.03  ? 78  PHE E CE1   1 
ATOM   3367  C  CE2   . PHE E 1 39  ? 32.353  49.658 -40.588 1.00 91.16  ? 78  PHE E CE2   1 
ATOM   3368  C  CZ    . PHE E 1 39  ? 31.125  50.112 -41.039 1.00 89.60  ? 78  PHE E CZ    1 
ATOM   3369  N  N     . LYS E 1 40  ? 34.536  54.277 -35.862 1.00 89.38  ? 79  LYS E N     1 
ATOM   3370  C  CA    . LYS E 1 40  ? 34.892  54.861 -34.568 1.00 90.26  ? 79  LYS E CA    1 
ATOM   3371  C  C     . LYS E 1 40  ? 36.407  55.117 -34.532 1.00 96.80  ? 79  LYS E C     1 
ATOM   3372  O  O     . LYS E 1 40  ? 37.220  54.252 -34.866 1.00 94.17  ? 79  LYS E O     1 
ATOM   3373  C  CB    . LYS E 1 40  ? 34.438  53.985 -33.381 1.00 93.13  ? 79  LYS E CB    1 
ATOM   3374  C  CG    . LYS E 1 40  ? 34.559  54.695 -32.030 1.00 109.87 ? 79  LYS E CG    1 
ATOM   3375  C  CD    . LYS E 1 40  ? 34.520  53.717 -30.861 1.00 119.32 ? 79  LYS E CD    1 
ATOM   3376  C  CE    . LYS E 1 40  ? 35.463  54.109 -29.742 1.00 123.94 ? 79  LYS E CE    1 
ATOM   3377  N  NZ    . LYS E 1 40  ? 35.422  53.120 -28.632 1.00 125.52 ? 79  LYS E NZ    1 
ATOM   3378  N  N     . THR E 1 41  ? 36.777  56.337 -34.162 1.00 98.83  ? 80  THR E N     1 
ATOM   3379  C  CA    . THR E 1 41  ? 38.187  56.718 -34.089 1.00 100.44 ? 80  THR E CA    1 
ATOM   3380  C  C     . THR E 1 41  ? 38.858  56.132 -32.829 1.00 107.42 ? 80  THR E C     1 
ATOM   3381  O  O     . THR E 1 41  ? 38.170  55.695 -31.894 1.00 107.62 ? 80  THR E O     1 
ATOM   3382  C  CB    . THR E 1 41  ? 38.341  58.220 -34.254 1.00 110.11 ? 80  THR E CB    1 
ATOM   3383  O  OG1   . THR E 1 41  ? 37.432  58.872 -33.369 1.00 111.65 ? 80  THR E OG1   1 
ATOM   3384  C  CG2   . THR E 1 41  ? 38.089  58.671 -35.691 1.00 109.37 ? 80  THR E CG2   1 
ATOM   3385  N  N     . ASP E 1 42  ? 40.206  56.097 -32.840 1.00 105.25 ? 81  ASP E N     1 
ATOM   3386  C  CA    . ASP E 1 42  ? 41.062  55.522 -31.798 1.00 105.61 ? 81  ASP E CA    1 
ATOM   3387  C  C     . ASP E 1 42  ? 40.528  54.161 -31.319 1.00 106.76 ? 81  ASP E C     1 
ATOM   3388  O  O     . ASP E 1 42  ? 40.128  54.006 -30.156 1.00 107.04 ? 81  ASP E O     1 
ATOM   3389  C  CB    . ASP E 1 42  ? 41.356  56.499 -30.622 1.00 108.60 ? 81  ASP E CB    1 
ATOM   3390  C  CG    . ASP E 1 42  ? 42.609  56.173 -29.790 1.00 124.24 ? 81  ASP E CG    1 
ATOM   3391  O  OD1   . ASP E 1 42  ? 42.934  54.962 -29.632 1.00 125.46 ? 81  ASP E OD1   1 
ATOM   3392  O  OD2   . ASP E 1 42  ? 43.257  57.126 -29.289 1.00 130.60 ? 81  ASP E OD2   1 
ATOM   3393  N  N     . LEU E 1 43  ? 40.471  53.197 -32.249 1.00 99.74  ? 82  LEU E N     1 
ATOM   3394  C  CA    . LEU E 1 43  ? 40.099  51.834 -31.901 1.00 97.83  ? 82  LEU E CA    1 
ATOM   3395  C  C     . LEU E 1 43  ? 41.332  50.966 -31.852 1.00 98.91  ? 82  LEU E C     1 
ATOM   3396  O  O     . LEU E 1 43  ? 42.260  51.146 -32.645 1.00 97.44  ? 82  LEU E O     1 
ATOM   3397  C  CB    . LEU E 1 43  ? 39.085  51.219 -32.869 1.00 97.46  ? 82  LEU E CB    1 
ATOM   3398  C  CG    . LEU E 1 43  ? 37.635  51.626 -32.696 1.00 101.09 ? 82  LEU E CG    1 
ATOM   3399  C  CD1   . LEU E 1 43  ? 36.841  51.155 -33.852 1.00 101.10 ? 82  LEU E CD1   1 
ATOM   3400  C  CD2   . LEU E 1 43  ? 37.041  51.090 -31.407 1.00 101.89 ? 82  LEU E CD2   1 
ATOM   3401  N  N     . ARG E 1 44  ? 41.323  50.005 -30.927 1.00 94.48  ? 83  ARG E N     1 
ATOM   3402  C  CA    . ARG E 1 44  ? 42.368  49.003 -30.763 1.00 93.13  ? 83  ARG E CA    1 
ATOM   3403  C  C     . ARG E 1 44  ? 41.772  47.651 -31.172 1.00 93.56  ? 83  ARG E C     1 
ATOM   3404  O  O     . ARG E 1 44  ? 40.557  47.463 -31.108 1.00 93.38  ? 83  ARG E O     1 
ATOM   3405  C  CB    . ARG E 1 44  ? 42.874  48.952 -29.315 1.00 93.50  ? 83  ARG E CB    1 
ATOM   3406  C  CG    . ARG E 1 44  ? 43.556  50.217 -28.863 1.00 107.98 ? 83  ARG E CG    1 
ATOM   3407  C  CD    . ARG E 1 44  ? 44.680  49.941 -27.878 1.00 123.45 ? 83  ARG E CD    1 
ATOM   3408  N  NE    . ARG E 1 44  ? 44.960  51.091 -27.012 1.00 139.52 ? 83  ARG E NE    1 
ATOM   3409  C  CZ    . ARG E 1 44  ? 45.796  52.090 -27.305 1.00 160.10 ? 83  ARG E CZ    1 
ATOM   3410  N  NH1   . ARG E 1 44  ? 46.430  52.117 -28.472 1.00 149.73 ? 83  ARG E NH1   1 
ATOM   3411  N  NH2   . ARG E 1 44  ? 45.990  53.078 -26.436 1.00 148.20 ? 83  ARG E NH2   1 
ATOM   3412  N  N     . PHE E 1 45  ? 42.623  46.732 -31.618 1.00 87.19  ? 84  PHE E N     1 
ATOM   3413  C  CA    . PHE E 1 45  ? 42.225  45.394 -32.015 1.00 85.87  ? 84  PHE E CA    1 
ATOM   3414  C  C     . PHE E 1 45  ? 43.074  44.367 -31.328 1.00 89.92  ? 84  PHE E C     1 
ATOM   3415  O  O     . PHE E 1 45  ? 44.308  44.458 -31.403 1.00 91.12  ? 84  PHE E O     1 
ATOM   3416  C  CB    . PHE E 1 45  ? 42.383  45.210 -33.527 1.00 86.97  ? 84  PHE E CB    1 
ATOM   3417  C  CG    . PHE E 1 45  ? 41.217  45.723 -34.318 1.00 87.74  ? 84  PHE E CG    1 
ATOM   3418  C  CD1   . PHE E 1 45  ? 40.090  44.932 -34.513 1.00 90.14  ? 84  PHE E CD1   1 
ATOM   3419  C  CD2   . PHE E 1 45  ? 41.239  46.990 -34.871 1.00 89.27  ? 84  PHE E CD2   1 
ATOM   3420  C  CE1   . PHE E 1 45  ? 39.002  45.410 -35.235 1.00 90.76  ? 84  PHE E CE1   1 
ATOM   3421  C  CE2   . PHE E 1 45  ? 40.158  47.460 -35.612 1.00 91.85  ? 84  PHE E CE2   1 
ATOM   3422  C  CZ    . PHE E 1 45  ? 39.035  46.674 -35.770 1.00 89.85  ? 84  PHE E CZ    1 
ATOM   3423  N  N     . GLN E 1 46  ? 42.437  43.353 -30.707 1.00 84.80  ? 85  GLN E N     1 
ATOM   3424  C  CA    . GLN E 1 46  ? 43.182  42.250 -30.128 1.00 84.74  ? 85  GLN E CA    1 
ATOM   3425  C  C     . GLN E 1 46  ? 43.754  41.497 -31.338 1.00 90.45  ? 85  GLN E C     1 
ATOM   3426  O  O     . GLN E 1 46  ? 43.086  41.447 -32.369 1.00 90.11  ? 85  GLN E O     1 
ATOM   3427  C  CB    . GLN E 1 46  ? 42.270  41.317 -29.332 1.00 85.92  ? 85  GLN E CB    1 
ATOM   3428  C  CG    . GLN E 1 46  ? 41.725  41.893 -28.032 1.00 90.90  ? 85  GLN E CG    1 
ATOM   3429  C  CD    . GLN E 1 46  ? 41.101  40.815 -27.176 1.00 98.84  ? 85  GLN E CD    1 
ATOM   3430  O  OE1   . GLN E 1 46  ? 40.532  39.827 -27.666 1.00 89.27  ? 85  GLN E OE1   1 
ATOM   3431  N  NE2   . GLN E 1 46  ? 41.168  40.999 -25.869 1.00 86.70  ? 85  GLN E NE2   1 
ATOM   3432  N  N     . SER E 1 47  ? 44.991  40.969 -31.250 1.00 88.15  ? 86  SER E N     1 
ATOM   3433  C  CA    . SER E 1 47  ? 45.636  40.224 -32.350 1.00 87.99  ? 86  SER E CA    1 
ATOM   3434  C  C     . SER E 1 47  ? 44.657  39.185 -32.932 1.00 91.60  ? 86  SER E C     1 
ATOM   3435  O  O     . SER E 1 47  ? 44.483  39.109 -34.155 1.00 92.55  ? 86  SER E O     1 
ATOM   3436  C  CB    . SER E 1 47  ? 46.882  39.502 -31.850 1.00 91.87  ? 86  SER E CB    1 
ATOM   3437  O  OG    . SER E 1 47  ? 47.406  40.081 -30.666 1.00 105.01 ? 86  SER E OG    1 
ATOM   3438  N  N     . SER E 1 48  ? 43.983  38.430 -32.029 1.00 85.59  ? 87  SER E N     1 
ATOM   3439  C  CA    . SER E 1 48  ? 43.010  37.396 -32.359 1.00 83.99  ? 87  SER E CA    1 
ATOM   3440  C  C     . SER E 1 48  ? 41.762  37.939 -33.025 1.00 86.97  ? 87  SER E C     1 
ATOM   3441  O  O     . SER E 1 48  ? 41.164  37.208 -33.808 1.00 87.79  ? 87  SER E O     1 
ATOM   3442  C  CB    . SER E 1 48  ? 42.638  36.580 -31.123 1.00 85.76  ? 87  SER E CB    1 
ATOM   3443  O  OG    . SER E 1 48  ? 42.066  37.375 -30.097 1.00 89.78  ? 87  SER E OG    1 
ATOM   3444  N  N     . ALA E 1 49  ? 41.347  39.195 -32.707 1.00 81.48  ? 88  ALA E N     1 
ATOM   3445  C  CA    . ALA E 1 49  ? 40.155  39.827 -33.295 1.00 80.13  ? 88  ALA E CA    1 
ATOM   3446  C  C     . ALA E 1 49  ? 40.340  39.981 -34.798 1.00 82.55  ? 88  ALA E C     1 
ATOM   3447  O  O     . ALA E 1 49  ? 39.393  39.738 -35.552 1.00 82.47  ? 88  ALA E O     1 
ATOM   3448  C  CB    . ALA E 1 49  ? 39.884  41.182 -32.656 1.00 80.55  ? 88  ALA E CB    1 
ATOM   3449  N  N     . VAL E 1 50  ? 41.578  40.308 -35.233 1.00 77.36  ? 89  VAL E N     1 
ATOM   3450  C  CA    . VAL E 1 50  ? 41.934  40.459 -36.645 1.00 76.93  ? 89  VAL E CA    1 
ATOM   3451  C  C     . VAL E 1 50  ? 41.976  39.069 -37.296 1.00 81.63  ? 89  VAL E C     1 
ATOM   3452  O  O     . VAL E 1 50  ? 41.416  38.880 -38.376 1.00 81.08  ? 89  VAL E O     1 
ATOM   3453  C  CB    . VAL E 1 50  ? 43.243  41.291 -36.837 1.00 80.58  ? 89  VAL E CB    1 
ATOM   3454  C  CG1   . VAL E 1 50  ? 43.649  41.389 -38.310 1.00 80.34  ? 89  VAL E CG1   1 
ATOM   3455  C  CG2   . VAL E 1 50  ? 43.105  42.687 -36.229 1.00 80.15  ? 89  VAL E CG2   1 
ATOM   3456  N  N     . MET E 1 51  ? 42.579  38.091 -36.606 1.00 79.84  ? 90  MET E N     1 
ATOM   3457  C  CA    . MET E 1 51  ? 42.660  36.708 -37.077 1.00 81.14  ? 90  MET E CA    1 
ATOM   3458  C  C     . MET E 1 51  ? 41.285  36.065 -37.280 1.00 81.42  ? 90  MET E C     1 
ATOM   3459  O  O     . MET E 1 51  ? 41.066  35.385 -38.287 1.00 80.76  ? 90  MET E O     1 
ATOM   3460  C  CB    . MET E 1 51  ? 43.527  35.882 -36.133 1.00 85.35  ? 90  MET E CB    1 
ATOM   3461  C  CG    . MET E 1 51  ? 44.976  36.282 -36.190 1.00 91.93  ? 90  MET E CG    1 
ATOM   3462  S  SD    . MET E 1 51  ? 45.573  36.353 -37.911 1.00 99.05  ? 90  MET E SD    1 
ATOM   3463  C  CE    . MET E 1 51  ? 45.821  34.571 -38.243 1.00 95.85  ? 90  MET E CE    1 
ATOM   3464  N  N     . ALA E 1 52  ? 40.350  36.335 -36.341 1.00 74.90  ? 91  ALA E N     1 
ATOM   3465  C  CA    . ALA E 1 52  ? 38.959  35.911 -36.375 1.00 72.82  ? 91  ALA E CA    1 
ATOM   3466  C  C     . ALA E 1 52  ? 38.310  36.488 -37.627 1.00 75.12  ? 91  ALA E C     1 
ATOM   3467  O  O     . ALA E 1 52  ? 37.663  35.746 -38.359 1.00 76.60  ? 91  ALA E O     1 
ATOM   3468  C  CB    . ALA E 1 52  ? 38.238  36.401 -35.128 1.00 73.05  ? 91  ALA E CB    1 
ATOM   3469  N  N     . LEU E 1 53  ? 38.543  37.784 -37.916 1.00 68.86  ? 92  LEU E N     1 
ATOM   3470  C  CA    . LEU E 1 53  ? 38.042  38.454 -39.118 1.00 67.63  ? 92  LEU E CA    1 
ATOM   3471  C  C     . LEU E 1 53  ? 38.610  37.856 -40.419 1.00 72.36  ? 92  LEU E C     1 
ATOM   3472  O  O     . LEU E 1 53  ? 37.859  37.603 -41.360 1.00 71.77  ? 92  LEU E O     1 
ATOM   3473  C  CB    . LEU E 1 53  ? 38.318  39.950 -39.045 1.00 67.02  ? 92  LEU E CB    1 
ATOM   3474  C  CG    . LEU E 1 53  ? 37.268  40.772 -38.300 1.00 70.77  ? 92  LEU E CG    1 
ATOM   3475  C  CD1   . LEU E 1 53  ? 37.852  42.053 -37.791 1.00 70.51  ? 92  LEU E CD1   1 
ATOM   3476  C  CD2   . LEU E 1 53  ? 36.067  41.052 -39.169 1.00 72.31  ? 92  LEU E CD2   1 
ATOM   3477  N  N     . GLN E 1 54  ? 39.924  37.599 -40.456 1.00 70.07  ? 93  GLN E N     1 
ATOM   3478  C  CA    . GLN E 1 54  ? 40.590  37.036 -41.632 1.00 70.01  ? 93  GLN E CA    1 
ATOM   3479  C  C     . GLN E 1 54  ? 40.081  35.653 -42.001 1.00 72.90  ? 93  GLN E C     1 
ATOM   3480  O  O     . GLN E 1 54  ? 39.791  35.391 -43.177 1.00 73.59  ? 93  GLN E O     1 
ATOM   3481  C  CB    . GLN E 1 54  ? 42.113  37.049 -41.481 1.00 71.33  ? 93  GLN E CB    1 
ATOM   3482  C  CG    . GLN E 1 54  ? 42.729  37.061 -42.859 1.00 81.66  ? 93  GLN E CG    1 
ATOM   3483  C  CD    . GLN E 1 54  ? 44.205  37.129 -42.888 1.00 96.64  ? 93  GLN E CD    1 
ATOM   3484  O  OE1   . GLN E 1 54  ? 44.874  37.373 -41.878 1.00 89.62  ? 93  GLN E OE1   1 
ATOM   3485  N  NE2   . GLN E 1 54  ? 44.737  36.923 -44.079 1.00 92.44  ? 93  GLN E NE2   1 
ATOM   3486  N  N     . GLU E 1 55  ? 39.954  34.786 -40.979 1.00 67.32  ? 94  GLU E N     1 
ATOM   3487  C  CA    . GLU E 1 55  ? 39.408  33.441 -41.088 1.00 66.29  ? 94  GLU E CA    1 
ATOM   3488  C  C     . GLU E 1 55  ? 37.993  33.503 -41.672 1.00 67.39  ? 94  GLU E C     1 
ATOM   3489  O  O     . GLU E 1 55  ? 37.678  32.760 -42.593 1.00 65.67  ? 94  GLU E O     1 
ATOM   3490  C  CB    . GLU E 1 55  ? 39.387  32.769 -39.705 1.00 67.86  ? 94  GLU E CB    1 
ATOM   3491  C  CG    . GLU E 1 55  ? 40.742  32.258 -39.230 1.00 79.70  ? 94  GLU E CG    1 
ATOM   3492  C  CD    . GLU E 1 55  ? 41.416  31.133 -40.010 1.00 105.28 ? 94  GLU E CD    1 
ATOM   3493  O  OE1   . GLU E 1 55  ? 40.725  30.218 -40.516 1.00 104.08 ? 94  GLU E OE1   1 
ATOM   3494  O  OE2   . GLU E 1 55  ? 42.661  31.186 -40.125 1.00 97.98  ? 94  GLU E OE2   1 
ATOM   3495  N  N     . ALA E 1 56  ? 37.178  34.440 -41.169 1.00 64.24  ? 95  ALA E N     1 
ATOM   3496  C  CA    . ALA E 1 56  ? 35.800  34.682 -41.575 1.00 64.52  ? 95  ALA E CA    1 
ATOM   3497  C  C     . ALA E 1 56  ? 35.680  35.121 -43.033 1.00 71.44  ? 95  ALA E C     1 
ATOM   3498  O  O     . ALA E 1 56  ? 34.807  34.619 -43.743 1.00 72.29  ? 95  ALA E O     1 
ATOM   3499  C  CB    . ALA E 1 56  ? 35.171  35.721 -40.658 1.00 64.77  ? 95  ALA E CB    1 
ATOM   3500  N  N     . CYS E 1 57  ? 36.547  36.061 -43.459 1.00 68.81  ? 96  CYS E N     1 
ATOM   3501  C  CA    . CYS E 1 57  ? 36.603  36.652 -44.794 1.00 69.26  ? 96  CYS E CA    1 
ATOM   3502  C  C     . CYS E 1 57  ? 36.943  35.634 -45.828 1.00 71.18  ? 96  CYS E C     1 
ATOM   3503  O  O     . CYS E 1 57  ? 36.255  35.502 -46.837 1.00 70.05  ? 96  CYS E O     1 
ATOM   3504  C  CB    . CYS E 1 57  ? 37.614  37.792 -44.814 1.00 70.85  ? 96  CYS E CB    1 
ATOM   3505  S  SG    . CYS E 1 57  ? 36.956  39.363 -44.223 1.00 75.33  ? 96  CYS E SG    1 
ATOM   3506  N  N     . GLU E 1 58  ? 38.050  34.951 -45.592 1.00 67.56  ? 97  GLU E N     1 
ATOM   3507  C  CA    . GLU E 1 58  ? 38.565  33.940 -46.482 1.00 67.12  ? 97  GLU E CA    1 
ATOM   3508  C  C     . GLU E 1 58  ? 37.602  32.771 -46.577 1.00 70.16  ? 97  GLU E C     1 
ATOM   3509  O  O     . GLU E 1 58  ? 37.325  32.331 -47.696 1.00 70.68  ? 97  GLU E O     1 
ATOM   3510  C  CB    . GLU E 1 58  ? 39.976  33.538 -46.064 1.00 68.31  ? 97  GLU E CB    1 
ATOM   3511  C  CG    . GLU E 1 58  ? 40.949  34.680 -46.272 1.00 78.30  ? 97  GLU E CG    1 
ATOM   3512  C  CD    . GLU E 1 58  ? 42.395  34.261 -46.342 1.00 115.42 ? 97  GLU E CD    1 
ATOM   3513  O  OE1   . GLU E 1 58  ? 42.672  33.213 -46.968 1.00 116.68 ? 97  GLU E OE1   1 
ATOM   3514  O  OE2   . GLU E 1 58  ? 43.250  34.978 -45.772 1.00 121.25 ? 97  GLU E OE2   1 
ATOM   3515  N  N     . ALA E 1 59  ? 37.011  32.334 -45.434 1.00 64.69  ? 98  ALA E N     1 
ATOM   3516  C  CA    . ALA E 1 59  ? 36.013  31.268 -45.469 1.00 63.55  ? 98  ALA E CA    1 
ATOM   3517  C  C     . ALA E 1 59  ? 34.839  31.735 -46.337 1.00 65.11  ? 98  ALA E C     1 
ATOM   3518  O  O     . ALA E 1 59  ? 34.519  31.059 -47.308 1.00 66.03  ? 98  ALA E O     1 
ATOM   3519  C  CB    . ALA E 1 59  ? 35.545  30.925 -44.072 1.00 64.52  ? 98  ALA E CB    1 
ATOM   3520  N  N     . TYR E 1 60  ? 34.306  32.946 -46.088 1.00 58.40  ? 99  TYR E N     1 
ATOM   3521  C  CA    . TYR E 1 60  ? 33.232  33.531 -46.894 1.00 56.12  ? 99  TYR E CA    1 
ATOM   3522  C  C     . TYR E 1 60  ? 33.525  33.528 -48.394 1.00 58.90  ? 99  TYR E C     1 
ATOM   3523  O  O     . TYR E 1 60  ? 32.701  33.026 -49.169 1.00 57.21  ? 99  TYR E O     1 
ATOM   3524  C  CB    . TYR E 1 60  ? 32.911  34.966 -46.419 1.00 55.44  ? 99  TYR E CB    1 
ATOM   3525  C  CG    . TYR E 1 60  ? 32.031  35.749 -47.372 1.00 53.96  ? 99  TYR E CG    1 
ATOM   3526  C  CD1   . TYR E 1 60  ? 30.669  35.484 -47.471 1.00 53.41  ? 99  TYR E CD1   1 
ATOM   3527  C  CD2   . TYR E 1 60  ? 32.557  36.763 -48.165 1.00 55.46  ? 99  TYR E CD2   1 
ATOM   3528  C  CE1   . TYR E 1 60  ? 29.861  36.171 -48.373 1.00 50.40  ? 99  TYR E CE1   1 
ATOM   3529  C  CE2   . TYR E 1 60  ? 31.752  37.482 -49.047 1.00 56.61  ? 99  TYR E CE2   1 
ATOM   3530  C  CZ    . TYR E 1 60  ? 30.409  37.164 -49.166 1.00 62.79  ? 99  TYR E CZ    1 
ATOM   3531  O  OH    . TYR E 1 60  ? 29.632  37.856 -50.060 1.00 66.22  ? 99  TYR E OH    1 
ATOM   3532  N  N     . LEU E 1 61  ? 34.692  34.106 -48.778 1.00 57.09  ? 100 LEU E N     1 
ATOM   3533  C  CA    . LEU E 1 61  ? 35.139  34.308 -50.161 1.00 58.14  ? 100 LEU E CA    1 
ATOM   3534  C  C     . LEU E 1 61  ? 35.337  33.031 -50.924 1.00 61.67  ? 100 LEU E C     1 
ATOM   3535  O  O     . LEU E 1 61  ? 34.935  32.966 -52.080 1.00 60.47  ? 100 LEU E O     1 
ATOM   3536  C  CB    . LEU E 1 61  ? 36.396  35.200 -50.277 1.00 58.51  ? 100 LEU E CB    1 
ATOM   3537  C  CG    . LEU E 1 61  ? 36.256  36.702 -50.006 1.00 64.17  ? 100 LEU E CG    1 
ATOM   3538  C  CD1   . LEU E 1 61  ? 37.591  37.384 -50.166 1.00 65.40  ? 100 LEU E CD1   1 
ATOM   3539  C  CD2   . LEU E 1 61  ? 35.263  37.381 -50.946 1.00 65.85  ? 100 LEU E CD2   1 
ATOM   3540  N  N     . VAL E 1 62  ? 35.951  32.026 -50.300 1.00 60.19  ? 101 VAL E N     1 
ATOM   3541  C  CA    . VAL E 1 62  ? 36.178  30.704 -50.902 1.00 60.99  ? 101 VAL E CA    1 
ATOM   3542  C  C     . VAL E 1 62  ? 34.823  30.017 -51.223 1.00 63.34  ? 101 VAL E C     1 
ATOM   3543  O  O     . VAL E 1 62  ? 34.621  29.557 -52.350 1.00 62.79  ? 101 VAL E O     1 
ATOM   3544  C  CB    . VAL E 1 62  ? 37.119  29.838 -50.022 1.00 66.02  ? 101 VAL E CB    1 
ATOM   3545  C  CG1   . VAL E 1 62  ? 37.145  28.386 -50.489 1.00 66.08  ? 101 VAL E CG1   1 
ATOM   3546  C  CG2   . VAL E 1 62  ? 38.535  30.423 -50.005 1.00 66.03  ? 101 VAL E CG2   1 
ATOM   3547  N  N     . GLY E 1 63  ? 33.905  30.023 -50.260 1.00 58.07  ? 102 GLY E N     1 
ATOM   3548  C  CA    . GLY E 1 63  ? 32.550  29.525 -50.453 1.00 57.21  ? 102 GLY E CA    1 
ATOM   3549  C  C     . GLY E 1 63  ? 31.779  30.315 -51.502 1.00 60.49  ? 102 GLY E C     1 
ATOM   3550  O  O     . GLY E 1 63  ? 30.906  29.762 -52.168 1.00 61.04  ? 102 GLY E O     1 
ATOM   3551  N  N     . LEU E 1 64  ? 32.092  31.611 -51.671 1.00 56.34  ? 103 LEU E N     1 
ATOM   3552  C  CA    . LEU E 1 64  ? 31.455  32.420 -52.714 1.00 56.49  ? 103 LEU E CA    1 
ATOM   3553  C  C     . LEU E 1 64  ? 31.991  32.021 -54.086 1.00 66.15  ? 103 LEU E C     1 
ATOM   3554  O  O     . LEU E 1 64  ? 31.210  31.899 -55.029 1.00 66.40  ? 103 LEU E O     1 
ATOM   3555  C  CB    . LEU E 1 64  ? 31.611  33.929 -52.473 1.00 55.22  ? 103 LEU E CB    1 
ATOM   3556  C  CG    . LEU E 1 64  ? 30.904  34.852 -53.465 1.00 58.07  ? 103 LEU E CG    1 
ATOM   3557  C  CD1   . LEU E 1 64  ? 29.409  34.782 -53.350 1.00 57.84  ? 103 LEU E CD1   1 
ATOM   3558  C  CD2   . LEU E 1 64  ? 31.296  36.236 -53.248 1.00 60.20  ? 103 LEU E CD2   1 
ATOM   3559  N  N     . PHE E 1 65  ? 33.311  31.752 -54.178 1.00 65.96  ? 104 PHE E N     1 
ATOM   3560  C  CA    . PHE E 1 65  ? 33.961  31.320 -55.409 1.00 67.28  ? 104 PHE E CA    1 
ATOM   3561  C  C     . PHE E 1 65  ? 33.464  29.947 -55.837 1.00 71.89  ? 104 PHE E C     1 
ATOM   3562  O  O     . PHE E 1 65  ? 33.515  29.608 -57.017 1.00 73.42  ? 104 PHE E O     1 
ATOM   3563  C  CB    . PHE E 1 65  ? 35.483  31.353 -55.254 1.00 70.46  ? 104 PHE E CB    1 
ATOM   3564  C  CG    . PHE E 1 65  ? 36.086  32.722 -55.470 1.00 74.00  ? 104 PHE E CG    1 
ATOM   3565  C  CD1   . PHE E 1 65  ? 35.828  33.441 -56.638 1.00 79.02  ? 104 PHE E CD1   1 
ATOM   3566  C  CD2   . PHE E 1 65  ? 36.949  33.275 -54.532 1.00 77.92  ? 104 PHE E CD2   1 
ATOM   3567  C  CE1   . PHE E 1 65  ? 36.396  34.704 -56.845 1.00 80.62  ? 104 PHE E CE1   1 
ATOM   3568  C  CE2   . PHE E 1 65  ? 37.529  34.533 -54.745 1.00 81.72  ? 104 PHE E CE2   1 
ATOM   3569  C  CZ    . PHE E 1 65  ? 37.247  35.240 -55.900 1.00 80.14  ? 104 PHE E CZ    1 
ATOM   3570  N  N     . GLU E 1 66  ? 32.944  29.174 -54.883 1.00 67.10  ? 105 GLU E N     1 
ATOM   3571  C  CA    . GLU E 1 66  ? 32.360  27.867 -55.147 1.00 66.03  ? 105 GLU E CA    1 
ATOM   3572  C  C     . GLU E 1 66  ? 31.060  28.069 -55.926 1.00 70.23  ? 105 GLU E C     1 
ATOM   3573  O  O     . GLU E 1 66  ? 30.945  27.554 -57.042 1.00 70.35  ? 105 GLU E O     1 
ATOM   3574  C  CB    . GLU E 1 66  ? 32.156  27.088 -53.833 1.00 66.76  ? 105 GLU E CB    1 
ATOM   3575  C  CG    . GLU E 1 66  ? 33.477  26.571 -53.289 1.00 73.74  ? 105 GLU E CG    1 
ATOM   3576  C  CD    . GLU E 1 66  ? 33.547  25.831 -51.967 1.00 94.24  ? 105 GLU E CD    1 
ATOM   3577  O  OE1   . GLU E 1 66  ? 32.557  25.844 -51.202 1.00 72.04  ? 105 GLU E OE1   1 
ATOM   3578  O  OE2   . GLU E 1 66  ? 34.615  25.235 -51.695 1.00 103.54 ? 105 GLU E OE2   1 
ATOM   3579  N  N     . ASP E 1 67  ? 30.130  28.900 -55.383 1.00 65.41  ? 106 ASP E N     1 
ATOM   3580  C  CA    . ASP E 1 67  ? 28.833  29.204 -55.997 1.00 64.01  ? 106 ASP E CA    1 
ATOM   3581  C  C     . ASP E 1 67  ? 29.025  29.956 -57.298 1.00 65.70  ? 106 ASP E C     1 
ATOM   3582  O  O     . ASP E 1 67  ? 28.260  29.750 -58.242 1.00 64.71  ? 106 ASP E O     1 
ATOM   3583  C  CB    . ASP E 1 67  ? 27.931  30.016 -55.040 1.00 65.53  ? 106 ASP E CB    1 
ATOM   3584  C  CG    . ASP E 1 67  ? 27.656  29.416 -53.671 1.00 72.47  ? 106 ASP E CG    1 
ATOM   3585  O  OD1   . ASP E 1 67  ? 28.016  28.221 -53.450 1.00 75.76  ? 106 ASP E OD1   1 
ATOM   3586  O  OD2   . ASP E 1 67  ? 27.083  30.131 -52.819 1.00 66.79  ? 106 ASP E OD2   1 
ATOM   3587  N  N     . THR E 1 68  ? 30.055  30.814 -57.351 1.00 61.81  ? 107 THR E N     1 
ATOM   3588  C  CA    . THR E 1 68  ? 30.366  31.597 -58.536 1.00 62.57  ? 107 THR E CA    1 
ATOM   3589  C  C     . THR E 1 68  ? 30.697  30.655 -59.691 1.00 70.13  ? 107 THR E C     1 
ATOM   3590  O  O     . THR E 1 68  ? 30.112  30.782 -60.767 1.00 70.83  ? 107 THR E O     1 
ATOM   3591  C  CB    . THR E 1 68  ? 31.445  32.652 -58.220 1.00 69.30  ? 107 THR E CB    1 
ATOM   3592  O  OG1   . THR E 1 68  ? 30.931  33.545 -57.225 1.00 70.77  ? 107 THR E OG1   1 
ATOM   3593  C  CG2   . THR E 1 68  ? 31.852  33.462 -59.445 1.00 63.33  ? 107 THR E CG2   1 
ATOM   3594  N  N     . ASN E 1 69  ? 31.579  29.672 -59.438 1.00 67.86  ? 108 ASN E N     1 
ATOM   3595  C  CA    . ASN E 1 69  ? 32.021  28.684 -60.416 1.00 68.44  ? 108 ASN E CA    1 
ATOM   3596  C  C     . ASN E 1 69  ? 30.830  27.861 -60.897 1.00 73.24  ? 108 ASN E C     1 
ATOM   3597  O  O     . ASN E 1 69  ? 30.690  27.635 -62.098 1.00 74.42  ? 108 ASN E O     1 
ATOM   3598  C  CB    . ASN E 1 69  ? 33.126  27.806 -59.809 1.00 71.94  ? 108 ASN E CB    1 
ATOM   3599  C  CG    . ASN E 1 69  ? 34.014  27.077 -60.799 1.00 103.75 ? 108 ASN E CG    1 
ATOM   3600  O  OD1   . ASN E 1 69  ? 34.600  27.656 -61.743 1.00 100.58 ? 108 ASN E OD1   1 
ATOM   3601  N  ND2   . ASN E 1 69  ? 34.154  25.776 -60.567 1.00 94.04  ? 108 ASN E ND2   1 
ATOM   3602  N  N     . LEU E 1 70  ? 29.924  27.495 -59.975 1.00 68.63  ? 109 LEU E N     1 
ATOM   3603  C  CA    . LEU E 1 70  ? 28.701  26.752 -60.303 1.00 67.81  ? 109 LEU E CA    1 
ATOM   3604  C  C     . LEU E 1 70  ? 27.858  27.545 -61.314 1.00 72.74  ? 109 LEU E C     1 
ATOM   3605  O  O     . LEU E 1 70  ? 27.340  26.968 -62.279 1.00 72.67  ? 109 LEU E O     1 
ATOM   3606  C  CB    . LEU E 1 70  ? 27.893  26.450 -59.038 1.00 67.14  ? 109 LEU E CB    1 
ATOM   3607  C  CG    . LEU E 1 70  ? 28.359  25.265 -58.223 1.00 71.31  ? 109 LEU E CG    1 
ATOM   3608  C  CD1   . LEU E 1 70  ? 27.743  25.305 -56.870 1.00 71.89  ? 109 LEU E CD1   1 
ATOM   3609  C  CD2   . LEU E 1 70  ? 28.196  23.957 -58.986 1.00 73.54  ? 109 LEU E CD2   1 
ATOM   3610  N  N     . CYS E 1 71  ? 27.805  28.881 -61.124 1.00 68.86  ? 110 CYS E N     1 
ATOM   3611  C  CA    . CYS E 1 71  ? 27.099  29.800 -62.013 1.00 68.16  ? 110 CYS E CA    1 
ATOM   3612  C  C     . CYS E 1 71  ? 27.798  29.908 -63.366 1.00 75.19  ? 110 CYS E C     1 
ATOM   3613  O  O     . CYS E 1 71  ? 27.110  29.866 -64.390 1.00 77.39  ? 110 CYS E O     1 
ATOM   3614  C  CB    . CYS E 1 71  ? 26.918  31.165 -61.362 1.00 67.14  ? 110 CYS E CB    1 
ATOM   3615  S  SG    . CYS E 1 71  ? 25.710  31.185 -60.022 1.00 70.47  ? 110 CYS E SG    1 
ATOM   3616  N  N     . ALA E 1 72  ? 29.155  30.013 -63.378 1.00 70.40  ? 111 ALA E N     1 
ATOM   3617  C  CA    . ALA E 1 72  ? 29.916  30.096 -64.624 1.00 69.80  ? 111 ALA E CA    1 
ATOM   3618  C  C     . ALA E 1 72  ? 29.618  28.846 -65.448 1.00 74.22  ? 111 ALA E C     1 
ATOM   3619  O  O     . ALA E 1 72  ? 29.114  28.964 -66.567 1.00 74.05  ? 111 ALA E O     1 
ATOM   3620  C  CB    . ALA E 1 72  ? 31.406  30.211 -64.331 1.00 70.39  ? 111 ALA E CB    1 
ATOM   3621  N  N     . ILE E 1 73  ? 29.790  27.658 -64.827 1.00 70.68  ? 112 ILE E N     1 
ATOM   3622  C  CA    . ILE E 1 73  ? 29.544  26.356 -65.438 1.00 70.52  ? 112 ILE E CA    1 
ATOM   3623  C  C     . ILE E 1 73  ? 28.095  26.251 -65.938 1.00 76.54  ? 112 ILE E C     1 
ATOM   3624  O  O     . ILE E 1 73  ? 27.874  25.674 -67.004 1.00 77.81  ? 112 ILE E O     1 
ATOM   3625  C  CB    . ILE E 1 73  ? 29.974  25.167 -64.510 1.00 72.86  ? 112 ILE E CB    1 
ATOM   3626  C  CG1   . ILE E 1 73  ? 31.453  25.287 -64.092 1.00 72.43  ? 112 ILE E CG1   1 
ATOM   3627  C  CG2   . ILE E 1 73  ? 29.734  23.801 -65.188 1.00 72.86  ? 112 ILE E CG2   1 
ATOM   3628  C  CD1   . ILE E 1 73  ? 31.856  24.474 -62.881 1.00 71.20  ? 112 ILE E CD1   1 
ATOM   3629  N  N     . HIS E 1 74  ? 27.124  26.830 -65.197 1.00 72.20  ? 113 HIS E N     1 
ATOM   3630  C  CA    . HIS E 1 74  ? 25.704  26.809 -65.568 1.00 72.19  ? 113 HIS E CA    1 
ATOM   3631  C  C     . HIS E 1 74  ? 25.449  27.444 -66.926 1.00 77.69  ? 113 HIS E C     1 
ATOM   3632  O  O     . HIS E 1 74  ? 24.617  26.956 -67.694 1.00 76.56  ? 113 HIS E O     1 
ATOM   3633  C  CB    . HIS E 1 74  ? 24.860  27.526 -64.517 1.00 72.62  ? 113 HIS E CB    1 
ATOM   3634  C  CG    . HIS E 1 74  ? 23.391  27.432 -64.783 1.00 75.95  ? 113 HIS E CG    1 
ATOM   3635  N  ND1   . HIS E 1 74  ? 22.684  26.269 -64.520 1.00 77.29  ? 113 HIS E ND1   1 
ATOM   3636  C  CD2   . HIS E 1 74  ? 22.541  28.354 -65.290 1.00 77.06  ? 113 HIS E CD2   1 
ATOM   3637  C  CE1   . HIS E 1 74  ? 21.433  26.526 -64.857 1.00 76.49  ? 113 HIS E CE1   1 
ATOM   3638  N  NE2   . HIS E 1 74  ? 21.296  27.766 -65.325 1.00 76.66  ? 113 HIS E NE2   1 
ATOM   3639  N  N     . ALA E 1 75  ? 26.170  28.544 -67.199 1.00 77.08  ? 114 ALA E N     1 
ATOM   3640  C  CA    . ALA E 1 75  ? 26.115  29.339 -68.425 1.00 78.16  ? 114 ALA E CA    1 
ATOM   3641  C  C     . ALA E 1 75  ? 27.036  28.753 -69.531 1.00 86.57  ? 114 ALA E C     1 
ATOM   3642  O  O     . ALA E 1 75  ? 27.288  29.402 -70.554 1.00 86.70  ? 114 ALA E O     1 
ATOM   3643  C  CB    . ALA E 1 75  ? 26.491  30.784 -68.109 1.00 78.51  ? 114 ALA E CB    1 
ATOM   3644  N  N     . LYS E 1 76  ? 27.498  27.505 -69.325 1.00 85.97  ? 115 LYS E N     1 
ATOM   3645  C  CA    . LYS E 1 76  ? 28.393  26.741 -70.206 1.00 87.49  ? 115 LYS E CA    1 
ATOM   3646  C  C     . LYS E 1 76  ? 29.794  27.394 -70.357 1.00 94.09  ? 115 LYS E C     1 
ATOM   3647  O  O     . LYS E 1 76  ? 30.482  27.183 -71.365 1.00 93.37  ? 115 LYS E O     1 
ATOM   3648  C  CB    . LYS E 1 76  ? 27.753  26.410 -71.583 1.00 90.54  ? 115 LYS E CB    1 
ATOM   3649  C  CG    . LYS E 1 76  ? 26.412  25.656 -71.509 1.00 108.03 ? 115 LYS E CG    1 
ATOM   3650  C  CD    . LYS E 1 76  ? 26.553  24.107 -71.324 1.00 114.15 ? 115 LYS E CD    1 
ATOM   3651  C  CE    . LYS E 1 76  ? 25.282  23.433 -70.882 1.00 122.15 ? 115 LYS E CE    1 
ATOM   3652  N  NZ    . LYS E 1 76  ? 25.048  23.536 -69.412 1.00 127.69 ? 115 LYS E NZ    1 
ATOM   3653  N  N     . ARG E 1 77  ? 30.219  28.148 -69.330 1.00 92.72  ? 116 ARG E N     1 
ATOM   3654  C  CA    . ARG E 1 77  ? 31.539  28.767 -69.267 1.00 93.28  ? 116 ARG E CA    1 
ATOM   3655  C  C     . ARG E 1 77  ? 32.430  27.988 -68.271 1.00 101.00 ? 116 ARG E C     1 
ATOM   3656  O  O     . ARG E 1 77  ? 31.939  27.152 -67.502 1.00 100.80 ? 116 ARG E O     1 
ATOM   3657  C  CB    . ARG E 1 77  ? 31.440  30.258 -68.902 1.00 91.24  ? 116 ARG E CB    1 
ATOM   3658  C  CG    . ARG E 1 77  ? 31.014  31.149 -70.068 1.00 93.63  ? 116 ARG E CG    1 
ATOM   3659  C  CD    . ARG E 1 77  ? 30.981  32.618 -69.693 1.00 97.10  ? 116 ARG E CD    1 
ATOM   3660  N  NE    . ARG E 1 77  ? 29.758  32.976 -68.962 1.00 102.49 ? 116 ARG E NE    1 
ATOM   3661  C  CZ    . ARG E 1 77  ? 29.686  33.145 -67.645 1.00 107.86 ? 116 ARG E CZ    1 
ATOM   3662  N  NH1   . ARG E 1 77  ? 30.769  33.006 -66.889 1.00 95.57  ? 116 ARG E NH1   1 
ATOM   3663  N  NH2   . ARG E 1 77  ? 28.533  33.466 -67.072 1.00 83.30  ? 116 ARG E NH2   1 
ATOM   3664  N  N     . VAL E 1 78  ? 33.735  28.240 -68.321 1.00 99.99  ? 117 VAL E N     1 
ATOM   3665  C  CA    . VAL E 1 78  ? 34.766  27.617 -67.494 1.00 101.11 ? 117 VAL E CA    1 
ATOM   3666  C  C     . VAL E 1 78  ? 35.334  28.702 -66.572 1.00 103.82 ? 117 VAL E C     1 
ATOM   3667  O  O     . VAL E 1 78  ? 35.659  28.424 -65.406 1.00 103.19 ? 117 VAL E O     1 
ATOM   3668  C  CB    . VAL E 1 78  ? 35.843  26.990 -68.431 1.00 107.22 ? 117 VAL E CB    1 
ATOM   3669  C  CG1   . VAL E 1 78  ? 37.188  26.789 -67.731 1.00 107.66 ? 117 VAL E CG1   1 
ATOM   3670  C  CG2   . VAL E 1 78  ? 35.348  25.680 -69.055 1.00 107.50 ? 117 VAL E CG2   1 
ATOM   3671  N  N     . THR E 1 79  ? 35.423  29.945 -67.120 1.00 99.46  ? 118 THR E N     1 
ATOM   3672  C  CA    . THR E 1 79  ? 35.929  31.159 -66.469 1.00 98.61  ? 118 THR E CA    1 
ATOM   3673  C  C     . THR E 1 79  ? 34.820  31.992 -65.815 1.00 98.91  ? 118 THR E C     1 
ATOM   3674  O  O     . THR E 1 79  ? 33.821  32.335 -66.458 1.00 97.88  ? 118 THR E O     1 
ATOM   3675  C  CB    . THR E 1 79  ? 36.839  32.022 -67.400 1.00 109.02 ? 118 THR E CB    1 
ATOM   3676  O  OG1   . THR E 1 79  ? 36.626  33.424 -67.188 1.00 110.08 ? 118 THR E OG1   1 
ATOM   3677  C  CG2   . THR E 1 79  ? 36.734  31.669 -68.873 1.00 106.32 ? 118 THR E CG2   1 
ATOM   3678  N  N     . ILE E 1 80  ? 35.053  32.336 -64.529 1.00 93.22  ? 119 ILE E N     1 
ATOM   3679  C  CA    . ILE E 1 80  ? 34.180  33.137 -63.664 1.00 91.81  ? 119 ILE E CA    1 
ATOM   3680  C  C     . ILE E 1 80  ? 34.178  34.605 -64.086 1.00 94.31  ? 119 ILE E C     1 
ATOM   3681  O  O     . ILE E 1 80  ? 35.227  35.158 -64.399 1.00 94.16  ? 119 ILE E O     1 
ATOM   3682  C  CB    . ILE E 1 80  ? 34.505  32.940 -62.152 1.00 94.02  ? 119 ILE E CB    1 
ATOM   3683  C  CG1   . ILE E 1 80  ? 35.984  33.308 -61.807 1.00 93.50  ? 119 ILE E CG1   1 
ATOM   3684  C  CG2   . ILE E 1 80  ? 34.151  31.522 -61.719 1.00 93.90  ? 119 ILE E CG2   1 
ATOM   3685  C  CD1   . ILE E 1 80  ? 36.270  33.629 -60.352 1.00 92.56  ? 119 ILE E CD1   1 
ATOM   3686  N  N     . MET E 1 81  ? 32.995  35.221 -64.090 1.00 89.60  ? 120 MET E N     1 
ATOM   3687  C  CA    . MET E 1 81  ? 32.759  36.605 -64.503 1.00 88.61  ? 120 MET E CA    1 
ATOM   3688  C  C     . MET E 1 81  ? 31.980  37.362 -63.423 1.00 89.48  ? 120 MET E C     1 
ATOM   3689  O  O     . MET E 1 81  ? 31.335  36.705 -62.601 1.00 88.05  ? 120 MET E O     1 
ATOM   3690  C  CB    . MET E 1 81  ? 31.945  36.607 -65.802 1.00 91.25  ? 120 MET E CB    1 
ATOM   3691  C  CG    . MET E 1 81  ? 32.741  36.234 -67.012 1.00 94.91  ? 120 MET E CG    1 
ATOM   3692  S  SD    . MET E 1 81  ? 31.658  36.170 -68.447 1.00 99.13  ? 120 MET E SD    1 
ATOM   3693  C  CE    . MET E 1 81  ? 32.870  36.285 -69.736 1.00 95.98  ? 120 MET E CE    1 
ATOM   3694  N  N     . PRO E 1 82  ? 31.979  38.726 -63.404 1.00 85.05  ? 121 PRO E N     1 
ATOM   3695  C  CA    . PRO E 1 82  ? 31.202  39.444 -62.372 1.00 84.39  ? 121 PRO E CA    1 
ATOM   3696  C  C     . PRO E 1 82  ? 29.728  39.031 -62.273 1.00 85.88  ? 121 PRO E C     1 
ATOM   3697  O  O     . PRO E 1 82  ? 29.214  38.899 -61.160 1.00 85.63  ? 121 PRO E O     1 
ATOM   3698  C  CB    . PRO E 1 82  ? 31.354  40.912 -62.780 1.00 86.05  ? 121 PRO E CB    1 
ATOM   3699  C  CG    . PRO E 1 82  ? 32.606  40.960 -63.541 1.00 90.22  ? 121 PRO E CG    1 
ATOM   3700  C  CD    . PRO E 1 82  ? 32.674  39.684 -64.294 1.00 85.96  ? 121 PRO E CD    1 
ATOM   3701  N  N     . LYS E 1 83  ? 29.077  38.766 -63.437 1.00 80.20  ? 122 LYS E N     1 
ATOM   3702  C  CA    . LYS E 1 83  ? 27.672  38.349 -63.540 1.00 78.55  ? 122 LYS E CA    1 
ATOM   3703  C  C     . LYS E 1 83  ? 27.375  37.073 -62.776 1.00 76.72  ? 122 LYS E C     1 
ATOM   3704  O  O     . LYS E 1 83  ? 26.237  36.911 -62.332 1.00 75.26  ? 122 LYS E O     1 
ATOM   3705  C  CB    . LYS E 1 83  ? 27.180  38.263 -64.999 1.00 81.82  ? 122 LYS E CB    1 
ATOM   3706  C  CG    . LYS E 1 83  ? 27.915  37.312 -65.942 1.00 93.63  ? 122 LYS E CG    1 
ATOM   3707  C  CD    . LYS E 1 83  ? 27.565  37.690 -67.381 1.00 100.31 ? 122 LYS E CD    1 
ATOM   3708  C  CE    . LYS E 1 83  ? 27.562  36.528 -68.336 1.00 112.23 ? 122 LYS E CE    1 
ATOM   3709  N  NZ    . LYS E 1 83  ? 26.894  36.880 -69.618 1.00 121.14 ? 122 LYS E NZ    1 
ATOM   3710  N  N     . ASP E 1 84  ? 28.412  36.212 -62.571 1.00 70.40  ? 123 ASP E N     1 
ATOM   3711  C  CA    . ASP E 1 84  ? 28.338  34.960 -61.796 1.00 69.03  ? 123 ASP E CA    1 
ATOM   3712  C  C     . ASP E 1 84  ? 28.395  35.262 -60.282 1.00 68.93  ? 123 ASP E C     1 
ATOM   3713  O  O     . ASP E 1 84  ? 27.576  34.716 -59.529 1.00 68.34  ? 123 ASP E O     1 
ATOM   3714  C  CB    . ASP E 1 84  ? 29.451  33.966 -62.195 1.00 70.67  ? 123 ASP E CB    1 
ATOM   3715  C  CG    . ASP E 1 84  ? 29.532  33.648 -63.671 1.00 79.59  ? 123 ASP E CG    1 
ATOM   3716  O  OD1   . ASP E 1 84  ? 28.491  33.301 -64.260 1.00 78.30  ? 123 ASP E OD1   1 
ATOM   3717  O  OD2   . ASP E 1 84  ? 30.646  33.730 -64.235 1.00 88.15  ? 123 ASP E OD2   1 
ATOM   3718  N  N     . ILE E 1 85  ? 29.353  36.141 -59.845 1.00 61.08  ? 124 ILE E N     1 
ATOM   3719  C  CA    . ILE E 1 85  ? 29.486  36.582 -58.449 1.00 59.26  ? 124 ILE E CA    1 
ATOM   3720  C  C     . ILE E 1 85  ? 28.150  37.236 -58.055 1.00 60.90  ? 124 ILE E C     1 
ATOM   3721  O  O     . ILE E 1 85  ? 27.611  36.936 -56.985 1.00 61.43  ? 124 ILE E O     1 
ATOM   3722  C  CB    . ILE E 1 85  ? 30.679  37.567 -58.233 1.00 61.96  ? 124 ILE E CB    1 
ATOM   3723  C  CG1   . ILE E 1 85  ? 32.042  36.881 -58.409 1.00 61.30  ? 124 ILE E CG1   1 
ATOM   3724  C  CG2   . ILE E 1 85  ? 30.605  38.236 -56.856 1.00 63.13  ? 124 ILE E CG2   1 
ATOM   3725  C  CD1   . ILE E 1 85  ? 33.298  37.808 -58.287 1.00 61.96  ? 124 ILE E CD1   1 
ATOM   3726  N  N     . GLN E 1 86  ? 27.614  38.101 -58.946 1.00 53.85  ? 125 GLN E N     1 
ATOM   3727  C  CA    . GLN E 1 86  ? 26.364  38.828 -58.763 1.00 51.81  ? 125 GLN E CA    1 
ATOM   3728  C  C     . GLN E 1 86  ? 25.156  37.904 -58.618 1.00 52.66  ? 125 GLN E C     1 
ATOM   3729  O  O     . GLN E 1 86  ? 24.332  38.129 -57.726 1.00 53.39  ? 125 GLN E O     1 
ATOM   3730  C  CB    . GLN E 1 86  ? 26.139  39.795 -59.913 1.00 53.07  ? 125 GLN E CB    1 
ATOM   3731  C  CG    . GLN E 1 86  ? 27.009  41.029 -59.873 1.00 66.41  ? 125 GLN E CG    1 
ATOM   3732  C  CD    . GLN E 1 86  ? 27.041  41.719 -61.225 1.00 84.37  ? 125 GLN E CD    1 
ATOM   3733  O  OE1   . GLN E 1 86  ? 26.084  41.693 -62.020 1.00 73.93  ? 125 GLN E OE1   1 
ATOM   3734  N  NE2   . GLN E 1 86  ? 28.154  42.358 -61.515 1.00 84.17  ? 125 GLN E NE2   1 
ATOM   3735  N  N     . LEU E 1 87  ? 25.042  36.871 -59.477 1.00 45.64  ? 126 LEU E N     1 
ATOM   3736  C  CA    . LEU E 1 87  ? 23.916  35.941 -59.412 1.00 43.58  ? 126 LEU E CA    1 
ATOM   3737  C  C     . LEU E 1 87  ? 23.995  35.098 -58.135 1.00 51.62  ? 126 LEU E C     1 
ATOM   3738  O  O     . LEU E 1 87  ? 22.961  34.834 -57.509 1.00 53.00  ? 126 LEU E O     1 
ATOM   3739  C  CB    . LEU E 1 87  ? 23.856  35.061 -60.672 1.00 42.47  ? 126 LEU E CB    1 
ATOM   3740  C  CG    . LEU E 1 87  ? 22.732  34.024 -60.777 1.00 45.62  ? 126 LEU E CG    1 
ATOM   3741  C  CD1   . LEU E 1 87  ? 21.361  34.674 -60.976 1.00 45.64  ? 126 LEU E CD1   1 
ATOM   3742  C  CD2   . LEU E 1 87  ? 23.005  33.053 -61.871 1.00 43.58  ? 126 LEU E CD2   1 
ATOM   3743  N  N     . ALA E 1 88  ? 25.234  34.715 -57.727 1.00 48.70  ? 127 ALA E N     1 
ATOM   3744  C  CA    . ALA E 1 88  ? 25.482  33.919 -56.520 1.00 48.31  ? 127 ALA E CA    1 
ATOM   3745  C  C     . ALA E 1 88  ? 25.008  34.721 -55.322 1.00 51.12  ? 127 ALA E C     1 
ATOM   3746  O  O     . ALA E 1 88  ? 24.271  34.212 -54.482 1.00 50.84  ? 127 ALA E O     1 
ATOM   3747  C  CB    . ALA E 1 88  ? 26.968  33.611 -56.389 1.00 49.03  ? 127 ALA E CB    1 
ATOM   3748  N  N     . ARG E 1 89  ? 25.365  36.005 -55.306 1.00 46.36  ? 128 ARG E N     1 
ATOM   3749  C  CA    . ARG E 1 89  ? 25.019  36.912 -54.230 1.00 45.23  ? 128 ARG E CA    1 
ATOM   3750  C  C     . ARG E 1 89  ? 23.540  37.231 -54.207 1.00 48.05  ? 128 ARG E C     1 
ATOM   3751  O  O     . ARG E 1 89  ? 23.000  37.352 -53.114 1.00 48.25  ? 128 ARG E O     1 
ATOM   3752  C  CB    . ARG E 1 89  ? 25.887  38.165 -54.271 1.00 43.76  ? 128 ARG E CB    1 
ATOM   3753  C  CG    . ARG E 1 89  ? 27.332  37.896 -53.868 1.00 51.37  ? 128 ARG E CG    1 
ATOM   3754  C  CD    . ARG E 1 89  ? 28.200  39.137 -53.710 1.00 64.66  ? 128 ARG E CD    1 
ATOM   3755  N  NE    . ARG E 1 89  ? 27.491  40.416 -53.498 1.00 80.13  ? 128 ARG E NE    1 
ATOM   3756  C  CZ    . ARG E 1 89  ? 27.296  40.987 -52.319 1.00 94.68  ? 128 ARG E CZ    1 
ATOM   3757  N  NH1   . ARG E 1 89  ? 27.751  40.411 -51.212 1.00 88.69  ? 128 ARG E NH1   1 
ATOM   3758  N  NH2   . ARG E 1 89  ? 26.630  42.126 -52.231 1.00 80.88  ? 128 ARG E NH2   1 
ATOM   3759  N  N     . ARG E 1 90  ? 22.873  37.331 -55.386 1.00 42.89  ? 129 ARG E N     1 
ATOM   3760  C  CA    . ARG E 1 90  ? 21.429  37.553 -55.455 1.00 42.00  ? 129 ARG E CA    1 
ATOM   3761  C  C     . ARG E 1 90  ? 20.633  36.342 -54.899 1.00 48.59  ? 129 ARG E C     1 
ATOM   3762  O  O     . ARG E 1 90  ? 19.756  36.524 -54.049 1.00 49.27  ? 129 ARG E O     1 
ATOM   3763  C  CB    . ARG E 1 90  ? 20.987  37.884 -56.869 1.00 39.08  ? 129 ARG E CB    1 
ATOM   3764  C  CG    . ARG E 1 90  ? 19.479  38.066 -56.962 1.00 60.12  ? 129 ARG E CG    1 
ATOM   3765  C  CD    . ARG E 1 90  ? 19.042  38.823 -58.197 1.00 94.12  ? 129 ARG E CD    1 
ATOM   3766  N  NE    . ARG E 1 90  ? 19.214  40.271 -58.044 1.00 115.57 ? 129 ARG E NE    1 
ATOM   3767  C  CZ    . ARG E 1 90  ? 18.802  41.177 -58.923 1.00 126.68 ? 129 ARG E CZ    1 
ATOM   3768  N  NH1   . ARG E 1 90  ? 18.183  40.800 -60.039 1.00 108.91 ? 129 ARG E NH1   1 
ATOM   3769  N  NH2   . ARG E 1 90  ? 18.996  42.471 -58.687 1.00 111.14 ? 129 ARG E NH2   1 
ATOM   3770  N  N     . ILE E 1 91  ? 20.948  35.118 -55.356 1.00 45.75  ? 130 ILE E N     1 
ATOM   3771  C  CA    . ILE E 1 91  ? 20.243  33.920 -54.907 1.00 46.81  ? 130 ILE E CA    1 
ATOM   3772  C  C     . ILE E 1 91  ? 20.523  33.623 -53.417 1.00 50.62  ? 130 ILE E C     1 
ATOM   3773  O  O     . ILE E 1 91  ? 19.596  33.221 -52.700 1.00 49.91  ? 130 ILE E O     1 
ATOM   3774  C  CB    . ILE E 1 91  ? 20.509  32.732 -55.840 1.00 50.71  ? 130 ILE E CB    1 
ATOM   3775  C  CG1   . ILE E 1 91  ? 20.063  33.082 -57.281 1.00 51.37  ? 130 ILE E CG1   1 
ATOM   3776  C  CG2   . ILE E 1 91  ? 19.829  31.447 -55.312 1.00 51.01  ? 130 ILE E CG2   1 
ATOM   3777  C  CD1   . ILE E 1 91  ? 20.675  32.206 -58.279 1.00 64.25  ? 130 ILE E CD1   1 
ATOM   3778  N  N     . ARG E 1 92  ? 21.768  33.918 -52.950 1.00 46.48  ? 131 ARG E N     1 
ATOM   3779  C  CA    . ARG E 1 92  ? 22.205  33.821 -51.554 1.00 45.96  ? 131 ARG E CA    1 
ATOM   3780  C  C     . ARG E 1 92  ? 21.409  34.863 -50.676 1.00 53.40  ? 131 ARG E C     1 
ATOM   3781  O  O     . ARG E 1 92  ? 21.402  34.778 -49.437 1.00 53.58  ? 131 ARG E O     1 
ATOM   3782  C  CB    . ARG E 1 92  ? 23.715  34.123 -51.470 1.00 42.87  ? 131 ARG E CB    1 
ATOM   3783  C  CG    . ARG E 1 92  ? 24.663  32.926 -51.474 1.00 41.34  ? 131 ARG E CG    1 
ATOM   3784  C  CD    . ARG E 1 92  ? 26.093  33.438 -51.676 1.00 36.51  ? 131 ARG E CD    1 
ATOM   3785  N  NE    . ARG E 1 92  ? 27.146  32.476 -51.326 1.00 44.15  ? 131 ARG E NE    1 
ATOM   3786  C  CZ    . ARG E 1 92  ? 28.141  32.739 -50.481 1.00 59.83  ? 131 ARG E CZ    1 
ATOM   3787  N  NH1   . ARG E 1 92  ? 28.195  33.899 -49.855 1.00 52.10  ? 131 ARG E NH1   1 
ATOM   3788  N  NH2   . ARG E 1 92  ? 29.082  31.829 -50.243 1.00 47.34  ? 131 ARG E NH2   1 
ATOM   3789  N  N     . GLY E 1 93  ? 20.773  35.834 -51.331 1.00 50.68  ? 132 GLY E N     1 
ATOM   3790  C  CA    . GLY E 1 93  ? 20.002  36.854 -50.646 1.00 51.92  ? 132 GLY E CA    1 
ATOM   3791  C  C     . GLY E 1 93  ? 20.866  37.921 -50.007 1.00 60.13  ? 132 GLY E C     1 
ATOM   3792  O  O     . GLY E 1 93  ? 20.490  38.516 -48.990 1.00 60.89  ? 132 GLY E O     1 
ATOM   3793  N  N     . GLU E 1 94  ? 22.032  38.174 -50.603 1.00 57.80  ? 133 GLU E N     1 
ATOM   3794  C  CA    . GLU E 1 94  ? 22.956  39.208 -50.143 1.00 58.17  ? 133 GLU E CA    1 
ATOM   3795  C  C     . GLU E 1 94  ? 22.614  40.494 -50.893 1.00 67.45  ? 133 GLU E C     1 
ATOM   3796  O  O     . GLU E 1 94  ? 22.679  41.588 -50.343 1.00 67.78  ? 133 GLU E O     1 
ATOM   3797  C  CB    . GLU E 1 94  ? 24.404  38.771 -50.397 1.00 58.85  ? 133 GLU E CB    1 
ATOM   3798  C  CG    . GLU E 1 94  ? 24.820  37.597 -49.528 1.00 60.11  ? 133 GLU E CG    1 
ATOM   3799  C  CD    . GLU E 1 94  ? 26.191  37.008 -49.777 1.00 63.50  ? 133 GLU E CD    1 
ATOM   3800  O  OE1   . GLU E 1 94  ? 26.981  37.625 -50.523 1.00 69.38  ? 133 GLU E OE1   1 
ATOM   3801  O  OE2   . GLU E 1 94  ? 26.482  35.930 -49.215 1.00 48.21  ? 133 GLU E OE2   1 
ATOM   3802  N  N     . ARG E 1 95  ? 22.237  40.301 -52.173 1.00 68.68  ? 134 ARG E N     1 
ATOM   3803  C  CA    . ARG E 1 95  ? 21.830  41.235 -53.224 1.00 71.06  ? 134 ARG E CA    1 
ATOM   3804  C  C     . ARG E 1 95  ? 20.302  41.071 -53.430 1.00 79.96  ? 134 ARG E C     1 
ATOM   3805  O  O     . ARG E 1 95  ? 19.747  40.000 -53.108 1.00 80.47  ? 134 ARG E O     1 
ATOM   3806  C  CB    . ARG E 1 95  ? 22.628  40.896 -54.516 1.00 73.45  ? 134 ARG E CB    1 
ATOM   3807  C  CG    . ARG E 1 95  ? 22.266  41.659 -55.796 1.00 90.65  ? 134 ARG E CG    1 
ATOM   3808  C  CD    . ARG E 1 95  ? 23.496  42.143 -56.563 1.00 111.05 ? 134 ARG E CD    1 
ATOM   3809  N  NE    . ARG E 1 95  ? 24.343  43.026 -55.749 1.00 127.46 ? 134 ARG E NE    1 
ATOM   3810  C  CZ    . ARG E 1 95  ? 24.086  44.308 -55.487 1.00 137.44 ? 134 ARG E CZ    1 
ATOM   3811  N  NH1   . ARG E 1 95  ? 23.000  44.892 -55.982 1.00 117.07 ? 134 ARG E NH1   1 
ATOM   3812  N  NH2   . ARG E 1 95  ? 24.909  45.011 -54.720 1.00 124.84 ? 134 ARG E NH2   1 
ATOM   3813  N  N     . ALA E 1 96  ? 19.643  42.135 -53.978 1.00 78.50  ? 135 ALA E N     1 
ATOM   3814  C  CA    . ALA E 1 96  ? 18.193  42.273 -54.222 1.00 86.39  ? 135 ALA E CA    1 
ATOM   3815  C  C     . ALA E 1 96  ? 17.468  41.056 -54.933 1.00 114.73 ? 135 ALA E C     1 
ATOM   3816  O  O     . ALA E 1 96  ? 17.007  40.109 -54.236 1.00 111.69 ? 135 ALA E O     1 
ATOM   3817  C  CB    . ALA E 1 96  ? 17.928  43.564 -54.982 1.00 87.20  ? 135 ALA E CB    1 
ATOM   3818  O  OXT   . ALA E 1 96  ? 17.315  41.078 -56.175 1.00 141.52 ? 135 ALA E OXT   1 
ATOM   3819  N  N     . ASN F 2 10  ? 44.377  50.748 -48.982 1.00 108.62 ? 25  ASN F N     1 
ATOM   3820  C  CA    . ASN F 2 10  ? 44.647  49.422 -48.423 1.00 108.30 ? 25  ASN F CA    1 
ATOM   3821  C  C     . ASN F 2 10  ? 43.803  48.297 -49.014 1.00 111.57 ? 25  ASN F C     1 
ATOM   3822  O  O     . ASN F 2 10  ? 44.183  47.127 -48.885 1.00 110.95 ? 25  ASN F O     1 
ATOM   3823  C  CB    . ASN F 2 10  ? 44.536  49.436 -46.907 1.00 109.88 ? 25  ASN F CB    1 
ATOM   3824  C  CG    . ASN F 2 10  ? 45.710  50.126 -46.274 1.00 142.26 ? 25  ASN F CG    1 
ATOM   3825  O  OD1   . ASN F 2 10  ? 46.857  49.705 -46.433 1.00 139.98 ? 25  ASN F OD1   1 
ATOM   3826  N  ND2   . ASN F 2 10  ? 45.458  51.215 -45.564 1.00 134.63 ? 25  ASN F ND2   1 
ATOM   3827  N  N     . ILE F 2 11  ? 42.672  48.643 -49.667 1.00 107.58 ? 26  ILE F N     1 
ATOM   3828  C  CA    . ILE F 2 11  ? 41.790  47.679 -50.332 1.00 106.92 ? 26  ILE F CA    1 
ATOM   3829  C  C     . ILE F 2 11  ? 42.544  47.026 -51.513 1.00 111.54 ? 26  ILE F C     1 
ATOM   3830  O  O     . ILE F 2 11  ? 42.289  45.872 -51.860 1.00 110.53 ? 26  ILE F O     1 
ATOM   3831  C  CB    . ILE F 2 11  ? 40.419  48.339 -50.701 1.00 109.56 ? 26  ILE F CB    1 
ATOM   3832  C  CG1   . ILE F 2 11  ? 39.196  47.415 -50.331 1.00 109.72 ? 26  ILE F CG1   1 
ATOM   3833  C  CG2   . ILE F 2 11  ? 40.335  48.869 -52.143 1.00 109.63 ? 26  ILE F CG2   1 
ATOM   3834  C  CD1   . ILE F 2 11  ? 39.057  45.982 -50.949 1.00 112.52 ? 26  ILE F CD1   1 
ATOM   3835  N  N     . GLN F 2 12  ? 43.537  47.750 -52.063 1.00 109.70 ? 27  GLN F N     1 
ATOM   3836  C  CA    . GLN F 2 12  ? 44.378  47.263 -53.152 1.00 110.19 ? 27  GLN F CA    1 
ATOM   3837  C  C     . GLN F 2 12  ? 45.510  46.352 -52.629 1.00 117.77 ? 27  GLN F C     1 
ATOM   3838  O  O     . GLN F 2 12  ? 46.265  45.776 -53.422 1.00 117.97 ? 27  GLN F O     1 
ATOM   3839  C  CB    . GLN F 2 12  ? 44.899  48.431 -53.991 1.00 110.90 ? 27  GLN F CB    1 
ATOM   3840  C  CG    . GLN F 2 12  ? 43.792  49.242 -54.678 1.00 117.03 ? 27  GLN F CG    1 
ATOM   3841  C  CD    . GLN F 2 12  ? 43.034  48.471 -55.734 1.00 129.73 ? 27  GLN F CD    1 
ATOM   3842  O  OE1   . GLN F 2 12  ? 43.617  47.884 -56.654 1.00 122.23 ? 27  GLN F OE1   1 
ATOM   3843  N  NE2   . GLN F 2 12  ? 41.710  48.464 -55.628 1.00 121.31 ? 27  GLN F NE2   1 
ATOM   3844  N  N     . GLY F 2 13  ? 45.581  46.223 -51.295 1.00 115.61 ? 28  GLY F N     1 
ATOM   3845  C  CA    . GLY F 2 13  ? 46.516  45.363 -50.578 1.00 115.45 ? 28  GLY F CA    1 
ATOM   3846  C  C     . GLY F 2 13  ? 46.151  43.909 -50.788 1.00 119.25 ? 28  GLY F C     1 
ATOM   3847  O  O     . GLY F 2 13  ? 47.031  43.047 -50.788 1.00 120.00 ? 28  GLY F O     1 
ATOM   3848  N  N     . ILE F 2 14  ? 44.837  43.637 -50.983 1.00 114.41 ? 29  ILE F N     1 
ATOM   3849  C  CA    . ILE F 2 14  ? 44.280  42.317 -51.294 1.00 113.53 ? 29  ILE F CA    1 
ATOM   3850  C  C     . ILE F 2 14  ? 44.500  42.235 -52.804 1.00 117.45 ? 29  ILE F C     1 
ATOM   3851  O  O     . ILE F 2 14  ? 43.690  42.736 -53.592 1.00 117.66 ? 29  ILE F O     1 
ATOM   3852  C  CB    . ILE F 2 14  ? 42.771  42.192 -50.903 1.00 116.11 ? 29  ILE F CB    1 
ATOM   3853  C  CG1   . ILE F 2 14  ? 42.422  42.953 -49.588 1.00 115.96 ? 29  ILE F CG1   1 
ATOM   3854  C  CG2   . ILE F 2 14  ? 42.322  40.722 -50.862 1.00 116.91 ? 29  ILE F CG2   1 
ATOM   3855  C  CD1   . ILE F 2 14  ? 43.030  42.438 -48.244 1.00 120.47 ? 29  ILE F CD1   1 
ATOM   3856  N  N     . THR F 2 15  ? 45.665  41.700 -53.183 1.00 112.96 ? 30  THR F N     1 
ATOM   3857  C  CA    . THR F 2 15  ? 46.172  41.663 -54.553 1.00 112.14 ? 30  THR F CA    1 
ATOM   3858  C  C     . THR F 2 15  ? 45.467  40.651 -55.454 1.00 114.67 ? 30  THR F C     1 
ATOM   3859  O  O     . THR F 2 15  ? 44.716  39.800 -54.978 1.00 113.78 ? 30  THR F O     1 
ATOM   3860  C  CB    . THR F 2 15  ? 47.699  41.449 -54.543 1.00 116.63 ? 30  THR F CB    1 
ATOM   3861  O  OG1   . THR F 2 15  ? 47.987  40.192 -53.921 1.00 117.07 ? 30  THR F OG1   1 
ATOM   3862  C  CG2   . THR F 2 15  ? 48.462  42.599 -53.870 1.00 112.18 ? 30  THR F CG2   1 
ATOM   3863  N  N     . LYS F 2 16  ? 45.700  40.794 -56.776 1.00 110.39 ? 31  LYS F N     1 
ATOM   3864  C  CA    . LYS F 2 16  ? 45.224  39.923 -57.848 1.00 109.41 ? 31  LYS F CA    1 
ATOM   3865  C  C     . LYS F 2 16  ? 45.710  38.470 -57.559 1.00 111.71 ? 31  LYS F C     1 
ATOM   3866  O  O     . LYS F 2 16  ? 44.862  37.581 -57.543 1.00 110.34 ? 31  LYS F O     1 
ATOM   3867  C  CB    . LYS F 2 16  ? 45.719  40.472 -59.210 1.00 111.60 ? 31  LYS F CB    1 
ATOM   3868  C  CG    . LYS F 2 16  ? 45.389  39.625 -60.428 1.00 121.62 ? 31  LYS F CG    1 
ATOM   3869  C  CD    . LYS F 2 16  ? 46.603  39.438 -61.330 1.00 129.34 ? 31  LYS F CD    1 
ATOM   3870  C  CE    . LYS F 2 16  ? 46.399  38.353 -62.359 1.00 136.48 ? 31  LYS F CE    1 
ATOM   3871  N  NZ    . LYS F 2 16  ? 45.591  38.827 -63.514 1.00 143.82 ? 31  LYS F NZ    1 
ATOM   3872  N  N     . PRO F 2 17  ? 47.008  38.218 -57.210 1.00 109.07 ? 32  PRO F N     1 
ATOM   3873  C  CA    . PRO F 2 17  ? 47.435  36.837 -56.913 1.00 108.84 ? 32  PRO F CA    1 
ATOM   3874  C  C     . PRO F 2 17  ? 46.809  36.229 -55.669 1.00 108.67 ? 32  PRO F C     1 
ATOM   3875  O  O     . PRO F 2 17  ? 46.516  35.039 -55.676 1.00 108.34 ? 32  PRO F O     1 
ATOM   3876  C  CB    . PRO F 2 17  ? 48.964  36.949 -56.788 1.00 111.70 ? 32  PRO F CB    1 
ATOM   3877  C  CG    . PRO F 2 17  ? 49.231  38.363 -56.474 1.00 116.50 ? 32  PRO F CG    1 
ATOM   3878  C  CD    . PRO F 2 17  ? 48.173  39.130 -57.202 1.00 111.65 ? 32  PRO F CD    1 
ATOM   3879  N  N     . ALA F 2 18  ? 46.589  37.037 -54.620 1.00 103.00 ? 33  ALA F N     1 
ATOM   3880  C  CA    . ALA F 2 18  ? 45.944  36.586 -53.384 1.00 101.92 ? 33  ALA F CA    1 
ATOM   3881  C  C     . ALA F 2 18  ? 44.469  36.197 -53.660 1.00 102.30 ? 33  ALA F C     1 
ATOM   3882  O  O     . ALA F 2 18  ? 43.997  35.192 -53.128 1.00 100.74 ? 33  ALA F O     1 
ATOM   3883  C  CB    . ALA F 2 18  ? 46.026  37.677 -52.330 1.00 102.72 ? 33  ALA F CB    1 
ATOM   3884  N  N     . ILE F 2 19  ? 43.775  36.968 -54.536 1.00 97.23  ? 34  ILE F N     1 
ATOM   3885  C  CA    . ILE F 2 19  ? 42.395  36.716 -54.968 1.00 96.17  ? 34  ILE F CA    1 
ATOM   3886  C  C     . ILE F 2 19  ? 42.331  35.441 -55.831 1.00 99.80  ? 34  ILE F C     1 
ATOM   3887  O  O     . ILE F 2 19  ? 41.399  34.654 -55.656 1.00 99.98  ? 34  ILE F O     1 
ATOM   3888  C  CB    . ILE F 2 19  ? 41.744  37.969 -55.632 1.00 98.86  ? 34  ILE F CB    1 
ATOM   3889  C  CG1   . ILE F 2 19  ? 41.446  39.038 -54.564 1.00 99.14  ? 34  ILE F CG1   1 
ATOM   3890  C  CG2   . ILE F 2 19  ? 40.466  37.627 -56.427 1.00 99.14  ? 34  ILE F CG2   1 
ATOM   3891  C  CD1   . ILE F 2 19  ? 41.305  40.467 -55.099 1.00 109.20 ? 34  ILE F CD1   1 
ATOM   3892  N  N     . ARG F 2 20  ? 43.328  35.210 -56.720 1.00 95.65  ? 35  ARG F N     1 
ATOM   3893  C  CA    . ARG F 2 20  ? 43.384  34.006 -57.559 1.00 95.39  ? 35  ARG F CA    1 
ATOM   3894  C  C     . ARG F 2 20  ? 43.477  32.759 -56.690 1.00 98.92  ? 35  ARG F C     1 
ATOM   3895  O  O     . ARG F 2 20  ? 42.781  31.783 -56.974 1.00 99.00  ? 35  ARG F O     1 
ATOM   3896  C  CB    . ARG F 2 20  ? 44.563  34.044 -58.531 1.00 97.26  ? 35  ARG F CB    1 
ATOM   3897  C  CG    . ARG F 2 20  ? 44.282  34.779 -59.834 1.00 114.24 ? 35  ARG F CG    1 
ATOM   3898  C  CD    . ARG F 2 20  ? 45.528  34.945 -60.710 1.00 128.63 ? 35  ARG F CD    1 
ATOM   3899  N  NE    . ARG F 2 20  ? 45.938  33.700 -61.368 1.00 141.29 ? 35  ARG F NE    1 
ATOM   3900  C  CZ    . ARG F 2 20  ? 46.886  32.881 -60.916 1.00 163.33 ? 35  ARG F CZ    1 
ATOM   3901  N  NH1   . ARG F 2 20  ? 47.540  33.163 -59.793 1.00 152.28 ? 35  ARG F NH1   1 
ATOM   3902  N  NH2   . ARG F 2 20  ? 47.189  31.773 -61.582 1.00 155.14 ? 35  ARG F NH2   1 
ATOM   3903  N  N     . ARG F 2 21  ? 44.306  32.801 -55.615 1.00 94.18  ? 36  ARG F N     1 
ATOM   3904  C  CA    . ARG F 2 21  ? 44.476  31.702 -54.653 1.00 93.28  ? 36  ARG F CA    1 
ATOM   3905  C  C     . ARG F 2 21  ? 43.137  31.333 -54.023 1.00 95.37  ? 36  ARG F C     1 
ATOM   3906  O  O     . ARG F 2 21  ? 42.830  30.144 -53.912 1.00 96.54  ? 36  ARG F O     1 
ATOM   3907  C  CB    . ARG F 2 21  ? 45.462  32.091 -53.547 1.00 93.73  ? 36  ARG F CB    1 
ATOM   3908  C  CG    . ARG F 2 21  ? 46.886  32.203 -54.025 1.00 108.56 ? 36  ARG F CG    1 
ATOM   3909  C  CD    . ARG F 2 21  ? 47.839  32.120 -52.865 1.00 126.26 ? 36  ARG F CD    1 
ATOM   3910  N  NE    . ARG F 2 21  ? 48.040  33.395 -52.175 1.00 138.76 ? 36  ARG F NE    1 
ATOM   3911  C  CZ    . ARG F 2 21  ? 48.977  34.283 -52.489 1.00 153.47 ? 36  ARG F CZ    1 
ATOM   3912  N  NH1   . ARG F 2 21  ? 49.774  34.078 -53.535 1.00 137.30 ? 36  ARG F NH1   1 
ATOM   3913  N  NH2   . ARG F 2 21  ? 49.117  35.389 -51.774 1.00 142.74 ? 36  ARG F NH2   1 
ATOM   3914  N  N     . LEU F 2 22  ? 42.328  32.355 -53.637 1.00 87.79  ? 37  LEU F N     1 
ATOM   3915  C  CA    . LEU F 2 22  ? 41.012  32.147 -53.041 1.00 85.39  ? 37  LEU F CA    1 
ATOM   3916  C  C     . LEU F 2 22  ? 40.046  31.510 -54.043 1.00 89.60  ? 37  LEU F C     1 
ATOM   3917  O  O     . LEU F 2 22  ? 39.273  30.632 -53.665 1.00 88.93  ? 37  LEU F O     1 
ATOM   3918  C  CB    . LEU F 2 22  ? 40.461  33.437 -52.443 1.00 84.42  ? 37  LEU F CB    1 
ATOM   3919  C  CG    . LEU F 2 22  ? 41.243  34.019 -51.256 1.00 87.66  ? 37  LEU F CG    1 
ATOM   3920  C  CD1   . LEU F 2 22  ? 40.993  35.503 -51.122 1.00 88.03  ? 37  LEU F CD1   1 
ATOM   3921  C  CD2   . LEU F 2 22  ? 40.923  33.309 -49.948 1.00 87.59  ? 37  LEU F CD2   1 
ATOM   3922  N  N     . ALA F 2 23  ? 40.148  31.882 -55.328 1.00 87.39  ? 38  ALA F N     1 
ATOM   3923  C  CA    . ALA F 2 23  ? 39.333  31.278 -56.384 1.00 88.12  ? 38  ALA F CA    1 
ATOM   3924  C  C     . ALA F 2 23  ? 39.737  29.814 -56.631 1.00 94.31  ? 38  ALA F C     1 
ATOM   3925  O  O     . ALA F 2 23  ? 38.865  29.004 -56.935 1.00 94.73  ? 38  ALA F O     1 
ATOM   3926  C  CB    . ALA F 2 23  ? 39.454  32.074 -57.662 1.00 88.82  ? 38  ALA F CB    1 
ATOM   3927  N  N     . ARG F 2 24  ? 41.043  29.471 -56.483 1.00 90.80  ? 39  ARG F N     1 
ATOM   3928  C  CA    . ARG F 2 24  ? 41.546  28.102 -56.658 1.00 90.09  ? 39  ARG F CA    1 
ATOM   3929  C  C     . ARG F 2 24  ? 41.021  27.187 -55.550 1.00 93.70  ? 39  ARG F C     1 
ATOM   3930  O  O     . ARG F 2 24  ? 40.657  26.044 -55.832 1.00 94.19  ? 39  ARG F O     1 
ATOM   3931  C  CB    . ARG F 2 24  ? 43.085  28.059 -56.736 1.00 90.13  ? 39  ARG F CB    1 
ATOM   3932  C  CG    . ARG F 2 24  ? 43.697  28.798 -57.932 1.00 100.83 ? 39  ARG F CG    1 
ATOM   3933  C  CD    . ARG F 2 24  ? 43.446  28.124 -59.269 1.00 112.07 ? 39  ARG F CD    1 
ATOM   3934  N  NE    . ARG F 2 24  ? 44.315  28.662 -60.318 1.00 123.28 ? 39  ARG F NE    1 
ATOM   3935  C  CZ    . ARG F 2 24  ? 43.890  29.349 -61.376 1.00 142.08 ? 39  ARG F CZ    1 
ATOM   3936  N  NH1   . ARG F 2 24  ? 42.594  29.580 -61.556 1.00 131.88 ? 39  ARG F NH1   1 
ATOM   3937  N  NH2   . ARG F 2 24  ? 44.760  29.796 -62.277 1.00 130.27 ? 39  ARG F NH2   1 
ATOM   3938  N  N     . ARG F 2 25  ? 40.937  27.692 -54.299 1.00 89.26  ? 40  ARG F N     1 
ATOM   3939  C  CA    . ARG F 2 25  ? 40.370  26.925 -53.182 1.00 88.81  ? 40  ARG F CA    1 
ATOM   3940  C  C     . ARG F 2 25  ? 38.863  26.711 -53.442 1.00 93.60  ? 40  ARG F C     1 
ATOM   3941  O  O     . ARG F 2 25  ? 38.320  25.651 -53.112 1.00 93.50  ? 40  ARG F O     1 
ATOM   3942  C  CB    . ARG F 2 25  ? 40.614  27.630 -51.850 1.00 86.08  ? 40  ARG F CB    1 
ATOM   3943  C  CG    . ARG F 2 25  ? 40.529  26.672 -50.682 1.00 86.82  ? 40  ARG F CG    1 
ATOM   3944  C  CD    . ARG F 2 25  ? 40.856  27.342 -49.372 1.00 90.37  ? 40  ARG F CD    1 
ATOM   3945  N  NE    . ARG F 2 25  ? 42.270  27.677 -49.259 1.00 97.48  ? 40  ARG F NE    1 
ATOM   3946  C  CZ    . ARG F 2 25  ? 43.002  27.460 -48.177 1.00 115.96 ? 40  ARG F CZ    1 
ATOM   3947  N  NH1   . ARG F 2 25  ? 42.457  26.903 -47.104 1.00 106.82 ? 40  ARG F NH1   1 
ATOM   3948  N  NH2   . ARG F 2 25  ? 44.282  27.802 -48.154 1.00 109.13 ? 40  ARG F NH2   1 
ATOM   3949  N  N     . GLY F 2 26  ? 38.237  27.701 -54.091 1.00 90.05  ? 41  GLY F N     1 
ATOM   3950  C  CA    . GLY F 2 26  ? 36.851  27.662 -54.539 1.00 89.89  ? 41  GLY F CA    1 
ATOM   3951  C  C     . GLY F 2 26  ? 36.673  26.767 -55.759 1.00 94.69  ? 41  GLY F C     1 
ATOM   3952  O  O     . GLY F 2 26  ? 35.547  26.548 -56.217 1.00 94.33  ? 41  GLY F O     1 
ATOM   3953  N  N     . GLY F 2 27  ? 37.789  26.239 -56.273 1.00 92.16  ? 42  GLY F N     1 
ATOM   3954  C  CA    . GLY F 2 27  ? 37.833  25.325 -57.412 1.00 92.54  ? 42  GLY F CA    1 
ATOM   3955  C  C     . GLY F 2 27  ? 37.519  25.977 -58.740 1.00 97.38  ? 42  GLY F C     1 
ATOM   3956  O  O     . GLY F 2 27  ? 36.735  25.430 -59.521 1.00 97.80  ? 42  GLY F O     1 
ATOM   3957  N  N     . VAL F 2 28  ? 38.140  27.144 -59.007 1.00 93.29  ? 43  VAL F N     1 
ATOM   3958  C  CA    . VAL F 2 28  ? 37.922  27.925 -60.221 1.00 93.10  ? 43  VAL F CA    1 
ATOM   3959  C  C     . VAL F 2 28  ? 39.069  27.688 -61.203 1.00 98.24  ? 43  VAL F C     1 
ATOM   3960  O  O     . VAL F 2 28  ? 40.231  27.888 -60.836 1.00 98.37  ? 43  VAL F O     1 
ATOM   3961  C  CB    . VAL F 2 28  ? 37.714  29.426 -59.879 1.00 97.04  ? 43  VAL F CB    1 
ATOM   3962  C  CG1   . VAL F 2 28  ? 37.765  30.290 -61.123 1.00 97.27  ? 43  VAL F CG1   1 
ATOM   3963  C  CG2   . VAL F 2 28  ? 36.410  29.657 -59.122 1.00 96.58  ? 43  VAL F CG2   1 
ATOM   3964  N  N     . LYS F 2 29  ? 38.747  27.269 -62.445 1.00 95.78  ? 44  LYS F N     1 
ATOM   3965  C  CA    . LYS F 2 29  ? 39.766  26.994 -63.470 1.00 96.31  ? 44  LYS F CA    1 
ATOM   3966  C  C     . LYS F 2 29  ? 40.262  28.252 -64.200 1.00 103.12 ? 44  LYS F C     1 
ATOM   3967  O  O     . LYS F 2 29  ? 41.446  28.322 -64.566 1.00 103.93 ? 44  LYS F O     1 
ATOM   3968  C  CB    . LYS F 2 29  ? 39.284  25.940 -64.484 1.00 97.90  ? 44  LYS F CB    1 
ATOM   3969  C  CG    . LYS F 2 29  ? 40.405  25.274 -65.286 1.00 100.66 ? 44  LYS F CG    1 
ATOM   3970  C  CD    . LYS F 2 29  ? 39.878  24.319 -66.343 1.00 104.99 ? 44  LYS F CD    1 
ATOM   3971  C  CE    . LYS F 2 29  ? 40.998  23.777 -67.192 1.00 110.63 ? 44  LYS F CE    1 
ATOM   3972  N  NZ    . LYS F 2 29  ? 40.487  22.961 -68.319 1.00 117.22 ? 44  LYS F NZ    1 
ATOM   3973  N  N     . ARG F 2 30  ? 39.362  29.216 -64.462 1.00 99.97  ? 45  ARG F N     1 
ATOM   3974  C  CA    . ARG F 2 30  ? 39.746  30.434 -65.176 1.00 99.67  ? 45  ARG F CA    1 
ATOM   3975  C  C     . ARG F 2 30  ? 39.037  31.675 -64.583 1.00 101.84 ? 45  ARG F C     1 
ATOM   3976  O  O     . ARG F 2 30  ? 37.889  31.592 -64.155 1.00 101.26 ? 45  ARG F O     1 
ATOM   3977  C  CB    . ARG F 2 30  ? 39.550  30.248 -66.696 1.00 100.94 ? 45  ARG F CB    1 
ATOM   3978  C  CG    . ARG F 2 30  ? 40.456  31.126 -67.553 1.00 114.20 ? 45  ARG F CG    1 
ATOM   3979  C  CD    . ARG F 2 30  ? 40.449  30.790 -69.026 1.00 126.87 ? 45  ARG F CD    1 
ATOM   3980  N  NE    . ARG F 2 30  ? 40.936  31.930 -69.806 1.00 142.42 ? 45  ARG F NE    1 
ATOM   3981  C  CZ    . ARG F 2 30  ? 40.243  32.542 -70.762 1.00 162.13 ? 45  ARG F CZ    1 
ATOM   3982  N  NH1   . ARG F 2 30  ? 39.042  32.098 -71.107 1.00 155.22 ? 45  ARG F NH1   1 
ATOM   3983  N  NH2   . ARG F 2 30  ? 40.757  33.585 -71.400 1.00 146.74 ? 45  ARG F NH2   1 
ATOM   3984  N  N     . ILE F 2 31  ? 39.759  32.795 -64.484 1.00 97.53  ? 46  ILE F N     1 
ATOM   3985  C  CA    . ILE F 2 31  ? 39.291  34.034 -63.857 1.00 97.02  ? 46  ILE F CA    1 
ATOM   3986  C  C     . ILE F 2 31  ? 39.302  35.243 -64.817 1.00 102.85 ? 46  ILE F C     1 
ATOM   3987  O  O     . ILE F 2 31  ? 40.368  35.627 -65.318 1.00 102.67 ? 46  ILE F O     1 
ATOM   3988  C  CB    . ILE F 2 31  ? 40.165  34.299 -62.585 1.00 99.29  ? 46  ILE F CB    1 
ATOM   3989  C  CG1   . ILE F 2 31  ? 40.036  33.177 -61.542 1.00 98.99  ? 46  ILE F CG1   1 
ATOM   3990  C  CG2   . ILE F 2 31  ? 39.890  35.663 -61.960 1.00 99.94  ? 46  ILE F CG2   1 
ATOM   3991  C  CD1   . ILE F 2 31  ? 41.289  32.905 -60.775 1.00 101.68 ? 46  ILE F CD1   1 
ATOM   3992  N  N     . SER F 2 32  ? 38.131  35.900 -64.984 1.00 100.71 ? 47  SER F N     1 
ATOM   3993  C  CA    . SER F 2 32  ? 37.966  37.138 -65.771 1.00 101.09 ? 47  SER F CA    1 
ATOM   3994  C  C     . SER F 2 32  ? 38.780  38.273 -65.113 1.00 106.94 ? 47  SER F C     1 
ATOM   3995  O  O     . SER F 2 32  ? 39.069  38.204 -63.919 1.00 107.64 ? 47  SER F O     1 
ATOM   3996  C  CB    . SER F 2 32  ? 36.490  37.538 -65.840 1.00 103.09 ? 47  SER F CB    1 
ATOM   3997  O  OG    . SER F 2 32  ? 36.242  38.735 -66.559 1.00 106.13 ? 47  SER F OG    1 
ATOM   3998  N  N     . GLY F 2 33  ? 39.134  39.295 -65.890 1.00 103.41 ? 48  GLY F N     1 
ATOM   3999  C  CA    . GLY F 2 33  ? 39.891  40.443 -65.401 1.00 103.15 ? 48  GLY F CA    1 
ATOM   4000  C  C     . GLY F 2 33  ? 39.096  41.349 -64.479 1.00 107.14 ? 48  GLY F C     1 
ATOM   4001  O  O     . GLY F 2 33  ? 39.668  42.040 -63.633 1.00 107.05 ? 48  GLY F O     1 
ATOM   4002  N  N     . LEU F 2 34  ? 37.768  41.344 -64.629 1.00 103.27 ? 49  LEU F N     1 
ATOM   4003  C  CA    . LEU F 2 34  ? 36.881  42.192 -63.839 1.00 102.75 ? 49  LEU F CA    1 
ATOM   4004  C  C     . LEU F 2 34  ? 36.588  41.612 -62.464 1.00 104.89 ? 49  LEU F C     1 
ATOM   4005  O  O     . LEU F 2 34  ? 36.073  42.328 -61.608 1.00 104.97 ? 49  LEU F O     1 
ATOM   4006  C  CB    . LEU F 2 34  ? 35.576  42.485 -64.607 1.00 103.05 ? 49  LEU F CB    1 
ATOM   4007  C  CG    . LEU F 2 34  ? 35.711  42.975 -66.056 1.00 107.96 ? 49  LEU F CG    1 
ATOM   4008  C  CD1   . LEU F 2 34  ? 34.513  42.561 -66.890 1.00 108.06 ? 49  LEU F CD1   1 
ATOM   4009  C  CD2   . LEU F 2 34  ? 35.931  44.466 -66.115 1.00 110.92 ? 49  LEU F CD2   1 
ATOM   4010  N  N     . ILE F 2 35  ? 36.927  40.328 -62.253 1.00 99.78  ? 50  ILE F N     1 
ATOM   4011  C  CA    . ILE F 2 35  ? 36.728  39.586 -61.005 1.00 98.74  ? 50  ILE F CA    1 
ATOM   4012  C  C     . ILE F 2 35  ? 37.487  40.217 -59.848 1.00 103.34 ? 50  ILE F C     1 
ATOM   4013  O  O     . ILE F 2 35  ? 36.949  40.290 -58.741 1.00 103.62 ? 50  ILE F O     1 
ATOM   4014  C  CB    . ILE F 2 35  ? 37.115  38.083 -61.188 1.00 101.01 ? 50  ILE F CB    1 
ATOM   4015  C  CG1   . ILE F 2 35  ? 36.098  37.325 -62.075 1.00 100.93 ? 50  ILE F CG1   1 
ATOM   4016  C  CG2   . ILE F 2 35  ? 37.371  37.353 -59.856 1.00 101.16 ? 50  ILE F CG2   1 
ATOM   4017  C  CD1   . ILE F 2 35  ? 34.756  37.013 -61.481 1.00 104.62 ? 50  ILE F CD1   1 
ATOM   4018  N  N     . TYR F 2 36  ? 38.729  40.654 -60.098 1.00 99.36  ? 51  TYR F N     1 
ATOM   4019  C  CA    . TYR F 2 36  ? 39.597  41.193 -59.059 1.00 99.13  ? 51  TYR F CA    1 
ATOM   4020  C  C     . TYR F 2 36  ? 39.000  42.417 -58.371 1.00 100.30 ? 51  TYR F C     1 
ATOM   4021  O  O     . TYR F 2 36  ? 38.930  42.429 -57.141 1.00 99.51  ? 51  TYR F O     1 
ATOM   4022  C  CB    . TYR F 2 36  ? 41.011  41.434 -59.598 1.00 101.58 ? 51  TYR F CB    1 
ATOM   4023  C  CG    . TYR F 2 36  ? 41.572  40.210 -60.298 1.00 105.46 ? 51  TYR F CG    1 
ATOM   4024  C  CD1   . TYR F 2 36  ? 41.851  39.039 -59.589 1.00 108.15 ? 51  TYR F CD1   1 
ATOM   4025  C  CD2   . TYR F 2 36  ? 41.764  40.199 -61.677 1.00 106.45 ? 51  TYR F CD2   1 
ATOM   4026  C  CE1   . TYR F 2 36  ? 42.315  37.891 -60.238 1.00 109.39 ? 51  TYR F CE1   1 
ATOM   4027  C  CE2   . TYR F 2 36  ? 42.250  39.066 -62.333 1.00 107.44 ? 51  TYR F CE2   1 
ATOM   4028  C  CZ    . TYR F 2 36  ? 42.535  37.917 -61.609 1.00 115.97 ? 51  TYR F CZ    1 
ATOM   4029  O  OH    . TYR F 2 36  ? 43.009  36.804 -62.267 1.00 117.19 ? 51  TYR F OH    1 
ATOM   4030  N  N     . GLU F 2 37  ? 38.466  43.375 -59.157 1.00 94.65  ? 52  GLU F N     1 
ATOM   4031  C  CA    . GLU F 2 37  ? 37.838  44.590 -58.634 1.00 92.81  ? 52  GLU F CA    1 
ATOM   4032  C  C     . GLU F 2 37  ? 36.454  44.318 -58.010 1.00 92.93  ? 52  GLU F C     1 
ATOM   4033  O  O     . GLU F 2 37  ? 36.001  45.091 -57.151 1.00 93.50  ? 52  GLU F O     1 
ATOM   4034  C  CB    . GLU F 2 37  ? 37.796  45.692 -59.705 1.00 93.99  ? 52  GLU F CB    1 
ATOM   4035  C  CG    . GLU F 2 37  ? 37.680  47.102 -59.139 1.00 105.22 ? 52  GLU F CG    1 
ATOM   4036  C  CD    . GLU F 2 37  ? 38.838  47.694 -58.347 1.00 124.79 ? 52  GLU F CD    1 
ATOM   4037  O  OE1   . GLU F 2 37  ? 39.043  48.925 -58.454 1.00 126.38 ? 52  GLU F OE1   1 
ATOM   4038  O  OE2   . GLU F 2 37  ? 39.522  46.950 -57.604 1.00 109.16 ? 52  GLU F OE2   1 
ATOM   4039  N  N     . GLU F 2 38  ? 35.806  43.206 -58.425 1.00 84.10  ? 53  GLU F N     1 
ATOM   4040  C  CA    . GLU F 2 38  ? 34.503  42.769 -57.916 1.00 81.37  ? 53  GLU F CA    1 
ATOM   4041  C  C     . GLU F 2 38  ? 34.647  42.080 -56.566 1.00 79.00  ? 53  GLU F C     1 
ATOM   4042  O  O     . GLU F 2 38  ? 33.840  42.318 -55.670 1.00 77.08  ? 53  GLU F O     1 
ATOM   4043  C  CB    . GLU F 2 38  ? 33.791  41.857 -58.926 1.00 82.82  ? 53  GLU F CB    1 
ATOM   4044  C  CG    . GLU F 2 38  ? 32.660  42.551 -59.671 1.00 93.76  ? 53  GLU F CG    1 
ATOM   4045  C  CD    . GLU F 2 38  ? 31.359  42.800 -58.934 1.00 111.20 ? 53  GLU F CD    1 
ATOM   4046  O  OE1   . GLU F 2 38  ? 30.313  42.909 -59.611 1.00 110.64 ? 53  GLU F OE1   1 
ATOM   4047  O  OE2   . GLU F 2 38  ? 31.378  42.890 -57.685 1.00 101.62 ? 53  GLU F OE2   1 
ATOM   4048  N  N     . THR F 2 39  ? 35.693  41.244 -56.416 1.00 73.34  ? 54  THR F N     1 
ATOM   4049  C  CA    . THR F 2 39  ? 36.023  40.540 -55.179 1.00 72.45  ? 54  THR F CA    1 
ATOM   4050  C  C     . THR F 2 39  ? 36.371  41.598 -54.138 1.00 74.05  ? 54  THR F C     1 
ATOM   4051  O  O     . THR F 2 39  ? 35.937  41.505 -52.997 1.00 73.92  ? 54  THR F O     1 
ATOM   4052  C  CB    . THR F 2 39  ? 37.150  39.517 -55.410 1.00 81.74  ? 54  THR F CB    1 
ATOM   4053  O  OG1   . THR F 2 39  ? 36.765  38.616 -56.448 1.00 82.91  ? 54  THR F OG1   1 
ATOM   4054  C  CG2   . THR F 2 39  ? 37.473  38.716 -54.165 1.00 80.27  ? 54  THR F CG2   1 
ATOM   4055  N  N     . ARG F 2 40  ? 37.104  42.627 -54.562 1.00 69.82  ? 55  ARG F N     1 
ATOM   4056  C  CA    . ARG F 2 40  ? 37.480  43.741 -53.700 1.00 69.80  ? 55  ARG F CA    1 
ATOM   4057  C  C     . ARG F 2 40  ? 36.215  44.443 -53.124 1.00 73.95  ? 55  ARG F C     1 
ATOM   4058  O  O     . ARG F 2 40  ? 36.109  44.618 -51.902 1.00 74.19  ? 55  ARG F O     1 
ATOM   4059  C  CB    . ARG F 2 40  ? 38.465  44.689 -54.419 1.00 68.50  ? 55  ARG F CB    1 
ATOM   4060  C  CG    . ARG F 2 40  ? 39.860  44.066 -54.553 1.00 80.68  ? 55  ARG F CG    1 
ATOM   4061  C  CD    . ARG F 2 40  ? 40.972  45.058 -54.886 1.00 94.33  ? 55  ARG F CD    1 
ATOM   4062  N  NE    . ARG F 2 40  ? 41.316  45.078 -56.312 1.00 102.53 ? 55  ARG F NE    1 
ATOM   4063  C  CZ    . ARG F 2 40  ? 42.204  44.271 -56.894 1.00 114.54 ? 55  ARG F CZ    1 
ATOM   4064  N  NH1   . ARG F 2 40  ? 42.449  44.371 -58.197 1.00 101.47 ? 55  ARG F NH1   1 
ATOM   4065  N  NH2   . ARG F 2 40  ? 42.848  43.354 -56.181 1.00 96.57  ? 55  ARG F NH2   1 
ATOM   4066  N  N     . GLY F 2 41  ? 35.241  44.717 -53.996 1.00 68.82  ? 56  GLY F N     1 
ATOM   4067  C  CA    . GLY F 2 41  ? 33.965  45.317 -53.633 1.00 67.84  ? 56  GLY F CA    1 
ATOM   4068  C  C     . GLY F 2 41  ? 33.205  44.488 -52.617 1.00 70.91  ? 56  GLY F C     1 
ATOM   4069  O  O     . GLY F 2 41  ? 32.789  45.020 -51.593 1.00 70.81  ? 56  GLY F O     1 
ATOM   4070  N  N     . VAL F 2 42  ? 33.096  43.162 -52.871 1.00 65.99  ? 57  VAL F N     1 
ATOM   4071  C  CA    . VAL F 2 42  ? 32.411  42.141 -52.061 1.00 65.17  ? 57  VAL F CA    1 
ATOM   4072  C  C     . VAL F 2 42  ? 33.089  41.935 -50.696 1.00 69.38  ? 57  VAL F C     1 
ATOM   4073  O  O     . VAL F 2 42  ? 32.392  41.833 -49.688 1.00 69.08  ? 57  VAL F O     1 
ATOM   4074  C  CB    . VAL F 2 42  ? 32.242  40.815 -52.869 1.00 67.73  ? 57  VAL F CB    1 
ATOM   4075  C  CG1   . VAL F 2 42  ? 31.810  39.648 -51.996 1.00 67.09  ? 57  VAL F CG1   1 
ATOM   4076  C  CG2   . VAL F 2 42  ? 31.254  41.006 -54.006 1.00 67.29  ? 57  VAL F CG2   1 
ATOM   4077  N  N     . LEU F 2 43  ? 34.428  41.892 -50.662 1.00 65.79  ? 58  LEU F N     1 
ATOM   4078  C  CA    . LEU F 2 43  ? 35.210  41.741 -49.429 1.00 64.87  ? 58  LEU F CA    1 
ATOM   4079  C  C     . LEU F 2 43  ? 35.039  42.961 -48.497 1.00 67.79  ? 58  LEU F C     1 
ATOM   4080  O  O     . LEU F 2 43  ? 34.908  42.777 -47.277 1.00 68.29  ? 58  LEU F O     1 
ATOM   4081  C  CB    . LEU F 2 43  ? 36.704  41.513 -49.765 1.00 64.53  ? 58  LEU F CB    1 
ATOM   4082  C  CG    . LEU F 2 43  ? 37.704  41.506 -48.612 1.00 68.37  ? 58  LEU F CG    1 
ATOM   4083  C  CD1   . LEU F 2 43  ? 37.465  40.320 -47.664 1.00 69.06  ? 58  LEU F CD1   1 
ATOM   4084  C  CD2   . LEU F 2 43  ? 39.088  41.466 -49.135 1.00 68.26  ? 58  LEU F CD2   1 
ATOM   4085  N  N     . LYS F 2 44  ? 35.036  44.193 -49.083 1.00 60.92  ? 59  LYS F N     1 
ATOM   4086  C  CA    . LYS F 2 44  ? 34.875  45.445 -48.346 1.00 59.43  ? 59  LYS F CA    1 
ATOM   4087  C  C     . LYS F 2 44  ? 33.521  45.487 -47.684 1.00 61.32  ? 59  LYS F C     1 
ATOM   4088  O  O     . LYS F 2 44  ? 33.451  45.883 -46.531 1.00 61.81  ? 59  LYS F O     1 
ATOM   4089  C  CB    . LYS F 2 44  ? 35.089  46.688 -49.236 1.00 61.96  ? 59  LYS F CB    1 
ATOM   4090  C  CG    . LYS F 2 44  ? 35.683  47.878 -48.472 1.00 73.08  ? 59  LYS F CG    1 
ATOM   4091  C  CD    . LYS F 2 44  ? 35.631  49.203 -49.223 1.00 81.38  ? 59  LYS F CD    1 
ATOM   4092  C  CE    . LYS F 2 44  ? 36.360  50.320 -48.471 1.00 100.54 ? 59  LYS F CE    1 
ATOM   4093  N  NZ    . LYS F 2 44  ? 37.167  51.242 -49.355 1.00 102.72 ? 59  LYS F NZ    1 
ATOM   4094  N  N     . VAL F 2 45  ? 32.454  45.044 -48.390 1.00 55.75  ? 60  VAL F N     1 
ATOM   4095  C  CA    . VAL F 2 45  ? 31.074  45.015 -47.881 1.00 54.09  ? 60  VAL F CA    1 
ATOM   4096  C  C     . VAL F 2 45  ? 31.018  44.049 -46.722 1.00 56.46  ? 60  VAL F C     1 
ATOM   4097  O  O     . VAL F 2 45  ? 30.492  44.390 -45.669 1.00 55.95  ? 60  VAL F O     1 
ATOM   4098  C  CB    . VAL F 2 45  ? 30.032  44.668 -48.972 1.00 57.14  ? 60  VAL F CB    1 
ATOM   4099  C  CG1   . VAL F 2 45  ? 28.637  44.555 -48.386 1.00 56.73  ? 60  VAL F CG1   1 
ATOM   4100  C  CG2   . VAL F 2 45  ? 30.027  45.706 -50.077 1.00 57.01  ? 60  VAL F CG2   1 
ATOM   4101  N  N     . PHE F 2 46  ? 31.609  42.866 -46.901 1.00 53.75  ? 61  PHE F N     1 
ATOM   4102  C  CA    . PHE F 2 46  ? 31.660  41.819 -45.880 1.00 53.31  ? 61  PHE F CA    1 
ATOM   4103  C  C     . PHE F 2 46  ? 32.318  42.359 -44.602 1.00 60.04  ? 61  PHE F C     1 
ATOM   4104  O  O     . PHE F 2 46  ? 31.745  42.221 -43.518 1.00 59.94  ? 61  PHE F O     1 
ATOM   4105  C  CB    . PHE F 2 46  ? 32.390  40.569 -46.403 1.00 53.77  ? 61  PHE F CB    1 
ATOM   4106  C  CG    . PHE F 2 46  ? 32.397  39.438 -45.405 1.00 53.86  ? 61  PHE F CG    1 
ATOM   4107  C  CD1   . PHE F 2 46  ? 33.383  39.352 -44.434 1.00 56.00  ? 61  PHE F CD1   1 
ATOM   4108  C  CD2   . PHE F 2 46  ? 31.396  38.490 -45.405 1.00 54.66  ? 61  PHE F CD2   1 
ATOM   4109  C  CE1   . PHE F 2 46  ? 33.361  38.342 -43.479 1.00 56.35  ? 61  PHE F CE1   1 
ATOM   4110  C  CE2   . PHE F 2 46  ? 31.388  37.478 -44.463 1.00 57.09  ? 61  PHE F CE2   1 
ATOM   4111  C  CZ    . PHE F 2 46  ? 32.366  37.414 -43.499 1.00 54.98  ? 61  PHE F CZ    1 
ATOM   4112  N  N     . LEU F 2 47  ? 33.504  42.980 -44.733 1.00 57.39  ? 62  LEU F N     1 
ATOM   4113  C  CA    . LEU F 2 47  ? 34.187  43.547 -43.587 1.00 57.26  ? 62  LEU F CA    1 
ATOM   4114  C  C     . LEU F 2 47  ? 33.407  44.724 -42.975 1.00 60.72  ? 62  LEU F C     1 
ATOM   4115  O  O     . LEU F 2 47  ? 33.340  44.830 -41.751 1.00 61.90  ? 62  LEU F O     1 
ATOM   4116  C  CB    . LEU F 2 47  ? 35.594  43.998 -43.977 1.00 57.49  ? 62  LEU F CB    1 
ATOM   4117  C  CG    . LEU F 2 47  ? 36.677  42.958 -43.921 1.00 63.01  ? 62  LEU F CG    1 
ATOM   4118  C  CD1   . LEU F 2 47  ? 37.986  43.558 -44.336 1.00 64.19  ? 62  LEU F CD1   1 
ATOM   4119  C  CD2   . LEU F 2 47  ? 36.860  42.428 -42.520 1.00 65.12  ? 62  LEU F CD2   1 
ATOM   4120  N  N     . GLU F 2 48  ? 32.825  45.608 -43.807 1.00 54.60  ? 63  GLU F N     1 
ATOM   4121  C  CA    . GLU F 2 48  ? 32.119  46.768 -43.264 1.00 53.38  ? 63  GLU F CA    1 
ATOM   4122  C  C     . GLU F 2 48  ? 31.068  46.260 -42.322 1.00 57.59  ? 63  GLU F C     1 
ATOM   4123  O  O     . GLU F 2 48  ? 31.120  46.581 -41.140 1.00 58.45  ? 63  GLU F O     1 
ATOM   4124  C  CB    . GLU F 2 48  ? 31.497  47.639 -44.362 1.00 54.23  ? 63  GLU F CB    1 
ATOM   4125  C  CG    . GLU F 2 48  ? 32.493  48.525 -45.086 1.00 67.94  ? 63  GLU F CG    1 
ATOM   4126  C  CD    . GLU F 2 48  ? 32.042  49.036 -46.444 1.00 91.62  ? 63  GLU F CD    1 
ATOM   4127  O  OE1   . GLU F 2 48  ? 30.955  48.618 -46.909 1.00 77.72  ? 63  GLU F OE1   1 
ATOM   4128  O  OE2   . GLU F 2 48  ? 32.776  49.855 -47.048 1.00 85.33  ? 63  GLU F OE2   1 
ATOM   4129  N  N     . ASN F 2 49  ? 30.209  45.355 -42.819 1.00 52.25  ? 64  ASN F N     1 
ATOM   4130  C  CA    . ASN F 2 49  ? 29.131  44.725 -42.081 1.00 51.17  ? 64  ASN F CA    1 
ATOM   4131  C  C     . ASN F 2 49  ? 29.580  44.052 -40.782 1.00 54.07  ? 64  ASN F C     1 
ATOM   4132  O  O     . ASN F 2 49  ? 29.023  44.363 -39.731 1.00 53.36  ? 64  ASN F O     1 
ATOM   4133  C  CB    . ASN F 2 49  ? 28.373  43.764 -42.987 1.00 52.02  ? 64  ASN F CB    1 
ATOM   4134  C  CG    . ASN F 2 49  ? 27.419  44.474 -43.926 1.00 84.58  ? 64  ASN F CG    1 
ATOM   4135  O  OD1   . ASN F 2 49  ? 27.606  44.496 -45.141 1.00 78.00  ? 64  ASN F OD1   1 
ATOM   4136  N  ND2   . ASN F 2 49  ? 26.362  45.070 -43.390 1.00 83.42  ? 64  ASN F ND2   1 
ATOM   4137  N  N     . VAL F 2 50  ? 30.619  43.206 -40.826 1.00 50.95  ? 65  VAL F N     1 
ATOM   4138  C  CA    . VAL F 2 50  ? 31.116  42.514 -39.625 1.00 50.57  ? 65  VAL F CA    1 
ATOM   4139  C  C     . VAL F 2 50  ? 31.725  43.494 -38.594 1.00 55.31  ? 65  VAL F C     1 
ATOM   4140  O  O     . VAL F 2 50  ? 31.293  43.485 -37.437 1.00 54.84  ? 65  VAL F O     1 
ATOM   4141  C  CB    . VAL F 2 50  ? 32.058  41.326 -39.935 1.00 53.93  ? 65  VAL F CB    1 
ATOM   4142  C  CG1   . VAL F 2 50  ? 32.517  40.658 -38.646 1.00 53.72  ? 65  VAL F CG1   1 
ATOM   4143  C  CG2   . VAL F 2 50  ? 31.361  40.303 -40.831 1.00 53.51  ? 65  VAL F CG2   1 
ATOM   4144  N  N     . ILE F 2 51  ? 32.686  44.348 -39.024 1.00 51.62  ? 66  ILE F N     1 
ATOM   4145  C  CA    . ILE F 2 51  ? 33.374  45.331 -38.178 1.00 50.60  ? 66  ILE F CA    1 
ATOM   4146  C  C     . ILE F 2 51  ? 32.391  46.339 -37.576 1.00 53.79  ? 66  ILE F C     1 
ATOM   4147  O  O     . ILE F 2 51  ? 32.550  46.709 -36.416 1.00 52.85  ? 66  ILE F O     1 
ATOM   4148  C  CB    . ILE F 2 51  ? 34.526  46.000 -38.959 1.00 53.70  ? 66  ILE F CB    1 
ATOM   4149  C  CG1   . ILE F 2 51  ? 35.584  44.950 -39.370 1.00 53.70  ? 66  ILE F CG1   1 
ATOM   4150  C  CG2   . ILE F 2 51  ? 35.164  47.154 -38.162 1.00 55.74  ? 66  ILE F CG2   1 
ATOM   4151  C  CD1   . ILE F 2 51  ? 36.432  45.354 -40.524 1.00 59.90  ? 66  ILE F CD1   1 
ATOM   4152  N  N     . ARG F 2 52  ? 31.364  46.757 -38.340 1.00 49.26  ? 67  ARG F N     1 
ATOM   4153  C  CA    . ARG F 2 52  ? 30.342  47.670 -37.829 1.00 48.38  ? 67  ARG F CA    1 
ATOM   4154  C  C     . ARG F 2 52  ? 29.706  47.082 -36.573 1.00 52.42  ? 67  ARG F C     1 
ATOM   4155  O  O     . ARG F 2 52  ? 29.727  47.709 -35.517 1.00 52.17  ? 67  ARG F O     1 
ATOM   4156  C  CB    . ARG F 2 52  ? 29.271  47.931 -38.888 1.00 48.26  ? 67  ARG F CB    1 
ATOM   4157  C  CG    . ARG F 2 52  ? 28.284  49.032 -38.533 1.00 57.27  ? 67  ARG F CG    1 
ATOM   4158  C  CD    . ARG F 2 52  ? 27.170  49.127 -39.559 1.00 82.43  ? 67  ARG F CD    1 
ATOM   4159  N  NE    . ARG F 2 52  ? 27.666  49.531 -40.875 1.00 102.18 ? 67  ARG F NE    1 
ATOM   4160  C  CZ    . ARG F 2 52  ? 27.609  48.771 -41.963 1.00 115.91 ? 67  ARG F CZ    1 
ATOM   4161  N  NH1   . ARG F 2 52  ? 27.043  47.570 -41.914 1.00 95.65  ? 67  ARG F NH1   1 
ATOM   4162  N  NH2   . ARG F 2 52  ? 28.095  49.214 -43.113 1.00 106.68 ? 67  ARG F NH2   1 
ATOM   4163  N  N     . ASP F 2 53  ? 29.217  45.851 -36.682 1.00 50.01  ? 68  ASP F N     1 
ATOM   4164  C  CA    . ASP F 2 53  ? 28.586  45.121 -35.588 1.00 50.37  ? 68  ASP F CA    1 
ATOM   4165  C  C     . ASP F 2 53  ? 29.568  44.840 -34.439 1.00 55.59  ? 68  ASP F C     1 
ATOM   4166  O  O     . ASP F 2 53  ? 29.202  45.034 -33.277 1.00 56.66  ? 68  ASP F O     1 
ATOM   4167  C  CB    . ASP F 2 53  ? 27.949  43.829 -36.111 1.00 51.17  ? 68  ASP F CB    1 
ATOM   4168  C  CG    . ASP F 2 53  ? 26.600  43.982 -36.806 1.00 59.81  ? 68  ASP F CG    1 
ATOM   4169  O  OD1   . ASP F 2 53  ? 26.287  45.111 -37.298 1.00 58.45  ? 68  ASP F OD1   1 
ATOM   4170  O  OD2   . ASP F 2 53  ? 25.868  42.974 -36.893 1.00 66.86  ? 68  ASP F OD2   1 
ATOM   4171  N  N     . ALA F 2 54  ? 30.818  44.444 -34.758 1.00 50.37  ? 69  ALA F N     1 
ATOM   4172  C  CA    . ALA F 2 54  ? 31.827  44.165 -33.743 1.00 49.86  ? 69  ALA F CA    1 
ATOM   4173  C  C     . ALA F 2 54  ? 32.087  45.417 -32.904 1.00 57.28  ? 69  ALA F C     1 
ATOM   4174  O  O     . ALA F 2 54  ? 32.061  45.353 -31.673 1.00 58.25  ? 69  ALA F O     1 
ATOM   4175  C  CB    . ALA F 2 54  ? 33.110  43.697 -34.401 1.00 50.18  ? 69  ALA F CB    1 
ATOM   4176  N  N     . VAL F 2 55  ? 32.264  46.564 -33.582 1.00 53.99  ? 70  VAL F N     1 
ATOM   4177  C  CA    . VAL F 2 55  ? 32.528  47.848 -32.968 1.00 54.18  ? 70  VAL F CA    1 
ATOM   4178  C  C     . VAL F 2 55  ? 31.307  48.296 -32.147 1.00 58.73  ? 70  VAL F C     1 
ATOM   4179  O  O     . VAL F 2 55  ? 31.500  48.824 -31.051 1.00 59.33  ? 70  VAL F O     1 
ATOM   4180  C  CB    . VAL F 2 55  ? 33.033  48.869 -34.019 1.00 58.13  ? 70  VAL F CB    1 
ATOM   4181  C  CG1   . VAL F 2 55  ? 33.090  50.281 -33.459 1.00 57.74  ? 70  VAL F CG1   1 
ATOM   4182  C  CG2   . VAL F 2 55  ? 34.400  48.456 -34.571 1.00 57.83  ? 70  VAL F CG2   1 
ATOM   4183  N  N     . THR F 2 56  ? 30.071  47.980 -32.606 1.00 53.66  ? 71  THR F N     1 
ATOM   4184  C  CA    . THR F 2 56  ? 28.842  48.259 -31.845 1.00 52.47  ? 71  THR F CA    1 
ATOM   4185  C  C     . THR F 2 56  ? 28.920  47.515 -30.494 1.00 54.31  ? 71  THR F C     1 
ATOM   4186  O  O     . THR F 2 56  ? 28.608  48.114 -29.463 1.00 54.66  ? 71  THR F O     1 
ATOM   4187  C  CB    . THR F 2 56  ? 27.590  47.876 -32.647 1.00 60.51  ? 71  THR F CB    1 
ATOM   4188  O  OG1   . THR F 2 56  ? 27.652  48.474 -33.942 1.00 64.73  ? 71  THR F OG1   1 
ATOM   4189  C  CG2   . THR F 2 56  ? 26.297  48.270 -31.946 1.00 57.93  ? 71  THR F CG2   1 
ATOM   4190  N  N     . TYR F 2 57  ? 29.395  46.240 -30.493 1.00 49.18  ? 72  TYR F N     1 
ATOM   4191  C  CA    . TYR F 2 57  ? 29.590  45.454 -29.259 1.00 48.00  ? 72  TYR F CA    1 
ATOM   4192  C  C     . TYR F 2 57  ? 30.667  46.084 -28.354 1.00 57.30  ? 72  TYR F C     1 
ATOM   4193  O  O     . TYR F 2 57  ? 30.419  46.289 -27.160 1.00 58.54  ? 72  TYR F O     1 
ATOM   4194  C  CB    . TYR F 2 57  ? 29.920  43.986 -29.558 1.00 46.07  ? 72  TYR F CB    1 
ATOM   4195  C  CG    . TYR F 2 57  ? 28.715  43.163 -29.953 1.00 43.07  ? 72  TYR F CG    1 
ATOM   4196  C  CD1   . TYR F 2 57  ? 27.643  42.998 -29.084 1.00 43.79  ? 72  TYR F CD1   1 
ATOM   4197  C  CD2   . TYR F 2 57  ? 28.645  42.547 -31.198 1.00 42.82  ? 72  TYR F CD2   1 
ATOM   4198  C  CE1   . TYR F 2 57  ? 26.522  42.256 -29.446 1.00 42.78  ? 72  TYR F CE1   1 
ATOM   4199  C  CE2   . TYR F 2 57  ? 27.507  41.834 -31.591 1.00 43.18  ? 72  TYR F CE2   1 
ATOM   4200  C  CZ    . TYR F 2 57  ? 26.456  41.679 -30.704 1.00 44.81  ? 72  TYR F CZ    1 
ATOM   4201  O  OH    . TYR F 2 57  ? 25.331  40.989 -31.059 1.00 35.20  ? 72  TYR F OH    1 
ATOM   4202  N  N     . THR F 2 58  ? 31.847  46.420 -28.939 1.00 54.70  ? 73  THR F N     1 
ATOM   4203  C  CA    . THR F 2 58  ? 32.971  47.067 -28.260 1.00 54.77  ? 73  THR F CA    1 
ATOM   4204  C  C     . THR F 2 58  ? 32.439  48.297 -27.557 1.00 61.23  ? 73  THR F C     1 
ATOM   4205  O  O     . THR F 2 58  ? 32.620  48.433 -26.352 1.00 60.95  ? 73  THR F O     1 
ATOM   4206  C  CB    . THR F 2 58  ? 34.060  47.424 -29.277 1.00 61.72  ? 73  THR F CB    1 
ATOM   4207  O  OG1   . THR F 2 58  ? 34.332  46.281 -30.074 1.00 69.25  ? 73  THR F OG1   1 
ATOM   4208  C  CG2   . THR F 2 58  ? 35.337  47.893 -28.630 1.00 57.03  ? 73  THR F CG2   1 
ATOM   4209  N  N     . GLU F 2 59  ? 31.716  49.148 -28.301 1.00 60.63  ? 74  GLU F N     1 
ATOM   4210  C  CA    . GLU F 2 59  ? 31.097  50.364 -27.785 1.00 62.11  ? 74  GLU F CA    1 
ATOM   4211  C  C     . GLU F 2 59  ? 30.146  50.058 -26.632 1.00 68.34  ? 74  GLU F C     1 
ATOM   4212  O  O     . GLU F 2 59  ? 30.268  50.703 -25.596 1.00 70.70  ? 74  GLU F O     1 
ATOM   4213  C  CB    . GLU F 2 59  ? 30.375  51.156 -28.883 1.00 63.76  ? 74  GLU F CB    1 
ATOM   4214  C  CG    . GLU F 2 59  ? 31.269  52.110 -29.648 1.00 77.68  ? 74  GLU F CG    1 
ATOM   4215  C  CD    . GLU F 2 59  ? 30.515  53.161 -30.441 1.00 118.84 ? 74  GLU F CD    1 
ATOM   4216  O  OE1   . GLU F 2 59  ? 29.802  52.791 -31.406 1.00 121.74 ? 74  GLU F OE1   1 
ATOM   4217  O  OE2   . GLU F 2 59  ? 30.647  54.360 -30.098 1.00 119.60 ? 74  GLU F OE2   1 
ATOM   4218  N  N     . HIS F 2 60  ? 29.236  49.064 -26.771 1.00 62.39  ? 75  HIS F N     1 
ATOM   4219  C  CA    . HIS F 2 60  ? 28.333  48.721 -25.665 1.00 60.56  ? 75  HIS F CA    1 
ATOM   4220  C  C     . HIS F 2 60  ? 29.132  48.362 -24.386 1.00 67.75  ? 75  HIS F C     1 
ATOM   4221  O  O     . HIS F 2 60  ? 28.814  48.859 -23.304 1.00 66.98  ? 75  HIS F O     1 
ATOM   4222  C  CB    . HIS F 2 60  ? 27.327  47.629 -26.058 1.00 59.15  ? 75  HIS F CB    1 
ATOM   4223  C  CG    . HIS F 2 60  ? 26.243  47.453 -25.047 1.00 61.09  ? 75  HIS F CG    1 
ATOM   4224  N  ND1   . HIS F 2 60  ? 26.219  46.366 -24.195 1.00 62.53  ? 75  HIS F ND1   1 
ATOM   4225  C  CD2   . HIS F 2 60  ? 25.219  48.270 -24.732 1.00 61.95  ? 75  HIS F CD2   1 
ATOM   4226  C  CE1   . HIS F 2 60  ? 25.157  46.532 -23.427 1.00 61.58  ? 75  HIS F CE1   1 
ATOM   4227  N  NE2   . HIS F 2 60  ? 24.517  47.659 -23.724 1.00 61.85  ? 75  HIS F NE2   1 
ATOM   4228  N  N     . ALA F 2 61  ? 30.235  47.603 -24.535 1.00 66.90  ? 76  ALA F N     1 
ATOM   4229  C  CA    . ALA F 2 61  ? 31.099  47.210 -23.421 1.00 68.41  ? 76  ALA F CA    1 
ATOM   4230  C  C     . ALA F 2 61  ? 31.849  48.397 -22.770 1.00 77.02  ? 76  ALA F C     1 
ATOM   4231  O  O     . ALA F 2 61  ? 32.526  48.225 -21.744 1.00 77.94  ? 76  ALA F O     1 
ATOM   4232  C  CB    . ALA F 2 61  ? 32.091  46.173 -23.905 1.00 69.07  ? 76  ALA F CB    1 
ATOM   4233  N  N     . LYS F 2 62  ? 31.723  49.601 -23.372 1.00 75.13  ? 77  LYS F N     1 
ATOM   4234  C  CA    . LYS F 2 62  ? 32.400  50.843 -22.968 1.00 75.30  ? 77  LYS F CA    1 
ATOM   4235  C  C     . LYS F 2 62  ? 33.929  50.652 -23.090 1.00 80.31  ? 77  LYS F C     1 
ATOM   4236  O  O     . LYS F 2 62  ? 34.712  51.190 -22.296 1.00 81.61  ? 77  LYS F O     1 
ATOM   4237  C  CB    . LYS F 2 62  ? 31.931  51.337 -21.580 1.00 77.63  ? 77  LYS F CB    1 
ATOM   4238  C  CG    . LYS F 2 62  ? 30.589  52.060 -21.606 1.00 86.80  ? 77  LYS F CG    1 
ATOM   4239  C  CD    . LYS F 2 62  ? 29.892  52.004 -20.251 1.00 95.48  ? 77  LYS F CD    1 
ATOM   4240  C  CE    . LYS F 2 62  ? 28.662  52.880 -20.201 1.00 107.24 ? 77  LYS F CE    1 
ATOM   4241  N  NZ    . LYS F 2 62  ? 27.962  52.772 -18.895 1.00 115.28 ? 77  LYS F NZ    1 
ATOM   4242  N  N     . ARG F 2 63  ? 34.329  49.865 -24.113 1.00 75.51  ? 78  ARG F N     1 
ATOM   4243  C  CA    . ARG F 2 63  ? 35.702  49.533 -24.456 1.00 75.05  ? 78  ARG F CA    1 
ATOM   4244  C  C     . ARG F 2 63  ? 36.192  50.272 -25.706 1.00 82.12  ? 78  ARG F C     1 
ATOM   4245  O  O     . ARG F 2 63  ? 35.389  50.700 -26.534 1.00 82.45  ? 78  ARG F O     1 
ATOM   4246  C  CB    . ARG F 2 63  ? 35.833  48.027 -24.664 1.00 71.55  ? 78  ARG F CB    1 
ATOM   4247  C  CG    . ARG F 2 63  ? 35.938  47.248 -23.372 1.00 73.05  ? 78  ARG F CG    1 
ATOM   4248  C  CD    . ARG F 2 63  ? 36.402  45.834 -23.637 1.00 78.43  ? 78  ARG F CD    1 
ATOM   4249  N  NE    . ARG F 2 63  ? 35.292  44.920 -23.927 1.00 77.30  ? 78  ARG F NE    1 
ATOM   4250  C  CZ    . ARG F 2 63  ? 34.890  44.583 -25.149 1.00 88.81  ? 78  ARG F CZ    1 
ATOM   4251  N  NH1   . ARG F 2 63  ? 35.470  45.113 -26.218 1.00 76.35  ? 78  ARG F NH1   1 
ATOM   4252  N  NH2   . ARG F 2 63  ? 33.895  43.725 -25.312 1.00 77.14  ? 78  ARG F NH2   1 
ATOM   4253  N  N     . LYS F 2 64  ? 37.521  50.423 -25.821 1.00 80.53  ? 79  LYS F N     1 
ATOM   4254  C  CA    . LYS F 2 64  ? 38.246  51.028 -26.940 1.00 80.91  ? 79  LYS F CA    1 
ATOM   4255  C  C     . LYS F 2 64  ? 38.824  49.914 -27.831 1.00 85.62  ? 79  LYS F C     1 
ATOM   4256  O  O     . LYS F 2 64  ? 39.048  50.135 -29.023 1.00 86.49  ? 79  LYS F O     1 
ATOM   4257  C  CB    . LYS F 2 64  ? 39.399  51.922 -26.414 1.00 83.03  ? 79  LYS F CB    1 
ATOM   4258  C  CG    . LYS F 2 64  ? 38.990  53.318 -25.976 1.00 92.31  ? 79  LYS F CG    1 
ATOM   4259  C  CD    . LYS F 2 64  ? 40.110  54.281 -26.353 1.00 106.90 ? 79  LYS F CD    1 
ATOM   4260  C  CE    . LYS F 2 64  ? 39.691  55.712 -26.644 1.00 128.28 ? 79  LYS F CE    1 
ATOM   4261  N  NZ    . LYS F 2 64  ? 38.933  55.829 -27.926 1.00 141.82 ? 79  LYS F NZ    1 
ATOM   4262  N  N     . THR F 2 65  ? 39.073  48.727 -27.225 1.00 80.31  ? 80  THR F N     1 
ATOM   4263  C  CA    . THR F 2 65  ? 39.660  47.541 -27.833 1.00 79.05  ? 80  THR F CA    1 
ATOM   4264  C  C     . THR F 2 65  ? 38.605  46.549 -28.260 1.00 80.13  ? 80  THR F C     1 
ATOM   4265  O  O     . THR F 2 65  ? 37.836  46.070 -27.424 1.00 80.23  ? 80  THR F O     1 
ATOM   4266  C  CB    . THR F 2 65  ? 40.658  46.890 -26.869 1.00 94.03  ? 80  THR F CB    1 
ATOM   4267  O  OG1   . THR F 2 65  ? 41.553  47.891 -26.338 1.00 97.04  ? 80  THR F OG1   1 
ATOM   4268  C  CG2   . THR F 2 65  ? 41.436  45.735 -27.517 1.00 93.52  ? 80  THR F CG2   1 
ATOM   4269  N  N     . VAL F 2 66  ? 38.585  46.248 -29.578 1.00 73.65  ? 81  VAL F N     1 
ATOM   4270  C  CA    . VAL F 2 66  ? 37.720  45.279 -30.249 1.00 71.37  ? 81  VAL F CA    1 
ATOM   4271  C  C     . VAL F 2 66  ? 38.339  43.905 -29.941 1.00 76.48  ? 81  VAL F C     1 
ATOM   4272  O  O     . VAL F 2 66  ? 39.497  43.643 -30.295 1.00 77.28  ? 81  VAL F O     1 
ATOM   4273  C  CB    . VAL F 2 66  ? 37.598  45.544 -31.778 1.00 72.89  ? 81  VAL F CB    1 
ATOM   4274  C  CG1   . VAL F 2 66  ? 36.767  44.465 -32.460 1.00 72.35  ? 81  VAL F CG1   1 
ATOM   4275  C  CG2   . VAL F 2 66  ? 37.020  46.927 -32.064 1.00 71.92  ? 81  VAL F CG2   1 
ATOM   4276  N  N     . THR F 2 67  ? 37.574  43.056 -29.231 1.00 71.67  ? 82  THR F N     1 
ATOM   4277  C  CA    . THR F 2 67  ? 38.023  41.736 -28.823 1.00 70.10  ? 82  THR F CA    1 
ATOM   4278  C  C     . THR F 2 67  ? 37.591  40.683 -29.830 1.00 74.08  ? 82  THR F C     1 
ATOM   4279  O  O     . THR F 2 67  ? 36.776  40.965 -30.718 1.00 74.06  ? 82  THR F O     1 
ATOM   4280  C  CB    . THR F 2 67  ? 37.592  41.443 -27.369 1.00 72.78  ? 82  THR F CB    1 
ATOM   4281  O  OG1   . THR F 2 67  ? 36.181  41.260 -27.275 1.00 70.55  ? 82  THR F OG1   1 
ATOM   4282  C  CG2   . THR F 2 67  ? 38.044  42.513 -26.393 1.00 70.75  ? 82  THR F CG2   1 
ATOM   4283  N  N     . ALA F 2 68  ? 38.169  39.472 -29.707 1.00 70.14  ? 83  ALA F N     1 
ATOM   4284  C  CA    . ALA F 2 68  ? 37.860  38.295 -30.524 1.00 68.94  ? 83  ALA F CA    1 
ATOM   4285  C  C     . ALA F 2 68  ? 36.370  37.985 -30.401 1.00 72.42  ? 83  ALA F C     1 
ATOM   4286  O  O     . ALA F 2 68  ? 35.711  37.766 -31.412 1.00 71.56  ? 83  ALA F O     1 
ATOM   4287  C  CB    . ALA F 2 68  ? 38.678  37.116 -30.043 1.00 69.22  ? 83  ALA F CB    1 
ATOM   4288  N  N     . MET F 2 69  ? 35.832  38.051 -29.164 1.00 69.69  ? 84  MET F N     1 
ATOM   4289  C  CA    . MET F 2 69  ? 34.416  37.830 -28.855 1.00 69.67  ? 84  MET F CA    1 
ATOM   4290  C  C     . MET F 2 69  ? 33.508  38.794 -29.563 1.00 70.11  ? 84  MET F C     1 
ATOM   4291  O  O     . MET F 2 69  ? 32.462  38.370 -30.026 1.00 69.95  ? 84  MET F O     1 
ATOM   4292  C  CB    . MET F 2 69  ? 34.143  37.891 -27.345 1.00 72.90  ? 84  MET F CB    1 
ATOM   4293  C  CG    . MET F 2 69  ? 34.524  36.631 -26.617 1.00 77.29  ? 84  MET F CG    1 
ATOM   4294  S  SD    . MET F 2 69  ? 33.721  35.187 -27.337 1.00 82.65  ? 84  MET F SD    1 
ATOM   4295  C  CE    . MET F 2 69  ? 33.028  34.438 -25.833 1.00 79.86  ? 84  MET F CE    1 
ATOM   4296  N  N     . ASP F 2 70  ? 33.887  40.081 -29.652 1.00 63.82  ? 85  ASP F N     1 
ATOM   4297  C  CA    . ASP F 2 70  ? 33.095  41.089 -30.357 1.00 62.26  ? 85  ASP F CA    1 
ATOM   4298  C  C     . ASP F 2 70  ? 32.941  40.705 -31.815 1.00 63.44  ? 85  ASP F C     1 
ATOM   4299  O  O     . ASP F 2 70  ? 31.857  40.883 -32.370 1.00 61.84  ? 85  ASP F O     1 
ATOM   4300  C  CB    . ASP F 2 70  ? 33.723  42.489 -30.241 1.00 63.77  ? 85  ASP F CB    1 
ATOM   4301  C  CG    . ASP F 2 70  ? 33.809  43.018 -28.826 1.00 67.02  ? 85  ASP F CG    1 
ATOM   4302  O  OD1   . ASP F 2 70  ? 32.951  42.639 -27.992 1.00 68.58  ? 85  ASP F OD1   1 
ATOM   4303  O  OD2   . ASP F 2 70  ? 34.731  43.799 -28.549 1.00 66.04  ? 85  ASP F OD2   1 
ATOM   4304  N  N     . VAL F 2 71  ? 34.022  40.146 -32.418 1.00 58.40  ? 86  VAL F N     1 
ATOM   4305  C  CA    . VAL F 2 71  ? 34.056  39.674 -33.806 1.00 56.46  ? 86  VAL F CA    1 
ATOM   4306  C  C     . VAL F 2 71  ? 33.222  38.406 -33.931 1.00 57.71  ? 86  VAL F C     1 
ATOM   4307  O  O     . VAL F 2 71  ? 32.465  38.249 -34.888 1.00 57.51  ? 86  VAL F O     1 
ATOM   4308  C  CB    . VAL F 2 71  ? 35.501  39.492 -34.299 1.00 59.21  ? 86  VAL F CB    1 
ATOM   4309  C  CG1   . VAL F 2 71  ? 35.539  38.765 -35.636 1.00 58.75  ? 86  VAL F CG1   1 
ATOM   4310  C  CG2   . VAL F 2 71  ? 36.198  40.842 -34.400 1.00 58.95  ? 86  VAL F CG2   1 
ATOM   4311  N  N     . VAL F 2 72  ? 33.338  37.531 -32.935 1.00 51.75  ? 87  VAL F N     1 
ATOM   4312  C  CA    . VAL F 2 72  ? 32.607  36.279 -32.852 1.00 50.69  ? 87  VAL F CA    1 
ATOM   4313  C  C     . VAL F 2 72  ? 31.105  36.568 -32.738 1.00 54.04  ? 87  VAL F C     1 
ATOM   4314  O  O     . VAL F 2 72  ? 30.325  36.010 -33.510 1.00 55.06  ? 87  VAL F O     1 
ATOM   4315  C  CB    . VAL F 2 72  ? 33.202  35.371 -31.731 1.00 54.50  ? 87  VAL F CB    1 
ATOM   4316  C  CG1   . VAL F 2 72  ? 32.201  34.353 -31.196 1.00 54.04  ? 87  VAL F CG1   1 
ATOM   4317  C  CG2   . VAL F 2 72  ? 34.465  34.663 -32.220 1.00 54.16  ? 87  VAL F CG2   1 
ATOM   4318  N  N     . TYR F 2 73  ? 30.716  37.517 -31.872 1.00 48.50  ? 88  TYR F N     1 
ATOM   4319  C  CA    . TYR F 2 73  ? 29.325  37.906 -31.688 1.00 46.97  ? 88  TYR F CA    1 
ATOM   4320  C  C     . TYR F 2 73  ? 28.713  38.501 -32.936 1.00 49.66  ? 88  TYR F C     1 
ATOM   4321  O  O     . TYR F 2 73  ? 27.545  38.215 -33.216 1.00 49.54  ? 88  TYR F O     1 
ATOM   4322  C  CB    . TYR F 2 73  ? 29.160  38.831 -30.487 1.00 47.68  ? 88  TYR F CB    1 
ATOM   4323  C  CG    . TYR F 2 73  ? 29.457  38.179 -29.157 1.00 51.52  ? 88  TYR F CG    1 
ATOM   4324  C  CD1   . TYR F 2 73  ? 29.220  36.826 -28.956 1.00 53.75  ? 88  TYR F CD1   1 
ATOM   4325  C  CD2   . TYR F 2 73  ? 29.981  38.910 -28.103 1.00 54.64  ? 88  TYR F CD2   1 
ATOM   4326  C  CE1   . TYR F 2 73  ? 29.512  36.213 -27.740 1.00 55.84  ? 88  TYR F CE1   1 
ATOM   4327  C  CE2   . TYR F 2 73  ? 30.284  38.308 -26.881 1.00 57.01  ? 88  TYR F CE2   1 
ATOM   4328  C  CZ    . TYR F 2 73  ? 30.036  36.958 -26.702 1.00 67.14  ? 88  TYR F CZ    1 
ATOM   4329  O  OH    . TYR F 2 73  ? 30.278  36.366 -25.487 1.00 74.74  ? 88  TYR F OH    1 
ATOM   4330  N  N     . ALA F 2 74  ? 29.509  39.300 -33.700 1.00 44.88  ? 89  ALA F N     1 
ATOM   4331  C  CA    . ALA F 2 74  ? 29.133  39.990 -34.952 1.00 43.17  ? 89  ALA F CA    1 
ATOM   4332  C  C     . ALA F 2 74  ? 28.850  38.980 -36.043 1.00 47.57  ? 89  ALA F C     1 
ATOM   4333  O  O     . ALA F 2 74  ? 27.858  39.111 -36.766 1.00 48.10  ? 89  ALA F O     1 
ATOM   4334  C  CB    . ALA F 2 74  ? 30.267  40.884 -35.400 1.00 43.51  ? 89  ALA F CB    1 
ATOM   4335  N  N     . LEU F 2 75  ? 29.746  37.973 -36.172 1.00 42.52  ? 90  LEU F N     1 
ATOM   4336  C  CA    . LEU F 2 75  ? 29.628  36.912 -37.166 1.00 40.48  ? 90  LEU F CA    1 
ATOM   4337  C  C     . LEU F 2 75  ? 28.389  36.091 -36.900 1.00 46.93  ? 90  LEU F C     1 
ATOM   4338  O  O     . LEU F 2 75  ? 27.612  35.893 -37.822 1.00 48.85  ? 90  LEU F O     1 
ATOM   4339  C  CB    . LEU F 2 75  ? 30.899  36.048 -37.228 1.00 38.94  ? 90  LEU F CB    1 
ATOM   4340  C  CG    . LEU F 2 75  ? 32.156  36.750 -37.782 1.00 41.97  ? 90  LEU F CG    1 
ATOM   4341  C  CD1   . LEU F 2 75  ? 33.409  36.050 -37.366 1.00 42.49  ? 90  LEU F CD1   1 
ATOM   4342  C  CD2   . LEU F 2 75  ? 32.104  36.910 -39.299 1.00 40.76  ? 90  LEU F CD2   1 
ATOM   4343  N  N     . LYS F 2 76  ? 28.132  35.702 -35.638 1.00 42.64  ? 91  LYS F N     1 
ATOM   4344  C  CA    . LYS F 2 76  ? 26.924  34.932 -35.293 1.00 41.69  ? 91  LYS F CA    1 
ATOM   4345  C  C     . LYS F 2 76  ? 25.658  35.677 -35.758 1.00 46.87  ? 91  LYS F C     1 
ATOM   4346  O  O     . LYS F 2 76  ? 24.799  35.054 -36.382 1.00 47.60  ? 91  LYS F O     1 
ATOM   4347  C  CB    . LYS F 2 76  ? 26.875  34.572 -33.790 1.00 43.04  ? 91  LYS F CB    1 
ATOM   4348  C  CG    . LYS F 2 76  ? 25.915  33.437 -33.438 1.00 60.97  ? 91  LYS F CG    1 
ATOM   4349  C  CD    . LYS F 2 76  ? 26.621  32.273 -32.732 1.00 76.21  ? 91  LYS F CD    1 
ATOM   4350  C  CE    . LYS F 2 76  ? 25.746  31.447 -31.828 1.00 88.53  ? 91  LYS F CE    1 
ATOM   4351  N  NZ    . LYS F 2 76  ? 26.525  30.370 -31.159 1.00 93.54  ? 91  LYS F NZ    1 
ATOM   4352  N  N     . ARG F 2 77  ? 25.604  37.023 -35.537 1.00 43.45  ? 92  ARG F N     1 
ATOM   4353  C  CA    . ARG F 2 77  ? 24.545  37.963 -35.945 1.00 42.10  ? 92  ARG F CA    1 
ATOM   4354  C  C     . ARG F 2 77  ? 24.383  37.941 -37.444 1.00 45.71  ? 92  ARG F C     1 
ATOM   4355  O  O     . ARG F 2 77  ? 23.251  37.823 -37.913 1.00 46.74  ? 92  ARG F O     1 
ATOM   4356  C  CB    . ARG F 2 77  ? 24.915  39.378 -35.552 1.00 41.17  ? 92  ARG F CB    1 
ATOM   4357  C  CG    . ARG F 2 77  ? 24.229  39.882 -34.324 1.00 51.78  ? 92  ARG F CG    1 
ATOM   4358  C  CD    . ARG F 2 77  ? 23.819  41.314 -34.536 1.00 43.31  ? 92  ARG F CD    1 
ATOM   4359  N  NE    . ARG F 2 77  ? 22.493  41.377 -35.146 1.00 56.21  ? 92  ARG F NE    1 
ATOM   4360  C  CZ    . ARG F 2 77  ? 22.249  41.836 -36.370 1.00 80.14  ? 92  ARG F CZ    1 
ATOM   4361  N  NH1   . ARG F 2 77  ? 23.237  42.316 -37.117 1.00 65.75  ? 92  ARG F NH1   1 
ATOM   4362  N  NH2   . ARG F 2 77  ? 21.014  41.843 -36.851 1.00 72.16  ? 92  ARG F NH2   1 
ATOM   4363  N  N     . GLN F 2 78  ? 25.520  38.037 -38.197 1.00 40.57  ? 93  GLN F N     1 
ATOM   4364  C  CA    . GLN F 2 78  ? 25.592  37.974 -39.663 1.00 39.91  ? 93  GLN F CA    1 
ATOM   4365  C  C     . GLN F 2 78  ? 25.242  36.567 -40.194 1.00 47.47  ? 93  GLN F C     1 
ATOM   4366  O  O     . GLN F 2 78  ? 25.225  36.371 -41.414 1.00 50.29  ? 93  GLN F O     1 
ATOM   4367  C  CB    . GLN F 2 78  ? 27.008  38.322 -40.156 1.00 40.33  ? 93  GLN F CB    1 
ATOM   4368  C  CG    . GLN F 2 78  ? 27.507  39.743 -39.869 1.00 42.48  ? 93  GLN F CG    1 
ATOM   4369  C  CD    . GLN F 2 78  ? 26.580  40.870 -40.284 1.00 55.78  ? 93  GLN F CD    1 
ATOM   4370  O  OE1   . GLN F 2 78  ? 26.043  40.928 -41.406 1.00 49.11  ? 93  GLN F OE1   1 
ATOM   4371  N  NE2   . GLN F 2 78  ? 26.387  41.811 -39.377 1.00 43.57  ? 93  GLN F NE2   1 
ATOM   4372  N  N     . GLY F 2 79  ? 25.097  35.600 -39.295 1.00 41.59  ? 94  GLY F N     1 
ATOM   4373  C  CA    . GLY F 2 79  ? 24.824  34.217 -39.708 1.00 41.62  ? 94  GLY F CA    1 
ATOM   4374  C  C     . GLY F 2 79  ? 26.048  33.616 -40.360 1.00 47.59  ? 94  GLY F C     1 
ATOM   4375  O  O     . GLY F 2 79  ? 25.909  32.970 -41.393 1.00 46.84  ? 94  GLY F O     1 
ATOM   4376  N  N     . ARG F 2 80  ? 27.214  33.850 -39.767 1.00 44.96  ? 95  ARG F N     1 
ATOM   4377  C  CA    . ARG F 2 80  ? 28.503  33.336 -40.287 1.00 45.92  ? 95  ARG F CA    1 
ATOM   4378  C  C     . ARG F 2 80  ? 29.276  33.016 -39.010 1.00 53.40  ? 95  ARG F C     1 
ATOM   4379  O  O     . ARG F 2 80  ? 30.392  33.492 -38.883 1.00 53.41  ? 95  ARG F O     1 
ATOM   4380  C  CB    . ARG F 2 80  ? 29.254  34.440 -41.029 1.00 48.08  ? 95  ARG F CB    1 
ATOM   4381  C  CG    . ARG F 2 80  ? 28.525  34.964 -42.253 1.00 60.53  ? 95  ARG F CG    1 
ATOM   4382  C  CD    . ARG F 2 80  ? 29.414  34.913 -43.462 1.00 65.17  ? 95  ARG F CD    1 
ATOM   4383  N  NE    . ARG F 2 80  ? 29.281  33.750 -44.319 1.00 60.81  ? 95  ARG F NE    1 
ATOM   4384  C  CZ    . ARG F 2 80  ? 30.241  32.868 -44.501 1.00 62.56  ? 95  ARG F CZ    1 
ATOM   4385  N  NH1   . ARG F 2 80  ? 31.384  33.007 -43.865 1.00 44.56  ? 95  ARG F NH1   1 
ATOM   4386  N  NH2   . ARG F 2 80  ? 30.062  31.859 -45.319 1.00 40.54  ? 95  ARG F NH2   1 
ATOM   4387  N  N     . THR F 2 81  ? 28.674  32.204 -38.141 1.00 50.71  ? 96  THR F N     1 
ATOM   4388  C  CA    . THR F 2 81  ? 29.226  31.594 -36.901 1.00 49.99  ? 96  THR F CA    1 
ATOM   4389  C  C     . THR F 2 81  ? 30.631  31.032 -37.103 1.00 54.38  ? 96  THR F C     1 
ATOM   4390  O  O     . THR F 2 81  ? 30.802  30.198 -37.978 1.00 52.79  ? 96  THR F O     1 
ATOM   4391  C  CB    . THR F 2 81  ? 28.290  30.483 -36.441 1.00 48.45  ? 96  THR F CB    1 
ATOM   4392  O  OG1   . THR F 2 81  ? 27.028  31.132 -36.378 1.00 43.99  ? 96  THR F OG1   1 
ATOM   4393  C  CG2   . THR F 2 81  ? 28.644  29.931 -35.086 1.00 42.47  ? 96  THR F CG2   1 
ATOM   4394  N  N     . LEU F 2 82  ? 31.564  31.428 -36.240 1.00 52.29  ? 97  LEU F N     1 
ATOM   4395  C  CA    . LEU F 2 82  ? 32.988  31.015 -36.348 1.00 51.98  ? 97  LEU F CA    1 
ATOM   4396  C  C     . LEU F 2 82  ? 33.403  30.147 -35.163 1.00 56.36  ? 97  LEU F C     1 
ATOM   4397  O  O     . LEU F 2 82  ? 33.153  30.541 -34.025 1.00 54.70  ? 97  LEU F O     1 
ATOM   4398  C  CB    . LEU F 2 82  ? 33.843  32.279 -36.379 1.00 51.66  ? 97  LEU F CB    1 
ATOM   4399  C  CG    . LEU F 2 82  ? 35.312  32.061 -36.711 1.00 55.85  ? 97  LEU F CG    1 
ATOM   4400  C  CD1   . LEU F 2 82  ? 35.458  31.275 -37.997 1.00 55.91  ? 97  LEU F CD1   1 
ATOM   4401  C  CD2   . LEU F 2 82  ? 36.030  33.386 -36.821 1.00 55.88  ? 97  LEU F CD2   1 
ATOM   4402  N  N     . TYR F 2 83  ? 34.075  29.034 -35.447 1.00 55.90  ? 98  TYR F N     1 
ATOM   4403  C  CA    . TYR F 2 83  ? 34.521  28.092 -34.393 1.00 57.03  ? 98  TYR F CA    1 
ATOM   4404  C  C     . TYR F 2 83  ? 36.032  28.213 -34.192 1.00 65.23  ? 98  TYR F C     1 
ATOM   4405  O  O     . TYR F 2 83  ? 36.782  28.120 -35.149 1.00 63.89  ? 98  TYR F O     1 
ATOM   4406  C  CB    . TYR F 2 83  ? 34.184  26.659 -34.798 1.00 57.57  ? 98  TYR F CB    1 
ATOM   4407  C  CG    . TYR F 2 83  ? 32.781  26.204 -34.503 1.00 58.75  ? 98  TYR F CG    1 
ATOM   4408  C  CD1   . TYR F 2 83  ? 31.771  27.096 -34.219 1.00 59.66  ? 98  TYR F CD1   1 
ATOM   4409  C  CD2   . TYR F 2 83  ? 32.462  24.862 -34.527 1.00 59.93  ? 98  TYR F CD2   1 
ATOM   4410  C  CE1   . TYR F 2 83  ? 30.485  26.661 -33.960 1.00 59.88  ? 98  TYR F CE1   1 
ATOM   4411  C  CE2   . TYR F 2 83  ? 31.185  24.409 -34.265 1.00 60.67  ? 98  TYR F CE2   1 
ATOM   4412  C  CZ    . TYR F 2 83  ? 30.188  25.312 -33.978 1.00 68.25  ? 98  TYR F CZ    1 
ATOM   4413  O  OH    . TYR F 2 83  ? 28.932  24.856 -33.717 1.00 67.26  ? 98  TYR F OH    1 
ATOM   4414  N  N     . GLY F 2 84  ? 36.444  28.402 -32.947 1.00 65.77  ? 99  GLY F N     1 
ATOM   4415  C  CA    . GLY F 2 84  ? 37.846  28.528 -32.563 1.00 67.29  ? 99  GLY F CA    1 
ATOM   4416  C  C     . GLY F 2 84  ? 38.371  29.841 -31.996 1.00 74.53  ? 99  GLY F C     1 
ATOM   4417  O  O     . GLY F 2 84  ? 39.576  29.914 -31.707 1.00 74.80  ? 99  GLY F O     1 
ATOM   4418  N  N     . PHE F 2 85  ? 37.513  30.886 -31.820 1.00 72.17  ? 100 PHE F N     1 
ATOM   4419  C  CA    . PHE F 2 85  ? 38.011  32.151 -31.285 1.00 72.84  ? 100 PHE F CA    1 
ATOM   4420  C  C     . PHE F 2 85  ? 37.397  32.579 -29.929 1.00 78.97  ? 100 PHE F C     1 
ATOM   4421  O  O     . PHE F 2 85  ? 37.458  33.756 -29.571 1.00 77.66  ? 100 PHE F O     1 
ATOM   4422  C  CB    . PHE F 2 85  ? 37.923  33.272 -32.329 1.00 74.74  ? 100 PHE F CB    1 
ATOM   4423  C  CG    . PHE F 2 85  ? 38.933  33.077 -33.434 1.00 76.42  ? 100 PHE F CG    1 
ATOM   4424  C  CD1   . PHE F 2 85  ? 38.646  32.272 -34.527 1.00 79.45  ? 100 PHE F CD1   1 
ATOM   4425  C  CD2   . PHE F 2 85  ? 40.189  33.662 -33.363 1.00 78.58  ? 100 PHE F CD2   1 
ATOM   4426  C  CE1   . PHE F 2 85  ? 39.587  32.076 -35.541 1.00 80.10  ? 100 PHE F CE1   1 
ATOM   4427  C  CE2   . PHE F 2 85  ? 41.132  33.458 -34.375 1.00 81.10  ? 100 PHE F CE2   1 
ATOM   4428  C  CZ    . PHE F 2 85  ? 40.826  32.662 -35.455 1.00 78.91  ? 100 PHE F CZ    1 
ATOM   4429  N  N     . GLY F 2 86  ? 36.952  31.617 -29.125 1.00 78.46  ? 101 GLY F N     1 
ATOM   4430  C  CA    . GLY F 2 86  ? 36.511  31.924 -27.765 1.00 79.61  ? 101 GLY F CA    1 
ATOM   4431  C  C     . GLY F 2 86  ? 35.100  31.582 -27.333 1.00 85.45  ? 101 GLY F C     1 
ATOM   4432  O  O     . GLY F 2 86  ? 34.900  31.164 -26.182 1.00 87.26  ? 101 GLY F O     1 
ATOM   4433  N  N     . GLY F 2 87  ? 34.129  31.821 -28.214 1.00 79.69  ? 102 GLY F N     1 
ATOM   4434  C  CA    . GLY F 2 87  ? 32.726  31.565 -27.921 1.00 78.73  ? 102 GLY F CA    1 
ATOM   4435  C  C     . GLY F 2 87  ? 32.236  30.399 -28.728 1.00 87.24  ? 102 GLY F C     1 
ATOM   4436  O  O     . GLY F 2 87  ? 31.331  29.691 -28.231 1.00 88.36  ? 102 GLY F O     1 
ATOM   4437  O  OXT   . GLY F 2 87  ? 32.747  30.212 -29.860 1.00 108.03 ? 102 GLY F OXT   1 
ATOM   4438  N  N     . ALA G 3 1   ? -0.639  63.264 -16.042 1.00 125.23 ? 14  ALA G N     1 
ATOM   4439  C  CA    . ALA G 3 1   ? -0.586  61.936 -16.683 1.00 124.64 ? 14  ALA G CA    1 
ATOM   4440  C  C     . ALA G 3 1   ? -0.676  60.779 -15.631 1.00 126.72 ? 14  ALA G C     1 
ATOM   4441  O  O     . ALA G 3 1   ? -0.437  61.036 -14.437 1.00 128.39 ? 14  ALA G O     1 
ATOM   4442  C  CB    . ALA G 3 1   ? 0.671   61.808 -17.544 1.00 125.22 ? 14  ALA G CB    1 
ATOM   4443  N  N     . LYS G 3 2   ? -1.087  59.534 -16.060 1.00 117.77 ? 15  LYS G N     1 
ATOM   4444  C  CA    . LYS G 3 2   ? -1.240  58.367 -15.165 1.00 114.52 ? 15  LYS G CA    1 
ATOM   4445  C  C     . LYS G 3 2   ? -0.735  57.073 -15.798 1.00 110.78 ? 15  LYS G C     1 
ATOM   4446  O  O     . LYS G 3 2   ? 0.038   56.360 -15.150 1.00 110.87 ? 15  LYS G O     1 
ATOM   4447  C  CB    . LYS G 3 2   ? -2.671  58.216 -14.618 1.00 116.69 ? 15  LYS G CB    1 
ATOM   4448  C  CG    . LYS G 3 2   ? -2.724  57.685 -13.183 1.00 119.72 ? 15  LYS G CG    1 
ATOM   4449  C  CD    . LYS G 3 2   ? -4.140  57.606 -12.649 1.00 125.98 ? 15  LYS G CD    1 
ATOM   4450  C  CE    . LYS G 3 2   ? -4.692  58.946 -12.203 1.00 139.80 ? 15  LYS G CE    1 
ATOM   4451  N  NZ    . LYS G 3 2   ? -4.259  59.315 -10.831 1.00 150.20 ? 15  LYS G NZ    1 
ATOM   4452  N  N     . THR G 3 3   ? -1.105  56.760 -17.053 1.00 100.68 ? 16  THR G N     1 
ATOM   4453  C  CA    . THR G 3 3   ? -0.454  55.564 -17.605 1.00 97.76  ? 16  THR G CA    1 
ATOM   4454  C  C     . THR G 3 3   ? 1.024   55.911 -17.840 1.00 96.85  ? 16  THR G C     1 
ATOM   4455  O  O     . THR G 3 3   ? 1.372   57.095 -17.932 1.00 96.59  ? 16  THR G O     1 
ATOM   4456  C  CB    . THR G 3 3   ? -1.120  54.966 -18.884 1.00 97.25  ? 16  THR G CB    1 
ATOM   4457  O  OG1   . THR G 3 3   ? -0.907  55.792 -20.037 1.00 85.68  ? 16  THR G OG1   1 
ATOM   4458  C  CG2   . THR G 3 3   ? -2.591  54.644 -18.700 1.00 97.00  ? 16  THR G CG2   1 
ATOM   4459  N  N     . ARG G 3 4   ? 1.889   54.886 -17.929 1.00 89.17  ? 17  ARG G N     1 
ATOM   4460  C  CA    . ARG G 3 4   ? 3.310   55.080 -18.217 1.00 86.34  ? 17  ARG G CA    1 
ATOM   4461  C  C     . ARG G 3 4   ? 3.496   55.566 -19.663 1.00 85.60  ? 17  ARG G C     1 
ATOM   4462  O  O     . ARG G 3 4   ? 4.439   56.303 -19.942 1.00 83.88  ? 17  ARG G O     1 
ATOM   4463  C  CB    . ARG G 3 4   ? 4.080   53.786 -17.981 1.00 83.96  ? 17  ARG G CB    1 
ATOM   4464  C  CG    . ARG G 3 4   ? 4.604   53.622 -16.566 1.00 84.28  ? 17  ARG G CG    1 
ATOM   4465  C  CD    . ARG G 3 4   ? 5.719   52.599 -16.524 1.00 88.38  ? 17  ARG G CD    1 
ATOM   4466  N  NE    . ARG G 3 4   ? 5.211   51.236 -16.672 1.00 91.32  ? 17  ARG G NE    1 
ATOM   4467  C  CZ    . ARG G 3 4   ? 5.788   50.168 -16.139 1.00 103.21 ? 17  ARG G CZ    1 
ATOM   4468  N  NH1   . ARG G 3 4   ? 6.904   50.292 -15.434 1.00 92.35  ? 17  ARG G NH1   1 
ATOM   4469  N  NH2   . ARG G 3 4   ? 5.250   48.968 -16.301 1.00 89.21  ? 17  ARG G NH2   1 
ATOM   4470  N  N     . SER G 3 5   ? 2.568   55.164 -20.567 1.00 81.00  ? 18  SER G N     1 
ATOM   4471  C  CA    . SER G 3 5   ? 2.518   55.540 -21.982 1.00 80.26  ? 18  SER G CA    1 
ATOM   4472  C  C     . SER G 3 5   ? 2.211   57.036 -22.096 1.00 85.10  ? 18  SER G C     1 
ATOM   4473  O  O     . SER G 3 5   ? 2.808   57.721 -22.930 1.00 85.34  ? 18  SER G O     1 
ATOM   4474  C  CB    . SER G 3 5   ? 1.468   54.717 -22.732 1.00 81.55  ? 18  SER G CB    1 
ATOM   4475  O  OG    . SER G 3 5   ? 1.579   53.325 -22.491 1.00 82.40  ? 18  SER G OG    1 
ATOM   4476  N  N     . SER G 3 6   ? 1.317   57.541 -21.228 1.00 81.88  ? 19  SER G N     1 
ATOM   4477  C  CA    . SER G 3 6   ? 0.951   58.954 -21.144 1.00 81.98  ? 19  SER G CA    1 
ATOM   4478  C  C     . SER G 3 6   ? 2.182   59.800 -20.774 1.00 84.47  ? 19  SER G C     1 
ATOM   4479  O  O     . SER G 3 6   ? 2.426   60.836 -21.402 1.00 84.15  ? 19  SER G O     1 
ATOM   4480  C  CB    . SER G 3 6   ? -0.126  59.157 -20.075 1.00 87.49  ? 19  SER G CB    1 
ATOM   4481  O  OG    . SER G 3 6   ? -1.382  59.526 -20.609 1.00 100.99 ? 19  SER G OG    1 
ATOM   4482  N  N     . ARG G 3 7   ? 2.962   59.332 -19.772 1.00 78.41  ? 20  ARG G N     1 
ATOM   4483  C  CA    . ARG G 3 7   ? 4.166   59.989 -19.258 1.00 76.41  ? 20  ARG G CA    1 
ATOM   4484  C  C     . ARG G 3 7   ? 5.275   60.059 -20.298 1.00 75.87  ? 20  ARG G C     1 
ATOM   4485  O  O     . ARG G 3 7   ? 6.003   61.039 -20.339 1.00 76.14  ? 20  ARG G O     1 
ATOM   4486  C  CB    . ARG G 3 7   ? 4.674   59.281 -17.998 1.00 76.16  ? 20  ARG G CB    1 
ATOM   4487  C  CG    . ARG G 3 7   ? 3.695   59.315 -16.844 1.00 86.04  ? 20  ARG G CG    1 
ATOM   4488  C  CD    . ARG G 3 7   ? 4.341   58.789 -15.590 1.00 100.25 ? 20  ARG G CD    1 
ATOM   4489  N  NE    . ARG G 3 7   ? 3.544   59.109 -14.406 1.00 117.13 ? 20  ARG G NE    1 
ATOM   4490  C  CZ    . ARG G 3 7   ? 2.733   58.251 -13.798 1.00 138.46 ? 20  ARG G CZ    1 
ATOM   4491  N  NH1   . ARG G 3 7   ? 2.611   57.004 -14.249 1.00 133.80 ? 20  ARG G NH1   1 
ATOM   4492  N  NH2   . ARG G 3 7   ? 2.049   58.626 -12.721 1.00 119.76 ? 20  ARG G NH2   1 
ATOM   4493  N  N     . ALA G 3 8   ? 5.404   59.039 -21.136 1.00 68.33  ? 21  ALA G N     1 
ATOM   4494  C  CA    . ALA G 3 8   ? 6.443   58.993 -22.163 1.00 66.63  ? 21  ALA G CA    1 
ATOM   4495  C  C     . ALA G 3 8   ? 6.002   59.602 -23.512 1.00 67.46  ? 21  ALA G C     1 
ATOM   4496  O  O     . ALA G 3 8   ? 6.821   59.765 -24.431 1.00 63.98  ? 21  ALA G O     1 
ATOM   4497  C  CB    . ALA G 3 8   ? 6.895   57.565 -22.349 1.00 67.34  ? 21  ALA G CB    1 
ATOM   4498  N  N     . GLY G 3 9   ? 4.719   59.958 -23.592 1.00 65.41  ? 22  GLY G N     1 
ATOM   4499  C  CA    . GLY G 3 9   ? 4.094   60.538 -24.780 1.00 65.32  ? 22  GLY G CA    1 
ATOM   4500  C  C     . GLY G 3 9   ? 3.929   59.536 -25.904 1.00 67.02  ? 22  GLY G C     1 
ATOM   4501  O  O     . GLY G 3 9   ? 4.132   59.869 -27.073 1.00 68.31  ? 22  GLY G O     1 
ATOM   4502  N  N     . LEU G 3 10  ? 3.571   58.296 -25.550 1.00 59.89  ? 23  LEU G N     1 
ATOM   4503  C  CA    . LEU G 3 10  ? 3.429   57.202 -26.500 1.00 57.53  ? 23  LEU G CA    1 
ATOM   4504  C  C     . LEU G 3 10  ? 1.994   56.688 -26.619 1.00 60.03  ? 23  LEU G C     1 
ATOM   4505  O  O     . LEU G 3 10  ? 1.201   56.787 -25.672 1.00 59.67  ? 23  LEU G O     1 
ATOM   4506  C  CB    . LEU G 3 10  ? 4.372   56.047 -26.108 1.00 56.57  ? 23  LEU G CB    1 
ATOM   4507  C  CG    . LEU G 3 10  ? 5.866   56.369 -25.988 1.00 60.33  ? 23  LEU G CG    1 
ATOM   4508  C  CD1   . LEU G 3 10  ? 6.603   55.256 -25.337 1.00 59.84  ? 23  LEU G CD1   1 
ATOM   4509  C  CD2   . LEU G 3 10  ? 6.495   56.631 -27.335 1.00 64.72  ? 23  LEU G CD2   1 
ATOM   4510  N  N     . GLN G 3 11  ? 1.664   56.150 -27.803 1.00 54.95  ? 24  GLN G N     1 
ATOM   4511  C  CA    . GLN G 3 11  ? 0.393   55.501 -28.097 1.00 54.15  ? 24  GLN G CA    1 
ATOM   4512  C  C     . GLN G 3 11  ? 0.522   54.043 -27.658 1.00 58.89  ? 24  GLN G C     1 
ATOM   4513  O  O     . GLN G 3 11  ? -0.421  53.507 -27.071 1.00 61.28  ? 24  GLN G O     1 
ATOM   4514  C  CB    . GLN G 3 11  ? 0.025   55.588 -29.593 1.00 55.08  ? 24  GLN G CB    1 
ATOM   4515  C  CG    . GLN G 3 11  ? -0.244  57.004 -30.132 1.00 60.10  ? 24  GLN G CG    1 
ATOM   4516  C  CD    . GLN G 3 11  ? -1.216  57.825 -29.314 1.00 84.10  ? 24  GLN G CD    1 
ATOM   4517  O  OE1   . GLN G 3 11  ? -2.397  57.498 -29.143 1.00 83.44  ? 24  GLN G OE1   1 
ATOM   4518  N  NE2   . GLN G 3 11  ? -0.735  58.928 -28.797 1.00 78.88  ? 24  GLN G NE2   1 
ATOM   4519  N  N     . PHE G 3 12  ? 1.714   53.418 -27.902 1.00 52.52  ? 25  PHE G N     1 
ATOM   4520  C  CA    . PHE G 3 12  ? 2.051   52.029 -27.568 1.00 51.09  ? 25  PHE G CA    1 
ATOM   4521  C  C     . PHE G 3 12  ? 2.116   51.781 -26.058 1.00 54.15  ? 25  PHE G C     1 
ATOM   4522  O  O     . PHE G 3 12  ? 2.409   52.724 -25.315 1.00 53.68  ? 25  PHE G O     1 
ATOM   4523  C  CB    . PHE G 3 12  ? 3.336   51.571 -28.294 1.00 52.30  ? 25  PHE G CB    1 
ATOM   4524  C  CG    . PHE G 3 12  ? 3.037   50.878 -29.605 1.00 52.71  ? 25  PHE G CG    1 
ATOM   4525  C  CD1   . PHE G 3 12  ? 2.209   51.480 -30.558 1.00 55.48  ? 25  PHE G CD1   1 
ATOM   4526  C  CD2   . PHE G 3 12  ? 3.560   49.624 -29.883 1.00 52.70  ? 25  PHE G CD2   1 
ATOM   4527  C  CE1   . PHE G 3 12  ? 1.908   50.827 -31.754 1.00 56.19  ? 25  PHE G CE1   1 
ATOM   4528  C  CE2   . PHE G 3 12  ? 3.265   48.975 -31.084 1.00 54.69  ? 25  PHE G CE2   1 
ATOM   4529  C  CZ    . PHE G 3 12  ? 2.427   49.570 -32.000 1.00 53.27  ? 25  PHE G CZ    1 
ATOM   4530  N  N     . PRO G 3 13  ? 1.794   50.546 -25.580 1.00 51.09  ? 26  PRO G N     1 
ATOM   4531  C  CA    . PRO G 3 13  ? 1.724   50.315 -24.125 1.00 50.98  ? 26  PRO G CA    1 
ATOM   4532  C  C     . PRO G 3 13  ? 3.033   49.959 -23.423 1.00 56.99  ? 26  PRO G C     1 
ATOM   4533  O  O     . PRO G 3 13  ? 3.539   48.838 -23.522 1.00 57.53  ? 26  PRO G O     1 
ATOM   4534  C  CB    . PRO G 3 13  ? 0.693   49.196 -24.001 1.00 52.83  ? 26  PRO G CB    1 
ATOM   4535  C  CG    . PRO G 3 13  ? 0.906   48.368 -25.276 1.00 57.57  ? 26  PRO G CG    1 
ATOM   4536  C  CD    . PRO G 3 13  ? 1.370   49.339 -26.338 1.00 53.30  ? 26  PRO G CD    1 
ATOM   4537  N  N     . VAL G 3 14  ? 3.541   50.915 -22.650 1.00 55.36  ? 27  VAL G N     1 
ATOM   4538  C  CA    . VAL G 3 14  ? 4.755   50.796 -21.844 1.00 55.58  ? 27  VAL G CA    1 
ATOM   4539  C  C     . VAL G 3 14  ? 4.511   49.712 -20.801 1.00 62.90  ? 27  VAL G C     1 
ATOM   4540  O  O     . VAL G 3 14  ? 5.379   48.860 -20.604 1.00 63.22  ? 27  VAL G O     1 
ATOM   4541  C  CB    . VAL G 3 14  ? 5.147   52.159 -21.198 1.00 58.58  ? 27  VAL G CB    1 
ATOM   4542  C  CG1   . VAL G 3 14  ? 6.316   51.994 -20.237 1.00 58.51  ? 27  VAL G CG1   1 
ATOM   4543  C  CG2   . VAL G 3 14  ? 5.475   53.215 -22.261 1.00 57.68  ? 27  VAL G CG2   1 
ATOM   4544  N  N     . GLY G 3 15  ? 3.314   49.726 -20.199 1.00 61.18  ? 28  GLY G N     1 
ATOM   4545  C  CA    . GLY G 3 15  ? 2.883   48.769 -19.181 1.00 60.93  ? 28  GLY G CA    1 
ATOM   4546  C  C     . GLY G 3 15  ? 3.020   47.322 -19.600 1.00 65.24  ? 28  GLY G C     1 
ATOM   4547  O  O     . GLY G 3 15  ? 3.673   46.535 -18.909 1.00 64.84  ? 28  GLY G O     1 
ATOM   4548  N  N     . ARG G 3 16  ? 2.424   46.984 -20.770 1.00 61.28  ? 29  ARG G N     1 
ATOM   4549  C  CA    . ARG G 3 16  ? 2.413   45.665 -21.408 1.00 59.38  ? 29  ARG G CA    1 
ATOM   4550  C  C     . ARG G 3 16  ? 3.825   45.237 -21.752 1.00 60.86  ? 29  ARG G C     1 
ATOM   4551  O  O     . ARG G 3 16  ? 4.241   44.160 -21.340 1.00 60.31  ? 29  ARG G O     1 
ATOM   4552  C  CB    . ARG G 3 16  ? 1.528   45.699 -22.667 1.00 57.56  ? 29  ARG G CB    1 
ATOM   4553  C  CG    . ARG G 3 16  ? 1.330   44.348 -23.348 1.00 61.39  ? 29  ARG G CG    1 
ATOM   4554  C  CD    . ARG G 3 16  ? 0.237   44.389 -24.398 1.00 59.04  ? 29  ARG G CD    1 
ATOM   4555  N  NE    . ARG G 3 16  ? -1.069  44.543 -23.765 1.00 67.47  ? 29  ARG G NE    1 
ATOM   4556  C  CZ    . ARG G 3 16  ? -2.229  44.307 -24.367 1.00 81.54  ? 29  ARG G CZ    1 
ATOM   4557  N  NH1   . ARG G 3 16  ? -2.257  43.887 -25.627 1.00 54.25  ? 29  ARG G NH1   1 
ATOM   4558  N  NH2   . ARG G 3 16  ? -3.368  44.456 -23.705 1.00 74.93  ? 29  ARG G NH2   1 
ATOM   4559  N  N     . VAL G 3 17  ? 4.564   46.098 -22.485 1.00 56.29  ? 30  VAL G N     1 
ATOM   4560  C  CA    . VAL G 3 17  ? 5.947   45.869 -22.920 1.00 55.53  ? 30  VAL G CA    1 
ATOM   4561  C  C     . VAL G 3 17  ? 6.822   45.402 -21.731 1.00 64.52  ? 30  VAL G C     1 
ATOM   4562  O  O     . VAL G 3 17  ? 7.509   44.388 -21.860 1.00 64.67  ? 30  VAL G O     1 
ATOM   4563  C  CB    . VAL G 3 17  ? 6.539   47.085 -23.706 1.00 56.17  ? 30  VAL G CB    1 
ATOM   4564  C  CG1   . VAL G 3 17  ? 8.033   46.916 -23.964 1.00 55.12  ? 30  VAL G CG1   1 
ATOM   4565  C  CG2   . VAL G 3 17  ? 5.802   47.302 -25.028 1.00 55.03  ? 30  VAL G CG2   1 
ATOM   4566  N  N     . HIS G 3 18  ? 6.716   46.081 -20.571 1.00 65.05  ? 31  HIS G N     1 
ATOM   4567  C  CA    . HIS G 3 18  ? 7.454   45.769 -19.345 1.00 67.78  ? 31  HIS G CA    1 
ATOM   4568  C  C     . HIS G 3 18  ? 7.119   44.376 -18.842 1.00 71.48  ? 31  HIS G C     1 
ATOM   4569  O  O     . HIS G 3 18  ? 8.025   43.616 -18.481 1.00 72.75  ? 31  HIS G O     1 
ATOM   4570  C  CB    . HIS G 3 18  ? 7.140   46.818 -18.268 1.00 70.84  ? 31  HIS G CB    1 
ATOM   4571  C  CG    . HIS G 3 18  ? 7.973   46.734 -17.022 1.00 76.14  ? 31  HIS G CG    1 
ATOM   4572  N  ND1   . HIS G 3 18  ? 9.355   46.765 -17.072 1.00 78.69  ? 31  HIS G ND1   1 
ATOM   4573  C  CD2   . HIS G 3 18  ? 7.582   46.722 -15.723 1.00 79.19  ? 31  HIS G CD2   1 
ATOM   4574  C  CE1   . HIS G 3 18  ? 9.759   46.744 -15.813 1.00 78.79  ? 31  HIS G CE1   1 
ATOM   4575  N  NE2   . HIS G 3 18  ? 8.727   46.724 -14.965 1.00 79.30  ? 31  HIS G NE2   1 
ATOM   4576  N  N     . ARG G 3 19  ? 5.819   44.031 -18.865 1.00 65.25  ? 32  ARG G N     1 
ATOM   4577  C  CA    . ARG G 3 19  ? 5.315   42.736 -18.423 1.00 63.04  ? 32  ARG G CA    1 
ATOM   4578  C  C     . ARG G 3 19  ? 5.836   41.636 -19.332 1.00 63.90  ? 32  ARG G C     1 
ATOM   4579  O  O     . ARG G 3 19  ? 6.310   40.618 -18.827 1.00 64.86  ? 32  ARG G O     1 
ATOM   4580  C  CB    . ARG G 3 19  ? 3.783   42.742 -18.376 1.00 61.52  ? 32  ARG G CB    1 
ATOM   4581  C  CG    . ARG G 3 19  ? 3.184   41.398 -18.017 1.00 69.89  ? 32  ARG G CG    1 
ATOM   4582  C  CD    . ARG G 3 19  ? 1.774   41.312 -18.522 1.00 72.55  ? 32  ARG G CD    1 
ATOM   4583  N  NE    . ARG G 3 19  ? 1.669   40.520 -19.743 1.00 69.29  ? 32  ARG G NE    1 
ATOM   4584  C  CZ    . ARG G 3 19  ? 0.882   40.831 -20.766 1.00 82.02  ? 32  ARG G CZ    1 
ATOM   4585  N  NH1   . ARG G 3 19  ? 0.161   41.945 -20.744 1.00 63.11  ? 32  ARG G NH1   1 
ATOM   4586  N  NH2   . ARG G 3 19  ? 0.813   40.031 -21.824 1.00 76.19  ? 32  ARG G NH2   1 
ATOM   4587  N  N     . LEU G 3 20  ? 5.780   41.859 -20.662 1.00 56.79  ? 33  LEU G N     1 
ATOM   4588  C  CA    . LEU G 3 20  ? 6.239   40.911 -21.679 1.00 54.64  ? 33  LEU G CA    1 
ATOM   4589  C  C     . LEU G 3 20  ? 7.747   40.682 -21.616 1.00 61.66  ? 33  LEU G C     1 
ATOM   4590  O  O     . LEU G 3 20  ? 8.186   39.559 -21.847 1.00 63.18  ? 33  LEU G O     1 
ATOM   4591  C  CB    . LEU G 3 20  ? 5.799   41.325 -23.084 1.00 53.20  ? 33  LEU G CB    1 
ATOM   4592  C  CG    . LEU G 3 20  ? 4.303   41.436 -23.349 1.00 56.05  ? 33  LEU G CG    1 
ATOM   4593  C  CD1   . LEU G 3 20  ? 4.045   42.092 -24.664 1.00 56.97  ? 33  LEU G CD1   1 
ATOM   4594  C  CD2   . LEU G 3 20  ? 3.680   40.124 -23.409 1.00 56.27  ? 33  LEU G CD2   1 
ATOM   4595  N  N     . LEU G 3 21  ? 8.530   41.713 -21.256 1.00 58.99  ? 34  LEU G N     1 
ATOM   4596  C  CA    . LEU G 3 21  ? 9.984   41.609 -21.096 1.00 58.95  ? 34  LEU G CA    1 
ATOM   4597  C  C     . LEU G 3 21  ? 10.356  40.731 -19.889 1.00 67.23  ? 34  LEU G C     1 
ATOM   4598  O  O     . LEU G 3 21  ? 11.213  39.840 -20.010 1.00 67.07  ? 34  LEU G O     1 
ATOM   4599  C  CB    . LEU G 3 21  ? 10.613  42.996 -20.919 1.00 57.85  ? 34  LEU G CB    1 
ATOM   4600  C  CG    . LEU G 3 21  ? 10.814  43.802 -22.161 1.00 60.19  ? 34  LEU G CG    1 
ATOM   4601  C  CD1   . LEU G 3 21  ? 10.985  45.253 -21.802 1.00 60.16  ? 34  LEU G CD1   1 
ATOM   4602  C  CD2   . LEU G 3 21  ? 11.988  43.276 -22.991 1.00 57.82  ? 34  LEU G CD2   1 
ATOM   4603  N  N     . ARG G 3 22  ? 9.697   40.999 -18.731 1.00 66.83  ? 35  ARG G N     1 
ATOM   4604  C  CA    . ARG G 3 22  ? 9.879   40.270 -17.471 1.00 68.32  ? 35  ARG G CA    1 
ATOM   4605  C  C     . ARG G 3 22  ? 9.416   38.806 -17.604 1.00 73.23  ? 35  ARG G C     1 
ATOM   4606  O  O     . ARG G 3 22  ? 10.183  37.875 -17.303 1.00 74.77  ? 35  ARG G O     1 
ATOM   4607  C  CB    . ARG G 3 22  ? 9.142   40.989 -16.324 1.00 70.83  ? 35  ARG G CB    1 
ATOM   4608  C  CG    . ARG G 3 22  ? 9.790   42.327 -15.905 1.00 85.27  ? 35  ARG G CG    1 
ATOM   4609  C  CD    . ARG G 3 22  ? 9.226   42.913 -14.617 1.00 93.35  ? 35  ARG G CD    1 
ATOM   4610  N  NE    . ARG G 3 22  ? 7.947   43.588 -14.837 1.00 106.15 ? 35  ARG G NE    1 
ATOM   4611  C  CZ    . ARG G 3 22  ? 6.749   43.039 -14.641 1.00 125.45 ? 35  ARG G CZ    1 
ATOM   4612  N  NH1   . ARG G 3 22  ? 6.645   41.787 -14.205 1.00 110.51 ? 35  ARG G NH1   1 
ATOM   4613  N  NH2   . ARG G 3 22  ? 5.646   43.736 -14.880 1.00 117.65 ? 35  ARG G NH2   1 
ATOM   4614  N  N     . LYS G 3 23  ? 8.181   38.611 -18.123 1.00 67.89  ? 36  LYS G N     1 
ATOM   4615  C  CA    . LYS G 3 23  ? 7.559   37.303 -18.332 1.00 66.64  ? 36  LYS G CA    1 
ATOM   4616  C  C     . LYS G 3 23  ? 8.044   36.557 -19.592 1.00 68.72  ? 36  LYS G C     1 
ATOM   4617  O  O     . LYS G 3 23  ? 7.529   35.489 -19.901 1.00 69.27  ? 36  LYS G O     1 
ATOM   4618  C  CB    . LYS G 3 23  ? 6.026   37.450 -18.332 1.00 69.00  ? 36  LYS G CB    1 
ATOM   4619  C  CG    . LYS G 3 23  ? 5.376   37.191 -16.961 1.00 92.04  ? 36  LYS G CG    1 
ATOM   4620  C  CD    . LYS G 3 23  ? 5.529   38.349 -15.963 1.00 106.04 ? 36  LYS G CD    1 
ATOM   4621  C  CE    . LYS G 3 23  ? 5.099   37.975 -14.567 1.00 115.28 ? 36  LYS G CE    1 
ATOM   4622  N  NZ    . LYS G 3 23  ? 5.527   39.002 -13.578 1.00 126.00 ? 36  LYS G NZ    1 
ATOM   4623  N  N     . GLY G 3 24  ? 9.005   37.123 -20.306 1.00 63.61  ? 37  GLY G N     1 
ATOM   4624  C  CA    . GLY G 3 24  ? 9.541   36.537 -21.529 1.00 62.02  ? 37  GLY G CA    1 
ATOM   4625  C  C     . GLY G 3 24  ? 10.870  35.829 -21.409 1.00 61.88  ? 37  GLY G C     1 
ATOM   4626  O  O     . GLY G 3 24  ? 11.343  35.278 -22.411 1.00 61.51  ? 37  GLY G O     1 
ATOM   4627  N  N     . ASN G 3 25  ? 11.473  35.804 -20.190 1.00 56.34  ? 38  ASN G N     1 
ATOM   4628  C  CA    . ASN G 3 25  ? 12.774  35.148 -19.903 1.00 56.88  ? 38  ASN G CA    1 
ATOM   4629  C  C     . ASN G 3 25  ? 13.943  35.749 -20.706 1.00 61.75  ? 38  ASN G C     1 
ATOM   4630  O  O     . ASN G 3 25  ? 14.611  35.021 -21.471 1.00 61.73  ? 38  ASN G O     1 
ATOM   4631  C  CB    . ASN G 3 25  ? 12.735  33.600 -20.140 1.00 57.33  ? 38  ASN G CB    1 
ATOM   4632  C  CG    . ASN G 3 25  ? 11.655  32.858 -19.420 1.00 77.84  ? 38  ASN G CG    1 
ATOM   4633  O  OD1   . ASN G 3 25  ? 11.721  32.668 -18.188 1.00 85.22  ? 38  ASN G OD1   1 
ATOM   4634  N  ND2   . ASN G 3 25  ? 10.635  32.446 -20.204 1.00 55.10  ? 38  ASN G ND2   1 
ATOM   4635  N  N     . TYR G 3 26  ? 14.177  37.074 -20.544 1.00 57.37  ? 39  TYR G N     1 
ATOM   4636  C  CA    . TYR G 3 26  ? 15.242  37.794 -21.237 1.00 55.93  ? 39  TYR G CA    1 
ATOM   4637  C  C     . TYR G 3 26  ? 16.356  38.212 -20.279 1.00 61.66  ? 39  TYR G C     1 
ATOM   4638  O  O     . TYR G 3 26  ? 17.522  38.289 -20.682 1.00 59.73  ? 39  TYR G O     1 
ATOM   4639  C  CB    . TYR G 3 26  ? 14.679  38.996 -21.990 1.00 55.46  ? 39  TYR G CB    1 
ATOM   4640  C  CG    . TYR G 3 26  ? 13.652  38.652 -23.042 1.00 55.64  ? 39  TYR G CG    1 
ATOM   4641  C  CD1   . TYR G 3 26  ? 14.029  38.063 -24.242 1.00 57.38  ? 39  TYR G CD1   1 
ATOM   4642  C  CD2   . TYR G 3 26  ? 12.316  38.989 -22.877 1.00 56.04  ? 39  TYR G CD2   1 
ATOM   4643  C  CE1   . TYR G 3 26  ? 13.087  37.754 -25.223 1.00 57.48  ? 39  TYR G CE1   1 
ATOM   4644  C  CE2   . TYR G 3 26  ? 11.369  38.717 -23.864 1.00 56.46  ? 39  TYR G CE2   1 
ATOM   4645  C  CZ    . TYR G 3 26  ? 11.757  38.090 -25.033 1.00 61.88  ? 39  TYR G CZ    1 
ATOM   4646  O  OH    . TYR G 3 26  ? 10.827  37.792 -26.001 1.00 60.58  ? 39  TYR G OH    1 
ATOM   4647  N  N     . SER G 3 27  ? 16.005  38.479 -19.006 1.00 61.30  ? 40  SER G N     1 
ATOM   4648  C  CA    . SER G 3 27  ? 16.965  38.882 -17.963 1.00 62.78  ? 40  SER G CA    1 
ATOM   4649  C  C     . SER G 3 27  ? 16.316  38.839 -16.604 1.00 70.16  ? 40  SER G C     1 
ATOM   4650  O  O     . SER G 3 27  ? 15.088  38.959 -16.522 1.00 70.44  ? 40  SER G O     1 
ATOM   4651  C  CB    . SER G 3 27  ? 17.489  40.298 -18.208 1.00 66.23  ? 40  SER G CB    1 
ATOM   4652  O  OG    . SER G 3 27  ? 16.440  41.251 -18.282 1.00 74.56  ? 40  SER G OG    1 
ATOM   4653  N  N     . GLU G 3 28  ? 17.140  38.719 -15.540 1.00 68.55  ? 41  GLU G N     1 
ATOM   4654  C  CA    . GLU G 3 28  ? 16.700  38.733 -14.138 1.00 69.78  ? 41  GLU G CA    1 
ATOM   4655  C  C     . GLU G 3 28  ? 15.836  40.021 -13.873 1.00 74.71  ? 41  GLU G C     1 
ATOM   4656  O  O     . GLU G 3 28  ? 14.695  39.902 -13.397 1.00 75.67  ? 41  GLU G O     1 
ATOM   4657  C  CB    . GLU G 3 28  ? 17.926  38.676 -13.199 1.00 71.65  ? 41  GLU G CB    1 
ATOM   4658  C  CG    . GLU G 3 28  ? 17.620  38.287 -11.761 1.00 89.39  ? 41  GLU G CG    1 
ATOM   4659  C  CD    . GLU G 3 28  ? 18.839  38.057 -10.881 1.00 127.98 ? 41  GLU G CD    1 
ATOM   4660  O  OE1   . GLU G 3 28  ? 19.372  39.042 -10.318 1.00 107.86 ? 41  GLU G OE1   1 
ATOM   4661  O  OE2   . GLU G 3 28  ? 19.247  36.881 -10.730 1.00 138.88 ? 41  GLU G OE2   1 
ATOM   4662  N  N     . ARG G 3 29  ? 16.365  41.229 -14.241 1.00 69.18  ? 42  ARG G N     1 
ATOM   4663  C  CA    . ARG G 3 29  ? 15.695  42.529 -14.041 1.00 67.42  ? 42  ARG G CA    1 
ATOM   4664  C  C     . ARG G 3 29  ? 15.521  43.339 -15.344 1.00 67.77  ? 42  ARG G C     1 
ATOM   4665  O  O     . ARG G 3 29  ? 16.245  43.131 -16.315 1.00 65.43  ? 42  ARG G O     1 
ATOM   4666  C  CB    . ARG G 3 29  ? 16.390  43.385 -12.947 1.00 66.83  ? 42  ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3 29  ? 16.766  42.659 -11.671 1.00 79.81  ? 42  ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3 29  ? 17.300  43.583 -10.611 1.00 97.14  ? 42  ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3 29  ? 16.482  43.511 -9.390  1.00 118.30 ? 42  ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3 29  ? 16.719  44.182 -8.260  1.00 137.17 ? 42  ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3 29  ? 17.751  45.012 -8.174  1.00 134.85 ? 42  ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3 29  ? 15.921  44.028 -7.208  1.00 115.51 ? 42  ARG G NH2   1 
ATOM   4673  N  N     . VAL G 3 30  ? 14.524  44.246 -15.356 1.00 64.41  ? 43  VAL G N     1 
ATOM   4674  C  CA    . VAL G 3 30  ? 14.199  45.156 -16.463 1.00 64.35  ? 43  VAL G CA    1 
ATOM   4675  C  C     . VAL G 3 30  ? 14.221  46.613 -15.948 1.00 69.78  ? 43  VAL G C     1 
ATOM   4676  O  O     . VAL G 3 30  ? 13.494  46.952 -15.011 1.00 70.30  ? 43  VAL G O     1 
ATOM   4677  C  CB    . VAL G 3 30  ? 12.837  44.822 -17.138 1.00 67.73  ? 43  VAL G CB    1 
ATOM   4678  C  CG1   . VAL G 3 30  ? 12.479  45.853 -18.215 1.00 67.11  ? 43  VAL G CG1   1 
ATOM   4679  C  CG2   . VAL G 3 30  ? 12.827  43.406 -17.716 1.00 67.49  ? 43  VAL G CG2   1 
ATOM   4680  N  N     . GLY G 3 31  ? 15.026  47.460 -16.580 1.00 66.47  ? 44  GLY G N     1 
ATOM   4681  C  CA    . GLY G 3 31  ? 15.102  48.880 -16.237 1.00 66.56  ? 44  GLY G CA    1 
ATOM   4682  C  C     . GLY G 3 31  ? 13.814  49.644 -16.493 1.00 71.17  ? 44  GLY G C     1 
ATOM   4683  O  O     . GLY G 3 31  ? 12.984  49.221 -17.286 1.00 71.46  ? 44  GLY G O     1 
ATOM   4684  N  N     . ALA G 3 32  ? 13.622  50.761 -15.812 1.00 69.31  ? 45  ALA G N     1 
ATOM   4685  C  CA    . ALA G 3 32  ? 12.411  51.593 -15.932 1.00 69.30  ? 45  ALA G CA    1 
ATOM   4686  C  C     . ALA G 3 32  ? 12.256  52.182 -17.303 1.00 71.29  ? 45  ALA G C     1 
ATOM   4687  O  O     . ALA G 3 32  ? 11.127  52.406 -17.740 1.00 70.63  ? 45  ALA G O     1 
ATOM   4688  C  CB    . ALA G 3 32  ? 12.426  52.712 -14.892 1.00 70.13  ? 45  ALA G CB    1 
ATOM   4689  N  N     . GLY G 3 33  ? 13.392  52.424 -17.957 1.00 66.83  ? 46  GLY G N     1 
ATOM   4690  C  CA    . GLY G 3 33  ? 13.475  53.034 -19.276 1.00 65.78  ? 46  GLY G CA    1 
ATOM   4691  C  C     . GLY G 3 33  ? 13.381  52.070 -20.434 1.00 65.40  ? 46  GLY G C     1 
ATOM   4692  O  O     . GLY G 3 33  ? 12.913  52.462 -21.505 1.00 65.24  ? 46  GLY G O     1 
ATOM   4693  N  N     . ALA G 3 34  ? 13.837  50.818 -20.236 1.00 58.08  ? 47  ALA G N     1 
ATOM   4694  C  CA    . ALA G 3 34  ? 13.789  49.788 -21.277 1.00 56.50  ? 47  ALA G CA    1 
ATOM   4695  C  C     . ALA G 3 34  ? 12.394  49.612 -21.942 1.00 59.11  ? 47  ALA G C     1 
ATOM   4696  O  O     . ALA G 3 34  ? 12.348  49.735 -23.173 1.00 58.12  ? 47  ALA G O     1 
ATOM   4697  C  CB    . ALA G 3 34  ? 14.316  48.462 -20.755 1.00 56.66  ? 47  ALA G CB    1 
ATOM   4698  N  N     . PRO G 3 35  ? 11.252  49.399 -21.207 1.00 55.24  ? 48  PRO G N     1 
ATOM   4699  C  CA    . PRO G 3 35  ? 9.956   49.234 -21.896 1.00 54.84  ? 48  PRO G CA    1 
ATOM   4700  C  C     . PRO G 3 35  ? 9.469   50.471 -22.636 1.00 57.15  ? 48  PRO G C     1 
ATOM   4701  O  O     . PRO G 3 35  ? 8.779   50.335 -23.646 1.00 56.38  ? 48  PRO G O     1 
ATOM   4702  C  CB    . PRO G 3 35  ? 8.998   48.834 -20.778 1.00 56.67  ? 48  PRO G CB    1 
ATOM   4703  C  CG    . PRO G 3 35  ? 9.609   49.364 -19.550 1.00 61.29  ? 48  PRO G CG    1 
ATOM   4704  C  CD    . PRO G 3 35  ? 11.080  49.238 -19.751 1.00 56.83  ? 48  PRO G CD    1 
ATOM   4705  N  N     . VAL G 3 36  ? 9.851   51.665 -22.128 1.00 52.30  ? 49  VAL G N     1 
ATOM   4706  C  CA    . VAL G 3 36  ? 9.572   52.991 -22.698 1.00 51.61  ? 49  VAL G CA    1 
ATOM   4707  C  C     . VAL G 3 36  ? 10.278  53.121 -24.074 1.00 52.45  ? 49  VAL G C     1 
ATOM   4708  O  O     . VAL G 3 36  ? 9.627   53.421 -25.077 1.00 52.50  ? 49  VAL G O     1 
ATOM   4709  C  CB    . VAL G 3 36  ? 10.042  54.103 -21.729 1.00 55.05  ? 49  VAL G CB    1 
ATOM   4710  C  CG1   . VAL G 3 36  ? 9.973   55.459 -22.383 1.00 54.31  ? 49  VAL G CG1   1 
ATOM   4711  C  CG2   . VAL G 3 36  ? 9.244   54.086 -20.434 1.00 55.32  ? 49  VAL G CG2   1 
ATOM   4712  N  N     . TYR G 3 37  ? 11.606  52.881 -24.101 1.00 45.09  ? 50  TYR G N     1 
ATOM   4713  C  CA    . TYR G 3 37  ? 12.435  52.924 -25.294 1.00 42.34  ? 50  TYR G CA    1 
ATOM   4714  C  C     . TYR G 3 37  ? 11.932  51.920 -26.308 1.00 46.83  ? 50  TYR G C     1 
ATOM   4715  O  O     . TYR G 3 37  ? 11.776  52.288 -27.474 1.00 47.62  ? 50  TYR G O     1 
ATOM   4716  C  CB    . TYR G 3 37  ? 13.894  52.618 -24.940 1.00 41.77  ? 50  TYR G CB    1 
ATOM   4717  C  CG    . TYR G 3 37  ? 14.893  53.114 -25.964 1.00 40.58  ? 50  TYR G CG    1 
ATOM   4718  C  CD1   . TYR G 3 37  ? 14.985  52.525 -27.223 1.00 41.59  ? 50  TYR G CD1   1 
ATOM   4719  C  CD2   . TYR G 3 37  ? 15.780  54.141 -25.660 1.00 40.88  ? 50  TYR G CD2   1 
ATOM   4720  C  CE1   . TYR G 3 37  ? 15.925  52.952 -28.156 1.00 40.56  ? 50  TYR G CE1   1 
ATOM   4721  C  CE2   . TYR G 3 37  ? 16.709  54.594 -26.594 1.00 41.67  ? 50  TYR G CE2   1 
ATOM   4722  C  CZ    . TYR G 3 37  ? 16.787  53.985 -27.833 1.00 48.69  ? 50  TYR G CZ    1 
ATOM   4723  O  OH    . TYR G 3 37  ? 17.699  54.424 -28.747 1.00 52.13  ? 50  TYR G OH    1 
ATOM   4724  N  N     . LEU G 3 38  ? 11.652  50.655 -25.866 1.00 42.12  ? 51  LEU G N     1 
ATOM   4725  C  CA    . LEU G 3 38  ? 11.159  49.588 -26.732 1.00 40.14  ? 51  LEU G CA    1 
ATOM   4726  C  C     . LEU G 3 38  ? 9.795   49.931 -27.325 1.00 45.46  ? 51  LEU G C     1 
ATOM   4727  O  O     . LEU G 3 38  ? 9.699   49.933 -28.555 1.00 46.73  ? 51  LEU G O     1 
ATOM   4728  C  CB    . LEU G 3 38  ? 11.187  48.228 -26.032 1.00 39.42  ? 51  LEU G CB    1 
ATOM   4729  C  CG    . LEU G 3 38  ? 10.764  46.943 -26.819 1.00 42.11  ? 51  LEU G CG    1 
ATOM   4730  C  CD1   . LEU G 3 38  ? 11.557  46.755 -28.114 1.00 41.87  ? 51  LEU G CD1   1 
ATOM   4731  C  CD2   . LEU G 3 38  ? 10.915  45.715 -25.969 1.00 37.20  ? 51  LEU G CD2   1 
ATOM   4732  N  N     . ALA G 3 39  ? 8.778   50.314 -26.477 1.00 41.09  ? 52  ALA G N     1 
ATOM   4733  C  CA    . ALA G 3 39  ? 7.411   50.718 -26.910 1.00 40.00  ? 52  ALA G CA    1 
ATOM   4734  C  C     . ALA G 3 39  ? 7.466   51.817 -27.981 1.00 44.20  ? 52  ALA G C     1 
ATOM   4735  O  O     . ALA G 3 39  ? 6.696   51.776 -28.938 1.00 45.37  ? 52  ALA G O     1 
ATOM   4736  C  CB    . ALA G 3 39  ? 6.570   51.185 -25.725 1.00 40.00  ? 52  ALA G CB    1 
ATOM   4737  N  N     . ALA G 3 40  ? 8.422   52.755 -27.824 1.00 38.71  ? 53  ALA G N     1 
ATOM   4738  C  CA    . ALA G 3 40  ? 8.717   53.888 -28.698 1.00 37.02  ? 53  ALA G CA    1 
ATOM   4739  C  C     . ALA G 3 40  ? 9.234   53.458 -30.073 1.00 38.70  ? 53  ALA G C     1 
ATOM   4740  O  O     . ALA G 3 40  ? 8.831   54.049 -31.082 1.00 36.93  ? 53  ALA G O     1 
ATOM   4741  C  CB    . ALA G 3 40  ? 9.741   54.763 -28.037 1.00 37.62  ? 53  ALA G CB    1 
ATOM   4742  N  N     . VAL G 3 41  ? 10.157  52.455 -30.096 1.00 33.74  ? 54  VAL G N     1 
ATOM   4743  C  CA    . VAL G 3 41  ? 10.769  51.876 -31.300 1.00 31.57  ? 54  VAL G CA    1 
ATOM   4744  C  C     . VAL G 3 41  ? 9.690   51.088 -32.054 1.00 32.54  ? 54  VAL G C     1 
ATOM   4745  O  O     . VAL G 3 41  ? 9.566   51.216 -33.280 1.00 30.76  ? 54  VAL G O     1 
ATOM   4746  C  CB    . VAL G 3 41  ? 12.014  50.991 -30.954 1.00 33.02  ? 54  VAL G CB    1 
ATOM   4747  C  CG1   . VAL G 3 41  ? 12.430  50.134 -32.140 1.00 31.22  ? 54  VAL G CG1   1 
ATOM   4748  C  CG2   . VAL G 3 41  ? 13.186  51.850 -30.487 1.00 32.22  ? 54  VAL G CG2   1 
ATOM   4749  N  N     . LEU G 3 42  ? 8.902   50.301 -31.306 1.00 28.68  ? 55  LEU G N     1 
ATOM   4750  C  CA    . LEU G 3 42  ? 7.828   49.477 -31.867 1.00 28.48  ? 55  LEU G CA    1 
ATOM   4751  C  C     . LEU G 3 42  ? 6.772   50.374 -32.477 1.00 34.74  ? 55  LEU G C     1 
ATOM   4752  O  O     . LEU G 3 42  ? 6.379   50.119 -33.609 1.00 34.75  ? 55  LEU G O     1 
ATOM   4753  C  CB    . LEU G 3 42  ? 7.235   48.518 -30.833 1.00 28.12  ? 55  LEU G CB    1 
ATOM   4754  C  CG    . LEU G 3 42  ? 8.166   47.432 -30.257 1.00 33.40  ? 55  LEU G CG    1 
ATOM   4755  C  CD1   . LEU G 3 42  ? 7.480   46.658 -29.201 1.00 34.39  ? 55  LEU G CD1   1 
ATOM   4756  C  CD2   . LEU G 3 42  ? 8.629   46.440 -31.303 1.00 34.16  ? 55  LEU G CD2   1 
ATOM   4757  N  N     . GLU G 3 43  ? 6.405   51.475 -31.782 1.00 31.08  ? 56  GLU G N     1 
ATOM   4758  C  CA    . GLU G 3 43  ? 5.448   52.489 -32.247 1.00 31.52  ? 56  GLU G CA    1 
ATOM   4759  C  C     . GLU G 3 43  ? 5.988   53.263 -33.470 1.00 38.48  ? 56  GLU G C     1 
ATOM   4760  O  O     . GLU G 3 43  ? 5.219   53.618 -34.364 1.00 38.89  ? 56  GLU G O     1 
ATOM   4761  C  CB    . GLU G 3 43  ? 5.145   53.490 -31.118 1.00 32.23  ? 56  GLU G CB    1 
ATOM   4762  C  CG    . GLU G 3 43  ? 4.088   54.517 -31.488 1.00 41.10  ? 56  GLU G CG    1 
ATOM   4763  C  CD    . GLU G 3 43  ? 3.738   55.514 -30.404 1.00 52.56  ? 56  GLU G CD    1 
ATOM   4764  O  OE1   . GLU G 3 43  ? 3.651   55.102 -29.229 1.00 49.41  ? 56  GLU G OE1   1 
ATOM   4765  O  OE2   . GLU G 3 43  ? 3.559   56.708 -30.722 1.00 50.61  ? 56  GLU G OE2   1 
ATOM   4766  N  N     . TYR G 3 44  ? 7.293   53.570 -33.479 1.00 36.24  ? 57  TYR G N     1 
ATOM   4767  C  CA    . TYR G 3 44  ? 7.892   54.276 -34.603 1.00 36.85  ? 57  TYR G CA    1 
ATOM   4768  C  C     . TYR G 3 44  ? 7.780   53.441 -35.882 1.00 38.53  ? 57  TYR G C     1 
ATOM   4769  O  O     . TYR G 3 44  ? 7.367   53.961 -36.929 1.00 40.84  ? 57  TYR G O     1 
ATOM   4770  C  CB    . TYR G 3 44  ? 9.362   54.642 -34.325 1.00 38.93  ? 57  TYR G CB    1 
ATOM   4771  C  CG    . TYR G 3 44  ? 10.118  54.965 -35.594 1.00 42.89  ? 57  TYR G CG    1 
ATOM   4772  C  CD1   . TYR G 3 44  ? 9.855   56.134 -36.309 1.00 45.45  ? 57  TYR G CD1   1 
ATOM   4773  C  CD2   . TYR G 3 44  ? 11.046  54.072 -36.122 1.00 44.86  ? 57  TYR G CD2   1 
ATOM   4774  C  CE1   . TYR G 3 44  ? 10.522  56.424 -37.498 1.00 48.13  ? 57  TYR G CE1   1 
ATOM   4775  C  CE2   . TYR G 3 44  ? 11.709  54.342 -37.322 1.00 46.58  ? 57  TYR G CE2   1 
ATOM   4776  C  CZ    . TYR G 3 44  ? 11.445  55.524 -38.004 1.00 57.49  ? 57  TYR G CZ    1 
ATOM   4777  O  OH    . TYR G 3 44  ? 12.112  55.846 -39.163 1.00 60.58  ? 57  TYR G OH    1 
ATOM   4778  N  N     . LEU G 3 45  ? 8.211   52.174 -35.795 1.00 29.87  ? 58  LEU G N     1 
ATOM   4779  C  CA    . LEU G 3 45  ? 8.206   51.253 -36.912 1.00 26.79  ? 58  LEU G CA    1 
ATOM   4780  C  C     . LEU G 3 45  ? 6.797   50.946 -37.371 1.00 32.08  ? 58  LEU G C     1 
ATOM   4781  O  O     . LEU G 3 45  ? 6.597   50.778 -38.570 1.00 31.86  ? 58  LEU G O     1 
ATOM   4782  C  CB    . LEU G 3 45  ? 8.967   49.985 -36.571 1.00 25.25  ? 58  LEU G CB    1 
ATOM   4783  C  CG    . LEU G 3 45  ? 10.459  50.104 -36.379 1.00 26.28  ? 58  LEU G CG    1 
ATOM   4784  C  CD1   . LEU G 3 45  ? 11.048  48.772 -35.927 1.00 24.08  ? 58  LEU G CD1   1 
ATOM   4785  C  CD2   . LEU G 3 45  ? 11.128  50.562 -37.641 1.00 25.93  ? 58  LEU G CD2   1 
ATOM   4786  N  N     . THR G 3 46  ? 5.804   50.921 -36.448 1.00 30.19  ? 59  THR G N     1 
ATOM   4787  C  CA    . THR G 3 46  ? 4.456   50.644 -36.934 1.00 30.77  ? 59  THR G CA    1 
ATOM   4788  C  C     . THR G 3 46  ? 3.940   51.861 -37.642 1.00 38.34  ? 59  THR G C     1 
ATOM   4789  O  O     . THR G 3 46  ? 3.223   51.685 -38.611 1.00 40.24  ? 59  THR G O     1 
ATOM   4790  C  CB    . THR G 3 46  ? 3.425   50.001 -35.948 1.00 32.67  ? 59  THR G CB    1 
ATOM   4791  O  OG1   . THR G 3 46  ? 2.348   50.897 -35.668 1.00 36.81  ? 59  THR G OG1   1 
ATOM   4792  C  CG2   . THR G 3 46  ? 4.019   49.456 -34.695 1.00 22.26  ? 59  THR G CG2   1 
ATOM   4793  N  N     . ALA G 3 47  ? 4.344   53.073 -37.231 1.00 36.08  ? 60  ALA G N     1 
ATOM   4794  C  CA    . ALA G 3 47  ? 3.963   54.328 -37.896 1.00 35.42  ? 60  ALA G CA    1 
ATOM   4795  C  C     . ALA G 3 47  ? 4.561   54.397 -39.308 1.00 37.24  ? 60  ALA G C     1 
ATOM   4796  O  O     . ALA G 3 47  ? 3.881   54.798 -40.252 1.00 33.16  ? 60  ALA G O     1 
ATOM   4797  C  CB    . ALA G 3 47  ? 4.438   55.512 -37.076 1.00 36.48  ? 60  ALA G CB    1 
ATOM   4798  N  N     . GLU G 3 48  ? 5.830   53.980 -39.437 1.00 37.61  ? 61  GLU G N     1 
ATOM   4799  C  CA    . GLU G 3 48  ? 6.542   53.910 -40.700 1.00 39.15  ? 61  GLU G CA    1 
ATOM   4800  C  C     . GLU G 3 48  ? 5.857   52.932 -41.684 1.00 45.61  ? 61  GLU G C     1 
ATOM   4801  O  O     . GLU G 3 48  ? 5.627   53.300 -42.830 1.00 48.82  ? 61  GLU G O     1 
ATOM   4802  C  CB    . GLU G 3 48  ? 8.006   53.525 -40.461 1.00 41.15  ? 61  GLU G CB    1 
ATOM   4803  C  CG    . GLU G 3 48  ? 8.950   54.124 -41.481 1.00 58.81  ? 61  GLU G CG    1 
ATOM   4804  C  CD    . GLU G 3 48  ? 8.965   55.636 -41.490 1.00 96.89  ? 61  GLU G CD    1 
ATOM   4805  O  OE1   . GLU G 3 48  ? 9.630   56.243 -40.615 1.00 85.83  ? 61  GLU G OE1   1 
ATOM   4806  O  OE2   . GLU G 3 48  ? 8.288   56.215 -42.371 1.00 113.67 ? 61  GLU G OE2   1 
ATOM   4807  N  N     . ILE G 3 49  ? 5.477   51.733 -41.234 1.00 40.08  ? 62  ILE G N     1 
ATOM   4808  C  CA    . ILE G 3 49  ? 4.788   50.765 -42.086 1.00 39.51  ? 62  ILE G CA    1 
ATOM   4809  C  C     . ILE G 3 49  ? 3.400   51.293 -42.508 1.00 44.41  ? 62  ILE G C     1 
ATOM   4810  O  O     . ILE G 3 49  ? 3.127   51.413 -43.705 1.00 45.37  ? 62  ILE G O     1 
ATOM   4811  C  CB    . ILE G 3 49  ? 4.766   49.366 -41.432 1.00 42.19  ? 62  ILE G CB    1 
ATOM   4812  C  CG1   . ILE G 3 49  ? 6.171   48.795 -41.460 1.00 43.50  ? 62  ILE G CG1   1 
ATOM   4813  C  CG2   . ILE G 3 49  ? 3.761   48.384 -42.111 1.00 41.23  ? 62  ILE G CG2   1 
ATOM   4814  C  CD1   . ILE G 3 49  ? 6.283   47.399 -40.985 1.00 57.65  ? 62  ILE G CD1   1 
ATOM   4815  N  N     . LEU G 3 50  ? 2.560   51.654 -41.525 1.00 39.75  ? 63  LEU G N     1 
ATOM   4816  C  CA    . LEU G 3 50  ? 1.213   52.201 -41.727 1.00 38.00  ? 63  LEU G CA    1 
ATOM   4817  C  C     . LEU G 3 50  ? 1.180   53.395 -42.687 1.00 37.54  ? 63  LEU G C     1 
ATOM   4818  O  O     . LEU G 3 50  ? 0.208   53.545 -43.450 1.00 33.45  ? 63  LEU G O     1 
ATOM   4819  C  CB    . LEU G 3 50  ? 0.538   52.558 -40.378 1.00 36.89  ? 63  LEU G CB    1 
ATOM   4820  C  CG    . LEU G 3 50  ? 0.173   51.329 -39.491 1.00 38.04  ? 63  LEU G CG    1 
ATOM   4821  C  CD1   . LEU G 3 50  ? -0.230  51.761 -38.122 1.00 39.18  ? 63  LEU G CD1   1 
ATOM   4822  C  CD2   . LEU G 3 50  ? -0.891  50.496 -40.091 1.00 31.86  ? 63  LEU G CD2   1 
ATOM   4823  N  N     . GLU G 3 51  ? 2.277   54.199 -42.692 1.00 37.04  ? 64  GLU G N     1 
ATOM   4824  C  CA    . GLU G 3 51  ? 2.439   55.389 -43.535 1.00 36.35  ? 64  GLU G CA    1 
ATOM   4825  C  C     . GLU G 3 51  ? 2.506   54.987 -44.991 1.00 40.73  ? 64  GLU G C     1 
ATOM   4826  O  O     . GLU G 3 51  ? 1.722   55.460 -45.784 1.00 41.65  ? 64  GLU G O     1 
ATOM   4827  C  CB    . GLU G 3 51  ? 3.694   56.182 -43.139 1.00 37.88  ? 64  GLU G CB    1 
ATOM   4828  C  CG    . GLU G 3 51  ? 4.143   57.267 -44.135 1.00 50.10  ? 64  GLU G CG    1 
ATOM   4829  C  CD    . GLU G 3 51  ? 3.308   58.527 -44.305 1.00 72.23  ? 64  GLU G CD    1 
ATOM   4830  O  OE1   . GLU G 3 51  ? 3.433   59.229 -45.344 1.00 61.39  ? 64  GLU G OE1   1 
ATOM   4831  O  OE2   . GLU G 3 51  ? 2.544   58.830 -43.362 1.00 72.31  ? 64  GLU G OE2   1 
ATOM   4832  N  N     . LEU G 3 52  ? 3.441   54.134 -45.340 1.00 37.23  ? 65  LEU G N     1 
ATOM   4833  C  CA    . LEU G 3 52  ? 3.657   53.699 -46.711 1.00 37.17  ? 65  LEU G CA    1 
ATOM   4834  C  C     . LEU G 3 52  ? 2.520   52.823 -47.246 1.00 41.23  ? 65  LEU G C     1 
ATOM   4835  O  O     . LEU G 3 52  ? 2.186   52.907 -48.437 1.00 39.22  ? 65  LEU G O     1 
ATOM   4836  C  CB    . LEU G 3 52  ? 5.013   52.991 -46.829 1.00 36.71  ? 65  LEU G CB    1 
ATOM   4837  C  CG    . LEU G 3 52  ? 6.218   53.822 -46.425 1.00 39.35  ? 65  LEU G CG    1 
ATOM   4838  C  CD1   . LEU G 3 52  ? 7.268   52.965 -45.861 1.00 38.83  ? 65  LEU G CD1   1 
ATOM   4839  C  CD2   . LEU G 3 52  ? 6.749   54.592 -47.558 1.00 38.51  ? 65  LEU G CD2   1 
ATOM   4840  N  N     . ALA G 3 53  ? 1.949   51.964 -46.367 1.00 39.61  ? 66  ALA G N     1 
ATOM   4841  C  CA    . ALA G 3 53  ? 0.834   51.067 -46.695 1.00 40.10  ? 66  ALA G CA    1 
ATOM   4842  C  C     . ALA G 3 53  ? -0.444  51.858 -46.937 1.00 45.12  ? 66  ALA G C     1 
ATOM   4843  O  O     . ALA G 3 53  ? -1.110  51.626 -47.946 1.00 42.51  ? 66  ALA G O     1 
ATOM   4844  C  CB    . ALA G 3 53  ? 0.625   50.039 -45.598 1.00 40.69  ? 66  ALA G CB    1 
ATOM   4845  N  N     . GLY G 3 54  ? -0.731  52.827 -46.059 1.00 44.70  ? 67  GLY G N     1 
ATOM   4846  C  CA    . GLY G 3 54  ? -1.880  53.701 -46.211 1.00 45.98  ? 67  GLY G CA    1 
ATOM   4847  C  C     . GLY G 3 54  ? -1.793  54.477 -47.513 1.00 54.40  ? 67  GLY G C     1 
ATOM   4848  O  O     . GLY G 3 54  ? -2.812  54.724 -48.159 1.00 54.94  ? 67  GLY G O     1 
ATOM   4849  N  N     . ASN G 3 55  ? -0.560  54.850 -47.917 1.00 53.11  ? 68  ASN G N     1 
ATOM   4850  C  CA    . ASN G 3 55  ? -0.281  55.548 -49.170 1.00 53.13  ? 68  ASN G CA    1 
ATOM   4851  C  C     . ASN G 3 55  ? -0.576  54.621 -50.325 1.00 63.68  ? 68  ASN G C     1 
ATOM   4852  O  O     . ASN G 3 55  ? -1.084  55.099 -51.326 1.00 67.01  ? 68  ASN G O     1 
ATOM   4853  C  CB    . ASN G 3 55  ? 1.180   55.934 -49.282 1.00 45.34  ? 68  ASN G CB    1 
ATOM   4854  C  CG    . ASN G 3 55  ? 1.637   57.117 -48.502 1.00 61.90  ? 68  ASN G CG    1 
ATOM   4855  O  OD1   . ASN G 3 55  ? 0.864   57.886 -47.895 1.00 46.88  ? 68  ASN G OD1   1 
ATOM   4856  N  ND2   . ASN G 3 55  ? 2.939   57.288 -48.537 1.00 56.09  ? 68  ASN G ND2   1 
ATOM   4857  N  N     . ALA G 3 56  ? -0.217  53.320 -50.223 1.00 61.08  ? 69  ALA G N     1 
ATOM   4858  C  CA    . ALA G 3 56  ? -0.455  52.340 -51.291 1.00 60.96  ? 69  ALA G CA    1 
ATOM   4859  C  C     . ALA G 3 56  ? -1.914  51.956 -51.380 1.00 66.74  ? 69  ALA G C     1 
ATOM   4860  O  O     . ALA G 3 56  ? -2.356  51.539 -52.444 1.00 66.55  ? 69  ALA G O     1 
ATOM   4861  C  CB    . ALA G 3 56  ? 0.407   51.117 -51.094 1.00 61.08  ? 69  ALA G CB    1 
ATOM   4862  N  N     . ALA G 3 57  ? -2.659  52.094 -50.264 1.00 65.12  ? 70  ALA G N     1 
ATOM   4863  C  CA    . ALA G 3 57  ? -4.085  51.811 -50.185 1.00 66.07  ? 70  ALA G CA    1 
ATOM   4864  C  C     . ALA G 3 57  ? -4.769  52.848 -51.032 1.00 77.63  ? 70  ALA G C     1 
ATOM   4865  O  O     . ALA G 3 57  ? -5.591  52.491 -51.869 1.00 79.18  ? 70  ALA G O     1 
ATOM   4866  C  CB    . ALA G 3 57  ? -4.563  51.915 -48.748 1.00 66.36  ? 70  ALA G CB    1 
ATOM   4867  N  N     . ARG G 3 58  ? -4.357  54.133 -50.859 1.00 78.53  ? 71  ARG G N     1 
ATOM   4868  C  CA    . ARG G 3 58  ? -4.783  55.364 -51.534 1.00 78.96  ? 71  ARG G CA    1 
ATOM   4869  C  C     . ARG G 3 58  ? -4.518  55.337 -53.052 1.00 88.46  ? 71  ARG G C     1 
ATOM   4870  O  O     . ARG G 3 58  ? -5.223  56.016 -53.776 1.00 90.95  ? 71  ARG G O     1 
ATOM   4871  C  CB    . ARG G 3 58  ? -4.031  56.530 -50.903 1.00 78.86  ? 71  ARG G CB    1 
ATOM   4872  C  CG    . ARG G 3 58  ? -4.298  57.921 -51.519 1.00 99.26  ? 71  ARG G CG    1 
ATOM   4873  C  CD    . ARG G 3 58  ? -3.122  58.877 -51.362 1.00 113.95 ? 71  ARG G CD    1 
ATOM   4874  N  NE    . ARG G 3 58  ? -1.974  58.522 -52.211 1.00 122.26 ? 71  ARG G NE    1 
ATOM   4875  C  CZ    . ARG G 3 58  ? -0.711  58.483 -51.788 1.00 127.03 ? 71  ARG G CZ    1 
ATOM   4876  N  NH1   . ARG G 3 58  ? -0.419  58.758 -50.523 1.00 104.50 ? 71  ARG G NH1   1 
ATOM   4877  N  NH2   . ARG G 3 58  ? 0.267   58.155 -52.625 1.00 108.39 ? 71  ARG G NH2   1 
ATOM   4878  N  N     . ASP G 3 59  ? -3.496  54.611 -53.531 1.00 87.78  ? 72  ASP G N     1 
ATOM   4879  C  CA    . ASP G 3 59  ? -3.171  54.499 -54.963 1.00 88.59  ? 72  ASP G CA    1 
ATOM   4880  C  C     . ASP G 3 59  ? -4.033  53.420 -55.599 1.00 94.65  ? 72  ASP G C     1 
ATOM   4881  O  O     . ASP G 3 59  ? -4.538  53.600 -56.703 1.00 93.87  ? 72  ASP G O     1 
ATOM   4882  C  CB    . ASP G 3 59  ? -1.686  54.140 -55.178 1.00 90.78  ? 72  ASP G CB    1 
ATOM   4883  C  CG    . ASP G 3 59  ? -0.681  55.029 -54.470 1.00 103.01 ? 72  ASP G CG    1 
ATOM   4884  O  OD1   . ASP G 3 59  ? -1.007  56.224 -54.223 1.00 103.62 ? 72  ASP G OD1   1 
ATOM   4885  O  OD2   . ASP G 3 59  ? 0.439   54.536 -54.162 1.00 107.35 ? 72  ASP G OD2   1 
ATOM   4886  N  N     . ASN G 3 60  ? -4.201  52.291 -54.897 1.00 94.06  ? 73  ASN G N     1 
ATOM   4887  C  CA    . ASN G 3 60  ? -5.020  51.167 -55.347 1.00 95.16  ? 73  ASN G CA    1 
ATOM   4888  C  C     . ASN G 3 60  ? -6.512  51.520 -55.214 1.00 100.52 ? 73  ASN G C     1 
ATOM   4889  O  O     . ASN G 3 60  ? -7.374  50.649 -55.390 1.00 101.20 ? 73  ASN G O     1 
ATOM   4890  C  CB    . ASN G 3 60  ? -4.670  49.891 -54.559 1.00 99.13  ? 73  ASN G CB    1 
ATOM   4891  C  CG    . ASN G 3 60  ? -3.404  49.151 -54.973 1.00 116.26 ? 73  ASN G CG    1 
ATOM   4892  O  OD1   . ASN G 3 60  ? -3.438  47.929 -55.194 1.00 107.29 ? 73  ASN G OD1   1 
ATOM   4893  N  ND2   . ASN G 3 60  ? -2.251  49.848 -55.037 1.00 99.97  ? 73  ASN G ND2   1 
ATOM   4894  N  N     . LYS G 3 61  ? -6.790  52.812 -54.887 1.00 96.89  ? 74  LYS G N     1 
ATOM   4895  C  CA    . LYS G 3 61  ? -8.090  53.488 -54.751 1.00 97.21  ? 74  LYS G CA    1 
ATOM   4896  C  C     . LYS G 3 61  ? -8.907  53.062 -53.513 1.00 97.26  ? 74  LYS G C     1 
ATOM   4897  O  O     . LYS G 3 61  ? -10.023 53.545 -53.299 1.00 98.30  ? 74  LYS G O     1 
ATOM   4898  C  CB    . LYS G 3 61  ? -8.927  53.357 -56.049 1.00 101.89 ? 74  LYS G CB    1 
ATOM   4899  C  CG    . LYS G 3 61  ? -8.393  54.183 -57.233 1.00 123.67 ? 74  LYS G CG    1 
ATOM   4900  C  CD    . LYS G 3 61  ? -7.548  53.343 -58.204 1.00 135.36 ? 74  LYS G CD    1 
ATOM   4901  C  CE    . LYS G 3 61  ? -6.935  54.156 -59.322 1.00 146.14 ? 74  LYS G CE    1 
ATOM   4902  N  NZ    . LYS G 3 61  ? -5.759  54.946 -58.867 1.00 153.90 ? 74  LYS G NZ    1 
ATOM   4903  N  N     . LYS G 3 62  ? -8.322  52.222 -52.673 1.00 89.54  ? 75  LYS G N     1 
ATOM   4904  C  CA    . LYS G 3 62  ? -8.976  51.699 -51.479 1.00 86.81  ? 75  LYS G CA    1 
ATOM   4905  C  C     . LYS G 3 62  ? -8.899  52.668 -50.260 1.00 82.48  ? 75  LYS G C     1 
ATOM   4906  O  O     . LYS G 3 62  ? -8.026  53.530 -50.177 1.00 79.69  ? 75  LYS G O     1 
ATOM   4907  C  CB    . LYS G 3 62  ? -8.443  50.282 -51.137 1.00 89.07  ? 75  LYS G CB    1 
ATOM   4908  C  CG    . LYS G 3 62  ? -8.664  49.203 -52.212 1.00 105.68 ? 75  LYS G CG    1 
ATOM   4909  C  CD    . LYS G 3 62  ? -10.050 48.529 -52.128 1.00 116.75 ? 75  LYS G CD    1 
ATOM   4910  C  CE    . LYS G 3 62  ? -10.073 47.073 -52.567 1.00 120.45 ? 75  LYS G CE    1 
ATOM   4911  N  NZ    . LYS G 3 62  ? -9.568  46.145 -51.513 1.00 116.11 ? 75  LYS G NZ    1 
ATOM   4912  N  N     . THR G 3 63  ? -9.853  52.484 -49.337 1.00 75.21  ? 76  THR G N     1 
ATOM   4913  C  CA    . THR G 3 63  ? -10.107 53.192 -48.089 1.00 73.71  ? 76  THR G CA    1 
ATOM   4914  C  C     . THR G 3 63  ? -9.466  52.456 -46.929 1.00 73.78  ? 76  THR G C     1 
ATOM   4915  O  O     . THR G 3 63  ? -9.131  53.075 -45.947 1.00 74.02  ? 76  THR G O     1 
ATOM   4916  C  CB    . THR G 3 63  ? -11.663 53.288 -47.917 1.00 85.15  ? 76  THR G CB    1 
ATOM   4917  O  OG1   . THR G 3 63  ? -12.167 54.526 -48.457 1.00 85.17  ? 76  THR G OG1   1 
ATOM   4918  C  CG2   . THR G 3 63  ? -12.148 53.073 -46.467 1.00 82.36  ? 76  THR G CG2   1 
ATOM   4919  N  N     . ARG G 3 64  ? -9.359  51.136 -47.030 1.00 70.11  ? 77  ARG G N     1 
ATOM   4920  C  CA    . ARG G 3 64  ? -8.874  50.175 -46.029 1.00 68.54  ? 77  ARG G CA    1 
ATOM   4921  C  C     . ARG G 3 64  ? -7.567  49.537 -46.464 1.00 67.54  ? 77  ARG G C     1 
ATOM   4922  O  O     . ARG G 3 64  ? -7.439  49.139 -47.630 1.00 68.22  ? 77  ARG G O     1 
ATOM   4923  C  CB    . ARG G 3 64  ? -9.897  49.028 -45.871 1.00 69.72  ? 77  ARG G CB    1 
ATOM   4924  C  CG    . ARG G 3 64  ? -11.261 49.456 -45.373 1.00 90.77  ? 77  ARG G CG    1 
ATOM   4925  C  CD    . ARG G 3 64  ? -12.272 48.336 -45.500 1.00 120.58 ? 77  ARG G CD    1 
ATOM   4926  N  NE    . ARG G 3 64  ? -13.625 48.807 -45.208 1.00 147.81 ? 77  ARG G NE    1 
ATOM   4927  C  CZ    . ARG G 3 64  ? -14.710 48.039 -45.237 1.00 175.88 ? 77  ARG G CZ    1 
ATOM   4928  N  NH1   . ARG G 3 64  ? -15.902 48.552 -44.950 1.00 170.22 ? 77  ARG G NH1   1 
ATOM   4929  N  NH2   . ARG G 3 64  ? -14.612 46.748 -45.540 1.00 165.76 ? 77  ARG G NH2   1 
ATOM   4930  N  N     . ILE G 3 65  ? -6.638  49.356 -45.505 1.00 58.54  ? 78  ILE G N     1 
ATOM   4931  C  CA    . ILE G 3 65  ? -5.352  48.693 -45.706 1.00 55.87  ? 78  ILE G CA    1 
ATOM   4932  C  C     . ILE G 3 65  ? -5.606  47.229 -45.661 1.00 56.82  ? 78  ILE G C     1 
ATOM   4933  O  O     . ILE G 3 65  ? -6.206  46.747 -44.704 1.00 58.71  ? 78  ILE G O     1 
ATOM   4934  C  CB    . ILE G 3 65  ? -4.278  49.100 -44.652 1.00 58.69  ? 78  ILE G CB    1 
ATOM   4935  C  CG1   . ILE G 3 65  ? -3.795  50.564 -44.867 1.00 57.83  ? 78  ILE G CG1   1 
ATOM   4936  C  CG2   . ILE G 3 65  ? -3.090  48.122 -44.676 1.00 59.67  ? 78  ILE G CG2   1 
ATOM   4937  C  CD1   . ILE G 3 65  ? -3.378  51.305 -43.629 1.00 48.63  ? 78  ILE G CD1   1 
ATOM   4938  N  N     . ILE G 3 66  ? -5.199  46.523 -46.722 1.00 48.81  ? 79  ILE G N     1 
ATOM   4939  C  CA    . ILE G 3 66  ? -5.270  45.067 -46.830 1.00 45.47  ? 79  ILE G CA    1 
ATOM   4940  C  C     . ILE G 3 66  ? -3.804  44.574 -46.840 1.00 48.63  ? 79  ILE G C     1 
ATOM   4941  O  O     . ILE G 3 66  ? -2.891  45.400 -47.034 1.00 49.73  ? 79  ILE G O     1 
ATOM   4942  C  CB    . ILE G 3 66  ? -6.086  44.595 -48.062 1.00 46.77  ? 79  ILE G CB    1 
ATOM   4943  C  CG1   . ILE G 3 66  ? -5.344  44.852 -49.391 1.00 45.68  ? 79  ILE G CG1   1 
ATOM   4944  C  CG2   . ILE G 3 66  ? -7.484  45.188 -48.044 1.00 46.65  ? 79  ILE G CG2   1 
ATOM   4945  C  CD1   . ILE G 3 66  ? -5.994  44.275 -50.669 1.00 36.75  ? 79  ILE G CD1   1 
ATOM   4946  N  N     . PRO G 3 67  ? -3.532  43.270 -46.631 1.00 43.16  ? 80  PRO G N     1 
ATOM   4947  C  CA    . PRO G 3 67  ? -2.133  42.795 -46.657 1.00 41.91  ? 80  PRO G CA    1 
ATOM   4948  C  C     . PRO G 3 67  ? -1.322  43.145 -47.929 1.00 42.83  ? 80  PRO G C     1 
ATOM   4949  O  O     . PRO G 3 67  ? -0.101  43.313 -47.844 1.00 38.24  ? 80  PRO G O     1 
ATOM   4950  C  CB    . PRO G 3 67  ? -2.290  41.292 -46.460 1.00 43.44  ? 80  PRO G CB    1 
ATOM   4951  C  CG    . PRO G 3 67  ? -3.561  41.143 -45.717 1.00 48.18  ? 80  PRO G CG    1 
ATOM   4952  C  CD    . PRO G 3 67  ? -4.451  42.153 -46.335 1.00 45.35  ? 80  PRO G CD    1 
ATOM   4953  N  N     . ARG G 3 68  ? -2.001  43.291 -49.099 1.00 41.57  ? 81  ARG G N     1 
ATOM   4954  C  CA    . ARG G 3 68  ? -1.350  43.658 -50.356 1.00 41.83  ? 81  ARG G CA    1 
ATOM   4955  C  C     . ARG G 3 68  ? -0.614  44.956 -50.164 1.00 49.23  ? 81  ARG G C     1 
ATOM   4956  O  O     . ARG G 3 68  ? 0.537   45.076 -50.567 1.00 51.82  ? 81  ARG G O     1 
ATOM   4957  C  CB    . ARG G 3 68  ? -2.369  43.869 -51.482 1.00 39.88  ? 81  ARG G CB    1 
ATOM   4958  C  CG    . ARG G 3 68  ? -1.889  43.340 -52.817 1.00 51.80  ? 81  ARG G CG    1 
ATOM   4959  C  CD    . ARG G 3 68  ? -0.670  44.015 -53.369 1.00 51.68  ? 81  ARG G CD    1 
ATOM   4960  N  NE    . ARG G 3 68  ? 0.225   43.077 -54.047 1.00 37.93  ? 81  ARG G NE    1 
ATOM   4961  C  CZ    . ARG G 3 68  ? 0.341   43.009 -55.361 1.00 56.24  ? 81  ARG G CZ    1 
ATOM   4962  N  NH1   . ARG G 3 68  ? -0.417  43.755 -56.137 1.00 55.20  ? 81  ARG G NH1   1 
ATOM   4963  N  NH2   . ARG G 3 68  ? 1.168   42.155 -55.909 1.00 64.31  ? 81  ARG G NH2   1 
ATOM   4964  N  N     . HIS G 3 69  ? -1.281  45.924 -49.539 1.00 43.61  ? 82  HIS G N     1 
ATOM   4965  C  CA    . HIS G 3 69  ? -0.758  47.242 -49.283 1.00 42.03  ? 82  HIS G CA    1 
ATOM   4966  C  C     . HIS G 3 69  ? 0.495   47.184 -48.396 1.00 46.93  ? 82  HIS G C     1 
ATOM   4967  O  O     . HIS G 3 69  ? 1.473   47.881 -48.689 1.00 51.98  ? 82  HIS G O     1 
ATOM   4968  C  CB    . HIS G 3 69  ? -1.852  48.103 -48.684 1.00 41.22  ? 82  HIS G CB    1 
ATOM   4969  C  CG    . HIS G 3 69  ? -3.078  48.147 -49.517 1.00 44.04  ? 82  HIS G CG    1 
ATOM   4970  N  ND1   . HIS G 3 69  ? -4.322  48.279 -48.945 1.00 46.33  ? 82  HIS G ND1   1 
ATOM   4971  C  CD2   . HIS G 3 69  ? -3.212  48.123 -50.863 1.00 46.67  ? 82  HIS G CD2   1 
ATOM   4972  C  CE1   . HIS G 3 69  ? -5.184  48.339 -49.957 1.00 46.72  ? 82  HIS G CE1   1 
ATOM   4973  N  NE2   . HIS G 3 69  ? -4.567  48.208 -51.133 1.00 47.03  ? 82  HIS G NE2   1 
ATOM   4974  N  N     . LEU G 3 70  ? 0.475   46.346 -47.345 1.00 35.44  ? 83  LEU G N     1 
ATOM   4975  C  CA    . LEU G 3 70  ? 1.610   46.156 -46.448 1.00 33.67  ? 83  LEU G CA    1 
ATOM   4976  C  C     . LEU G 3 70  ? 2.775   45.549 -47.236 1.00 35.27  ? 83  LEU G C     1 
ATOM   4977  O  O     . LEU G 3 70  ? 3.889   46.013 -47.129 1.00 38.23  ? 83  LEU G O     1 
ATOM   4978  C  CB    . LEU G 3 70  ? 1.211   45.251 -45.283 1.00 33.70  ? 83  LEU G CB    1 
ATOM   4979  C  CG    . LEU G 3 70  ? 0.079   45.797 -44.409 1.00 38.18  ? 83  LEU G CG    1 
ATOM   4980  C  CD1   . LEU G 3 70  ? -0.528  44.687 -43.588 1.00 38.34  ? 83  LEU G CD1   1 
ATOM   4981  C  CD2   . LEU G 3 70  ? 0.547   46.954 -43.539 1.00 36.26  ? 83  LEU G CD2   1 
ATOM   4982  N  N     . GLN G 3 71  ? 2.495   44.605 -48.110 1.00 26.63  ? 84  GLN G N     1 
ATOM   4983  C  CA    . GLN G 3 71  ? 3.477   44.013 -48.988 1.00 25.37  ? 84  GLN G CA    1 
ATOM   4984  C  C     . GLN G 3 71  ? 4.086   45.028 -49.937 1.00 30.68  ? 84  GLN G C     1 
ATOM   4985  O  O     . GLN G 3 71  ? 5.305   45.123 -49.993 1.00 29.85  ? 84  GLN G O     1 
ATOM   4986  C  CB    . GLN G 3 71  ? 2.840   42.849 -49.750 1.00 27.39  ? 84  GLN G CB    1 
ATOM   4987  C  CG    . GLN G 3 71  ? 3.759   42.097 -50.710 1.00 45.76  ? 84  GLN G CG    1 
ATOM   4988  C  CD    . GLN G 3 71  ? 4.895   41.311 -50.110 1.00 46.77  ? 84  GLN G CD    1 
ATOM   4989  O  OE1   . GLN G 3 71  ? 5.554   40.566 -50.833 1.00 46.70  ? 84  GLN G OE1   1 
ATOM   4990  N  NE2   . GLN G 3 71  ? 5.220   41.492 -48.825 1.00 16.00  ? 84  GLN G NE2   1 
ATOM   4991  N  N     . LEU G 3 72  ? 3.257   45.847 -50.635 1.00 29.20  ? 85  LEU G N     1 
ATOM   4992  C  CA    . LEU G 3 72  ? 3.781   46.843 -51.565 1.00 28.77  ? 85  LEU G CA    1 
ATOM   4993  C  C     . LEU G 3 72  ? 4.637   47.839 -50.839 1.00 40.78  ? 85  LEU G C     1 
ATOM   4994  O  O     . LEU G 3 72  ? 5.697   48.197 -51.355 1.00 45.58  ? 85  LEU G O     1 
ATOM   4995  C  CB    . LEU G 3 72  ? 2.678   47.559 -52.335 1.00 27.62  ? 85  LEU G CB    1 
ATOM   4996  C  CG    . LEU G 3 72  ? 1.722   46.701 -53.094 1.00 31.48  ? 85  LEU G CG    1 
ATOM   4997  C  CD1   . LEU G 3 72  ? 0.473   47.424 -53.418 1.00 28.15  ? 85  LEU G CD1   1 
ATOM   4998  C  CD2   . LEU G 3 72  ? 2.367   46.059 -54.299 1.00 39.63  ? 85  LEU G CD2   1 
ATOM   4999  N  N     . ALA G 3 73  ? 4.194   48.286 -49.634 1.00 35.20  ? 86  ALA G N     1 
ATOM   5000  C  CA    . ALA G 3 73  ? 4.918   49.242 -48.798 1.00 31.10  ? 86  ALA G CA    1 
ATOM   5001  C  C     . ALA G 3 73  ? 6.245   48.646 -48.355 1.00 36.76  ? 86  ALA G C     1 
ATOM   5002  O  O     . ALA G 3 73  ? 7.249   49.326 -48.496 1.00 39.64  ? 86  ALA G O     1 
ATOM   5003  C  CB    . ALA G 3 73  ? 4.092   49.601 -47.588 1.00 30.32  ? 86  ALA G CB    1 
ATOM   5004  N  N     . ILE G 3 74  ? 6.261   47.386 -47.851 1.00 31.08  ? 87  ILE G N     1 
ATOM   5005  C  CA    . ILE G 3 74  ? 7.461   46.711 -47.359 1.00 31.06  ? 87  ILE G CA    1 
ATOM   5006  C  C     . ILE G 3 74  ? 8.459   46.525 -48.485 1.00 36.05  ? 87  ILE G C     1 
ATOM   5007  O  O     . ILE G 3 74  ? 9.640   46.845 -48.315 1.00 35.12  ? 87  ILE G O     1 
ATOM   5008  C  CB    . ILE G 3 74  ? 7.182   45.327 -46.647 1.00 34.26  ? 87  ILE G CB    1 
ATOM   5009  C  CG1   . ILE G 3 74  ? 6.147   45.367 -45.499 1.00 34.98  ? 87  ILE G CG1   1 
ATOM   5010  C  CG2   . ILE G 3 74  ? 8.454   44.641 -46.142 1.00 36.55  ? 87  ILE G CG2   1 
ATOM   5011  C  CD1   . ILE G 3 74  ? 6.213   46.460 -44.511 1.00 45.73  ? 87  ILE G CD1   1 
ATOM   5012  N  N     . ARG G 3 75  ? 7.994   45.982 -49.624 1.00 33.86  ? 88  ARG G N     1 
ATOM   5013  C  CA    . ARG G 3 75  ? 8.910   45.594 -50.688 1.00 34.87  ? 88  ARG G CA    1 
ATOM   5014  C  C     . ARG G 3 75  ? 9.317   46.746 -51.559 1.00 43.14  ? 88  ARG G C     1 
ATOM   5015  O  O     . ARG G 3 75  ? 10.277  46.598 -52.308 1.00 44.48  ? 88  ARG G O     1 
ATOM   5016  C  CB    . ARG G 3 75  ? 8.409   44.383 -51.505 1.00 33.71  ? 88  ARG G CB    1 
ATOM   5017  C  CG    . ARG G 3 75  ? 7.579   43.414 -50.669 1.00 37.13  ? 88  ARG G CG    1 
ATOM   5018  C  CD    . ARG G 3 75  ? 8.158   42.119 -50.139 1.00 28.14  ? 88  ARG G CD    1 
ATOM   5019  N  NE    . ARG G 3 75  ? 9.328   42.215 -49.279 1.00 29.36  ? 88  ARG G NE    1 
ATOM   5020  C  CZ    . ARG G 3 75  ? 9.514   41.523 -48.151 1.00 42.54  ? 88  ARG G CZ    1 
ATOM   5021  N  NH1   . ARG G 3 75  ? 8.528   40.801 -47.628 1.00 11.87  ? 88  ARG G NH1   1 
ATOM   5022  N  NH2   . ARG G 3 75  ? 10.663  41.606 -47.504 1.00 37.18  ? 88  ARG G NH2   1 
ATOM   5023  N  N     . ASN G 3 76  ? 8.686   47.914 -51.402 1.00 41.48  ? 89  ASN G N     1 
ATOM   5024  C  CA    . ASN G 3 76  ? 9.116   49.089 -52.147 1.00 41.96  ? 89  ASN G CA    1 
ATOM   5025  C  C     . ASN G 3 76  ? 10.056  50.001 -51.338 1.00 47.87  ? 89  ASN G C     1 
ATOM   5026  O  O     . ASN G 3 76  ? 10.711  50.835 -51.949 1.00 49.13  ? 89  ASN G O     1 
ATOM   5027  C  CB    . ASN G 3 76  ? 7.965   49.849 -52.739 1.00 39.80  ? 89  ASN G CB    1 
ATOM   5028  C  CG    . ASN G 3 76  ? 7.436   49.226 -53.998 1.00 50.89  ? 89  ASN G CG    1 
ATOM   5029  O  OD1   . ASN G 3 76  ? 8.184   48.915 -54.943 1.00 50.30  ? 89  ASN G OD1   1 
ATOM   5030  N  ND2   . ASN G 3 76  ? 6.125   49.086 -54.052 1.00 38.66  ? 89  ASN G ND2   1 
ATOM   5031  N  N     . ASP G 3 77  ? 10.157  49.820 -49.995 1.00 43.64  ? 90  ASP G N     1 
ATOM   5032  C  CA    . ASP G 3 77  ? 11.109  50.528 -49.147 1.00 43.39  ? 90  ASP G CA    1 
ATOM   5033  C  C     . ASP G 3 77  ? 12.319  49.625 -49.026 1.00 50.14  ? 90  ASP G C     1 
ATOM   5034  O  O     . ASP G 3 77  ? 12.162  48.461 -48.680 1.00 52.01  ? 90  ASP G O     1 
ATOM   5035  C  CB    . ASP G 3 77  ? 10.554  50.831 -47.747 1.00 45.41  ? 90  ASP G CB    1 
ATOM   5036  C  CG    . ASP G 3 77  ? 11.467  51.740 -46.902 1.00 67.72  ? 90  ASP G CG    1 
ATOM   5037  O  OD1   . ASP G 3 77  ? 12.137  52.626 -47.481 1.00 70.64  ? 90  ASP G OD1   1 
ATOM   5038  O  OD2   . ASP G 3 77  ? 11.504  51.570 -45.667 1.00 76.50  ? 90  ASP G OD2   1 
ATOM   5039  N  N     . GLU G 3 78  ? 13.522  50.148 -49.310 1.00 46.46  ? 91  GLU G N     1 
ATOM   5040  C  CA    . GLU G 3 78  ? 14.784  49.398 -49.265 1.00 44.85  ? 91  GLU G CA    1 
ATOM   5041  C  C     . GLU G 3 78  ? 15.048  48.817 -47.879 1.00 45.59  ? 91  GLU G C     1 
ATOM   5042  O  O     . GLU G 3 78  ? 15.331  47.620 -47.752 1.00 47.05  ? 91  GLU G O     1 
ATOM   5043  C  CB    . GLU G 3 78  ? 15.935  50.331 -49.725 1.00 46.26  ? 91  GLU G CB    1 
ATOM   5044  C  CG    . GLU G 3 78  ? 17.271  49.645 -49.969 1.00 60.07  ? 91  GLU G CG    1 
ATOM   5045  C  CD    . GLU G 3 78  ? 18.324  50.527 -50.605 1.00 89.13  ? 91  GLU G CD    1 
ATOM   5046  O  OE1   . GLU G 3 78  ? 19.188  51.047 -49.862 1.00 81.16  ? 91  GLU G OE1   1 
ATOM   5047  O  OE2   . GLU G 3 78  ? 18.286  50.702 -51.846 1.00 92.18  ? 91  GLU G OE2   1 
ATOM   5048  N  N     . GLU G 3 79  ? 14.889  49.664 -46.847 1.00 41.37  ? 92  GLU G N     1 
ATOM   5049  C  CA    . GLU G 3 79  ? 15.134  49.362 -45.437 1.00 40.43  ? 92  GLU G CA    1 
ATOM   5050  C  C     . GLU G 3 79  ? 14.085  48.438 -44.812 1.00 41.10  ? 92  GLU G C     1 
ATOM   5051  O  O     . GLU G 3 79  ? 14.485  47.546 -44.071 1.00 41.49  ? 92  GLU G O     1 
ATOM   5052  C  CB    . GLU G 3 79  ? 15.315  50.651 -44.619 1.00 41.76  ? 92  GLU G CB    1 
ATOM   5053  C  CG    . GLU G 3 79  ? 16.590  51.380 -44.980 1.00 52.79  ? 92  GLU G CG    1 
ATOM   5054  C  CD    . GLU G 3 79  ? 17.019  52.537 -44.099 1.00 83.18  ? 92  GLU G CD    1 
ATOM   5055  O  OE1   . GLU G 3 79  ? 16.189  53.023 -43.297 1.00 100.48 ? 92  GLU G OE1   1 
ATOM   5056  O  OE2   . GLU G 3 79  ? 18.189  52.969 -44.228 1.00 69.81  ? 92  GLU G OE2   1 
ATOM   5057  N  N     . LEU G 3 80  ? 12.769  48.613 -45.109 1.00 33.74  ? 93  LEU G N     1 
ATOM   5058  C  CA    . LEU G 3 80  ? 11.754  47.689 -44.593 1.00 31.90  ? 93  LEU G CA    1 
ATOM   5059  C  C     . LEU G 3 80  ? 11.909  46.362 -45.313 1.00 36.98  ? 93  LEU G C     1 
ATOM   5060  O  O     . LEU G 3 80  ? 11.781  45.288 -44.694 1.00 37.70  ? 93  LEU G O     1 
ATOM   5061  C  CB    . LEU G 3 80  ? 10.308  48.194 -44.728 1.00 31.46  ? 93  LEU G CB    1 
ATOM   5062  C  CG    . LEU G 3 80  ? 9.904   49.399 -43.885 1.00 36.74  ? 93  LEU G CG    1 
ATOM   5063  C  CD1   . LEU G 3 80  ? 8.646   50.001 -44.417 1.00 37.95  ? 93  LEU G CD1   1 
ATOM   5064  C  CD2   . LEU G 3 80  ? 9.745   49.072 -42.419 1.00 34.75  ? 93  LEU G CD2   1 
ATOM   5065  N  N     . ASN G 3 81  ? 12.230  46.410 -46.618 1.00 32.51  ? 94  ASN G N     1 
ATOM   5066  C  CA    . ASN G 3 81  ? 12.456  45.162 -47.337 1.00 32.43  ? 94  ASN G CA    1 
ATOM   5067  C  C     . ASN G 3 81  ? 13.587  44.379 -46.707 1.00 39.14  ? 94  ASN G C     1 
ATOM   5068  O  O     . ASN G 3 81  ? 13.470  43.182 -46.620 1.00 40.63  ? 94  ASN G O     1 
ATOM   5069  C  CB    . ASN G 3 81  ? 12.764  45.400 -48.787 1.00 27.57  ? 94  ASN G CB    1 
ATOM   5070  C  CG    . ASN G 3 81  ? 12.777  44.111 -49.545 1.00 39.54  ? 94  ASN G CG    1 
ATOM   5071  O  OD1   . ASN G 3 81  ? 11.934  43.261 -49.354 1.00 39.71  ? 94  ASN G OD1   1 
ATOM   5072  N  ND2   . ASN G 3 81  ? 13.733  43.920 -50.410 1.00 40.33  ? 94  ASN G ND2   1 
ATOM   5073  N  N     . LYS G 3 82  ? 14.671  45.054 -46.254 1.00 37.56  ? 95  LYS G N     1 
ATOM   5074  C  CA    . LYS G 3 82  ? 15.823  44.405 -45.613 1.00 35.22  ? 95  LYS G CA    1 
ATOM   5075  C  C     . LYS G 3 82  ? 15.393  43.882 -44.274 1.00 36.60  ? 95  LYS G C     1 
ATOM   5076  O  O     . LYS G 3 82  ? 15.619  42.725 -43.991 1.00 40.35  ? 95  LYS G O     1 
ATOM   5077  C  CB    . LYS G 3 82  ? 16.992  45.401 -45.484 1.00 37.69  ? 95  LYS G CB    1 
ATOM   5078  C  CG    . LYS G 3 82  ? 18.297  44.748 -45.023 1.00 56.65  ? 95  LYS G CG    1 
ATOM   5079  C  CD    . LYS G 3 82  ? 19.556  45.306 -45.699 1.00 73.06  ? 95  LYS G CD    1 
ATOM   5080  C  CE    . LYS G 3 82  ? 20.726  44.328 -45.657 1.00 94.47  ? 95  LYS G CE    1 
ATOM   5081  N  NZ    . LYS G 3 82  ? 20.355  42.910 -46.012 1.00 102.29 ? 95  LYS G NZ    1 
ATOM   5082  N  N     . LEU G 3 83  ? 14.707  44.697 -43.479 1.00 31.92  ? 96  LEU G N     1 
ATOM   5083  C  CA    . LEU G 3 83  ? 14.244  44.338 -42.131 1.00 30.75  ? 96  LEU G CA    1 
ATOM   5084  C  C     . LEU G 3 83  ? 13.302  43.151 -42.160 1.00 35.14  ? 96  LEU G C     1 
ATOM   5085  O  O     . LEU G 3 83  ? 13.392  42.304 -41.284 1.00 37.10  ? 96  LEU G O     1 
ATOM   5086  C  CB    . LEU G 3 83  ? 13.632  45.575 -41.389 1.00 29.63  ? 96  LEU G CB    1 
ATOM   5087  C  CG    . LEU G 3 83  ? 12.973  45.329 -40.027 1.00 31.42  ? 96  LEU G CG    1 
ATOM   5088  C  CD1   . LEU G 3 83  ? 13.968  44.906 -39.002 1.00 31.36  ? 96  LEU G CD1   1 
ATOM   5089  C  CD2   . LEU G 3 83  ? 12.201  46.521 -39.558 1.00 21.29  ? 96  LEU G CD2   1 
ATOM   5090  N  N     . LEU G 3 84  ? 12.442  43.056 -43.190 1.00 29.87  ? 97  LEU G N     1 
ATOM   5091  C  CA    . LEU G 3 84  ? 11.488  41.957 -43.325 1.00 27.14  ? 97  LEU G CA    1 
ATOM   5092  C  C     . LEU G 3 84  ? 11.794  41.052 -44.546 1.00 36.30  ? 97  LEU G C     1 
ATOM   5093  O  O     . LEU G 3 84  ? 10.884  40.456 -45.143 1.00 38.83  ? 97  LEU G O     1 
ATOM   5094  C  CB    . LEU G 3 84  ? 10.058  42.503 -43.327 1.00 25.72  ? 97  LEU G CB    1 
ATOM   5095  C  CG    . LEU G 3 84  ? 9.725   43.441 -42.176 1.00 28.58  ? 97  LEU G CG    1 
ATOM   5096  C  CD1   . LEU G 3 84  ? 8.464   44.162 -42.418 1.00 27.31  ? 97  LEU G CD1   1 
ATOM   5097  C  CD2   . LEU G 3 84  ? 9.652   42.710 -40.879 1.00 35.99  ? 97  LEU G CD2   1 
ATOM   5098  N  N     . GLY G 3 85  ? 13.086  40.899 -44.836 1.00 31.63  ? 98  GLY G N     1 
ATOM   5099  C  CA    . GLY G 3 85  ? 13.595  40.131 -45.956 1.00 30.97  ? 98  GLY G CA    1 
ATOM   5100  C  C     . GLY G 3 85  ? 13.401  38.637 -45.905 1.00 35.38  ? 98  GLY G C     1 
ATOM   5101  O  O     . GLY G 3 85  ? 13.442  37.971 -46.948 1.00 39.25  ? 98  GLY G O     1 
ATOM   5102  N  N     . ARG G 3 86  ? 13.238  38.079 -44.705 1.00 25.67  ? 99  ARG G N     1 
ATOM   5103  C  CA    . ARG G 3 86  ? 13.073  36.640 -44.559 1.00 20.31  ? 99  ARG G CA    1 
ATOM   5104  C  C     . ARG G 3 86  ? 11.749  36.363 -43.824 1.00 24.19  ? 99  ARG G C     1 
ATOM   5105  O  O     . ARG G 3 86  ? 11.652  35.442 -42.995 1.00 28.61  ? 99  ARG G O     1 
ATOM   5106  C  CB    . ARG G 3 86  ? 14.304  36.005 -43.837 1.00 14.79  ? 99  ARG G CB    1 
ATOM   5107  C  CG    . ARG G 3 86  ? 15.651  36.168 -44.565 1.00 18.07  ? 99  ARG G CG    1 
ATOM   5108  C  CD    . ARG G 3 86  ? 16.428  34.916 -44.946 1.00 48.40  ? 99  ARG G CD    1 
ATOM   5109  N  NE    . ARG G 3 86  ? 15.989  34.344 -46.228 1.00 79.78  ? 99  ARG G NE    1 
ATOM   5110  C  CZ    . ARG G 3 86  ? 15.306  33.200 -46.362 1.00 98.09  ? 99  ARG G CZ    1 
ATOM   5111  N  NH1   . ARG G 3 86  ? 15.001  32.465 -45.295 1.00 66.37  ? 99  ARG G NH1   1 
ATOM   5112  N  NH2   . ARG G 3 86  ? 14.946  32.772 -47.569 1.00 93.24  ? 99  ARG G NH2   1 
ATOM   5113  N  N     . VAL G 3 87  ? 10.719  37.144 -44.190 1.00 17.77  ? 100 VAL G N     1 
ATOM   5114  C  CA    . VAL G 3 87  ? 9.343   37.191 -43.651 1.00 18.40  ? 100 VAL G CA    1 
ATOM   5115  C  C     . VAL G 3 87  ? 8.388   37.109 -44.837 1.00 22.65  ? 100 VAL G C     1 
ATOM   5116  O  O     . VAL G 3 87  ? 8.710   37.645 -45.911 1.00 22.37  ? 100 VAL G O     1 
ATOM   5117  C  CB    . VAL G 3 87  ? 9.100   38.528 -42.880 1.00 24.68  ? 100 VAL G CB    1 
ATOM   5118  C  CG1   . VAL G 3 87  ? 7.637   38.750 -42.615 1.00 25.60  ? 100 VAL G CG1   1 
ATOM   5119  C  CG2   . VAL G 3 87  ? 9.860   38.576 -41.572 1.00 25.09  ? 100 VAL G CG2   1 
ATOM   5120  N  N     . THR G 3 88  ? 7.228   36.419 -44.649 1.00 19.42  ? 101 THR G N     1 
ATOM   5121  C  CA    . THR G 3 88  ? 6.196   36.236 -45.664 1.00 19.14  ? 101 THR G CA    1 
ATOM   5122  C  C     . THR G 3 88  ? 4.891   36.914 -45.205 1.00 21.90  ? 101 THR G C     1 
ATOM   5123  O  O     . THR G 3 88  ? 4.327   36.562 -44.167 1.00 16.54  ? 101 THR G O     1 
ATOM   5124  C  CB    . THR G 3 88  ? 6.071   34.711 -46.091 1.00 28.77  ? 101 THR G CB    1 
ATOM   5125  O  OG1   . THR G 3 88  ? 7.051   34.411 -47.091 1.00 36.43  ? 101 THR G OG1   1 
ATOM   5126  C  CG2   . THR G 3 88  ? 4.694   34.312 -46.666 1.00 12.01  ? 101 THR G CG2   1 
ATOM   5127  N  N     . ILE G 3 89  ? 4.428   37.906 -45.990 1.00 26.24  ? 102 ILE G N     1 
ATOM   5128  C  CA    . ILE G 3 89  ? 3.143   38.560 -45.686 1.00 29.33  ? 102 ILE G CA    1 
ATOM   5129  C  C     . ILE G 3 89  ? 2.043   37.707 -46.329 1.00 34.89  ? 102 ILE G C     1 
ATOM   5130  O  O     . ILE G 3 89  ? 1.989   37.587 -47.553 1.00 36.25  ? 102 ILE G O     1 
ATOM   5131  C  CB    . ILE G 3 89  ? 3.097   40.106 -45.993 1.00 32.39  ? 102 ILE G CB    1 
ATOM   5132  C  CG1   . ILE G 3 89  ? 3.962   40.876 -45.007 1.00 30.78  ? 102 ILE G CG1   1 
ATOM   5133  C  CG2   . ILE G 3 89  ? 1.675   40.683 -45.996 1.00 35.07  ? 102 ILE G CG2   1 
ATOM   5134  C  CD1   . ILE G 3 89  ? 5.131   41.306 -45.589 1.00 36.54  ? 102 ILE G CD1   1 
ATOM   5135  N  N     . ALA G 3 90  ? 1.260   37.012 -45.500 1.00 30.01  ? 103 ALA G N     1 
ATOM   5136  C  CA    . ALA G 3 90  ? 0.203   36.179 -46.039 1.00 30.79  ? 103 ALA G CA    1 
ATOM   5137  C  C     . ALA G 3 90  ? -0.819  37.071 -46.767 1.00 40.64  ? 103 ALA G C     1 
ATOM   5138  O  O     . ALA G 3 90  ? -1.216  38.128 -46.238 1.00 42.84  ? 103 ALA G O     1 
ATOM   5139  C  CB    . ALA G 3 90  ? -0.453  35.391 -44.937 1.00 31.43  ? 103 ALA G CB    1 
ATOM   5140  N  N     . GLN G 3 91  ? -1.146  36.698 -48.041 1.00 35.63  ? 104 GLN G N     1 
ATOM   5141  C  CA    . GLN G 3 91  ? -2.051  37.434 -48.945 1.00 31.99  ? 104 GLN G CA    1 
ATOM   5142  C  C     . GLN G 3 91  ? -1.381  38.715 -49.502 1.00 37.14  ? 104 GLN G C     1 
ATOM   5143  O  O     . GLN G 3 91  ? -2.042  39.584 -50.029 1.00 38.06  ? 104 GLN G O     1 
ATOM   5144  C  CB    . GLN G 3 91  ? -3.408  37.693 -48.277 1.00 30.84  ? 104 GLN G CB    1 
ATOM   5145  C  CG    . GLN G 3 91  ? -4.318  36.507 -48.242 1.00 52.69  ? 104 GLN G CG    1 
ATOM   5146  C  CD    . GLN G 3 91  ? -4.707  36.060 -49.636 1.00 83.07  ? 104 GLN G CD    1 
ATOM   5147  O  OE1   . GLN G 3 91  ? -5.362  36.810 -50.387 1.00 81.16  ? 104 GLN G OE1   1 
ATOM   5148  N  NE2   . GLN G 3 91  ? -4.290  34.830 -50.012 1.00 69.32  ? 104 GLN G NE2   1 
ATOM   5149  N  N     . GLY G 3 92  ? -0.068  38.797 -49.414 1.00 33.94  ? 105 GLY G N     1 
ATOM   5150  C  CA    . GLY G 3 92  ? 0.694   39.931 -49.903 1.00 33.75  ? 105 GLY G CA    1 
ATOM   5151  C  C     . GLY G 3 92  ? 0.881   39.997 -51.401 1.00 41.94  ? 105 GLY G C     1 
ATOM   5152  O  O     . GLY G 3 92  ? 0.870   41.085 -51.962 1.00 45.67  ? 105 GLY G O     1 
ATOM   5153  N  N     . GLY G 3 93  ? 1.045   38.865 -52.061 1.00 40.84  ? 106 GLY G N     1 
ATOM   5154  C  CA    . GLY G 3 93  ? 1.323   38.807 -53.499 1.00 42.58  ? 106 GLY G CA    1 
ATOM   5155  C  C     . GLY G 3 93  ? 2.790   39.145 -53.759 1.00 51.89  ? 106 GLY G C     1 
ATOM   5156  O  O     . GLY G 3 93  ? 3.590   39.200 -52.808 1.00 50.99  ? 106 GLY G O     1 
ATOM   5157  N  N     . VAL G 3 94  ? 3.161   39.420 -55.044 1.00 50.16  ? 107 VAL G N     1 
ATOM   5158  C  CA    . VAL G 3 94  ? 4.563   39.795 -55.368 1.00 48.90  ? 107 VAL G CA    1 
ATOM   5159  C  C     . VAL G 3 94  ? 4.635   41.203 -55.882 1.00 53.66  ? 107 VAL G C     1 
ATOM   5160  O  O     . VAL G 3 94  ? 3.599   41.774 -56.172 1.00 55.29  ? 107 VAL G O     1 
ATOM   5161  C  CB    . VAL G 3 94  ? 5.285   38.833 -56.364 1.00 50.38  ? 107 VAL G CB    1 
ATOM   5162  C  CG1   . VAL G 3 94  ? 5.576   37.506 -55.741 1.00 48.24  ? 107 VAL G CG1   1 
ATOM   5163  C  CG2   . VAL G 3 94  ? 4.549   38.700 -57.690 1.00 49.81  ? 107 VAL G CG2   1 
ATOM   5164  N  N     . LEU G 3 95  ? 5.836   41.765 -56.087 1.00 48.06  ? 108 LEU G N     1 
ATOM   5165  C  CA    . LEU G 3 95  ? 5.815   43.087 -56.731 1.00 45.80  ? 108 LEU G CA    1 
ATOM   5166  C  C     . LEU G 3 95  ? 5.748   42.840 -58.230 1.00 55.76  ? 108 LEU G C     1 
ATOM   5167  O  O     . LEU G 3 95  ? 6.416   41.916 -58.710 1.00 57.77  ? 108 LEU G O     1 
ATOM   5168  C  CB    . LEU G 3 95  ? 7.044   43.970 -56.448 1.00 43.09  ? 108 LEU G CB    1 
ATOM   5169  C  CG    . LEU G 3 95  ? 7.189   44.609 -55.105 1.00 42.27  ? 108 LEU G CG    1 
ATOM   5170  C  CD1   . LEU G 3 95  ? 8.400   45.482 -55.109 1.00 40.16  ? 108 LEU G CD1   1 
ATOM   5171  C  CD2   . LEU G 3 95  ? 5.934   45.351 -54.684 1.00 40.53  ? 108 LEU G CD2   1 
ATOM   5172  N  N     . PRO G 3 96  ? 4.959   43.612 -58.997 1.00 55.75  ? 109 PRO G N     1 
ATOM   5173  C  CA    . PRO G 3 96  ? 4.975   43.407 -60.444 1.00 57.58  ? 109 PRO G CA    1 
ATOM   5174  C  C     . PRO G 3 96  ? 6.365   43.742 -60.984 1.00 66.86  ? 109 PRO G C     1 
ATOM   5175  O  O     . PRO G 3 96  ? 6.886   44.802 -60.679 1.00 67.99  ? 109 PRO G O     1 
ATOM   5176  C  CB    . PRO G 3 96  ? 3.881   44.347 -60.958 1.00 59.10  ? 109 PRO G CB    1 
ATOM   5177  C  CG    . PRO G 3 96  ? 3.116   44.788 -59.732 1.00 62.88  ? 109 PRO G CG    1 
ATOM   5178  C  CD    . PRO G 3 96  ? 4.096   44.748 -58.625 1.00 57.83  ? 109 PRO G CD    1 
ATOM   5179  N  N     . ASN G 3 97  ? 7.002   42.777 -61.671 1.00 67.41  ? 110 ASN G N     1 
ATOM   5180  C  CA    . ASN G 3 97  ? 8.317   42.882 -62.303 1.00 68.34  ? 110 ASN G CA    1 
ATOM   5181  C  C     . ASN G 3 97  ? 8.518   41.752 -63.313 1.00 74.78  ? 110 ASN G C     1 
ATOM   5182  O  O     . ASN G 3 97  ? 8.513   40.580 -62.950 1.00 74.92  ? 110 ASN G O     1 
ATOM   5183  C  CB    . ASN G 3 97  ? 9.484   43.008 -61.277 1.00 68.85  ? 110 ASN G CB    1 
ATOM   5184  C  CG    . ASN G 3 97  ? 10.885  42.824 -61.836 1.00 103.33 ? 110 ASN G CG    1 
ATOM   5185  O  OD1   . ASN G 3 97  ? 11.568  41.857 -61.501 1.00 102.16 ? 110 ASN G OD1   1 
ATOM   5186  N  ND2   . ASN G 3 97  ? 11.364  43.754 -62.678 1.00 96.42  ? 110 ASN G ND2   1 
ATOM   5187  N  N     . ILE G 3 98  ? 8.625   42.128 -64.591 1.00 74.99  ? 111 ILE G N     1 
ATOM   5188  C  CA    . ILE G 3 98  ? 8.916   41.267 -65.738 1.00 76.91  ? 111 ILE G CA    1 
ATOM   5189  C  C     . ILE G 3 98  ? 10.369  41.589 -66.092 1.00 85.41  ? 111 ILE G C     1 
ATOM   5190  O  O     . ILE G 3 98  ? 10.750  42.759 -66.114 1.00 85.14  ? 111 ILE G O     1 
ATOM   5191  C  CB    . ILE G 3 98  ? 7.934   41.464 -66.965 1.00 79.94  ? 111 ILE G CB    1 
ATOM   5192  C  CG1   . ILE G 3 98  ? 6.484   41.011 -66.641 1.00 80.14  ? 111 ILE G CG1   1 
ATOM   5193  C  CG2   . ILE G 3 98  ? 8.419   40.705 -68.229 1.00 80.17  ? 111 ILE G CG2   1 
ATOM   5194  C  CD1   . ILE G 3 98  ? 5.533   41.995 -65.915 1.00 80.01  ? 111 ILE G CD1   1 
ATOM   5195  N  N     . GLN G 3 99  ? 11.181  40.559 -66.310 1.00 86.48  ? 112 GLN G N     1 
ATOM   5196  C  CA    . GLN G 3 99  ? 12.584  40.717 -66.674 1.00 88.54  ? 112 GLN G CA    1 
ATOM   5197  C  C     . GLN G 3 99  ? 12.629  41.216 -68.122 1.00 100.19 ? 112 GLN G C     1 
ATOM   5198  O  O     . GLN G 3 99  ? 12.029  40.598 -69.016 1.00 100.15 ? 112 GLN G O     1 
ATOM   5199  C  CB    . GLN G 3 99  ? 13.354  39.393 -66.479 1.00 89.35  ? 112 GLN G CB    1 
ATOM   5200  C  CG    . GLN G 3 99  ? 13.384  38.902 -65.026 1.00 82.60  ? 112 GLN G CG    1 
ATOM   5201  C  CD    . GLN G 3 99  ? 14.315  39.717 -64.150 1.00 91.41  ? 112 GLN G CD    1 
ATOM   5202  O  OE1   . GLN G 3 99  ? 15.500  39.904 -64.470 1.00 95.49  ? 112 GLN G OE1   1 
ATOM   5203  N  NE2   . GLN G 3 99  ? 13.809  40.214 -63.017 1.00 59.78  ? 112 GLN G NE2   1 
ATOM   5204  N  N     . ALA G 3 100 ? 13.272  42.387 -68.326 1.00 102.17 ? 113 ALA G N     1 
ATOM   5205  C  CA    . ALA G 3 100 ? 13.382  43.092 -69.611 1.00 104.38 ? 113 ALA G CA    1 
ATOM   5206  C  C     . ALA G 3 100 ? 13.849  42.218 -70.781 1.00 114.00 ? 113 ALA G C     1 
ATOM   5207  O  O     . ALA G 3 100 ? 13.504  42.499 -71.939 1.00 114.84 ? 113 ALA G O     1 
ATOM   5208  C  CB    . ALA G 3 100 ? 14.276  44.313 -69.465 1.00 105.14 ? 113 ALA G CB    1 
ATOM   5209  N  N     . VAL G 3 101 ? 14.607  41.147 -70.468 1.00 112.69 ? 114 VAL G N     1 
ATOM   5210  C  CA    . VAL G 3 101 ? 15.140  40.188 -71.437 1.00 113.58 ? 114 VAL G CA    1 
ATOM   5211  C  C     . VAL G 3 101 ? 13.978  39.391 -72.060 1.00 119.98 ? 114 VAL G C     1 
ATOM   5212  O  O     . VAL G 3 101 ? 14.036  39.036 -73.247 1.00 118.80 ? 114 VAL G O     1 
ATOM   5213  C  CB    . VAL G 3 101 ? 16.212  39.260 -70.795 1.00 117.62 ? 114 VAL G CB    1 
ATOM   5214  C  CG1   . VAL G 3 101 ? 17.100  38.632 -71.867 1.00 117.59 ? 114 VAL G CG1   1 
ATOM   5215  C  CG2   . VAL G 3 101 ? 17.070  40.007 -69.767 1.00 117.35 ? 114 VAL G CG2   1 
ATOM   5216  N  N     . LEU G 3 102 ? 12.912  39.150 -71.253 1.00 119.31 ? 115 LEU G N     1 
ATOM   5217  C  CA    . LEU G 3 102 ? 11.710  38.399 -71.644 1.00 120.42 ? 115 LEU G CA    1 
ATOM   5218  C  C     . LEU G 3 102 ? 10.750  39.200 -72.513 1.00 128.47 ? 115 LEU G C     1 
ATOM   5219  O  O     . LEU G 3 102 ? 10.058  38.603 -73.352 1.00 126.62 ? 115 LEU G O     1 
ATOM   5220  C  CB    . LEU G 3 102 ? 10.979  37.818 -70.417 1.00 120.04 ? 115 LEU G CB    1 
ATOM   5221  C  CG    . LEU G 3 102 ? 11.799  36.931 -69.477 1.00 123.68 ? 115 LEU G CG    1 
ATOM   5222  C  CD1   . LEU G 3 102 ? 11.082  36.732 -68.175 1.00 123.64 ? 115 LEU G CD1   1 
ATOM   5223  C  CD2   . LEU G 3 102 ? 12.141  35.593 -70.113 1.00 125.01 ? 115 LEU G CD2   1 
ATOM   5224  N  N     . LEU G 3 103 ? 10.734  40.553 -72.328 1.00 129.61 ? 116 LEU G N     1 
ATOM   5225  C  CA    . LEU G 3 103 ? 9.906   41.519 -73.075 1.00 131.52 ? 116 LEU G CA    1 
ATOM   5226  C  C     . LEU G 3 103 ? 10.066  41.394 -74.615 1.00 140.25 ? 116 LEU G C     1 
ATOM   5227  O  O     . LEU G 3 103 ? 11.170  41.087 -75.081 1.00 140.65 ? 116 LEU G O     1 
ATOM   5228  C  CB    . LEU G 3 103 ? 10.167  42.962 -72.602 1.00 131.33 ? 116 LEU G CB    1 
ATOM   5229  C  CG    . LEU G 3 103 ? 9.685   43.326 -71.181 1.00 136.40 ? 116 LEU G CG    1 
ATOM   5230  C  CD1   . LEU G 3 103 ? 10.199  44.705 -70.751 1.00 136.45 ? 116 LEU G CD1   1 
ATOM   5231  C  CD2   . LEU G 3 103 ? 8.158   43.275 -71.069 1.00 138.98 ? 116 LEU G CD2   1 
ATOM   5232  N  N     . PRO G 3 104 ? 8.981   41.568 -75.418 1.00 138.89 ? 117 PRO G N     1 
ATOM   5233  C  CA    . PRO G 3 104 ? 9.112   41.381 -76.882 1.00 138.81 ? 117 PRO G CA    1 
ATOM   5234  C  C     . PRO G 3 104 ? 9.961   42.421 -77.623 1.00 143.17 ? 117 PRO G C     1 
ATOM   5235  O  O     . PRO G 3 104 ? 10.214  43.511 -77.096 1.00 143.15 ? 117 PRO G O     1 
ATOM   5236  C  CB    . PRO G 3 104 ? 7.668   41.374 -77.373 1.00 140.52 ? 117 PRO G CB    1 
ATOM   5237  C  CG    . PRO G 3 104 ? 6.915   42.146 -76.345 1.00 145.11 ? 117 PRO G CG    1 
ATOM   5238  C  CD    . PRO G 3 104 ? 7.590   41.899 -75.034 1.00 140.81 ? 117 PRO G CD    1 
ATOM   5239  N  N     . LYS G 3 105 ? 10.414  42.064 -78.850 1.00 139.51 ? 118 LYS G N     1 
ATOM   5240  C  CA    . LYS G 3 105 ? 11.264  42.913 -79.693 1.00 164.45 ? 118 LYS G CA    1 
ATOM   5241  C  C     . LYS G 3 105 ? 10.435  43.830 -80.587 1.00 195.31 ? 118 LYS G C     1 
ATOM   5242  O  O     . LYS G 3 105 ? 10.065  44.916 -80.152 1.00 155.83 ? 118 LYS G O     1 
ATOM   5243  C  CB    . LYS G 3 105 ? 12.322  42.100 -80.475 1.00 166.74 ? 118 LYS G CB    1 
ATOM   5244  C  CG    . LYS G 3 105 ? 11.803  41.032 -81.437 1.00 180.89 ? 118 LYS G CG    1 
ATOM   5245  C  CD    . LYS G 3 105 ? 12.940  40.132 -81.956 1.00 191.86 ? 118 LYS G CD    1 
ATOM   5246  C  CE    . LYS G 3 105 ? 13.624  40.667 -83.199 1.00 203.85 ? 118 LYS G CE    1 
ATOM   5247  N  NZ    . LYS G 3 105 ? 14.715  39.769 -83.666 1.00 212.49 ? 118 LYS G NZ    1 
ATOM   5248  N  N     . ARG H 4 1   ? -13.805 30.271 -22.048 1.00 129.50 ? 28  ARG H N     1 
ATOM   5249  C  CA    . ARG H 4 1   ? -12.627 30.643 -22.857 1.00 130.14 ? 28  ARG H CA    1 
ATOM   5250  C  C     . ARG H 4 1   ? -11.479 31.248 -22.011 1.00 132.40 ? 28  ARG H C     1 
ATOM   5251  O  O     . ARG H 4 1   ? -11.516 31.191 -20.773 1.00 133.86 ? 28  ARG H O     1 
ATOM   5252  C  CB    . ARG H 4 1   ? -13.005 31.641 -23.981 1.00 132.69 ? 28  ARG H CB    1 
ATOM   5253  C  CG    . ARG H 4 1   ? -13.400 31.025 -25.312 1.00 145.01 ? 28  ARG H CG    1 
ATOM   5254  C  CD    . ARG H 4 1   ? -13.898 32.109 -26.250 1.00 156.98 ? 28  ARG H CD    1 
ATOM   5255  N  NE    . ARG H 4 1   ? -12.822 32.690 -27.046 1.00 168.02 ? 28  ARG H NE    1 
ATOM   5256  C  CZ    . ARG H 4 1   ? -12.837 33.921 -27.546 1.00 181.82 ? 28  ARG H CZ    1 
ATOM   5257  N  NH1   . ARG H 4 1   ? -13.868 34.726 -27.320 1.00 166.66 ? 28  ARG H NH1   1 
ATOM   5258  N  NH2   . ARG H 4 1   ? -11.814 34.362 -28.267 1.00 168.70 ? 28  ARG H NH2   1 
ATOM   5259  N  N     . SER H 4 2   ? -10.466 31.824 -22.695 1.00 124.65 ? 29  SER H N     1 
ATOM   5260  C  CA    . SER H 4 2   ? -9.311  32.483 -22.081 1.00 123.20 ? 29  SER H CA    1 
ATOM   5261  C  C     . SER H 4 2   ? -8.934  33.702 -22.934 1.00 122.29 ? 29  SER H C     1 
ATOM   5262  O  O     . SER H 4 2   ? -8.843  33.584 -24.169 1.00 121.88 ? 29  SER H O     1 
ATOM   5263  C  CB    . SER H 4 2   ? -8.130  31.522 -21.959 1.00 127.99 ? 29  SER H CB    1 
ATOM   5264  O  OG    . SER H 4 2   ? -7.554  31.202 -23.216 1.00 138.77 ? 29  SER H OG    1 
ATOM   5265  N  N     . ARG H 4 3   ? -8.732  34.865 -22.276 1.00 114.32 ? 30  ARG H N     1 
ATOM   5266  C  CA    . ARG H 4 3   ? -8.439  36.158 -22.921 1.00 111.43 ? 30  ARG H CA    1 
ATOM   5267  C  C     . ARG H 4 3   ? -7.183  36.138 -23.799 1.00 108.08 ? 30  ARG H C     1 
ATOM   5268  O  O     . ARG H 4 3   ? -6.198  35.496 -23.445 1.00 107.77 ? 30  ARG H O     1 
ATOM   5269  C  CB    . ARG H 4 3   ? -8.386  37.327 -21.900 1.00 112.05 ? 30  ARG H CB    1 
ATOM   5270  C  CG    . ARG H 4 3   ? -9.616  37.508 -20.993 1.00 124.58 ? 30  ARG H CG    1 
ATOM   5271  C  CD    . ARG H 4 3   ? -10.875 37.947 -21.734 1.00 134.79 ? 30  ARG H CD    1 
ATOM   5272  N  NE    . ARG H 4 3   ? -11.395 39.240 -21.273 1.00 146.38 ? 30  ARG H NE    1 
ATOM   5273  C  CZ    . ARG H 4 3   ? -12.435 39.391 -20.449 1.00 162.55 ? 30  ARG H CZ    1 
ATOM   5274  N  NH1   . ARG H 4 3   ? -13.077 38.331 -19.975 1.00 149.40 ? 30  ARG H NH1   1 
ATOM   5275  N  NH2   . ARG H 4 3   ? -12.834 40.607 -20.101 1.00 150.30 ? 30  ARG H NH2   1 
ATOM   5276  N  N     . LYS H 4 4   ? -7.256  36.818 -24.959 1.00 98.79  ? 31  LYS H N     1 
ATOM   5277  C  CA    . LYS H 4 4   ? -6.182  36.940 -25.938 1.00 95.80  ? 31  LYS H CA    1 
ATOM   5278  C  C     . LYS H 4 4   ? -5.770  38.410 -26.084 1.00 93.96  ? 31  LYS H C     1 
ATOM   5279  O  O     . LYS H 4 4   ? -6.617  39.257 -26.348 1.00 92.96  ? 31  LYS H O     1 
ATOM   5280  C  CB    . LYS H 4 4   ? -6.623  36.364 -27.306 1.00 97.83  ? 31  LYS H CB    1 
ATOM   5281  C  CG    . LYS H 4 4   ? -7.281  35.003 -27.254 1.00 117.82 ? 31  LYS H CG    1 
ATOM   5282  C  CD    . LYS H 4 4   ? -7.113  34.211 -28.543 1.00 131.70 ? 31  LYS H CD    1 
ATOM   5283  C  CE    . LYS H 4 4   ? -7.747  32.837 -28.447 1.00 148.42 ? 31  LYS H CE    1 
ATOM   5284  N  NZ    . LYS H 4 4   ? -7.169  31.989 -27.361 1.00 158.52 ? 31  LYS H NZ    1 
ATOM   5285  N  N     . GLU H 4 5   ? -4.467  38.699 -25.932 1.00 86.55  ? 32  GLU H N     1 
ATOM   5286  C  CA    . GLU H 4 5   ? -3.867  40.041 -26.073 1.00 83.75  ? 32  GLU H CA    1 
ATOM   5287  C  C     . GLU H 4 5   ? -3.755  40.397 -27.557 1.00 81.79  ? 32  GLU H C     1 
ATOM   5288  O  O     . GLU H 4 5   ? -3.945  39.516 -28.403 1.00 83.42  ? 32  GLU H O     1 
ATOM   5289  C  CB    . GLU H 4 5   ? -2.445  40.065 -25.474 1.00 85.05  ? 32  GLU H CB    1 
ATOM   5290  C  CG    . GLU H 4 5   ? -2.369  39.688 -24.016 1.00 98.79  ? 32  GLU H CG    1 
ATOM   5291  C  CD    . GLU H 4 5   ? -2.141  40.866 -23.099 1.00 129.32 ? 32  GLU H CD    1 
ATOM   5292  O  OE1   . GLU H 4 5   ? -1.051  41.475 -23.184 1.00 131.76 ? 32  GLU H OE1   1 
ATOM   5293  O  OE2   . GLU H 4 5   ? -3.051  41.184 -22.299 1.00 131.69 ? 32  GLU H OE2   1 
ATOM   5294  N  N     . SER H 4 6   ? -3.369  41.662 -27.867 1.00 70.90  ? 33  SER H N     1 
ATOM   5295  C  CA    . SER H 4 6   ? -3.196  42.216 -29.212 1.00 67.29  ? 33  SER H CA    1 
ATOM   5296  C  C     . SER H 4 6   ? -2.673  43.669 -29.150 1.00 70.01  ? 33  SER H C     1 
ATOM   5297  O  O     . SER H 4 6   ? -2.927  44.384 -28.178 1.00 70.32  ? 33  SER H O     1 
ATOM   5298  C  CB    . SER H 4 6   ? -4.537  42.228 -29.940 1.00 66.68  ? 33  SER H CB    1 
ATOM   5299  O  OG    . SER H 4 6   ? -4.369  41.957 -31.317 1.00 67.83  ? 33  SER H OG    1 
ATOM   5300  N  N     . TYR H 4 7   ? -1.998  44.120 -30.221 1.00 62.90  ? 34  TYR H N     1 
ATOM   5301  C  CA    . TYR H 4 7   ? -1.538  45.490 -30.382 1.00 60.03  ? 34  TYR H CA    1 
ATOM   5302  C  C     . TYR H 4 7   ? -2.568  46.288 -31.211 1.00 65.11  ? 34  TYR H C     1 
ATOM   5303  O  O     . TYR H 4 7   ? -2.318  47.450 -31.573 1.00 65.73  ? 34  TYR H O     1 
ATOM   5304  C  CB    . TYR H 4 7   ? -0.163  45.512 -31.042 1.00 59.73  ? 34  TYR H CB    1 
ATOM   5305  C  CG    . TYR H 4 7   ? 0.941   45.020 -30.136 1.00 61.15  ? 34  TYR H CG    1 
ATOM   5306  C  CD1   . TYR H 4 7   ? 1.574   45.881 -29.243 1.00 62.99  ? 34  TYR H CD1   1 
ATOM   5307  C  CD2   . TYR H 4 7   ? 1.375   43.705 -30.188 1.00 62.02  ? 34  TYR H CD2   1 
ATOM   5308  C  CE1   . TYR H 4 7   ? 2.604   45.436 -28.415 1.00 62.50  ? 34  TYR H CE1   1 
ATOM   5309  C  CE2   . TYR H 4 7   ? 2.405   43.250 -29.366 1.00 63.33  ? 34  TYR H CE2   1 
ATOM   5310  C  CZ    . TYR H 4 7   ? 3.022   44.120 -28.485 1.00 68.61  ? 34  TYR H CZ    1 
ATOM   5311  O  OH    . TYR H 4 7   ? 4.034   43.667 -27.668 1.00 70.00  ? 34  TYR H OH    1 
ATOM   5312  N  N     . SER H 4 8   ? -3.750  45.663 -31.468 1.00 60.87  ? 35  SER H N     1 
ATOM   5313  C  CA    . SER H 4 8   ? -4.882  46.171 -32.256 1.00 60.05  ? 35  SER H CA    1 
ATOM   5314  C  C     . SER H 4 8   ? -5.262  47.603 -31.935 1.00 61.82  ? 35  SER H C     1 
ATOM   5315  O  O     . SER H 4 8   ? -5.391  48.423 -32.838 1.00 61.56  ? 35  SER H O     1 
ATOM   5316  C  CB    . SER H 4 8   ? -6.099  45.271 -32.076 1.00 63.30  ? 35  SER H CB    1 
ATOM   5317  O  OG    . SER H 4 8   ? -5.824  43.948 -32.505 1.00 79.36  ? 35  SER H OG    1 
ATOM   5318  N  N     . VAL H 4 9   ? -5.440  47.883 -30.644 1.00 56.79  ? 36  VAL H N     1 
ATOM   5319  C  CA    . VAL H 4 9   ? -5.844  49.161 -30.076 1.00 55.89  ? 36  VAL H CA    1 
ATOM   5320  C  C     . VAL H 4 9   ? -4.854  50.282 -30.427 1.00 61.67  ? 36  VAL H C     1 
ATOM   5321  O  O     . VAL H 4 9   ? -5.272  51.397 -30.759 1.00 61.96  ? 36  VAL H O     1 
ATOM   5322  C  CB    . VAL H 4 9   ? -6.051  48.981 -28.553 1.00 59.10  ? 36  VAL H CB    1 
ATOM   5323  C  CG1   . VAL H 4 9   ? -6.183  50.311 -27.824 1.00 59.18  ? 36  VAL H CG1   1 
ATOM   5324  C  CG2   . VAL H 4 9   ? -7.264  48.103 -28.279 1.00 58.91  ? 36  VAL H CG2   1 
ATOM   5325  N  N     . TYR H 4 10  ? -3.554  49.956 -30.396 1.00 57.99  ? 37  TYR H N     1 
ATOM   5326  C  CA    . TYR H 4 10  ? -2.451  50.876 -30.652 1.00 56.80  ? 37  TYR H CA    1 
ATOM   5327  C  C     . TYR H 4 10  ? -2.177  51.053 -32.126 1.00 59.75  ? 37  TYR H C     1 
ATOM   5328  O  O     . TYR H 4 10  ? -1.936  52.169 -32.559 1.00 62.50  ? 37  TYR H O     1 
ATOM   5329  C  CB    . TYR H 4 10  ? -1.203  50.414 -29.890 1.00 57.79  ? 37  TYR H CB    1 
ATOM   5330  C  CG    . TYR H 4 10  ? -1.568  49.804 -28.560 1.00 58.67  ? 37  TYR H CG    1 
ATOM   5331  C  CD1   . TYR H 4 10  ? -1.953  50.603 -27.488 1.00 61.54  ? 37  TYR H CD1   1 
ATOM   5332  C  CD2   . TYR H 4 10  ? -1.651  48.431 -28.407 1.00 58.66  ? 37  TYR H CD2   1 
ATOM   5333  C  CE1   . TYR H 4 10  ? -2.372  50.042 -26.285 1.00 62.88  ? 37  TYR H CE1   1 
ATOM   5334  C  CE2   . TYR H 4 10  ? -2.066  47.860 -27.214 1.00 59.75  ? 37  TYR H CE2   1 
ATOM   5335  C  CZ    . TYR H 4 10  ? -2.426  48.670 -26.157 1.00 70.78  ? 37  TYR H CZ    1 
ATOM   5336  O  OH    . TYR H 4 10  ? -2.794  48.095 -24.977 1.00 78.82  ? 37  TYR H OH    1 
ATOM   5337  N  N     . VAL H 4 11  ? -2.232  49.976 -32.903 1.00 54.15  ? 38  VAL H N     1 
ATOM   5338  C  CA    . VAL H 4 11  ? -2.022  50.007 -34.350 1.00 52.48  ? 38  VAL H CA    1 
ATOM   5339  C  C     . VAL H 4 11  ? -3.086  50.934 -34.963 1.00 60.74  ? 38  VAL H C     1 
ATOM   5340  O  O     . VAL H 4 11  ? -2.737  51.802 -35.766 1.00 62.67  ? 38  VAL H O     1 
ATOM   5341  C  CB    . VAL H 4 11  ? -1.984  48.566 -34.970 1.00 53.01  ? 38  VAL H CB    1 
ATOM   5342  C  CG1   . VAL H 4 11  ? -1.944  48.611 -36.489 1.00 53.25  ? 38  VAL H CG1   1 
ATOM   5343  C  CG2   . VAL H 4 11  ? -0.790  47.783 -34.450 1.00 50.69  ? 38  VAL H CG2   1 
ATOM   5344  N  N     . TYR H 4 12  ? -4.345  50.832 -34.495 1.00 58.79  ? 39  TYR H N     1 
ATOM   5345  C  CA    . TYR H 4 12  ? -5.462  51.665 -34.936 1.00 61.30  ? 39  TYR H CA    1 
ATOM   5346  C  C     . TYR H 4 12  ? -5.192  53.170 -34.567 1.00 66.93  ? 39  TYR H C     1 
ATOM   5347  O  O     . TYR H 4 12  ? -5.434  54.061 -35.384 1.00 67.74  ? 39  TYR H O     1 
ATOM   5348  C  CB    . TYR H 4 12  ? -6.745  51.187 -34.258 1.00 64.57  ? 39  TYR H CB    1 
ATOM   5349  C  CG    . TYR H 4 12  ? -7.821  50.654 -35.171 1.00 71.13  ? 39  TYR H CG    1 
ATOM   5350  C  CD1   . TYR H 4 12  ? -8.791  51.505 -35.704 1.00 75.01  ? 39  TYR H CD1   1 
ATOM   5351  C  CD2   . TYR H 4 12  ? -7.988  49.278 -35.351 1.00 74.01  ? 39  TYR H CD2   1 
ATOM   5352  C  CE1   . TYR H 4 12  ? -9.865  51.002 -36.455 1.00 80.83  ? 39  TYR H CE1   1 
ATOM   5353  C  CE2   . TYR H 4 12  ? -9.038  48.759 -36.124 1.00 76.09  ? 39  TYR H CE2   1 
ATOM   5354  C  CZ    . TYR H 4 12  ? -9.986  49.624 -36.666 1.00 89.72  ? 39  TYR H CZ    1 
ATOM   5355  O  OH    . TYR H 4 12  ? -11.050 49.101 -37.391 1.00 88.69  ? 39  TYR H OH    1 
ATOM   5356  N  N     . LYS H 4 13  ? -4.679  53.430 -33.340 1.00 60.54  ? 40  LYS H N     1 
ATOM   5357  C  CA    . LYS H 4 13  ? -4.333  54.760 -32.851 1.00 57.85  ? 40  LYS H CA    1 
ATOM   5358  C  C     . LYS H 4 13  ? -3.247  55.343 -33.766 1.00 59.38  ? 40  LYS H C     1 
ATOM   5359  O  O     . LYS H 4 13  ? -3.467  56.388 -34.385 1.00 59.99  ? 40  LYS H O     1 
ATOM   5360  C  CB    . LYS H 4 13  ? -3.817  54.682 -31.400 1.00 59.44  ? 40  LYS H CB    1 
ATOM   5361  C  CG    . LYS H 4 13  ? -4.897  54.685 -30.330 1.00 65.38  ? 40  LYS H CG    1 
ATOM   5362  C  CD    . LYS H 4 13  ? -4.285  54.602 -28.939 1.00 69.77  ? 40  LYS H CD    1 
ATOM   5363  C  CE    . LYS H 4 13  ? -5.262  54.959 -27.857 1.00 78.82  ? 40  LYS H CE    1 
ATOM   5364  N  NZ    . LYS H 4 13  ? -6.158  53.820 -27.545 1.00 94.52  ? 40  LYS H NZ    1 
ATOM   5365  N  N     . VAL H 4 14  ? -2.115  54.612 -33.926 1.00 53.01  ? 41  VAL H N     1 
ATOM   5366  C  CA    . VAL H 4 14  ? -0.987  55.037 -34.766 1.00 50.26  ? 41  VAL H CA    1 
ATOM   5367  C  C     . VAL H 4 14  ? -1.456  55.194 -36.254 1.00 56.39  ? 41  VAL H C     1 
ATOM   5368  O  O     . VAL H 4 14  ? -0.995  56.115 -36.929 1.00 55.28  ? 41  VAL H O     1 
ATOM   5369  C  CB    . VAL H 4 14  ? 0.258   54.133 -34.542 1.00 49.70  ? 41  VAL H CB    1 
ATOM   5370  C  CG1   . VAL H 4 14  ? 1.351   54.394 -35.555 1.00 47.69  ? 41  VAL H CG1   1 
ATOM   5371  C  CG2   . VAL H 4 14  ? 0.801   54.332 -33.139 1.00 48.76  ? 41  VAL H CG2   1 
ATOM   5372  N  N     . LEU H 4 15  ? -2.450  54.400 -36.714 1.00 54.56  ? 42  LEU H N     1 
ATOM   5373  C  CA    . LEU H 4 15  ? -2.982  54.577 -38.070 1.00 55.71  ? 42  LEU H CA    1 
ATOM   5374  C  C     . LEU H 4 15  ? -3.726  55.913 -38.197 1.00 64.65  ? 42  LEU H C     1 
ATOM   5375  O  O     . LEU H 4 15  ? -3.539  56.626 -39.180 1.00 65.77  ? 42  LEU H O     1 
ATOM   5376  C  CB    . LEU H 4 15  ? -3.884  53.390 -38.488 1.00 55.84  ? 42  LEU H CB    1 
ATOM   5377  C  CG    . LEU H 4 15  ? -4.753  53.498 -39.758 1.00 59.27  ? 42  LEU H CG    1 
ATOM   5378  C  CD1   . LEU H 4 15  ? -3.928  53.780 -40.989 1.00 58.64  ? 42  LEU H CD1   1 
ATOM   5379  C  CD2   . LEU H 4 15  ? -5.455  52.202 -39.996 1.00 61.72  ? 42  LEU H CD2   1 
ATOM   5380  N  N     . LYS H 4 16  ? -4.553  56.257 -37.197 1.00 61.39  ? 43  LYS H N     1 
ATOM   5381  C  CA    . LYS H 4 16  ? -5.355  57.470 -37.220 1.00 59.63  ? 43  LYS H CA    1 
ATOM   5382  C  C     . LYS H 4 16  ? -4.507  58.708 -37.118 1.00 60.28  ? 43  LYS H C     1 
ATOM   5383  O  O     . LYS H 4 16  ? -4.865  59.712 -37.735 1.00 60.00  ? 43  LYS H O     1 
ATOM   5384  C  CB    . LYS H 4 16  ? -6.476  57.430 -36.168 1.00 62.77  ? 43  LYS H CB    1 
ATOM   5385  C  CG    . LYS H 4 16  ? -7.368  56.161 -36.266 1.00 81.15  ? 43  LYS H CG    1 
ATOM   5386  C  CD    . LYS H 4 16  ? -8.444  56.243 -37.349 1.00 98.26  ? 43  LYS H CD    1 
ATOM   5387  C  CE    . LYS H 4 16  ? -8.102  55.535 -38.635 1.00 110.19 ? 43  LYS H CE    1 
ATOM   5388  N  NZ    . LYS H 4 16  ? -9.000  55.973 -39.739 1.00 120.61 ? 43  LYS H NZ    1 
ATOM   5389  N  N     . GLN H 4 17  ? -3.357  58.633 -36.412 1.00 52.69  ? 44  GLN H N     1 
ATOM   5390  C  CA    . GLN H 4 17  ? -2.438  59.761 -36.331 1.00 49.88  ? 44  GLN H CA    1 
ATOM   5391  C  C     . GLN H 4 17  ? -1.810  60.019 -37.699 1.00 57.27  ? 44  GLN H C     1 
ATOM   5392  O  O     . GLN H 4 17  ? -1.572  61.192 -38.088 1.00 61.39  ? 44  GLN H O     1 
ATOM   5393  C  CB    . GLN H 4 17  ? -1.297  59.476 -35.363 1.00 49.39  ? 44  GLN H CB    1 
ATOM   5394  C  CG    . GLN H 4 17  ? -1.625  59.445 -33.900 1.00 39.00  ? 44  GLN H CG    1 
ATOM   5395  C  CD    . GLN H 4 17  ? -0.331  59.270 -33.156 1.00 54.91  ? 44  GLN H CD    1 
ATOM   5396  O  OE1   . GLN H 4 17  ? 0.385   58.243 -33.308 1.00 53.06  ? 44  GLN H OE1   1 
ATOM   5397  N  NE2   . GLN H 4 17  ? 0.035   60.269 -32.361 1.00 37.88  ? 44  GLN H NE2   1 
ATOM   5398  N  N     . VAL H 4 18  ? -1.538  58.933 -38.430 1.00 52.41  ? 45  VAL H N     1 
ATOM   5399  C  CA    . VAL H 4 18  ? -0.809  58.996 -39.679 1.00 54.22  ? 45  VAL H CA    1 
ATOM   5400  C  C     . VAL H 4 18  ? -1.734  59.293 -40.871 1.00 61.00  ? 45  VAL H C     1 
ATOM   5401  O  O     . VAL H 4 18  ? -1.586  60.364 -41.471 1.00 68.20  ? 45  VAL H O     1 
ATOM   5402  C  CB    . VAL H 4 18  ? 0.107   57.769 -39.854 1.00 61.75  ? 45  VAL H CB    1 
ATOM   5403  C  CG1   . VAL H 4 18  ? 0.733   57.734 -41.229 1.00 62.82  ? 45  VAL H CG1   1 
ATOM   5404  C  CG2   . VAL H 4 18  ? 1.198   57.785 -38.795 1.00 61.79  ? 45  VAL H CG2   1 
ATOM   5405  N  N     . HIS H 4 19  ? -2.690  58.433 -41.153 1.00 54.86  ? 46  HIS H N     1 
ATOM   5406  C  CA    . HIS H 4 19  ? -3.688  58.493 -42.223 1.00 54.82  ? 46  HIS H CA    1 
ATOM   5407  C  C     . HIS H 4 19  ? -5.047  58.478 -41.515 1.00 64.82  ? 46  HIS H C     1 
ATOM   5408  O  O     . HIS H 4 19  ? -5.551  57.405 -41.136 1.00 63.62  ? 46  HIS H O     1 
ATOM   5409  C  CB    . HIS H 4 19  ? -3.581  57.252 -43.149 1.00 53.62  ? 46  HIS H CB    1 
ATOM   5410  C  CG    . HIS H 4 19  ? -2.375  57.259 -44.025 1.00 55.42  ? 46  HIS H CG    1 
ATOM   5411  N  ND1   . HIS H 4 19  ? -1.316  56.408 -43.797 1.00 56.91  ? 46  HIS H ND1   1 
ATOM   5412  C  CD2   . HIS H 4 19  ? -2.104  58.011 -45.113 1.00 55.33  ? 46  HIS H CD2   1 
ATOM   5413  C  CE1   . HIS H 4 19  ? -0.445  56.674 -44.755 1.00 55.64  ? 46  HIS H CE1   1 
ATOM   5414  N  NE2   . HIS H 4 19  ? -0.873  57.645 -45.558 1.00 55.06  ? 46  HIS H NE2   1 
ATOM   5415  N  N     . PRO H 4 20  ? -5.656  59.662 -41.293 1.00 65.92  ? 47  PRO H N     1 
ATOM   5416  C  CA    . PRO H 4 20  ? -6.895  59.689 -40.528 1.00 67.46  ? 47  PRO H CA    1 
ATOM   5417  C  C     . PRO H 4 20  ? -8.113  59.260 -41.327 1.00 79.09  ? 47  PRO H C     1 
ATOM   5418  O  O     . PRO H 4 20  ? -9.162  59.103 -40.717 1.00 82.59  ? 47  PRO H O     1 
ATOM   5419  C  CB    . PRO H 4 20  ? -6.956  61.133 -40.036 1.00 67.63  ? 47  PRO H CB    1 
ATOM   5420  C  CG    . PRO H 4 20  ? -5.594  61.734 -40.351 1.00 70.56  ? 47  PRO H CG    1 
ATOM   5421  C  CD    . PRO H 4 20  ? -5.231  61.035 -41.600 1.00 66.41  ? 47  PRO H CD    1 
ATOM   5422  N  N     . ASP H 4 21  ? -7.982  59.032 -42.657 1.00 75.74  ? 48  ASP H N     1 
ATOM   5423  C  CA    . ASP H 4 21  ? -9.105  58.629 -43.504 1.00 75.76  ? 48  ASP H CA    1 
ATOM   5424  C  C     . ASP H 4 21  ? -8.925  57.231 -44.109 1.00 77.81  ? 48  ASP H C     1 
ATOM   5425  O  O     . ASP H 4 21  ? -9.681  56.845 -45.016 1.00 77.59  ? 48  ASP H O     1 
ATOM   5426  C  CB    . ASP H 4 21  ? -9.406  59.690 -44.587 1.00 78.54  ? 48  ASP H CB    1 
ATOM   5427  C  CG    . ASP H 4 21  ? -10.325 60.824 -44.169 1.00 102.08 ? 48  ASP H CG    1 
ATOM   5428  O  OD1   . ASP H 4 21  ? -10.283 61.225 -42.978 1.00 104.84 ? 48  ASP H OD1   1 
ATOM   5429  O  OD2   . ASP H 4 21  ? -11.068 61.330 -45.035 1.00 114.58 ? 48  ASP H OD2   1 
ATOM   5430  N  N     . THR H 4 22  ? -7.953  56.461 -43.567 1.00 71.41  ? 49  THR H N     1 
ATOM   5431  C  CA    . THR H 4 22  ? -7.628  55.101 -43.994 1.00 69.13  ? 49  THR H CA    1 
ATOM   5432  C  C     . THR H 4 22  ? -7.975  54.084 -42.878 1.00 69.99  ? 49  THR H C     1 
ATOM   5433  O  O     . THR H 4 22  ? -7.802  54.373 -41.694 1.00 70.73  ? 49  THR H O     1 
ATOM   5434  C  CB    . THR H 4 22  ? -6.167  55.044 -44.510 1.00 68.52  ? 49  THR H CB    1 
ATOM   5435  O  OG1   . THR H 4 22  ? -6.004  55.981 -45.589 1.00 70.27  ? 49  THR H OG1   1 
ATOM   5436  C  CG2   . THR H 4 22  ? -5.754  53.660 -44.986 1.00 56.90  ? 49  THR H CG2   1 
ATOM   5437  N  N     . GLY H 4 23  ? -8.483  52.924 -43.293 1.00 62.66  ? 50  GLY H N     1 
ATOM   5438  C  CA    . GLY H 4 23  ? -8.893  51.814 -42.441 1.00 60.67  ? 50  GLY H CA    1 
ATOM   5439  C  C     . GLY H 4 23  ? -7.973  50.618 -42.518 1.00 60.14  ? 50  GLY H C     1 
ATOM   5440  O  O     . GLY H 4 23  ? -6.971  50.649 -43.227 1.00 60.36  ? 50  GLY H O     1 
ATOM   5441  N  N     . ILE H 4 24  ? -8.269  49.574 -41.750 1.00 52.98  ? 51  ILE H N     1 
ATOM   5442  C  CA    . ILE H 4 24  ? -7.447  48.381 -41.757 1.00 50.65  ? 51  ILE H CA    1 
ATOM   5443  C  C     . ILE H 4 24  ? -8.327  47.098 -41.706 1.00 56.50  ? 51  ILE H C     1 
ATOM   5444  O  O     . ILE H 4 24  ? -9.291  47.005 -40.933 1.00 56.31  ? 51  ILE H O     1 
ATOM   5445  C  CB    . ILE H 4 24  ? -6.319  48.445 -40.675 1.00 51.93  ? 51  ILE H CB    1 
ATOM   5446  C  CG1   . ILE H 4 24  ? -5.160  47.466 -41.015 1.00 50.46  ? 51  ILE H CG1   1 
ATOM   5447  C  CG2   . ILE H 4 24  ? -6.856  48.268 -39.244 1.00 50.58  ? 51  ILE H CG2   1 
ATOM   5448  C  CD1   . ILE H 4 24  ? -3.986  47.520 -40.139 1.00 43.88  ? 51  ILE H CD1   1 
ATOM   5449  N  N     . SER H 4 25  ? -7.988  46.119 -42.577 1.00 53.41  ? 52  SER H N     1 
ATOM   5450  C  CA    . SER H 4 25  ? -8.681  44.839 -42.674 1.00 52.00  ? 52  SER H CA    1 
ATOM   5451  C  C     . SER H 4 25  ? -8.274  43.943 -41.510 1.00 56.21  ? 52  SER H C     1 
ATOM   5452  O  O     . SER H 4 25  ? -7.221  44.157 -40.908 1.00 56.43  ? 52  SER H O     1 
ATOM   5453  C  CB    . SER H 4 25  ? -8.408  44.185 -44.023 1.00 53.83  ? 52  SER H CB    1 
ATOM   5454  O  OG    . SER H 4 25  ? -7.245  43.369 -44.037 1.00 65.80  ? 52  SER H OG    1 
ATOM   5455  N  N     . SER H 4 26  ? -9.121  42.968 -41.171 1.00 54.53  ? 53  SER H N     1 
ATOM   5456  C  CA    . SER H 4 26  ? -8.892  41.991 -40.099 1.00 55.26  ? 53  SER H CA    1 
ATOM   5457  C  C     . SER H 4 26  ? -7.532  41.289 -40.267 1.00 57.18  ? 53  SER H C     1 
ATOM   5458  O  O     . SER H 4 26  ? -6.770  41.161 -39.294 1.00 57.45  ? 53  SER H O     1 
ATOM   5459  C  CB    . SER H 4 26  ? -10.011 40.960 -40.117 1.00 61.13  ? 53  SER H CB    1 
ATOM   5460  O  OG    . SER H 4 26  ? -9.949  40.184 -38.938 1.00 81.94  ? 53  SER H OG    1 
ATOM   5461  N  N     . LYS H 4 27  ? -7.233  40.874 -41.534 1.00 50.25  ? 54  LYS H N     1 
ATOM   5462  C  CA    . LYS H 4 27  ? -5.996  40.200 -41.919 1.00 48.22  ? 54  LYS H CA    1 
ATOM   5463  C  C     . LYS H 4 27  ? -4.822  41.126 -41.899 1.00 46.47  ? 54  LYS H C     1 
ATOM   5464  O  O     . LYS H 4 27  ? -3.773  40.745 -41.400 1.00 45.24  ? 54  LYS H O     1 
ATOM   5465  C  CB    . LYS H 4 27  ? -6.126  39.474 -43.263 1.00 50.82  ? 54  LYS H CB    1 
ATOM   5466  C  CG    . LYS H 4 27  ? -7.195  38.427 -43.216 1.00 55.99  ? 54  LYS H CG    1 
ATOM   5467  C  CD    . LYS H 4 27  ? -7.470  37.947 -44.608 1.00 66.39  ? 54  LYS H CD    1 
ATOM   5468  C  CE    . LYS H 4 27  ? -8.383  36.753 -44.642 1.00 68.89  ? 54  LYS H CE    1 
ATOM   5469  N  NZ    . LYS H 4 27  ? -9.596  37.058 -45.447 1.00 85.99  ? 54  LYS H NZ    1 
ATOM   5470  N  N     . ALA H 4 28  ? -4.983  42.346 -42.406 1.00 42.23  ? 55  ALA H N     1 
ATOM   5471  C  CA    . ALA H 4 28  ? -3.910  43.345 -42.400 1.00 41.34  ? 55  ALA H CA    1 
ATOM   5472  C  C     . ALA H 4 28  ? -3.496  43.684 -40.977 1.00 44.61  ? 55  ALA H C     1 
ATOM   5473  O  O     . ALA H 4 28  ? -2.317  43.831 -40.718 1.00 43.09  ? 55  ALA H O     1 
ATOM   5474  C  CB    . ALA H 4 28  ? -4.333  44.583 -43.147 1.00 41.78  ? 55  ALA H CB    1 
ATOM   5475  N  N     . MET H 4 29  ? -4.450  43.707 -40.047 1.00 44.43  ? 56  MET H N     1 
ATOM   5476  C  CA    . MET H 4 29  ? -4.181  43.926 -38.635 1.00 45.78  ? 56  MET H CA    1 
ATOM   5477  C  C     . MET H 4 29  ? -3.450  42.694 -38.075 1.00 50.55  ? 56  MET H C     1 
ATOM   5478  O  O     . MET H 4 29  ? -2.531  42.859 -37.271 1.00 53.03  ? 56  MET H O     1 
ATOM   5479  C  CB    . MET H 4 29  ? -5.488  44.204 -37.885 1.00 48.72  ? 56  MET H CB    1 
ATOM   5480  C  CG    . MET H 4 29  ? -5.321  44.395 -36.386 1.00 52.50  ? 56  MET H CG    1 
ATOM   5481  S  SD    . MET H 4 29  ? -4.274  45.760 -35.898 1.00 56.10  ? 56  MET H SD    1 
ATOM   5482  C  CE    . MET H 4 29  ? -5.406  47.142 -36.071 1.00 52.29  ? 56  MET H CE    1 
ATOM   5483  N  N     . GLY H 4 30  ? -3.838  41.491 -38.534 1.00 44.54  ? 57  GLY H N     1 
ATOM   5484  C  CA    . GLY H 4 30  ? -3.175  40.225 -38.201 1.00 40.80  ? 57  GLY H CA    1 
ATOM   5485  C  C     . GLY H 4 30  ? -1.683  40.324 -38.484 1.00 40.59  ? 57  GLY H C     1 
ATOM   5486  O  O     . GLY H 4 30  ? -0.868  40.160 -37.577 1.00 40.53  ? 57  GLY H O     1 
ATOM   5487  N  N     . ILE H 4 31  ? -1.327  40.755 -39.709 1.00 34.40  ? 58  ILE H N     1 
ATOM   5488  C  CA    . ILE H 4 31  ? 0.040   41.048 -40.155 1.00 31.44  ? 58  ILE H CA    1 
ATOM   5489  C  C     . ILE H 4 31  ? 0.718   42.128 -39.283 1.00 34.86  ? 58  ILE H C     1 
ATOM   5490  O  O     . ILE H 4 31  ? 1.898   42.009 -38.960 1.00 34.96  ? 58  ILE H O     1 
ATOM   5491  C  CB    . ILE H 4 31  ? 0.047   41.378 -41.675 1.00 32.92  ? 58  ILE H CB    1 
ATOM   5492  C  CG1   . ILE H 4 31  ? -0.132  40.074 -42.454 1.00 34.57  ? 58  ILE H CG1   1 
ATOM   5493  C  CG2   . ILE H 4 31  ? 1.341   42.068 -42.115 1.00 31.34  ? 58  ILE H CG2   1 
ATOM   5494  C  CD1   . ILE H 4 31  ? -1.082  40.154 -43.361 1.00 49.83  ? 58  ILE H CD1   1 
ATOM   5495  N  N     . MET H 4 32  ? -0.021  43.167 -38.887 1.00 31.08  ? 59  MET H N     1 
ATOM   5496  C  CA    . MET H 4 32  ? 0.551   44.224 -38.061 1.00 29.95  ? 59  MET H CA    1 
ATOM   5497  C  C     . MET H 4 32  ? 0.948   43.715 -36.672 1.00 35.48  ? 59  MET H C     1 
ATOM   5498  O  O     . MET H 4 32  ? 2.041   44.018 -36.208 1.00 35.98  ? 59  MET H O     1 
ATOM   5499  C  CB    . MET H 4 32  ? -0.348  45.455 -38.003 1.00 31.98  ? 59  MET H CB    1 
ATOM   5500  C  CG    . MET H 4 32  ? -0.397  46.281 -39.276 1.00 34.46  ? 59  MET H CG    1 
ATOM   5501  S  SD    . MET H 4 32  ? 1.181   46.733 -39.995 1.00 39.50  ? 59  MET H SD    1 
ATOM   5502  C  CE    . MET H 4 32  ? 1.827   47.916 -38.805 1.00 34.59  ? 59  MET H CE    1 
ATOM   5503  N  N     . ASN H 4 33  ? 0.102   42.875 -36.057 1.00 32.21  ? 60  ASN H N     1 
ATOM   5504  C  CA    . ASN H 4 33  ? 0.334   42.247 -34.757 1.00 31.65  ? 60  ASN H CA    1 
ATOM   5505  C  C     . ASN H 4 33  ? 1.505   41.248 -34.831 1.00 35.46  ? 60  ASN H C     1 
ATOM   5506  O  O     . ASN H 4 33  ? 2.347   41.207 -33.920 1.00 37.01  ? 60  ASN H O     1 
ATOM   5507  C  CB    . ASN H 4 33  ? -0.909  41.528 -34.306 1.00 33.31  ? 60  ASN H CB    1 
ATOM   5508  C  CG    . ASN H 4 33  ? -1.394  42.089 -33.012 1.00 64.25  ? 60  ASN H CG    1 
ATOM   5509  O  OD1   . ASN H 4 33  ? -0.848  41.817 -31.947 1.00 70.46  ? 60  ASN H OD1   1 
ATOM   5510  N  ND2   . ASN H 4 33  ? -2.428  42.897 -33.082 1.00 52.08  ? 60  ASN H ND2   1 
ATOM   5511  N  N     . SER H 4 34  ? 1.561   40.455 -35.924 1.00 26.27  ? 61  SER H N     1 
ATOM   5512  C  CA    . SER H 4 34  ? 2.653   39.545 -36.201 1.00 24.68  ? 61  SER H CA    1 
ATOM   5513  C  C     . SER H 4 34  ? 3.970   40.333 -36.293 1.00 29.90  ? 61  SER H C     1 
ATOM   5514  O  O     . SER H 4 34  ? 4.970   39.913 -35.715 1.00 30.82  ? 61  SER H O     1 
ATOM   5515  C  CB    . SER H 4 34  ? 2.377   38.759 -37.485 1.00 29.03  ? 61  SER H CB    1 
ATOM   5516  O  OG    . SER H 4 34  ? 1.246   37.905 -37.323 1.00 42.66  ? 61  SER H OG    1 
ATOM   5517  N  N     . PHE H 4 35  ? 3.936   41.538 -36.936 1.00 25.95  ? 62  PHE H N     1 
ATOM   5518  C  CA    . PHE H 4 35  ? 5.088   42.423 -37.119 1.00 23.46  ? 62  PHE H CA    1 
ATOM   5519  C  C     . PHE H 4 35  ? 5.616   42.941 -35.786 1.00 27.12  ? 62  PHE H C     1 
ATOM   5520  O  O     . PHE H 4 35  ? 6.814   42.862 -35.547 1.00 25.05  ? 62  PHE H O     1 
ATOM   5521  C  CB    . PHE H 4 35  ? 4.768   43.575 -38.114 1.00 23.07  ? 62  PHE H CB    1 
ATOM   5522  C  CG    . PHE H 4 35  ? 5.826   44.659 -38.146 1.00 23.51  ? 62  PHE H CG    1 
ATOM   5523  C  CD1   . PHE H 4 35  ? 7.077   44.423 -38.712 1.00 24.62  ? 62  PHE H CD1   1 
ATOM   5524  C  CD2   . PHE H 4 35  ? 5.584   45.914 -37.576 1.00 27.25  ? 62  PHE H CD2   1 
ATOM   5525  C  CE1   . PHE H 4 35  ? 8.070   45.404 -38.686 1.00 25.10  ? 62  PHE H CE1   1 
ATOM   5526  C  CE2   . PHE H 4 35  ? 6.577   46.901 -37.555 1.00 27.76  ? 62  PHE H CE2   1 
ATOM   5527  C  CZ    . PHE H 4 35  ? 7.807   46.644 -38.118 1.00 25.49  ? 62  PHE H CZ    1 
ATOM   5528  N  N     . VAL H 4 36  ? 4.720   43.458 -34.926 1.00 25.60  ? 63  VAL H N     1 
ATOM   5529  C  CA    . VAL H 4 36  ? 5.055   44.000 -33.601 1.00 26.59  ? 63  VAL H CA    1 
ATOM   5530  C  C     . VAL H 4 36  ? 5.676   42.939 -32.718 1.00 36.45  ? 63  VAL H C     1 
ATOM   5531  O  O     . VAL H 4 36  ? 6.652   43.223 -32.027 1.00 38.59  ? 63  VAL H O     1 
ATOM   5532  C  CB    . VAL H 4 36  ? 3.861   44.704 -32.901 1.00 30.12  ? 63  VAL H CB    1 
ATOM   5533  C  CG1   . VAL H 4 36  ? 4.336   45.453 -31.666 1.00 30.26  ? 63  VAL H CG1   1 
ATOM   5534  C  CG2   . VAL H 4 36  ? 3.172   45.675 -33.847 1.00 29.82  ? 63  VAL H CG2   1 
ATOM   5535  N  N     . ASN H 4 37  ? 5.131   41.703 -32.767 1.00 33.99  ? 64  ASN H N     1 
ATOM   5536  C  CA    . ASN H 4 37  ? 5.631   40.601 -31.968 1.00 33.46  ? 64  ASN H CA    1 
ATOM   5537  C  C     . ASN H 4 37  ? 6.992   40.110 -32.405 1.00 36.82  ? 64  ASN H C     1 
ATOM   5538  O  O     . ASN H 4 37  ? 7.802   39.725 -31.558 1.00 39.72  ? 64  ASN H O     1 
ATOM   5539  C  CB    . ASN H 4 37  ? 4.622   39.458 -31.907 1.00 24.68  ? 64  ASN H CB    1 
ATOM   5540  C  CG    . ASN H 4 37  ? 3.464   39.787 -31.006 1.00 56.24  ? 64  ASN H CG    1 
ATOM   5541  O  OD1   . ASN H 4 37  ? 3.612   40.363 -29.912 1.00 63.09  ? 64  ASN H OD1   1 
ATOM   5542  N  ND2   . ASN H 4 37  ? 2.282   39.436 -31.446 1.00 48.28  ? 64  ASN H ND2   1 
ATOM   5543  N  N     . ASP H 4 38  ? 7.233   40.091 -33.717 1.00 27.12  ? 65  ASP H N     1 
ATOM   5544  C  CA    . ASP H 4 38  ? 8.495   39.654 -34.276 1.00 23.48  ? 65  ASP H CA    1 
ATOM   5545  C  C     . ASP H 4 38  ? 9.621   40.610 -33.844 1.00 30.48  ? 65  ASP H C     1 
ATOM   5546  O  O     . ASP H 4 38  ? 10.621  40.171 -33.300 1.00 31.18  ? 65  ASP H O     1 
ATOM   5547  C  CB    . ASP H 4 38  ? 8.376   39.512 -35.794 1.00 22.67  ? 65  ASP H CB    1 
ATOM   5548  C  CG    . ASP H 4 38  ? 9.674   39.254 -36.518 1.00 36.93  ? 65  ASP H CG    1 
ATOM   5549  O  OD1   . ASP H 4 38  ? 10.591  38.661 -35.912 1.00 41.62  ? 65  ASP H OD1   1 
ATOM   5550  O  OD2   . ASP H 4 38  ? 9.771   39.620 -37.688 1.00 48.16  ? 65  ASP H OD2   1 
ATOM   5551  N  N     . ILE H 4 39  ? 9.439   41.906 -34.048 1.00 29.58  ? 66  ILE H N     1 
ATOM   5552  C  CA    . ILE H 4 39  ? 10.421  42.925 -33.709 1.00 29.56  ? 66  ILE H CA    1 
ATOM   5553  C  C     . ILE H 4 39  ? 10.579  43.043 -32.173 1.00 36.20  ? 66  ILE H C     1 
ATOM   5554  O  O     . ILE H 4 39  ? 11.689  43.235 -31.686 1.00 35.60  ? 66  ILE H O     1 
ATOM   5555  C  CB    . ILE H 4 39  ? 10.091  44.258 -34.435 1.00 31.28  ? 66  ILE H CB    1 
ATOM   5556  C  CG1   . ILE H 4 39  ? 9.863   44.052 -35.951 1.00 31.21  ? 66  ILE H CG1   1 
ATOM   5557  C  CG2   . ILE H 4 39  ? 11.137  45.290 -34.182 1.00 30.15  ? 66  ILE H CG2   1 
ATOM   5558  C  CD1   . ILE H 4 39  ? 10.992  43.496 -36.768 1.00 36.32  ? 66  ILE H CD1   1 
ATOM   5559  N  N     . PHE H 4 40  ? 9.503   42.849 -31.410 1.00 34.99  ? 67  PHE H N     1 
ATOM   5560  C  CA    . PHE H 4 40  ? 9.636   42.851 -29.964 1.00 36.10  ? 67  PHE H CA    1 
ATOM   5561  C  C     . PHE H 4 40  ? 10.656  41.754 -29.575 1.00 41.60  ? 67  PHE H C     1 
ATOM   5562  O  O     . PHE H 4 40  ? 11.630  42.077 -28.902 1.00 42.18  ? 67  PHE H O     1 
ATOM   5563  C  CB    . PHE H 4 40  ? 8.287   42.585 -29.282 1.00 39.14  ? 67  PHE H CB    1 
ATOM   5564  C  CG    . PHE H 4 40  ? 8.395   42.521 -27.772 1.00 41.83  ? 67  PHE H CG    1 
ATOM   5565  C  CD1   . PHE H 4 40  ? 8.854   41.362 -27.134 1.00 46.35  ? 67  PHE H CD1   1 
ATOM   5566  C  CD2   . PHE H 4 40  ? 7.996   43.594 -26.985 1.00 43.06  ? 67  PHE H CD2   1 
ATOM   5567  C  CE1   . PHE H 4 40  ? 8.973   41.308 -25.742 1.00 47.60  ? 67  PHE H CE1   1 
ATOM   5568  C  CE2   . PHE H 4 40  ? 8.065   43.518 -25.593 1.00 46.65  ? 67  PHE H CE2   1 
ATOM   5569  C  CZ    . PHE H 4 40  ? 8.604   42.396 -24.981 1.00 45.61  ? 67  PHE H CZ    1 
ATOM   5570  N  N     . GLU H 4 41  ? 10.440  40.473 -30.028 1.00 35.72  ? 68  GLU H N     1 
ATOM   5571  C  CA    . GLU H 4 41  ? 11.313  39.344 -29.748 1.00 33.71  ? 68  GLU H CA    1 
ATOM   5572  C  C     . GLU H 4 41  ? 12.703  39.511 -30.384 1.00 32.18  ? 68  GLU H C     1 
ATOM   5573  O  O     . GLU H 4 41  ? 13.667  39.162 -29.735 1.00 32.78  ? 68  GLU H O     1 
ATOM   5574  C  CB    . GLU H 4 41  ? 10.655  37.977 -30.066 1.00 36.27  ? 68  GLU H CB    1 
ATOM   5575  C  CG    . GLU H 4 41  ? 10.543  37.539 -31.529 1.00 54.26  ? 68  GLU H CG    1 
ATOM   5576  C  CD    . GLU H 4 41  ? 9.365   36.637 -31.896 1.00 82.97  ? 68  GLU H CD    1 
ATOM   5577  O  OE1   . GLU H 4 41  ? 9.301   36.206 -33.076 1.00 67.90  ? 68  GLU H OE1   1 
ATOM   5578  O  OE2   . GLU H 4 41  ? 8.499   36.378 -31.020 1.00 67.48  ? 68  GLU H OE2   1 
ATOM   5579  N  N     . ARG H 4 42  ? 12.841  40.091 -31.566 1.00 26.53  ? 69  ARG H N     1 
ATOM   5580  C  CA    . ARG H 4 42  ? 14.155  40.366 -32.146 1.00 27.06  ? 69  ARG H CA    1 
ATOM   5581  C  C     . ARG H 4 42  ? 14.975  41.348 -31.249 1.00 39.19  ? 69  ARG H C     1 
ATOM   5582  O  O     . ARG H 4 42  ? 16.128  41.061 -30.911 1.00 43.22  ? 69  ARG H O     1 
ATOM   5583  C  CB    . ARG H 4 42  ? 13.973  40.998 -33.500 1.00 22.22  ? 69  ARG H CB    1 
ATOM   5584  C  CG    . ARG H 4 42  ? 13.596  39.990 -34.546 1.00 18.74  ? 69  ARG H CG    1 
ATOM   5585  C  CD    . ARG H 4 42  ? 13.869  40.594 -35.890 1.00 37.79  ? 69  ARG H CD    1 
ATOM   5586  N  NE    . ARG H 4 42  ? 12.925  40.184 -36.930 1.00 28.10  ? 69  ARG H NE    1 
ATOM   5587  C  CZ    . ARG H 4 42  ? 13.034  40.584 -38.191 1.00 41.43  ? 69  ARG H CZ    1 
ATOM   5588  N  NH1   . ARG H 4 42  ? 14.036  41.369 -38.561 1.00 22.17  ? 69  ARG H NH1   1 
ATOM   5589  N  NH2   . ARG H 4 42  ? 12.155  40.187 -39.096 1.00 39.85  ? 69  ARG H NH2   1 
ATOM   5590  N  N     . ILE H 4 43  ? 14.364  42.460 -30.816 1.00 35.53  ? 70  ILE H N     1 
ATOM   5591  C  CA    . ILE H 4 43  ? 15.041  43.436 -29.969 1.00 35.96  ? 70  ILE H CA    1 
ATOM   5592  C  C     . ILE H 4 43  ? 15.259  42.890 -28.555 1.00 43.18  ? 70  ILE H C     1 
ATOM   5593  O  O     . ILE H 4 43  ? 16.383  42.935 -28.069 1.00 45.76  ? 70  ILE H O     1 
ATOM   5594  C  CB    . ILE H 4 43  ? 14.363  44.846 -29.986 1.00 38.80  ? 70  ILE H CB    1 
ATOM   5595  C  CG1   . ILE H 4 43  ? 14.267  45.434 -31.430 1.00 36.84  ? 70  ILE H CG1   1 
ATOM   5596  C  CG2   . ILE H 4 43  ? 15.067  45.843 -29.026 1.00 40.39  ? 70  ILE H CG2   1 
ATOM   5597  C  CD1   . ILE H 4 43  ? 13.288  46.532 -31.527 1.00 18.77  ? 70  ILE H CD1   1 
ATOM   5598  N  N     . ALA H 4 44  ? 14.217  42.329 -27.922 1.00 38.80  ? 71  ALA H N     1 
ATOM   5599  C  CA    . ALA H 4 44  ? 14.287  41.806 -26.560 1.00 37.26  ? 71  ALA H CA    1 
ATOM   5600  C  C     . ALA H 4 44  ? 15.322  40.706 -26.405 1.00 42.85  ? 71  ALA H C     1 
ATOM   5601  O  O     . ALA H 4 44  ? 16.022  40.673 -25.393 1.00 44.36  ? 71  ALA H O     1 
ATOM   5602  C  CB    . ALA H 4 44  ? 12.920  41.343 -26.106 1.00 37.54  ? 71  ALA H CB    1 
ATOM   5603  N  N     . GLY H 4 45  ? 15.448  39.858 -27.424 1.00 38.35  ? 72  GLY H N     1 
ATOM   5604  C  CA    . GLY H 4 45  ? 16.406  38.766 -27.463 1.00 38.02  ? 72  GLY H CA    1 
ATOM   5605  C  C     . GLY H 4 45  ? 17.825  39.268 -27.600 1.00 43.91  ? 72  GLY H C     1 
ATOM   5606  O  O     . GLY H 4 45  ? 18.714  38.801 -26.883 1.00 43.25  ? 72  GLY H O     1 
ATOM   5607  N  N     . GLU H 4 46  ? 18.046  40.242 -28.507 1.00 42.15  ? 73  GLU H N     1 
ATOM   5608  C  CA    . GLU H 4 46  ? 19.369  40.846 -28.738 1.00 42.53  ? 73  GLU H CA    1 
ATOM   5609  C  C     . GLU H 4 46  ? 19.880  41.564 -27.485 1.00 48.70  ? 73  GLU H C     1 
ATOM   5610  O  O     . GLU H 4 46  ? 21.057  41.440 -27.126 1.00 49.34  ? 73  GLU H O     1 
ATOM   5611  C  CB    . GLU H 4 46  ? 19.342  41.789 -29.950 1.00 43.33  ? 73  GLU H CB    1 
ATOM   5612  C  CG    . GLU H 4 46  ? 20.713  42.301 -30.380 1.00 50.99  ? 73  GLU H CG    1 
ATOM   5613  C  CD    . GLU H 4 46  ? 21.759  41.240 -30.667 1.00 67.23  ? 73  GLU H CD    1 
ATOM   5614  O  OE1   . GLU H 4 46  ? 22.726  41.139 -29.873 1.00 44.12  ? 73  GLU H OE1   1 
ATOM   5615  O  OE2   . GLU H 4 46  ? 21.604  40.504 -31.673 1.00 54.75  ? 73  GLU H OE2   1 
ATOM   5616  N  N     . ALA H 4 47  ? 18.973  42.284 -26.814 1.00 44.48  ? 74  ALA H N     1 
ATOM   5617  C  CA    . ALA H 4 47  ? 19.224  42.977 -25.569 1.00 44.24  ? 74  ALA H CA    1 
ATOM   5618  C  C     . ALA H 4 47  ? 19.488  41.978 -24.457 1.00 48.91  ? 74  ALA H C     1 
ATOM   5619  O  O     . ALA H 4 47  ? 20.304  42.256 -23.592 1.00 49.74  ? 74  ALA H O     1 
ATOM   5620  C  CB    . ALA H 4 47  ? 18.030  43.832 -25.216 1.00 45.56  ? 74  ALA H CB    1 
ATOM   5621  N  N     . SER H 4 48  ? 18.825  40.808 -24.496 1.00 45.54  ? 75  SER H N     1 
ATOM   5622  C  CA    . SER H 4 48  ? 18.994  39.741 -23.527 1.00 46.71  ? 75  SER H CA    1 
ATOM   5623  C  C     . SER H 4 48  ? 20.424  39.176 -23.564 1.00 52.88  ? 75  SER H C     1 
ATOM   5624  O  O     . SER H 4 48  ? 21.007  38.879 -22.509 1.00 52.70  ? 75  SER H O     1 
ATOM   5625  C  CB    . SER H 4 48  ? 17.968  38.640 -23.782 1.00 51.04  ? 75  SER H CB    1 
ATOM   5626  O  OG    . SER H 4 48  ? 18.250  37.444 -23.073 1.00 61.52  ? 75  SER H OG    1 
ATOM   5627  N  N     . ARG H 4 49  ? 20.969  39.031 -24.796 1.00 48.77  ? 76  ARG H N     1 
ATOM   5628  C  CA    . ARG H 4 49  ? 22.309  38.543 -25.103 1.00 47.00  ? 76  ARG H CA    1 
ATOM   5629  C  C     . ARG H 4 49  ? 23.339  39.586 -24.733 1.00 53.49  ? 76  ARG H C     1 
ATOM   5630  O  O     . ARG H 4 49  ? 24.380  39.215 -24.202 1.00 54.05  ? 76  ARG H O     1 
ATOM   5631  C  CB    . ARG H 4 49  ? 22.409  38.269 -26.590 1.00 41.40  ? 76  ARG H CB    1 
ATOM   5632  C  CG    . ARG H 4 49  ? 22.566  36.832 -26.894 1.00 51.20  ? 76  ARG H CG    1 
ATOM   5633  C  CD    . ARG H 4 49  ? 22.348  36.584 -28.355 1.00 60.60  ? 76  ARG H CD    1 
ATOM   5634  N  NE    . ARG H 4 49  ? 20.952  36.266 -28.636 1.00 58.76  ? 76  ARG H NE    1 
ATOM   5635  C  CZ    . ARG H 4 49  ? 20.237  36.870 -29.573 1.00 75.16  ? 76  ARG H CZ    1 
ATOM   5636  N  NH1   . ARG H 4 49  ? 20.778  37.832 -30.315 1.00 62.32  ? 76  ARG H NH1   1 
ATOM   5637  N  NH2   . ARG H 4 49  ? 18.975  36.511 -29.785 1.00 64.63  ? 76  ARG H NH2   1 
ATOM   5638  N  N     . LEU H 4 50  ? 23.066  40.888 -25.032 1.00 50.79  ? 77  LEU H N     1 
ATOM   5639  C  CA    . LEU H 4 50  ? 23.955  42.005 -24.722 1.00 50.75  ? 77  LEU H CA    1 
ATOM   5640  C  C     . LEU H 4 50  ? 24.239  42.058 -23.216 1.00 59.09  ? 77  LEU H C     1 
ATOM   5641  O  O     . LEU H 4 50  ? 25.401  42.079 -22.815 1.00 59.64  ? 77  LEU H O     1 
ATOM   5642  C  CB    . LEU H 4 50  ? 23.359  43.341 -25.207 1.00 50.22  ? 77  LEU H CB    1 
ATOM   5643  C  CG    . LEU H 4 50  ? 23.593  43.723 -26.668 1.00 53.32  ? 77  LEU H CG    1 
ATOM   5644  C  CD1   . LEU H 4 50  ? 22.590  44.749 -27.132 1.00 52.44  ? 77  LEU H CD1   1 
ATOM   5645  C  CD2   . LEU H 4 50  ? 24.966  44.281 -26.874 1.00 52.76  ? 77  LEU H CD2   1 
ATOM   5646  N  N     . ALA H 4 51  ? 23.179  42.005 -22.391 1.00 58.29  ? 78  ALA H N     1 
ATOM   5647  C  CA    . ALA H 4 51  ? 23.277  42.024 -20.940 1.00 59.42  ? 78  ALA H CA    1 
ATOM   5648  C  C     . ALA H 4 51  ? 24.056  40.808 -20.460 1.00 67.71  ? 78  ALA H C     1 
ATOM   5649  O  O     . ALA H 4 51  ? 24.956  40.954 -19.634 1.00 65.75  ? 78  ALA H O     1 
ATOM   5650  C  CB    . ALA H 4 51  ? 21.897  42.069 -20.328 1.00 60.10  ? 78  ALA H CB    1 
ATOM   5651  N  N     . HIS H 4 52  ? 23.782  39.631 -21.058 1.00 70.57  ? 79  HIS H N     1 
ATOM   5652  C  CA    . HIS H 4 52  ? 24.448  38.355 -20.789 1.00 73.02  ? 79  HIS H CA    1 
ATOM   5653  C  C     . HIS H 4 52  ? 25.948  38.429 -21.048 1.00 75.67  ? 79  HIS H C     1 
ATOM   5654  O  O     . HIS H 4 52  ? 26.723  38.073 -20.161 1.00 76.06  ? 79  HIS H O     1 
ATOM   5655  C  CB    . HIS H 4 52  ? 23.850  37.259 -21.666 1.00 76.00  ? 79  HIS H CB    1 
ATOM   5656  C  CG    . HIS H 4 52  ? 22.749  36.478 -21.021 1.00 82.01  ? 79  HIS H CG    1 
ATOM   5657  N  ND1   . HIS H 4 52  ? 21.512  36.320 -21.644 1.00 84.51  ? 79  HIS H ND1   1 
ATOM   5658  C  CD2   . HIS H 4 52  ? 22.747  35.783 -19.857 1.00 84.94  ? 79  HIS H CD2   1 
ATOM   5659  C  CE1   . HIS H 4 52  ? 20.796  35.567 -20.827 1.00 84.54  ? 79  HIS H CE1   1 
ATOM   5660  N  NE2   . HIS H 4 52  ? 21.510  35.195 -19.753 1.00 84.92  ? 79  HIS H NE2   1 
ATOM   5661  N  N     . TYR H 4 53  ? 26.354  38.899 -22.255 1.00 71.19  ? 80  TYR H N     1 
ATOM   5662  C  CA    . TYR H 4 53  ? 27.750  39.045 -22.689 1.00 70.92  ? 80  TYR H CA    1 
ATOM   5663  C  C     . TYR H 4 53  ? 28.537  39.882 -21.736 1.00 76.20  ? 80  TYR H C     1 
ATOM   5664  O  O     . TYR H 4 53  ? 29.683  39.554 -21.444 1.00 76.58  ? 80  TYR H O     1 
ATOM   5665  C  CB    . TYR H 4 53  ? 27.847  39.750 -24.049 1.00 72.12  ? 80  TYR H CB    1 
ATOM   5666  C  CG    . TYR H 4 53  ? 27.248  39.023 -25.229 1.00 74.82  ? 80  TYR H CG    1 
ATOM   5667  C  CD1   . TYR H 4 53  ? 27.137  37.630 -25.240 1.00 76.26  ? 80  TYR H CD1   1 
ATOM   5668  C  CD2   . TYR H 4 53  ? 26.841  39.720 -26.362 1.00 76.55  ? 80  TYR H CD2   1 
ATOM   5669  C  CE1   . TYR H 4 53  ? 26.607  36.954 -26.337 1.00 76.78  ? 80  TYR H CE1   1 
ATOM   5670  C  CE2   . TYR H 4 53  ? 26.322  39.054 -27.473 1.00 78.31  ? 80  TYR H CE2   1 
ATOM   5671  C  CZ    . TYR H 4 53  ? 26.209  37.671 -27.459 1.00 87.89  ? 80  TYR H CZ    1 
ATOM   5672  O  OH    . TYR H 4 53  ? 25.680  37.031 -28.564 1.00 92.11  ? 80  TYR H OH    1 
ATOM   5673  N  N     . ASN H 4 54  ? 27.921  40.982 -21.270 1.00 73.34  ? 81  ASN H N     1 
ATOM   5674  C  CA    . ASN H 4 54  ? 28.530  41.980 -20.409 1.00 73.72  ? 81  ASN H CA    1 
ATOM   5675  C  C     . ASN H 4 54  ? 28.327  41.689 -18.901 1.00 79.97  ? 81  ASN H C     1 
ATOM   5676  O  O     . ASN H 4 54  ? 28.604  42.551 -18.065 1.00 80.71  ? 81  ASN H O     1 
ATOM   5677  C  CB    . ASN H 4 54  ? 28.047  43.387 -20.836 1.00 70.08  ? 81  ASN H CB    1 
ATOM   5678  C  CG    . ASN H 4 54  ? 28.473  43.752 -22.255 1.00 89.13  ? 81  ASN H CG    1 
ATOM   5679  O  OD1   . ASN H 4 54  ? 29.655  43.917 -22.554 1.00 81.60  ? 81  ASN H OD1   1 
ATOM   5680  N  ND2   . ASN H 4 54  ? 27.534  43.876 -23.179 1.00 82.70  ? 81  ASN H ND2   1 
ATOM   5681  N  N     . LYS H 4 55  ? 27.923  40.451 -18.563 1.00 76.93  ? 82  LYS H N     1 
ATOM   5682  C  CA    . LYS H 4 55  ? 27.691  39.951 -17.198 1.00 76.89  ? 82  LYS H CA    1 
ATOM   5683  C  C     . LYS H 4 55  ? 26.796  40.897 -16.343 1.00 79.78  ? 82  LYS H C     1 
ATOM   5684  O  O     . LYS H 4 55  ? 27.068  41.170 -15.163 1.00 78.06  ? 82  LYS H O     1 
ATOM   5685  C  CB    . LYS H 4 55  ? 29.019  39.604 -16.506 1.00 79.75  ? 82  LYS H CB    1 
ATOM   5686  C  CG    . LYS H 4 55  ? 29.660  38.325 -17.043 1.00 98.67  ? 82  LYS H CG    1 
ATOM   5687  C  CD    . LYS H 4 55  ? 31.189  38.413 -17.068 1.00 110.48 ? 82  LYS H CD    1 
ATOM   5688  C  CE    . LYS H 4 55  ? 31.777  38.012 -18.414 1.00 124.11 ? 82  LYS H CE    1 
ATOM   5689  N  NZ    . LYS H 4 55  ? 31.598  39.065 -19.466 1.00 133.68 ? 82  LYS H NZ    1 
ATOM   5690  N  N     . ARG H 4 56  ? 25.697  41.353 -16.961 1.00 77.32  ? 83  ARG H N     1 
ATOM   5691  C  CA    . ARG H 4 56  ? 24.709  42.231 -16.337 1.00 77.81  ? 83  ARG H CA    1 
ATOM   5692  C  C     . ARG H 4 56  ? 23.347  41.543 -16.238 1.00 81.40  ? 83  ARG H C     1 
ATOM   5693  O  O     . ARG H 4 56  ? 22.900  40.937 -17.218 1.00 81.72  ? 83  ARG H O     1 
ATOM   5694  C  CB    . ARG H 4 56  ? 24.618  43.566 -17.085 1.00 79.26  ? 83  ARG H CB    1 
ATOM   5695  C  CG    . ARG H 4 56  ? 25.614  44.583 -16.539 1.00 98.54  ? 83  ARG H CG    1 
ATOM   5696  C  CD    . ARG H 4 56  ? 26.375  45.319 -17.625 1.00 112.44 ? 83  ARG H CD    1 
ATOM   5697  N  NE    . ARG H 4 56  ? 27.183  46.409 -17.071 1.00 120.60 ? 83  ARG H NE    1 
ATOM   5698  C  CZ    . ARG H 4 56  ? 28.453  46.290 -16.698 1.00 136.33 ? 83  ARG H CZ    1 
ATOM   5699  N  NH1   . ARG H 4 56  ? 29.079  45.122 -16.805 1.00 117.84 ? 83  ARG H NH1   1 
ATOM   5700  N  NH2   . ARG H 4 56  ? 29.109  47.337 -16.210 1.00 128.83 ? 83  ARG H NH2   1 
ATOM   5701  N  N     . SER H 4 57  ? 22.712  41.610 -15.034 1.00 75.87  ? 84  SER H N     1 
ATOM   5702  C  CA    . SER H 4 57  ? 21.404  41.012 -14.691 1.00 73.99  ? 84  SER H CA    1 
ATOM   5703  C  C     . SER H 4 57  ? 20.201  41.709 -15.337 1.00 74.95  ? 84  SER H C     1 
ATOM   5704  O  O     . SER H 4 57  ? 19.160  41.081 -15.562 1.00 74.51  ? 84  SER H O     1 
ATOM   5705  C  CB    . SER H 4 57  ? 21.207  41.019 -13.179 1.00 76.01  ? 84  SER H CB    1 
ATOM   5706  O  OG    . SER H 4 57  ? 22.232  40.265 -12.560 1.00 86.52  ? 84  SER H OG    1 
ATOM   5707  N  N     . THR H 4 58  ? 20.345  43.010 -15.606 1.00 68.68  ? 85  THR H N     1 
ATOM   5708  C  CA    . THR H 4 58  ? 19.275  43.847 -16.100 1.00 66.80  ? 85  THR H CA    1 
ATOM   5709  C  C     . THR H 4 58  ? 19.387  44.200 -17.567 1.00 66.28  ? 85  THR H C     1 
ATOM   5710  O  O     . THR H 4 58  ? 20.490  44.416 -18.073 1.00 66.40  ? 85  THR H O     1 
ATOM   5711  C  CB    . THR H 4 58  ? 19.254  45.161 -15.297 1.00 77.87  ? 85  THR H CB    1 
ATOM   5712  O  OG1   . THR H 4 58  ? 20.272  46.019 -15.820 1.00 84.47  ? 85  THR H OG1   1 
ATOM   5713  C  CG2   . THR H 4 58  ? 19.461  44.961 -13.774 1.00 74.78  ? 85  THR H CG2   1 
ATOM   5714  N  N     . ILE H 4 59  ? 18.222  44.329 -18.225 1.00 58.46  ? 86  ILE H N     1 
ATOM   5715  C  CA    . ILE H 4 59  ? 18.075  44.868 -19.570 1.00 55.66  ? 86  ILE H CA    1 
ATOM   5716  C  C     . ILE H 4 59  ? 17.604  46.289 -19.322 1.00 62.56  ? 86  ILE H C     1 
ATOM   5717  O  O     . ILE H 4 59  ? 16.534  46.493 -18.728 1.00 62.90  ? 86  ILE H O     1 
ATOM   5718  C  CB    . ILE H 4 59  ? 17.098  44.101 -20.482 1.00 56.39  ? 86  ILE H CB    1 
ATOM   5719  C  CG1   . ILE H 4 59  ? 17.727  42.776 -20.957 1.00 55.86  ? 86  ILE H CG1   1 
ATOM   5720  C  CG2   . ILE H 4 59  ? 16.698  44.958 -21.684 1.00 54.08  ? 86  ILE H CG2   1 
ATOM   5721  C  CD1   . ILE H 4 59  ? 16.762  41.808 -21.515 1.00 43.89  ? 86  ILE H CD1   1 
ATOM   5722  N  N     . THR H 4 60  ? 18.429  47.271 -19.736 1.00 59.52  ? 87  THR H N     1 
ATOM   5723  C  CA    . THR H 4 60  ? 18.131  48.697 -19.608 1.00 58.82  ? 87  THR H CA    1 
ATOM   5724  C  C     . THR H 4 60  ? 17.884  49.311 -20.993 1.00 61.27  ? 87  THR H C     1 
ATOM   5725  O  O     . THR H 4 60  ? 17.976  48.612 -22.011 1.00 61.57  ? 87  THR H O     1 
ATOM   5726  C  CB    . THR H 4 60  ? 19.220  49.420 -18.808 1.00 66.50  ? 87  THR H CB    1 
ATOM   5727  O  OG1   . THR H 4 60  ? 20.418  49.457 -19.581 1.00 63.45  ? 87  THR H OG1   1 
ATOM   5728  C  CG2   . THR H 4 60  ? 19.471  48.782 -17.443 1.00 68.35  ? 87  THR H CG2   1 
ATOM   5729  N  N     . SER H 4 61  ? 17.558  50.615 -21.031 1.00 54.76  ? 88  SER H N     1 
ATOM   5730  C  CA    . SER H 4 61  ? 17.322  51.325 -22.283 1.00 53.99  ? 88  SER H CA    1 
ATOM   5731  C  C     . SER H 4 61  ? 18.584  51.320 -23.150 1.00 56.01  ? 88  SER H C     1 
ATOM   5732  O  O     . SER H 4 61  ? 18.494  51.408 -24.375 1.00 55.61  ? 88  SER H O     1 
ATOM   5733  C  CB    . SER H 4 61  ? 16.859  52.747 -22.004 1.00 58.61  ? 88  SER H CB    1 
ATOM   5734  O  OG    . SER H 4 61  ? 17.233  53.163 -20.699 1.00 72.22  ? 88  SER H OG    1 
ATOM   5735  N  N     . ARG H 4 62  ? 19.749  51.141 -22.507 1.00 51.23  ? 89  ARG H N     1 
ATOM   5736  C  CA    . ARG H 4 62  ? 21.044  51.071 -23.160 1.00 50.86  ? 89  ARG H CA    1 
ATOM   5737  C  C     . ARG H 4 62  ? 21.177  49.773 -23.938 1.00 53.13  ? 89  ARG H C     1 
ATOM   5738  O  O     . ARG H 4 62  ? 21.768  49.786 -25.020 1.00 53.15  ? 89  ARG H O     1 
ATOM   5739  C  CB    . ARG H 4 62  ? 22.159  51.246 -22.125 1.00 54.06  ? 89  ARG H CB    1 
ATOM   5740  C  CG    . ARG H 4 62  ? 23.522  51.346 -22.747 1.00 69.44  ? 89  ARG H CG    1 
ATOM   5741  C  CD    . ARG H 4 62  ? 24.532  52.035 -21.856 1.00 81.62  ? 89  ARG H CD    1 
ATOM   5742  N  NE    . ARG H 4 62  ? 25.716  52.422 -22.632 1.00 86.78  ? 89  ARG H NE    1 
ATOM   5743  C  CZ    . ARG H 4 62  ? 26.714  51.598 -22.941 1.00 86.26  ? 89  ARG H CZ    1 
ATOM   5744  N  NH1   . ARG H 4 62  ? 26.698  50.338 -22.520 1.00 60.65  ? 89  ARG H NH1   1 
ATOM   5745  N  NH2   . ARG H 4 62  ? 27.736  52.030 -23.673 1.00 65.91  ? 89  ARG H NH2   1 
ATOM   5746  N  N     . GLU H 4 63  ? 20.612  48.656 -23.407 1.00 48.26  ? 90  GLU H N     1 
ATOM   5747  C  CA    . GLU H 4 63  ? 20.615  47.338 -24.079 1.00 45.97  ? 90  GLU H CA    1 
ATOM   5748  C  C     . GLU H 4 63  ? 19.648  47.372 -25.254 1.00 46.64  ? 90  GLU H C     1 
ATOM   5749  O  O     . GLU H 4 63  ? 20.003  46.904 -26.328 1.00 45.84  ? 90  GLU H O     1 
ATOM   5750  C  CB    . GLU H 4 63  ? 20.278  46.212 -23.104 1.00 46.90  ? 90  GLU H CB    1 
ATOM   5751  C  CG    . GLU H 4 63  ? 21.487  45.683 -22.347 1.00 58.56  ? 90  GLU H CG    1 
ATOM   5752  C  CD    . GLU H 4 63  ? 22.014  46.533 -21.198 1.00 76.74  ? 90  GLU H CD    1 
ATOM   5753  O  OE1   . GLU H 4 63  ? 21.539  46.374 -20.050 1.00 73.51  ? 90  GLU H OE1   1 
ATOM   5754  O  OE2   . GLU H 4 63  ? 22.870  47.406 -21.457 1.00 61.66  ? 90  GLU H OE2   1 
ATOM   5755  N  N     . ILE H 4 64  ? 18.461  48.010 -25.070 1.00 41.03  ? 91  ILE H N     1 
ATOM   5756  C  CA    . ILE H 4 64  ? 17.436  48.220 -26.105 1.00 39.04  ? 91  ILE H CA    1 
ATOM   5757  C  C     . ILE H 4 64  ? 18.049  49.043 -27.231 1.00 41.67  ? 91  ILE H C     1 
ATOM   5758  O  O     . ILE H 4 64  ? 17.919  48.665 -28.384 1.00 41.27  ? 91  ILE H O     1 
ATOM   5759  C  CB    . ILE H 4 64  ? 16.120  48.885 -25.545 1.00 40.73  ? 91  ILE H CB    1 
ATOM   5760  C  CG1   . ILE H 4 64  ? 15.517  48.103 -24.348 1.00 40.49  ? 91  ILE H CG1   1 
ATOM   5761  C  CG2   . ILE H 4 64  ? 15.064  49.082 -26.637 1.00 39.20  ? 91  ILE H CG2   1 
ATOM   5762  C  CD1   . ILE H 4 64  ? 14.999  46.619 -24.646 1.00 30.81  ? 91  ILE H CD1   1 
ATOM   5763  N  N     . GLN H 4 65  ? 18.774  50.108 -26.904 1.00 38.49  ? 92  GLN H N     1 
ATOM   5764  C  CA    . GLN H 4 65  ? 19.348  50.986 -27.913 1.00 38.26  ? 92  GLN H CA    1 
ATOM   5765  C  C     . GLN H 4 65  ? 20.396  50.339 -28.806 1.00 43.03  ? 92  GLN H C     1 
ATOM   5766  O  O     . GLN H 4 65  ? 20.326  50.519 -30.025 1.00 42.20  ? 92  GLN H O     1 
ATOM   5767  C  CB    . GLN H 4 65  ? 19.891  52.256 -27.292 1.00 39.69  ? 92  GLN H CB    1 
ATOM   5768  C  CG    . GLN H 4 65  ? 20.225  53.292 -28.344 1.00 46.50  ? 92  GLN H CG    1 
ATOM   5769  C  CD    . GLN H 4 65  ? 20.708  54.524 -27.710 1.00 55.92  ? 92  GLN H CD    1 
ATOM   5770  O  OE1   . GLN H 4 65  ? 19.940  55.301 -27.132 1.00 53.45  ? 92  GLN H OE1   1 
ATOM   5771  N  NE2   . GLN H 4 65  ? 22.002  54.702 -27.792 1.00 47.75  ? 92  GLN H NE2   1 
ATOM   5772  N  N     . THR H 4 66  ? 21.352  49.592 -28.238 1.00 41.65  ? 93  THR H N     1 
ATOM   5773  C  CA    . THR H 4 66  ? 22.360  48.977 -29.113 1.00 42.16  ? 93  THR H CA    1 
ATOM   5774  C  C     . THR H 4 66  ? 21.762  47.768 -29.872 1.00 45.75  ? 93  THR H C     1 
ATOM   5775  O  O     . THR H 4 66  ? 22.255  47.462 -30.956 1.00 47.30  ? 93  THR H O     1 
ATOM   5776  C  CB    . THR H 4 66  ? 23.718  48.702 -28.423 1.00 48.66  ? 93  THR H CB    1 
ATOM   5777  O  OG1   . THR H 4 66  ? 24.111  47.351 -28.543 1.00 53.23  ? 93  THR H OG1   1 
ATOM   5778  C  CG2   . THR H 4 66  ? 23.775  49.131 -27.006 1.00 43.89  ? 93  THR H CG2   1 
ATOM   5779  N  N     . ALA H 4 67  ? 20.676  47.150 -29.351 1.00 38.89  ? 94  ALA H N     1 
ATOM   5780  C  CA    . ALA H 4 67  ? 19.989  46.057 -30.029 1.00 37.17  ? 94  ALA H CA    1 
ATOM   5781  C  C     . ALA H 4 67  ? 19.353  46.622 -31.302 1.00 40.94  ? 94  ALA H C     1 
ATOM   5782  O  O     . ALA H 4 67  ? 19.483  46.013 -32.362 1.00 43.12  ? 94  ALA H O     1 
ATOM   5783  C  CB    . ALA H 4 67  ? 18.926  45.481 -29.125 1.00 37.59  ? 94  ALA H CB    1 
ATOM   5784  N  N     . VAL H 4 68  ? 18.728  47.825 -31.197 1.00 33.41  ? 95  VAL H N     1 
ATOM   5785  C  CA    . VAL H 4 68  ? 18.071  48.569 -32.277 1.00 31.23  ? 95  VAL H CA    1 
ATOM   5786  C  C     . VAL H 4 68  ? 19.133  48.909 -33.328 1.00 34.38  ? 95  VAL H C     1 
ATOM   5787  O  O     . VAL H 4 68  ? 18.927  48.706 -34.532 1.00 32.99  ? 95  VAL H O     1 
ATOM   5788  C  CB    . VAL H 4 68  ? 17.354  49.841 -31.703 1.00 33.90  ? 95  VAL H CB    1 
ATOM   5789  C  CG1   . VAL H 4 68  ? 16.986  50.837 -32.789 1.00 32.46  ? 95  VAL H CG1   1 
ATOM   5790  C  CG2   . VAL H 4 68  ? 16.115  49.468 -30.912 1.00 34.14  ? 95  VAL H CG2   1 
ATOM   5791  N  N     . ARG H 4 69  ? 20.280  49.399 -32.845 1.00 30.91  ? 96  ARG H N     1 
ATOM   5792  C  CA    . ARG H 4 69  ? 21.434  49.742 -33.657 1.00 30.86  ? 96  ARG H CA    1 
ATOM   5793  C  C     . ARG H 4 69  ? 21.934  48.520 -34.454 1.00 35.90  ? 96  ARG H C     1 
ATOM   5794  O  O     . ARG H 4 69  ? 22.383  48.671 -35.600 1.00 36.16  ? 96  ARG H O     1 
ATOM   5795  C  CB    . ARG H 4 69  ? 22.550  50.278 -32.757 1.00 31.46  ? 96  ARG H CB    1 
ATOM   5796  C  CG    . ARG H 4 69  ? 22.355  51.726 -32.386 1.00 45.96  ? 96  ARG H CG    1 
ATOM   5797  C  CD    . ARG H 4 69  ? 23.598  52.531 -32.636 1.00 67.63  ? 96  ARG H CD    1 
ATOM   5798  N  NE    . ARG H 4 69  ? 23.343  53.939 -32.369 1.00 88.01  ? 96  ARG H NE    1 
ATOM   5799  C  CZ    . ARG H 4 69  ? 23.366  54.480 -31.156 1.00 95.78  ? 96  ARG H CZ    1 
ATOM   5800  N  NH1   . ARG H 4 69  ? 23.616  53.723 -30.088 1.00 69.26  ? 96  ARG H NH1   1 
ATOM   5801  N  NH2   . ARG H 4 69  ? 23.151  55.781 -30.998 1.00 79.99  ? 96  ARG H NH2   1 
ATOM   5802  N  N     . LEU H 4 70  ? 21.839  47.316 -33.847 1.00 31.35  ? 97  LEU H N     1 
ATOM   5803  C  CA    . LEU H 4 70  ? 22.282  46.076 -34.478 1.00 30.65  ? 97  LEU H CA    1 
ATOM   5804  C  C     . LEU H 4 70  ? 21.250  45.509 -35.449 1.00 35.11  ? 97  LEU H C     1 
ATOM   5805  O  O     . LEU H 4 70  ? 21.634  44.972 -36.491 1.00 33.75  ? 97  LEU H O     1 
ATOM   5806  C  CB    . LEU H 4 70  ? 22.621  44.998 -33.433 1.00 30.06  ? 97  LEU H CB    1 
ATOM   5807  C  CG    . LEU H 4 70  ? 23.842  45.203 -32.568 1.00 34.55  ? 97  LEU H CG    1 
ATOM   5808  C  CD1   . LEU H 4 70  ? 23.783  44.306 -31.373 1.00 35.63  ? 97  LEU H CD1   1 
ATOM   5809  C  CD2   . LEU H 4 70  ? 25.130  44.954 -33.337 1.00 35.30  ? 97  LEU H CD2   1 
ATOM   5810  N  N     . LEU H 4 71  ? 19.977  45.593 -35.099 1.00 32.40  ? 98  LEU H N     1 
ATOM   5811  C  CA    . LEU H 4 71  ? 18.951  44.900 -35.911 1.00 32.86  ? 98  LEU H CA    1 
ATOM   5812  C  C     . LEU H 4 71  ? 18.322  45.764 -36.991 1.00 36.64  ? 98  LEU H C     1 
ATOM   5813  O  O     . LEU H 4 71  ? 17.962  45.206 -38.015 1.00 36.74  ? 98  LEU H O     1 
ATOM   5814  C  CB    . LEU H 4 71  ? 17.902  44.359 -34.945 1.00 33.66  ? 98  LEU H CB    1 
ATOM   5815  C  CG    . LEU H 4 71  ? 18.436  43.256 -34.044 1.00 39.89  ? 98  LEU H CG    1 
ATOM   5816  C  CD1   . LEU H 4 71  ? 17.844  43.337 -32.664 1.00 41.67  ? 98  LEU H CD1   1 
ATOM   5817  C  CD2   . LEU H 4 71  ? 18.180  41.907 -34.663 1.00 39.72  ? 98  LEU H CD2   1 
ATOM   5818  N  N     . LEU H 4 72  ? 18.198  47.064 -36.760 1.00 31.80  ? 99  LEU H N     1 
ATOM   5819  C  CA    . LEU H 4 72  ? 17.523  47.943 -37.738 1.00 29.37  ? 99  LEU H CA    1 
ATOM   5820  C  C     . LEU H 4 72  ? 18.504  48.404 -38.806 1.00 36.13  ? 99  LEU H C     1 
ATOM   5821  O  O     . LEU H 4 72  ? 19.678  48.500 -38.518 1.00 37.91  ? 99  LEU H O     1 
ATOM   5822  C  CB    . LEU H 4 72  ? 16.969  49.147 -36.985 1.00 28.33  ? 99  LEU H CB    1 
ATOM   5823  C  CG    . LEU H 4 72  ? 15.705  48.912 -36.176 1.00 30.25  ? 99  LEU H CG    1 
ATOM   5824  C  CD1   . LEU H 4 72  ? 14.741  50.051 -36.367 1.00 28.06  ? 99  LEU H CD1   1 
ATOM   5825  C  CD2   . LEU H 4 72  ? 15.055  47.616 -36.573 1.00 31.93  ? 99  LEU H CD2   1 
ATOM   5826  N  N     . PRO H 4 73  ? 18.086  48.678 -40.157 1.00 33.39  ? 100 PRO H N     1 
ATOM   5827  C  CA    . PRO H 4 73  ? 18.744  49.299 -41.577 1.00 34.30  ? 100 PRO H CA    1 
ATOM   5828  C  C     . PRO H 4 73  ? 19.268  50.560 -40.885 1.00 45.21  ? 100 PRO H C     1 
ATOM   5829  O  O     . PRO H 4 73  ? 18.774  50.885 -39.849 1.00 46.73  ? 100 PRO H O     1 
ATOM   5830  C  CB    . PRO H 4 73  ? 17.614  49.163 -42.572 1.00 35.39  ? 100 PRO H CB    1 
ATOM   5831  C  CG    . PRO H 4 73  ? 16.919  47.969 -42.055 1.00 39.04  ? 100 PRO H CG    1 
ATOM   5832  C  CD    . PRO H 4 73  ? 16.760  48.320 -40.602 1.00 34.67  ? 100 PRO H CD    1 
ATOM   5833  N  N     . GLY H 4 74  ? 20.295  51.170 -41.465 1.00 43.44  ? 101 GLY H N     1 
ATOM   5834  C  CA    . GLY H 4 74  ? 20.895  52.458 -41.078 1.00 43.63  ? 101 GLY H CA    1 
ATOM   5835  C  C     . GLY H 4 74  ? 19.952  53.581 -40.690 1.00 51.83  ? 101 GLY H C     1 
ATOM   5836  O  O     . GLY H 4 74  ? 20.061  54.040 -39.564 1.00 53.84  ? 101 GLY H O     1 
ATOM   5837  N  N     . GLU H 4 75  ? 19.055  53.998 -41.579 1.00 47.61  ? 102 GLU H N     1 
ATOM   5838  C  CA    . GLU H 4 75  ? 18.204  55.186 -41.324 1.00 46.76  ? 102 GLU H CA    1 
ATOM   5839  C  C     . GLU H 4 75  ? 16.996  54.893 -40.447 1.00 48.58  ? 102 GLU H C     1 
ATOM   5840  O  O     . GLU H 4 75  ? 16.500  55.819 -39.849 1.00 48.21  ? 102 GLU H O     1 
ATOM   5841  C  CB    . GLU H 4 75  ? 17.788  55.798 -42.651 1.00 48.98  ? 102 GLU H CB    1 
ATOM   5842  C  CG    . GLU H 4 75  ? 18.873  56.670 -43.239 1.00 66.49  ? 102 GLU H CG    1 
ATOM   5843  C  CD    . GLU H 4 75  ? 18.816  58.086 -42.709 1.00 96.74  ? 102 GLU H CD    1 
ATOM   5844  O  OE1   . GLU H 4 75  ? 19.878  58.648 -42.433 1.00 101.48 ? 102 GLU H OE1   1 
ATOM   5845  O  OE2   . GLU H 4 75  ? 17.704  58.605 -42.559 1.00 97.52  ? 102 GLU H OE2   1 
ATOM   5846  N  N     . LEU H 4 76  ? 16.512  53.659 -40.423 1.00 44.46  ? 103 LEU H N     1 
ATOM   5847  C  CA    . LEU H 4 76  ? 15.361  53.298 -39.565 1.00 42.84  ? 103 LEU H CA    1 
ATOM   5848  C  C     . LEU H 4 76  ? 15.886  53.279 -38.142 1.00 47.83  ? 103 LEU H C     1 
ATOM   5849  O  O     . LEU H 4 76  ? 15.200  53.707 -37.240 1.00 47.19  ? 103 LEU H O     1 
ATOM   5850  C  CB    . LEU H 4 76  ? 14.939  51.888 -39.958 1.00 41.81  ? 103 LEU H CB    1 
ATOM   5851  C  CG    . LEU H 4 76  ? 13.568  51.732 -40.593 1.00 45.59  ? 103 LEU H CG    1 
ATOM   5852  C  CD1   . LEU H 4 76  ? 13.398  52.706 -41.734 1.00 45.43  ? 103 LEU H CD1   1 
ATOM   5853  C  CD2   . LEU H 4 76  ? 13.414  50.313 -41.086 1.00 50.60  ? 103 LEU H CD2   1 
ATOM   5854  N  N     . ALA H 4 77  ? 17.089  52.752 -37.995 1.00 44.84  ? 104 ALA H N     1 
ATOM   5855  C  CA    . ALA H 4 77  ? 17.785  52.646 -36.724 1.00 44.71  ? 104 ALA H CA    1 
ATOM   5856  C  C     . ALA H 4 77  ? 18.045  54.036 -36.161 1.00 51.11  ? 104 ALA H C     1 
ATOM   5857  O  O     . ALA H 4 77  ? 17.871  54.253 -34.963 1.00 51.99  ? 104 ALA H O     1 
ATOM   5858  C  CB    . ALA H 4 77  ? 19.092  51.919 -36.928 1.00 45.40  ? 104 ALA H CB    1 
ATOM   5859  N  N     . LYS H 4 78  ? 18.422  54.983 -37.043 1.00 47.65  ? 105 LYS H N     1 
ATOM   5860  C  CA    . LYS H 4 78  ? 18.735  56.379 -36.749 1.00 46.31  ? 105 LYS H CA    1 
ATOM   5861  C  C     . LYS H 4 78  ? 17.531  57.059 -36.132 1.00 50.18  ? 105 LYS H C     1 
ATOM   5862  O  O     . LYS H 4 78  ? 17.665  57.745 -35.129 1.00 51.75  ? 105 LYS H O     1 
ATOM   5863  C  CB    . LYS H 4 78  ? 19.121  57.085 -38.057 1.00 48.45  ? 105 LYS H CB    1 
ATOM   5864  C  CG    . LYS H 4 78  ? 20.224  58.116 -37.958 1.00 68.16  ? 105 LYS H CG    1 
ATOM   5865  C  CD    . LYS H 4 78  ? 20.347  58.880 -39.288 1.00 81.01  ? 105 LYS H CD    1 
ATOM   5866  C  CE    . LYS H 4 78  ? 21.666  59.601 -39.453 1.00 102.30 ? 105 LYS H CE    1 
ATOM   5867  N  NZ    . LYS H 4 78  ? 22.559  59.000 -40.511 1.00 111.88 ? 105 LYS H NZ    1 
ATOM   5868  N  N     . HIS H 4 79  ? 16.362  56.858 -36.718 1.00 46.20  ? 106 HIS H N     1 
ATOM   5869  C  CA    . HIS H 4 79  ? 15.131  57.464 -36.262 1.00 46.38  ? 106 HIS H CA    1 
ATOM   5870  C  C     . HIS H 4 79  ? 14.542  56.780 -35.060 1.00 47.75  ? 106 HIS H C     1 
ATOM   5871  O  O     . HIS H 4 79  ? 13.967  57.471 -34.221 1.00 47.57  ? 106 HIS H O     1 
ATOM   5872  C  CB    . HIS H 4 79  ? 14.112  57.528 -37.393 1.00 48.62  ? 106 HIS H CB    1 
ATOM   5873  C  CG    . HIS H 4 79  ? 14.497  58.435 -38.527 1.00 53.69  ? 106 HIS H CG    1 
ATOM   5874  N  ND1   . HIS H 4 79  ? 14.644  57.952 -39.812 1.00 56.47  ? 106 HIS H ND1   1 
ATOM   5875  C  CD2   . HIS H 4 79  ? 14.727  59.768 -38.536 1.00 57.78  ? 106 HIS H CD2   1 
ATOM   5876  C  CE1   . HIS H 4 79  ? 14.957  58.989 -40.564 1.00 56.80  ? 106 HIS H CE1   1 
ATOM   5877  N  NE2   . HIS H 4 79  ? 15.023  60.109 -39.840 1.00 58.00  ? 106 HIS H NE2   1 
ATOM   5878  N  N     . ALA H 4 80  ? 14.649  55.423 -34.978 1.00 42.48  ? 107 ALA H N     1 
ATOM   5879  C  CA    . ALA H 4 80  ? 14.133  54.635 -33.860 1.00 40.10  ? 107 ALA H CA    1 
ATOM   5880  C  C     . ALA H 4 80  ? 14.878  55.002 -32.557 1.00 44.04  ? 107 ALA H C     1 
ATOM   5881  O  O     . ALA H 4 80  ? 14.246  55.203 -31.519 1.00 41.68  ? 107 ALA H O     1 
ATOM   5882  C  CB    . ALA H 4 80  ? 14.261  53.175 -34.166 1.00 40.53  ? 107 ALA H CB    1 
ATOM   5883  N  N     . VAL H 4 81  ? 16.211  55.189 -32.647 1.00 42.58  ? 108 VAL H N     1 
ATOM   5884  C  CA    . VAL H 4 81  ? 17.076  55.618 -31.544 1.00 42.24  ? 108 VAL H CA    1 
ATOM   5885  C  C     . VAL H 4 81  ? 16.693  57.042 -31.090 1.00 50.31  ? 108 VAL H C     1 
ATOM   5886  O  O     . VAL H 4 81  ? 16.640  57.324 -29.888 1.00 50.26  ? 108 VAL H O     1 
ATOM   5887  C  CB    . VAL H 4 81  ? 18.563  55.452 -31.929 1.00 44.62  ? 108 VAL H CB    1 
ATOM   5888  C  CG1   . VAL H 4 81  ? 19.470  56.296 -31.056 1.00 43.71  ? 108 VAL H CG1   1 
ATOM   5889  C  CG2   . VAL H 4 81  ? 18.973  53.981 -31.857 1.00 44.25  ? 108 VAL H CG2   1 
ATOM   5890  N  N     . SER H 4 82  ? 16.344  57.911 -32.054 1.00 48.58  ? 109 SER H N     1 
ATOM   5891  C  CA    . SER H 4 82  ? 15.871  59.258 -31.773 1.00 49.28  ? 109 SER H CA    1 
ATOM   5892  C  C     . SER H 4 82  ? 14.514  59.176 -31.044 1.00 53.64  ? 109 SER H C     1 
ATOM   5893  O  O     . SER H 4 82  ? 14.390  59.632 -29.916 1.00 55.33  ? 109 SER H O     1 
ATOM   5894  C  CB    . SER H 4 82  ? 15.799  60.083 -33.059 1.00 54.04  ? 109 SER H CB    1 
ATOM   5895  O  OG    . SER H 4 82  ? 14.725  61.013 -33.073 1.00 64.25  ? 109 SER H OG    1 
ATOM   5896  N  N     . GLU H 4 83  ? 13.544  58.525 -31.666 1.00 49.94  ? 110 GLU H N     1 
ATOM   5897  C  CA    . GLU H 4 83  ? 12.207  58.292 -31.136 1.00 49.55  ? 110 GLU H CA    1 
ATOM   5898  C  C     . GLU H 4 83  ? 12.209  57.718 -29.711 1.00 50.52  ? 110 GLU H C     1 
ATOM   5899  O  O     . GLU H 4 83  ? 11.445  58.200 -28.860 1.00 50.38  ? 110 GLU H O     1 
ATOM   5900  C  CB    . GLU H 4 83  ? 11.434  57.385 -32.102 1.00 50.88  ? 110 GLU H CB    1 
ATOM   5901  C  CG    . GLU H 4 83  ? 10.584  58.157 -33.096 1.00 68.03  ? 110 GLU H CG    1 
ATOM   5902  C  CD    . GLU H 4 83  ? 9.229   58.524 -32.523 1.00 103.88 ? 110 GLU H CD    1 
ATOM   5903  O  OE1   . GLU H 4 83  ? 8.264   57.743 -32.715 1.00 84.27  ? 110 GLU H OE1   1 
ATOM   5904  O  OE2   . GLU H 4 83  ? 9.144   59.583 -31.855 1.00 111.24 ? 110 GLU H OE2   1 
ATOM   5905  N  N     . GLY H 4 84  ? 13.097  56.743 -29.483 1.00 44.21  ? 111 GLY H N     1 
ATOM   5906  C  CA    . GLY H 4 84  ? 13.306  56.064 -28.217 1.00 43.73  ? 111 GLY H CA    1 
ATOM   5907  C  C     . GLY H 4 84  ? 13.890  56.951 -27.145 1.00 51.62  ? 111 GLY H C     1 
ATOM   5908  O  O     . GLY H 4 84  ? 13.309  57.033 -26.057 1.00 52.01  ? 111 GLY H O     1 
ATOM   5909  N  N     . THR H 4 85  ? 15.025  57.659 -27.456 1.00 48.85  ? 112 THR H N     1 
ATOM   5910  C  CA    . THR H 4 85  ? 15.714  58.565 -26.526 1.00 49.46  ? 112 THR H CA    1 
ATOM   5911  C  C     . THR H 4 85  ? 14.798  59.690 -26.071 1.00 54.41  ? 112 THR H C     1 
ATOM   5912  O  O     . THR H 4 85  ? 14.863  60.109 -24.926 1.00 53.62  ? 112 THR H O     1 
ATOM   5913  C  CB    . THR H 4 85  ? 17.043  59.108 -27.090 1.00 67.74  ? 112 THR H CB    1 
ATOM   5914  O  OG1   . THR H 4 85  ? 16.869  59.634 -28.389 1.00 83.51  ? 112 THR H OG1   1 
ATOM   5915  C  CG2   . THR H 4 85  ? 18.176  58.087 -27.080 1.00 65.02  ? 112 THR H CG2   1 
ATOM   5916  N  N     . LYS H 4 86  ? 13.941  60.157 -26.984 1.00 52.87  ? 113 LYS H N     1 
ATOM   5917  C  CA    . LYS H 4 86  ? 12.924  61.185 -26.811 1.00 53.23  ? 113 LYS H CA    1 
ATOM   5918  C  C     . LYS H 4 86  ? 11.904  60.708 -25.750 1.00 59.98  ? 113 LYS H C     1 
ATOM   5919  O  O     . LYS H 4 86  ? 11.673  61.419 -24.765 1.00 59.13  ? 113 LYS H O     1 
ATOM   5920  C  CB    . LYS H 4 86  ? 12.242  61.411 -28.176 1.00 55.51  ? 113 LYS H CB    1 
ATOM   5921  C  CG    . LYS H 4 86  ? 11.430  62.670 -28.361 1.00 65.20  ? 113 LYS H CG    1 
ATOM   5922  C  CD    . LYS H 4 86  ? 10.888  62.700 -29.797 1.00 79.34  ? 113 LYS H CD    1 
ATOM   5923  C  CE    . LYS H 4 86  ? 10.058  63.923 -30.098 1.00 89.65  ? 113 LYS H CE    1 
ATOM   5924  N  NZ    . LYS H 4 86  ? 9.162   63.660 -31.248 1.00 97.65  ? 113 LYS H NZ    1 
ATOM   5925  N  N     . ALA H 4 87  ? 11.349  59.482 -25.930 1.00 57.95  ? 114 ALA H N     1 
ATOM   5926  C  CA    . ALA H 4 87  ? 10.359  58.876 -25.028 1.00 58.16  ? 114 ALA H CA    1 
ATOM   5927  C  C     . ALA H 4 87  ? 10.876  58.723 -23.595 1.00 62.83  ? 114 ALA H C     1 
ATOM   5928  O  O     . ALA H 4 87  ? 10.148  59.027 -22.645 1.00 60.55  ? 114 ALA H O     1 
ATOM   5929  C  CB    . ALA H 4 87  ? 9.903   57.525 -25.573 1.00 58.33  ? 114 ALA H CB    1 
ATOM   5930  N  N     . VAL H 4 88  ? 12.134  58.269 -23.453 1.00 62.08  ? 115 VAL H N     1 
ATOM   5931  C  CA    . VAL H 4 88  ? 12.775  58.015 -22.161 1.00 62.91  ? 115 VAL H CA    1 
ATOM   5932  C  C     . VAL H 4 88  ? 12.954  59.315 -21.410 1.00 69.62  ? 115 VAL H C     1 
ATOM   5933  O  O     . VAL H 4 88  ? 12.532  59.406 -20.257 1.00 71.32  ? 115 VAL H O     1 
ATOM   5934  C  CB    . VAL H 4 88  ? 14.078  57.170 -22.293 1.00 66.58  ? 115 VAL H CB    1 
ATOM   5935  C  CG1   . VAL H 4 88  ? 14.770  56.998 -20.945 1.00 66.36  ? 115 VAL H CG1   1 
ATOM   5936  C  CG2   . VAL H 4 88  ? 13.785  55.804 -22.911 1.00 66.14  ? 115 VAL H CG2   1 
ATOM   5937  N  N     . THR H 4 89  ? 13.508  60.336 -22.092 1.00 65.98  ? 116 THR H N     1 
ATOM   5938  C  CA    . THR H 4 89  ? 13.732  61.688 -21.601 1.00 64.65  ? 116 THR H CA    1 
ATOM   5939  C  C     . THR H 4 89  ? 12.416  62.292 -21.085 1.00 70.42  ? 116 THR H C     1 
ATOM   5940  O  O     . THR H 4 89  ? 12.394  62.867 -19.990 1.00 71.07  ? 116 THR H O     1 
ATOM   5941  C  CB    . THR H 4 89  ? 14.362  62.520 -22.737 1.00 69.05  ? 116 THR H CB    1 
ATOM   5942  O  OG1   . THR H 4 89  ? 15.626  61.978 -23.080 1.00 71.87  ? 116 THR H OG1   1 
ATOM   5943  C  CG2   . THR H 4 89  ? 14.566  63.935 -22.373 1.00 66.52  ? 116 THR H CG2   1 
ATOM   5944  N  N     . LYS H 4 90  ? 11.330  62.173 -21.885 1.00 67.39  ? 117 LYS H N     1 
ATOM   5945  C  CA    . LYS H 4 90  ? 9.991   62.690 -21.565 1.00 67.39  ? 117 LYS H CA    1 
ATOM   5946  C  C     . LYS H 4 90  ? 9.436   61.991 -20.314 1.00 74.79  ? 117 LYS H C     1 
ATOM   5947  O  O     . LYS H 4 90  ? 8.908   62.673 -19.419 1.00 74.21  ? 117 LYS H O     1 
ATOM   5948  C  CB    . LYS H 4 90  ? 9.046   62.544 -22.781 1.00 67.67  ? 117 LYS H CB    1 
ATOM   5949  C  CG    . LYS H 4 90  ? 7.633   63.071 -22.548 1.00 70.27  ? 117 LYS H CG    1 
ATOM   5950  C  CD    . LYS H 4 90  ? 6.963   63.543 -23.832 1.00 73.17  ? 117 LYS H CD    1 
ATOM   5951  C  CE    . LYS H 4 90  ? 5.498   63.910 -23.670 1.00 82.42  ? 117 LYS H CE    1 
ATOM   5952  N  NZ    . LYS H 4 90  ? 5.261   65.018 -22.696 1.00 93.30  ? 117 LYS H NZ    1 
ATOM   5953  N  N     . TYR H 4 91  ? 9.603   60.638 -20.251 1.00 72.89  ? 118 TYR H N     1 
ATOM   5954  C  CA    . TYR H 4 91  ? 9.205   59.751 -19.150 1.00 73.48  ? 118 TYR H CA    1 
ATOM   5955  C  C     . TYR H 4 91  ? 9.926   60.128 -17.840 1.00 81.13  ? 118 TYR H C     1 
ATOM   5956  O  O     . TYR H 4 91  ? 9.278   60.236 -16.792 1.00 80.72  ? 118 TYR H O     1 
ATOM   5957  C  CB    . TYR H 4 91  ? 9.465   58.277 -19.534 1.00 74.69  ? 118 TYR H CB    1 
ATOM   5958  C  CG    . TYR H 4 91  ? 9.074   57.295 -18.453 1.00 76.28  ? 118 TYR H CG    1 
ATOM   5959  C  CD1   . TYR H 4 91  ? 7.748   56.912 -18.279 1.00 78.54  ? 118 TYR H CD1   1 
ATOM   5960  C  CD2   . TYR H 4 91  ? 10.023  56.773 -17.577 1.00 76.34  ? 118 TYR H CD2   1 
ATOM   5961  C  CE1   . TYR H 4 91  ? 7.370   56.057 -17.247 1.00 79.79  ? 118 TYR H CE1   1 
ATOM   5962  C  CE2   . TYR H 4 91  ? 9.655   55.944 -16.520 1.00 77.05  ? 118 TYR H CE2   1 
ATOM   5963  C  CZ    . TYR H 4 91  ? 8.327   55.575 -16.367 1.00 88.13  ? 118 TYR H CZ    1 
ATOM   5964  O  OH    . TYR H 4 91  ? 7.959   54.727 -15.346 1.00 94.42  ? 118 TYR H OH    1 
ATOM   5965  N  N     . THR H 4 92  ? 11.265  60.342 -17.911 1.00 81.09  ? 119 THR H N     1 
ATOM   5966  C  CA    . THR H 4 92  ? 12.125  60.766 -16.790 1.00 82.42  ? 119 THR H CA    1 
ATOM   5967  C  C     . THR H 4 92  ? 11.690  62.181 -16.301 1.00 91.77  ? 119 THR H C     1 
ATOM   5968  O  O     . THR H 4 92  ? 11.879  62.517 -15.128 1.00 92.98  ? 119 THR H O     1 
ATOM   5969  C  CB    . THR H 4 92  ? 13.623  60.712 -17.195 1.00 84.35  ? 119 THR H CB    1 
ATOM   5970  O  OG1   . THR H 4 92  ? 13.915  59.513 -17.914 1.00 75.67  ? 119 THR H OG1   1 
ATOM   5971  C  CG2   . THR H 4 92  ? 14.559  60.813 -15.999 1.00 84.17  ? 119 THR H CG2   1 
ATOM   5972  N  N     . SER H 4 93  ? 11.106  62.997 -17.205 1.00 90.80  ? 120 SER H N     1 
ATOM   5973  C  CA    . SER H 4 93  ? 10.592  64.326 -16.873 1.00 92.24  ? 120 SER H CA    1 
ATOM   5974  C  C     . SER H 4 93  ? 9.279   64.193 -16.079 1.00 98.03  ? 120 SER H C     1 
ATOM   5975  O  O     . SER H 4 93  ? 9.108   64.878 -15.063 1.00 98.69  ? 120 SER H O     1 
ATOM   5976  C  CB    . SER H 4 93  ? 10.369  65.161 -18.133 1.00 96.62  ? 120 SER H CB    1 
ATOM   5977  O  OG    . SER H 4 93  ? 11.578  65.416 -18.830 1.00 107.87 ? 120 SER H OG    1 
ATOM   5978  N  N     . ALA H 4 94  ? 8.375   63.281 -16.517 1.00 94.31  ? 121 ALA H N     1 
ATOM   5979  C  CA    . ALA H 4 94  ? 7.079   63.052 -15.883 1.00 121.18 ? 121 ALA H CA    1 
ATOM   5980  C  C     . ALA H 4 94  ? 7.111   61.963 -14.815 1.00 149.96 ? 121 ALA H C     1 
ATOM   5981  O  O     . ALA H 4 94  ? 7.134   62.300 -13.628 1.00 108.33 ? 121 ALA H O     1 
ATOM   5982  C  CB    . ALA H 4 94  ? 6.026   62.746 -16.935 1.00 121.86 ? 121 ALA H CB    1 
ATOM   5983  O  "O5'" . DA  I 5 1   ? 48.954  4.883  -74.351 1.00 248.05 ? -72 DA  I "O5'" 1 
ATOM   5984  C  "C5'" . DA  I 5 1   ? 49.261  3.521  -74.635 1.00 248.22 ? -72 DA  I "C5'" 1 
ATOM   5985  C  "C4'" . DA  I 5 1   ? 49.989  3.387  -75.967 1.00 248.52 ? -72 DA  I "C4'" 1 
ATOM   5986  O  "O4'" . DA  I 5 1   ? 49.358  4.235  -76.964 1.00 248.66 ? -72 DA  I "O4'" 1 
ATOM   5987  C  "C3'" . DA  I 5 1   ? 51.473  3.775  -75.948 1.00 248.73 ? -72 DA  I "C3'" 1 
ATOM   5988  O  "O3'" . DA  I 5 1   ? 52.257  2.792  -76.655 1.00 248.85 ? -72 DA  I "O3'" 1 
ATOM   5989  C  "C2'" . DA  I 5 1   ? 51.496  5.128  -76.659 1.00 248.81 ? -72 DA  I "C2'" 1 
ATOM   5990  C  "C1'" . DA  I 5 1   ? 50.347  4.974  -77.647 1.00 248.91 ? -72 DA  I "C1'" 1 
ATOM   5991  N  N9    . DA  I 5 1   ? 49.772  6.251  -78.089 1.00 249.29 ? -72 DA  I N9    1 
ATOM   5992  C  C8    . DA  I 5 1   ? 48.512  6.726  -77.825 1.00 249.46 ? -72 DA  I C8    1 
ATOM   5993  N  N7    . DA  I 5 1   ? 48.262  7.903  -78.352 1.00 249.56 ? -72 DA  I N7    1 
ATOM   5994  C  C5    . DA  I 5 1   ? 49.435  8.229  -79.015 1.00 249.57 ? -72 DA  I C5    1 
ATOM   5995  C  C6    . DA  I 5 1   ? 49.818  9.361  -79.778 1.00 249.58 ? -72 DA  I C6    1 
ATOM   5996  N  N6    . DA  I 5 1   ? 49.012  10.407 -79.993 1.00 249.53 ? -72 DA  I N6    1 
ATOM   5997  N  N1    . DA  I 5 1   ? 51.071  9.374  -80.308 1.00 249.57 ? -72 DA  I N1    1 
ATOM   5998  C  C2    . DA  I 5 1   ? 51.883  8.324  -80.081 1.00 249.52 ? -72 DA  I C2    1 
ATOM   5999  N  N3    . DA  I 5 1   ? 51.633  7.204  -79.389 1.00 249.48 ? -72 DA  I N3    1 
ATOM   6000  C  C4    . DA  I 5 1   ? 50.378  7.218  -78.875 1.00 249.48 ? -72 DA  I C4    1 
ATOM   6001  P  P     . DT  I 5 2   ? 53.787  2.498  -76.242 1.00 248.94 ? -71 DT  I P     1 
ATOM   6002  O  OP1   . DT  I 5 2   ? 53.928  1.036  -76.052 1.00 248.96 ? -71 DT  I OP1   1 
ATOM   6003  O  OP2   . DT  I 5 2   ? 54.167  3.421  -75.144 1.00 249.11 ? -71 DT  I OP2   1 
ATOM   6004  O  "O5'" . DT  I 5 2   ? 54.611  2.931  -77.549 1.00 248.63 ? -71 DT  I "O5'" 1 
ATOM   6005  C  "C5'" . DT  I 5 2   ? 56.033  2.756  -77.589 1.00 248.32 ? -71 DT  I "C5'" 1 
ATOM   6006  C  "C4'" . DT  I 5 2   ? 56.756  4.084  -77.784 1.00 248.15 ? -71 DT  I "C4'" 1 
ATOM   6007  O  "O4'" . DT  I 5 2   ? 55.816  5.185  -77.682 1.00 248.17 ? -71 DT  I "O4'" 1 
ATOM   6008  C  "C3'" . DT  I 5 2   ? 57.866  4.375  -76.762 1.00 248.08 ? -71 DT  I "C3'" 1 
ATOM   6009  O  "O3'" . DT  I 5 2   ? 59.123  4.562  -77.426 1.00 248.02 ? -71 DT  I "O3'" 1 
ATOM   6010  C  "C2'" . DT  I 5 2   ? 57.406  5.656  -76.057 1.00 248.11 ? -71 DT  I "C2'" 1 
ATOM   6011  C  "C1'" . DT  I 5 2   ? 56.470  6.272  -77.085 1.00 248.15 ? -71 DT  I "C1'" 1 
ATOM   6012  N  N1    . DT  I 5 2   ? 55.440  7.224  -76.496 1.00 248.14 ? -71 DT  I N1    1 
ATOM   6013  C  C2    . DT  I 5 2   ? 55.248  8.471  -77.081 1.00 248.15 ? -71 DT  I C2    1 
ATOM   6014  O  O2    . DT  I 5 2   ? 55.828  8.844  -78.088 1.00 248.22 ? -71 DT  I O2    1 
ATOM   6015  N  N3    . DT  I 5 2   ? 54.331  9.272  -76.441 1.00 248.10 ? -71 DT  I N3    1 
ATOM   6016  C  C4    . DT  I 5 2   ? 53.607  8.971  -75.295 1.00 248.07 ? -71 DT  I C4    1 
ATOM   6017  O  O4    . DT  I 5 2   ? 52.821  9.802  -74.848 1.00 248.06 ? -71 DT  I O4    1 
ATOM   6018  C  C5    . DT  I 5 2   ? 53.867  7.660  -74.719 1.00 248.06 ? -71 DT  I C5    1 
ATOM   6019  C  C7    . DT  I 5 2   ? 53.147  7.216  -73.477 1.00 248.03 ? -71 DT  I C7    1 
ATOM   6020  C  C6    . DT  I 5 2   ? 54.758  6.863  -75.338 1.00 248.09 ? -71 DT  I C6    1 
ATOM   6021  P  P     . DC  I 5 3   ? 60.510  4.542  -76.604 1.00 247.90 ? -70 DC  I P     1 
ATOM   6022  O  OP1   . DC  I 5 3   ? 61.556  4.005  -77.506 1.00 247.92 ? -70 DC  I OP1   1 
ATOM   6023  O  OP2   . DC  I 5 3   ? 60.272  3.893  -75.290 1.00 247.91 ? -70 DC  I OP2   1 
ATOM   6024  O  "O5'" . DC  I 5 3   ? 60.793  6.103  -76.335 1.00 247.60 ? -70 DC  I "O5'" 1 
ATOM   6025  C  "C5'" . DC  I 5 3   ? 61.672  6.849  -77.197 1.00 247.24 ? -70 DC  I "C5'" 1 
ATOM   6026  C  "C4'" . DC  I 5 3   ? 61.245  8.307  -77.297 1.00 246.87 ? -70 DC  I "C4'" 1 
ATOM   6027  O  "O4'" . DC  I 5 3   ? 59.829  8.413  -77.049 1.00 246.85 ? -70 DC  I "O4'" 1 
ATOM   6028  C  "C3'" . DC  I 5 3   ? 61.889  9.242  -76.286 1.00 246.55 ? -70 DC  I "C3'" 1 
ATOM   6029  O  "O3'" . DC  I 5 3   ? 63.147  9.731  -76.800 1.00 246.06 ? -70 DC  I "O3'" 1 
ATOM   6030  C  "C2'" . DC  I 5 3   ? 60.858  10.372 -76.159 1.00 246.72 ? -70 DC  I "C2'" 1 
ATOM   6031  C  "C1'" . DC  I 5 3   ? 59.533  9.705  -76.562 1.00 246.82 ? -70 DC  I "C1'" 1 
ATOM   6032  N  N1    . DC  I 5 3   ? 58.512  9.599  -75.434 1.00 246.82 ? -70 DC  I N1    1 
ATOM   6033  C  C2    . DC  I 5 3   ? 57.389  10.462 -75.416 1.00 246.76 ? -70 DC  I C2    1 
ATOM   6034  O  O2    . DC  I 5 3   ? 57.238  11.292 -76.325 1.00 246.67 ? -70 DC  I O2    1 
ATOM   6035  N  N3    . DC  I 5 3   ? 56.480  10.337 -74.406 1.00 246.80 ? -70 DC  I N3    1 
ATOM   6036  C  C4    . DC  I 5 3   ? 56.664  9.426  -73.439 1.00 246.79 ? -70 DC  I C4    1 
ATOM   6037  N  N4    . DC  I 5 3   ? 55.749  9.355  -72.466 1.00 246.78 ? -70 DC  I N4    1 
ATOM   6038  C  C5    . DC  I 5 3   ? 57.797  8.550  -73.430 1.00 246.81 ? -70 DC  I C5    1 
ATOM   6039  C  C6    . DC  I 5 3   ? 58.690  8.674  -74.429 1.00 246.83 ? -70 DC  I C6    1 
ATOM   6040  P  P     . DT  I 5 4   ? 64.330  10.198 -75.809 1.00 245.70 ? -69 DT  I P     1 
ATOM   6041  O  OP1   . DT  I 5 4   ? 65.512  10.530 -76.636 1.00 245.61 ? -69 DT  I OP1   1 
ATOM   6042  O  OP2   . DT  I 5 4   ? 64.452  9.196  -74.723 1.00 245.68 ? -69 DT  I OP2   1 
ATOM   6043  O  "O5'" . DT  I 5 4   ? 63.755  11.549 -75.172 1.00 245.69 ? -69 DT  I "O5'" 1 
ATOM   6044  C  "C5'" . DT  I 5 4   ? 64.580  12.386 -74.349 1.00 245.59 ? -69 DT  I "C5'" 1 
ATOM   6045  C  "C4'" . DT  I 5 4   ? 63.841  13.675 -73.982 1.00 245.34 ? -69 DT  I "C4'" 1 
ATOM   6046  O  "O4'" . DT  I 5 4   ? 62.426  13.396 -73.792 1.00 245.31 ? -69 DT  I "O4'" 1 
ATOM   6047  C  "C3'" . DT  I 5 4   ? 64.315  14.386 -72.711 1.00 244.95 ? -69 DT  I "C3'" 1 
ATOM   6048  O  "O3'" . DT  I 5 4   ? 64.313  15.820 -72.918 1.00 244.40 ? -69 DT  I "O3'" 1 
ATOM   6049  C  "C2'" . DT  I 5 4   ? 63.291  13.949 -71.659 1.00 245.09 ? -69 DT  I "C2'" 1 
ATOM   6050  C  "C1'" . DT  I 5 4   ? 62.020  13.757 -72.487 1.00 245.23 ? -69 DT  I "C1'" 1 
ATOM   6051  N  N1    . DT  I 5 4   ? 61.091  12.681 -71.950 1.00 245.25 ? -69 DT  I N1    1 
ATOM   6052  C  C2    . DT  I 5 4   ? 59.870  13.048 -71.399 1.00 245.20 ? -69 DT  I C2    1 
ATOM   6053  O  O2    . DT  I 5 4   ? 59.485  14.205 -71.325 1.00 245.07 ? -69 DT  I O2    1 
ATOM   6054  N  N3    . DT  I 5 4   ? 59.111  11.998 -70.933 1.00 245.25 ? -69 DT  I N3    1 
ATOM   6055  C  C4    . DT  I 5 4   ? 59.433  10.646 -70.964 1.00 245.26 ? -69 DT  I C4    1 
ATOM   6056  O  O4    . DT  I 5 4   ? 58.638  9.828  -70.505 1.00 245.28 ? -69 DT  I O4    1 
ATOM   6057  C  C5    . DT  I 5 4   ? 60.726  10.326 -71.555 1.00 245.22 ? -69 DT  I C5    1 
ATOM   6058  C  C7    . DT  I 5 4   ? 61.194  8.901  -71.646 1.00 245.16 ? -69 DT  I C7    1 
ATOM   6059  C  C6    . DT  I 5 4   ? 61.480  11.344 -72.013 1.00 245.25 ? -69 DT  I C6    1 
ATOM   6060  P  P     . DT  I 5 5   ? 64.923  16.838 -71.825 1.00 243.94 ? -68 DT  I P     1 
ATOM   6061  O  OP1   . DT  I 5 5   ? 65.416  18.033 -72.548 1.00 243.78 ? -68 DT  I OP1   1 
ATOM   6062  O  OP2   . DT  I 5 5   ? 65.839  16.092 -70.929 1.00 243.74 ? -68 DT  I OP2   1 
ATOM   6063  O  "O5'" . DT  I 5 5   ? 63.631  17.248 -70.971 1.00 244.27 ? -68 DT  I "O5'" 1 
ATOM   6064  C  "C5'" . DT  I 5 5   ? 62.494  17.847 -71.619 1.00 244.47 ? -68 DT  I "C5'" 1 
ATOM   6065  C  "C4'" . DT  I 5 5   ? 61.299  17.936 -70.680 1.00 244.48 ? -68 DT  I "C4'" 1 
ATOM   6066  O  "O4'" . DT  I 5 5   ? 60.861  16.609 -70.313 1.00 244.52 ? -68 DT  I "O4'" 1 
ATOM   6067  C  "C3'" . DT  I 5 5   ? 61.548  18.690 -69.364 1.00 244.37 ? -68 DT  I "C3'" 1 
ATOM   6068  O  "O3'" . DT  I 5 5   ? 60.712  19.859 -69.300 1.00 244.13 ? -68 DT  I "O3'" 1 
ATOM   6069  C  "C2'" . DT  I 5 5   ? 61.192  17.666 -68.268 1.00 244.57 ? -68 DT  I "C2'" 1 
ATOM   6070  C  "C1'" . DT  I 5 5   ? 60.318  16.671 -69.024 1.00 244.79 ? -68 DT  I "C1'" 1 
ATOM   6071  N  N1    . DT  I 5 5   ? 60.268  15.266 -68.415 1.00 245.26 ? -68 DT  I N1    1 
ATOM   6072  C  C2    . DT  I 5 5   ? 59.146  14.876 -67.684 1.00 245.61 ? -68 DT  I C2    1 
ATOM   6073  O  O2    . DT  I 5 5   ? 58.181  15.601 -67.483 1.00 245.79 ? -68 DT  I O2    1 
ATOM   6074  N  N3    . DT  I 5 5   ? 59.196  13.591 -67.192 1.00 245.64 ? -68 DT  I N3    1 
ATOM   6075  C  C4    . DT  I 5 5   ? 60.225  12.672 -67.337 1.00 245.58 ? -68 DT  I C4    1 
ATOM   6076  O  O4    . DT  I 5 5   ? 60.114  11.559 -66.824 1.00 245.59 ? -68 DT  I O4    1 
ATOM   6077  C  C5    . DT  I 5 5   ? 61.368  13.135 -68.109 1.00 245.46 ? -68 DT  I C5    1 
ATOM   6078  C  C7    . DT  I 5 5   ? 62.545  12.229 -68.340 1.00 245.44 ? -68 DT  I C7    1 
ATOM   6079  C  C6    . DT  I 5 5   ? 61.340  14.396 -68.593 1.00 245.34 ? -68 DT  I C6    1 
ATOM   6080  P  P     . DA  I 5 6   ? 61.337  21.324 -69.046 1.00 243.84 ? -67 DA  I P     1 
ATOM   6081  O  OP1   . DA  I 5 6   ? 60.916  22.196 -70.168 1.00 243.85 ? -67 DA  I OP1   1 
ATOM   6082  O  OP2   . DA  I 5 6   ? 62.779  21.180 -68.731 1.00 243.81 ? -67 DA  I OP2   1 
ATOM   6083  O  "O5'" . DA  I 5 6   ? 60.588  21.809 -67.714 1.00 243.61 ? -67 DA  I "O5'" 1 
ATOM   6084  C  "C5'" . DA  I 5 6   ? 60.842  21.162 -66.472 1.00 243.44 ? -67 DA  I "C5'" 1 
ATOM   6085  C  "C4'" . DA  I 5 6   ? 59.541  20.799 -65.784 1.00 243.33 ? -67 DA  I "C4'" 1 
ATOM   6086  O  "O4'" . DA  I 5 6   ? 59.327  19.369 -65.872 1.00 243.42 ? -67 DA  I "O4'" 1 
ATOM   6087  C  "C3'" . DA  I 5 6   ? 59.471  21.164 -64.302 1.00 243.18 ? -67 DA  I "C3'" 1 
ATOM   6088  O  "O3'" . DA  I 5 6   ? 58.312  21.967 -64.053 1.00 242.87 ? -67 DA  I "O3'" 1 
ATOM   6089  C  "C2'" . DA  I 5 6   ? 59.408  19.813 -63.577 1.00 243.36 ? -67 DA  I "C2'" 1 
ATOM   6090  C  "C1'" . DA  I 5 6   ? 58.848  18.882 -64.643 1.00 243.57 ? -67 DA  I "C1'" 1 
ATOM   6091  N  N9    . DA  I 5 6   ? 59.288  17.489 -64.493 1.00 244.00 ? -67 DA  I N9    1 
ATOM   6092  C  C8    . DA  I 5 6   ? 60.578  17.019 -64.542 1.00 244.19 ? -67 DA  I C8    1 
ATOM   6093  N  N7    . DA  I 5 6   ? 60.681  15.720 -64.371 1.00 244.28 ? -67 DA  I N7    1 
ATOM   6094  C  C5    . DA  I 5 6   ? 59.371  15.300 -64.203 1.00 244.28 ? -67 DA  I C5    1 
ATOM   6095  C  C6    . DA  I 5 6   ? 58.796  14.021 -63.978 1.00 244.22 ? -67 DA  I C6    1 
ATOM   6096  N  N6    . DA  I 5 6   ? 59.516  12.896 -63.893 1.00 244.14 ? -67 DA  I N6    1 
ATOM   6097  N  N1    . DA  I 5 6   ? 57.444  13.947 -63.858 1.00 244.23 ? -67 DA  I N1    1 
ATOM   6098  C  C2    . DA  I 5 6   ? 56.721  15.080 -63.948 1.00 244.26 ? -67 DA  I C2    1 
ATOM   6099  N  N3    . DA  I 5 6   ? 57.146  16.336 -64.153 1.00 244.25 ? -67 DA  I N3    1 
ATOM   6100  C  C4    . DA  I 5 6   ? 58.494  16.380 -64.271 1.00 244.20 ? -67 DA  I C4    1 
ATOM   6101  P  P     . DG  I 5 7   ? 58.186  22.857 -62.717 1.00 242.49 ? -66 DG  I P     1 
ATOM   6102  O  OP1   . DG  I 5 7   ? 57.293  24.001 -63.016 1.00 242.51 ? -66 DG  I OP1   1 
ATOM   6103  O  OP2   . DG  I 5 7   ? 59.547  23.111 -62.186 1.00 242.47 ? -66 DG  I OP2   1 
ATOM   6104  O  "O5'" . DG  I 5 7   ? 57.442  21.863 -61.701 1.00 242.21 ? -66 DG  I "O5'" 1 
ATOM   6105  C  "C5'" . DG  I 5 7   ? 56.117  21.380 -61.994 1.00 241.92 ? -66 DG  I "C5'" 1 
ATOM   6106  C  "C4'" . DG  I 5 7   ? 55.718  20.237 -61.066 1.00 241.56 ? -66 DG  I "C4'" 1 
ATOM   6107  O  "O4'" . DG  I 5 7   ? 56.593  19.099 -61.277 1.00 241.64 ? -66 DG  I "O4'" 1 
ATOM   6108  C  "C3'" . DG  I 5 7   ? 55.775  20.551 -59.564 1.00 241.12 ? -66 DG  I "C3'" 1 
ATOM   6109  O  "O3'" . DG  I 5 7   ? 54.588  20.077 -58.916 1.00 240.31 ? -66 DG  I "O3'" 1 
ATOM   6110  C  "C2'" . DG  I 5 7   ? 57.015  19.788 -59.093 1.00 241.42 ? -66 DG  I "C2'" 1 
ATOM   6111  C  "C1'" . DG  I 5 7   ? 56.990  18.590 -60.028 1.00 241.81 ? -66 DG  I "C1'" 1 
ATOM   6112  N  N9    . DG  I 5 7   ? 58.273  17.899 -60.184 1.00 242.45 ? -66 DG  I N9    1 
ATOM   6113  C  C8    . DG  I 5 7   ? 59.534  18.459 -60.242 1.00 242.61 ? -66 DG  I C8    1 
ATOM   6114  N  N7    . DG  I 5 7   ? 60.488  17.583 -60.415 1.00 242.69 ? -66 DG  I N7    1 
ATOM   6115  C  C5    . DG  I 5 7   ? 59.823  16.365 -60.485 1.00 242.82 ? -66 DG  I C5    1 
ATOM   6116  C  C6    . DG  I 5 7   ? 60.332  15.045 -60.664 1.00 242.92 ? -66 DG  I C6    1 
ATOM   6117  O  O6    . DG  I 5 7   ? 61.514  14.689 -60.796 1.00 242.78 ? -66 DG  I O6    1 
ATOM   6118  N  N1    . DG  I 5 7   ? 59.305  14.087 -60.682 1.00 243.09 ? -66 DG  I N1    1 
ATOM   6119  C  C2    . DG  I 5 7   ? 57.954  14.373 -60.543 1.00 243.09 ? -66 DG  I C2    1 
ATOM   6120  N  N2    . DG  I 5 7   ? 57.111  13.331 -60.584 1.00 243.09 ? -66 DG  I N2    1 
ATOM   6121  N  N3    . DG  I 5 7   ? 57.470  15.601 -60.368 1.00 242.96 ? -66 DG  I N3    1 
ATOM   6122  C  C4    . DG  I 5 7   ? 58.455  16.545 -60.350 1.00 242.79 ? -66 DG  I C4    1 
ATOM   6123  P  P     . DG  I 5 8   ? 53.841  20.986 -57.824 1.00 239.46 ? -65 DG  I P     1 
ATOM   6124  O  OP1   . DG  I 5 8   ? 53.003  21.968 -58.546 1.00 239.35 ? -65 DG  I OP1   1 
ATOM   6125  O  OP2   . DG  I 5 8   ? 54.851  21.457 -56.847 1.00 239.40 ? -65 DG  I OP2   1 
ATOM   6126  O  "O5'" . DG  I 5 8   ? 52.882  19.952 -57.062 1.00 238.90 ? -65 DG  I "O5'" 1 
ATOM   6127  C  "C5'" . DG  I 5 8   ? 52.403  18.770 -57.711 1.00 238.42 ? -65 DG  I "C5'" 1 
ATOM   6128  C  "C4'" . DG  I 5 8   ? 52.849  17.520 -56.964 1.00 238.03 ? -65 DG  I "C4'" 1 
ATOM   6129  O  "O4'" . DG  I 5 8   ? 54.221  17.211 -57.320 1.00 238.07 ? -65 DG  I "O4'" 1 
ATOM   6130  C  "C3'" . DG  I 5 8   ? 52.816  17.617 -55.427 1.00 237.74 ? -65 DG  I "C3'" 1 
ATOM   6131  O  "O3'" . DG  I 5 8   ? 52.102  16.508 -54.868 1.00 237.45 ? -65 DG  I "O3'" 1 
ATOM   6132  C  "C2'" . DG  I 5 8   ? 54.295  17.591 -55.030 1.00 237.84 ? -65 DG  I "C2'" 1 
ATOM   6133  C  "C1'" . DG  I 5 8   ? 54.895  16.781 -56.168 1.00 238.05 ? -65 DG  I "C1'" 1 
ATOM   6134  N  N9    . DG  I 5 8   ? 56.342  16.959 -56.351 1.00 238.12 ? -65 DG  I N9    1 
ATOM   6135  C  C8    . DG  I 5 8   ? 57.074  18.114 -56.174 1.00 238.05 ? -65 DG  I C8    1 
ATOM   6136  N  N7    . DG  I 5 8   ? 58.353  17.960 -56.377 1.00 238.04 ? -65 DG  I N7    1 
ATOM   6137  C  C5    . DG  I 5 8   ? 58.493  16.606 -56.657 1.00 238.19 ? -65 DG  I C5    1 
ATOM   6138  C  C6    . DG  I 5 8   ? 59.661  15.840 -56.942 1.00 238.32 ? -65 DG  I C6    1 
ATOM   6139  O  O6    . DG  I 5 8   ? 60.836  16.228 -57.008 1.00 238.38 ? -65 DG  I O6    1 
ATOM   6140  N  N1    . DG  I 5 8   ? 59.359  14.491 -57.170 1.00 238.32 ? -65 DG  I N1    1 
ATOM   6141  C  C2    . DG  I 5 8   ? 58.088  13.951 -57.135 1.00 238.29 ? -65 DG  I C2    1 
ATOM   6142  N  N2    . DG  I 5 8   ? 57.995  12.636 -57.370 1.00 238.29 ? -65 DG  I N2    1 
ATOM   6143  N  N3    . DG  I 5 8   ? 56.989  14.654 -56.866 1.00 238.24 ? -65 DG  I N3    1 
ATOM   6144  C  C4    . DG  I 5 8   ? 57.264  15.972 -56.638 1.00 238.20 ? -65 DG  I C4    1 
ATOM   6145  P  P     . DG  I 5 9   ? 51.252  16.679 -53.512 1.00 237.33 ? -64 DG  I P     1 
ATOM   6146  O  OP1   . DG  I 5 9   ? 49.824  16.821 -53.882 1.00 237.38 ? -64 DG  I OP1   1 
ATOM   6147  O  OP2   . DG  I 5 9   ? 51.900  17.719 -52.675 1.00 237.43 ? -64 DG  I OP2   1 
ATOM   6148  O  "O5'" . DG  I 5 9   ? 51.462  15.275 -52.774 1.00 236.99 ? -64 DG  I "O5'" 1 
ATOM   6149  C  "C5'" . DG  I 5 9   ? 51.044  14.062 -53.395 1.00 236.78 ? -64 DG  I "C5'" 1 
ATOM   6150  C  "C4'" . DG  I 5 9   ? 52.140  13.010 -53.315 1.00 236.58 ? -64 DG  I "C4'" 1 
ATOM   6151  O  "O4'" . DG  I 5 9   ? 53.411  13.596 -53.694 1.00 236.59 ? -64 DG  I "O4'" 1 
ATOM   6152  C  "C3'" . DG  I 5 9   ? 52.351  12.379 -51.932 1.00 236.30 ? -64 DG  I "C3'" 1 
ATOM   6153  O  "O3'" . DG  I 5 9   ? 52.416  10.955 -52.056 1.00 235.97 ? -64 DG  I "O3'" 1 
ATOM   6154  C  "C2'" . DG  I 5 9   ? 53.683  12.971 -51.461 1.00 236.38 ? -64 DG  I "C2'" 1 
ATOM   6155  C  "C1'" . DG  I 5 9   ? 54.399  13.192 -52.781 1.00 236.55 ? -64 DG  I "C1'" 1 
ATOM   6156  N  N9    . DG  I 5 9   ? 55.446  14.213 -52.736 1.00 236.72 ? -64 DG  I N9    1 
ATOM   6157  C  C8    . DG  I 5 9   ? 55.327  15.525 -52.326 1.00 236.79 ? -64 DG  I C8    1 
ATOM   6158  N  N7    . DG  I 5 9   ? 56.441  16.201 -52.413 1.00 236.78 ? -64 DG  I N7    1 
ATOM   6159  C  C5    . DG  I 5 9   ? 57.351  15.288 -52.932 1.00 236.78 ? -64 DG  I C5    1 
ATOM   6160  C  C6    . DG  I 5 9   ? 58.728  15.442 -53.254 1.00 236.75 ? -64 DG  I C6    1 
ATOM   6161  O  O6    . DG  I 5 9   ? 59.430  16.456 -53.149 1.00 236.73 ? -64 DG  I O6    1 
ATOM   6162  N  N1    . DG  I 5 9   ? 59.281  14.257 -53.760 1.00 236.74 ? -64 DG  I N1    1 
ATOM   6163  C  C2    . DG  I 5 9   ? 58.585  13.073 -53.921 1.00 236.81 ? -64 DG  I C2    1 
ATOM   6164  N  N2    . DG  I 5 9   ? 59.260  12.047 -54.443 1.00 236.87 ? -64 DG  I N2    1 
ATOM   6165  N  N3    . DG  I 5 9   ? 57.301  12.923 -53.631 1.00 236.81 ? -64 DG  I N3    1 
ATOM   6166  C  C4    . DG  I 5 9   ? 56.750  14.061 -53.134 1.00 236.77 ? -64 DG  I C4    1 
ATOM   6167  P  P     . DT  I 5 10  ? 52.264  10.001 -50.772 1.00 235.80 ? -63 DT  I P     1 
ATOM   6168  O  OP1   . DT  I 5 10  ? 51.453  8.830  -51.175 1.00 235.76 ? -63 DT  I OP1   1 
ATOM   6169  O  OP2   . DT  I 5 10  ? 51.842  10.819 -49.610 1.00 235.78 ? -63 DT  I OP2   1 
ATOM   6170  O  "O5'" . DT  I 5 10  ? 53.770  9.531  -50.512 1.00 236.00 ? -63 DT  I "O5'" 1 
ATOM   6171  C  "C5'" . DT  I 5 10  ? 54.432  8.672  -51.448 1.00 236.13 ? -63 DT  I "C5'" 1 
ATOM   6172  C  "C4'" . DT  I 5 10  ? 55.926  8.607  -51.176 1.00 236.25 ? -63 DT  I "C4'" 1 
ATOM   6173  O  "O4'" . DT  I 5 10  ? 56.510  9.905  -51.379 1.00 236.27 ? -63 DT  I "O4'" 1 
ATOM   6174  C  "C3'" . DT  I 5 10  ? 56.315  8.201  -49.753 1.00 236.35 ? -63 DT  I "C3'" 1 
ATOM   6175  O  "O3'" . DT  I 5 10  ? 56.759  6.846  -49.734 1.00 236.48 ? -63 DT  I "O3'" 1 
ATOM   6176  C  "C2'" . DT  I 5 10  ? 57.440  9.175  -49.360 1.00 236.28 ? -63 DT  I "C2'" 1 
ATOM   6177  C  "C1'" . DT  I 5 10  ? 57.700  9.961  -50.643 1.00 236.28 ? -63 DT  I "C1'" 1 
ATOM   6178  N  N1    . DT  I 5 10  ? 58.076  11.410 -50.418 1.00 236.33 ? -63 DT  I N1    1 
ATOM   6179  C  C2    . DT  I 5 10  ? 59.357  11.841 -50.742 1.00 236.48 ? -63 DT  I C2    1 
ATOM   6180  O  O2    . DT  I 5 10  ? 60.219  11.113 -51.211 1.00 236.62 ? -63 DT  I O2    1 
ATOM   6181  N  N3    . DT  I 5 10  ? 59.589  13.176 -50.508 1.00 236.44 ? -63 DT  I N3    1 
ATOM   6182  C  C4    . DT  I 5 10  ? 58.702  14.105 -49.985 1.00 236.42 ? -63 DT  I C4    1 
ATOM   6183  O  O4    . DT  I 5 10  ? 59.073  15.266 -49.827 1.00 236.49 ? -63 DT  I O4    1 
ATOM   6184  C  C5    . DT  I 5 10  ? 57.381  13.590 -49.654 1.00 236.33 ? -63 DT  I C5    1 
ATOM   6185  C  C7    . DT  I 5 10  ? 56.334  14.494 -49.068 1.00 236.31 ? -63 DT  I C7    1 
ATOM   6186  C  C6    . DT  I 5 10  ? 57.134  12.287 -49.888 1.00 236.29 ? -63 DT  I C6    1 
ATOM   6187  P  P     . DT  I 5 11  ? 56.702  5.979  -48.381 1.00 236.52 ? -62 DT  I P     1 
ATOM   6188  O  OP1   . DT  I 5 11  ? 56.534  4.557  -48.767 1.00 236.54 ? -62 DT  I OP1   1 
ATOM   6189  O  OP2   . DT  I 5 11  ? 55.729  6.608  -47.453 1.00 236.57 ? -62 DT  I OP2   1 
ATOM   6190  O  "O5'" . DT  I 5 11  ? 58.166  6.188  -47.768 1.00 236.37 ? -62 DT  I "O5'" 1 
ATOM   6191  C  "C5'" . DT  I 5 11  ? 59.290  5.555  -48.376 1.00 236.27 ? -62 DT  I "C5'" 1 
ATOM   6192  C  "C4'" . DT  I 5 11  ? 60.563  6.337  -48.121 1.00 236.14 ? -62 DT  I "C4'" 1 
ATOM   6193  O  "O4'" . DT  I 5 11  ? 60.330  7.735  -48.360 1.00 235.93 ? -62 DT  I "O4'" 1 
ATOM   6194  C  "C3'" . DT  I 5 11  ? 61.107  6.247  -46.694 1.00 236.19 ? -62 DT  I "C3'" 1 
ATOM   6195  O  "O3'" . DT  I 5 11  ? 62.241  5.363  -46.656 1.00 236.40 ? -62 DT  I "O3'" 1 
ATOM   6196  C  "C2'" . DT  I 5 11  ? 61.496  7.694  -46.338 1.00 236.01 ? -62 DT  I "C2'" 1 
ATOM   6197  C  "C1'" . DT  I 5 11  ? 61.287  8.457  -47.644 1.00 235.89 ? -62 DT  I "C1'" 1 
ATOM   6198  N  N1    . DT  I 5 11  ? 60.792  9.866  -47.460 1.00 235.84 ? -62 DT  I N1    1 
ATOM   6199  C  C2    . DT  I 5 11  ? 61.551  10.925 -47.940 1.00 235.82 ? -62 DT  I C2    1 
ATOM   6200  O  O2    . DT  I 5 11  ? 62.614  10.785 -48.528 1.00 235.67 ? -62 DT  I O2    1 
ATOM   6201  N  N3    . DT  I 5 11  ? 61.003  12.169 -47.719 1.00 235.92 ? -62 DT  I N3    1 
ATOM   6202  C  C4    . DT  I 5 11  ? 59.803  12.460 -47.076 1.00 235.84 ? -62 DT  I C4    1 
ATOM   6203  O  O4    . DT  I 5 11  ? 59.461  13.633 -46.939 1.00 235.78 ? -62 DT  I O4    1 
ATOM   6204  C  C5    . DT  I 5 11  ? 59.065  11.306 -46.584 1.00 235.82 ? -62 DT  I C5    1 
ATOM   6205  C  C7    . DT  I 5 11  ? 57.759  11.486 -45.864 1.00 235.80 ? -62 DT  I C7    1 
ATOM   6206  C  C6    . DT  I 5 11  ? 59.593  10.086 -46.787 1.00 235.84 ? -62 DT  I C6    1 
ATOM   6207  P  P     . DA  I 5 12  ? 62.662  4.614  -45.295 1.00 236.47 ? -61 DA  I P     1 
ATOM   6208  O  OP1   . DA  I 5 12  ? 63.532  3.469  -45.659 1.00 236.45 ? -61 DA  I OP1   1 
ATOM   6209  O  OP2   . DA  I 5 12  ? 61.436  4.373  -44.493 1.00 236.59 ? -61 DA  I OP2   1 
ATOM   6210  O  "O5'" . DA  I 5 12  ? 63.539  5.727  -44.532 1.00 236.28 ? -61 DA  I "O5'" 1 
ATOM   6211  C  "C5'" . DA  I 5 12  ? 64.857  6.040  -44.992 1.00 236.02 ? -61 DA  I "C5'" 1 
ATOM   6212  C  "C4'" . DA  I 5 12  ? 65.320  7.409  -44.513 1.00 235.70 ? -61 DA  I "C4'" 1 
ATOM   6213  O  "O4'" . DA  I 5 12  ? 64.344  8.421  -44.831 1.00 235.43 ? -61 DA  I "O4'" 1 
ATOM   6214  C  "C3'" . DA  I 5 12  ? 65.600  7.547  -43.006 1.00 235.67 ? -61 DA  I "C3'" 1 
ATOM   6215  O  "O3'" . DA  I 5 12  ? 67.001  7.800  -42.805 1.00 235.90 ? -61 DA  I "O3'" 1 
ATOM   6216  C  "C2'" . DA  I 5 12  ? 64.744  8.753  -42.579 1.00 235.39 ? -61 DA  I "C2'" 1 
ATOM   6217  C  "C1'" . DA  I 5 12  ? 64.507  9.455  -43.909 1.00 235.32 ? -61 DA  I "C1'" 1 
ATOM   6218  N  N9    . DA  I 5 12  ? 63.327  10.322 -43.939 1.00 235.22 ? -61 DA  I N9    1 
ATOM   6219  C  C8    . DA  I 5 12  ? 62.029  9.966  -43.686 1.00 235.19 ? -61 DA  I C8    1 
ATOM   6220  N  N7    . DA  I 5 12  ? 61.177  10.962 -43.770 1.00 235.21 ? -61 DA  I N7    1 
ATOM   6221  C  C5    . DA  I 5 12  ? 61.968  12.052 -44.096 1.00 235.23 ? -61 DA  I C5    1 
ATOM   6222  C  C6    . DA  I 5 12  ? 61.668  13.422 -44.324 1.00 235.24 ? -61 DA  I C6    1 
ATOM   6223  N  N6    . DA  I 5 12  ? 60.430  13.927 -44.248 1.00 235.19 ? -61 DA  I N6    1 
ATOM   6224  N  N1    . DA  I 5 12  ? 62.700  14.252 -44.632 1.00 235.20 ? -61 DA  I N1    1 
ATOM   6225  C  C2    . DA  I 5 12  ? 63.946  13.746 -44.691 1.00 235.13 ? -61 DA  I C2    1 
ATOM   6226  N  N3    . DA  I 5 12  ? 64.347  12.481 -44.505 1.00 235.12 ? -61 DA  I N3    1 
ATOM   6227  C  C4    . DA  I 5 12  ? 63.301  11.677 -44.202 1.00 235.19 ? -61 DA  I C4    1 
ATOM   6228  P  P     . DG  I 5 13  ? 67.731  7.460  -41.408 1.00 235.75 ? -60 DG  I P     1 
ATOM   6229  O  OP1   . DG  I 5 13  ? 68.919  6.623  -41.708 1.00 235.52 ? -60 DG  I OP1   1 
ATOM   6230  O  OP2   . DG  I 5 13  ? 66.712  6.975  -40.443 1.00 235.99 ? -60 DG  I OP2   1 
ATOM   6231  O  "O5'" . DG  I 5 13  ? 68.219  8.903  -40.908 1.00 235.05 ? -60 DG  I "O5'" 1 
ATOM   6232  C  "C5'" . DG  I 5 13  ? 69.033  9.728  -41.751 1.00 234.16 ? -60 DG  I "C5'" 1 
ATOM   6233  C  "C4'" . DG  I 5 13  ? 68.779  11.202 -41.479 1.00 233.23 ? -60 DG  I "C4'" 1 
ATOM   6234  O  "O4'" . DG  I 5 13  ? 67.396  11.510 -41.742 1.00 233.21 ? -60 DG  I "O4'" 1 
ATOM   6235  C  "C3'" . DG  I 5 13  ? 69.043  11.655 -40.037 1.00 232.40 ? -60 DG  I "C3'" 1 
ATOM   6236  O  "O3'" . DG  I 5 13  ? 70.144  12.551 -39.992 1.00 231.23 ? -60 DG  I "O3'" 1 
ATOM   6237  C  "C2'" . DG  I 5 13  ? 67.745  12.338 -39.597 1.00 232.82 ? -60 DG  I "C2'" 1 
ATOM   6238  C  "C1'" . DG  I 5 13  ? 67.025  12.576 -40.915 1.00 233.23 ? -60 DG  I "C1'" 1 
ATOM   6239  N  N9    . DG  I 5 13  ? 65.569  12.594 -40.785 1.00 233.61 ? -60 DG  I N9    1 
ATOM   6240  C  C8    . DG  I 5 13  ? 64.768  11.583 -40.304 1.00 233.80 ? -60 DG  I C8    1 
ATOM   6241  N  N7    . DG  I 5 13  ? 63.504  11.901 -40.245 1.00 233.96 ? -60 DG  I N7    1 
ATOM   6242  C  C5    . DG  I 5 13  ? 63.459  13.215 -40.699 1.00 233.93 ? -60 DG  I C5    1 
ATOM   6243  C  C6    . DG  I 5 13  ? 62.349  14.094 -40.863 1.00 233.83 ? -60 DG  I C6    1 
ATOM   6244  O  O6    . DG  I 5 13  ? 61.153  13.865 -40.636 1.00 233.72 ? -60 DG  I O6    1 
ATOM   6245  N  N1    . DG  I 5 13  ? 62.742  15.349 -41.352 1.00 233.79 ? -60 DG  I N1    1 
ATOM   6246  C  C2    . DG  I 5 13  ? 64.045  15.705 -41.650 1.00 233.73 ? -60 DG  I C2    1 
ATOM   6247  N  N2    . DG  I 5 13  ? 64.233  16.945 -42.121 1.00 233.60 ? -60 DG  I N2    1 
ATOM   6248  N  N3    . DG  I 5 13  ? 65.092  14.889 -41.502 1.00 233.78 ? -60 DG  I N3    1 
ATOM   6249  C  C4    . DG  I 5 13  ? 64.727  13.664 -41.021 1.00 233.79 ? -60 DG  I C4    1 
ATOM   6250  P  P     . DG  I 5 14  ? 71.057  12.645 -38.674 1.00 230.05 ? -59 DG  I P     1 
ATOM   6251  O  OP1   . DG  I 5 14  ? 72.392  13.151 -39.082 1.00 230.29 ? -59 DG  I OP1   1 
ATOM   6252  O  OP2   . DG  I 5 14  ? 70.956  11.361 -37.942 1.00 230.35 ? -59 DG  I OP2   1 
ATOM   6253  O  "O5'" . DG  I 5 14  ? 70.311  13.758 -37.800 1.00 227.90 ? -59 DG  I "O5'" 1 
ATOM   6254  C  "C5'" . DG  I 5 14  ? 70.340  15.123 -38.198 1.00 226.06 ? -59 DG  I "C5'" 1 
ATOM   6255  C  "C4'" . DG  I 5 14  ? 69.222  15.898 -37.531 1.00 224.41 ? -59 DG  I "C4'" 1 
ATOM   6256  O  "O4'" . DG  I 5 14  ? 67.966  15.190 -37.711 1.00 224.28 ? -59 DG  I "O4'" 1 
ATOM   6257  C  "C3'" . DG  I 5 14  ? 69.385  16.115 -36.017 1.00 222.93 ? -59 DG  I "C3'" 1 
ATOM   6258  O  "O3'" . DG  I 5 14  ? 69.192  17.502 -35.703 1.00 220.92 ? -59 DG  I "O3'" 1 
ATOM   6259  C  "C2'" . DG  I 5 14  ? 68.276  15.242 -35.409 1.00 223.48 ? -59 DG  I "C2'" 1 
ATOM   6260  C  "C1'" . DG  I 5 14  ? 67.232  15.271 -36.518 1.00 223.91 ? -59 DG  I "C1'" 1 
ATOM   6261  N  N9    . DG  I 5 14  ? 66.234  14.184 -36.475 1.00 223.87 ? -59 DG  I N9    1 
ATOM   6262  C  C8    . DG  I 5 14  ? 66.417  12.889 -36.031 1.00 223.90 ? -59 DG  I C8    1 
ATOM   6263  N  N7    . DG  I 5 14  ? 65.335  12.158 -36.085 1.00 223.80 ? -59 DG  I N7    1 
ATOM   6264  C  C5    . DG  I 5 14  ? 64.369  13.013 -36.600 1.00 223.75 ? -59 DG  I C5    1 
ATOM   6265  C  C6    . DG  I 5 14  ? 62.993  12.778 -36.889 1.00 223.71 ? -59 DG  I C6    1 
ATOM   6266  O  O6    . DG  I 5 14  ? 62.345  11.732 -36.739 1.00 223.72 ? -59 DG  I O6    1 
ATOM   6267  N  N1    . DG  I 5 14  ? 62.363  13.921 -37.404 1.00 223.58 ? -59 DG  I N1    1 
ATOM   6268  C  C2    . DG  I 5 14  ? 62.988  15.133 -37.621 1.00 223.50 ? -59 DG  I C2    1 
ATOM   6269  N  N2    . DG  I 5 14  ? 62.227  16.115 -38.119 1.00 223.30 ? -59 DG  I N2    1 
ATOM   6270  N  N3    . DG  I 5 14  ? 64.273  15.366 -37.354 1.00 223.69 ? -59 DG  I N3    1 
ATOM   6271  C  C4    . DG  I 5 14  ? 64.902  14.267 -36.841 1.00 223.78 ? -59 DG  I C4    1 
ATOM   6272  P  P     . DG  I 5 15  ? 70.024  18.208 -34.525 1.00 218.88 ? -58 DG  I P     1 
ATOM   6273  O  OP1   . DG  I 5 15  ? 71.370  18.530 -35.049 1.00 218.98 ? -58 DG  I OP1   1 
ATOM   6274  O  OP2   . DG  I 5 15  ? 69.889  17.385 -33.298 1.00 218.63 ? -58 DG  I OP2   1 
ATOM   6275  O  "O5'" . DG  I 5 15  ? 69.215  19.575 -34.287 1.00 217.30 ? -58 DG  I "O5'" 1 
ATOM   6276  C  "C5'" . DG  I 5 15  ? 69.134  20.569 -35.326 1.00 215.74 ? -58 DG  I "C5'" 1 
ATOM   6277  C  "C4'" . DG  I 5 15  ? 67.732  21.174 -35.425 1.00 214.16 ? -58 DG  I "C4'" 1 
ATOM   6278  O  "O4'" . DG  I 5 15  ? 66.781  20.161 -35.836 1.00 213.81 ? -58 DG  I "O4'" 1 
ATOM   6279  C  "C3'" . DG  I 5 15  ? 67.175  21.798 -34.137 1.00 212.77 ? -58 DG  I "C3'" 1 
ATOM   6280  O  "O3'" . DG  I 5 15  ? 66.801  23.162 -34.367 1.00 211.05 ? -58 DG  I "O3'" 1 
ATOM   6281  C  "C2'" . DG  I 5 15  ? 65.962  20.932 -33.792 1.00 213.04 ? -58 DG  I "C2'" 1 
ATOM   6282  C  "C1'" . DG  I 5 15  ? 65.573  20.348 -35.141 1.00 213.42 ? -58 DG  I "C1'" 1 
ATOM   6283  N  N9    . DG  I 5 15  ? 64.902  19.054 -35.028 1.00 213.53 ? -58 DG  I N9    1 
ATOM   6284  C  C8    . DG  I 5 15  ? 65.496  17.840 -34.769 1.00 213.55 ? -58 DG  I C8    1 
ATOM   6285  N  N7    . DG  I 5 15  ? 64.652  16.854 -34.670 1.00 213.64 ? -58 DG  I N7    1 
ATOM   6286  C  C5    . DG  I 5 15  ? 63.410  17.446 -34.853 1.00 213.60 ? -58 DG  I C5    1 
ATOM   6287  C  C6    . DG  I 5 15  ? 62.113  16.869 -34.839 1.00 213.42 ? -58 DG  I C6    1 
ATOM   6288  O  O6    . DG  I 5 15  ? 61.806  15.680 -34.674 1.00 213.18 ? -58 DG  I O6    1 
ATOM   6289  N  N1    . DG  I 5 15  ? 61.114  17.823 -35.063 1.00 213.59 ? -58 DG  I N1    1 
ATOM   6290  C  C2    . DG  I 5 15  ? 61.341  19.173 -35.253 1.00 213.72 ? -58 DG  I C2    1 
ATOM   6291  N  N2    . DG  I 5 15  ? 60.254  19.936 -35.447 1.00 213.81 ? -58 DG  I N2    1 
ATOM   6292  N  N3    . DG  I 5 15  ? 62.555  19.729 -35.266 1.00 213.69 ? -58 DG  I N3    1 
ATOM   6293  C  C4    . DG  I 5 15  ? 63.541  18.809 -35.055 1.00 213.64 ? -58 DG  I C4    1 
ATOM   6294  P  P     . DT  I 5 16  ? 66.735  24.219 -33.154 1.00 209.20 ? -57 DT  I P     1 
ATOM   6295  O  OP1   . DT  I 5 16  ? 67.354  25.484 -33.613 1.00 209.26 ? -57 DT  I OP1   1 
ATOM   6296  O  OP2   . DT  I 5 16  ? 67.231  23.562 -31.918 1.00 209.13 ? -57 DT  I OP2   1 
ATOM   6297  O  "O5'" . DT  I 5 16  ? 65.170  24.454 -32.972 1.00 207.29 ? -57 DT  I "O5'" 1 
ATOM   6298  C  "C5'" . DT  I 5 16  ? 64.349  24.817 -34.078 1.00 205.26 ? -57 DT  I "C5'" 1 
ATOM   6299  C  "C4'" . DT  I 5 16  ? 62.892  24.583 -33.732 1.00 203.30 ? -57 DT  I "C4'" 1 
ATOM   6300  O  "O4'" . DT  I 5 16  ? 62.688  23.170 -33.479 1.00 202.85 ? -57 DT  I "O4'" 1 
ATOM   6301  C  "C3'" . DT  I 5 16  ? 62.404  25.327 -32.486 1.00 201.95 ? -57 DT  I "C3'" 1 
ATOM   6302  O  "O3'" . DT  I 5 16  ? 61.189  25.999 -32.759 1.00 200.66 ? -57 DT  I "O3'" 1 
ATOM   6303  C  "C2'" . DT  I 5 16  ? 62.228  24.231 -31.434 1.00 202.11 ? -57 DT  I "C2'" 1 
ATOM   6304  C  "C1'" . DT  I 5 16  ? 61.972  22.990 -32.279 1.00 202.55 ? -57 DT  I "C1'" 1 
ATOM   6305  N  N1    . DT  I 5 16  ? 62.433  21.689 -31.628 1.00 202.83 ? -57 DT  I N1    1 
ATOM   6306  C  C2    . DT  I 5 16  ? 61.565  20.603 -31.574 1.00 202.98 ? -57 DT  I C2    1 
ATOM   6307  O  O2    . DT  I 5 16  ? 60.432  20.623 -32.028 1.00 203.22 ? -57 DT  I O2    1 
ATOM   6308  N  N3    . DT  I 5 16  ? 62.086  19.476 -30.972 1.00 202.93 ? -57 DT  I N3    1 
ATOM   6309  C  C4    . DT  I 5 16  ? 63.359  19.323 -30.424 1.00 202.99 ? -57 DT  I C4    1 
ATOM   6310  O  O4    . DT  I 5 16  ? 63.673  18.245 -29.918 1.00 202.96 ? -57 DT  I O4    1 
ATOM   6311  C  C5    . DT  I 5 16  ? 64.218  20.498 -30.508 1.00 202.94 ? -57 DT  I C5    1 
ATOM   6312  C  C7    . DT  I 5 16  ? 65.615  20.467 -29.951 1.00 202.60 ? -57 DT  I C7    1 
ATOM   6313  C  C6    . DT  I 5 16  ? 63.718  21.607 -31.094 1.00 203.06 ? -57 DT  I C6    1 
ATOM   6314  P  P     . DT  I 5 17  ? 60.771  27.323 -31.944 1.00 199.43 ? -56 DT  I P     1 
ATOM   6315  O  OP1   . DT  I 5 17  ? 60.736  28.457 -32.898 1.00 199.34 ? -56 DT  I OP1   1 
ATOM   6316  O  OP2   . DT  I 5 17  ? 61.602  27.412 -30.717 1.00 199.41 ? -56 DT  I OP2   1 
ATOM   6317  O  "O5'" . DT  I 5 17  ? 59.273  26.995 -31.490 1.00 198.23 ? -56 DT  I "O5'" 1 
ATOM   6318  C  "C5'" . DT  I 5 17  ? 58.332  26.491 -32.436 1.00 196.84 ? -56 DT  I "C5'" 1 
ATOM   6319  C  "C4'" . DT  I 5 17  ? 57.499  25.380 -31.826 1.00 195.46 ? -56 DT  I "C4'" 1 
ATOM   6320  O  "O4'" . DT  I 5 17  ? 58.356  24.299 -31.381 1.00 195.24 ? -56 DT  I "O4'" 1 
ATOM   6321  C  "C3'" . DT  I 5 17  ? 56.662  25.790 -30.611 1.00 194.39 ? -56 DT  I "C3'" 1 
ATOM   6322  O  "O3'" . DT  I 5 17  ? 55.335  25.372 -30.796 1.00 193.04 ? -56 DT  I "O3'" 1 
ATOM   6323  C  "C2'" . DT  I 5 17  ? 57.317  25.045 -29.451 1.00 194.73 ? -56 DT  I "C2'" 1 
ATOM   6324  C  "C1'" . DT  I 5 17  ? 57.866  23.820 -30.158 1.00 195.31 ? -56 DT  I "C1'" 1 
ATOM   6325  N  N1    . DT  I 5 17  ? 58.977  23.119 -29.424 1.00 196.21 ? -56 DT  I N1    1 
ATOM   6326  C  C2    . DT  I 5 17  ? 58.969  21.732 -29.349 1.00 196.57 ? -56 DT  I C2    1 
ATOM   6327  O  O2    . DT  I 5 17  ? 58.104  21.033 -29.857 1.00 196.67 ? -56 DT  I O2    1 
ATOM   6328  N  N3    . DT  I 5 17  ? 60.037  21.186 -28.667 1.00 196.64 ? -56 DT  I N3    1 
ATOM   6329  C  C4    . DT  I 5 17  ? 61.083  21.870 -28.056 1.00 196.62 ? -56 DT  I C4    1 
ATOM   6330  O  O4    . DT  I 5 17  ? 61.959  21.232 -27.478 1.00 196.70 ? -56 DT  I O4    1 
ATOM   6331  C  C5    . DT  I 5 17  ? 61.028  23.324 -28.163 1.00 196.53 ? -56 DT  I C5    1 
ATOM   6332  C  C7    . DT  I 5 17  ? 62.100  24.180 -27.548 1.00 196.43 ? -56 DT  I C7    1 
ATOM   6333  C  C6    . DT  I 5 17  ? 59.988  23.868 -28.827 1.00 196.53 ? -56 DT  I C6    1 
ATOM   6334  P  P     . DA  I 5 18  ? 54.144  26.429 -30.751 1.00 191.58 ? -55 DA  I P     1 
ATOM   6335  O  OP1   . DA  I 5 18  ? 54.113  27.137 -32.051 1.00 191.52 ? -55 DA  I OP1   1 
ATOM   6336  O  OP2   . DA  I 5 18  ? 54.261  27.197 -29.489 1.00 191.53 ? -55 DA  I OP2   1 
ATOM   6337  O  "O5'" . DA  I 5 18  ? 52.849  25.503 -30.642 1.00 190.41 ? -55 DA  I "O5'" 1 
ATOM   6338  C  "C5'" . DA  I 5 18  ? 52.895  24.140 -31.071 1.00 189.18 ? -55 DA  I "C5'" 1 
ATOM   6339  C  "C4'" . DA  I 5 18  ? 52.777  23.193 -29.886 1.00 187.96 ? -55 DA  I "C4'" 1 
ATOM   6340  O  "O4'" . DA  I 5 18  ? 54.019  23.184 -29.141 1.00 187.64 ? -55 DA  I "O4'" 1 
ATOM   6341  C  "C3'" . DA  I 5 18  ? 51.670  23.534 -28.881 1.00 187.01 ? -55 DA  I "C3'" 1 
ATOM   6342  O  "O3'" . DA  I 5 18  ? 50.845  22.388 -28.649 1.00 185.62 ? -55 DA  I "O3'" 1 
ATOM   6343  C  "C2'" . DA  I 5 18  ? 52.434  23.963 -27.623 1.00 187.27 ? -55 DA  I "C2'" 1 
ATOM   6344  C  "C1'" . DA  I 5 18  ? 53.731  23.180 -27.768 1.00 187.63 ? -55 DA  I "C1'" 1 
ATOM   6345  N  N9    . DA  I 5 18  ? 54.874  23.759 -27.061 1.00 188.16 ? -55 DA  I N9    1 
ATOM   6346  C  C8    . DA  I 5 18  ? 55.084  25.080 -26.758 1.00 188.31 ? -55 DA  I C8    1 
ATOM   6347  N  N7    . DA  I 5 18  ? 56.226  25.312 -26.154 1.00 188.41 ? -55 DA  I N7    1 
ATOM   6348  C  C5    . DA  I 5 18  ? 56.813  24.061 -26.054 1.00 188.44 ? -55 DA  I C5    1 
ATOM   6349  C  C6    . DA  I 5 18  ? 58.053  23.623 -25.515 1.00 188.48 ? -55 DA  I C6    1 
ATOM   6350  N  N6    . DA  I 5 18  ? 58.930  24.442 -24.921 1.00 188.26 ? -55 DA  I N6    1 
ATOM   6351  N  N1    . DA  I 5 18  ? 58.328  22.294 -25.565 1.00 188.69 ? -55 DA  I N1    1 
ATOM   6352  C  C2    . DA  I 5 18  ? 57.439  21.469 -26.153 1.00 188.74 ? -55 DA  I C2    1 
ATOM   6353  N  N3    . DA  I 5 18  ? 56.252  21.765 -26.706 1.00 188.58 ? -55 DA  I N3    1 
ATOM   6354  C  C4    . DA  I 5 18  ? 55.998  23.091 -26.625 1.00 188.40 ? -55 DA  I C4    1 
ATOM   6355  P  P     . DG  I 5 19  ? 49.258  22.534 -28.665 1.00 184.23 ? -54 DG  I P     1 
ATOM   6356  O  OP1   . DG  I 5 19  ? 48.850  22.846 -30.051 1.00 183.82 ? -54 DG  I OP1   1 
ATOM   6357  O  OP2   . DG  I 5 19  ? 48.883  23.435 -27.556 1.00 183.82 ? -54 DG  I OP2   1 
ATOM   6358  O  "O5'" . DG  I 5 19  ? 48.749  21.071 -28.284 1.00 184.97 ? -54 DG  I "O5'" 1 
ATOM   6359  C  "C5'" . DG  I 5 19  ? 48.969  19.977 -29.165 1.00 186.13 ? -54 DG  I "C5'" 1 
ATOM   6360  C  "C4'" . DG  I 5 19  ? 49.692  18.846 -28.453 1.00 187.41 ? -54 DG  I "C4'" 1 
ATOM   6361  O  "O4'" . DG  I 5 19  ? 50.879  19.364 -27.802 1.00 188.28 ? -54 DG  I "O4'" 1 
ATOM   6362  C  "C3'" . DG  I 5 19  ? 48.895  18.109 -27.372 1.00 187.87 ? -54 DG  I "C3'" 1 
ATOM   6363  O  "O3'" . DG  I 5 19  ? 49.146  16.702 -27.482 1.00 188.01 ? -54 DG  I "O3'" 1 
ATOM   6364  C  "C2'" . DG  I 5 19  ? 49.461  18.684 -26.069 1.00 188.35 ? -54 DG  I "C2'" 1 
ATOM   6365  C  "C1'" . DG  I 5 19  ? 50.912  18.938 -26.459 1.00 188.93 ? -54 DG  I "C1'" 1 
ATOM   6366  N  N9    . DG  I 5 19  ? 51.588  19.969 -25.661 1.00 190.08 ? -54 DG  I N9    1 
ATOM   6367  C  C8    . DG  I 5 19  ? 51.277  21.310 -25.603 1.00 190.50 ? -54 DG  I C8    1 
ATOM   6368  N  N7    . DG  I 5 19  ? 52.084  22.004 -24.846 1.00 190.66 ? -54 DG  I N7    1 
ATOM   6369  C  C5    . DG  I 5 19  ? 53.004  21.074 -24.391 1.00 190.75 ? -54 DG  I C5    1 
ATOM   6370  C  C6    . DG  I 5 19  ? 54.121  21.245 -23.537 1.00 191.01 ? -54 DG  I C6    1 
ATOM   6371  O  O6    . DG  I 5 19  ? 54.498  22.280 -22.975 1.00 191.09 ? -54 DG  I O6    1 
ATOM   6372  N  N1    . DG  I 5 19  ? 54.782  20.036 -23.292 1.00 191.32 ? -54 DG  I N1    1 
ATOM   6373  C  C2    . DG  I 5 19  ? 54.424  18.817 -23.835 1.00 191.44 ? -54 DG  I C2    1 
ATOM   6374  N  N2    . DG  I 5 19  ? 55.194  17.766 -23.503 1.00 191.84 ? -54 DG  I N2    1 
ATOM   6375  N  N3    . DG  I 5 19  ? 53.387  18.645 -24.656 1.00 191.03 ? -54 DG  I N3    1 
ATOM   6376  C  C4    . DG  I 5 19  ? 52.723  19.814 -24.889 1.00 190.64 ? -54 DG  I C4    1 
ATOM   6377  P  P     . DG  I 5 20  ? 48.105  15.626 -26.916 1.00 188.29 ? -53 DG  I P     1 
ATOM   6378  O  OP1   . DG  I 5 20  ? 48.451  14.310 -27.509 1.00 187.90 ? -53 DG  I OP1   1 
ATOM   6379  O  OP2   . DG  I 5 20  ? 46.746  16.169 -27.088 1.00 188.29 ? -53 DG  I OP2   1 
ATOM   6380  O  "O5'" . DG  I 5 20  ? 48.422  15.607 -25.339 1.00 189.29 ? -53 DG  I "O5'" 1 
ATOM   6381  C  "C5'" . DG  I 5 20  ? 49.416  14.718 -24.797 1.00 190.04 ? -53 DG  I "C5'" 1 
ATOM   6382  C  "C4'" . DG  I 5 20  ? 49.747  15.064 -23.349 1.00 190.69 ? -53 DG  I "C4'" 1 
ATOM   6383  O  "O4'" . DG  I 5 20  ? 50.076  16.469 -23.233 1.00 191.08 ? -53 DG  I "O4'" 1 
ATOM   6384  C  "C3'" . DG  I 5 20  ? 48.636  14.788 -22.325 1.00 191.05 ? -53 DG  I "C3'" 1 
ATOM   6385  O  "O3'" . DG  I 5 20  ? 49.163  14.032 -21.244 1.00 191.30 ? -53 DG  I "O3'" 1 
ATOM   6386  C  "C2'" . DG  I 5 20  ? 48.206  16.186 -21.866 1.00 191.28 ? -53 DG  I "C2'" 1 
ATOM   6387  C  "C1'" . DG  I 5 20  ? 49.488  16.983 -22.066 1.00 191.52 ? -53 DG  I "C1'" 1 
ATOM   6388  N  N9    . DG  I 5 20  ? 49.298  18.431 -22.229 1.00 192.22 ? -53 DG  I N9    1 
ATOM   6389  C  C8    . DG  I 5 20  ? 48.209  19.084 -22.781 1.00 192.39 ? -53 DG  I C8    1 
ATOM   6390  N  N7    . DG  I 5 20  ? 48.338  20.387 -22.806 1.00 192.65 ? -53 DG  I N7    1 
ATOM   6391  C  C5    . DG  I 5 20  ? 49.593  20.619 -22.240 1.00 192.86 ? -53 DG  I C5    1 
ATOM   6392  C  C6    . DG  I 5 20  ? 50.291  21.847 -21.997 1.00 192.95 ? -53 DG  I C6    1 
ATOM   6393  O  O6    . DG  I 5 20  ? 49.917  23.008 -22.241 1.00 193.01 ? -53 DG  I O6    1 
ATOM   6394  N  N1    . DG  I 5 20  ? 51.546  21.628 -21.407 1.00 192.70 ? -53 DG  I N1    1 
ATOM   6395  C  C2    . DG  I 5 20  ? 52.067  20.383 -21.101 1.00 192.47 ? -53 DG  I C2    1 
ATOM   6396  N  N2    . DG  I 5 20  ? 53.273  20.371 -20.524 1.00 192.34 ? -53 DG  I N2    1 
ATOM   6397  N  N3    . DG  I 5 20  ? 51.425  19.233 -21.310 1.00 192.50 ? -53 DG  I N3    1 
ATOM   6398  C  C4    . DG  I 5 20  ? 50.198  19.423 -21.883 1.00 192.60 ? -53 DG  I C4    1 
ATOM   6399  P  P     . DG  I 5 21  ? 48.500  12.636 -20.815 1.00 191.52 ? -52 DG  I P     1 
ATOM   6400  O  OP1   . DG  I 5 21  ? 48.763  11.651 -21.891 1.00 191.51 ? -52 DG  I OP1   1 
ATOM   6401  O  OP2   . DG  I 5 21  ? 47.107  12.904 -20.381 1.00 191.53 ? -52 DG  I OP2   1 
ATOM   6402  O  "O5'" . DG  I 5 21  ? 49.351  12.226 -19.519 1.00 191.48 ? -52 DG  I "O5'" 1 
ATOM   6403  C  "C5'" . DG  I 5 21  ? 50.772  12.040 -19.613 1.00 191.54 ? -52 DG  I "C5'" 1 
ATOM   6404  C  "C4'" . DG  I 5 21  ? 51.513  12.770 -18.497 1.00 191.72 ? -52 DG  I "C4'" 1 
ATOM   6405  O  "O4'" . DG  I 5 21  ? 51.643  14.179 -18.829 1.00 191.60 ? -52 DG  I "O4'" 1 
ATOM   6406  C  "C3'" . DG  I 5 21  ? 50.861  12.710 -17.102 1.00 192.23 ? -52 DG  I "C3'" 1 
ATOM   6407  O  "O3'" . DG  I 5 21  ? 51.822  12.257 -16.118 1.00 193.08 ? -52 DG  I "O3'" 1 
ATOM   6408  C  "C2'" . DG  I 5 21  ? 50.426  14.154 -16.848 1.00 192.00 ? -52 DG  I "C2'" 1 
ATOM   6409  C  "C1'" . DG  I 5 21  ? 51.451  14.932 -17.658 1.00 191.93 ? -52 DG  I "C1'" 1 
ATOM   6410  N  N9    . DG  I 5 21  ? 51.026  16.300 -18.001 1.00 192.34 ? -52 DG  I N9    1 
ATOM   6411  C  C8    . DG  I 5 21  ? 49.815  16.688 -18.545 1.00 192.38 ? -52 DG  I C8    1 
ATOM   6412  N  N7    . DG  I 5 21  ? 49.682  17.981 -18.659 1.00 192.35 ? -52 DG  I N7    1 
ATOM   6413  C  C5    . DG  I 5 21  ? 50.864  18.493 -18.138 1.00 192.42 ? -52 DG  I C5    1 
ATOM   6414  C  C6    . DG  I 5 21  ? 51.289  19.842 -17.982 1.00 192.39 ? -52 DG  I C6    1 
ATOM   6415  O  O6    . DG  I 5 21  ? 50.694  20.875 -18.316 1.00 192.25 ? -52 DG  I O6    1 
ATOM   6416  N  N1    . DG  I 5 21  ? 52.572  19.928 -17.420 1.00 192.60 ? -52 DG  I N1    1 
ATOM   6417  C  C2    . DG  I 5 21  ? 53.334  18.844 -17.018 1.00 192.61 ? -52 DG  I C2    1 
ATOM   6418  N  N2    . DG  I 5 21  ? 54.535  19.121 -16.477 1.00 192.40 ? -52 DG  I N2    1 
ATOM   6419  N  N3    . DG  I 5 21  ? 52.941  17.574 -17.147 1.00 192.64 ? -52 DG  I N3    1 
ATOM   6420  C  C4    . DG  I 5 21  ? 51.695  17.473 -17.706 1.00 192.50 ? -52 DG  I C4    1 
ATOM   6421  P  P     . DT  I 5 22  ? 51.384  11.933 -14.599 1.00 193.58 ? -51 DT  I P     1 
ATOM   6422  O  OP1   . DT  I 5 22  ? 52.379  10.985 -14.039 1.00 193.39 ? -51 DT  I OP1   1 
ATOM   6423  O  OP2   . DT  I 5 22  ? 49.942  11.576 -14.591 1.00 193.44 ? -51 DT  I OP2   1 
ATOM   6424  O  "O5'" . DT  I 5 22  ? 51.542  13.359 -13.861 1.00 194.19 ? -51 DT  I "O5'" 1 
ATOM   6425  C  "C5'" . DT  I 5 22  ? 52.849  13.871 -13.549 1.00 194.64 ? -51 DT  I "C5'" 1 
ATOM   6426  C  "C4'" . DT  I 5 22  ? 52.838  15.378 -13.290 1.00 195.03 ? -51 DT  I "C4'" 1 
ATOM   6427  O  "O4'" . DT  I 5 22  ? 52.110  16.072 -14.315 1.00 195.07 ? -51 DT  I "O4'" 1 
ATOM   6428  C  "C3'" . DT  I 5 22  ? 52.164  15.837 -12.011 1.00 195.47 ? -51 DT  I "C3'" 1 
ATOM   6429  O  "O3'" . DT  I 5 22  ? 53.050  15.678 -10.897 1.00 196.19 ? -51 DT  I "O3'" 1 
ATOM   6430  C  "C2'" . DT  I 5 22  ? 51.896  17.318 -12.304 1.00 195.25 ? -51 DT  I "C2'" 1 
ATOM   6431  C  "C1'" . DT  I 5 22  ? 51.860  17.381 -13.838 1.00 195.07 ? -51 DT  I "C1'" 1 
ATOM   6432  N  N1    . DT  I 5 22  ? 50.553  17.933 -14.421 1.00 194.81 ? -51 DT  I N1    1 
ATOM   6433  C  C2    . DT  I 5 22  ? 50.372  19.312 -14.490 1.00 194.72 ? -51 DT  I C2    1 
ATOM   6434  O  O2    . DT  I 5 22  ? 51.197  20.120 -14.090 1.00 194.69 ? -51 DT  I O2    1 
ATOM   6435  N  N3    . DT  I 5 22  ? 49.179  19.713 -15.054 1.00 194.72 ? -51 DT  I N3    1 
ATOM   6436  C  C4    . DT  I 5 22  ? 48.162  18.899 -15.546 1.00 194.70 ? -51 DT  I C4    1 
ATOM   6437  O  O4    . DT  I 5 22  ? 47.150  19.417 -16.019 1.00 194.58 ? -51 DT  I O4    1 
ATOM   6438  C  C5    . DT  I 5 22  ? 48.407  17.468 -15.445 1.00 194.71 ? -51 DT  I C5    1 
ATOM   6439  C  C7    . DT  I 5 22  ? 47.377  16.487 -15.936 1.00 194.57 ? -51 DT  I C7    1 
ATOM   6440  C  C6    . DT  I 5 22  ? 49.572  17.059 -14.885 1.00 194.75 ? -51 DT  I C6    1 
ATOM   6441  P  P     . DT  I 5 23  ? 52.478  15.480 -9.405  1.00 196.64 ? -50 DT  I P     1 
ATOM   6442  O  OP1   . DT  I 5 23  ? 53.530  14.797 -8.605  1.00 196.61 ? -50 DT  I OP1   1 
ATOM   6443  O  OP2   . DT  I 5 23  ? 51.120  14.884 -9.497  1.00 196.63 ? -50 DT  I OP2   1 
ATOM   6444  O  "O5'" . DT  I 5 23  ? 52.306  16.990 -8.886  1.00 196.80 ? -50 DT  I "O5'" 1 
ATOM   6445  C  "C5'" . DT  I 5 23  ? 53.388  17.673 -8.236  1.00 196.94 ? -50 DT  I "C5'" 1 
ATOM   6446  C  "C4'" . DT  I 5 23  ? 53.122  19.168 -8.161  1.00 197.01 ? -50 DT  I "C4'" 1 
ATOM   6447  O  "O4'" . DT  I 5 23  ? 52.623  19.624 -9.437  1.00 196.97 ? -50 DT  I "O4'" 1 
ATOM   6448  C  "C3'" . DT  I 5 23  ? 52.067  19.591 -7.144  1.00 197.19 ? -50 DT  I "C3'" 1 
ATOM   6449  O  "O3'" . DT  I 5 23  ? 52.679  19.820 -5.865  1.00 197.54 ? -50 DT  I "O3'" 1 
ATOM   6450  C  "C2'" . DT  I 5 23  ? 51.535  20.888 -7.742  1.00 197.04 ? -50 DT  I "C2'" 1 
ATOM   6451  C  "C1'" . DT  I 5 23  ? 51.668  20.650 -9.243  1.00 196.98 ? -50 DT  I "C1'" 1 
ATOM   6452  N  N1    . DT  I 5 23  ? 50.366  20.282 -9.932  1.00 196.84 ? -50 DT  I N1    1 
ATOM   6453  C  C2    . DT  I 5 23  ? 49.568  21.290 -10.444 1.00 196.68 ? -50 DT  I C2    1 
ATOM   6454  O  O2    . DT  I 5 23  ? 49.854  22.474 -10.369 1.00 196.55 ? -50 DT  I O2    1 
ATOM   6455  N  N3    . DT  I 5 23  ? 48.414  20.857 -11.057 1.00 196.72 ? -50 DT  I N3    1 
ATOM   6456  C  C4    . DT  I 5 23  ? 47.984  19.542 -11.209 1.00 196.68 ? -50 DT  I C4    1 
ATOM   6457  O  O4    . DT  I 5 23  ? 46.918  19.319 -11.780 1.00 196.56 ? -50 DT  I O4    1 
ATOM   6458  C  C5    . DT  I 5 23  ? 48.861  18.532 -10.638 1.00 196.77 ? -50 DT  I C5    1 
ATOM   6459  C  C7    . DT  I 5 23  ? 48.505  17.074 -10.724 1.00 196.78 ? -50 DT  I C7    1 
ATOM   6460  C  C6    . DT  I 5 23  ? 49.981  18.948 -10.019 1.00 196.83 ? -50 DT  I C6    1 
ATOM   6461  P  P     . DA  I 5 24  ? 51.860  19.589 -4.496  1.00 197.60 ? -49 DA  I P     1 
ATOM   6462  O  OP1   . DA  I 5 24  ? 52.846  19.542 -3.381  1.00 197.64 ? -49 DA  I OP1   1 
ATOM   6463  O  OP2   . DA  I 5 24  ? 50.923  18.455 -4.697  1.00 197.60 ? -49 DA  I OP2   1 
ATOM   6464  O  "O5'" . DA  I 5 24  ? 50.976  20.921 -4.364  1.00 197.18 ? -49 DA  I "O5'" 1 
ATOM   6465  C  "C5'" . DA  I 5 24  ? 51.592  22.209 -4.250  1.00 196.78 ? -49 DA  I "C5'" 1 
ATOM   6466  C  "C4'" . DA  I 5 24  ? 50.600  23.306 -4.604  1.00 196.42 ? -49 DA  I "C4'" 1 
ATOM   6467  O  "O4'" . DA  I 5 24  ? 49.975  22.997 -5.875  1.00 196.42 ? -49 DA  I "O4'" 1 
ATOM   6468  C  "C3'" . DA  I 5 24  ? 49.462  23.493 -3.598  1.00 196.22 ? -49 DA  I "C3'" 1 
ATOM   6469  O  "O3'" . DA  I 5 24  ? 49.309  24.863 -3.260  1.00 195.98 ? -49 DA  I "O3'" 1 
ATOM   6470  C  "C2'" . DA  I 5 24  ? 48.229  22.954 -4.317  1.00 196.32 ? -49 DA  I "C2'" 1 
ATOM   6471  C  "C1'" . DA  I 5 24  ? 48.584  23.179 -5.777  1.00 196.38 ? -49 DA  I "C1'" 1 
ATOM   6472  N  N9    . DA  I 5 24  ? 47.920  22.239 -6.675  1.00 196.37 ? -49 DA  I N9    1 
ATOM   6473  C  C8    . DA  I 5 24  ? 47.990  20.872 -6.636  1.00 196.33 ? -49 DA  I C8    1 
ATOM   6474  N  N7    . DA  I 5 24  ? 47.221  20.275 -7.515  1.00 196.39 ? -49 DA  I N7    1 
ATOM   6475  C  C5    . DA  I 5 24  ? 46.590  21.319 -8.168  1.00 196.43 ? -49 DA  I C5    1 
ATOM   6476  C  C6    . DA  I 5 24  ? 45.650  21.355 -9.226  1.00 196.50 ? -49 DA  I C6    1 
ATOM   6477  N  N6    . DA  I 5 24  ? 45.166  20.258 -9.813  1.00 196.45 ? -49 DA  I N6    1 
ATOM   6478  N  N1    . DA  I 5 24  ? 45.220  22.571 -9.649  1.00 196.63 ? -49 DA  I N1    1 
ATOM   6479  C  C2    . DA  I 5 24  ? 45.712  23.676 -9.061  1.00 196.69 ? -49 DA  I C2    1 
ATOM   6480  N  N3    . DA  I 5 24  ? 46.590  23.767 -8.053  1.00 196.59 ? -49 DA  I N3    1 
ATOM   6481  C  C4    . DA  I 5 24  ? 46.996  22.540 -7.650  1.00 196.44 ? -49 DA  I C4    1 
ATOM   6482  P  P     . DG  I 5 25  ? 48.689  25.279 -1.839  1.00 195.89 ? -48 DG  I P     1 
ATOM   6483  O  OP1   . DG  I 5 25  ? 49.553  26.333 -1.259  1.00 196.44 ? -48 DG  I OP1   1 
ATOM   6484  O  OP2   . DG  I 5 25  ? 48.419  24.043 -1.060  1.00 196.14 ? -48 DG  I OP2   1 
ATOM   6485  O  "O5'" . DG  I 5 25  ? 47.278  25.914 -2.229  1.00 194.66 ? -48 DG  I "O5'" 1 
ATOM   6486  C  "C5'" . DG  I 5 25  ? 47.201  27.134 -2.953  1.00 193.73 ? -48 DG  I "C5'" 1 
ATOM   6487  C  "C4'" . DG  I 5 25  ? 45.818  27.293 -3.566  1.00 193.07 ? -48 DG  I "C4'" 1 
ATOM   6488  O  "O4'" . DG  I 5 25  ? 45.468  26.091 -4.306  1.00 192.98 ? -48 DG  I "O4'" 1 
ATOM   6489  C  "C3'" . DG  I 5 25  ? 44.679  27.529 -2.569  1.00 192.57 ? -48 DG  I "C3'" 1 
ATOM   6490  O  "O3'" . DG  I 5 25  ? 43.770  28.500 -3.100  1.00 191.88 ? -48 DG  I "O3'" 1 
ATOM   6491  C  "C2'" . DG  I 5 25  ? 44.028  26.148 -2.453  1.00 192.77 ? -48 DG  I "C2'" 1 
ATOM   6492  C  "C1'" . DG  I 5 25  ? 44.221  25.599 -3.864  1.00 192.98 ? -48 DG  I "C1'" 1 
ATOM   6493  N  N9    . DG  I 5 25  ? 44.240  24.134 -3.955  1.00 193.35 ? -48 DG  I N9    1 
ATOM   6494  C  C8    . DG  I 5 25  ? 44.734  23.244 -3.025  1.00 193.70 ? -48 DG  I C8    1 
ATOM   6495  N  N7    . DG  I 5 25  ? 44.648  21.995 -3.397  1.00 193.78 ? -48 DG  I N7    1 
ATOM   6496  C  C5    . DG  I 5 25  ? 44.092  22.057 -4.668  1.00 193.64 ? -48 DG  I C5    1 
ATOM   6497  C  C6    . DG  I 5 25  ? 43.769  21.014 -5.580  1.00 193.68 ? -48 DG  I C6    1 
ATOM   6498  O  O6    . DG  I 5 25  ? 43.910  19.793 -5.428  1.00 193.79 ? -48 DG  I O6    1 
ATOM   6499  N  N1    . DG  I 5 25  ? 43.219  21.508 -6.767  1.00 193.64 ? -48 DG  I N1    1 
ATOM   6500  C  C2    . DG  I 5 25  ? 43.003  22.844 -7.035  1.00 193.70 ? -48 DG  I C2    1 
ATOM   6501  N  N2    . DG  I 5 25  ? 42.473  23.135 -8.232  1.00 193.72 ? -48 DG  I N2    1 
ATOM   6502  N  N3    . DG  I 5 25  ? 43.311  23.830 -6.194  1.00 193.67 ? -48 DG  I N3    1 
ATOM   6503  C  C4    . DG  I 5 25  ? 43.844  23.367 -5.031  1.00 193.50 ? -48 DG  I C4    1 
ATOM   6504  P  P     . DG  I 5 26  ? 43.187  29.694 -2.188  1.00 191.01 ? -47 DG  I P     1 
ATOM   6505  O  OP1   . DG  I 5 26  ? 44.251  30.130 -1.247  1.00 191.16 ? -47 DG  I OP1   1 
ATOM   6506  O  OP2   . DG  I 5 26  ? 41.874  29.254 -1.658  1.00 191.16 ? -47 DG  I OP2   1 
ATOM   6507  O  "O5'" . DG  I 5 26  ? 42.912  30.882 -3.245  1.00 189.38 ? -47 DG  I "O5'" 1 
ATOM   6508  C  "C5'" . DG  I 5 26  ? 43.205  30.714 -4.652  1.00 187.78 ? -47 DG  I "C5'" 1 
ATOM   6509  C  "C4'" . DG  I 5 26  ? 41.992  30.191 -5.420  1.00 186.21 ? -47 DG  I "C4'" 1 
ATOM   6510  O  "O4'" . DG  I 5 26  ? 41.991  28.747 -5.393  1.00 186.16 ? -47 DG  I "O4'" 1 
ATOM   6511  C  "C3'" . DG  I 5 26  ? 40.634  30.632 -4.875  1.00 184.64 ? -47 DG  I "C3'" 1 
ATOM   6512  O  "O3'" . DG  I 5 26  ? 40.031  31.572 -5.759  1.00 182.31 ? -47 DG  I "O3'" 1 
ATOM   6513  C  "C2'" . DG  I 5 26  ? 39.809  29.343 -4.754  1.00 185.41 ? -47 DG  I "C2'" 1 
ATOM   6514  C  "C1'" . DG  I 5 26  ? 40.668  28.275 -5.420  1.00 186.16 ? -47 DG  I "C1'" 1 
ATOM   6515  N  N9    . DG  I 5 26  ? 40.619  26.981 -4.721  1.00 186.93 ? -47 DG  I N9    1 
ATOM   6516  C  C8    . DG  I 5 26  ? 40.835  26.758 -3.376  1.00 187.19 ? -47 DG  I C8    1 
ATOM   6517  N  N7    . DG  I 5 26  ? 40.721  25.507 -3.023  1.00 187.37 ? -47 DG  I N7    1 
ATOM   6518  C  C5    . DG  I 5 26  ? 40.350  24.855 -4.195  1.00 187.49 ? -47 DG  I C5    1 
ATOM   6519  C  C6    . DG  I 5 26  ? 40.065  23.479 -4.427  1.00 187.56 ? -47 DG  I C6    1 
ATOM   6520  O  O6    . DG  I 5 26  ? 40.082  22.545 -3.610  1.00 187.64 ? -47 DG  I O6    1 
ATOM   6521  N  N1    . DG  I 5 26  ? 39.718  23.234 -5.764  1.00 187.43 ? -47 DG  I N1    1 
ATOM   6522  C  C2    . DG  I 5 26  ? 39.667  24.196 -6.754  1.00 187.42 ? -47 DG  I C2    1 
ATOM   6523  N  N2    . DG  I 5 26  ? 39.326  23.770 -7.980  1.00 187.53 ? -47 DG  I N2    1 
ATOM   6524  N  N3    . DG  I 5 26  ? 39.934  25.490 -6.552  1.00 187.36 ? -47 DG  I N3    1 
ATOM   6525  C  C4    . DG  I 5 26  ? 40.263  25.750 -5.251  1.00 187.30 ? -47 DG  I C4    1 
ATOM   6526  P  P     . DG  I 5 27  ? 38.718  32.398 -5.327  1.00 180.14 ? -46 DG  I P     1 
ATOM   6527  O  OP1   . DG  I 5 27  ? 38.741  33.693 -6.049  1.00 180.14 ? -46 DG  I OP1   1 
ATOM   6528  O  OP2   . DG  I 5 27  ? 38.609  32.385 -3.848  1.00 179.99 ? -46 DG  I OP2   1 
ATOM   6529  O  "O5'" . DG  I 5 27  ? 37.530  31.496 -5.913  1.00 178.28 ? -46 DG  I "O5'" 1 
ATOM   6530  C  "C5'" . DG  I 5 27  ? 37.513  31.131 -7.304  1.00 176.35 ? -46 DG  I "C5'" 1 
ATOM   6531  C  "C4'" . DG  I 5 27  ? 36.684  29.872 -7.537  1.00 174.31 ? -46 DG  I "C4'" 1 
ATOM   6532  O  "O4'" . DG  I 5 27  ? 37.089  28.825 -6.617  1.00 174.09 ? -46 DG  I "O4'" 1 
ATOM   6533  C  "C3'" . DG  I 5 27  ? 35.177  30.036 -7.366  1.00 172.44 ? -46 DG  I "C3'" 1 
ATOM   6534  O  "O3'" . DG  I 5 27  ? 34.497  29.357 -8.411  1.00 169.91 ? -46 DG  I "O3'" 1 
ATOM   6535  C  "C2'" . DG  I 5 27  ? 34.898  29.401 -6.003  1.00 173.19 ? -46 DG  I "C2'" 1 
ATOM   6536  C  "C1'" . DG  I 5 27  ? 35.958  28.311 -5.947  1.00 173.97 ? -46 DG  I "C1'" 1 
ATOM   6537  N  N9    . DG  I 5 27  ? 36.359  27.916 -4.590  1.00 174.81 ? -46 DG  I N9    1 
ATOM   6538  C  C8    . DG  I 5 27  ? 36.626  28.740 -3.512  1.00 175.10 ? -46 DG  I C8    1 
ATOM   6539  N  N7    . DG  I 5 27  ? 37.024  28.095 -2.445  1.00 175.08 ? -46 DG  I N7    1 
ATOM   6540  C  C5    . DG  I 5 27  ? 37.013  26.760 -2.832  1.00 175.06 ? -46 DG  I C5    1 
ATOM   6541  C  C6    . DG  I 5 27  ? 37.339  25.586 -2.098  1.00 175.11 ? -46 DG  I C6    1 
ATOM   6542  O  O6    . DG  I 5 27  ? 37.709  25.496 -0.912  1.00 175.36 ? -46 DG  I O6    1 
ATOM   6543  N  N1    . DG  I 5 27  ? 37.197  24.427 -2.883  1.00 174.89 ? -46 DG  I N1    1 
ATOM   6544  C  C2    . DG  I 5 27  ? 36.790  24.414 -4.207  1.00 174.67 ? -46 DG  I C2    1 
ATOM   6545  N  N2    . DG  I 5 27  ? 36.714  23.222 -4.807  1.00 174.22 ? -46 DG  I N2    1 
ATOM   6546  N  N3    . DG  I 5 27  ? 36.493  25.504 -4.899  1.00 175.06 ? -46 DG  I N3    1 
ATOM   6547  C  C4    . DG  I 5 27  ? 36.619  26.637 -4.155  1.00 175.08 ? -46 DG  I C4    1 
ATOM   6548  P  P     . DT  I 5 28  ? 33.127  29.941 -8.988  1.00 167.75 ? -45 DT  I P     1 
ATOM   6549  O  OP1   . DT  I 5 28  ? 33.445  30.750 -10.189 1.00 167.97 ? -45 DT  I OP1   1 
ATOM   6550  O  OP2   . DT  I 5 28  ? 32.376  30.548 -7.864  1.00 167.63 ? -45 DT  I OP2   1 
ATOM   6551  O  "O5'" . DT  I 5 28  ? 32.325  28.632 -9.444  1.00 165.62 ? -45 DT  I "O5'" 1 
ATOM   6552  C  "C5'" . DT  I 5 28  ? 32.906  27.692 -10.340 1.00 163.25 ? -45 DT  I "C5'" 1 
ATOM   6553  C  "C4'" . DT  I 5 28  ? 32.615  26.275 -9.880  1.00 161.01 ? -45 DT  I "C4'" 1 
ATOM   6554  O  "O4'" . DT  I 5 28  ? 33.244  26.038 -8.587  1.00 161.06 ? -45 DT  I "O4'" 1 
ATOM   6555  C  "C3'" . DT  I 5 28  ? 31.128  25.940 -9.702  1.00 158.91 ? -45 DT  I "C3'" 1 
ATOM   6556  O  "O3'" . DT  I 5 28  ? 30.799  24.769 -10.440 1.00 155.68 ? -45 DT  I "O3'" 1 
ATOM   6557  C  "C2'" . DT  I 5 28  ? 30.981  25.709 -8.194  1.00 159.91 ? -45 DT  I "C2'" 1 
ATOM   6558  C  "C1'" . DT  I 5 28  ? 32.381  25.255 -7.805  1.00 160.76 ? -45 DT  I "C1'" 1 
ATOM   6559  N  N1    . DT  I 5 28  ? 32.709  25.451 -6.343  1.00 161.52 ? -45 DT  I N1    1 
ATOM   6560  C  C2    . DT  I 5 28  ? 33.269  24.399 -5.622  1.00 162.79 ? -45 DT  I C2    1 
ATOM   6561  O  O2    . DT  I 5 28  ? 33.569  23.322 -6.114  1.00 163.59 ? -45 DT  I O2    1 
ATOM   6562  N  N3    . DT  I 5 28  ? 33.483  24.666 -4.289  1.00 162.87 ? -45 DT  I N3    1 
ATOM   6563  C  C4    . DT  I 5 28  ? 33.188  25.843 -3.612  1.00 162.70 ? -45 DT  I C4    1 
ATOM   6564  O  O4    . DT  I 5 28  ? 33.449  25.926 -2.416  1.00 163.00 ? -45 DT  I O4    1 
ATOM   6565  C  C5    . DT  I 5 28  ? 32.588  26.897 -4.418  1.00 161.88 ? -45 DT  I C5    1 
ATOM   6566  C  C7    . DT  I 5 28  ? 32.212  28.210 -3.794  1.00 161.71 ? -45 DT  I C7    1 
ATOM   6567  C  C6    . DT  I 5 28  ? 32.377  26.651 -5.723  1.00 161.50 ? -45 DT  I C6    1 
ATOM   6568  P  P     . DT  I 5 29  ? 29.312  24.467 -10.927 1.00 152.92 ? -44 DT  I P     1 
ATOM   6569  O  OP1   . DT  I 5 29  ? 29.289  24.633 -12.379 1.00 152.72 ? -44 DT  I OP1   1 
ATOM   6570  O  OP2   . DT  I 5 29  ? 28.397  25.243 -10.078 1.00 152.35 ? -44 DT  I OP2   1 
ATOM   6571  O  "O5'" . DT  I 5 29  ? 29.104  22.955 -10.493 1.00 152.90 ? -44 DT  I "O5'" 1 
ATOM   6572  C  "C5'" . DT  I 5 29  ? 30.223  22.161 -10.075 1.00 153.22 ? -44 DT  I "C5'" 1 
ATOM   6573  C  "C4'" . DT  I 5 29  ? 29.850  21.229 -8.944  1.00 153.26 ? -44 DT  I "C4'" 1 
ATOM   6574  O  "O4'" . DT  I 5 29  ? 30.264  21.792 -7.678  1.00 152.96 ? -44 DT  I "O4'" 1 
ATOM   6575  C  "C3'" . DT  I 5 29  ? 28.368  20.894 -8.785  1.00 153.77 ? -44 DT  I "C3'" 1 
ATOM   6576  O  "O3'" . DT  I 5 29  ? 28.362  19.504 -8.462  1.00 154.63 ? -44 DT  I "O3'" 1 
ATOM   6577  C  "C2'" . DT  I 5 29  ? 27.954  21.745 -7.599  1.00 153.30 ? -44 DT  I "C2'" 1 
ATOM   6578  C  "C1'" . DT  I 5 29  ? 29.202  21.687 -6.751  1.00 153.34 ? -44 DT  I "C1'" 1 
ATOM   6579  N  N1    . DT  I 5 29  ? 29.359  22.765 -5.765  1.00 154.20 ? -44 DT  I N1    1 
ATOM   6580  C  C2    . DT  I 5 29  ? 30.427  22.695 -4.905  1.00 155.35 ? -44 DT  I C2    1 
ATOM   6581  O  O2    . DT  I 5 29  ? 31.237  21.786 -4.921  1.00 155.45 ? -44 DT  I O2    1 
ATOM   6582  N  N3    . DT  I 5 29  ? 30.523  23.743 -4.027  1.00 156.03 ? -44 DT  I N3    1 
ATOM   6583  C  C4    . DT  I 5 29  ? 29.677  24.828 -3.927  1.00 155.95 ? -44 DT  I C4    1 
ATOM   6584  O  O4    . DT  I 5 29  ? 29.889  25.693 -3.085  1.00 156.51 ? -44 DT  I O4    1 
ATOM   6585  C  C5    . DT  I 5 29  ? 28.573  24.833 -4.853  1.00 155.16 ? -44 DT  I C5    1 
ATOM   6586  C  C7    . DT  I 5 29  ? 27.599  25.965 -4.810  1.00 155.39 ? -44 DT  I C7    1 
ATOM   6587  C  C6    . DT  I 5 29  ? 28.469  23.813 -5.713  1.00 154.56 ? -44 DT  I C6    1 
ATOM   6588  P  P     . DA  I 5 30  ? 27.039  18.643 -8.510  1.00 155.77 ? -43 DA  I P     1 
ATOM   6589  O  OP1   . DA  I 5 30  ? 27.227  17.562 -9.490  1.00 155.61 ? -43 DA  I OP1   1 
ATOM   6590  O  OP2   . DA  I 5 30  ? 25.881  19.528 -8.632  1.00 155.51 ? -43 DA  I OP2   1 
ATOM   6591  O  "O5'" . DA  I 5 30  ? 26.968  18.034 -7.041  1.00 158.19 ? -43 DA  I "O5'" 1 
ATOM   6592  C  "C5'" . DA  I 5 30  ? 28.091  17.351 -6.433  1.00 160.44 ? -43 DA  I "C5'" 1 
ATOM   6593  C  "C4'" . DA  I 5 30  ? 27.890  17.164 -4.945  1.00 162.51 ? -43 DA  I "C4'" 1 
ATOM   6594  O  "O4'" . DA  I 5 30  ? 28.108  18.416 -4.257  1.00 162.93 ? -43 DA  I "O4'" 1 
ATOM   6595  C  "C3'" . DA  I 5 30  ? 26.513  16.668 -4.499  1.00 164.84 ? -43 DA  I "C3'" 1 
ATOM   6596  O  "O3'" . DA  I 5 30  ? 26.696  15.708 -3.455  1.00 168.25 ? -43 DA  I "O3'" 1 
ATOM   6597  C  "C2'" . DA  I 5 30  ? 25.862  17.911 -3.924  1.00 164.27 ? -43 DA  I "C2'" 1 
ATOM   6598  C  "C1'" . DA  I 5 30  ? 27.057  18.633 -3.341  1.00 164.10 ? -43 DA  I "C1'" 1 
ATOM   6599  N  N9    . DA  I 5 30  ? 26.897  20.076 -3.174  1.00 165.42 ? -43 DA  I N9    1 
ATOM   6600  C  C8    . DA  I 5 30  ? 26.491  20.990 -4.112  1.00 165.94 ? -43 DA  I C8    1 
ATOM   6601  N  N7    . DA  I 5 30  ? 26.445  22.221 -3.666  1.00 166.31 ? -43 DA  I N7    1 
ATOM   6602  C  C5    . DA  I 5 30  ? 26.845  22.111 -2.344  1.00 166.77 ? -43 DA  I C5    1 
ATOM   6603  C  C6    . DA  I 5 30  ? 27.008  23.063 -1.324  1.00 167.28 ? -43 DA  I C6    1 
ATOM   6604  N  N6    . DA  I 5 30  ? 26.771  24.367 -1.484  1.00 167.29 ? -43 DA  I N6    1 
ATOM   6605  N  N1    . DA  I 5 30  ? 27.424  22.625 -0.116  1.00 167.36 ? -43 DA  I N1    1 
ATOM   6606  C  C2    . DA  I 5 30  ? 27.661  21.318 0.042   1.00 167.23 ? -43 DA  I C2    1 
ATOM   6607  N  N3    . DA  I 5 30  ? 27.546  20.327 -0.839  1.00 166.96 ? -43 DA  I N3    1 
ATOM   6608  C  C4    . DA  I 5 30  ? 27.129  20.796 -2.027  1.00 166.39 ? -43 DA  I C4    1 
ATOM   6609  P  P     . DG  I 5 31  ? 25.670  14.509 -3.247  1.00 171.35 ? -42 DG  I P     1 
ATOM   6610  O  OP1   . DG  I 5 31  ? 26.428  13.244 -3.302  1.00 170.94 ? -42 DG  I OP1   1 
ATOM   6611  O  OP2   . DG  I 5 31  ? 24.532  14.710 -4.154  1.00 171.38 ? -42 DG  I OP2   1 
ATOM   6612  O  "O5'" . DG  I 5 31  ? 25.125  14.759 -1.774  1.00 174.38 ? -42 DG  I "O5'" 1 
ATOM   6613  C  "C5'" . DG  I 5 31  ? 25.959  14.533 -0.625  1.00 177.31 ? -42 DG  I "C5'" 1 
ATOM   6614  C  "C4'" . DG  I 5 31  ? 25.370  15.177 0.610   1.00 180.32 ? -42 DG  I "C4'" 1 
ATOM   6615  O  "O4'" . DG  I 5 31  ? 25.220  16.601 0.410   1.00 180.88 ? -42 DG  I "O4'" 1 
ATOM   6616  C  "C3'" . DG  I 5 31  ? 24.001  14.650 1.053   1.00 182.90 ? -42 DG  I "C3'" 1 
ATOM   6617  O  "O3'" . DG  I 5 31  ? 24.012  14.456 2.470   1.00 186.38 ? -42 DG  I "O3'" 1 
ATOM   6618  C  "C2'" . DG  I 5 31  ? 23.048  15.775 0.701   1.00 182.20 ? -42 DG  I "C2'" 1 
ATOM   6619  C  "C1'" . DG  I 5 31  ? 23.921  17.015 0.787   1.00 181.71 ? -42 DG  I "C1'" 1 
ATOM   6620  N  N9    . DG  I 5 31  ? 23.500  18.054 -0.144  1.00 182.13 ? -42 DG  I N9    1 
ATOM   6621  C  C8    . DG  I 5 31  ? 22.953  17.857 -1.388  1.00 182.30 ? -42 DG  I C8    1 
ATOM   6622  N  N7    . DG  I 5 31  ? 22.657  18.969 -2.000  1.00 182.42 ? -42 DG  I N7    1 
ATOM   6623  C  C5    . DG  I 5 31  ? 23.028  19.962 -1.105  1.00 182.48 ? -42 DG  I C5    1 
ATOM   6624  C  C6    . DG  I 5 31  ? 22.948  21.376 -1.217  1.00 182.47 ? -42 DG  I C6    1 
ATOM   6625  O  O6    . DG  I 5 31  ? 22.521  22.051 -2.160  1.00 182.29 ? -42 DG  I O6    1 
ATOM   6626  N  N1    . DG  I 5 31  ? 23.436  22.008 -0.079  1.00 182.49 ? -42 DG  I N1    1 
ATOM   6627  C  C2    . DG  I 5 31  ? 23.950  21.365 1.018   1.00 182.35 ? -42 DG  I C2    1 
ATOM   6628  N  N2    . DG  I 5 31  ? 24.365  22.155 2.016   1.00 182.26 ? -42 DG  I N2    1 
ATOM   6629  N  N3    . DG  I 5 31  ? 24.016  20.047 1.142   1.00 182.23 ? -42 DG  I N3    1 
ATOM   6630  C  C4    . DG  I 5 31  ? 23.548  19.413 0.047   1.00 182.29 ? -42 DG  I C4    1 
ATOM   6631  P  P     . DG  I 5 32  ? 22.778  13.774 3.220   1.00 189.42 ? -41 DG  I P     1 
ATOM   6632  O  OP1   . DG  I 5 32  ? 23.339  12.927 4.311   1.00 189.36 ? -41 DG  I OP1   1 
ATOM   6633  O  OP2   . DG  I 5 32  ? 21.886  13.161 2.202   1.00 189.61 ? -41 DG  I OP2   1 
ATOM   6634  O  "O5'" . DG  I 5 32  ? 21.999  15.033 3.862   1.00 191.56 ? -41 DG  I "O5'" 1 
ATOM   6635  C  "C5'" . DG  I 5 32  ? 22.261  15.437 5.213   1.00 193.38 ? -41 DG  I "C5'" 1 
ATOM   6636  C  "C4'" . DG  I 5 32  ? 22.107  16.944 5.410   1.00 195.12 ? -41 DG  I "C4'" 1 
ATOM   6637  O  "O4'" . DG  I 5 32  ? 22.368  17.663 4.189   1.00 195.48 ? -41 DG  I "O4'" 1 
ATOM   6638  C  "C3'" . DG  I 5 32  ? 20.727  17.417 5.813   1.00 196.42 ? -41 DG  I "C3'" 1 
ATOM   6639  O  "O3'" . DG  I 5 32  ? 20.521  17.190 7.219   1.00 197.86 ? -41 DG  I "O3'" 1 
ATOM   6640  C  "C2'" . DG  I 5 32  ? 20.810  18.912 5.491   1.00 196.17 ? -41 DG  I "C2'" 1 
ATOM   6641  C  "C1'" . DG  I 5 32  ? 21.786  18.952 4.305   1.00 196.11 ? -41 DG  I "C1'" 1 
ATOM   6642  N  N9    . DG  I 5 32  ? 21.152  19.321 3.034   1.00 196.77 ? -41 DG  I N9    1 
ATOM   6643  C  C8    . DG  I 5 32  ? 20.529  18.482 2.138   1.00 196.93 ? -41 DG  I C8    1 
ATOM   6644  N  N7    . DG  I 5 32  ? 20.041  19.101 1.096   1.00 197.07 ? -41 DG  I N7    1 
ATOM   6645  C  C5    . DG  I 5 32  ? 20.328  20.443 1.327   1.00 197.18 ? -41 DG  I C5    1 
ATOM   6646  C  C6    . DG  I 5 32  ? 20.041  21.601 0.538   1.00 197.34 ? -41 DG  I C6    1 
ATOM   6647  O  O6    . DG  I 5 32  ? 19.471  21.663 -0.560  1.00 197.35 ? -41 DG  I O6    1 
ATOM   6648  N  N1    . DG  I 5 32  ? 20.526  22.769 1.130   1.00 197.48 ? -41 DG  I N1    1 
ATOM   6649  C  C2    . DG  I 5 32  ? 21.187  22.819 2.340   1.00 197.75 ? -41 DG  I C2    1 
ATOM   6650  N  N2    . DG  I 5 32  ? 21.595  24.028 2.742   1.00 198.15 ? -41 DG  I N2    1 
ATOM   6651  N  N3    . DG  I 5 32  ? 21.461  21.749 3.087   1.00 197.47 ? -41 DG  I N3    1 
ATOM   6652  C  C4    . DG  I 5 32  ? 21.006  20.596 2.521   1.00 197.14 ? -41 DG  I C4    1 
ATOM   6653  P  P     . DG  I 5 33  ? 19.119  16.620 7.765   1.00 198.84 ? -40 DG  I P     1 
ATOM   6654  O  OP1   . DG  I 5 33  ? 19.225  16.486 9.245   1.00 198.76 ? -40 DG  I OP1   1 
ATOM   6655  O  OP2   . DG  I 5 33  ? 18.755  15.437 6.945   1.00 199.03 ? -40 DG  I OP2   1 
ATOM   6656  O  "O5'" . DG  I 5 33  ? 18.084  17.799 7.408   1.00 199.17 ? -40 DG  I "O5'" 1 
ATOM   6657  C  "C5'" . DG  I 5 33  ? 18.087  19.019 8.159   1.00 199.47 ? -40 DG  I "C5'" 1 
ATOM   6658  C  "C4'" . DG  I 5 33  ? 17.311  20.111 7.440   1.00 199.74 ? -40 DG  I "C4'" 1 
ATOM   6659  O  "O4'" . DG  I 5 33  ? 17.729  20.178 6.058   1.00 199.56 ? -40 DG  I "O4'" 1 
ATOM   6660  C  "C3'" . DG  I 5 33  ? 15.783  19.926 7.417   1.00 200.19 ? -40 DG  I "C3'" 1 
ATOM   6661  O  "O3'" . DG  I 5 33  ? 15.137  20.999 8.119   1.00 200.92 ? -40 DG  I "O3'" 1 
ATOM   6662  C  "C2'" . DG  I 5 33  ? 15.421  19.934 5.927   1.00 199.78 ? -40 DG  I "C2'" 1 
ATOM   6663  C  "C1'" . DG  I 5 33  ? 16.635  20.595 5.296   1.00 199.44 ? -40 DG  I "C1'" 1 
ATOM   6664  N  N9    . DG  I 5 33  ? 16.837  20.211 3.901   1.00 199.03 ? -40 DG  I N9    1 
ATOM   6665  C  C8    . DG  I 5 33  ? 17.102  18.950 3.412   1.00 198.95 ? -40 DG  I C8    1 
ATOM   6666  N  N7    . DG  I 5 33  ? 17.119  18.892 2.107   1.00 198.81 ? -40 DG  I N7    1 
ATOM   6667  C  C5    . DG  I 5 33  ? 16.828  20.189 1.705   1.00 198.54 ? -40 DG  I C5    1 
ATOM   6668  C  C6    . DG  I 5 33  ? 16.690  20.738 0.404   1.00 198.19 ? -40 DG  I C6    1 
ATOM   6669  O  O6    . DG  I 5 33  ? 16.846  20.172 -0.686  1.00 198.23 ? -40 DG  I O6    1 
ATOM   6670  N  N1    . DG  I 5 33  ? 16.402  22.108 0.445   1.00 197.91 ? -40 DG  I N1    1 
ATOM   6671  C  C2    . DG  I 5 33  ? 16.219  22.838 1.599   1.00 197.80 ? -40 DG  I C2    1 
ATOM   6672  N  N2    . DG  I 5 33  ? 15.902  24.127 1.450   1.00 197.50 ? -40 DG  I N2    1 
ATOM   6673  N  N3    . DG  I 5 33  ? 16.315  22.330 2.818   1.00 198.21 ? -40 DG  I N3    1 
ATOM   6674  C  C4    . DG  I 5 33  ? 16.627  21.006 2.799   1.00 198.62 ? -40 DG  I C4    1 
ATOM   6675  P  P     . DT  I 5 34  ? 13.667  20.815 8.766   1.00 201.42 ? -39 DT  I P     1 
ATOM   6676  O  OP1   . DT  I 5 34  ? 13.788  20.992 10.238  1.00 201.49 ? -39 DT  I OP1   1 
ATOM   6677  O  OP2   . DT  I 5 34  ? 13.056  19.576 8.228   1.00 201.60 ? -39 DT  I OP2   1 
ATOM   6678  O  "O5'" . DT  I 5 34  ? 12.856  22.052 8.152   1.00 201.23 ? -39 DT  I "O5'" 1 
ATOM   6679  C  "C5'" . DT  I 5 34  ? 13.357  23.371 8.290   1.00 201.25 ? -39 DT  I "C5'" 1 
ATOM   6680  C  "C4'" . DT  I 5 34  ? 13.085  24.183 7.045   1.00 201.58 ? -39 DT  I "C4'" 1 
ATOM   6681  O  "O4'" . DT  I 5 34  ? 13.509  23.456 5.875   1.00 201.85 ? -39 DT  I "O4'" 1 
ATOM   6682  C  "C3'" . DT  I 5 34  ? 11.615  24.536 6.804   1.00 201.74 ? -39 DT  I "C3'" 1 
ATOM   6683  O  "O3'" . DT  I 5 34  ? 11.408  25.931 7.065   1.00 201.65 ? -39 DT  I "O3'" 1 
ATOM   6684  C  "C2'" . DT  I 5 34  ? 11.370  24.187 5.321   1.00 201.95 ? -39 DT  I "C2'" 1 
ATOM   6685  C  "C1'" . DT  I 5 34  ? 12.779  23.957 4.786   1.00 202.05 ? -39 DT  I "C1'" 1 
ATOM   6686  N  N1    . DT  I 5 34  ? 12.849  22.980 3.619   1.00 202.19 ? -39 DT  I N1    1 
ATOM   6687  C  C2    . DT  I 5 34  ? 12.928  23.470 2.317   1.00 201.92 ? -39 DT  I C2    1 
ATOM   6688  O  O2    . DT  I 5 34  ? 13.010  24.658 2.042   1.00 201.70 ? -39 DT  I O2    1 
ATOM   6689  N  N3    . DT  I 5 34  ? 12.975  22.500 1.342   1.00 201.95 ? -39 DT  I N3    1 
ATOM   6690  C  C4    . DT  I 5 34  ? 12.925  21.125 1.512   1.00 202.15 ? -39 DT  I C4    1 
ATOM   6691  O  O4    . DT  I 5 34  ? 12.967  20.396 0.520   1.00 202.04 ? -39 DT  I O4    1 
ATOM   6692  C  C5    . DT  I 5 34  ? 12.806  20.674 2.894   1.00 202.45 ? -39 DT  I C5    1 
ATOM   6693  C  C7    . DT  I 5 34  ? 12.735  19.207 3.217   1.00 202.57 ? -39 DT  I C7    1 
ATOM   6694  C  C6    . DT  I 5 34  ? 12.769  21.610 3.865   1.00 202.44 ? -39 DT  I C6    1 
ATOM   6695  P  P     . DT  I 5 35  ? 9.932   26.524 7.319   1.00 201.12 ? -38 DT  I P     1 
ATOM   6696  O  OP1   . DT  I 5 35  ? 10.070  27.754 8.141   1.00 201.45 ? -38 DT  I OP1   1 
ATOM   6697  O  OP2   . DT  I 5 35  ? 9.058   25.418 7.792   1.00 201.39 ? -38 DT  I OP2   1 
ATOM   6698  O  "O5'" . DT  I 5 35  ? 9.457   26.934 5.843   1.00 199.01 ? -38 DT  I "O5'" 1 
ATOM   6699  C  "C5'" . DT  I 5 35  ? 10.207  27.887 5.087   1.00 196.96 ? -38 DT  I "C5'" 1 
ATOM   6700  C  "C4'" . DT  I 5 35  ? 9.806   27.863 3.625   1.00 195.05 ? -38 DT  I "C4'" 1 
ATOM   6701  O  "O4'" . DT  I 5 35  ? 10.252  26.631 3.015   1.00 194.86 ? -38 DT  I "O4'" 1 
ATOM   6702  C  "C3'" . DT  I 5 35  ? 8.293   27.947 3.356   1.00 193.40 ? -38 DT  I "C3'" 1 
ATOM   6703  O  "O3'" . DT  I 5 35  ? 7.987   29.144 2.641   1.00 191.08 ? -38 DT  I "O3'" 1 
ATOM   6704  C  "C2'" . DT  I 5 35  ? 7.986   26.695 2.518   1.00 194.08 ? -38 DT  I "C2'" 1 
ATOM   6705  C  "C1'" . DT  I 5 35  ? 9.361   26.326 1.978   1.00 194.57 ? -38 DT  I "C1'" 1 
ATOM   6706  N  N1    . DT  I 5 35  ? 9.521   24.859 1.569   1.00 194.53 ? -38 DT  I N1    1 
ATOM   6707  C  C2    . DT  I 5 35  ? 10.132  24.561 0.358   1.00 194.26 ? -38 DT  I C2    1 
ATOM   6708  O  O2    . DT  I 5 35  ? 10.578  25.412 -0.395  1.00 194.08 ? -38 DT  I O2    1 
ATOM   6709  N  N3    . DT  I 5 35  ? 10.209  23.216 0.064   1.00 194.16 ? -38 DT  I N3    1 
ATOM   6710  C  C4    . DT  I 5 35  ? 9.731   22.158 0.829   1.00 194.20 ? -38 DT  I C4    1 
ATOM   6711  O  O4    . DT  I 5 35  ? 9.872   21.007 0.418   1.00 194.19 ? -38 DT  I O4    1 
ATOM   6712  C  C5    . DT  I 5 35  ? 9.075   22.534 2.073   1.00 194.29 ? -38 DT  I C5    1 
ATOM   6713  C  C7    . DT  I 5 35  ? 8.512   21.480 2.985   1.00 194.22 ? -38 DT  I C7    1 
ATOM   6714  C  C6    . DT  I 5 35  ? 9.007   23.847 2.383   1.00 194.47 ? -38 DT  I C6    1 
ATOM   6715  P  P     . DA  I 5 36  ? 6.519   29.803 2.715   1.00 188.72 ? -37 DA  I P     1 
ATOM   6716  O  OP1   . DA  I 5 36  ? 6.678   31.218 3.128   1.00 188.84 ? -37 DA  I OP1   1 
ATOM   6717  O  OP2   . DA  I 5 36  ? 5.624   28.899 3.485   1.00 188.54 ? -37 DA  I OP2   1 
ATOM   6718  O  "O5'" . DA  I 5 36  ? 6.034   29.773 1.196   1.00 186.23 ? -37 DA  I "O5'" 1 
ATOM   6719  C  "C5'" . DA  I 5 36  ? 6.832   30.349 0.174   1.00 183.48 ? -37 DA  I "C5'" 1 
ATOM   6720  C  "C4'" . DA  I 5 36  ? 6.600   29.634 -1.141  1.00 180.69 ? -37 DA  I "C4'" 1 
ATOM   6721  O  "O4'" . DA  I 5 36  ? 7.017   28.252 -1.032  1.00 180.22 ? -37 DA  I "O4'" 1 
ATOM   6722  C  "C3'" . DA  I 5 36  ? 5.143   29.609 -1.616  1.00 178.43 ? -37 DA  I "C3'" 1 
ATOM   6723  O  "O3'" . DA  I 5 36  ? 5.079   30.133 -2.916  1.00 175.83 ? -37 DA  I "O3'" 1 
ATOM   6724  C  "C2'" . DA  I 5 36  ? 4.770   28.122 -1.594  1.00 179.00 ? -37 DA  I "C2'" 1 
ATOM   6725  C  "C1'" . DA  I 5 36  ? 6.127   27.461 -1.766  1.00 179.89 ? -37 DA  I "C1'" 1 
ATOM   6726  N  N9    . DA  I 5 36  ? 6.198   26.094 -1.265  1.00 180.63 ? -37 DA  I N9    1 
ATOM   6727  C  C8    . DA  I 5 36  ? 5.689   25.615 -0.088  1.00 181.01 ? -37 DA  I C8    1 
ATOM   6728  N  N7    . DA  I 5 36  ? 5.901   24.335 0.103   1.00 181.39 ? -37 DA  I N7    1 
ATOM   6729  C  C5    . DA  I 5 36  ? 6.606   23.943 -1.020  1.00 181.64 ? -37 DA  I C5    1 
ATOM   6730  C  C6    . DA  I 5 36  ? 7.137   22.692 -1.427  1.00 182.08 ? -37 DA  I C6    1 
ATOM   6731  N  N6    . DA  I 5 36  ? 7.028   21.576 -0.698  1.00 182.26 ? -37 DA  I N6    1 
ATOM   6732  N  N1    . DA  I 5 36  ? 7.787   22.637 -2.623  1.00 182.25 ? -37 DA  I N1    1 
ATOM   6733  C  C2    . DA  I 5 36  ? 7.895   23.765 -3.357  1.00 182.18 ? -37 DA  I C2    1 
ATOM   6734  N  N3    . DA  I 5 36  ? 7.439   24.997 -3.076  1.00 181.90 ? -37 DA  I N3    1 
ATOM   6735  C  C4    . DA  I 5 36  ? 6.801   25.018 -1.879  1.00 181.40 ? -37 DA  I C4    1 
ATOM   6736  P  P     . DG  I 5 37  ? 3.813   30.979 -3.409  1.00 173.06 ? -36 DG  I P     1 
ATOM   6737  O  OP1   . DG  I 5 37  ? 4.146   32.420 -3.275  1.00 173.28 ? -36 DG  I OP1   1 
ATOM   6738  O  OP2   . DG  I 5 37  ? 2.596   30.427 -2.753  1.00 172.73 ? -36 DG  I OP2   1 
ATOM   6739  O  "O5'" . DG  I 5 37  ? 3.743   30.620 -4.972  1.00 169.89 ? -36 DG  I "O5'" 1 
ATOM   6740  C  "C5'" . DG  I 5 37  ? 4.936   30.243 -5.690  1.00 166.47 ? -36 DG  I "C5'" 1 
ATOM   6741  C  "C4'" . DG  I 5 37  ? 4.740   28.932 -6.441  1.00 162.93 ? -36 DG  I "C4'" 1 
ATOM   6742  O  "O4'" . DG  I 5 37  ? 4.667   27.824 -5.511  1.00 162.30 ? -36 DG  I "O4'" 1 
ATOM   6743  C  "C3'" . DG  I 5 37  ? 3.478   28.858 -7.302  1.00 160.29 ? -36 DG  I "C3'" 1 
ATOM   6744  O  "O3'" . DG  I 5 37  ? 3.819   28.462 -8.593  1.00 157.17 ? -36 DG  I "O3'" 1 
ATOM   6745  C  "C2'" . DG  I 5 37  ? 2.611   27.814 -6.606  1.00 161.08 ? -36 DG  I "C2'" 1 
ATOM   6746  C  "C1'" . DG  I 5 37  ? 3.659   26.947 -5.938  1.00 162.21 ? -36 DG  I "C1'" 1 
ATOM   6747  N  N9    . DG  I 5 37  ? 3.166   26.189 -4.795  1.00 163.75 ? -36 DG  I N9    1 
ATOM   6748  C  C8    . DG  I 5 37  ? 2.284   26.612 -3.817  1.00 164.27 ? -36 DG  I C8    1 
ATOM   6749  N  N7    . DG  I 5 37  ? 2.000   25.687 -2.936  1.00 164.60 ? -36 DG  I N7    1 
ATOM   6750  C  C5    . DG  I 5 37  ? 2.732   24.579 -3.357  1.00 164.98 ? -36 DG  I C5    1 
ATOM   6751  C  C6    . DG  I 5 37  ? 2.841   23.270 -2.793  1.00 165.38 ? -36 DG  I C6    1 
ATOM   6752  O  O6    . DG  I 5 37  ? 2.268   22.812 -1.795  1.00 165.60 ? -36 DG  I O6    1 
ATOM   6753  N  N1    . DG  I 5 37  ? 3.686   22.445 -3.546  1.00 165.63 ? -36 DG  I N1    1 
ATOM   6754  C  C2    . DG  I 5 37  ? 4.366   22.842 -4.684  1.00 166.09 ? -36 DG  I C2    1 
ATOM   6755  N  N2    . DG  I 5 37  ? 5.163   21.929 -5.252  1.00 166.63 ? -36 DG  I N2    1 
ATOM   6756  N  N3    . DG  I 5 37  ? 4.287   24.065 -5.214  1.00 165.55 ? -36 DG  I N3    1 
ATOM   6757  C  C4    . DG  I 5 37  ? 3.447   24.875 -4.507  1.00 164.86 ? -36 DG  I C4    1 
ATOM   6758  P  P     . DG  I 5 38  ? 3.812   29.427 -9.781  1.00 154.40 ? -35 DG  I P     1 
ATOM   6759  O  OP1   . DG  I 5 38  ? 4.782   30.494 -9.494  1.00 154.09 ? -35 DG  I OP1   1 
ATOM   6760  O  OP2   . DG  I 5 38  ? 2.411   29.754 -10.097 1.00 154.19 ? -35 DG  I OP2   1 
ATOM   6761  O  "O5'" . DG  I 5 38  ? 4.421   28.474 -10.892 1.00 152.19 ? -35 DG  I "O5'" 1 
ATOM   6762  C  "C5'" . DG  I 5 38  ? 5.593   27.713 -10.561 1.00 149.41 ? -35 DG  I "C5'" 1 
ATOM   6763  C  "C4'" . DG  I 5 38  ? 5.461   26.276 -11.001 1.00 146.36 ? -35 DG  I "C4'" 1 
ATOM   6764  O  "O4'" . DG  I 5 38  ? 4.654   25.545 -10.052 1.00 145.39 ? -35 DG  I "O4'" 1 
ATOM   6765  C  "C3'" . DG  I 5 38  ? 4.797   26.057 -12.358 1.00 144.40 ? -35 DG  I "C3'" 1 
ATOM   6766  O  "O3'" . DG  I 5 38  ? 5.441   24.907 -12.910 1.00 141.97 ? -35 DG  I "O3'" 1 
ATOM   6767  C  "C2'" . DG  I 5 38  ? 3.363   25.760 -11.967 1.00 144.71 ? -35 DG  I "C2'" 1 
ATOM   6768  C  "C1'" . DG  I 5 38  ? 3.573   24.935 -10.726 1.00 145.24 ? -35 DG  I "C1'" 1 
ATOM   6769  N  N9    . DG  I 5 38  ? 2.433   24.953 -9.829  1.00 146.15 ? -35 DG  I N9    1 
ATOM   6770  C  C8    . DG  I 5 38  ? 1.450   25.908 -9.759  1.00 146.65 ? -35 DG  I C8    1 
ATOM   6771  N  N7    . DG  I 5 38  ? 0.570   25.668 -8.826  1.00 147.00 ? -35 DG  I N7    1 
ATOM   6772  C  C5    . DG  I 5 38  ? 0.996   24.480 -8.251  1.00 147.17 ? -35 DG  I C5    1 
ATOM   6773  C  C6    . DG  I 5 38  ? 0.454   23.737 -7.172  1.00 147.18 ? -35 DG  I C6    1 
ATOM   6774  O  O6    . DG  I 5 38  ? -0.574  23.959 -6.528  1.00 146.59 ? -35 DG  I O6    1 
ATOM   6775  N  N1    . DG  I 5 38  ? 1.192   22.587 -6.920  1.00 148.06 ? -35 DG  I N1    1 
ATOM   6776  C  C2    . DG  I 5 38  ? 2.336   22.226 -7.585  1.00 148.67 ? -35 DG  I C2    1 
ATOM   6777  N  N2    . DG  I 5 38  ? 2.911   21.087 -7.187  1.00 149.59 ? -35 DG  I N2    1 
ATOM   6778  N  N3    . DG  I 5 38  ? 2.866   22.923 -8.577  1.00 147.53 ? -35 DG  I N3    1 
ATOM   6779  C  C4    . DG  I 5 38  ? 2.148   24.029 -8.857  1.00 146.91 ? -35 DG  I C4    1 
ATOM   6780  P  P     . DG  I 5 39  ? 5.127   24.386 -14.367 1.00 139.87 ? -34 DG  I P     1 
ATOM   6781  O  OP1   . DG  I 5 39  ? 6.402   24.040 -14.989 1.00 139.61 ? -34 DG  I OP1   1 
ATOM   6782  O  OP2   . DG  I 5 39  ? 4.185   25.298 -15.024 1.00 139.24 ? -34 DG  I OP2   1 
ATOM   6783  O  "O5'" . DG  I 5 39  ? 4.369   23.020 -14.106 1.00 140.84 ? -34 DG  I "O5'" 1 
ATOM   6784  C  "C5'" . DG  I 5 39  ? 4.916   22.037 -13.212 1.00 142.14 ? -34 DG  I "C5'" 1 
ATOM   6785  C  "C4'" . DG  I 5 39  ? 3.954   20.880 -13.094 1.00 143.61 ? -34 DG  I "C4'" 1 
ATOM   6786  O  "O4'" . DG  I 5 39  ? 2.940   21.230 -12.127 1.00 144.09 ? -34 DG  I "O4'" 1 
ATOM   6787  C  "C3'" . DG  I 5 39  ? 3.188   20.614 -14.383 1.00 144.92 ? -34 DG  I "C3'" 1 
ATOM   6788  O  "O3'" . DG  I 5 39  ? 2.640   19.302 -14.347 1.00 146.21 ? -34 DG  I "O3'" 1 
ATOM   6789  C  "C2'" . DG  I 5 39  ? 1.993   21.523 -14.218 1.00 144.89 ? -34 DG  I "C2'" 1 
ATOM   6790  C  "C1'" . DG  I 5 39  ? 1.692   21.192 -12.783 1.00 144.99 ? -34 DG  I "C1'" 1 
ATOM   6791  N  N9    . DG  I 5 39  ? 0.770   22.072 -12.086 1.00 146.35 ? -34 DG  I N9    1 
ATOM   6792  C  C8    . DG  I 5 39  ? 0.403   23.352 -12.418 1.00 147.35 ? -34 DG  I C8    1 
ATOM   6793  N  N7    . DG  I 5 39  ? -0.492  23.852 -11.611 1.00 147.64 ? -34 DG  I N7    1 
ATOM   6794  C  C5    . DG  I 5 39  ? -0.749  22.830 -10.710 1.00 147.72 ? -34 DG  I C5    1 
ATOM   6795  C  C6    . DG  I 5 39  ? -1.655  22.772 -9.618  1.00 148.54 ? -34 DG  I C6    1 
ATOM   6796  O  O6    . DG  I 5 39  ? -2.396  23.660 -9.185  1.00 149.09 ? -34 DG  I O6    1 
ATOM   6797  N  N1    . DG  I 5 39  ? -1.582  21.551 -8.958  1.00 148.35 ? -34 DG  I N1    1 
ATOM   6798  C  C2    . DG  I 5 39  ? -0.759  20.512 -9.315  1.00 147.88 ? -34 DG  I C2    1 
ATOM   6799  N  N2    . DG  I 5 39  ? -0.868  19.396 -8.584  1.00 147.58 ? -34 DG  I N2    1 
ATOM   6800  N  N3    . DG  I 5 39  ? 0.044   20.533 -10.364 1.00 147.75 ? -34 DG  I N3    1 
ATOM   6801  C  C4    . DG  I 5 39  ? 0.022   21.726 -10.992 1.00 147.14 ? -34 DG  I C4    1 
ATOM   6802  P  P     . DT  I 5 40  ? 3.296   18.137 -15.150 1.00 147.10 ? -33 DT  I P     1 
ATOM   6803  O  OP1   . DT  I 5 40  ? 4.736   18.149 -14.864 1.00 146.86 ? -33 DT  I OP1   1 
ATOM   6804  O  OP2   . DT  I 5 40  ? 2.800   18.204 -16.527 1.00 146.70 ? -33 DT  I OP2   1 
ATOM   6805  O  "O5'" . DT  I 5 40  ? 2.635   16.849 -14.497 1.00 149.64 ? -33 DT  I "O5'" 1 
ATOM   6806  C  "C5'" . DT  I 5 40  ? 2.772   16.582 -13.090 1.00 152.06 ? -33 DT  I "C5'" 1 
ATOM   6807  C  "C4'" . DT  I 5 40  ? 1.538   15.910 -12.531 1.00 154.62 ? -33 DT  I "C4'" 1 
ATOM   6808  O  "O4'" . DT  I 5 40  ? 0.667   16.888 -11.920 1.00 154.97 ? -33 DT  I "O4'" 1 
ATOM   6809  C  "C3'" . DT  I 5 40  ? 0.673   15.137 -13.528 1.00 156.93 ? -33 DT  I "C3'" 1 
ATOM   6810  O  "O3'" . DT  I 5 40  ? 0.397   13.855 -12.939 1.00 159.96 ? -33 DT  I "O3'" 1 
ATOM   6811  C  "C2'" . DT  I 5 40  ? -0.560  16.010 -13.666 1.00 156.13 ? -33 DT  I "C2'" 1 
ATOM   6812  C  "C1'" . DT  I 5 40  ? -0.660  16.586 -12.277 1.00 155.46 ? -33 DT  I "C1'" 1 
ATOM   6813  N  N1    . DT  I 5 40  ? -1.451  17.816 -12.160 1.00 155.57 ? -33 DT  I N1    1 
ATOM   6814  C  C2    . DT  I 5 40  ? -2.325  17.919 -11.105 1.00 155.64 ? -33 DT  I C2    1 
ATOM   6815  O  O2    . DT  I 5 40  ? -2.467  17.043 -10.270 1.00 156.13 ? -33 DT  I O2    1 
ATOM   6816  N  N3    . DT  I 5 40  ? -3.046  19.085 -11.073 1.00 155.28 ? -33 DT  I N3    1 
ATOM   6817  C  C4    . DT  I 5 40  ? -2.928  20.162 -11.925 1.00 155.23 ? -33 DT  I C4    1 
ATOM   6818  O  O4    . DT  I 5 40  ? -3.651  21.139 -11.773 1.00 155.49 ? -33 DT  I O4    1 
ATOM   6819  C  C5    . DT  I 5 40  ? -2.028  19.967 -13.035 1.00 155.31 ? -33 DT  I C5    1 
ATOM   6820  C  C7    . DT  I 5 40  ? -1.869  21.064 -14.039 1.00 154.94 ? -33 DT  I C7    1 
ATOM   6821  C  C6    . DT  I 5 40  ? -1.324  18.830 -13.082 1.00 155.53 ? -33 DT  I C6    1 
ATOM   6822  P  P     . DT  I 5 41  ? -0.561  12.790 -13.646 1.00 162.54 ? -32 DT  I P     1 
ATOM   6823  O  OP1   . DT  I 5 41  ? -0.198  11.447 -13.132 1.00 162.85 ? -32 DT  I OP1   1 
ATOM   6824  O  OP2   . DT  I 5 41  ? -0.562  13.047 -15.115 1.00 162.37 ? -32 DT  I OP2   1 
ATOM   6825  O  "O5'" . DT  I 5 41  ? -2.001  13.212 -13.058 1.00 164.38 ? -32 DT  I "O5'" 1 
ATOM   6826  C  "C5'" . DT  I 5 41  ? -2.740  12.315 -12.234 1.00 166.51 ? -32 DT  I "C5'" 1 
ATOM   6827  C  "C4'" . DT  I 5 41  ? -3.814  13.034 -11.431 1.00 169.19 ? -32 DT  I "C4'" 1 
ATOM   6828  O  "O4'" . DT  I 5 41  ? -3.635  14.452 -11.494 1.00 169.81 ? -32 DT  I "O4'" 1 
ATOM   6829  C  "C3'" . DT  I 5 41  ? -5.234  12.827 -11.915 1.00 171.63 ? -32 DT  I "C3'" 1 
ATOM   6830  O  "O3'" . DT  I 5 41  ? -5.751  11.612 -11.386 1.00 174.87 ? -32 DT  I "O3'" 1 
ATOM   6831  C  "C2'" . DT  I 5 41  ? -5.969  14.032 -11.329 1.00 171.06 ? -32 DT  I "C2'" 1 
ATOM   6832  C  "C1'" . DT  I 5 41  ? -4.854  15.062 -11.121 1.00 170.73 ? -32 DT  I "C1'" 1 
ATOM   6833  N  N1    . DT  I 5 41  ? -5.056  16.318 -11.914 1.00 171.54 ? -32 DT  I N1    1 
ATOM   6834  C  C2    . DT  I 5 41  ? -5.782  17.363 -11.352 1.00 171.91 ? -32 DT  I C2    1 
ATOM   6835  O  O2    . DT  I 5 41  ? -6.233  17.338 -10.214 1.00 171.80 ? -32 DT  I O2    1 
ATOM   6836  N  N3    . DT  I 5 41  ? -5.933  18.462 -12.169 1.00 172.00 ? -32 DT  I N3    1 
ATOM   6837  C  C4    . DT  I 5 41  ? -5.482  18.608 -13.473 1.00 171.82 ? -32 DT  I C4    1 
ATOM   6838  O  O4    . DT  I 5 41  ? -5.719  19.652 -14.074 1.00 171.96 ? -32 DT  I O4    1 
ATOM   6839  C  C5    . DT  I 5 41  ? -4.758  17.465 -14.017 1.00 171.69 ? -32 DT  I C5    1 
ATOM   6840  C  C7    . DT  I 5 41  ? -4.213  17.501 -15.417 1.00 171.84 ? -32 DT  I C7    1 
ATOM   6841  C  C6    . DT  I 5 41  ? -4.589  16.388 -13.224 1.00 171.65 ? -32 DT  I C6    1 
ATOM   6842  P  P     . DA  I 5 42  ? -6.599  10.627 -12.320 1.00 177.59 ? -31 DA  I P     1 
ATOM   6843  O  OP1   . DA  I 5 42  ? -6.677  9.311  -11.640 1.00 177.30 ? -31 DA  I OP1   1 
ATOM   6844  O  OP2   . DA  I 5 42  ? -6.043  10.722 -13.702 1.00 177.81 ? -31 DA  I OP2   1 
ATOM   6845  O  "O5'" . DA  I 5 42  ? -8.055  11.298 -12.336 1.00 179.44 ? -31 DA  I "O5'" 1 
ATOM   6846  C  "C5'" . DA  I 5 42  ? -8.888  11.285 -11.176 1.00 181.12 ? -31 DA  I "C5'" 1 
ATOM   6847  C  "C4'" . DA  I 5 42  ? -9.988  12.334 -11.295 1.00 183.05 ? -31 DA  I "C4'" 1 
ATOM   6848  O  "O4'" . DA  I 5 42  ? -9.404  13.616 -11.653 1.00 183.66 ? -31 DA  I "O4'" 1 
ATOM   6849  C  "C3'" . DA  I 5 42  ? -11.063 12.044 -12.351 1.00 184.50 ? -31 DA  I "C3'" 1 
ATOM   6850  O  "O3'" . DA  I 5 42  ? -12.366 12.260 -11.813 1.00 186.35 ? -31 DA  I "O3'" 1 
ATOM   6851  C  "C2'" . DA  I 5 42  ? -10.756 13.039 -13.464 1.00 184.42 ? -31 DA  I "C2'" 1 
ATOM   6852  C  "C1'" . DA  I 5 42  ? -10.160 14.199 -12.686 1.00 184.16 ? -31 DA  I "C1'" 1 
ATOM   6853  N  N9    . DA  I 5 42  ? -9.287  15.041 -13.497 1.00 184.27 ? -31 DA  I N9    1 
ATOM   6854  C  C8    . DA  I 5 42  ? -8.164  14.648 -14.180 1.00 184.27 ? -31 DA  I C8    1 
ATOM   6855  N  N7    . DA  I 5 42  ? -7.614  15.603 -14.886 1.00 184.46 ? -31 DA  I N7    1 
ATOM   6856  C  C5    . DA  I 5 42  ? -8.441  16.694 -14.674 1.00 184.60 ? -31 DA  I C5    1 
ATOM   6857  C  C6    . DA  I 5 42  ? -8.399  18.030 -15.143 1.00 184.77 ? -31 DA  I C6    1 
ATOM   6858  N  N6    . DA  I 5 42  ? -7.447  18.487 -15.962 1.00 184.74 ? -31 DA  I N6    1 
ATOM   6859  N  N1    . DA  I 5 42  ? -9.382  18.878 -14.731 1.00 184.80 ? -31 DA  I N1    1 
ATOM   6860  C  C2    . DA  I 5 42  ? -10.349 18.406 -13.921 1.00 184.60 ? -31 DA  I C2    1 
ATOM   6861  N  N3    . DA  I 5 42  ? -10.491 17.173 -13.417 1.00 184.41 ? -31 DA  I N3    1 
ATOM   6862  C  C4    . DA  I 5 42  ? -9.495  16.357 -13.838 1.00 184.40 ? -31 DA  I C4    1 
ATOM   6863  P  P     . DG  I 5 43  ? -13.664 11.662 -12.550 1.00 188.27 ? -30 DG  I P     1 
ATOM   6864  O  OP1   . DG  I 5 43  ? -14.528 11.035 -11.511 1.00 188.47 ? -30 DG  I OP1   1 
ATOM   6865  O  OP2   . DG  I 5 43  ? -13.214 10.860 -13.716 1.00 188.69 ? -30 DG  I OP2   1 
ATOM   6866  O  "O5'" . DG  I 5 43  ? -14.389 12.968 -13.125 1.00 188.82 ? -30 DG  I "O5'" 1 
ATOM   6867  C  "C5'" . DG  I 5 43  ? -15.136 13.820 -12.264 1.00 189.59 ? -30 DG  I "C5'" 1 
ATOM   6868  C  "C4'" . DG  I 5 43  ? -15.083 15.254 -12.754 1.00 190.38 ? -30 DG  I "C4'" 1 
ATOM   6869  O  "O4'" . DG  I 5 43  ? -13.734 15.555 -13.216 1.00 190.83 ? -30 DG  I "O4'" 1 
ATOM   6870  C  "C3'" . DG  I 5 43  ? -15.981 15.559 -13.941 1.00 190.66 ? -30 DG  I "C3'" 1 
ATOM   6871  O  "O3'" . DG  I 5 43  ? -17.310 15.894 -13.492 1.00 190.82 ? -30 DG  I "O3'" 1 
ATOM   6872  C  "C2'" . DG  I 5 43  ? -15.266 16.759 -14.556 1.00 190.86 ? -30 DG  I "C2'" 1 
ATOM   6873  C  "C1'" . DG  I 5 43  ? -13.793 16.397 -14.356 1.00 191.00 ? -30 DG  I "C1'" 1 
ATOM   6874  N  N9    . DG  I 5 43  ? -13.191 15.705 -15.510 1.00 191.29 ? -30 DG  I N9    1 
ATOM   6875  C  C8    . DG  I 5 43  ? -13.253 14.357 -15.797 1.00 191.58 ? -30 DG  I C8    1 
ATOM   6876  N  N7    . DG  I 5 43  ? -12.673 14.030 -16.919 1.00 191.57 ? -30 DG  I N7    1 
ATOM   6877  C  C5    . DG  I 5 43  ? -12.205 15.232 -17.422 1.00 191.37 ? -30 DG  I C5    1 
ATOM   6878  C  C6    . DG  I 5 43  ? -11.489 15.501 -18.617 1.00 191.33 ? -30 DG  I C6    1 
ATOM   6879  O  O6    . DG  I 5 43  ? -11.124 14.698 -19.488 1.00 191.26 ? -30 DG  I O6    1 
ATOM   6880  N  N1    . DG  I 5 43  ? -11.203 16.865 -18.757 1.00 191.37 ? -30 DG  I N1    1 
ATOM   6881  C  C2    . DG  I 5 43  ? -11.564 17.843 -17.846 1.00 191.33 ? -30 DG  I C2    1 
ATOM   6882  N  N2    . DG  I 5 43  ? -11.223 19.100 -18.157 1.00 191.31 ? -30 DG  I N2    1 
ATOM   6883  N  N3    . DG  I 5 43  ? -12.248 17.604 -16.726 1.00 191.28 ? -30 DG  I N3    1 
ATOM   6884  C  C4    . DG  I 5 43  ? -12.527 16.280 -16.573 1.00 191.29 ? -30 DG  I C4    1 
ATOM   6885  P  P     . DG  I 5 44  ? -18.602 15.122 -14.078 1.00 191.03 ? -29 DG  I P     1 
ATOM   6886  O  OP1   . DG  I 5 44  ? -19.656 15.142 -13.033 1.00 191.08 ? -29 DG  I OP1   1 
ATOM   6887  O  OP2   . DG  I 5 44  ? -18.152 13.822 -14.634 1.00 191.08 ? -29 DG  I OP2   1 
ATOM   6888  O  "O5'" . DG  I 5 44  ? -19.059 16.048 -15.316 1.00 190.79 ? -29 DG  I "O5'" 1 
ATOM   6889  C  "C5'" . DG  I 5 44  ? -19.928 17.196 -15.130 1.00 190.26 ? -29 DG  I "C5'" 1 
ATOM   6890  C  "C4'" . DG  I 5 44  ? -19.299 18.464 -15.708 1.00 189.61 ? -29 DG  I "C4'" 1 
ATOM   6891  O  "O4'" . DG  I 5 44  ? -17.850 18.345 -15.637 1.00 189.70 ? -29 DG  I "O4'" 1 
ATOM   6892  C  "C3'" . DG  I 5 44  ? -19.584 18.743 -17.186 1.00 188.81 ? -29 DG  I "C3'" 1 
ATOM   6893  O  "O3'" . DG  I 5 44  ? -20.789 19.493 -17.363 1.00 187.55 ? -29 DG  I "O3'" 1 
ATOM   6894  C  "C2'" . DG  I 5 44  ? -18.366 19.564 -17.577 1.00 189.31 ? -29 DG  I "C2'" 1 
ATOM   6895  C  "C1'" . DG  I 5 44  ? -17.265 18.835 -16.834 1.00 189.80 ? -29 DG  I "C1'" 1 
ATOM   6896  N  N9    . DG  I 5 44  ? -16.681 17.724 -17.605 1.00 190.34 ? -29 DG  I N9    1 
ATOM   6897  C  C8    . DG  I 5 44  ? -17.092 16.408 -17.628 1.00 190.45 ? -29 DG  I C8    1 
ATOM   6898  N  N7    . DG  I 5 44  ? -16.422 15.662 -18.460 1.00 190.62 ? -29 DG  I N7    1 
ATOM   6899  C  C5    . DG  I 5 44  ? -15.530 16.538 -19.056 1.00 190.81 ? -29 DG  I C5    1 
ATOM   6900  C  C6    . DG  I 5 44  ? -14.539 16.298 -20.043 1.00 191.02 ? -29 DG  I C6    1 
ATOM   6901  O  O6    . DG  I 5 44  ? -14.254 15.224 -20.597 1.00 190.96 ? -29 DG  I O6    1 
ATOM   6902  N  N1    . DG  I 5 44  ? -13.842 17.471 -20.376 1.00 191.20 ? -29 DG  I N1    1 
ATOM   6903  C  C2    . DG  I 5 44  ? -14.074 18.715 -19.811 1.00 191.17 ? -29 DG  I C2    1 
ATOM   6904  N  N2    . DG  I 5 44  ? -13.315 19.725 -20.258 1.00 191.24 ? -29 DG  I N2    1 
ATOM   6905  N  N3    . DG  I 5 44  ? -14.998 18.949 -18.883 1.00 190.98 ? -29 DG  I N3    1 
ATOM   6906  C  C4    . DG  I 5 44  ? -15.688 17.819 -18.554 1.00 190.75 ? -29 DG  I C4    1 
ATOM   6907  P  P     . DG  I 5 45  ? -21.497 19.580 -18.817 1.00 186.25 ? -28 DG  I P     1 
ATOM   6908  O  OP1   . DG  I 5 45  ? -22.961 19.508 -18.607 1.00 186.44 ? -28 DG  I OP1   1 
ATOM   6909  O  OP2   . DG  I 5 45  ? -20.839 18.612 -19.730 1.00 186.22 ? -28 DG  I OP2   1 
ATOM   6910  O  "O5'" . DG  I 5 45  ? -21.126 21.041 -19.342 1.00 184.75 ? -28 DG  I "O5'" 1 
ATOM   6911  C  "C5'" . DG  I 5 45  ? -20.972 22.129 -18.440 1.00 183.66 ? -28 DG  I "C5'" 1 
ATOM   6912  C  "C4'" . DG  I 5 45  ? -19.944 23.117 -18.976 1.00 182.66 ? -28 DG  I "C4'" 1 
ATOM   6913  O  "O4'" . DG  I 5 45  ? -18.682 22.435 -19.225 1.00 182.52 ? -28 DG  I "O4'" 1 
ATOM   6914  C  "C3'" . DG  I 5 45  ? -20.325 23.800 -20.284 1.00 181.86 ? -28 DG  I "C3'" 1 
ATOM   6915  O  "O3'" . DG  I 5 45  ? -19.933 25.174 -20.253 1.00 180.91 ? -28 DG  I "O3'" 1 
ATOM   6916  C  "C2'" . DG  I 5 45  ? -19.551 23.008 -21.335 1.00 182.11 ? -28 DG  I "C2'" 1 
ATOM   6917  C  "C1'" . DG  I 5 45  ? -18.296 22.592 -20.577 1.00 182.47 ? -28 DG  I "C1'" 1 
ATOM   6918  N  N9    . DG  I 5 45  ? -17.722 21.327 -21.057 1.00 182.93 ? -28 DG  I N9    1 
ATOM   6919  C  C8    . DG  I 5 45  ? -18.291 20.073 -20.967 1.00 183.25 ? -28 DG  I C8    1 
ATOM   6920  N  N7    . DG  I 5 45  ? -17.571 19.129 -21.505 1.00 183.29 ? -28 DG  I N7    1 
ATOM   6921  C  C5    . DG  I 5 45  ? -16.476 19.797 -22.036 1.00 183.22 ? -28 DG  I C5    1 
ATOM   6922  C  C6    . DG  I 5 45  ? -15.372 19.297 -22.781 1.00 183.24 ? -28 DG  I C6    1 
ATOM   6923  O  O6    . DG  I 5 45  ? -15.120 18.122 -23.071 1.00 183.39 ? -28 DG  I O6    1 
ATOM   6924  N  N1    . DG  I 5 45  ? -14.478 20.309 -23.140 1.00 183.13 ? -28 DG  I N1    1 
ATOM   6925  C  C2    . DG  I 5 45  ? -14.640 21.645 -22.837 1.00 183.29 ? -28 DG  I C2    1 
ATOM   6926  N  N2    . DG  I 5 45  ? -13.679 22.475 -23.272 1.00 183.36 ? -28 DG  I N2    1 
ATOM   6927  N  N3    . DG  I 5 45  ? -15.678 22.132 -22.152 1.00 183.31 ? -28 DG  I N3    1 
ATOM   6928  C  C4    . DG  I 5 45  ? -16.558 21.155 -21.786 1.00 183.11 ? -28 DG  I C4    1 
ATOM   6929  P  P     . DT  I 5 46  ? -20.644 26.255 -21.209 1.00 179.71 ? -27 DT  I P     1 
ATOM   6930  O  OP1   . DT  I 5 46  ? -20.354 27.609 -20.667 1.00 179.92 ? -27 DT  I OP1   1 
ATOM   6931  O  OP2   . DT  I 5 46  ? -22.055 25.834 -21.419 1.00 179.73 ? -27 DT  I OP2   1 
ATOM   6932  O  "O5'" . DT  I 5 46  ? -19.863 26.075 -22.603 1.00 177.50 ? -27 DT  I "O5'" 1 
ATOM   6933  C  "C5'" . DT  I 5 46  ? -18.426 26.160 -22.666 1.00 175.03 ? -27 DT  I "C5'" 1 
ATOM   6934  C  "C4'" . DT  I 5 46  ? -17.907 25.613 -23.987 1.00 172.74 ? -27 DT  I "C4'" 1 
ATOM   6935  O  "O4'" . DT  I 5 46  ? -17.646 24.189 -23.882 1.00 172.60 ? -27 DT  I "O4'" 1 
ATOM   6936  C  "C3'" . DT  I 5 46  ? -18.844 25.790 -25.191 1.00 171.00 ? -27 DT  I "C3'" 1 
ATOM   6937  O  "O3'" . DT  I 5 46  ? -18.139 26.390 -26.240 1.00 168.99 ? -27 DT  I "O3'" 1 
ATOM   6938  C  "C2'" . DT  I 5 46  ? -19.246 24.360 -25.548 1.00 171.73 ? -27 DT  I "C2'" 1 
ATOM   6939  C  "C1'" . DT  I 5 46  ? -18.015 23.587 -25.097 1.00 172.60 ? -27 DT  I "C1'" 1 
ATOM   6940  N  N1    . DT  I 5 46  ? -18.221 22.063 -24.904 1.00 173.42 ? -27 DT  I N1    1 
ATOM   6941  C  C2    . DT  I 5 46  ? -17.209 21.181 -25.288 1.00 173.83 ? -27 DT  I C2    1 
ATOM   6942  O  O2    . DT  I 5 46  ? -16.124 21.542 -25.718 1.00 174.07 ? -27 DT  I O2    1 
ATOM   6943  N  N3    . DT  I 5 46  ? -17.512 19.848 -25.126 1.00 173.84 ? -27 DT  I N3    1 
ATOM   6944  C  C4    . DT  I 5 46  ? -18.684 19.305 -24.621 1.00 174.13 ? -27 DT  I C4    1 
ATOM   6945  O  O4    . DT  I 5 46  ? -18.780 18.085 -24.512 1.00 174.58 ? -27 DT  I O4    1 
ATOM   6946  C  C5    . DT  I 5 46  ? -19.714 20.271 -24.256 1.00 174.00 ? -27 DT  I C5    1 
ATOM   6947  C  C7    . DT  I 5 46  ? -21.040 19.806 -23.706 1.00 173.98 ? -27 DT  I C7    1 
ATOM   6948  C  C6    . DT  I 5 46  ? -19.444 21.582 -24.439 1.00 173.72 ? -27 DT  I C6    1 
ATOM   6949  P  P     . DT  I 5 47  ? -18.827 27.424 -27.165 1.00 166.83 ? -26 DT  I P     1 
ATOM   6950  O  OP1   . DT  I 5 47  ? -19.338 28.499 -26.305 1.00 166.92 ? -26 DT  I OP1   1 
ATOM   6951  O  OP2   . DT  I 5 47  ? -19.746 26.694 -28.048 1.00 166.96 ? -26 DT  I OP2   1 
ATOM   6952  O  "O5'" . DT  I 5 47  ? -17.599 27.936 -28.031 1.00 163.80 ? -26 DT  I "O5'" 1 
ATOM   6953  C  "C5'" . DT  I 5 47  ? -16.267 27.789 -27.512 1.00 160.86 ? -26 DT  I "C5'" 1 
ATOM   6954  C  "C4'" . DT  I 5 47  ? -15.492 26.732 -28.267 1.00 158.17 ? -26 DT  I "C4'" 1 
ATOM   6955  O  "O4'" . DT  I 5 47  ? -15.928 25.403 -27.909 1.00 157.57 ? -26 DT  I "O4'" 1 
ATOM   6956  C  "C3'" . DT  I 5 47  ? -15.567 26.807 -29.795 1.00 156.39 ? -26 DT  I "C3'" 1 
ATOM   6957  O  "O3'" . DT  I 5 47  ? -14.232 26.766 -30.291 1.00 154.79 ? -26 DT  I "O3'" 1 
ATOM   6958  C  "C2'" . DT  I 5 47  ? -16.264 25.519 -30.189 1.00 156.60 ? -26 DT  I "C2'" 1 
ATOM   6959  C  "C1'" . DT  I 5 47  ? -15.846 24.604 -29.068 1.00 157.14 ? -26 DT  I "C1'" 1 
ATOM   6960  N  N1    . DT  I 5 47  ? -16.709 23.437 -28.875 1.00 157.44 ? -26 DT  I N1    1 
ATOM   6961  C  C2    . DT  I 5 47  ? -16.118 22.197 -28.869 1.00 157.57 ? -26 DT  I C2    1 
ATOM   6962  O  O2    . DT  I 5 47  ? -14.921 22.031 -29.021 1.00 157.52 ? -26 DT  I O2    1 
ATOM   6963  N  N3    . DT  I 5 47  ? -16.980 21.155 -28.653 1.00 157.79 ? -26 DT  I N3    1 
ATOM   6964  C  C4    . DT  I 5 47  ? -18.347 21.223 -28.483 1.00 157.66 ? -26 DT  I C4    1 
ATOM   6965  O  O4    . DT  I 5 47  ? -18.995 20.193 -28.320 1.00 157.03 ? -26 DT  I O4    1 
ATOM   6966  C  C5    . DT  I 5 47  ? -18.902 22.558 -28.500 1.00 157.84 ? -26 DT  I C5    1 
ATOM   6967  C  C7    . DT  I 5 47  ? -20.375 22.735 -28.312 1.00 157.83 ? -26 DT  I C7    1 
ATOM   6968  C  C6    . DT  I 5 47  ? -18.065 23.584 -28.696 1.00 157.70 ? -26 DT  I C6    1 
ATOM   6969  P  P     . DA  I 5 48  ? -13.912 27.277 -31.742 1.00 153.11 ? -25 DA  I P     1 
ATOM   6970  O  OP1   . DA  I 5 48  ? -12.879 28.316 -31.647 1.00 152.83 ? -25 DA  I OP1   1 
ATOM   6971  O  OP2   . DA  I 5 48  ? -15.184 27.572 -32.412 1.00 153.88 ? -25 DA  I OP2   1 
ATOM   6972  O  "O5'" . DA  I 5 48  ? -13.288 25.992 -32.426 1.00 150.10 ? -25 DA  I "O5'" 1 
ATOM   6973  C  "C5'" . DA  I 5 48  ? -13.323 24.732 -31.751 1.00 147.50 ? -25 DA  I "C5'" 1 
ATOM   6974  C  "C4'" . DA  I 5 48  ? -13.204 23.615 -32.759 1.00 144.94 ? -25 DA  I "C4'" 1 
ATOM   6975  O  "O4'" . DA  I 5 48  ? -14.287 22.678 -32.556 1.00 145.56 ? -25 DA  I "O4'" 1 
ATOM   6976  C  "C3'" . DA  I 5 48  ? -13.309 24.060 -34.215 1.00 141.49 ? -25 DA  I "C3'" 1 
ATOM   6977  O  "O3'" . DA  I 5 48  ? -12.550 23.173 -35.036 1.00 135.60 ? -25 DA  I "O3'" 1 
ATOM   6978  C  "C2'" . DA  I 5 48  ? -14.781 23.864 -34.513 1.00 143.72 ? -25 DA  I "C2'" 1 
ATOM   6979  C  "C1'" . DA  I 5 48  ? -15.062 22.590 -33.738 1.00 145.56 ? -25 DA  I "C1'" 1 
ATOM   6980  N  N9    . DA  I 5 48  ? -16.458 22.384 -33.351 1.00 147.37 ? -25 DA  I N9    1 
ATOM   6981  C  C8    . DA  I 5 48  ? -17.547 23.160 -33.658 1.00 148.10 ? -25 DA  I C8    1 
ATOM   6982  N  N7    . DA  I 5 48  ? -18.678 22.693 -33.189 1.00 148.65 ? -25 DA  I N7    1 
ATOM   6983  C  C5    . DA  I 5 48  ? -18.308 21.538 -32.517 1.00 149.16 ? -25 DA  I C5    1 
ATOM   6984  C  C6    . DA  I 5 48  ? -19.046 20.589 -31.790 1.00 149.99 ? -25 DA  I C6    1 
ATOM   6985  N  N6    . DA  I 5 48  ? -20.366 20.655 -31.612 1.00 149.85 ? -25 DA  I N6    1 
ATOM   6986  N  N1    . DA  I 5 48  ? -18.374 19.548 -31.255 1.00 150.39 ? -25 DA  I N1    1 
ATOM   6987  C  C2    . DA  I 5 48  ? -17.048 19.488 -31.423 1.00 150.10 ? -25 DA  I C2    1 
ATOM   6988  N  N3    . DA  I 5 48  ? -16.245 20.314 -32.086 1.00 149.15 ? -25 DA  I N3    1 
ATOM   6989  C  C4    . DA  I 5 48  ? -16.944 21.334 -32.610 1.00 148.57 ? -25 DA  I C4    1 
ATOM   6990  P  P     . DG  I 5 49  ? -11.090 23.559 -35.515 1.00 129.26 ? -24 DG  I P     1 
ATOM   6991  O  OP1   . DG  I 5 49  ? -10.227 23.623 -34.332 1.00 128.08 ? -24 DG  I OP1   1 
ATOM   6992  O  OP2   . DG  I 5 49  ? -11.196 24.689 -36.441 1.00 127.83 ? -24 DG  I OP2   1 
ATOM   6993  O  "O5'" . DG  I 5 49  ? -10.658 22.310 -36.394 1.00 127.65 ? -24 DG  I "O5'" 1 
ATOM   6994  C  "C5'" . DG  I 5 49  ? -10.104 21.131 -35.796 1.00 125.63 ? -24 DG  I "C5'" 1 
ATOM   6995  C  "C4'" . DG  I 5 49  ? -10.883 19.915 -36.236 1.00 124.47 ? -24 DG  I "C4'" 1 
ATOM   6996  O  "O4'" . DG  I 5 49  ? -12.260 20.143 -35.891 1.00 125.29 ? -24 DG  I "O4'" 1 
ATOM   6997  C  "C3'" . DG  I 5 49  ? -10.862 19.614 -37.739 1.00 122.75 ? -24 DG  I "C3'" 1 
ATOM   6998  O  "O3'" . DG  I 5 49  ? -10.196 18.368 -37.961 1.00 119.87 ? -24 DG  I "O3'" 1 
ATOM   6999  C  "C2'" . DG  I 5 49  ? -12.330 19.582 -38.135 1.00 124.17 ? -24 DG  I "C2'" 1 
ATOM   7000  C  "C1'" . DG  I 5 49  ? -13.083 19.505 -36.834 1.00 125.57 ? -24 DG  I "C1'" 1 
ATOM   7001  N  N9    . DG  I 5 49  ? -14.350 20.219 -36.868 1.00 127.26 ? -24 DG  I N9    1 
ATOM   7002  C  C8    . DG  I 5 49  ? -14.634 21.363 -37.569 1.00 128.13 ? -24 DG  I C8    1 
ATOM   7003  N  N7    . DG  I 5 49  ? -15.862 21.771 -37.407 1.00 128.71 ? -24 DG  I N7    1 
ATOM   7004  C  C5    . DG  I 5 49  ? -16.422 20.838 -36.548 1.00 129.98 ? -24 DG  I C5    1 
ATOM   7005  C  C6    . DG  I 5 49  ? -17.737 20.747 -36.021 1.00 132.56 ? -24 DG  I C6    1 
ATOM   7006  O  O6    . DG  I 5 49  ? -18.689 21.515 -36.194 1.00 133.87 ? -24 DG  I O6    1 
ATOM   7007  N  N1    . DG  I 5 49  ? -17.885 19.636 -35.201 1.00 132.38 ? -24 DG  I N1    1 
ATOM   7008  C  C2    . DG  I 5 49  ? -16.895 18.729 -34.922 1.00 131.83 ? -24 DG  I C2    1 
ATOM   7009  N  N2    . DG  I 5 49  ? -17.239 17.715 -34.120 1.00 132.98 ? -24 DG  I N2    1 
ATOM   7010  N  N3    . DG  I 5 49  ? -15.669 18.795 -35.415 1.00 129.99 ? -24 DG  I N3    1 
ATOM   7011  C  C4    . DG  I 5 49  ? -15.503 19.869 -36.212 1.00 128.92 ? -24 DG  I C4    1 
ATOM   7012  P  P     . DG  I 5 50  ? -9.915  17.812 -39.419 1.00 118.45 ? -23 DG  I P     1 
ATOM   7013  O  OP1   . DG  I 5 50  ? -8.588  17.207 -39.439 1.00 116.98 ? -23 DG  I OP1   1 
ATOM   7014  O  OP2   . DG  I 5 50  ? -10.259 18.811 -40.428 1.00 117.68 ? -23 DG  I OP2   1 
ATOM   7015  O  "O5'" . DG  I 5 50  ? -10.913 16.591 -39.508 1.00 123.14 ? -23 DG  I "O5'" 1 
ATOM   7016  C  "C5'" . DG  I 5 50  ? -11.302 15.894 -38.317 1.00 127.44 ? -23 DG  I "C5'" 1 
ATOM   7017  C  "C4'" . DG  I 5 50  ? -12.408 14.930 -38.661 1.00 131.72 ? -23 DG  I "C4'" 1 
ATOM   7018  O  "O4'" . DG  I 5 50  ? -13.679 15.612 -38.556 1.00 132.64 ? -23 DG  I "O4'" 1 
ATOM   7019  C  "C3'" . DG  I 5 50  ? -12.327 14.425 -40.098 1.00 135.52 ? -23 DG  I "C3'" 1 
ATOM   7020  O  "O3'" . DG  I 5 50  ? -12.835 13.094 -40.148 1.00 139.86 ? -23 DG  I "O3'" 1 
ATOM   7021  C  "C2'" . DG  I 5 50  ? -13.247 15.372 -40.836 1.00 134.77 ? -23 DG  I "C2'" 1 
ATOM   7022  C  "C1'" . DG  I 5 50  ? -14.336 15.580 -39.812 1.00 134.26 ? -23 DG  I "C1'" 1 
ATOM   7023  N  N9    . DG  I 5 50  ? -15.039 16.843 -39.988 1.00 135.57 ? -23 DG  I N9    1 
ATOM   7024  C  C8    . DG  I 5 50  ? -14.729 17.840 -40.880 1.00 136.42 ? -23 DG  I C8    1 
ATOM   7025  N  N7    . DG  I 5 50  ? -15.543 18.856 -40.815 1.00 136.52 ? -23 DG  I N7    1 
ATOM   7026  C  C5    . DG  I 5 50  ? -16.447 18.507 -39.823 1.00 136.95 ? -23 DG  I C5    1 
ATOM   7027  C  C6    . DG  I 5 50  ? -17.561 19.216 -39.307 1.00 138.12 ? -23 DG  I C6    1 
ATOM   7028  O  O6    . DG  I 5 50  ? -17.974 20.335 -39.626 1.00 139.05 ? -23 DG  I O6    1 
ATOM   7029  N  N1    . DG  I 5 50  ? -18.209 18.497 -38.307 1.00 138.08 ? -23 DG  I N1    1 
ATOM   7030  C  C2    . DG  I 5 50  ? -17.829 17.256 -37.860 1.00 137.78 ? -23 DG  I C2    1 
ATOM   7031  N  N2    . DG  I 5 50  ? -18.583 16.722 -36.892 1.00 137.78 ? -23 DG  I N2    1 
ATOM   7032  N  N3    . DG  I 5 50  ? -16.789 16.585 -38.331 1.00 137.09 ? -23 DG  I N3    1 
ATOM   7033  C  C4    . DG  I 5 50  ? -16.148 17.266 -39.303 1.00 136.44 ? -23 DG  I C4    1 
ATOM   7034  P  P     . DG  I 5 51  ? -12.765 12.233 -41.483 1.00 142.96 ? -22 DG  I P     1 
ATOM   7035  O  OP1   . DG  I 5 51  ? -12.371 10.865 -41.093 1.00 142.98 ? -22 DG  I OP1   1 
ATOM   7036  O  OP2   . DG  I 5 51  ? -11.960 12.949 -42.493 1.00 144.43 ? -22 DG  I OP2   1 
ATOM   7037  O  "O5'" . DG  I 5 51  ? -14.287 12.188 -41.924 1.00 144.63 ? -22 DG  I "O5'" 1 
ATOM   7038  C  "C5'" . DG  I 5 51  ? -15.256 11.731 -40.978 1.00 147.86 ? -22 DG  I "C5'" 1 
ATOM   7039  C  "C4'" . DG  I 5 51  ? -16.644 11.832 -41.559 1.00 151.10 ? -22 DG  I "C4'" 1 
ATOM   7040  O  "O4'" . DG  I 5 51  ? -17.142 13.161 -41.312 1.00 152.01 ? -22 DG  I "O4'" 1 
ATOM   7041  C  "C3'" . DG  I 5 51  ? -16.728 11.604 -43.072 1.00 153.74 ? -22 DG  I "C3'" 1 
ATOM   7042  O  "O3'" . DG  I 5 51  ? -17.582 10.486 -43.349 1.00 156.63 ? -22 DG  I "O3'" 1 
ATOM   7043  C  "C2'" . DG  I 5 51  ? -17.284 12.909 -43.613 1.00 153.42 ? -22 DG  I "C2'" 1 
ATOM   7044  C  "C1'" . DG  I 5 51  ? -17.922 13.560 -42.410 1.00 153.16 ? -22 DG  I "C1'" 1 
ATOM   7045  N  N9    . DG  I 5 51  ? -17.873 15.011 -42.490 1.00 154.15 ? -22 DG  I N9    1 
ATOM   7046  C  C8    . DG  I 5 51  ? -16.838 15.769 -42.980 1.00 154.42 ? -22 DG  I C8    1 
ATOM   7047  N  N7    . DG  I 5 51  ? -17.087 17.049 -42.962 1.00 154.79 ? -22 DG  I N7    1 
ATOM   7048  C  C5    . DG  I 5 51  ? -18.368 17.142 -42.439 1.00 155.03 ? -22 DG  I C5    1 
ATOM   7049  C  C6    . DG  I 5 51  ? -19.174 18.282 -42.184 1.00 155.17 ? -22 DG  I C6    1 
ATOM   7050  O  O6    . DG  I 5 51  ? -18.907 19.471 -42.377 1.00 155.00 ? -22 DG  I O6    1 
ATOM   7051  N  N1    . DG  I 5 51  ? -20.409 17.927 -41.653 1.00 155.17 ? -22 DG  I N1    1 
ATOM   7052  C  C2    . DG  I 5 51  ? -20.816 16.641 -41.400 1.00 155.02 ? -22 DG  I C2    1 
ATOM   7053  N  N2    . DG  I 5 51  ? -22.042 16.504 -40.885 1.00 155.05 ? -22 DG  I N2    1 
ATOM   7054  N  N3    . DG  I 5 51  ? -20.076 15.569 -41.636 1.00 154.85 ? -22 DG  I N3    1 
ATOM   7055  C  C4    . DG  I 5 51  ? -18.871 15.892 -42.152 1.00 154.72 ? -22 DG  I C4    1 
ATOM   7056  P  P     . DT  I 5 52  ? -17.880 10.002 -44.854 1.00 159.12 ? -21 DT  I P     1 
ATOM   7057  O  OP1   . DT  I 5 52  ? -18.094 8.538  -44.820 1.00 159.41 ? -21 DT  I OP1   1 
ATOM   7058  O  OP2   . DT  I 5 52  ? -16.851 10.567 -45.758 1.00 159.56 ? -21 DT  I OP2   1 
ATOM   7059  O  "O5'" . DT  I 5 52  ? -19.270 10.724 -45.179 1.00 160.72 ? -21 DT  I "O5'" 1 
ATOM   7060  C  "C5'" . DT  I 5 52  ? -20.411 10.420 -44.395 1.00 162.72 ? -21 DT  I "C5'" 1 
ATOM   7061  C  "C4'" . DT  I 5 52  ? -21.488 11.476 -44.533 1.00 164.90 ? -21 DT  I "C4'" 1 
ATOM   7062  O  "O4'" . DT  I 5 52  ? -21.049 12.729 -43.968 1.00 165.58 ? -21 DT  I "O4'" 1 
ATOM   7063  C  "C3'" . DT  I 5 52  ? -21.886 11.856 -45.943 1.00 166.44 ? -21 DT  I "C3'" 1 
ATOM   7064  O  "O3'" . DT  I 5 52  ? -22.726 10.842 -46.538 1.00 167.97 ? -21 DT  I "O3'" 1 
ATOM   7065  C  "C2'" . DT  I 5 52  ? -22.662 13.136 -45.663 1.00 166.45 ? -21 DT  I "C2'" 1 
ATOM   7066  C  "C1'" . DT  I 5 52  ? -21.870 13.758 -44.505 1.00 166.36 ? -21 DT  I "C1'" 1 
ATOM   7067  N  N1    . DT  I 5 52  ? -21.027 14.934 -44.931 1.00 167.25 ? -21 DT  I N1    1 
ATOM   7068  C  C2    . DT  I 5 52  ? -21.596 16.211 -44.951 1.00 167.72 ? -21 DT  I C2    1 
ATOM   7069  O  O2    . DT  I 5 52  ? -22.739 16.453 -44.573 1.00 167.90 ? -21 DT  I O2    1 
ATOM   7070  N  N3    . DT  I 5 52  ? -20.754 17.208 -45.398 1.00 167.59 ? -21 DT  I N3    1 
ATOM   7071  C  C4    . DT  I 5 52  ? -19.449 17.066 -45.856 1.00 167.69 ? -21 DT  I C4    1 
ATOM   7072  O  O4    . DT  I 5 52  ? -18.839 18.060 -46.241 1.00 167.74 ? -21 DT  I O4    1 
ATOM   7073  C  C5    . DT  I 5 52  ? -18.926 15.703 -45.845 1.00 167.94 ? -21 DT  I C5    1 
ATOM   7074  C  C7    . DT  I 5 52  ? -17.520 15.417 -46.302 1.00 168.13 ? -21 DT  I C7    1 
ATOM   7075  C  C6    . DT  I 5 52  ? -19.742 14.716 -45.421 1.00 167.62 ? -21 DT  I C6    1 
ATOM   7076  P  P     . DT  I 5 53  ? -22.824 10.687 -48.144 1.00 169.02 ? -20 DT  I P     1 
ATOM   7077  O  OP1   . DT  I 5 53  ? -23.297 9.308  -48.435 1.00 168.65 ? -20 DT  I OP1   1 
ATOM   7078  O  OP2   . DT  I 5 53  ? -21.551 11.172 -48.742 1.00 169.04 ? -20 DT  I OP2   1 
ATOM   7079  O  "O5'" . DT  I 5 53  ? -23.969 11.735 -48.545 1.00 169.74 ? -20 DT  I "O5'" 1 
ATOM   7080  C  "C5'" . DT  I 5 53  ? -25.294 11.569 -48.065 1.00 170.80 ? -20 DT  I "C5'" 1 
ATOM   7081  C  "C4'" . DT  I 5 53  ? -26.008 12.904 -47.946 1.00 172.14 ? -20 DT  I "C4'" 1 
ATOM   7082  O  "O4'" . DT  I 5 53  ? -25.260 13.796 -47.081 1.00 172.25 ? -20 DT  I "O4'" 1 
ATOM   7083  C  "C3'" . DT  I 5 53  ? -26.152 13.691 -49.232 1.00 173.31 ? -20 DT  I "C3'" 1 
ATOM   7084  O  "O3'" . DT  I 5 53  ? -27.238 13.178 -50.029 1.00 174.58 ? -20 DT  I "O3'" 1 
ATOM   7085  C  "C2'" . DT  I 5 53  ? -26.448 15.083 -48.676 1.00 172.95 ? -20 DT  I "C2'" 1 
ATOM   7086  C  "C1'" . DT  I 5 53  ? -25.510 15.140 -47.469 1.00 172.62 ? -20 DT  I "C1'" 1 
ATOM   7087  N  N1    . DT  I 5 53  ? -24.191 15.864 -47.750 1.00 172.87 ? -20 DT  I N1    1 
ATOM   7088  C  C2    . DT  I 5 53  ? -24.110 17.236 -47.527 1.00 173.00 ? -20 DT  I C2    1 
ATOM   7089  O  O2    . DT  I 5 53  ? -25.029 17.901 -47.070 1.00 173.12 ? -20 DT  I O2    1 
ATOM   7090  N  N3    . DT  I 5 53  ? -22.890 17.803 -47.841 1.00 172.83 ? -20 DT  I N3    1 
ATOM   7091  C  C4    . DT  I 5 53  ? -21.778 17.167 -48.384 1.00 172.66 ? -20 DT  I C4    1 
ATOM   7092  O  O4    . DT  I 5 53  ? -20.758 17.820 -48.604 1.00 172.23 ? -20 DT  I O4    1 
ATOM   7093  C  C5    . DT  I 5 53  ? -21.931 15.732 -48.607 1.00 172.93 ? -20 DT  I C5    1 
ATOM   7094  C  C7    . DT  I 5 53  ? -20.798 14.921 -49.172 1.00 172.94 ? -20 DT  I C7    1 
ATOM   7095  C  C6    . DT  I 5 53  ? -23.124 15.169 -48.318 1.00 172.91 ? -20 DT  I C6    1 
ATOM   7096  P  P     . DA  I 5 54  ? -27.182 13.250 -51.639 1.00 175.73 ? -19 DA  I P     1 
ATOM   7097  O  OP1   . DA  I 5 54  ? -28.380 12.547 -52.164 1.00 175.77 ? -19 DA  I OP1   1 
ATOM   7098  O  OP2   . DA  I 5 54  ? -25.831 12.827 -52.079 1.00 175.85 ? -19 DA  I OP2   1 
ATOM   7099  O  "O5'" . DA  I 5 54  ? -27.320 14.819 -51.943 1.00 176.70 ? -19 DA  I "O5'" 1 
ATOM   7100  C  "C5'" . DA  I 5 54  ? -28.516 15.527 -51.571 1.00 177.74 ? -19 DA  I "C5'" 1 
ATOM   7101  C  "C4'" . DA  I 5 54  ? -28.348 17.031 -51.727 1.00 178.59 ? -19 DA  I "C4'" 1 
ATOM   7102  O  "O4'" . DA  I 5 54  ? -27.405 17.541 -50.744 1.00 179.09 ? -19 DA  I "O4'" 1 
ATOM   7103  C  "C3'" . DA  I 5 54  ? -27.805 17.478 -53.069 1.00 178.87 ? -19 DA  I "C3'" 1 
ATOM   7104  O  "O3'" . DA  I 5 54  ? -28.874 17.582 -54.007 1.00 178.64 ? -19 DA  I "O3'" 1 
ATOM   7105  C  "C2'" . DA  I 5 54  ? -27.198 18.836 -52.720 1.00 179.31 ? -19 DA  I "C2'" 1 
ATOM   7106  C  "C1'" . DA  I 5 54  ? -26.604 18.557 -51.333 1.00 179.55 ? -19 DA  I "C1'" 1 
ATOM   7107  N  N9    . DA  I 5 54  ? -25.210 18.096 -51.371 1.00 180.28 ? -19 DA  I N9    1 
ATOM   7108  C  C8    . DA  I 5 54  ? -24.758 16.806 -51.238 1.00 180.55 ? -19 DA  I C8    1 
ATOM   7109  N  N7    . DA  I 5 54  ? -23.457 16.681 -51.335 1.00 180.68 ? -19 DA  I N7    1 
ATOM   7110  C  C5    . DA  I 5 54  ? -23.017 17.972 -51.558 1.00 180.85 ? -19 DA  I C5    1 
ATOM   7111  C  C6    . DA  I 5 54  ? -21.724 18.522 -51.737 1.00 181.22 ? -19 DA  I C6    1 
ATOM   7112  N  N6    . DA  I 5 54  ? -20.606 17.788 -51.724 1.00 181.21 ? -19 DA  I N6    1 
ATOM   7113  N  N1    . DA  I 5 54  ? -21.630 19.862 -51.946 1.00 181.57 ? -19 DA  I N1    1 
ATOM   7114  C  C2    . DA  I 5 54  ? -22.761 20.594 -51.982 1.00 181.54 ? -19 DA  I C2    1 
ATOM   7115  N  N3    . DA  I 5 54  ? -24.029 20.192 -51.808 1.00 181.21 ? -19 DA  I N3    1 
ATOM   7116  C  C4    . DA  I 5 54  ? -24.088 18.859 -51.596 1.00 180.73 ? -19 DA  I C4    1 
ATOM   7117  P  P     . DG  I 5 55  ? -28.674 16.930 -55.451 1.00 178.22 ? -18 DG  I P     1 
ATOM   7118  O  OP1   . DG  I 5 55  ? -29.981 16.427 -55.923 1.00 178.19 ? -18 DG  I OP1   1 
ATOM   7119  O  OP2   . DG  I 5 55  ? -27.510 16.026 -55.379 1.00 178.15 ? -18 DG  I OP2   1 
ATOM   7120  O  "O5'" . DG  I 5 55  ? -28.259 18.159 -56.369 1.00 177.36 ? -18 DG  I "O5'" 1 
ATOM   7121  C  "C5'" . DG  I 5 55  ? -29.120 19.298 -56.518 1.00 176.14 ? -18 DG  I "C5'" 1 
ATOM   7122  C  "C4'" . DG  I 5 55  ? -28.282 20.552 -56.545 1.00 174.69 ? -18 DG  I "C4'" 1 
ATOM   7123  O  "O4'" . DG  I 5 55  ? -27.292 20.459 -55.500 1.00 174.07 ? -18 DG  I "O4'" 1 
ATOM   7124  C  "C3'" . DG  I 5 55  ? -27.494 20.724 -57.836 1.00 173.92 ? -18 DG  I "C3'" 1 
ATOM   7125  O  "O3'" . DG  I 5 55  ? -28.197 21.600 -58.713 1.00 173.39 ? -18 DG  I "O3'" 1 
ATOM   7126  C  "C2'" . DG  I 5 55  ? -26.209 21.393 -57.386 1.00 173.70 ? -18 DG  I "C2'" 1 
ATOM   7127  C  "C1'" . DG  I 5 55  ? -26.061 21.022 -55.920 1.00 173.55 ? -18 DG  I "C1'" 1 
ATOM   7128  N  N9    . DG  I 5 55  ? -25.010 20.051 -55.647 1.00 173.07 ? -18 DG  I N9    1 
ATOM   7129  C  C8    . DG  I 5 55  ? -25.164 18.703 -55.441 1.00 172.99 ? -18 DG  I C8    1 
ATOM   7130  N  N7    . DG  I 5 55  ? -24.038 18.090 -55.202 1.00 172.87 ? -18 DG  I N7    1 
ATOM   7131  C  C5    . DG  I 5 55  ? -23.083 19.095 -55.250 1.00 172.72 ? -18 DG  I C5    1 
ATOM   7132  C  C6    . DG  I 5 55  ? -21.673 19.034 -55.084 1.00 172.54 ? -18 DG  I C6    1 
ATOM   7133  O  O6    . DG  I 5 55  ? -20.971 18.052 -54.827 1.00 172.40 ? -18 DG  I O6    1 
ATOM   7134  N  N1    . DG  I 5 55  ? -21.087 20.287 -55.208 1.00 172.77 ? -18 DG  I N1    1 
ATOM   7135  C  C2    . DG  I 5 55  ? -21.765 21.446 -55.485 1.00 172.99 ? -18 DG  I C2    1 
ATOM   7136  N  N2    . DG  I 5 55  ? -21.021 22.559 -55.568 1.00 172.99 ? -18 DG  I N2    1 
ATOM   7137  N  N3    . DG  I 5 55  ? -23.077 21.516 -55.652 1.00 173.03 ? -18 DG  I N3    1 
ATOM   7138  C  C4    . DG  I 5 55  ? -23.668 20.311 -55.527 1.00 172.91 ? -18 DG  I C4    1 
ATOM   7139  P  P     . DG  I 5 56  ? -27.884 21.554 -60.257 1.00 173.02 ? -17 DG  I P     1 
ATOM   7140  O  OP1   . DG  I 5 56  ? -29.073 22.015 -60.980 1.00 173.18 ? -17 DG  I OP1   1 
ATOM   7141  O  OP2   . DG  I 5 56  ? -27.288 20.234 -60.557 1.00 173.26 ? -17 DG  I OP2   1 
ATOM   7142  O  "O5'" . DG  I 5 56  ? -26.799 22.695 -60.450 1.00 171.65 ? -17 DG  I "O5'" 1 
ATOM   7143  C  "C5'" . DG  I 5 56  ? -26.822 23.867 -59.628 1.00 170.34 ? -17 DG  I "C5'" 1 
ATOM   7144  C  "C4'" . DG  I 5 56  ? -25.608 24.708 -59.937 1.00 169.08 ? -17 DG  I "C4'" 1 
ATOM   7145  O  "O4'" . DG  I 5 56  ? -24.436 24.084 -59.366 1.00 169.19 ? -17 DG  I "O4'" 1 
ATOM   7146  C  "C3'" . DG  I 5 56  ? -25.302 24.807 -61.421 1.00 167.70 ? -17 DG  I "C3'" 1 
ATOM   7147  O  "O3'" . DG  I 5 56  ? -24.436 25.922 -61.532 1.00 165.87 ? -17 DG  I "O3'" 1 
ATOM   7148  C  "C2'" . DG  I 5 56  ? -24.493 23.550 -61.660 1.00 168.33 ? -17 DG  I "C2'" 1 
ATOM   7149  C  "C1'" . DG  I 5 56  ? -23.649 23.492 -60.396 1.00 168.84 ? -17 DG  I "C1'" 1 
ATOM   7150  N  N9    . DG  I 5 56  ? -23.313 22.141 -59.970 1.00 168.78 ? -17 DG  I N9    1 
ATOM   7151  C  C8    . DG  I 5 56  ? -24.120 21.033 -60.042 1.00 168.78 ? -17 DG  I C8    1 
ATOM   7152  N  N7    . DG  I 5 56  ? -23.555 19.956 -59.571 1.00 168.68 ? -17 DG  I N7    1 
ATOM   7153  C  C5    . DG  I 5 56  ? -22.302 20.379 -59.156 1.00 168.55 ? -17 DG  I C5    1 
ATOM   7154  C  C6    . DG  I 5 56  ? -21.242 19.653 -58.556 1.00 168.43 ? -17 DG  I C6    1 
ATOM   7155  O  O6    . DG  I 5 56  ? -21.200 18.454 -58.265 1.00 168.54 ? -17 DG  I O6    1 
ATOM   7156  N  N1    . DG  I 5 56  ? -20.146 20.468 -58.296 1.00 168.19 ? -17 DG  I N1    1 
ATOM   7157  C  C2    . DG  I 5 56  ? -20.078 21.809 -58.582 1.00 167.86 ? -17 DG  I C2    1 
ATOM   7158  N  N2    . DG  I 5 56  ? -18.936 22.422 -58.252 1.00 167.36 ? -17 DG  I N2    1 
ATOM   7159  N  N3    . DG  I 5 56  ? -21.063 22.500 -59.133 1.00 168.13 ? -17 DG  I N3    1 
ATOM   7160  C  C4    . DG  I 5 56  ? -22.138 21.727 -59.393 1.00 168.52 ? -17 DG  I C4    1 
ATOM   7161  P  P     . DG  I 5 57  ? -24.441 26.814 -62.824 1.00 164.07 ? -16 DG  I P     1 
ATOM   7162  O  OP1   . DG  I 5 57  ? -25.406 27.909 -62.614 1.00 164.67 ? -16 DG  I OP1   1 
ATOM   7163  O  OP2   . DG  I 5 57  ? -24.577 25.916 -63.987 1.00 163.84 ? -16 DG  I OP2   1 
ATOM   7164  O  "O5'" . DG  I 5 57  ? -22.972 27.403 -62.809 1.00 160.70 ? -16 DG  I "O5'" 1 
ATOM   7165  C  "C5'" . DG  I 5 57  ? -22.239 27.382 -61.591 1.00 157.21 ? -16 DG  I "C5'" 1 
ATOM   7166  C  "C4'" . DG  I 5 57  ? -20.768 27.394 -61.910 1.00 153.82 ? -16 DG  I "C4'" 1 
ATOM   7167  O  "O4'" . DG  I 5 57  ? -20.256 26.049 -61.815 1.00 152.97 ? -16 DG  I "O4'" 1 
ATOM   7168  C  "C3'" . DG  I 5 57  ? -20.426 27.866 -63.317 1.00 151.22 ? -16 DG  I "C3'" 1 
ATOM   7169  O  "O3'" . DG  I 5 57  ? -19.125 28.405 -63.183 1.00 148.25 ? -16 DG  I "O3'" 1 
ATOM   7170  C  "C2'" . DG  I 5 57  ? -20.346 26.571 -64.097 1.00 151.56 ? -16 DG  I "C2'" 1 
ATOM   7171  C  "C1'" . DG  I 5 57  ? -19.755 25.622 -63.069 1.00 151.73 ? -16 DG  I "C1'" 1 
ATOM   7172  N  N9    . DG  I 5 57  ? -20.127 24.224 -63.237 1.00 150.62 ? -16 DG  I N9    1 
ATOM   7173  C  C8    . DG  I 5 57  ? -21.171 23.733 -63.980 1.00 150.50 ? -16 DG  I C8    1 
ATOM   7174  N  N7    . DG  I 5 57  ? -21.268 22.433 -63.930 1.00 150.49 ? -16 DG  I N7    1 
ATOM   7175  C  C5    . DG  I 5 57  ? -20.234 22.044 -63.092 1.00 150.09 ? -16 DG  I C5    1 
ATOM   7176  C  C6    . DG  I 5 57  ? -19.838 20.749 -62.660 1.00 149.98 ? -16 DG  I C6    1 
ATOM   7177  O  O6    . DG  I 5 57  ? -20.339 19.659 -62.942 1.00 149.48 ? -16 DG  I O6    1 
ATOM   7178  N  N1    . DG  I 5 57  ? -18.741 20.806 -61.810 1.00 149.98 ? -16 DG  I N1    1 
ATOM   7179  C  C2    . DG  I 5 57  ? -18.100 21.957 -61.433 1.00 148.89 ? -16 DG  I C2    1 
ATOM   7180  N  N2    . DG  I 5 57  ? -17.046 21.802 -60.621 1.00 147.82 ? -16 DG  I N2    1 
ATOM   7181  N  N3    . DG  I 5 57  ? -18.454 23.169 -61.831 1.00 149.53 ? -16 DG  I N3    1 
ATOM   7182  C  C4    . DG  I 5 57  ? -19.530 23.139 -62.644 1.00 149.98 ? -16 DG  I C4    1 
ATOM   7183  P  P     . DT  I 5 58  ? -18.581 29.445 -64.200 1.00 145.63 ? -15 DT  I P     1 
ATOM   7184  O  OP1   . DT  I 5 58  ? -19.268 30.718 -63.958 1.00 146.26 ? -15 DT  I OP1   1 
ATOM   7185  O  OP2   . DT  I 5 58  ? -18.567 28.835 -65.534 1.00 144.95 ? -15 DT  I OP2   1 
ATOM   7186  O  "O5'" . DT  I 5 58  ? -17.094 29.627 -63.687 1.00 143.63 ? -15 DT  I "O5'" 1 
ATOM   7187  C  "C5'" . DT  I 5 58  ? -16.864 29.601 -62.269 1.00 141.60 ? -15 DT  I "C5'" 1 
ATOM   7188  C  "C4'" . DT  I 5 58  ? -15.891 28.510 -61.892 1.00 139.33 ? -15 DT  I "C4'" 1 
ATOM   7189  O  "O4'" . DT  I 5 58  ? -16.404 27.201 -62.235 1.00 139.44 ? -15 DT  I "O4'" 1 
ATOM   7190  C  "C3'" . DT  I 5 58  ? -14.521 28.609 -62.561 1.00 136.96 ? -15 DT  I "C3'" 1 
ATOM   7191  O  "O3'" . DT  I 5 58  ? -13.585 28.322 -61.525 1.00 134.32 ? -15 DT  I "O3'" 1 
ATOM   7192  C  "C2'" . DT  I 5 58  ? -14.558 27.490 -63.588 1.00 138.06 ? -15 DT  I "C2'" 1 
ATOM   7193  C  "C1'" . DT  I 5 58  ? -15.346 26.467 -62.814 1.00 139.52 ? -15 DT  I "C1'" 1 
ATOM   7194  N  N1    . DT  I 5 58  ? -15.921 25.342 -63.563 1.00 141.33 ? -15 DT  I N1    1 
ATOM   7195  C  C2    . DT  I 5 58  ? -15.619 24.081 -63.112 1.00 143.19 ? -15 DT  I C2    1 
ATOM   7196  O  O2    . DT  I 5 58  ? -14.896 23.876 -62.155 1.00 143.92 ? -15 DT  I O2    1 
ATOM   7197  N  N3    . DT  I 5 58  ? -16.200 23.063 -63.821 1.00 144.17 ? -15 DT  I N3    1 
ATOM   7198  C  C4    . DT  I 5 58  ? -17.022 23.178 -64.922 1.00 144.61 ? -15 DT  I C4    1 
ATOM   7199  O  O4    . DT  I 5 58  ? -17.468 22.168 -65.459 1.00 145.35 ? -15 DT  I O4    1 
ATOM   7200  C  C5    . DT  I 5 58  ? -17.314 24.533 -65.332 1.00 143.52 ? -15 DT  I C5    1 
ATOM   7201  C  C7    . DT  I 5 58  ? -18.195 24.758 -66.520 1.00 143.50 ? -15 DT  I C7    1 
ATOM   7202  C  C6    . DT  I 5 58  ? -16.747 25.534 -64.647 1.00 142.32 ? -15 DT  I C6    1 
ATOM   7203  P  P     . DT  I 5 59  ? -12.125 28.876 -61.603 1.00 132.81 ? -14 DT  I P     1 
ATOM   7204  O  OP1   . DT  I 5 59  ? -11.859 29.595 -60.354 1.00 132.43 ? -14 DT  I OP1   1 
ATOM   7205  O  OP2   . DT  I 5 59  ? -11.955 29.540 -62.902 1.00 132.90 ? -14 DT  I OP2   1 
ATOM   7206  O  "O5'" . DT  I 5 59  ? -11.227 27.567 -61.718 1.00 131.16 ? -14 DT  I "O5'" 1 
ATOM   7207  C  "C5'" . DT  I 5 59  ? -11.547 26.357 -61.011 1.00 128.63 ? -14 DT  I "C5'" 1 
ATOM   7208  C  "C4'" . DT  I 5 59  ? -10.984 25.143 -61.715 1.00 126.46 ? -14 DT  I "C4'" 1 
ATOM   7209  O  "O4'" . DT  I 5 59  ? -11.988 24.613 -62.602 1.00 125.80 ? -14 DT  I "O4'" 1 
ATOM   7210  C  "C3'" . DT  I 5 59  ? -9.715  25.333 -62.558 1.00 125.61 ? -14 DT  I "C3'" 1 
ATOM   7211  O  "O3'" . DT  I 5 59  ? -8.780  24.318 -62.156 1.00 124.70 ? -14 DT  I "O3'" 1 
ATOM   7212  C  "C2'" . DT  I 5 59  ? -10.206 25.143 -63.985 1.00 125.72 ? -14 DT  I "C2'" 1 
ATOM   7213  C  "C1'" . DT  I 5 59  ? -11.379 24.210 -63.805 1.00 126.23 ? -14 DT  I "C1'" 1 
ATOM   7214  N  N1    . DT  I 5 59  ? -12.393 24.280 -64.867 1.00 127.64 ? -14 DT  I N1    1 
ATOM   7215  C  C2    . DT  I 5 59  ? -13.091 23.136 -65.173 1.00 128.91 ? -14 DT  I C2    1 
ATOM   7216  O  O2    . DT  I 5 59  ? -12.914 22.076 -64.601 1.00 129.19 ? -14 DT  I O2    1 
ATOM   7217  N  N3    . DT  I 5 59  ? -14.020 23.284 -66.170 1.00 129.66 ? -14 DT  I N3    1 
ATOM   7218  C  C4    . DT  I 5 59  ? -14.301 24.430 -66.885 1.00 130.05 ? -14 DT  I C4    1 
ATOM   7219  O  O4    . DT  I 5 59  ? -15.170 24.413 -67.749 1.00 131.25 ? -14 DT  I O4    1 
ATOM   7220  C  C5    . DT  I 5 59  ? -13.534 25.591 -66.511 1.00 128.91 ? -14 DT  I C5    1 
ATOM   7221  C  C7    . DT  I 5 59  ? -13.774 26.879 -67.229 1.00 129.40 ? -14 DT  I C7    1 
ATOM   7222  C  C6    . DT  I 5 59  ? -12.627 25.459 -65.537 1.00 128.20 ? -14 DT  I C6    1 
ATOM   7223  P  P     . DA  I 5 60  ? -7.228  24.288 -62.470 1.00 124.00 ? -13 DA  I P     1 
ATOM   7224  O  OP1   . DA  I 5 60  ? -6.526  24.492 -61.214 1.00 124.41 ? -13 DA  I OP1   1 
ATOM   7225  O  OP2   . DA  I 5 60  ? -6.967  25.132 -63.638 1.00 123.73 ? -13 DA  I OP2   1 
ATOM   7226  O  "O5'" . DA  I 5 60  ? -7.012  22.765 -62.853 1.00 124.59 ? -13 DA  I "O5'" 1 
ATOM   7227  C  "C5'" . DA  I 5 60  ? -7.853  21.756 -62.260 1.00 124.44 ? -13 DA  I "C5'" 1 
ATOM   7228  C  "C4'" . DA  I 5 60  ? -8.170  20.644 -63.233 1.00 124.14 ? -13 DA  I "C4'" 1 
ATOM   7229  O  "O4'" . DA  I 5 60  ? -9.257  21.055 -64.083 1.00 124.52 ? -13 DA  I "O4'" 1 
ATOM   7230  C  "C3'" . DA  I 5 60  ? -7.023  20.218 -64.152 1.00 124.15 ? -13 DA  I "C3'" 1 
ATOM   7231  O  "O3'" . DA  I 5 60  ? -6.639  18.872 -63.842 1.00 122.98 ? -13 DA  I "O3'" 1 
ATOM   7232  C  "C2'" . DA  I 5 60  ? -7.586  20.356 -65.557 1.00 124.81 ? -13 DA  I "C2'" 1 
ATOM   7233  C  "C1'" . DA  I 5 60  ? -9.082  20.528 -65.376 1.00 125.85 ? -13 DA  I "C1'" 1 
ATOM   7234  N  N9    . DA  I 5 60  ? -9.650  21.482 -66.324 1.00 128.45 ? -13 DA  I N9    1 
ATOM   7235  C  C8    . DA  I 5 60  ? -9.440  22.837 -66.358 1.00 129.06 ? -13 DA  I C8    1 
ATOM   7236  N  N7    . DA  I 5 60  ? -10.056 23.443 -67.342 1.00 129.15 ? -13 DA  I N7    1 
ATOM   7237  C  C5    . DA  I 5 60  ? -10.701 22.416 -68.012 1.00 129.93 ? -13 DA  I C5    1 
ATOM   7238  C  C6    . DA  I 5 60  ? -11.522 22.402 -69.148 1.00 131.18 ? -13 DA  I C6    1 
ATOM   7239  N  N6    . DA  I 5 60  ? -11.850 23.496 -69.835 1.00 131.61 ? -13 DA  I N6    1 
ATOM   7240  N  N1    . DA  I 5 60  ? -12.010 21.211 -69.556 1.00 131.29 ? -13 DA  I N1    1 
ATOM   7241  C  C2    . DA  I 5 60  ? -11.696 20.118 -68.853 1.00 130.53 ? -13 DA  I C2    1 
ATOM   7242  N  N3    . DA  I 5 60  ? -10.924 20.002 -67.777 1.00 129.20 ? -13 DA  I N3    1 
ATOM   7243  C  C4    . DA  I 5 60  ? -10.457 21.202 -67.399 1.00 129.08 ? -13 DA  I C4    1 
ATOM   7244  P  P     . DG  I 5 61  ? -5.343  18.209 -64.481 1.00 121.42 ? -12 DG  I P     1 
ATOM   7245  O  OP1   . DG  I 5 61  ? -4.672  17.437 -63.444 1.00 122.33 ? -12 DG  I OP1   1 
ATOM   7246  O  OP2   . DG  I 5 61  ? -4.604  19.188 -65.269 1.00 121.18 ? -12 DG  I OP2   1 
ATOM   7247  O  "O5'" . DG  I 5 61  ? -5.938  17.212 -65.557 1.00 122.95 ? -12 DG  I "O5'" 1 
ATOM   7248  C  "C5'" . DG  I 5 61  ? -7.222  16.601 -65.381 1.00 125.53 ? -12 DG  I "C5'" 1 
ATOM   7249  C  "C4'" . DG  I 5 61  ? -7.548  15.796 -66.613 1.00 128.25 ? -12 DG  I "C4'" 1 
ATOM   7250  O  "O4'" . DG  I 5 61  ? -8.109  16.676 -67.606 1.00 127.70 ? -12 DG  I "O4'" 1 
ATOM   7251  C  "C3'" . DG  I 5 61  ? -6.329  15.166 -67.272 1.00 131.43 ? -12 DG  I "C3'" 1 
ATOM   7252  O  "O3'" . DG  I 5 61  ? -6.724  13.979 -67.955 1.00 135.93 ? -12 DG  I "O3'" 1 
ATOM   7253  C  "C2'" . DG  I 5 61  ? -5.899  16.232 -68.255 1.00 130.35 ? -12 DG  I "C2'" 1 
ATOM   7254  C  "C1'" . DG  I 5 61  ? -7.225  16.808 -68.704 1.00 128.86 ? -12 DG  I "C1'" 1 
ATOM   7255  N  N9    . DG  I 5 61  ? -7.146  18.221 -69.040 1.00 129.23 ? -12 DG  I N9    1 
ATOM   7256  C  C8    . DG  I 5 61  ? -6.250  19.127 -68.534 1.00 129.85 ? -12 DG  I C8    1 
ATOM   7257  N  N7    . DG  I 5 61  ? -6.417  20.331 -69.005 1.00 129.97 ? -12 DG  I N7    1 
ATOM   7258  C  C5    . DG  I 5 61  ? -7.491  20.213 -69.874 1.00 129.70 ? -12 DG  I C5    1 
ATOM   7259  C  C6    . DG  I 5 61  ? -8.132  21.190 -70.678 1.00 129.54 ? -12 DG  I C6    1 
ATOM   7260  O  O6    . DG  I 5 61  ? -7.854  22.385 -70.800 1.00 129.79 ? -12 DG  I O6    1 
ATOM   7261  N  N1    . DG  I 5 61  ? -9.184  20.647 -71.405 1.00 128.94 ? -12 DG  I N1    1 
ATOM   7262  C  C2    . DG  I 5 61  ? -9.566  19.331 -71.369 1.00 128.39 ? -12 DG  I C2    1 
ATOM   7263  N  N2    . DG  I 5 61  ? -10.614 19.002 -72.135 1.00 127.53 ? -12 DG  I N2    1 
ATOM   7264  N  N3    . DG  I 5 61  ? -8.990  18.412 -70.608 1.00 128.73 ? -12 DG  I N3    1 
ATOM   7265  C  C4    . DG  I 5 61  ? -7.955  18.917 -69.903 1.00 129.19 ? -12 DG  I C4    1 
ATOM   7266  P  P     . DG  I 5 62  ? -5.641  12.989 -68.527 1.00 139.88 ? -11 DG  I P     1 
ATOM   7267  O  OP1   . DG  I 5 62  ? -6.161  11.626 -68.379 1.00 139.87 ? -11 DG  I OP1   1 
ATOM   7268  O  OP2   . DG  I 5 62  ? -4.332  13.348 -67.963 1.00 140.09 ? -11 DG  I OP2   1 
ATOM   7269  O  "O5'" . DG  I 5 62  ? -5.662  13.291 -70.085 1.00 141.96 ? -11 DG  I "O5'" 1 
ATOM   7270  C  "C5'" . DG  I 5 62  ? -6.829  12.973 -70.850 1.00 143.06 ? -11 DG  I "C5'" 1 
ATOM   7271  C  "C4'" . DG  I 5 62  ? -6.713  13.514 -72.253 1.00 144.25 ? -11 DG  I "C4'" 1 
ATOM   7272  O  "O4'" . DG  I 5 62  ? -6.901  14.941 -72.221 1.00 143.86 ? -11 DG  I "O4'" 1 
ATOM   7273  C  "C3'" . DG  I 5 62  ? -5.375  13.272 -72.960 1.00 146.49 ? -11 DG  I "C3'" 1 
ATOM   7274  O  "O3'" . DG  I 5 62  ? -5.649  12.819 -74.287 1.00 150.35 ? -11 DG  I "O3'" 1 
ATOM   7275  C  "C2'" . DG  I 5 62  ? -4.771  14.658 -73.062 1.00 145.28 ? -11 DG  I "C2'" 1 
ATOM   7276  C  "C1'" . DG  I 5 62  ? -6.009  15.521 -73.143 1.00 144.39 ? -11 DG  I "C1'" 1 
ATOM   7277  N  N9    . DG  I 5 62  ? -5.810  16.919 -72.766 1.00 143.93 ? -11 DG  I N9    1 
ATOM   7278  C  C8    . DG  I 5 62  ? -5.222  17.391 -71.616 1.00 143.31 ? -11 DG  I C8    1 
ATOM   7279  N  N7    . DG  I 5 62  ? -5.171  18.694 -71.565 1.00 142.83 ? -11 DG  I N7    1 
ATOM   7280  C  C5    . DG  I 5 62  ? -5.758  19.109 -72.752 1.00 143.00 ? -11 DG  I C5    1 
ATOM   7281  C  C6    . DG  I 5 62  ? -5.979  20.417 -73.259 1.00 142.71 ? -11 DG  I C6    1 
ATOM   7282  O  O6    . DG  I 5 62  ? -5.691  21.501 -72.744 1.00 142.58 ? -11 DG  I O6    1 
ATOM   7283  N  N1    . DG  I 5 62  ? -6.603  20.386 -74.501 1.00 142.97 ? -11 DG  I N1    1 
ATOM   7284  C  C2    . DG  I 5 62  ? -6.970  19.244 -75.169 1.00 143.49 ? -11 DG  I C2    1 
ATOM   7285  N  N2    . DG  I 5 62  ? -7.562  19.424 -76.357 1.00 143.62 ? -11 DG  I N2    1 
ATOM   7286  N  N3    . DG  I 5 62  ? -6.763  18.018 -74.711 1.00 143.48 ? -11 DG  I N3    1 
ATOM   7287  C  C4    . DG  I 5 62  ? -6.156  18.025 -73.506 1.00 143.59 ? -11 DG  I C4    1 
ATOM   7288  P  P     . DG  I 5 63  ? -4.610  11.888 -75.086 1.00 153.61 ? -10 DG  I P     1 
ATOM   7289  O  OP1   . DG  I 5 63  ? -5.072  10.501 -74.954 1.00 154.06 ? -10 DG  I OP1   1 
ATOM   7290  O  OP2   . DG  I 5 63  ? -3.259  12.241 -74.625 1.00 153.79 ? -10 DG  I OP2   1 
ATOM   7291  O  "O5'" . DG  I 5 63  ? -4.783  12.425 -76.572 1.00 155.03 ? -10 DG  I "O5'" 1 
ATOM   7292  C  "C5'" . DG  I 5 63  ? -6.101  12.788 -77.022 1.00 156.38 ? -10 DG  I "C5'" 1 
ATOM   7293  C  "C4'" . DG  I 5 63  ? -6.063  13.886 -78.059 1.00 158.08 ? -10 DG  I "C4'" 1 
ATOM   7294  O  "O4'" . DG  I 5 63  ? -6.002  15.183 -77.417 1.00 158.30 ? -10 DG  I "O4'" 1 
ATOM   7295  C  "C3'" . DG  I 5 63  ? -4.878  13.845 -79.020 1.00 160.06 ? -10 DG  I "C3'" 1 
ATOM   7296  O  "O3'" . DG  I 5 63  ? -5.301  14.410 -80.258 1.00 163.40 ? -10 DG  I "O3'" 1 
ATOM   7297  C  "C2'" . DG  I 5 63  ? -3.936  14.861 -78.417 1.00 159.29 ? -10 DG  I "C2'" 1 
ATOM   7298  C  "C1'" . DG  I 5 63  ? -4.923  15.920 -77.975 1.00 158.48 ? -10 DG  I "C1'" 1 
ATOM   7299  N  N9    . DG  I 5 63  ? -4.393  16.808 -76.944 1.00 157.58 ? -10 DG  I N9    1 
ATOM   7300  C  C8    . DG  I 5 63  ? -3.780  16.424 -75.778 1.00 157.35 ? -10 DG  I C8    1 
ATOM   7301  N  N7    . DG  I 5 63  ? -3.368  17.431 -75.059 1.00 157.09 ? -10 DG  I N7    1 
ATOM   7302  C  C5    . DG  I 5 63  ? -3.709  18.547 -75.806 1.00 156.86 ? -10 DG  I C5    1 
ATOM   7303  C  C6    . DG  I 5 63  ? -3.510  19.925 -75.538 1.00 155.89 ? -10 DG  I C6    1 
ATOM   7304  O  O6    . DG  I 5 63  ? -2.983  20.446 -74.552 1.00 155.48 ? -10 DG  I O6    1 
ATOM   7305  N  N1    . DG  I 5 63  ? -4.005  20.725 -76.561 1.00 155.50 ? -10 DG  I N1    1 
ATOM   7306  C  C2    . DG  I 5 63  ? -4.613  20.258 -77.698 1.00 155.56 ? -10 DG  I C2    1 
ATOM   7307  N  N2    . DG  I 5 63  ? -5.028  21.190 -78.564 1.00 155.09 ? -10 DG  I N2    1 
ATOM   7308  N  N3    . DG  I 5 63  ? -4.807  18.974 -77.962 1.00 156.40 ? -10 DG  I N3    1 
ATOM   7309  C  C4    . DG  I 5 63  ? -4.321  18.179 -76.985 1.00 157.03 ? -10 DG  I C4    1 
ATOM   7310  P  P     . DT  I 5 64  ? -4.571  14.023 -81.608 1.00 166.50 ? -9  DT  I P     1 
ATOM   7311  O  OP1   . DT  I 5 64  ? -5.057  12.696 -82.016 1.00 166.50 ? -9  DT  I OP1   1 
ATOM   7312  O  OP2   . DT  I 5 64  ? -3.120  14.255 -81.455 1.00 167.19 ? -9  DT  I OP2   1 
ATOM   7313  O  "O5'" . DT  I 5 64  ? -5.125  15.099 -82.640 1.00 167.37 ? -9  DT  I "O5'" 1 
ATOM   7314  C  "C5'" . DT  I 5 64  ? -6.107  16.067 -82.243 1.00 168.16 ? -9  DT  I "C5'" 1 
ATOM   7315  C  "C4'" . DT  I 5 64  ? -5.593  17.463 -82.509 1.00 169.31 ? -9  DT  I "C4'" 1 
ATOM   7316  O  "O4'" . DT  I 5 64  ? -4.961  17.980 -81.316 1.00 169.73 ? -9  DT  I "O4'" 1 
ATOM   7317  C  "C3'" . DT  I 5 64  ? -4.542  17.559 -83.620 1.00 170.16 ? -9  DT  I "C3'" 1 
ATOM   7318  O  "O3'" . DT  I 5 64  ? -5.087  18.223 -84.766 1.00 171.11 ? -9  DT  I "O3'" 1 
ATOM   7319  C  "C2'" . DT  I 5 64  ? -3.415  18.380 -83.008 1.00 170.14 ? -9  DT  I "C2'" 1 
ATOM   7320  C  "C1'" . DT  I 5 64  ? -3.983  18.914 -81.709 1.00 169.90 ? -9  DT  I "C1'" 1 
ATOM   7321  N  N1    . DT  I 5 64  ? -2.979  19.012 -80.637 1.00 169.75 ? -9  DT  I N1    1 
ATOM   7322  C  C2    . DT  I 5 64  ? -2.485  20.260 -80.347 1.00 169.83 ? -9  DT  I C2    1 
ATOM   7323  O  O2    . DT  I 5 64  ? -2.860  21.270 -80.914 1.00 169.90 ? -9  DT  I O2    1 
ATOM   7324  N  N3    . DT  I 5 64  ? -1.531  20.285 -79.365 1.00 169.91 ? -9  DT  I N3    1 
ATOM   7325  C  C4    . DT  I 5 64  ? -1.025  19.208 -78.667 1.00 170.09 ? -9  DT  I C4    1 
ATOM   7326  O  O4    . DT  I 5 64  ? -0.168  19.383 -77.807 1.00 170.23 ? -9  DT  I O4    1 
ATOM   7327  C  C5    . DT  I 5 64  ? -1.581  17.927 -79.026 1.00 169.89 ? -9  DT  I C5    1 
ATOM   7328  C  C7    . DT  I 5 64  ? -1.089  16.703 -78.321 1.00 169.85 ? -9  DT  I C7    1 
ATOM   7329  C  C6    . DT  I 5 64  ? -2.513  17.891 -79.988 1.00 169.70 ? -9  DT  I C6    1 
ATOM   7330  P  P     . DT  I 5 65  ? -4.193  18.517 -86.065 1.00 172.09 ? -8  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5 65  ? -5.100  18.644 -87.216 1.00 172.20 ? -8  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5 65  ? -3.061  17.575 -86.104 1.00 172.43 ? -8  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5 65  ? -3.587  19.958 -85.798 1.00 172.00 ? -8  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5 65  ? -3.881  21.048 -86.690 1.00 171.53 ? -8  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5 65  ? -3.060  22.276 -86.364 1.00 170.73 ? -8  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5 65  ? -2.577  22.242 -85.000 1.00 170.30 ? -8  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5 65  ? -1.837  22.486 -87.261 1.00 170.50 ? -8  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5 65  ? -2.016  23.745 -87.909 1.00 170.64 ? -8  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5 65  ? -0.655  22.409 -86.308 1.00 170.28 ? -8  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5 65  ? -1.258  22.741 -84.956 1.00 170.42 ? -8  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5 65  ? -0.578  22.114 -83.808 1.00 170.70 ? -8  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5 65  ? 0.067   22.925 -82.906 1.00 170.99 ? -8  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5 65  ? 0.100   24.139 -83.008 1.00 171.02 ? -8  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5 65  ? 0.670   22.261 -81.869 1.00 171.05 ? -8  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5 65  ? 0.692   20.899 -81.650 1.00 170.97 ? -8  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5 65  ? 1.276   20.445 -80.671 1.00 170.96 ? -8  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5 65  ? 0.002   20.107 -82.639 1.00 170.74 ? -8  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5 65  ? -0.038  18.621 -82.479 1.00 170.74 ? -8  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5 65  ? -0.603  20.747 -83.648 1.00 170.61 ? -8  DT  I C6    1 
ATOM   7350  P  P     . DA  I 5 66  ? -1.017  24.240 -89.043 1.00 170.75 ? -7  DA  I P     1 
ATOM   7351  O  OP1   . DA  I 5 66  ? -1.686  25.336 -89.792 1.00 171.03 ? -7  DA  I OP1   1 
ATOM   7352  O  OP2   . DA  I 5 66  ? -0.503  23.054 -89.775 1.00 171.00 ? -7  DA  I OP2   1 
ATOM   7353  O  "O5'" . DA  I 5 66  ? 0.193   24.858 -88.195 1.00 169.58 ? -7  DA  I "O5'" 1 
ATOM   7354  C  "C5'" . DA  I 5 66  ? -0.053  25.899 -87.228 1.00 168.00 ? -7  DA  I "C5'" 1 
ATOM   7355  C  "C4'" . DA  I 5 66  ? 1.203   26.203 -86.434 1.00 166.34 ? -7  DA  I "C4'" 1 
ATOM   7356  O  "O4'" . DA  I 5 66  ? 1.479   25.111 -85.523 1.00 166.26 ? -7  DA  I "O4'" 1 
ATOM   7357  C  "C3'" . DA  I 5 66  ? 2.467   26.408 -87.278 1.00 164.99 ? -7  DA  I "C3'" 1 
ATOM   7358  O  "O3'" . DA  I 5 66  ? 3.086   27.622 -86.925 1.00 162.98 ? -7  DA  I "O3'" 1 
ATOM   7359  C  "C2'" . DA  I 5 66  ? 3.349   25.203 -86.933 1.00 165.67 ? -7  DA  I "C2'" 1 
ATOM   7360  C  "C1'" . DA  I 5 66  ? 2.856   24.818 -85.541 1.00 166.26 ? -7  DA  I "C1'" 1 
ATOM   7361  N  N9    . DA  I 5 66  ? 3.041   23.395 -85.218 1.00 166.76 ? -7  DA  I N9    1 
ATOM   7362  C  C8    . DA  I 5 66  ? 2.820   22.322 -86.045 1.00 167.09 ? -7  DA  I C8    1 
ATOM   7363  N  N7    . DA  I 5 66  ? 3.088   21.161 -85.495 1.00 167.28 ? -7  DA  I N7    1 
ATOM   7364  C  C5    . DA  I 5 66  ? 3.528   21.487 -84.220 1.00 167.21 ? -7  DA  I C5    1 
ATOM   7365  C  C6    . DA  I 5 66  ? 3.977   20.695 -83.125 1.00 167.40 ? -7  DA  I C6    1 
ATOM   7366  N  N6    . DA  I 5 66  ? 4.044   19.356 -83.160 1.00 167.30 ? -7  DA  I N6    1 
ATOM   7367  N  N1    . DA  I 5 66  ? 4.339   21.341 -81.984 1.00 167.37 ? -7  DA  I N1    1 
ATOM   7368  C  C2    . DA  I 5 66  ? 4.270   22.682 -81.952 1.00 167.23 ? -7  DA  I C2    1 
ATOM   7369  N  N3    . DA  I 5 66  ? 3.867   23.527 -82.914 1.00 167.07 ? -7  DA  I N3    1 
ATOM   7370  C  C4    . DA  I 5 66  ? 3.512   22.862 -84.033 1.00 166.90 ? -7  DA  I C4    1 
ATOM   7371  P  P     . DG  I 5 67  ? 3.467   28.632 -88.010 1.00 160.87 ? -6  DG  I P     1 
ATOM   7372  O  OP1   . DG  I 5 67  ? 2.255   28.936 -88.773 1.00 160.61 ? -6  DG  I OP1   1 
ATOM   7373  O  OP2   . DG  I 5 67  ? 4.665   28.129 -88.689 1.00 160.52 ? -6  DG  I OP2   1 
ATOM   7374  O  "O5'" . DG  I 5 67  ? 3.868   29.885 -87.123 1.00 159.96 ? -6  DG  I "O5'" 1 
ATOM   7375  C  "C5'" . DG  I 5 67  ? 3.005   30.293 -86.041 1.00 158.90 ? -6  DG  I "C5'" 1 
ATOM   7376  C  "C4'" . DG  I 5 67  ? 3.707   30.221 -84.704 1.00 157.67 ? -6  DG  I "C4'" 1 
ATOM   7377  O  "O4'" . DG  I 5 67  ? 4.114   28.868 -84.403 1.00 157.10 ? -6  DG  I "O4'" 1 
ATOM   7378  C  "C3'" . DG  I 5 67  ? 4.959   31.085 -84.571 1.00 157.31 ? -6  DG  I "C3'" 1 
ATOM   7379  O  "O3'" . DG  I 5 67  ? 4.873   31.766 -83.318 1.00 157.47 ? -6  DG  I "O3'" 1 
ATOM   7380  C  "C2'" . DG  I 5 67  ? 6.096   30.078 -84.617 1.00 157.03 ? -6  DG  I "C2'" 1 
ATOM   7381  C  "C1'" . DG  I 5 67  ? 5.475   28.833 -84.021 1.00 156.98 ? -6  DG  I "C1'" 1 
ATOM   7382  N  N9    . DG  I 5 67  ? 6.042   27.597 -84.540 1.00 157.33 ? -6  DG  I N9    1 
ATOM   7383  C  C8    . DG  I 5 67  ? 6.328   27.316 -85.852 1.00 157.69 ? -6  DG  I C8    1 
ATOM   7384  N  N7    . DG  I 5 67  ? 6.811   26.117 -86.027 1.00 157.75 ? -6  DG  I N7    1 
ATOM   7385  C  C5    . DG  I 5 67  ? 6.844   25.572 -84.752 1.00 157.89 ? -6  DG  I C5    1 
ATOM   7386  C  C6    . DG  I 5 67  ? 7.271   24.290 -84.312 1.00 158.16 ? -6  DG  I C6    1 
ATOM   7387  O  O6    . DG  I 5 67  ? 7.731   23.357 -84.981 1.00 157.64 ? -6  DG  I O6    1 
ATOM   7388  N  N1    . DG  I 5 67  ? 7.124   24.147 -82.936 1.00 158.64 ? -6  DG  I N1    1 
ATOM   7389  C  C2    . DG  I 5 67  ? 6.635   25.115 -82.091 1.00 158.46 ? -6  DG  I C2    1 
ATOM   7390  N  N2    . DG  I 5 67  ? 6.561   24.783 -80.793 1.00 158.42 ? -6  DG  I N2    1 
ATOM   7391  N  N3    . DG  I 5 67  ? 6.229   26.312 -82.491 1.00 158.08 ? -6  DG  I N3    1 
ATOM   7392  C  C4    . DG  I 5 67  ? 6.365   26.472 -83.824 1.00 157.70 ? -6  DG  I C4    1 
ATOM   7393  P  P     . DG  I 5 68  ? 5.767   33.033 -83.036 1.00 157.77 ? -5  DG  I P     1 
ATOM   7394  O  OP1   . DG  I 5 68  ? 4.876   34.138 -82.619 1.00 158.11 ? -5  DG  I OP1   1 
ATOM   7395  O  OP2   . DG  I 5 68  ? 6.688   33.210 -84.182 1.00 158.02 ? -5  DG  I OP2   1 
ATOM   7396  O  "O5'" . DG  I 5 68  ? 6.632   32.583 -81.779 1.00 156.56 ? -5  DG  I "O5'" 1 
ATOM   7397  C  "C5'" . DG  I 5 68  ? 6.894   31.194 -81.510 1.00 154.92 ? -5  DG  I "C5'" 1 
ATOM   7398  C  "C4'" . DG  I 5 68  ? 8.341   30.976 -81.137 1.00 153.47 ? -5  DG  I "C4'" 1 
ATOM   7399  O  "O4'" . DG  I 5 68  ? 8.786   29.711 -81.681 1.00 153.28 ? -5  DG  I "O4'" 1 
ATOM   7400  C  "C3'" . DG  I 5 68  ? 9.308   32.016 -81.695 1.00 152.35 ? -5  DG  I "C3'" 1 
ATOM   7401  O  "O3'" . DG  I 5 68  ? 10.501  32.028 -80.919 1.00 151.11 ? -5  DG  I "O3'" 1 
ATOM   7402  C  "C2'" . DG  I 5 68  ? 9.762   31.365 -82.982 1.00 152.58 ? -5  DG  I "C2'" 1 
ATOM   7403  C  "C1'" . DG  I 5 68  ? 9.918   29.944 -82.497 1.00 152.93 ? -5  DG  I "C1'" 1 
ATOM   7404  N  N9    . DG  I 5 68  ? 9.946   28.927 -83.541 1.00 153.02 ? -5  DG  I N9    1 
ATOM   7405  C  C8    . DG  I 5 68  ? 9.773   29.119 -84.889 1.00 153.01 ? -5  DG  I C8    1 
ATOM   7406  N  N7    . DG  I 5 68  ? 9.889   28.020 -85.582 1.00 153.16 ? -5  DG  I N7    1 
ATOM   7407  C  C5    . DG  I 5 68  ? 10.162  27.045 -84.635 1.00 153.19 ? -5  DG  I C5    1 
ATOM   7408  C  C6    . DG  I 5 68  ? 10.387  25.652 -84.790 1.00 153.36 ? -5  DG  I C6    1 
ATOM   7409  O  O6    . DG  I 5 68  ? 10.393  24.983 -85.829 1.00 153.40 ? -5  DG  I O6    1 
ATOM   7410  N  N1    . DG  I 5 68  ? 10.628  25.032 -83.568 1.00 153.52 ? -5  DG  I N1    1 
ATOM   7411  C  C2    . DG  I 5 68  ? 10.651  25.672 -82.354 1.00 153.49 ? -5  DG  I C2    1 
ATOM   7412  N  N2    . DG  I 5 68  ? 10.898  24.901 -81.288 1.00 153.36 ? -5  DG  I N2    1 
ATOM   7413  N  N3    . DG  I 5 68  ? 10.454  26.971 -82.198 1.00 153.45 ? -5  DG  I N3    1 
ATOM   7414  C  C4    . DG  I 5 68  ? 10.212  27.591 -83.372 1.00 153.22 ? -5  DG  I C4    1 
ATOM   7415  P  P     . DG  I 5 69  ? 10.697  33.088 -79.778 1.00 149.93 ? -4  DG  I P     1 
ATOM   7416  O  OP1   . DG  I 5 69  ? 9.368   33.491 -79.291 1.00 149.74 ? -4  DG  I OP1   1 
ATOM   7417  O  OP2   . DG  I 5 69  ? 11.628  34.103 -80.270 1.00 149.78 ? -4  DG  I OP2   1 
ATOM   7418  O  "O5'" . DG  I 5 69  ? 11.485  32.262 -78.672 1.00 149.54 ? -4  DG  I "O5'" 1 
ATOM   7419  C  "C5'" . DG  I 5 69  ? 10.808  31.321 -77.818 1.00 148.90 ? -4  DG  I "C5'" 1 
ATOM   7420  C  "C4'" . DG  I 5 69  ? 11.642  30.078 -77.616 1.00 148.53 ? -4  DG  I "C4'" 1 
ATOM   7421  O  "O4'" . DG  I 5 69  ? 11.755  29.347 -78.859 1.00 149.07 ? -4  DG  I "O4'" 1 
ATOM   7422  C  "C3'" . DG  I 5 69  ? 13.070  30.318 -77.136 1.00 147.95 ? -4  DG  I "C3'" 1 
ATOM   7423  O  "O3'" . DG  I 5 69  ? 13.337  29.322 -76.148 1.00 146.68 ? -4  DG  I "O3'" 1 
ATOM   7424  C  "C2'" . DG  I 5 69  ? 13.894  30.142 -78.401 1.00 148.72 ? -4  DG  I "C2'" 1 
ATOM   7425  C  "C1'" . DG  I 5 69  ? 13.117  29.085 -79.157 1.00 149.36 ? -4  DG  I "C1'" 1 
ATOM   7426  N  N9    . DG  I 5 69  ? 13.282  29.137 -80.610 1.00 150.29 ? -4  DG  I N9    1 
ATOM   7427  C  C8    . DG  I 5 69  ? 13.124  30.241 -81.410 1.00 150.94 ? -4  DG  I C8    1 
ATOM   7428  N  N7    . DG  I 5 69  ? 13.324  29.992 -82.675 1.00 151.22 ? -4  DG  I N7    1 
ATOM   7429  C  C5    . DG  I 5 69  ? 13.649  28.644 -82.712 1.00 151.36 ? -4  DG  I C5    1 
ATOM   7430  C  C6    . DG  I 5 69  ? 13.984  27.810 -83.813 1.00 151.86 ? -4  DG  I C6    1 
ATOM   7431  O  O6    . DG  I 5 69  ? 14.062  28.108 -85.008 1.00 151.84 ? -4  DG  I O6    1 
ATOM   7432  N  N1    . DG  I 5 69  ? 14.244  26.506 -83.408 1.00 152.20 ? -4  DG  I N1    1 
ATOM   7433  C  C2    . DG  I 5 69  ? 14.200  26.063 -82.111 1.00 152.22 ? -4  DG  I C2    1 
ATOM   7434  N  N2    . DG  I 5 69  ? 14.480  24.767 -81.925 1.00 152.30 ? -4  DG  I N2    1 
ATOM   7435  N  N3    . DG  I 5 69  ? 13.893  26.831 -81.073 1.00 151.69 ? -4  DG  I N3    1 
ATOM   7436  C  C4    . DG  I 5 69  ? 13.627  28.101 -81.446 1.00 150.91 ? -4  DG  I C4    1 
ATOM   7437  P  P     . DT  I 5 70  ? 14.601  29.406 -75.196 1.00 145.65 ? -3  DT  I P     1 
ATOM   7438  O  OP1   . DT  I 5 70  ? 14.123  29.323 -73.817 1.00 144.99 ? -3  DT  I OP1   1 
ATOM   7439  O  OP2   . DT  I 5 70  ? 15.472  30.502 -75.629 1.00 145.86 ? -3  DT  I OP2   1 
ATOM   7440  O  "O5'" . DT  I 5 70  ? 15.397  28.076 -75.530 1.00 146.63 ? -3  DT  I "O5'" 1 
ATOM   7441  C  "C5'" . DT  I 5 70  ? 14.735  26.808 -75.471 1.00 147.70 ? -3  DT  I "C5'" 1 
ATOM   7442  C  "C4'" . DT  I 5 70  ? 15.518  25.773 -76.242 1.00 149.00 ? -3  DT  I "C4'" 1 
ATOM   7443  O  "O4'" . DT  I 5 70  ? 15.495  26.096 -77.649 1.00 149.25 ? -3  DT  I "O4'" 1 
ATOM   7444  C  "C3'" . DT  I 5 70  ? 16.994  25.657 -75.859 1.00 150.48 ? -3  DT  I "C3'" 1 
ATOM   7445  O  "O3'" . DT  I 5 70  ? 17.292  24.294 -75.579 1.00 153.00 ? -3  DT  I "O3'" 1 
ATOM   7446  C  "C2'" . DT  I 5 70  ? 17.732  26.061 -77.123 1.00 149.89 ? -3  DT  I "C2'" 1 
ATOM   7447  C  "C1'" . DT  I 5 70  ? 16.728  25.682 -78.184 1.00 149.69 ? -3  DT  I "C1'" 1 
ATOM   7448  N  N1    . DT  I 5 70  ? 16.916  26.340 -79.488 1.00 150.12 ? -3  DT  I N1    1 
ATOM   7449  C  C2    . DT  I 5 70  ? 17.303  25.554 -80.547 1.00 150.92 ? -3  DT  I C2    1 
ATOM   7450  O  O2    . DT  I 5 70  ? 17.442  24.347 -80.463 1.00 151.38 ? -3  DT  I O2    1 
ATOM   7451  N  N3    . DT  I 5 70  ? 17.473  26.229 -81.726 1.00 150.74 ? -3  DT  I N3    1 
ATOM   7452  C  C4    . DT  I 5 70  ? 17.337  27.584 -81.938 1.00 150.42 ? -3  DT  I C4    1 
ATOM   7453  O  O4    . DT  I 5 70  ? 17.544  28.052 -83.052 1.00 150.42 ? -3  DT  I O4    1 
ATOM   7454  C  C5    . DT  I 5 70  ? 16.948  28.351 -80.780 1.00 150.14 ? -3  DT  I C5    1 
ATOM   7455  C  C7    . DT  I 5 70  ? 16.771  29.829 -80.915 1.00 150.10 ? -3  DT  I C7    1 
ATOM   7456  C  C6    . DT  I 5 70  ? 16.759  27.699 -79.628 1.00 149.97 ? -3  DT  I C6    1 
ATOM   7457  P  P     . DT  I 5 71  ? 18.692  23.903 -74.978 1.00 155.66 ? -2  DT  I P     1 
ATOM   7458  O  OP1   . DT  I 5 71  ? 18.519  22.662 -74.222 1.00 155.43 ? -2  DT  I OP1   1 
ATOM   7459  O  OP2   . DT  I 5 71  ? 19.259  25.086 -74.326 1.00 155.36 ? -2  DT  I OP2   1 
ATOM   7460  O  "O5'" . DT  I 5 71  ? 19.584  23.583 -76.256 1.00 159.20 ? -2  DT  I "O5'" 1 
ATOM   7461  C  "C5'" . DT  I 5 71  ? 19.514  22.285 -76.889 1.00 162.56 ? -2  DT  I "C5'" 1 
ATOM   7462  C  "C4'" . DT  I 5 71  ? 20.455  22.167 -78.069 1.00 165.63 ? -2  DT  I "C4'" 1 
ATOM   7463  O  "O4'" . DT  I 5 71  ? 20.121  23.146 -79.078 1.00 166.25 ? -2  DT  I "O4'" 1 
ATOM   7464  C  "C3'" . DT  I 5 71  ? 21.945  22.337 -77.759 1.00 168.17 ? -2  DT  I "C3'" 1 
ATOM   7465  O  "O3'" . DT  I 5 71  ? 22.651  21.267 -78.379 1.00 171.73 ? -2  DT  I "O3'" 1 
ATOM   7466  C  "C2'" . DT  I 5 71  ? 22.315  23.642 -78.435 1.00 167.40 ? -2  DT  I "C2'" 1 
ATOM   7467  C  "C1'" . DT  I 5 71  ? 21.288  23.784 -79.544 1.00 166.86 ? -2  DT  I "C1'" 1 
ATOM   7468  N  N1    . DT  I 5 71  ? 20.952  25.184 -79.802 1.00 166.98 ? -2  DT  I N1    1 
ATOM   7469  C  C2    . DT  I 5 71  ? 20.719  25.599 -81.091 1.00 166.99 ? -2  DT  I C2    1 
ATOM   7470  O  O2    . DT  I 5 71  ? 20.763  24.850 -82.048 1.00 167.08 ? -2  DT  I O2    1 
ATOM   7471  N  N3    . DT  I 5 71  ? 20.437  26.934 -81.218 1.00 166.96 ? -2  DT  I N3    1 
ATOM   7472  C  C4    . DT  I 5 71  ? 20.354  27.869 -80.206 1.00 167.11 ? -2  DT  I C4    1 
ATOM   7473  O  O4    . DT  I 5 71  ? 20.079  29.032 -80.470 1.00 167.26 ? -2  DT  I O4    1 
ATOM   7474  C  C5    . DT  I 5 71  ? 20.618  27.365 -78.882 1.00 167.08 ? -2  DT  I C5    1 
ATOM   7475  C  C7    . DT  I 5 71  ? 20.557  28.307 -77.722 1.00 167.19 ? -2  DT  I C7    1 
ATOM   7476  C  C6    . DT  I 5 71  ? 20.899  26.066 -78.747 1.00 167.01 ? -2  DT  I C6    1 
ATOM   7477  P  P     . DA  I 5 72  ? 24.028  20.721 -77.794 1.00 175.28 ? -1  DA  I P     1 
ATOM   7478  O  OP1   . DA  I 5 72  ? 23.791  19.336 -77.305 1.00 175.33 ? -1  DA  I OP1   1 
ATOM   7479  O  OP2   . DA  I 5 72  ? 24.628  21.731 -76.884 1.00 174.98 ? -1  DA  I OP2   1 
ATOM   7480  O  "O5'" . DA  I 5 72  ? 24.940  20.669 -79.117 1.00 178.54 ? -1  DA  I "O5'" 1 
ATOM   7481  C  "C5'" . DA  I 5 72  ? 24.924  19.524 -79.975 1.00 181.42 ? -1  DA  I "C5'" 1 
ATOM   7482  C  "C4'" . DA  I 5 72  ? 24.757  19.925 -81.436 1.00 184.36 ? -1  DA  I "C4'" 1 
ATOM   7483  O  "O4'" . DA  I 5 72  ? 23.748  20.955 -81.557 1.00 184.91 ? -1  DA  I "O4'" 1 
ATOM   7484  C  "C3'" . DA  I 5 72  ? 25.981  20.528 -82.106 1.00 186.70 ? -1  DA  I "C3'" 1 
ATOM   7485  O  "O3'" . DA  I 5 72  ? 26.885  19.494 -82.544 1.00 189.32 ? -1  DA  I "O3'" 1 
ATOM   7486  C  "C2'" . DA  I 5 72  ? 25.338  21.242 -83.290 1.00 186.26 ? -1  DA  I "C2'" 1 
ATOM   7487  C  "C1'" . DA  I 5 72  ? 24.039  21.765 -82.685 1.00 185.66 ? -1  DA  I "C1'" 1 
ATOM   7488  N  N9    . DA  I 5 72  ? 24.117  23.166 -82.270 1.00 185.99 ? -1  DA  I N9    1 
ATOM   7489  C  C8    . DA  I 5 72  ? 24.616  23.657 -81.090 1.00 186.20 ? -1  DA  I C8    1 
ATOM   7490  N  N7    . DA  I 5 72  ? 24.558  24.965 -80.986 1.00 186.31 ? -1  DA  I N7    1 
ATOM   7491  C  C5    . DA  I 5 72  ? 24.041  25.368 -82.206 1.00 186.50 ? -1  DA  I C5    1 
ATOM   7492  C  C6    . DA  I 5 72  ? 23.748  26.646 -82.744 1.00 186.70 ? -1  DA  I C6    1 
ATOM   7493  N  N6    . DA  I 5 72  ? 23.953  27.787 -82.079 1.00 186.66 ? -1  DA  I N6    1 
ATOM   7494  N  N1    . DA  I 5 72  ? 23.241  26.699 -84.005 1.00 186.81 ? -1  DA  I N1    1 
ATOM   7495  C  C2    . DA  I 5 72  ? 23.043  25.545 -84.676 1.00 186.65 ? -1  DA  I C2    1 
ATOM   7496  N  N3    . DA  I 5 72  ? 23.259  24.288 -84.268 1.00 186.39 ? -1  DA  I N3    1 
ATOM   7497  C  C4    . DA  I 5 72  ? 23.773  24.268 -83.017 1.00 186.29 ? -1  DA  I C4    1 
ATOM   7498  P  P     . DG  I 5 73  ? 28.475  19.764 -82.612 1.00 191.49 ? 0   DG  I P     1 
ATOM   7499  O  OP1   . DG  I 5 73  ? 29.141  18.466 -82.889 1.00 191.52 ? 0   DG  I OP1   1 
ATOM   7500  O  OP2   . DG  I 5 73  ? 28.867  20.551 -81.410 1.00 191.48 ? 0   DG  I OP2   1 
ATOM   7501  O  "O5'" . DG  I 5 73  ? 28.636  20.719 -83.899 1.00 192.99 ? 0   DG  I "O5'" 1 
ATOM   7502  C  "C5'" . DG  I 5 73  ? 28.333  20.232 -85.214 1.00 194.30 ? 0   DG  I "C5'" 1 
ATOM   7503  C  "C4'" . DG  I 5 73  ? 28.126  21.379 -86.197 1.00 195.72 ? 0   DG  I "C4'" 1 
ATOM   7504  O  "O4'" . DG  I 5 73  ? 27.189  22.337 -85.657 1.00 195.99 ? 0   DG  I "O4'" 1 
ATOM   7505  C  "C3'" . DG  I 5 73  ? 29.374  22.173 -86.539 1.00 196.92 ? 0   DG  I "C3'" 1 
ATOM   7506  O  "O3'" . DG  I 5 73  ? 30.031  21.556 -87.662 1.00 198.35 ? 0   DG  I "O3'" 1 
ATOM   7507  C  "C2'" . DG  I 5 73  ? 28.805  23.547 -86.908 1.00 196.63 ? 0   DG  I "C2'" 1 
ATOM   7508  C  "C1'" . DG  I 5 73  ? 27.542  23.649 -86.054 1.00 196.37 ? 0   DG  I "C1'" 1 
ATOM   7509  N  N9    . DG  I 5 73  ? 27.698  24.480 -84.856 1.00 196.70 ? 0   DG  I N9    1 
ATOM   7510  C  C8    . DG  I 5 73  ? 28.219  24.089 -83.638 1.00 196.86 ? 0   DG  I C8    1 
ATOM   7511  N  N7    . DG  I 5 73  ? 28.209  25.031 -82.735 1.00 196.97 ? 0   DG  I N7    1 
ATOM   7512  C  C5    . DG  I 5 73  ? 27.646  26.125 -83.387 1.00 197.06 ? 0   DG  I C5    1 
ATOM   7513  C  C6    . DG  I 5 73  ? 27.365  27.440 -82.905 1.00 197.03 ? 0   DG  I C6    1 
ATOM   7514  O  O6    . DG  I 5 73  ? 27.600  27.909 -81.780 1.00 197.03 ? 0   DG  I O6    1 
ATOM   7515  N  N1    . DG  I 5 73  ? 26.804  28.256 -83.898 1.00 196.88 ? 0   DG  I N1    1 
ATOM   7516  C  C2    . DG  I 5 73  ? 26.509  27.843 -85.183 1.00 196.77 ? 0   DG  I C2    1 
ATOM   7517  N  N2    . DG  I 5 73  ? 25.955  28.760 -85.986 1.00 196.65 ? 0   DG  I N2    1 
ATOM   7518  N  N3    . DG  I 5 73  ? 26.749  26.609 -85.647 1.00 196.82 ? 0   DG  I N3    1 
ATOM   7519  C  C4    . DG  I 5 73  ? 27.323  25.805 -84.698 1.00 196.91 ? 0   DG  I C4    1 
ATOM   7520  P  P     . DG  I 5 74  ? 31.634  21.560 -87.804 1.00 199.38 ? 1   DG  I P     1 
ATOM   7521  O  OP1   . DG  I 5 74  ? 31.993  20.615 -88.891 1.00 199.39 ? 1   DG  I OP1   1 
ATOM   7522  O  OP2   . DG  I 5 74  ? 32.228  21.391 -86.453 1.00 199.41 ? 1   DG  I OP2   1 
ATOM   7523  O  "O5'" . DG  I 5 74  ? 31.947  23.051 -88.293 1.00 199.99 ? 1   DG  I "O5'" 1 
ATOM   7524  C  "C5'" . DG  I 5 74  ? 31.376  23.552 -89.506 1.00 200.38 ? 1   DG  I "C5'" 1 
ATOM   7525  C  "C4'" . DG  I 5 74  ? 31.431  25.066 -89.528 1.00 200.75 ? 1   DG  I "C4'" 1 
ATOM   7526  O  "O4'" . DG  I 5 74  ? 30.900  25.588 -88.287 1.00 200.58 ? 1   DG  I "O4'" 1 
ATOM   7527  C  "C3'" . DG  I 5 74  ? 32.830  25.644 -89.698 1.00 201.28 ? 1   DG  I "C3'" 1 
ATOM   7528  O  "O3'" . DG  I 5 74  ? 32.883  26.458 -90.868 1.00 202.06 ? 1   DG  I "O3'" 1 
ATOM   7529  C  "C2'" . DG  I 5 74  ? 33.104  26.436 -88.412 1.00 200.94 ? 1   DG  I "C2'" 1 
ATOM   7530  C  "C1'" . DG  I 5 74  ? 31.728  26.602 -87.775 1.00 200.65 ? 1   DG  I "C1'" 1 
ATOM   7531  N  N9    . DG  I 5 74  ? 31.748  26.479 -86.311 1.00 200.58 ? 1   DG  I N9    1 
ATOM   7532  C  C8    . DG  I 5 74  ? 32.359  25.490 -85.568 1.00 200.61 ? 1   DG  I C8    1 
ATOM   7533  N  N7    . DG  I 5 74  ? 32.222  25.641 -84.278 1.00 200.58 ? 1   DG  I N7    1 
ATOM   7534  C  C5    . DG  I 5 74  ? 31.461  26.795 -84.148 1.00 200.50 ? 1   DG  I C5    1 
ATOM   7535  C  C6    . DG  I 5 74  ? 30.975  27.449 -82.977 1.00 200.34 ? 1   DG  I C6    1 
ATOM   7536  O  O6    . DG  I 5 74  ? 31.151  27.129 -81.789 1.00 200.15 ? 1   DG  I O6    1 
ATOM   7537  N  N1    . DG  I 5 74  ? 30.252  28.611 -83.292 1.00 200.32 ? 1   DG  I N1    1 
ATOM   7538  C  C2    . DG  I 5 74  ? 29.987  29.052 -84.578 1.00 200.23 ? 1   DG  I C2    1 
ATOM   7539  N  N2    . DG  I 5 74  ? 29.247  30.163 -84.690 1.00 200.02 ? 1   DG  I N2    1 
ATOM   7540  N  N3    . DG  I 5 74  ? 30.430  28.444 -85.679 1.00 200.37 ? 1   DG  I N3    1 
ATOM   7541  C  C4    . DG  I 5 74  ? 31.160  27.327 -85.393 1.00 200.49 ? 1   DG  I C4    1 
ATOM   7542  P  P     . DG  I 5 75  ? 34.268  26.959 -91.594 1.00 202.56 ? 2   DG  I P     1 
ATOM   7543  O  OP1   . DG  I 5 75  ? 34.145  26.703 -93.039 1.00 202.71 ? 2   DG  I OP1   1 
ATOM   7544  O  OP2   . DG  I 5 75  ? 35.423  26.425 -90.837 1.00 202.68 ? 2   DG  I OP2   1 
ATOM   7545  O  "O5'" . DG  I 5 75  ? 34.227  28.529 -91.346 1.00 202.38 ? 2   DG  I "O5'" 1 
ATOM   7546  C  "C5'" . DG  I 5 75  ? 33.069  29.121 -90.742 1.00 202.06 ? 2   DG  I "C5'" 1 
ATOM   7547  C  "C4'" . DG  I 5 75  ? 33.453  30.338 -89.936 1.00 201.71 ? 2   DG  I "C4'" 1 
ATOM   7548  O  "O4'" . DG  I 5 75  ? 33.245  30.079 -88.526 1.00 201.77 ? 2   DG  I "O4'" 1 
ATOM   7549  C  "C3'" . DG  I 5 75  ? 34.911  30.780 -90.054 1.00 201.43 ? 2   DG  I "C3'" 1 
ATOM   7550  O  "O3'" . DG  I 5 75  ? 34.890  32.191 -89.812 1.00 200.97 ? 2   DG  I "O3'" 1 
ATOM   7551  C  "C2'" . DG  I 5 75  ? 35.543  30.128 -88.839 1.00 201.63 ? 2   DG  I "C2'" 1 
ATOM   7552  C  "C1'" . DG  I 5 75  ? 34.445  30.406 -87.838 1.00 201.89 ? 2   DG  I "C1'" 1 
ATOM   7553  N  N9    . DG  I 5 75  ? 34.484  29.652 -86.587 1.00 202.21 ? 2   DG  I N9    1 
ATOM   7554  C  C8    . DG  I 5 75  ? 34.997  28.395 -86.379 1.00 202.29 ? 2   DG  I C8    1 
ATOM   7555  N  N7    . DG  I 5 75  ? 34.886  27.996 -85.141 1.00 202.26 ? 2   DG  I N7    1 
ATOM   7556  C  C5    . DG  I 5 75  ? 34.258  29.051 -84.494 1.00 202.30 ? 2   DG  I C5    1 
ATOM   7557  C  C6    . DG  I 5 75  ? 33.870  29.197 -83.136 1.00 202.32 ? 2   DG  I C6    1 
ATOM   7558  O  O6    . DG  I 5 75  ? 34.008  28.398 -82.205 1.00 202.33 ? 2   DG  I O6    1 
ATOM   7559  N  N1    . DG  I 5 75  ? 33.264  30.428 -82.905 1.00 202.25 ? 2   DG  I N1    1 
ATOM   7560  C  C2    . DG  I 5 75  ? 33.059  31.395 -83.857 1.00 202.13 ? 2   DG  I C2    1 
ATOM   7561  N  N2    . DG  I 5 75  ? 32.458  32.515 -83.438 1.00 201.98 ? 2   DG  I N2    1 
ATOM   7562  N  N3    . DG  I 5 75  ? 33.415  31.271 -85.126 1.00 202.22 ? 2   DG  I N3    1 
ATOM   7563  C  C4    . DG  I 5 75  ? 34.002  30.080 -85.374 1.00 202.26 ? 2   DG  I C4    1 
ATOM   7564  P  P     . DT  I 5 76  ? 36.095  33.140 -90.264 1.00 200.37 ? 3   DT  I P     1 
ATOM   7565  O  OP1   . DT  I 5 76  ? 35.651  33.892 -91.461 1.00 200.56 ? 3   DT  I OP1   1 
ATOM   7566  O  OP2   . DT  I 5 76  ? 37.347  32.345 -90.303 1.00 200.54 ? 3   DT  I OP2   1 
ATOM   7567  O  "O5'" . DT  I 5 76  ? 36.227  34.156 -89.046 1.00 198.98 ? 3   DT  I "O5'" 1 
ATOM   7568  C  "C5'" . DT  I 5 76  ? 35.354  35.288 -88.938 1.00 197.59 ? 3   DT  I "C5'" 1 
ATOM   7569  C  "C4'" . DT  I 5 76  ? 35.618  36.024 -87.647 1.00 196.27 ? 3   DT  I "C4'" 1 
ATOM   7570  O  "O4'" . DT  I 5 76  ? 35.399  35.137 -86.528 1.00 196.13 ? 3   DT  I "O4'" 1 
ATOM   7571  C  "C3'" . DT  I 5 76  ? 37.042  36.563 -87.501 1.00 195.23 ? 3   DT  I "C3'" 1 
ATOM   7572  O  "O3'" . DT  I 5 76  ? 36.975  37.988 -87.408 1.00 193.96 ? 3   DT  I "O3'" 1 
ATOM   7573  C  "C2'" . DT  I 5 76  ? 37.564  35.904 -86.234 1.00 195.57 ? 3   DT  I "C2'" 1 
ATOM   7574  C  "C1'" . DT  I 5 76  ? 36.316  35.461 -85.506 1.00 196.03 ? 3   DT  I "C1'" 1 
ATOM   7575  N  N1    . DT  I 5 76  ? 36.538  34.251 -84.696 1.00 196.36 ? 3   DT  I N1    1 
ATOM   7576  C  C2    . DT  I 5 76  ? 36.494  34.338 -83.321 1.00 196.43 ? 3   DT  I C2    1 
ATOM   7577  O  O2    . DT  I 5 76  ? 36.267  35.377 -82.724 1.00 196.32 ? 3   DT  I O2    1 
ATOM   7578  N  N3    . DT  I 5 76  ? 36.726  33.155 -82.667 1.00 196.54 ? 3   DT  I N3    1 
ATOM   7579  C  C4    . DT  I 5 76  ? 37.008  31.927 -83.236 1.00 196.61 ? 3   DT  I C4    1 
ATOM   7580  O  O4    . DT  I 5 76  ? 37.205  30.951 -82.518 1.00 196.60 ? 3   DT  I O4    1 
ATOM   7581  C  C5    . DT  I 5 76  ? 37.045  31.912 -84.681 1.00 196.59 ? 3   DT  I C5    1 
ATOM   7582  C  C7    . DT  I 5 76  ? 37.349  30.630 -85.387 1.00 196.61 ? 3   DT  I C7    1 
ATOM   7583  C  C6    . DT  I 5 76  ? 36.818  33.060 -85.328 1.00 196.51 ? 3   DT  I C6    1 
ATOM   7584  P  P     . DT  I 5 77  ? 38.272  38.865 -87.116 1.00 192.69 ? 4   DT  I P     1 
ATOM   7585  O  OP1   . DT  I 5 77  ? 38.028  40.221 -87.647 1.00 192.62 ? 4   DT  I OP1   1 
ATOM   7586  O  OP2   . DT  I 5 77  ? 39.479  38.119 -87.525 1.00 192.78 ? 4   DT  I OP2   1 
ATOM   7587  O  "O5'" . DT  I 5 77  ? 38.291  38.958 -85.533 1.00 191.42 ? 4   DT  I "O5'" 1 
ATOM   7588  C  "C5'" . DT  I 5 77  ? 37.197  39.566 -84.836 1.00 189.98 ? 4   DT  I "C5'" 1 
ATOM   7589  C  "C4'" . DT  I 5 77  ? 37.488  39.551 -83.357 1.00 188.40 ? 4   DT  I "C4'" 1 
ATOM   7590  O  "O4'" . DT  I 5 77  ? 37.514  38.181 -82.901 1.00 187.94 ? 4   DT  I "O4'" 1 
ATOM   7591  C  "C3'" . DT  I 5 77  ? 38.837  40.168 -82.980 1.00 187.34 ? 4   DT  I "C3'" 1 
ATOM   7592  O  "O3'" . DT  I 5 77  ? 38.540  41.194 -82.033 1.00 186.19 ? 4   DT  I "O3'" 1 
ATOM   7593  C  "C2'" . DT  I 5 77  ? 39.651  38.995 -82.461 1.00 187.49 ? 4   DT  I "C2'" 1 
ATOM   7594  C  "C1'" . DT  I 5 77  ? 38.609  37.981 -82.039 1.00 187.69 ? 4   DT  I "C1'" 1 
ATOM   7595  N  N1    . DT  I 5 77  ? 39.038  36.581 -82.179 1.00 187.65 ? 4   DT  I N1    1 
ATOM   7596  C  C2    . DT  I 5 77  ? 39.041  35.792 -81.055 1.00 187.59 ? 4   DT  I C2    1 
ATOM   7597  O  O2    . DT  I 5 77  ? 38.706  36.199 -79.956 1.00 187.56 ? 4   DT  I O2    1 
ATOM   7598  N  N3    . DT  I 5 77  ? 39.458  34.501 -81.262 1.00 187.52 ? 4   DT  I N3    1 
ATOM   7599  C  C4    . DT  I 5 77  ? 39.866  33.939 -82.454 1.00 187.51 ? 4   DT  I C4    1 
ATOM   7600  O  O4    . DT  I 5 77  ? 40.205  32.761 -82.488 1.00 187.38 ? 4   DT  I O4    1 
ATOM   7601  C  C5    . DT  I 5 77  ? 39.838  34.824 -83.592 1.00 187.64 ? 4   DT  I C5    1 
ATOM   7602  C  C7    . DT  I 5 77  ? 40.257  34.301 -84.928 1.00 187.70 ? 4   DT  I C7    1 
ATOM   7603  C  C6    . DT  I 5 77  ? 39.428  36.083 -83.401 1.00 187.66 ? 4   DT  I C6    1 
ATOM   7604  P  P     . DA  I 5 78  ? 39.653  42.183 -81.461 1.00 185.05 ? 5   DA  I P     1 
ATOM   7605  O  OP1   . DA  I 5 78  ? 39.072  43.534 -81.512 1.00 185.23 ? 5   DA  I OP1   1 
ATOM   7606  O  OP2   . DA  I 5 78  ? 40.943  41.913 -82.124 1.00 184.92 ? 5   DA  I OP2   1 
ATOM   7607  O  "O5'" . DA  I 5 78  ? 39.751  41.663 -79.959 1.00 183.60 ? 5   DA  I "O5'" 1 
ATOM   7608  C  "C5'" . DA  I 5 78  ? 38.869  40.602 -79.546 1.00 182.16 ? 5   DA  I "C5'" 1 
ATOM   7609  C  "C4'" . DA  I 5 78  ? 39.288  39.980 -78.235 1.00 180.92 ? 5   DA  I "C4'" 1 
ATOM   7610  O  "O4'" . DA  I 5 78  ? 39.723  38.620 -78.439 1.00 180.72 ? 5   DA  I "O4'" 1 
ATOM   7611  C  "C3'" . DA  I 5 78  ? 40.439  40.653 -77.508 1.00 179.97 ? 5   DA  I "C3'" 1 
ATOM   7612  O  "O3'" . DA  I 5 78  ? 40.283  40.253 -76.158 1.00 178.92 ? 5   DA  I "O3'" 1 
ATOM   7613  C  "C2'" . DA  I 5 78  ? 41.643  39.910 -78.043 1.00 180.25 ? 5   DA  I "C2'" 1 
ATOM   7614  C  "C1'" . DA  I 5 78  ? 41.111  38.492 -78.157 1.00 180.61 ? 5   DA  I "C1'" 1 
ATOM   7615  N  N9    . DA  I 5 78  ? 41.717  37.721 -79.241 1.00 180.94 ? 5   DA  I N9    1 
ATOM   7616  C  C8    . DA  I 5 78  ? 42.240  38.207 -80.413 1.00 180.90 ? 5   DA  I C8    1 
ATOM   7617  N  N7    . DA  I 5 78  ? 42.700  37.277 -81.213 1.00 180.85 ? 5   DA  I N7    1 
ATOM   7618  C  C5    . DA  I 5 78  ? 42.472  36.098 -80.517 1.00 181.06 ? 5   DA  I C5    1 
ATOM   7619  C  C6    . DA  I 5 78  ? 42.745  34.754 -80.821 1.00 181.14 ? 5   DA  I C6    1 
ATOM   7620  N  N6    . DA  I 5 78  ? 43.330  34.356 -81.950 1.00 181.21 ? 5   DA  I N6    1 
ATOM   7621  N  N1    . DA  I 5 78  ? 42.390  33.821 -79.913 1.00 181.06 ? 5   DA  I N1    1 
ATOM   7622  C  C2    . DA  I 5 78  ? 41.795  34.221 -78.784 1.00 181.06 ? 5   DA  I C2    1 
ATOM   7623  N  N3    . DA  I 5 78  ? 41.499  35.454 -78.378 1.00 181.03 ? 5   DA  I N3    1 
ATOM   7624  C  C4    . DA  I 5 78  ? 41.897  36.360 -79.288 1.00 181.09 ? 5   DA  I C4    1 
ATOM   7625  P  P     . DG  I 5 79  ? 40.442  41.296 -75.014 1.00 177.79 ? 6   DG  I P     1 
ATOM   7626  O  OP1   . DG  I 5 79  ? 39.698  42.498 -75.404 1.00 178.09 ? 6   DG  I OP1   1 
ATOM   7627  O  OP2   . DG  I 5 79  ? 41.873  41.396 -74.691 1.00 177.71 ? 6   DG  I OP2   1 
ATOM   7628  O  "O5'" . DG  I 5 79  ? 39.631  40.628 -73.825 1.00 176.31 ? 6   DG  I "O5'" 1 
ATOM   7629  C  "C5'" . DG  I 5 79  ? 38.753  39.526 -74.084 1.00 175.10 ? 6   DG  I "C5'" 1 
ATOM   7630  C  "C4'" . DG  I 5 79  ? 39.132  38.363 -73.200 1.00 174.09 ? 6   DG  I "C4'" 1 
ATOM   7631  O  "O4'" . DG  I 5 79  ? 40.081  37.515 -73.882 1.00 173.74 ? 6   DG  I "O4'" 1 
ATOM   7632  C  "C3'" . DG  I 5 79  ? 39.834  38.766 -71.914 1.00 173.58 ? 6   DG  I "C3'" 1 
ATOM   7633  O  "O3'" . DG  I 5 79  ? 39.691  37.687 -70.994 1.00 172.83 ? 6   DG  I "O3'" 1 
ATOM   7634  C  "C2'" . DG  I 5 79  ? 41.280  38.831 -72.357 1.00 173.65 ? 6   DG  I "C2'" 1 
ATOM   7635  C  "C1'" . DG  I 5 79  ? 41.360  37.624 -73.272 1.00 173.91 ? 6   DG  I "C1'" 1 
ATOM   7636  N  N9    . DG  I 5 79  ? 42.341  37.740 -74.340 1.00 174.78 ? 6   DG  I N9    1 
ATOM   7637  C  C8    . DG  I 5 79  ? 42.877  38.897 -74.850 1.00 175.42 ? 6   DG  I C8    1 
ATOM   7638  N  N7    . DG  I 5 79  ? 43.695  38.688 -75.845 1.00 175.67 ? 6   DG  I N7    1 
ATOM   7639  C  C5    . DG  I 5 79  ? 43.689  37.310 -76.010 1.00 175.53 ? 6   DG  I C5    1 
ATOM   7640  C  C6    . DG  I 5 79  ? 44.413  36.489 -76.918 1.00 175.59 ? 6   DG  I C6    1 
ATOM   7641  O  O6    . DG  I 5 79  ? 45.203  36.832 -77.805 1.00 175.61 ? 6   DG  I O6    1 
ATOM   7642  N  N1    . DG  I 5 79  ? 44.133  35.141 -76.724 1.00 175.43 ? 6   DG  I N1    1 
ATOM   7643  C  C2    . DG  I 5 79  ? 43.282  34.643 -75.767 1.00 175.11 ? 6   DG  I C2    1 
ATOM   7644  N  N2    . DG  I 5 79  ? 43.128  33.312 -75.749 1.00 174.95 ? 6   DG  I N2    1 
ATOM   7645  N  N3    . DG  I 5 79  ? 42.608  35.397 -74.910 1.00 175.04 ? 6   DG  I N3    1 
ATOM   7646  C  C4    . DG  I 5 79  ? 42.868  36.710 -75.079 1.00 175.10 ? 6   DG  I C4    1 
ATOM   7647  P  P     . DG  I 5 80  ? 38.565  37.730 -69.892 1.00 171.60 ? 7   DG  I P     1 
ATOM   7648  O  OP1   . DG  I 5 80  ? 37.567  36.709 -70.223 1.00 171.47 ? 7   DG  I OP1   1 
ATOM   7649  O  OP2   . DG  I 5 80  ? 38.137  39.127 -69.724 1.00 171.67 ? 7   DG  I OP2   1 
ATOM   7650  O  "O5'" . DG  I 5 80  ? 39.370  37.283 -68.603 1.00 170.49 ? 7   DG  I "O5'" 1 
ATOM   7651  C  "C5'" . DG  I 5 80  ? 40.807  37.283 -68.618 1.00 169.49 ? 7   DG  I "C5'" 1 
ATOM   7652  C  "C4'" . DG  I 5 80  ? 41.321  35.878 -68.823 1.00 168.58 ? 7   DG  I "C4'" 1 
ATOM   7653  O  "O4'" . DG  I 5 80  ? 42.004  35.817 -70.090 1.00 168.56 ? 7   DG  I "O4'" 1 
ATOM   7654  C  "C3'" . DG  I 5 80  ? 42.353  35.436 -67.795 1.00 167.98 ? 7   DG  I "C3'" 1 
ATOM   7655  O  "O3'" . DG  I 5 80  ? 42.355  34.012 -67.707 1.00 167.09 ? 7   DG  I "O3'" 1 
ATOM   7656  C  "C2'" . DG  I 5 80  ? 43.646  35.945 -68.400 1.00 168.36 ? 7   DG  I "C2'" 1 
ATOM   7657  C  "C1'" . DG  I 5 80  ? 43.412  35.747 -69.887 1.00 168.62 ? 7   DG  I "C1'" 1 
ATOM   7658  N  N9    . DG  I 5 80  ? 44.040  36.756 -70.734 1.00 168.74 ? 7   DG  I N9    1 
ATOM   7659  C  C8    . DG  I 5 80  ? 44.041  38.115 -70.536 1.00 168.83 ? 7   DG  I C8    1 
ATOM   7660  N  N7    . DG  I 5 80  ? 44.675  38.768 -71.471 1.00 168.81 ? 7   DG  I N7    1 
ATOM   7661  C  C5    . DG  I 5 80  ? 45.142  37.779 -72.324 1.00 168.88 ? 7   DG  I C5    1 
ATOM   7662  C  C6    . DG  I 5 80  ? 45.916  37.878 -73.510 1.00 169.06 ? 7   DG  I C6    1 
ATOM   7663  O  O6    . DG  I 5 80  ? 46.348  38.895 -74.064 1.00 168.97 ? 7   DG  I O6    1 
ATOM   7664  N  N1    . DG  I 5 80  ? 46.182  36.627 -74.055 1.00 169.09 ? 7   DG  I N1    1 
ATOM   7665  C  C2    . DG  I 5 80  ? 45.736  35.435 -73.541 1.00 168.99 ? 7   DG  I C2    1 
ATOM   7666  N  N2    . DG  I 5 80  ? 46.101  34.335 -74.206 1.00 169.24 ? 7   DG  I N2    1 
ATOM   7667  N  N3    . DG  I 5 80  ? 45.021  35.328 -72.433 1.00 168.67 ? 7   DG  I N3    1 
ATOM   7668  C  C4    . DG  I 5 80  ? 44.751  36.532 -71.887 1.00 168.68 ? 7   DG  I C4    1 
ATOM   7669  P  P     . DG  I 5 81  ? 43.174  33.288 -66.571 1.00 166.65 ? 8   DG  I P     1 
ATOM   7670  O  OP1   . DG  I 5 81  ? 42.367  32.175 -66.060 1.00 166.58 ? 8   DG  I OP1   1 
ATOM   7671  O  OP2   . DG  I 5 81  ? 43.705  34.295 -65.645 1.00 166.29 ? 8   DG  I OP2   1 
ATOM   7672  O  "O5'" . DG  I 5 81  ? 44.361  32.600 -67.365 1.00 167.75 ? 8   DG  I "O5'" 1 
ATOM   7673  C  "C5'" . DG  I 5 81  ? 44.230  31.231 -67.794 1.00 168.61 ? 8   DG  I "C5'" 1 
ATOM   7674  C  "C4'" . DG  I 5 81  ? 45.581  30.664 -68.155 1.00 169.11 ? 8   DG  I "C4'" 1 
ATOM   7675  O  "O4'" . DG  I 5 81  ? 46.128  31.443 -69.239 1.00 169.09 ? 8   DG  I "O4'" 1 
ATOM   7676  C  "C3'" . DG  I 5 81  ? 46.618  30.755 -67.042 1.00 169.76 ? 8   DG  I "C3'" 1 
ATOM   7677  O  "O3'" . DG  I 5 81  ? 47.674  29.869 -67.373 1.00 170.84 ? 8   DG  I "O3'" 1 
ATOM   7678  C  "C2'" . DG  I 5 81  ? 47.219  32.117 -67.290 1.00 169.55 ? 8   DG  I "C2'" 1 
ATOM   7679  C  "C1'" . DG  I 5 81  ? 47.325  32.059 -68.797 1.00 169.72 ? 8   DG  I "C1'" 1 
ATOM   7680  N  N9    . DG  I 5 81  ? 47.447  33.342 -69.472 1.00 170.80 ? 8   DG  I N9    1 
ATOM   7681  C  C8    . DG  I 5 81  ? 46.810  34.517 -69.159 1.00 171.14 ? 8   DG  I C8    1 
ATOM   7682  N  N7    . DG  I 5 81  ? 47.134  35.502 -69.952 1.00 171.51 ? 8   DG  I N7    1 
ATOM   7683  C  C5    . DG  I 5 81  ? 48.031  34.939 -70.849 1.00 171.59 ? 8   DG  I C5    1 
ATOM   7684  C  C6    . DG  I 5 81  ? 48.728  35.521 -71.942 1.00 171.65 ? 8   DG  I C6    1 
ATOM   7685  O  O6    . DG  I 5 81  ? 48.674  36.682 -72.358 1.00 171.70 ? 8   DG  I O6    1 
ATOM   7686  N  N1    . DG  I 5 81  ? 49.545  34.595 -72.580 1.00 171.74 ? 8   DG  I N1    1 
ATOM   7687  C  C2    . DG  I 5 81  ? 49.679  33.279 -72.212 1.00 171.80 ? 8   DG  I C2    1 
ATOM   7688  N  N2    . DG  I 5 81  ? 50.517  32.543 -72.951 1.00 171.96 ? 8   DG  I N2    1 
ATOM   7689  N  N3    . DG  I 5 81  ? 49.041  32.727 -71.192 1.00 171.63 ? 8   DG  I N3    1 
ATOM   7690  C  C4    . DG  I 5 81  ? 48.240  33.608 -70.559 1.00 171.42 ? 8   DG  I C4    1 
ATOM   7691  P  P     . DT  I 5 82  ? 47.949  28.596 -66.494 1.00 172.18 ? 9   DT  I P     1 
ATOM   7692  O  OP1   . DT  I 5 82  ? 47.118  27.498 -67.011 1.00 172.21 ? 9   DT  I OP1   1 
ATOM   7693  O  OP2   . DT  I 5 82  ? 47.858  28.985 -65.082 1.00 171.92 ? 9   DT  I OP2   1 
ATOM   7694  O  "O5'" . DT  I 5 82  ? 49.469  28.276 -66.831 1.00 174.19 ? 9   DT  I "O5'" 1 
ATOM   7695  C  "C5'" . DT  I 5 82  ? 49.873  27.961 -68.184 1.00 175.69 ? 9   DT  I "C5'" 1 
ATOM   7696  C  "C4'" . DT  I 5 82  ? 51.165  28.646 -68.579 1.00 177.04 ? 9   DT  I "C4'" 1 
ATOM   7697  O  "O4'" . DT  I 5 82  ? 50.972  30.054 -68.827 1.00 177.13 ? 9   DT  I "O4'" 1 
ATOM   7698  C  "C3'" . DT  I 5 82  ? 52.345  28.545 -67.605 1.00 178.63 ? 9   DT  I "C3'" 1 
ATOM   7699  O  "O3'" . DT  I 5 82  ? 53.306  27.698 -68.232 1.00 181.03 ? 9   DT  I "O3'" 1 
ATOM   7700  C  "C2'" . DT  I 5 82  ? 52.870  29.971 -67.507 1.00 178.05 ? 9   DT  I "C2'" 1 
ATOM   7701  C  "C1'" . DT  I 5 82  ? 52.238  30.653 -68.707 1.00 177.58 ? 9   DT  I "C1'" 1 
ATOM   7702  N  N1    . DT  I 5 82  ? 52.047  32.112 -68.615 1.00 177.57 ? 9   DT  I N1    1 
ATOM   7703  C  C2    . DT  I 5 82  ? 52.830  32.913 -69.409 1.00 177.76 ? 9   DT  I C2    1 
ATOM   7704  O  O2    . DT  I 5 82  ? 53.676  32.475 -70.169 1.00 177.86 ? 9   DT  I O2    1 
ATOM   7705  N  N3    . DT  I 5 82  ? 52.589  34.257 -69.279 1.00 177.67 ? 9   DT  I N3    1 
ATOM   7706  C  C4    . DT  I 5 82  ? 51.657  34.862 -68.462 1.00 177.56 ? 9   DT  I C4    1 
ATOM   7707  O  O4    . DT  I 5 82  ? 51.560  36.085 -68.447 1.00 177.57 ? 9   DT  I O4    1 
ATOM   7708  C  C5    . DT  I 5 82  ? 50.871  33.961 -67.656 1.00 177.50 ? 9   DT  I C5    1 
ATOM   7709  C  C7    . DT  I 5 82  ? 49.839  34.527 -66.735 1.00 177.48 ? 9   DT  I C7    1 
ATOM   7710  C  C6    . DT  I 5 82  ? 51.098  32.648 -67.776 1.00 177.47 ? 9   DT  I C6    1 
ATOM   7711  P  P     . DT  I 5 83  ? 54.519  26.972 -67.450 1.00 183.33 ? 10  DT  I P     1 
ATOM   7712  O  OP1   . DT  I 5 83  ? 54.481  25.536 -67.797 1.00 183.38 ? 10  DT  I OP1   1 
ATOM   7713  O  OP2   . DT  I 5 83  ? 54.469  27.391 -66.038 1.00 183.38 ? 10  DT  I OP2   1 
ATOM   7714  O  "O5'" . DT  I 5 83  ? 55.795  27.721 -68.043 1.00 185.29 ? 10  DT  I "O5'" 1 
ATOM   7715  C  "C5'" . DT  I 5 83  ? 55.644  28.763 -69.037 1.00 187.24 ? 10  DT  I "C5'" 1 
ATOM   7716  C  "C4'" . DT  I 5 83  ? 56.725  29.817 -68.935 1.00 189.21 ? 10  DT  I "C4'" 1 
ATOM   7717  O  "O4'" . DT  I 5 83  ? 56.145  31.148 -68.950 1.00 189.37 ? 10  DT  I "O4'" 1 
ATOM   7718  C  "C3'" . DT  I 5 83  ? 57.613  29.780 -67.686 1.00 191.06 ? 10  DT  I "C3'" 1 
ATOM   7719  O  "O3'" . DT  I 5 83  ? 58.892  30.273 -68.111 1.00 193.60 ? 10  DT  I "O3'" 1 
ATOM   7720  C  "C2'" . DT  I 5 83  ? 57.021  30.890 -66.842 1.00 190.34 ? 10  DT  I "C2'" 1 
ATOM   7721  C  "C1'" . DT  I 5 83  ? 56.819  31.885 -67.950 1.00 189.81 ? 10  DT  I "C1'" 1 
ATOM   7722  N  N1    . DT  I 5 83  ? 56.040  33.079 -67.625 1.00 189.92 ? 10  DT  I N1    1 
ATOM   7723  C  C2    . DT  I 5 83  ? 56.375  34.244 -68.271 1.00 189.98 ? 10  DT  I C2    1 
ATOM   7724  O  O2    . DT  I 5 83  ? 57.258  34.310 -69.110 1.00 189.91 ? 10  DT  I O2    1 
ATOM   7725  N  N3    . DT  I 5 83  ? 55.646  35.341 -67.887 1.00 190.16 ? 10  DT  I N3    1 
ATOM   7726  C  C4    . DT  I 5 83  ? 54.641  35.385 -66.941 1.00 190.25 ? 10  DT  I C4    1 
ATOM   7727  O  O4    . DT  I 5 83  ? 54.057  36.441 -66.717 1.00 190.25 ? 10  DT  I O4    1 
ATOM   7728  C  C5    . DT  I 5 83  ? 54.346  34.125 -66.299 1.00 190.22 ? 10  DT  I C5    1 
ATOM   7729  C  C7    . DT  I 5 83  ? 53.273  34.075 -65.260 1.00 190.10 ? 10  DT  I C7    1 
ATOM   7730  C  C6    . DT  I 5 83  ? 55.063  33.053 -66.657 1.00 190.15 ? 10  DT  I C6    1 
ATOM   7731  P  P     . DA  I 5 84  ? 60.236  29.985 -67.285 1.00 196.03 ? 11  DA  I P     1 
ATOM   7732  O  OP1   . DA  I 5 84  ? 60.854  28.756 -67.845 1.00 196.10 ? 11  DA  I OP1   1 
ATOM   7733  O  OP2   . DA  I 5 84  ? 59.950  30.061 -65.836 1.00 196.14 ? 11  DA  I OP2   1 
ATOM   7734  O  "O5'" . DA  I 5 84  ? 61.117  31.272 -67.598 1.00 198.05 ? 11  DA  I "O5'" 1 
ATOM   7735  C  "C5'" . DA  I 5 84  ? 60.704  32.183 -68.626 1.00 199.87 ? 11  DA  I "C5'" 1 
ATOM   7736  C  "C4'" . DA  I 5 84  ? 61.179  33.588 -68.337 1.00 201.66 ? 11  DA  I "C4'" 1 
ATOM   7737  O  "O4'" . DA  I 5 84  ? 60.062  34.419 -67.943 1.00 202.03 ? 11  DA  I "O4'" 1 
ATOM   7738  C  "C3'" . DA  I 5 84  ? 62.205  33.724 -67.215 1.00 203.10 ? 11  DA  I "C3'" 1 
ATOM   7739  O  "O3'" . DA  I 5 84  ? 63.053  34.830 -67.534 1.00 204.90 ? 11  DA  I "O3'" 1 
ATOM   7740  C  "C2'" . DA  I 5 84  ? 61.347  34.110 -66.028 1.00 202.75 ? 11  DA  I "C2'" 1 
ATOM   7741  C  "C1'" . DA  I 5 84  ? 60.354  35.034 -66.700 1.00 202.52 ? 11  DA  I "C1'" 1 
ATOM   7742  N  N9    . DA  I 5 84  ? 59.097  35.217 -65.982 1.00 202.90 ? 11  DA  I N9    1 
ATOM   7743  C  C8    . DA  I 5 84  ? 58.273  34.249 -65.469 1.00 202.98 ? 11  DA  I C8    1 
ATOM   7744  N  N7    . DA  I 5 84  ? 57.204  34.723 -64.879 1.00 203.07 ? 11  DA  I N7    1 
ATOM   7745  C  C5    . DA  I 5 84  ? 57.338  36.098 -65.001 1.00 203.16 ? 11  DA  I C5    1 
ATOM   7746  C  C6    . DA  I 5 84  ? 56.532  37.168 -64.577 1.00 203.12 ? 11  DA  I C6    1 
ATOM   7747  N  N6    . DA  I 5 84  ? 55.388  37.011 -63.910 1.00 203.07 ? 11  DA  I N6    1 
ATOM   7748  N  N1    . DA  I 5 84  ? 56.953  38.421 -64.855 1.00 203.14 ? 11  DA  I N1    1 
ATOM   7749  C  C2    . DA  I 5 84  ? 58.106  38.576 -65.517 1.00 203.19 ? 11  DA  I C2    1 
ATOM   7750  N  N3    . DA  I 5 84  ? 58.948  37.650 -65.972 1.00 203.25 ? 11  DA  I N3    1 
ATOM   7751  C  C4    . DA  I 5 84  ? 58.499  36.417 -65.680 1.00 203.17 ? 11  DA  I C4    1 
ATOM   7752  P  P     . DG  I 5 85  ? 64.577  34.895 -67.032 1.00 206.46 ? 12  DG  I P     1 
ATOM   7753  O  OP1   . DG  I 5 85  ? 65.446  34.991 -68.220 1.00 206.48 ? 12  DG  I OP1   1 
ATOM   7754  O  OP2   . DG  I 5 85  ? 64.776  33.820 -66.036 1.00 206.60 ? 12  DG  I OP2   1 
ATOM   7755  O  "O5'" . DG  I 5 85  ? 64.656  36.306 -66.306 1.00 207.24 ? 12  DG  I "O5'" 1 
ATOM   7756  C  "C5'" . DG  I 5 85  ? 64.267  37.495 -67.007 1.00 207.86 ? 12  DG  I "C5'" 1 
ATOM   7757  C  "C4'" . DG  I 5 85  ? 64.151  38.645 -66.038 1.00 208.40 ? 12  DG  I "C4'" 1 
ATOM   7758  O  "O4'" . DG  I 5 85  ? 62.950  38.464 -65.254 1.00 208.45 ? 12  DG  I "O4'" 1 
ATOM   7759  C  "C3'" . DG  I 5 85  ? 65.276  38.701 -65.013 1.00 208.94 ? 12  DG  I "C3'" 1 
ATOM   7760  O  "O3'" . DG  I 5 85  ? 65.239  39.997 -64.421 1.00 209.61 ? 12  DG  I "O3'" 1 
ATOM   7761  C  "C2'" . DG  I 5 85  ? 64.744  37.781 -63.942 1.00 208.73 ? 12  DG  I "C2'" 1 
ATOM   7762  C  "C1'" . DG  I 5 85  ? 63.317  38.272 -63.898 1.00 208.60 ? 12  DG  I "C1'" 1 
ATOM   7763  N  N9    . DG  I 5 85  ? 62.388  37.322 -63.310 1.00 208.66 ? 12  DG  I N9    1 
ATOM   7764  C  C8    . DG  I 5 85  ? 62.531  35.958 -63.241 1.00 208.59 ? 12  DG  I C8    1 
ATOM   7765  N  N7    . DG  I 5 85  ? 61.537  35.369 -62.637 1.00 208.66 ? 12  DG  I N7    1 
ATOM   7766  C  C5    . DG  I 5 85  ? 60.694  36.409 -62.271 1.00 208.80 ? 12  DG  I C5    1 
ATOM   7767  C  C6    . DG  I 5 85  ? 59.457  36.386 -61.578 1.00 208.91 ? 12  DG  I C6    1 
ATOM   7768  O  O6    . DG  I 5 85  ? 58.838  35.409 -61.142 1.00 208.84 ? 12  DG  I O6    1 
ATOM   7769  N  N1    . DG  I 5 85  ? 58.937  37.666 -61.415 1.00 209.04 ? 12  DG  I N1    1 
ATOM   7770  C  C2    . DG  I 5 85  ? 59.530  38.819 -61.868 1.00 209.09 ? 12  DG  I C2    1 
ATOM   7771  N  N2    . DG  I 5 85  ? 58.873  39.958 -61.615 1.00 209.07 ? 12  DG  I N2    1 
ATOM   7772  N  N3    . DG  I 5 85  ? 60.694  38.856 -62.499 1.00 209.05 ? 12  DG  I N3    1 
ATOM   7773  C  C4    . DG  I 5 85  ? 61.212  37.621 -62.672 1.00 208.85 ? 12  DG  I C4    1 
ATOM   7774  P  P     . DG  I 5 86  ? 66.464  40.549 -63.581 1.00 210.00 ? 13  DG  I P     1 
ATOM   7775  O  OP1   . DG  I 5 86  ? 67.662  40.501 -64.445 1.00 209.89 ? 13  DG  I OP1   1 
ATOM   7776  O  OP2   . DG  I 5 86  ? 66.486  39.884 -62.261 1.00 210.07 ? 13  DG  I OP2   1 
ATOM   7777  O  "O5'" . DG  I 5 86  ? 66.034  42.060 -63.342 1.00 209.83 ? 13  DG  I "O5'" 1 
ATOM   7778  C  "C5'" . DG  I 5 86  ? 64.962  42.622 -64.116 1.00 209.41 ? 13  DG  I "C5'" 1 
ATOM   7779  C  "C4'" . DG  I 5 86  ? 64.139  43.553 -63.261 1.00 208.88 ? 13  DG  I "C4'" 1 
ATOM   7780  O  "O4'" . DG  I 5 86  ? 63.108  42.795 -62.589 1.00 208.82 ? 13  DG  I "O4'" 1 
ATOM   7781  C  "C3'" . DG  I 5 86  ? 64.925  44.228 -62.147 1.00 208.46 ? 13  DG  I "C3'" 1 
ATOM   7782  O  "O3'" . DG  I 5 86  ? 64.206  45.396 -61.768 1.00 208.12 ? 13  DG  I "O3'" 1 
ATOM   7783  C  "C2'" . DG  I 5 86  ? 64.816  43.211 -61.036 1.00 208.59 ? 13  DG  I "C2'" 1 
ATOM   7784  C  "C1'" . DG  I 5 86  ? 63.374  42.764 -61.193 1.00 208.72 ? 13  DG  I "C1'" 1 
ATOM   7785  N  N9    . DG  I 5 86  ? 63.130  41.407 -60.720 1.00 208.57 ? 13  DG  I N9    1 
ATOM   7786  C  C8    . DG  I 5 86  ? 63.932  40.310 -60.919 1.00 208.54 ? 13  DG  I C8    1 
ATOM   7787  N  N7    . DG  I 5 86  ? 63.463  39.225 -60.367 1.00 208.55 ? 13  DG  I N7    1 
ATOM   7788  C  C5    . DG  I 5 86  ? 62.282  39.631 -59.763 1.00 208.59 ? 13  DG  I C5    1 
ATOM   7789  C  C6    . DG  I 5 86  ? 61.337  38.890 -59.003 1.00 208.53 ? 13  DG  I C6    1 
ATOM   7790  O  O6    . DG  I 5 86  ? 61.347  37.687 -58.724 1.00 208.50 ? 13  DG  I O6    1 
ATOM   7791  N  N1    . DG  I 5 86  ? 60.281  39.690 -58.578 1.00 208.46 ? 13  DG  I N1    1 
ATOM   7792  C  C2    . DG  I 5 86  ? 60.158  41.032 -58.839 1.00 208.46 ? 13  DG  I C2    1 
ATOM   7793  N  N2    . DG  I 5 86  ? 59.071  41.631 -58.336 1.00 208.48 ? 13  DG  I N2    1 
ATOM   7794  N  N3    . DG  I 5 86  ? 61.036  41.737 -59.537 1.00 208.45 ? 13  DG  I N3    1 
ATOM   7795  C  C4    . DG  I 5 86  ? 62.060  40.975 -59.976 1.00 208.53 ? 13  DG  I C4    1 
ATOM   7796  P  P     . DG  I 5 87  ? 64.887  46.642 -60.977 1.00 207.95 ? 14  DG  I P     1 
ATOM   7797  O  OP1   . DG  I 5 87  ? 64.766  47.847 -61.826 1.00 208.02 ? 14  DG  I OP1   1 
ATOM   7798  O  OP2   . DG  I 5 87  ? 66.207  46.198 -60.481 1.00 208.18 ? 14  DG  I OP2   1 
ATOM   7799  O  "O5'" . DG  I 5 87  ? 63.951  46.779 -59.696 1.00 207.61 ? 14  DG  I "O5'" 1 
ATOM   7800  C  "C5'" . DG  I 5 87  ? 62.572  46.351 -59.757 1.00 207.46 ? 14  DG  I "C5'" 1 
ATOM   7801  C  "C4'" . DG  I 5 87  ? 62.140  45.678 -58.473 1.00 207.24 ? 14  DG  I "C4'" 1 
ATOM   7802  O  "O4'" . DG  I 5 87  ? 62.407  44.264 -58.521 1.00 207.42 ? 14  DG  I "O4'" 1 
ATOM   7803  C  "C3'" . DG  I 5 87  ? 62.820  46.178 -57.201 1.00 206.77 ? 14  DG  I "C3'" 1 
ATOM   7804  O  "O3'" . DG  I 5 87  ? 61.849  46.853 -56.409 1.00 205.67 ? 14  DG  I "O3'" 1 
ATOM   7805  C  "C2'" . DG  I 5 87  ? 63.253  44.909 -56.480 1.00 207.24 ? 14  DG  I "C2'" 1 
ATOM   7806  C  "C1'" . DG  I 5 87  ? 62.488  43.814 -57.192 1.00 207.63 ? 14  DG  I "C1'" 1 
ATOM   7807  N  N9    . DG  I 5 87  ? 63.163  42.522 -57.193 1.00 208.17 ? 14  DG  I N9    1 
ATOM   7808  C  C8    . DG  I 5 87  ? 64.348  42.227 -57.819 1.00 208.41 ? 14  DG  I C8    1 
ATOM   7809  N  N7    . DG  I 5 87  ? 64.722  40.987 -57.653 1.00 208.54 ? 14  DG  I N7    1 
ATOM   7810  C  C5    . DG  I 5 87  ? 63.751  40.444 -56.823 1.00 208.54 ? 14  DG  I C5    1 
ATOM   7811  C  C6    . DG  I 5 87  ? 63.624  39.129 -56.294 1.00 208.49 ? 14  DG  I C6    1 
ATOM   7812  O  O6    . DG  I 5 87  ? 64.383  38.163 -56.437 1.00 208.51 ? 14  DG  I O6    1 
ATOM   7813  N  N1    . DG  I 5 87  ? 62.477  38.998 -55.517 1.00 208.38 ? 14  DG  I N1    1 
ATOM   7814  C  C2    . DG  I 5 87  ? 61.566  39.998 -55.286 1.00 208.45 ? 14  DG  I C2    1 
ATOM   7815  N  N2    . DG  I 5 87  ? 60.521  39.673 -54.510 1.00 208.56 ? 14  DG  I N2    1 
ATOM   7816  N  N3    . DG  I 5 87  ? 61.664  41.222 -55.787 1.00 208.45 ? 14  DG  I N3    1 
ATOM   7817  C  C4    . DG  I 5 87  ? 62.775  41.374 -56.539 1.00 208.43 ? 14  DG  I C4    1 
ATOM   7818  P  P     . DT  I 5 88  ? 62.103  48.344 -55.968 1.00 204.37 ? 15  DT  I P     1 
ATOM   7819  O  OP1   . DT  I 5 88  ? 61.789  49.216 -57.113 1.00 204.85 ? 15  DT  I OP1   1 
ATOM   7820  O  OP2   . DT  I 5 88  ? 63.417  48.407 -55.304 1.00 204.22 ? 15  DT  I OP2   1 
ATOM   7821  O  "O5'" . DT  I 5 88  ? 60.971  48.615 -54.891 1.00 202.87 ? 15  DT  I "O5'" 1 
ATOM   7822  C  "C5'" . DT  I 5 88  ? 59.718  49.161 -55.311 1.00 201.39 ? 15  DT  I "C5'" 1 
ATOM   7823  C  "C4'" . DT  I 5 88  ? 58.596  48.221 -54.945 1.00 199.89 ? 15  DT  I "C4'" 1 
ATOM   7824  O  "O4'" . DT  I 5 88  ? 59.029  46.850 -55.088 1.00 199.42 ? 15  DT  I "O4'" 1 
ATOM   7825  C  "C3'" . DT  I 5 88  ? 58.113  48.339 -53.506 1.00 199.13 ? 15  DT  I "C3'" 1 
ATOM   7826  O  "O3'" . DT  I 5 88  ? 56.776  47.863 -53.520 1.00 198.49 ? 15  DT  I "O3'" 1 
ATOM   7827  C  "C2'" . DT  I 5 88  ? 58.951  47.302 -52.792 1.00 199.16 ? 15  DT  I "C2'" 1 
ATOM   7828  C  "C1'" . DT  I 5 88  ? 58.955  46.197 -53.829 1.00 199.33 ? 15  DT  I "C1'" 1 
ATOM   7829  N  N1    . DT  I 5 88  ? 60.086  45.266 -53.739 1.00 199.49 ? 15  DT  I N1    1 
ATOM   7830  C  C2    . DT  I 5 88  ? 60.011  44.090 -54.444 1.00 199.58 ? 15  DT  I C2    1 
ATOM   7831  O  O2    . DT  I 5 88  ? 59.057  43.791 -55.143 1.00 199.61 ? 15  DT  I O2    1 
ATOM   7832  N  N3    . DT  I 5 88  ? 61.104  43.273 -54.307 1.00 199.71 ? 15  DT  I N3    1 
ATOM   7833  C  C4    . DT  I 5 88  ? 62.238  43.514 -53.558 1.00 199.87 ? 15  DT  I C4    1 
ATOM   7834  O  O4    . DT  I 5 88  ? 63.143  42.687 -53.535 1.00 199.94 ? 15  DT  I O4    1 
ATOM   7835  C  C5    . DT  I 5 88  ? 62.252  44.770 -52.850 1.00 199.90 ? 15  DT  I C5    1 
ATOM   7836  C  C7    . DT  I 5 88  ? 63.436  45.113 -52.005 1.00 199.91 ? 15  DT  I C7    1 
ATOM   7837  C  C6    . DT  I 5 88  ? 61.187  45.571 -52.970 1.00 199.74 ? 15  DT  I C6    1 
ATOM   7838  P  P     . DT  I 5 89  ? 55.677  48.408 -52.493 1.00 197.64 ? 16  DT  I P     1 
ATOM   7839  O  OP1   . DT  I 5 89  ? 54.363  48.314 -53.161 1.00 197.74 ? 16  DT  I OP1   1 
ATOM   7840  O  OP2   . DT  I 5 89  ? 56.143  49.708 -51.969 1.00 197.30 ? 16  DT  I OP2   1 
ATOM   7841  O  "O5'" . DT  I 5 89  ? 55.722  47.327 -51.323 1.00 196.73 ? 16  DT  I "O5'" 1 
ATOM   7842  C  "C5'" . DT  I 5 89  ? 56.057  45.967 -51.631 1.00 195.83 ? 16  DT  I "C5'" 1 
ATOM   7843  C  "C4'" . DT  I 5 89  ? 55.642  45.011 -50.537 1.00 195.14 ? 16  DT  I "C4'" 1 
ATOM   7844  O  "O4'" . DT  I 5 89  ? 56.790  44.231 -50.134 1.00 194.86 ? 16  DT  I "O4'" 1 
ATOM   7845  C  "C3'" . DT  I 5 89  ? 55.101  45.616 -49.246 1.00 194.91 ? 16  DT  I "C3'" 1 
ATOM   7846  O  "O3'" . DT  I 5 89  ? 54.339  44.553 -48.666 1.00 194.73 ? 16  DT  I "O3'" 1 
ATOM   7847  C  "C2'" . DT  I 5 89  ? 56.366  45.800 -48.432 1.00 194.82 ? 16  DT  I "C2'" 1 
ATOM   7848  C  "C1'" . DT  I 5 89  ? 57.177  44.571 -48.807 1.00 194.96 ? 16  DT  I "C1'" 1 
ATOM   7849  N  N1    . DT  I 5 89  ? 58.604  44.866 -48.831 1.00 195.38 ? 16  DT  I N1    1 
ATOM   7850  C  C2    . DT  I 5 89  ? 59.465  43.996 -49.459 1.00 195.53 ? 16  DT  I C2    1 
ATOM   7851  O  O2    . DT  I 5 89  ? 59.102  42.951 -49.970 1.00 195.62 ? 16  DT  I O2    1 
ATOM   7852  N  N3    . DT  I 5 89  ? 60.777  44.395 -49.461 1.00 195.44 ? 16  DT  I N3    1 
ATOM   7853  C  C4    . DT  I 5 89  ? 61.295  45.558 -48.925 1.00 195.51 ? 16  DT  I C4    1 
ATOM   7854  O  O4    . DT  I 5 89  ? 62.493  45.792 -49.017 1.00 195.79 ? 16  DT  I O4    1 
ATOM   7855  C  C5    . DT  I 5 89  ? 60.332  46.430 -48.298 1.00 195.43 ? 16  DT  I C5    1 
ATOM   7856  C  C7    . DT  I 5 89  ? 60.802  47.709 -47.684 1.00 195.56 ? 16  DT  I C7    1 
ATOM   7857  C  C6    . DT  I 5 89  ? 59.052  46.049 -48.289 1.00 195.41 ? 16  DT  I C6    1 
ATOM   7858  P  P     . DA  I 5 90  ? 53.321  44.764 -47.445 1.00 194.27 ? 17  DA  I P     1 
ATOM   7859  O  OP1   . DA  I 5 90  ? 52.118  45.440 -47.960 1.00 194.05 ? 17  DA  I OP1   1 
ATOM   7860  O  OP2   . DA  I 5 90  ? 54.042  45.317 -46.281 1.00 194.07 ? 17  DA  I OP2   1 
ATOM   7861  O  "O5'" . DA  I 5 90  ? 52.990  43.257 -47.073 1.00 194.57 ? 17  DA  I "O5'" 1 
ATOM   7862  C  "C5'" . DA  I 5 90  ? 53.314  42.215 -48.014 1.00 194.87 ? 17  DA  I "C5'" 1 
ATOM   7863  C  "C4'" . DA  I 5 90  ? 54.067  41.095 -47.335 1.00 195.16 ? 17  DA  I "C4'" 1 
ATOM   7864  O  "O4'" . DA  I 5 90  ? 55.483  41.394 -47.304 1.00 195.28 ? 17  DA  I "O4'" 1 
ATOM   7865  C  "C3'" . DA  I 5 90  ? 53.640  40.838 -45.890 1.00 195.35 ? 17  DA  I "C3'" 1 
ATOM   7866  O  "O3'" . DA  I 5 90  ? 53.246  39.474 -45.749 1.00 195.50 ? 17  DA  I "O3'" 1 
ATOM   7867  C  "C2'" . DA  I 5 90  ? 54.880  41.151 -45.070 1.00 195.46 ? 17  DA  I "C2'" 1 
ATOM   7868  C  "C1'" . DA  I 5 90  ? 56.018  41.005 -46.056 1.00 195.39 ? 17  DA  I "C1'" 1 
ATOM   7869  N  N9    . DA  I 5 90  ? 57.146  41.884 -45.754 1.00 195.52 ? 17  DA  I N9    1 
ATOM   7870  C  C8    . DA  I 5 90  ? 57.133  42.996 -44.952 1.00 195.53 ? 17  DA  I C8    1 
ATOM   7871  N  N7    . DA  I 5 90  ? 58.296  43.590 -44.853 1.00 195.48 ? 17  DA  I N7    1 
ATOM   7872  C  C5    . DA  I 5 90  ? 59.136  42.808 -45.631 1.00 195.69 ? 17  DA  I C5    1 
ATOM   7873  C  C6    . DA  I 5 90  ? 60.503  42.905 -45.935 1.00 195.86 ? 17  DA  I C6    1 
ATOM   7874  N  N6    . DA  I 5 90  ? 61.299  43.866 -45.465 1.00 195.71 ? 17  DA  I N6    1 
ATOM   7875  N  N1    . DA  I 5 90  ? 61.035  41.965 -46.745 1.00 196.08 ? 17  DA  I N1    1 
ATOM   7876  C  C2    . DA  I 5 90  ? 60.238  40.997 -47.209 1.00 196.21 ? 17  DA  I C2    1 
ATOM   7877  N  N3    . DA  I 5 90  ? 58.939  40.802 -46.999 1.00 196.11 ? 17  DA  I N3    1 
ATOM   7878  C  C4    . DA  I 5 90  ? 58.442  41.754 -46.192 1.00 195.78 ? 17  DA  I C4    1 
ATOM   7879  P  P     . DG  I 5 91  ? 52.690  38.947 -44.374 1.00 195.99 ? 18  DG  I P     1 
ATOM   7880  O  OP1   . DG  I 5 91  ? 51.802  37.807 -44.656 1.00 195.60 ? 18  DG  I OP1   1 
ATOM   7881  O  OP2   . DG  I 5 91  ? 52.220  40.103 -43.598 1.00 195.82 ? 18  DG  I OP2   1 
ATOM   7882  O  "O5'" . DG  I 5 91  ? 53.985  38.417 -43.628 1.00 197.73 ? 18  DG  I "O5'" 1 
ATOM   7883  C  "C5'" . DG  I 5 91  ? 54.522  37.122 -43.923 1.00 199.45 ? 18  DG  I "C5'" 1 
ATOM   7884  C  "C4'" . DG  I 5 91  ? 55.824  36.933 -43.182 1.00 200.98 ? 18  DG  I "C4'" 1 
ATOM   7885  O  "O4'" . DG  I 5 91  ? 56.588  38.151 -43.291 1.00 201.26 ? 18  DG  I "O4'" 1 
ATOM   7886  C  "C3'" . DG  I 5 91  ? 55.672  36.646 -41.684 1.00 202.25 ? 18  DG  I "C3'" 1 
ATOM   7887  O  "O3'" . DG  I 5 91  ? 56.280  35.384 -41.382 1.00 203.80 ? 18  DG  I "O3'" 1 
ATOM   7888  C  "C2'" . DG  I 5 91  ? 56.335  37.837 -41.005 1.00 201.92 ? 18  DG  I "C2'" 1 
ATOM   7889  C  "C1'" . DG  I 5 91  ? 57.260  38.380 -42.075 1.00 201.76 ? 18  DG  I "C1'" 1 
ATOM   7890  N  N9    . DG  I 5 91  ? 57.552  39.807 -41.992 1.00 202.23 ? 18  DG  I N9    1 
ATOM   7891  C  C8    . DG  I 5 91  ? 56.645  40.824 -41.828 1.00 202.34 ? 18  DG  I C8    1 
ATOM   7892  N  N7    . DG  I 5 91  ? 57.199  42.006 -41.808 1.00 202.46 ? 18  DG  I N7    1 
ATOM   7893  C  C5    . DG  I 5 91  ? 58.552  41.755 -41.981 1.00 202.67 ? 18  DG  I C5    1 
ATOM   7894  C  C6    . DG  I 5 91  ? 59.652  42.653 -42.056 1.00 202.98 ? 18  DG  I C6    1 
ATOM   7895  O  O6    . DG  I 5 91  ? 59.648  43.885 -41.956 1.00 203.01 ? 18  DG  I O6    1 
ATOM   7896  N  N1    . DG  I 5 91  ? 60.855  41.977 -42.227 1.00 203.17 ? 18  DG  I N1    1 
ATOM   7897  C  C2    . DG  I 5 91  ? 60.981  40.615 -42.342 1.00 203.11 ? 18  DG  I C2    1 
ATOM   7898  N  N2    . DG  I 5 91  ? 62.226  40.153 -42.521 1.00 203.26 ? 18  DG  I N2    1 
ATOM   7899  N  N3    . DG  I 5 91  ? 59.964  39.768 -42.282 1.00 202.81 ? 18  DG  I N3    1 
ATOM   7900  C  C4    . DG  I 5 91  ? 58.787  40.403 -42.102 1.00 202.58 ? 18  DG  I C4    1 
ATOM   7901  P  P     . DG  I 5 92  ? 55.617  34.367 -40.328 1.00 205.42 ? 19  DG  I P     1 
ATOM   7902  O  OP1   . DG  I 5 92  ? 56.413  33.116 -40.349 1.00 205.25 ? 19  DG  I OP1   1 
ATOM   7903  O  OP2   . DG  I 5 92  ? 54.156  34.307 -40.571 1.00 205.51 ? 19  DG  I OP2   1 
ATOM   7904  O  "O5'" . DG  I 5 92  ? 55.844  35.130 -38.929 1.00 207.22 ? 19  DG  I "O5'" 1 
ATOM   7905  C  "C5'" . DG  I 5 92  ? 56.746  34.613 -37.942 1.00 209.05 ? 19  DG  I "C5'" 1 
ATOM   7906  C  "C4'" . DG  I 5 92  ? 58.151  35.155 -38.152 1.00 210.95 ? 19  DG  I "C4'" 1 
ATOM   7907  O  "O4'" . DG  I 5 92  ? 58.093  36.505 -38.672 1.00 211.35 ? 19  DG  I "O4'" 1 
ATOM   7908  C  "C3'" . DG  I 5 92  ? 59.022  35.218 -36.894 1.00 212.44 ? 19  DG  I "C3'" 1 
ATOM   7909  O  "O3'" . DG  I 5 92  ? 60.185  34.405 -37.074 1.00 214.31 ? 19  DG  I "O3'" 1 
ATOM   7910  C  "C2'" . DG  I 5 92  ? 59.382  36.706 -36.758 1.00 212.10 ? 19  DG  I "C2'" 1 
ATOM   7911  C  "C1'" . DG  I 5 92  ? 59.189  37.218 -38.176 1.00 211.79 ? 19  DG  I "C1'" 1 
ATOM   7912  N  N9    . DG  I 5 92  ? 58.908  38.660 -38.257 1.00 211.95 ? 19  DG  I N9    1 
ATOM   7913  C  C8    . DG  I 5 92  ? 57.698  39.289 -38.045 1.00 211.93 ? 19  DG  I C8    1 
ATOM   7914  N  N7    . DG  I 5 92  ? 57.755  40.589 -38.170 1.00 211.95 ? 19  DG  I N7    1 
ATOM   7915  C  C5    . DG  I 5 92  ? 59.086  40.846 -38.488 1.00 212.01 ? 19  DG  I C5    1 
ATOM   7916  C  C6    . DG  I 5 92  ? 59.755  42.083 -38.723 1.00 212.04 ? 19  DG  I C6    1 
ATOM   7917  O  O6    . DG  I 5 92  ? 59.279  43.226 -38.721 1.00 212.09 ? 19  DG  I O6    1 
ATOM   7918  N  N1    . DG  I 5 92  ? 61.115  41.899 -39.000 1.00 212.02 ? 19  DG  I N1    1 
ATOM   7919  C  C2    . DG  I 5 92  ? 61.753  40.675 -39.035 1.00 212.03 ? 19  DG  I C2    1 
ATOM   7920  N  N2    . DG  I 5 92  ? 63.062  40.695 -39.322 1.00 212.13 ? 19  DG  I N2    1 
ATOM   7921  N  N3    . DG  I 5 92  ? 61.144  39.511 -38.803 1.00 211.95 ? 19  DG  I N3    1 
ATOM   7922  C  C4    . DG  I 5 92  ? 59.813  39.669 -38.538 1.00 211.99 ? 19  DG  I C4    1 
ATOM   7923  P  P     . DG  I 5 93  ? 61.032  33.827 -35.820 1.00 216.11 ? 20  DG  I P     1 
ATOM   7924  O  OP1   . DG  I 5 93  ? 61.893  32.731 -36.312 1.00 216.11 ? 20  DG  I OP1   1 
ATOM   7925  O  OP2   . DG  I 5 93  ? 60.080  33.575 -34.712 1.00 216.18 ? 20  DG  I OP2   1 
ATOM   7926  O  "O5'" . DG  I 5 93  ? 61.923  35.076 -35.387 1.00 217.52 ? 20  DG  I "O5'" 1 
ATOM   7927  C  "C5'" . DG  I 5 93  ? 63.144  35.417 -36.063 1.00 218.69 ? 20  DG  I "C5'" 1 
ATOM   7928  C  "C4'" . DG  I 5 93  ? 63.912  36.437 -35.255 1.00 219.86 ? 20  DG  I "C4'" 1 
ATOM   7929  O  "O4'" . DG  I 5 93  ? 63.419  37.767 -35.548 1.00 220.18 ? 20  DG  I "O4'" 1 
ATOM   7930  C  "C3'" . DG  I 5 93  ? 63.779  36.284 -33.739 1.00 220.84 ? 20  DG  I "C3'" 1 
ATOM   7931  O  "O3'" . DG  I 5 93  ? 64.980  36.758 -33.116 1.00 222.00 ? 20  DG  I "O3'" 1 
ATOM   7932  C  "C2'" . DG  I 5 93  ? 62.675  37.267 -33.406 1.00 220.68 ? 20  DG  I "C2'" 1 
ATOM   7933  C  "C1'" . DG  I 5 93  ? 63.082  38.398 -34.322 1.00 220.52 ? 20  DG  I "C1'" 1 
ATOM   7934  N  N9    . DG  I 5 93  ? 62.071  39.414 -34.594 1.00 220.58 ? 20  DG  I N9    1 
ATOM   7935  C  C8    . DG  I 5 93  ? 60.755  39.217 -34.933 1.00 220.57 ? 20  DG  I C8    1 
ATOM   7936  N  N7    . DG  I 5 93  ? 60.104  40.331 -35.129 1.00 220.56 ? 20  DG  I N7    1 
ATOM   7937  C  C5    . DG  I 5 93  ? 61.046  41.324 -34.900 1.00 220.48 ? 20  DG  I C5    1 
ATOM   7938  C  C6    . DG  I 5 93  ? 60.931  42.738 -34.980 1.00 220.40 ? 20  DG  I C6    1 
ATOM   7939  O  O6    . DG  I 5 93  ? 59.932  43.414 -35.236 1.00 220.50 ? 20  DG  I O6    1 
ATOM   7940  N  N1    . DG  I 5 93  ? 62.125  43.368 -34.654 1.00 220.28 ? 20  DG  I N1    1 
ATOM   7941  C  C2    . DG  I 5 93  ? 63.291  42.722 -34.334 1.00 220.30 ? 20  DG  I C2    1 
ATOM   7942  N  N2    . DG  I 5 93  ? 64.343  43.506 -34.075 1.00 220.28 ? 20  DG  I N2    1 
ATOM   7943  N  N3    . DG  I 5 93  ? 63.419  41.406 -34.274 1.00 220.41 ? 20  DG  I N3    1 
ATOM   7944  C  C4    . DG  I 5 93  ? 62.263  40.773 -34.564 1.00 220.51 ? 20  DG  I C4    1 
ATOM   7945  P  P     . DT  I 5 94  ? 65.342  36.330 -31.616 1.00 222.95 ? 21  DT  I P     1 
ATOM   7946  O  OP1   . DT  I 5 94  ? 66.736  35.836 -31.614 1.00 222.95 ? 21  DT  I OP1   1 
ATOM   7947  O  OP2   . DT  I 5 94  ? 64.255  35.453 -31.118 1.00 223.15 ? 21  DT  I OP2   1 
ATOM   7948  O  "O5'" . DT  I 5 94  ? 65.274  37.707 -30.823 1.00 223.08 ? 21  DT  I "O5'" 1 
ATOM   7949  C  "C5'" . DT  I 5 94  ? 64.984  38.916 -31.538 1.00 223.05 ? 21  DT  I "C5'" 1 
ATOM   7950  C  "C4'" . DT  I 5 94  ? 64.942  40.103 -30.608 1.00 222.95 ? 21  DT  I "C4'" 1 
ATOM   7951  O  "O4'" . DT  I 5 94  ? 63.992  41.055 -31.141 1.00 222.97 ? 21  DT  I "O4'" 1 
ATOM   7952  C  "C3'" . DT  I 5 94  ? 64.461  39.831 -29.182 1.00 222.76 ? 21  DT  I "C3'" 1 
ATOM   7953  O  "O3'" . DT  I 5 94  ? 64.960  40.970 -28.462 1.00 222.44 ? 21  DT  I "O3'" 1 
ATOM   7954  C  "C2'" . DT  I 5 94  ? 62.966  39.989 -29.346 1.00 222.85 ? 21  DT  I "C2'" 1 
ATOM   7955  C  "C1'" . DT  I 5 94  ? 62.976  41.253 -30.171 1.00 222.88 ? 21  DT  I "C1'" 1 
ATOM   7956  N  N1    . DT  I 5 94  ? 61.721  41.541 -30.865 1.00 222.65 ? 21  DT  I N1    1 
ATOM   7957  C  C2    . DT  I 5 94  ? 61.463  42.846 -31.205 1.00 222.46 ? 21  DT  I C2    1 
ATOM   7958  O  O2    . DT  I 5 94  ? 62.241  43.757 -30.979 1.00 222.40 ? 21  DT  I O2    1 
ATOM   7959  N  N3    . DT  I 5 94  ? 60.254  43.047 -31.818 1.00 222.43 ? 21  DT  I N3    1 
ATOM   7960  C  C4    . DT  I 5 94  ? 59.292  42.097 -32.096 1.00 222.50 ? 21  DT  I C4    1 
ATOM   7961  O  O4    . DT  I 5 94  ? 58.260  42.425 -32.669 1.00 222.53 ? 21  DT  I O4    1 
ATOM   7962  C  C5    . DT  I 5 94  ? 59.633  40.747 -31.716 1.00 222.51 ? 21  DT  I C5    1 
ATOM   7963  C  C7    . DT  I 5 94  ? 58.659  39.647 -31.993 1.00 222.46 ? 21  DT  I C7    1 
ATOM   7964  C  C6    . DT  I 5 94  ? 60.807  40.542 -31.111 1.00 222.57 ? 21  DT  I C6    1 
ATOM   7965  P  P     . DT  I 5 95  ? 65.072  41.026 -26.824 1.00 221.80 ? 22  DT  I P     1 
ATOM   7966  O  OP1   . DT  I 5 95  ? 66.436  41.492 -26.474 1.00 221.90 ? 22  DT  I OP1   1 
ATOM   7967  O  OP2   . DT  I 5 95  ? 64.574  39.742 -26.290 1.00 221.76 ? 22  DT  I OP2   1 
ATOM   7968  O  "O5'" . DT  I 5 95  ? 63.994  42.141 -26.450 1.00 220.47 ? 22  DT  I "O5'" 1 
ATOM   7969  C  "C5'" . DT  I 5 95  ? 64.346  43.319 -25.699 1.00 219.00 ? 22  DT  I "C5'" 1 
ATOM   7970  C  "C4'" . DT  I 5 95  ? 64.219  44.583 -26.521 1.00 217.50 ? 22  DT  I "C4'" 1 
ATOM   7971  O  "O4'" . DT  I 5 95  ? 63.451  44.372 -27.725 1.00 216.90 ? 22  DT  I "O4'" 1 
ATOM   7972  C  "C3'" . DT  I 5 95  ? 63.500  45.719 -25.806 1.00 216.75 ? 22  DT  I "C3'" 1 
ATOM   7973  O  "O3'" . DT  I 5 95  ? 64.380  46.411 -24.912 1.00 216.28 ? 22  DT  I "O3'" 1 
ATOM   7974  C  "C2'" . DT  I 5 95  ? 62.994  46.577 -26.952 1.00 216.55 ? 22  DT  I "C2'" 1 
ATOM   7975  C  "C1'" . DT  I 5 95  ? 62.796  45.585 -28.098 1.00 216.38 ? 22  DT  I "C1'" 1 
ATOM   7976  N  N1    . DT  I 5 95  ? 61.391  45.258 -28.449 1.00 215.65 ? 22  DT  I N1    1 
ATOM   7977  C  C2    . DT  I 5 95  ? 60.659  46.169 -29.177 1.00 215.19 ? 22  DT  I C2    1 
ATOM   7978  O  O2    . DT  I 5 95  ? 61.092  47.256 -29.515 1.00 215.03 ? 22  DT  I O2    1 
ATOM   7979  N  N3    . DT  I 5 95  ? 59.384  45.764 -29.482 1.00 214.95 ? 22  DT  I N3    1 
ATOM   7980  C  C4    . DT  I 5 95  ? 58.788  44.565 -29.151 1.00 214.72 ? 22  DT  I C4    1 
ATOM   7981  O  O4    . DT  I 5 95  ? 57.632  44.344 -29.489 1.00 214.44 ? 22  DT  I O4    1 
ATOM   7982  C  C5    . DT  I 5 95  ? 59.615  43.652 -28.404 1.00 214.95 ? 22  DT  I C5    1 
ATOM   7983  C  C7    . DT  I 5 95  ? 59.049  42.328 -28.000 1.00 214.87 ? 22  DT  I C7    1 
ATOM   7984  C  C6    . DT  I 5 95  ? 60.857  44.040 -28.089 1.00 215.34 ? 22  DT  I C6    1 
ATOM   7985  P  P     . DA  I 5 96  ? 63.991  46.518 -23.367 1.00 215.64 ? 23  DA  I P     1 
ATOM   7986  O  OP1   . DA  I 5 96  ? 65.200  46.877 -22.582 1.00 215.57 ? 23  DA  I OP1   1 
ATOM   7987  O  OP2   . DA  I 5 96  ? 63.215  45.301 -23.013 1.00 215.68 ? 23  DA  I OP2   1 
ATOM   7988  O  "O5'" . DA  I 5 96  ? 62.979  47.756 -23.361 1.00 214.43 ? 23  DA  I "O5'" 1 
ATOM   7989  C  "C5'" . DA  I 5 96  ? 63.398  49.043 -23.835 1.00 213.01 ? 23  DA  I "C5'" 1 
ATOM   7990  C  "C4'" . DA  I 5 96  ? 62.200  49.957 -24.024 1.00 211.49 ? 23  DA  I "C4'" 1 
ATOM   7991  O  "O4'" . DA  I 5 96  ? 61.267  49.351 -24.959 1.00 211.44 ? 23  DA  I "O4'" 1 
ATOM   7992  C  "C3'" . DA  I 5 96  ? 61.402  50.244 -22.746 1.00 210.07 ? 23  DA  I "C3'" 1 
ATOM   7993  O  "O3'" . DA  I 5 96  ? 61.210  51.646 -22.588 1.00 208.05 ? 23  DA  I "O3'" 1 
ATOM   7994  C  "C2'" . DA  I 5 96  ? 60.080  49.507 -22.964 1.00 210.70 ? 23  DA  I "C2'" 1 
ATOM   7995  C  "C1'" . DA  I 5 96  ? 59.957  49.521 -24.476 1.00 211.37 ? 23  DA  I "C1'" 1 
ATOM   7996  N  N9    . DA  I 5 96  ? 59.107  48.448 -24.997 1.00 211.93 ? 23  DA  I N9    1 
ATOM   7997  C  C8    . DA  I 5 96  ? 59.338  47.098 -24.923 1.00 212.13 ? 23  DA  I C8    1 
ATOM   7998  N  N7    . DA  I 5 96  ? 58.372  46.362 -25.421 1.00 212.31 ? 23  DA  I N7    1 
ATOM   7999  C  C5    . DA  I 5 96  ? 57.430  47.288 -25.837 1.00 212.49 ? 23  DA  I C5    1 
ATOM   8000  C  C6    . DA  I 5 96  ? 56.160  47.150 -26.461 1.00 212.67 ? 23  DA  I C6    1 
ATOM   8001  N  N6    . DA  I 5 96  ? 55.623  45.969 -26.783 1.00 212.61 ? 23  DA  I N6    1 
ATOM   8002  N  N1    . DA  I 5 96  ? 55.470  48.284 -26.749 1.00 212.81 ? 23  DA  I N1    1 
ATOM   8003  C  C2    . DA  I 5 96  ? 56.021  49.475 -26.437 1.00 212.93 ? 23  DA  I C2    1 
ATOM   8004  N  N3    . DA  I 5 96  ? 57.203  49.731 -25.849 1.00 212.69 ? 23  DA  I N3    1 
ATOM   8005  C  C4    . DA  I 5 96  ? 57.862  48.583 -25.570 1.00 212.36 ? 23  DA  I C4    1 
ATOM   8006  P  P     . DG  I 5 97  ? 60.842  52.281 -21.155 1.00 205.96 ? 24  DG  I P     1 
ATOM   8007  O  OP1   . DG  I 5 97  ? 61.866  53.310 -20.834 1.00 205.94 ? 24  DG  I OP1   1 
ATOM   8008  O  OP2   . DG  I 5 97  ? 60.572  51.180 -20.195 1.00 206.01 ? 24  DG  I OP2   1 
ATOM   8009  O  "O5'" . DG  I 5 97  ? 59.450  53.008 -21.447 1.00 203.38 ? 24  DG  I "O5'" 1 
ATOM   8010  C  "C5'" . DG  I 5 97  ? 59.335  53.942 -22.518 1.00 200.62 ? 24  DG  I "C5'" 1 
ATOM   8011  C  "C4'" . DG  I 5 97  ? 57.888  54.092 -22.938 1.00 197.79 ? 24  DG  I "C4'" 1 
ATOM   8012  O  "O4'" . DG  I 5 97  ? 57.393  52.826 -23.441 1.00 197.07 ? 24  DG  I "O4'" 1 
ATOM   8013  C  "C3'" . DG  I 5 97  ? 56.935  54.530 -21.827 1.00 195.89 ? 24  DG  I "C3'" 1 
ATOM   8014  O  "O3'" . DG  I 5 97  ? 56.123  55.611 -22.295 1.00 193.92 ? 24  DG  I "O3'" 1 
ATOM   8015  C  "C2'" . DG  I 5 97  ? 56.112  53.268 -21.530 1.00 196.16 ? 24  DG  I "C2'" 1 
ATOM   8016  C  "C1'" . DG  I 5 97  ? 56.138  52.541 -22.869 1.00 196.56 ? 24  DG  I "C1'" 1 
ATOM   8017  N  N9    . DG  I 5 97  ? 56.007  51.085 -22.761 1.00 196.51 ? 24  DG  I N9    1 
ATOM   8018  C  C8    . DG  I 5 97  ? 56.944  50.211 -22.266 1.00 196.47 ? 24  DG  I C8    1 
ATOM   8019  N  N7    . DG  I 5 97  ? 56.591  48.957 -22.349 1.00 196.57 ? 24  DG  I N7    1 
ATOM   8020  C  C5    . DG  I 5 97  ? 55.322  48.994 -22.916 1.00 196.60 ? 24  DG  I C5    1 
ATOM   8021  C  C6    . DG  I 5 97  ? 54.426  47.929 -23.241 1.00 196.34 ? 24  DG  I C6    1 
ATOM   8022  O  O6    . DG  I 5 97  ? 54.589  46.711 -23.076 1.00 196.23 ? 24  DG  I O6    1 
ATOM   8023  N  N1    . DG  I 5 97  ? 53.243  48.400 -23.822 1.00 196.23 ? 24  DG  I N1    1 
ATOM   8024  C  C2    . DG  I 5 97  ? 52.953  49.731 -24.054 1.00 196.33 ? 24  DG  I C2    1 
ATOM   8025  N  N2    . DG  I 5 97  ? 51.753  49.990 -24.595 1.00 196.27 ? 24  DG  I N2    1 
ATOM   8026  N  N3    . DG  I 5 97  ? 53.774  50.740 -23.743 1.00 196.58 ? 24  DG  I N3    1 
ATOM   8027  C  C4    . DG  I 5 97  ? 54.943  50.300 -23.182 1.00 196.64 ? 24  DG  I C4    1 
ATOM   8028  P  P     . DG  I 5 98  ? 55.493  56.705 -21.287 1.00 191.76 ? 25  DG  I P     1 
ATOM   8029  O  OP1   . DG  I 5 98  ? 56.030  58.038 -21.662 1.00 191.58 ? 25  DG  I OP1   1 
ATOM   8030  O  OP2   . DG  I 5 98  ? 55.643  56.213 -19.895 1.00 191.78 ? 25  DG  I OP2   1 
ATOM   8031  O  "O5'" . DG  I 5 98  ? 53.928  56.666 -21.644 1.00 189.56 ? 25  DG  I "O5'" 1 
ATOM   8032  C  "C5'" . DG  I 5 98  ? 53.427  55.810 -22.700 1.00 186.93 ? 25  DG  I "C5'" 1 
ATOM   8033  C  "C4'" . DG  I 5 98  ? 52.123  55.140 -22.296 1.00 184.14 ? 25  DG  I "C4'" 1 
ATOM   8034  O  "O4'" . DG  I 5 98  ? 52.355  53.740 -22.004 1.00 183.44 ? 25  DG  I "O4'" 1 
ATOM   8035  C  "C3'" . DG  I 5 98  ? 51.442  55.737 -21.066 1.00 182.24 ? 25  DG  I "C3'" 1 
ATOM   8036  O  "O3'" . DG  I 5 98  ? 50.090  55.966 -21.339 1.00 180.20 ? 25  DG  I "O3'" 1 
ATOM   8037  C  "C2'" . DG  I 5 98  ? 51.636  54.681 -19.981 1.00 182.58 ? 25  DG  I "C2'" 1 
ATOM   8038  C  "C1'" . DG  I 5 98  ? 51.717  53.395 -20.795 1.00 183.03 ? 25  DG  I "C1'" 1 
ATOM   8039  N  N9    . DG  I 5 98  ? 52.492  52.331 -20.149 1.00 183.20 ? 25  DG  I N9    1 
ATOM   8040  C  C8    . DG  I 5 98  ? 53.526  52.484 -19.244 1.00 183.52 ? 25  DG  I C8    1 
ATOM   8041  N  N7    . DG  I 5 98  ? 54.051  51.357 -18.854 1.00 183.48 ? 25  DG  I N7    1 
ATOM   8042  C  C5    . DG  I 5 98  ? 53.319  50.390 -19.532 1.00 183.22 ? 25  DG  I C5    1 
ATOM   8043  C  C6    . DG  I 5 98  ? 53.434  48.976 -19.508 1.00 183.10 ? 25  DG  I C6    1 
ATOM   8044  O  O6    . DG  I 5 98  ? 54.233  48.284 -18.856 1.00 183.25 ? 25  DG  I O6    1 
ATOM   8045  N  N1    . DG  I 5 98  ? 52.496  48.361 -20.349 1.00 182.67 ? 25  DG  I N1    1 
ATOM   8046  C  C2    . DG  I 5 98  ? 51.562  49.034 -21.105 1.00 182.40 ? 25  DG  I C2    1 
ATOM   8047  N  N2    . DG  I 5 98  ? 50.771  48.283 -21.870 1.00 182.27 ? 25  DG  I N2    1 
ATOM   8048  N  N3    . DG  I 5 98  ? 51.457  50.358 -21.155 1.00 182.61 ? 25  DG  I N3    1 
ATOM   8049  C  C4    . DG  I 5 98  ? 52.357  50.973 -20.337 1.00 183.00 ? 25  DG  I C4    1 
ATOM   8050  P  P     . DG  I 5 99  ? 49.517  57.393 -21.103 1.00 178.17 ? 26  DG  I P     1 
ATOM   8051  O  OP1   . DG  I 5 99  ? 50.268  58.319 -21.968 1.00 178.21 ? 26  DG  I OP1   1 
ATOM   8052  O  OP2   . DG  I 5 99  ? 49.479  57.612 -19.643 1.00 178.21 ? 26  DG  I OP2   1 
ATOM   8053  O  "O5'" . DG  I 5 99  ? 48.051  57.299 -21.707 1.00 176.11 ? 26  DG  I "O5'" 1 
ATOM   8054  C  "C5'" . DG  I 5 99  ? 47.851  57.152 -23.121 1.00 174.14 ? 26  DG  I "C5'" 1 
ATOM   8055  C  "C4'" . DG  I 5 99  ? 47.226  55.809 -23.413 1.00 172.43 ? 26  DG  I "C4'" 1 
ATOM   8056  O  "O4'" . DG  I 5 99  ? 47.951  54.780 -22.702 1.00 172.06 ? 26  DG  I "O4'" 1 
ATOM   8057  C  "C3'" . DG  I 5 99  ? 45.771  55.672 -22.964 1.00 171.12 ? 26  DG  I "C3'" 1 
ATOM   8058  O  "O3'" . DG  I 5 99  ? 45.081  54.833 -23.892 1.00 169.32 ? 26  DG  I "O3'" 1 
ATOM   8059  C  "C2'" . DG  I 5 99  ? 45.895  54.913 -21.661 1.00 171.52 ? 26  DG  I "C2'" 1 
ATOM   8060  C  "C1'" . DG  I 5 99  ? 47.014  53.976 -22.022 1.00 171.95 ? 26  DG  I "C1'" 1 
ATOM   8061  N  N9    . DG  I 5 99  ? 47.681  53.350 -20.890 1.00 172.32 ? 26  DG  I N9    1 
ATOM   8062  C  C8    . DG  I 5 99  ? 48.149  53.954 -19.749 1.00 172.35 ? 26  DG  I C8    1 
ATOM   8063  N  N7    . DG  I 5 99  ? 48.683  53.112 -18.906 1.00 172.37 ? 26  DG  I N7    1 
ATOM   8064  C  C5    . DG  I 5 99  ? 48.537  51.875 -19.518 1.00 172.56 ? 26  DG  I C5    1 
ATOM   8065  C  C6    . DG  I 5 99  ? 48.935  50.581 -19.084 1.00 172.72 ? 26  DG  I C6    1 
ATOM   8066  O  O6    . DG  I 5 99  ? 49.491  50.258 -18.027 1.00 172.78 ? 26  DG  I O6    1 
ATOM   8067  N  N1    . DG  I 5 99  ? 48.576  49.601 -20.005 1.00 172.67 ? 26  DG  I N1    1 
ATOM   8068  C  C2    . DG  I 5 99  ? 47.958  49.841 -21.209 1.00 172.48 ? 26  DG  I C2    1 
ATOM   8069  N  N2    . DG  I 5 99  ? 47.716  48.769 -21.974 1.00 172.48 ? 26  DG  I N2    1 
ATOM   8070  N  N3    . DG  I 5 99  ? 47.596  51.042 -21.629 1.00 172.34 ? 26  DG  I N3    1 
ATOM   8071  C  C4    . DG  I 5 99  ? 47.915  52.006 -20.740 1.00 172.47 ? 26  DG  I C4    1 
ATOM   8072  P  P     . DT  I 5 100 ? 43.506  54.939 -24.151 1.00 167.64 ? 27  DT  I P     1 
ATOM   8073  O  OP1   . DT  I 5 100 ? 43.309  55.354 -25.544 1.00 167.86 ? 27  DT  I OP1   1 
ATOM   8074  O  OP2   . DT  I 5 100 ? 42.921  55.724 -23.056 1.00 167.91 ? 27  DT  I OP2   1 
ATOM   8075  O  "O5'" . DT  I 5 100 ? 43.071  53.427 -23.943 1.00 165.44 ? 27  DT  I "O5'" 1 
ATOM   8076  C  "C5'" . DT  I 5 100 ? 44.020  52.540 -23.341 1.00 163.51 ? 27  DT  I "C5'" 1 
ATOM   8077  C  "C4'" . DT  I 5 100 ? 43.508  51.121 -23.285 1.00 161.68 ? 27  DT  I "C4'" 1 
ATOM   8078  O  "O4'" . DT  I 5 100 ? 44.309  50.419 -22.309 1.00 161.57 ? 27  DT  I "O4'" 1 
ATOM   8079  C  "C3'" . DT  I 5 100 ? 42.071  50.969 -22.801 1.00 160.12 ? 27  DT  I "C3'" 1 
ATOM   8080  O  "O3'" . DT  I 5 100 ? 41.526  49.735 -23.301 1.00 157.78 ? 27  DT  I "O3'" 1 
ATOM   8081  C  "C2'" . DT  I 5 100 ? 42.257  50.937 -21.297 1.00 160.77 ? 27  DT  I "C2'" 1 
ATOM   8082  C  "C1'" . DT  I 5 100 ? 43.517  50.102 -21.176 1.00 161.54 ? 27  DT  I "C1'" 1 
ATOM   8083  N  N1    . DT  I 5 100 ? 44.329  50.343 -19.972 1.00 162.35 ? 27  DT  I N1    1 
ATOM   8084  C  C2    . DT  I 5 100 ? 44.974  49.267 -19.412 1.00 162.72 ? 27  DT  I C2    1 
ATOM   8085  O  O2    . DT  I 5 100 ? 44.891  48.137 -19.857 1.00 162.81 ? 27  DT  I O2    1 
ATOM   8086  N  N3    . DT  I 5 100 ? 45.711  49.560 -18.294 1.00 162.83 ? 27  DT  I N3    1 
ATOM   8087  C  C4    . DT  I 5 100 ? 45.859  50.793 -17.692 1.00 162.96 ? 27  DT  I C4    1 
ATOM   8088  O  O4    . DT  I 5 100 ? 46.572  50.905 -16.698 1.00 163.14 ? 27  DT  I O4    1 
ATOM   8089  C  C5    . DT  I 5 100 ? 45.174  51.882 -18.346 1.00 162.69 ? 27  DT  I C5    1 
ATOM   8090  C  C7    . DT  I 5 100 ? 45.286  53.259 -17.773 1.00 162.71 ? 27  DT  I C7    1 
ATOM   8091  C  C6    . DT  I 5 100 ? 44.440  51.603 -19.430 1.00 162.52 ? 27  DT  I C6    1 
ATOM   8092  P  P     . DT  I 5 101 ? 39.953  49.452 -23.251 1.00 155.38 ? 28  DT  I P     1 
ATOM   8093  O  OP1   . DT  I 5 101 ? 39.499  49.068 -24.595 1.00 155.23 ? 28  DT  I OP1   1 
ATOM   8094  O  OP2   . DT  I 5 101 ? 39.317  50.566 -22.545 1.00 154.61 ? 28  DT  I OP2   1 
ATOM   8095  O  "O5'" . DT  I 5 101 ? 39.824  48.207 -22.278 1.00 155.72 ? 28  DT  I "O5'" 1 
ATOM   8096  C  "C5'" . DT  I 5 101 ? 40.414  46.951 -22.629 1.00 156.64 ? 28  DT  I "C5'" 1 
ATOM   8097  C  "C4'" . DT  I 5 101 ? 40.652  46.129 -21.385 1.00 157.73 ? 28  DT  I "C4'" 1 
ATOM   8098  O  "O4'" . DT  I 5 101 ? 41.477  46.879 -20.465 1.00 157.68 ? 28  DT  I "O4'" 1 
ATOM   8099  C  "C3'" . DT  I 5 101 ? 39.393  45.760 -20.598 1.00 159.03 ? 28  DT  I "C3'" 1 
ATOM   8100  O  "O3'" . DT  I 5 101 ? 39.596  44.453 -20.058 1.00 161.02 ? 28  DT  I "O3'" 1 
ATOM   8101  C  "C2'" . DT  I 5 101 ? 39.391  46.773 -19.471 1.00 158.53 ? 28  DT  I "C2'" 1 
ATOM   8102  C  "C1'" . DT  I 5 101 ? 40.874  46.828 -19.189 1.00 157.96 ? 28  DT  I "C1'" 1 
ATOM   8103  N  N1    . DT  I 5 101 ? 41.375  47.962 -18.406 1.00 157.75 ? 28  DT  I N1    1 
ATOM   8104  C  C2    . DT  I 5 101 ? 42.484  47.736 -17.631 1.00 158.02 ? 28  DT  I C2    1 
ATOM   8105  O  O2    . DT  I 5 101 ? 43.035  46.651 -17.561 1.00 158.08 ? 28  DT  I O2    1 
ATOM   8106  N  N3    . DT  I 5 101 ? 42.927  48.830 -16.932 1.00 158.13 ? 28  DT  I N3    1 
ATOM   8107  C  C4    . DT  I 5 101 ? 42.388  50.099 -16.944 1.00 158.26 ? 28  DT  I C4    1 
ATOM   8108  O  O4    . DT  I 5 101 ? 42.895  50.984 -16.263 1.00 158.39 ? 28  DT  I O4    1 
ATOM   8109  C  C5    . DT  I 5 101 ? 41.225  50.265 -17.778 1.00 157.86 ? 28  DT  I C5    1 
ATOM   8110  C  C7    . DT  I 5 101 ? 40.574  51.609 -17.854 1.00 157.78 ? 28  DT  I C7    1 
ATOM   8111  C  C6    . DT  I 5 101 ? 40.784  49.202 -18.461 1.00 157.76 ? 28  DT  I C6    1 
ATOM   8112  P  P     . DA  I 5 102 ? 38.391  43.659 -19.418 1.00 163.13 ? 29  DA  I P     1 
ATOM   8113  O  OP1   . DA  I 5 102 ? 38.519  42.226 -19.793 1.00 162.94 ? 29  DA  I OP1   1 
ATOM   8114  O  OP2   . DA  I 5 102 ? 37.146  44.399 -19.736 1.00 163.21 ? 29  DA  I OP2   1 
ATOM   8115  O  "O5'" . DA  I 5 102 ? 38.654  43.811 -17.850 1.00 165.43 ? 29  DA  I "O5'" 1 
ATOM   8116  C  "C5'" . DA  I 5 102 ? 39.918  43.451 -17.283 1.00 167.82 ? 29  DA  I "C5'" 1 
ATOM   8117  C  "C4'" . DA  I 5 102 ? 40.014  43.940 -15.852 1.00 170.02 ? 29  DA  I "C4'" 1 
ATOM   8118  O  "O4'" . DA  I 5 102 ? 40.263  45.365 -15.845 1.00 170.62 ? 29  DA  I "O4'" 1 
ATOM   8119  C  "C3'" . DA  I 5 102 ? 38.744  43.721 -15.032 1.00 171.52 ? 29  DA  I "C3'" 1 
ATOM   8120  O  "O3'" . DA  I 5 102 ? 38.981  42.790 -13.994 1.00 172.75 ? 29  DA  I "O3'" 1 
ATOM   8121  C  "C2'" . DA  I 5 102 ? 38.367  45.107 -14.496 1.00 171.46 ? 29  DA  I "C2'" 1 
ATOM   8122  C  "C1'" . DA  I 5 102 ? 39.622  45.937 -14.739 1.00 171.33 ? 29  DA  I "C1'" 1 
ATOM   8123  N  N9    . DA  I 5 102 ? 39.331  47.330 -15.053 1.00 172.09 ? 29  DA  I N9    1 
ATOM   8124  C  C8    . DA  I 5 102 ? 38.553  47.800 -16.076 1.00 172.49 ? 29  DA  I C8    1 
ATOM   8125  N  N7    . DA  I 5 102 ? 38.446  49.106 -16.114 1.00 172.72 ? 29  DA  I N7    1 
ATOM   8126  C  C5    . DA  I 5 102 ? 39.178  49.527 -15.023 1.00 173.04 ? 29  DA  I C5    1 
ATOM   8127  C  C6    . DA  I 5 102 ? 39.456  50.817 -14.496 1.00 173.71 ? 29  DA  I C6    1 
ATOM   8128  N  N6    . DA  I 5 102 ? 38.990  51.953 -15.040 1.00 173.66 ? 29  DA  I N6    1 
ATOM   8129  N  N1    . DA  I 5 102 ? 40.237  50.888 -13.381 1.00 174.04 ? 29  DA  I N1    1 
ATOM   8130  C  C2    . DA  I 5 102 ? 40.708  49.740 -12.846 1.00 173.89 ? 29  DA  I C2    1 
ATOM   8131  N  N3    . DA  I 5 102 ? 40.494  48.474 -13.238 1.00 173.35 ? 29  DA  I N3    1 
ATOM   8132  C  C4    . DA  I 5 102 ? 39.723  48.438 -14.346 1.00 172.78 ? 29  DA  I C4    1 
ATOM   8133  P  P     . DG  I 5 103 ? 37.975  41.565 -13.786 1.00 174.03 ? 30  DG  I P     1 
ATOM   8134  O  OP1   . DG  I 5 103 ? 38.198  40.595 -14.886 1.00 174.03 ? 30  DG  I OP1   1 
ATOM   8135  O  OP2   . DG  I 5 103 ? 36.627  42.125 -13.548 1.00 174.01 ? 30  DG  I OP2   1 
ATOM   8136  O  "O5'" . DG  I 5 103 ? 38.468  40.912 -12.420 1.00 175.84 ? 30  DG  I "O5'" 1 
ATOM   8137  C  "C5'" . DG  I 5 103 ? 39.828  40.547 -12.247 1.00 177.58 ? 30  DG  I "C5'" 1 
ATOM   8138  C  "C4'" . DG  I 5 103 ? 40.401  41.236 -11.030 1.00 179.23 ? 30  DG  I "C4'" 1 
ATOM   8139  O  "O4'" . DG  I 5 103 ? 40.415  42.667 -11.253 1.00 179.50 ? 30  DG  I "O4'" 1 
ATOM   8140  C  "C3'" . DG  I 5 103 ? 39.609  41.015 -9.733  1.00 180.90 ? 30  DG  I "C3'" 1 
ATOM   8141  O  "O3'" . DG  I 5 103 ? 40.485  40.574 -8.700  1.00 183.23 ? 30  DG  I "O3'" 1 
ATOM   8142  C  "C2'" . DG  I 5 103 ? 39.022  42.392 -9.428  1.00 180.44 ? 30  DG  I "C2'" 1 
ATOM   8143  C  "C1'" . DG  I 5 103 ? 40.057  43.301 -10.060 1.00 180.23 ? 30  DG  I "C1'" 1 
ATOM   8144  N  N9    . DG  I 5 103 ? 39.569  44.645 -10.351 1.00 180.95 ? 30  DG  I N9    1 
ATOM   8145  C  C8    . DG  I 5 103 ? 38.448  44.982 -11.071 1.00 181.15 ? 30  DG  I C8    1 
ATOM   8146  N  N7    . DG  I 5 103 ? 38.231  46.265 -11.129 1.00 181.42 ? 30  DG  I N7    1 
ATOM   8147  C  C5    . DG  I 5 103 ? 39.242  46.816 -10.357 1.00 181.82 ? 30  DG  I C5    1 
ATOM   8148  C  C6    . DG  I 5 103 ? 39.502  48.172 -10.026 1.00 182.43 ? 30  DG  I C6    1 
ATOM   8149  O  O6    . DG  I 5 103 ? 38.863  49.171 -10.372 1.00 182.65 ? 30  DG  I O6    1 
ATOM   8150  N  N1    . DG  I 5 103 ? 40.643  48.311 -9.215  1.00 182.62 ? 30  DG  I N1    1 
ATOM   8151  C  C2    . DG  I 5 103 ? 41.420  47.256 -8.761  1.00 182.49 ? 30  DG  I C2    1 
ATOM   8152  N  N2    . DG  I 5 103 ? 42.478  47.575 -7.990  1.00 182.37 ? 30  DG  I N2    1 
ATOM   8153  N  N3    . DG  I 5 103 ? 41.172  45.975 -9.051  1.00 182.24 ? 30  DG  I N3    1 
ATOM   8154  C  C4    . DG  I 5 103 ? 40.068  45.831 -9.853  1.00 181.70 ? 30  DG  I C4    1 
ATOM   8155  P  P     . DG  I 5 104 ? 39.928  39.920 -7.282  1.00 185.37 ? 31  DG  I P     1 
ATOM   8156  O  OP1   . DG  I 5 104 ? 41.080  39.331 -6.570  1.00 185.55 ? 31  DG  I OP1   1 
ATOM   8157  O  OP2   . DG  I 5 104 ? 38.733  39.111 -7.591  1.00 185.39 ? 31  DG  I OP2   1 
ATOM   8158  O  "O5'" . DG  I 5 104 ? 39.379  41.177 -6.470  1.00 186.84 ? 31  DG  I "O5'" 1 
ATOM   8159  C  "C5'" . DG  I 5 104 ? 40.215  42.326 -6.249  1.00 188.22 ? 31  DG  I "C5'" 1 
ATOM   8160  C  "C4'" . DG  I 5 104 ? 39.634  43.275 -5.224  1.00 189.64 ? 31  DG  I "C4'" 1 
ATOM   8161  O  "O4'" . DG  I 5 104 ? 39.221  44.506 -5.864  1.00 190.05 ? 31  DG  I "O4'" 1 
ATOM   8162  C  "C3'" . DG  I 5 104 ? 38.417  42.792 -4.438  1.00 190.64 ? 31  DG  I "C3'" 1 
ATOM   8163  O  "O3'" . DG  I 5 104 ? 38.474  43.406 -3.147  1.00 191.73 ? 31  DG  I "O3'" 1 
ATOM   8164  C  "C2'" . DG  I 5 104 ? 37.262  43.438 -5.178  1.00 190.51 ? 31  DG  I "C2'" 1 
ATOM   8165  C  "C1'" . DG  I 5 104 ? 37.865  44.778 -5.546  1.00 190.43 ? 31  DG  I "C1'" 1 
ATOM   8166  N  N9    . DG  I 5 104 ? 37.254  45.410 -6.707  1.00 190.80 ? 31  DG  I N9    1 
ATOM   8167  C  C8    . DG  I 5 104 ? 36.790  44.783 -7.837  1.00 191.10 ? 31  DG  I C8    1 
ATOM   8168  N  N7    . DG  I 5 104 ? 36.306  45.612 -8.721  1.00 191.22 ? 31  DG  I N7    1 
ATOM   8169  C  C5    . DG  I 5 104 ? 36.472  46.862 -8.145  1.00 191.13 ? 31  DG  I C5    1 
ATOM   8170  C  C6    . DG  I 5 104 ? 36.135  48.149 -8.636  1.00 191.19 ? 31  DG  I C6    1 
ATOM   8171  O  O6    . DG  I 5 104 ? 35.609  48.449 -9.712  1.00 191.32 ? 31  DG  I O6    1 
ATOM   8172  N  N1    . DG  I 5 104 ? 36.472  49.148 -7.730  1.00 191.05 ? 31  DG  I N1    1 
ATOM   8173  C  C2    . DG  I 5 104 ? 37.054  48.935 -6.506  1.00 190.80 ? 31  DG  I C2    1 
ATOM   8174  N  N2    . DG  I 5 104 ? 37.301  50.029 -5.775  1.00 190.58 ? 31  DG  I N2    1 
ATOM   8175  N  N3    . DG  I 5 104 ? 37.372  47.738 -6.035  1.00 190.76 ? 31  DG  I N3    1 
ATOM   8176  C  C4    . DG  I 5 104 ? 37.060  46.754 -6.903  1.00 190.87 ? 31  DG  I C4    1 
ATOM   8177  P  P     . DG  I 5 105 ? 37.781  42.720 -1.881  1.00 192.50 ? 32  DG  I P     1 
ATOM   8178  O  OP1   . DG  I 5 105 ? 38.817  41.935 -1.174  1.00 192.59 ? 32  DG  I OP1   1 
ATOM   8179  O  OP2   . DG  I 5 105 ? 36.540  42.059 -2.335  1.00 192.60 ? 32  DG  I OP2   1 
ATOM   8180  O  "O5'" . DG  I 5 105 ? 37.362  43.966 -0.982  1.00 192.75 ? 32  DG  I "O5'" 1 
ATOM   8181  C  "C5'" . DG  I 5 105 ? 38.328  44.972 -0.634  1.00 192.97 ? 32  DG  I "C5'" 1 
ATOM   8182  C  "C4'" . DG  I 5 105 ? 37.674  46.331 -0.639  1.00 193.18 ? 32  DG  I "C4'" 1 
ATOM   8183  O  "O4'" . DG  I 5 105 ? 37.319  46.671 -1.995  1.00 193.16 ? 32  DG  I "O4'" 1 
ATOM   8184  C  "C3'" . DG  I 5 105 ? 36.387  46.405 0.180   1.00 193.48 ? 32  DG  I "C3'" 1 
ATOM   8185  O  "O3'" . DG  I 5 105 ? 36.535  47.359 1.229   1.00 194.12 ? 32  DG  I "O3'" 1 
ATOM   8186  C  "C2'" . DG  I 5 105 ? 35.329  46.880 -0.802  1.00 193.28 ? 32  DG  I "C2'" 1 
ATOM   8187  C  "C1'" . DG  I 5 105 ? 36.087  47.360 -2.017  1.00 193.19 ? 32  DG  I "C1'" 1 
ATOM   8188  N  N9    . DG  I 5 105 ? 35.390  46.985 -3.239  1.00 193.15 ? 32  DG  I N9    1 
ATOM   8189  C  C8    . DG  I 5 105 ? 35.179  45.706 -3.687  1.00 193.23 ? 32  DG  I C8    1 
ATOM   8190  N  N7    . DG  I 5 105 ? 34.496  45.657 -4.797  1.00 193.35 ? 32  DG  I N7    1 
ATOM   8191  C  C5    . DG  I 5 105 ? 34.207  46.985 -5.080  1.00 193.35 ? 32  DG  I C5    1 
ATOM   8192  C  C6    . DG  I 5 105 ? 33.488  47.558 -6.164  1.00 193.38 ? 32  DG  I C6    1 
ATOM   8193  O  O6    . DG  I 5 105 ? 32.932  46.985 -7.108  1.00 193.39 ? 32  DG  I O6    1 
ATOM   8194  N  N1    . DG  I 5 105 ? 33.438  48.944 -6.069  1.00 193.27 ? 32  DG  I N1    1 
ATOM   8195  C  C2    . DG  I 5 105 ? 34.024  49.685 -5.074  1.00 193.19 ? 32  DG  I C2    1 
ATOM   8196  N  N2    . DG  I 5 105 ? 33.863  51.011 -5.160  1.00 193.14 ? 32  DG  I N2    1 
ATOM   8197  N  N3    . DG  I 5 105 ? 34.691  49.163 -4.055  1.00 193.21 ? 32  DG  I N3    1 
ATOM   8198  C  C4    . DG  I 5 105 ? 34.747  47.817 -4.124  1.00 193.20 ? 32  DG  I C4    1 
ATOM   8199  P  P     . DT  I 5 106 ? 35.345  47.608 2.256   1.00 194.62 ? 33  DT  I P     1 
ATOM   8200  O  OP1   . DT  I 5 106 ? 35.933  48.079 3.524   1.00 194.43 ? 33  DT  I OP1   1 
ATOM   8201  O  OP2   . DT  I 5 106 ? 34.472  46.415 2.256   1.00 194.77 ? 33  DT  I OP2   1 
ATOM   8202  O  "O5'" . DT  I 5 106 ? 34.548  48.833 1.622   1.00 194.48 ? 33  DT  I "O5'" 1 
ATOM   8203  C  "C5'" . DT  I 5 106 ? 35.196  50.092 1.395   1.00 193.96 ? 33  DT  I "C5'" 1 
ATOM   8204  C  "C4'" . DT  I 5 106 ? 34.176  51.187 1.190   1.00 193.29 ? 33  DT  I "C4'" 1 
ATOM   8205  O  "O4'" . DT  I 5 106 ? 33.675  51.145 -0.166  1.00 193.28 ? 33  DT  I "O4'" 1 
ATOM   8206  C  "C3'" . DT  I 5 106 ? 32.933  51.110 2.068   1.00 192.76 ? 33  DT  I "C3'" 1 
ATOM   8207  O  "O3'" . DT  I 5 106 ? 32.404  52.431 2.065   1.00 192.08 ? 33  DT  I "O3'" 1 
ATOM   8208  C  "C2'" . DT  I 5 106 ? 31.974  50.324 1.203   1.00 193.00 ? 33  DT  I "C2'" 1 
ATOM   8209  C  "C1'" . DT  I 5 106 ? 32.264  50.981 -0.131  1.00 193.30 ? 33  DT  I "C1'" 1 
ATOM   8210  N  N1    . DT  I 5 106 ? 31.861  50.227 -1.326  1.00 193.62 ? 33  DT  I N1    1 
ATOM   8211  C  C2    . DT  I 5 106 ? 31.328  50.938 -2.373  1.00 193.73 ? 33  DT  I C2    1 
ATOM   8212  O  O2    . DT  I 5 106 ? 31.182  52.147 -2.351  1.00 193.64 ? 33  DT  I O2    1 
ATOM   8213  N  N3    . DT  I 5 106 ? 30.981  50.180 -3.460  1.00 193.90 ? 33  DT  I N3    1 
ATOM   8214  C  C4    . DT  I 5 106 ? 31.100  48.814 -3.595  1.00 194.07 ? 33  DT  I C4    1 
ATOM   8215  O  O4    . DT  I 5 106 ? 30.750  48.272 -4.636  1.00 194.06 ? 33  DT  I O4    1 
ATOM   8216  C  C5    . DT  I 5 106 ? 31.674  48.131 -2.461  1.00 194.10 ? 33  DT  I C5    1 
ATOM   8217  C  C7    . DT  I 5 106 ? 31.846  46.646 -2.520  1.00 194.13 ? 33  DT  I C7    1 
ATOM   8218  C  C6    . DT  I 5 106 ? 32.019  48.861 -1.396  1.00 193.88 ? 33  DT  I C6    1 
ATOM   8219  P  P     . DT  I 5 107 ? 31.307  52.854 3.114   1.00 191.26 ? 34  DT  I P     1 
ATOM   8220  O  OP1   . DT  I 5 107 ? 31.759  54.125 3.743   1.00 191.17 ? 34  DT  I OP1   1 
ATOM   8221  O  OP2   . DT  I 5 107 ? 31.009  51.681 3.972   1.00 191.50 ? 34  DT  I OP2   1 
ATOM   8222  O  "O5'" . DT  I 5 107 ? 30.011  53.142 2.216   1.00 189.63 ? 34  DT  I "O5'" 1 
ATOM   8223  C  "C5'" . DT  I 5 107 ? 29.999  54.245 1.314   1.00 187.97 ? 34  DT  I "C5'" 1 
ATOM   8224  C  "C4'" . DT  I 5 107 ? 28.835  54.149 0.351   1.00 186.42 ? 34  DT  I "C4'" 1 
ATOM   8225  O  "O4'" . DT  I 5 107 ? 28.963  52.952 -0.452  1.00 186.42 ? 34  DT  I "O4'" 1 
ATOM   8226  C  "C3'" . DT  I 5 107 ? 27.442  54.086 1.001   1.00 185.12 ? 34  DT  I "C3'" 1 
ATOM   8227  O  "O3'" . DT  I 5 107 ? 26.627  55.146 0.493   1.00 183.52 ? 34  DT  I "O3'" 1 
ATOM   8228  C  "C2'" . DT  I 5 107 ? 26.906  52.711 0.576   1.00 185.69 ? 34  DT  I "C2'" 1 
ATOM   8229  C  "C1'" . DT  I 5 107 ? 27.673  52.477 -0.721  1.00 186.28 ? 34  DT  I "C1'" 1 
ATOM   8230  N  N1    . DT  I 5 107 ? 27.742  51.013 -1.182  1.00 186.39 ? 34  DT  I N1    1 
ATOM   8231  C  C2    . DT  I 5 107 ? 27.486  50.698 -2.519  1.00 186.21 ? 34  DT  I C2    1 
ATOM   8232  O  O2    . DT  I 5 107 ? 27.231  51.531 -3.382  1.00 185.90 ? 34  DT  I O2    1 
ATOM   8233  N  N3    . DT  I 5 107 ? 27.562  49.353 -2.814  1.00 186.29 ? 34  DT  I N3    1 
ATOM   8234  C  C4    . DT  I 5 107 ? 27.838  48.307 -1.934  1.00 186.29 ? 34  DT  I C4    1 
ATOM   8235  O  O4    . DT  I 5 107 ? 27.869  47.152 -2.358  1.00 186.34 ? 34  DT  I O4    1 
ATOM   8236  C  C5    . DT  I 5 107 ? 28.083  48.701 -0.554  1.00 186.24 ? 34  DT  I C5    1 
ATOM   8237  C  C7    . DT  I 5 107 ? 28.400  47.667 0.488   1.00 186.15 ? 34  DT  I C7    1 
ATOM   8238  C  C6    . DT  I 5 107 ? 28.022  50.013 -0.250  1.00 186.38 ? 34  DT  I C6    1 
ATOM   8239  P  P     . DA  I 5 108 ? 25.417  55.756 1.363   1.00 182.02 ? 35  DA  I P     1 
ATOM   8240  O  OP1   . DA  I 5 108 ? 25.986  56.727 2.331   1.00 182.30 ? 35  DA  I OP1   1 
ATOM   8241  O  OP2   . DA  I 5 108 ? 24.586  54.629 1.857   1.00 181.98 ? 35  DA  I OP2   1 
ATOM   8242  O  "O5'" . DA  I 5 108 ? 24.544  56.562 0.276   1.00 179.93 ? 35  DA  I "O5'" 1 
ATOM   8243  C  "C5'" . DA  I 5 108 ? 25.122  56.985 -0.975  1.00 177.71 ? 35  DA  I "C5'" 1 
ATOM   8244  C  "C4'" . DA  I 5 108 ? 24.421  56.333 -2.177  1.00 175.24 ? 35  DA  I "C4'" 1 
ATOM   8245  O  "O4'" . DA  I 5 108 ? 24.677  54.906 -2.203  1.00 174.71 ? 35  DA  I "O4'" 1 
ATOM   8246  C  "C3'" . DA  I 5 108 ? 22.901  56.507 -2.245  1.00 173.10 ? 35  DA  I "C3'" 1 
ATOM   8247  O  "O3'" . DA  I 5 108 ? 22.528  56.983 -3.529  1.00 170.34 ? 35  DA  I "O3'" 1 
ATOM   8248  C  "C2'" . DA  I 5 108 ? 22.348  55.105 -1.981  1.00 173.66 ? 35  DA  I "C2'" 1 
ATOM   8249  C  "C1'" . DA  I 5 108 ? 23.480  54.210 -2.467  1.00 174.31 ? 35  DA  I "C1'" 1 
ATOM   8250  N  N9    . DA  I 5 108 ? 23.543  52.926 -1.774  1.00 174.66 ? 35  DA  I N9    1 
ATOM   8251  C  C8    . DA  I 5 108 ? 23.395  52.706 -0.426  1.00 175.00 ? 35  DA  I C8    1 
ATOM   8252  N  N7    . DA  I 5 108 ? 23.536  51.451 -0.072  1.00 175.10 ? 35  DA  I N7    1 
ATOM   8253  C  C5    . DA  I 5 108 ? 23.814  50.800 -1.262  1.00 174.91 ? 35  DA  I C5    1 
ATOM   8254  C  C6    . DA  I 5 108 ? 24.067  49.440 -1.572  1.00 174.77 ? 35  DA  I C6    1 
ATOM   8255  N  N6    . DA  I 5 108 ? 24.089  48.468 -0.654  1.00 174.37 ? 35  DA  I N6    1 
ATOM   8256  N  N1    . DA  I 5 108 ? 24.301  49.124 -2.871  1.00 174.99 ? 35  DA  I N1    1 
ATOM   8257  C  C2    . DA  I 5 108 ? 24.269  50.106 -3.792  1.00 174.96 ? 35  DA  I C2    1 
ATOM   8258  N  N3    . DA  I 5 108 ? 24.079  51.419 -3.618  1.00 174.76 ? 35  DA  I N3    1 
ATOM   8259  C  C4    . DA  I 5 108 ? 23.833  51.700 -2.323  1.00 174.72 ? 35  DA  I C4    1 
ATOM   8260  P  P     . DG  I 5 109 ? 21.207  57.876 -3.721  1.00 167.62 ? 36  DG  I P     1 
ATOM   8261  O  OP1   . DG  I 5 109 ? 21.622  59.179 -4.292  1.00 167.60 ? 36  DG  I OP1   1 
ATOM   8262  O  OP2   . DG  I 5 109 ? 20.414  57.836 -2.464  1.00 167.25 ? 36  DG  I OP2   1 
ATOM   8263  O  "O5'" . DG  I 5 109 ? 20.381  57.068 -4.834  1.00 165.15 ? 36  DG  I "O5'" 1 
ATOM   8264  C  "C5'" . DG  I 5 109 ? 21.047  56.397 -5.911  1.00 162.24 ? 36  DG  I "C5'" 1 
ATOM   8265  C  "C4'" . DG  I 5 109 ? 20.269  55.161 -6.336  1.00 159.41 ? 36  DG  I "C4'" 1 
ATOM   8266  O  "O4'" . DG  I 5 109 ? 20.515  54.075 -5.404  1.00 158.88 ? 36  DG  I "O4'" 1 
ATOM   8267  C  "C3'" . DG  I 5 109 ? 18.746  55.334 -6.405  1.00 157.08 ? 36  DG  I "C3'" 1 
ATOM   8268  O  "O3'" . DG  I 5 109 ? 18.268  54.817 -7.629  1.00 154.22 ? 36  DG  I "O3'" 1 
ATOM   8269  C  "C2'" . DG  I 5 109 ? 18.238  54.516 -5.218  1.00 157.64 ? 36  DG  I "C2'" 1 
ATOM   8270  C  "C1'" . DG  I 5 109 ? 19.300  53.430 -5.126  1.00 158.40 ? 36  DG  I "C1'" 1 
ATOM   8271  N  N9    . DG  I 5 109 ? 19.393  52.787 -3.814  1.00 158.57 ? 36  DG  I N9    1 
ATOM   8272  C  C8    . DG  I 5 109 ? 18.991  53.307 -2.606  1.00 158.73 ? 36  DG  I C8    1 
ATOM   8273  N  N7    . DG  I 5 109 ? 19.169  52.498 -1.602  1.00 158.99 ? 36  DG  I N7    1 
ATOM   8274  C  C5    . DG  I 5 109 ? 19.728  51.361 -2.171  1.00 159.06 ? 36  DG  I C5    1 
ATOM   8275  C  C6    . DG  I 5 109 ? 20.141  50.137 -1.564  1.00 159.27 ? 36  DG  I C6    1 
ATOM   8276  O  O6    . DG  I 5 109 ? 20.091  49.819 -0.363  1.00 159.40 ? 36  DG  I O6    1 
ATOM   8277  N  N1    . DG  I 5 109 ? 20.659  49.233 -2.505  1.00 159.19 ? 36  DG  I N1    1 
ATOM   8278  C  C2    . DG  I 5 109 ? 20.774  49.484 -3.858  1.00 158.93 ? 36  DG  I C2    1 
ATOM   8279  N  N2    . DG  I 5 109 ? 21.323  48.509 -4.596  1.00 158.56 ? 36  DG  I N2    1 
ATOM   8280  N  N3    . DG  I 5 109 ? 20.393  50.628 -4.440  1.00 159.15 ? 36  DG  I N3    1 
ATOM   8281  C  C4    . DG  I 5 109 ? 19.877  51.520 -3.537  1.00 158.93 ? 36  DG  I C4    1 
ATOM   8282  P  P     . DG  I 5 110 ? 17.723  55.802 -8.766  1.00 151.28 ? 37  DG  I P     1 
ATOM   8283  O  OP1   . DG  I 5 110 ? 18.810  56.744 -9.126  1.00 151.68 ? 37  DG  I OP1   1 
ATOM   8284  O  OP2   . DG  I 5 110 ? 16.409  56.325 -8.315  1.00 151.37 ? 37  DG  I OP2   1 
ATOM   8285  O  "O5'" . DG  I 5 110 ? 17.474  54.813 -10.002 1.00 147.60 ? 37  DG  I "O5'" 1 
ATOM   8286  C  "C5'" . DG  I 5 110 ? 18.557  54.040 -10.540 1.00 143.75 ? 37  DG  I "C5'" 1 
ATOM   8287  C  "C4'" . DG  I 5 110 ? 18.278  52.541 -10.440 1.00 139.86 ? 37  DG  I "C4'" 1 
ATOM   8288  O  "O4'" . DG  I 5 110 ? 18.188  52.133 -9.054  1.00 139.20 ? 37  DG  I "O4'" 1 
ATOM   8289  C  "C3'" . DG  I 5 110 ? 16.986  52.054 -11.100 1.00 136.96 ? 37  DG  I "C3'" 1 
ATOM   8290  O  "O3'" . DG  I 5 110 ? 17.230  50.822 -11.761 1.00 132.91 ? 37  DG  I "O3'" 1 
ATOM   8291  C  "C2'" . DG  I 5 110 ? 16.050  51.859 -9.914  1.00 138.07 ? 37  DG  I "C2'" 1 
ATOM   8292  C  "C1'" . DG  I 5 110 ? 17.034  51.351 -8.888  1.00 139.26 ? 37  DG  I "C1'" 1 
ATOM   8293  N  N9    . DG  I 5 110 ? 16.597  51.459 -7.511  1.00 141.01 ? 37  DG  I N9    1 
ATOM   8294  C  C8    . DG  I 5 110 ? 15.900  52.490 -6.921  1.00 141.59 ? 37  DG  I C8    1 
ATOM   8295  N  N7    . DG  I 5 110 ? 15.716  52.326 -5.637  1.00 142.12 ? 37  DG  I N7    1 
ATOM   8296  C  C5    . DG  I 5 110 ? 16.360  51.129 -5.357  1.00 142.62 ? 37  DG  I C5    1 
ATOM   8297  C  C6    . DG  I 5 110 ? 16.512  50.430 -4.126  1.00 143.18 ? 37  DG  I C6    1 
ATOM   8298  O  O6    . DG  I 5 110 ? 16.076  50.742 -3.011  1.00 143.01 ? 37  DG  I O6    1 
ATOM   8299  N  N1    . DG  I 5 110 ? 17.208  49.220 -4.294  1.00 143.81 ? 37  DG  I N1    1 
ATOM   8300  C  C2    . DG  I 5 110 ? 17.712  48.759 -5.507  1.00 144.16 ? 37  DG  I C2    1 
ATOM   8301  N  N2    . DG  I 5 110 ? 18.358  47.580 -5.485  1.00 144.68 ? 37  DG  I N2    1 
ATOM   8302  N  N3    . DG  I 5 110 ? 17.581  49.410 -6.660  1.00 143.46 ? 37  DG  I N3    1 
ATOM   8303  C  C4    . DG  I 5 110 ? 16.900  50.583 -6.509  1.00 142.45 ? 37  DG  I C4    1 
ATOM   8304  P  P     . DG  I 5 111 ? 16.386  50.411 -13.039 1.00 129.12 ? 38  DG  I P     1 
ATOM   8305  O  OP1   . DG  I 5 111 ? 17.349  50.123 -14.124 1.00 127.89 ? 38  DG  I OP1   1 
ATOM   8306  O  OP2   . DG  I 5 111 ? 15.314  51.408 -13.237 1.00 128.51 ? 38  DG  I OP2   1 
ATOM   8307  O  "O5'" . DG  I 5 111 ? 15.675  49.070 -12.567 1.00 129.62 ? 38  DG  I "O5'" 1 
ATOM   8308  C  "C5'" . DG  I 5 111 ? 16.420  47.868 -12.360 1.00 129.96 ? 38  DG  I "C5'" 1 
ATOM   8309  C  "C4'" . DG  I 5 111 ? 15.668  46.917 -11.441 1.00 130.14 ? 38  DG  I "C4'" 1 
ATOM   8310  O  "O4'" . DG  I 5 111 ? 15.663  47.456 -10.094 1.00 130.49 ? 38  DG  I "O4'" 1 
ATOM   8311  C  "C3'" . DG  I 5 111 ? 14.188  46.663 -11.798 1.00 130.49 ? 38  DG  I "C3'" 1 
ATOM   8312  O  "O3'" . DG  I 5 111 ? 13.903  45.250 -11.738 1.00 131.14 ? 38  DG  I "O3'" 1 
ATOM   8313  C  "C2'" . DG  I 5 111 ? 13.440  47.434 -10.714 1.00 130.64 ? 38  DG  I "C2'" 1 
ATOM   8314  C  "C1'" . DG  I 5 111 ? 14.388  47.261 -9.553  1.00 130.94 ? 38  DG  I "C1'" 1 
ATOM   8315  N  N9    . DG  I 5 111 ? 14.165  48.190 -8.464  1.00 131.72 ? 38  DG  I N9    1 
ATOM   8316  C  C8    . DG  I 5 111 ? 13.755  49.496 -8.558  1.00 132.07 ? 38  DG  I C8    1 
ATOM   8317  N  N7    . DG  I 5 111 ? 13.529  50.055 -7.405  1.00 132.56 ? 38  DG  I N7    1 
ATOM   8318  C  C5    . DG  I 5 111 ? 13.765  49.043 -6.488  1.00 132.95 ? 38  DG  I C5    1 
ATOM   8319  C  C6    . DG  I 5 111 ? 13.665  49.049 -5.069  1.00 133.57 ? 38  DG  I C6    1 
ATOM   8320  O  O6    . DG  I 5 111 ? 13.378  50.002 -4.325  1.00 133.65 ? 38  DG  I O6    1 
ATOM   8321  N  N1    . DG  I 5 111 ? 14.003  47.802 -4.518  1.00 134.02 ? 38  DG  I N1    1 
ATOM   8322  C  C2    . DG  I 5 111 ? 14.370  46.686 -5.252  1.00 134.36 ? 38  DG  I C2    1 
ATOM   8323  N  N2    . DG  I 5 111 ? 14.646  45.569 -4.551  1.00 134.97 ? 38  DG  I N2    1 
ATOM   8324  N  N3    . DG  I 5 111 ? 14.455  46.670 -6.585  1.00 133.59 ? 38  DG  I N3    1 
ATOM   8325  C  C4    . DG  I 5 111 ? 14.140  47.880 -7.132  1.00 132.70 ? 38  DG  I C4    1 
ATOM   8326  P  P     . DT  I 5 112 ? 12.425  44.659 -11.998 1.00 132.07 ? 39  DT  I P     1 
ATOM   8327  O  OP1   . DT  I 5 112 ? 12.526  43.651 -13.073 1.00 132.02 ? 39  DT  I OP1   1 
ATOM   8328  O  OP2   . DT  I 5 112 ? 11.462  45.777 -12.132 1.00 131.74 ? 39  DT  I OP2   1 
ATOM   8329  O  "O5'" . DT  I 5 112 ? 12.101  43.916 -10.630 1.00 134.80 ? 39  DT  I "O5'" 1 
ATOM   8330  C  "C5'" . DT  I 5 112 ? 13.032  42.980 -10.075 1.00 138.03 ? 39  DT  I "C5'" 1 
ATOM   8331  C  "C4'" . DT  I 5 112 ? 12.573  42.526 -8.704  1.00 141.27 ? 39  DT  I "C4'" 1 
ATOM   8332  O  "O4'" . DT  I 5 112 ? 12.638  43.650 -7.788  1.00 142.21 ? 39  DT  I "O4'" 1 
ATOM   8333  C  "C3'" . DT  I 5 112 ? 11.136  42.012 -8.668  1.00 143.82 ? 39  DT  I "C3'" 1 
ATOM   8334  O  "O3'" . DT  I 5 112 ? 11.082  40.677 -8.210  1.00 146.90 ? 39  DT  I "O3'" 1 
ATOM   8335  C  "C2'" . DT  I 5 112 ? 10.392  42.965 -7.738  1.00 143.58 ? 39  DT  I "C2'" 1 
ATOM   8336  C  "C1'" . DT  I 5 112 ? 11.500  43.664 -6.967  1.00 143.19 ? 39  DT  I "C1'" 1 
ATOM   8337  N  N1    . DT  I 5 112 ? 11.152  45.084 -6.630  1.00 144.03 ? 39  DT  I N1    1 
ATOM   8338  C  C2    . DT  I 5 112 ? 10.889  45.417 -5.307  1.00 145.11 ? 39  DT  I C2    1 
ATOM   8339  O  O2    . DT  I 5 112 ? 11.037  44.640 -4.369  1.00 145.79 ? 39  DT  I O2    1 
ATOM   8340  N  N3    . DT  I 5 112 ? 10.504  46.727 -5.110  1.00 145.05 ? 39  DT  I N3    1 
ATOM   8341  C  C4    . DT  I 5 112 ? 10.309  47.707 -6.080  1.00 144.75 ? 39  DT  I C4    1 
ATOM   8342  O  O4    . DT  I 5 112 ? 9.958   48.835 -5.730  1.00 144.92 ? 39  DT  I O4    1 
ATOM   8343  C  C5    . DT  I 5 112 ? 10.554  47.284 -7.454  1.00 144.11 ? 39  DT  I C5    1 
ATOM   8344  C  C7    . DT  I 5 112 ? 10.369  48.246 -8.594  1.00 143.60 ? 39  DT  I C7    1 
ATOM   8345  C  C6    . DT  I 5 112 ? 10.949  46.008 -7.660  1.00 143.98 ? 39  DT  I C6    1 
ATOM   8346  P  P     . DT  I 5 113 ? 9.775   39.782 -8.488  1.00 149.88 ? 40  DT  I P     1 
ATOM   8347  O  OP1   . DT  I 5 113 ? 10.214  38.376 -8.679  1.00 150.00 ? 40  DT  I OP1   1 
ATOM   8348  O  OP2   . DT  I 5 113 ? 8.965   40.450 -9.541  1.00 149.79 ? 40  DT  I OP2   1 
ATOM   8349  O  "O5'" . DT  I 5 113 ? 8.968   39.895 -7.112  1.00 152.62 ? 40  DT  I "O5'" 1 
ATOM   8350  C  "C5'" . DT  I 5 113 ? 9.500   39.344 -5.921  1.00 155.28 ? 40  DT  I "C5'" 1 
ATOM   8351  C  "C4'" . DT  I 5 113 ? 8.965   40.073 -4.709  1.00 158.01 ? 40  DT  I "C4'" 1 
ATOM   8352  O  "O4'" . DT  I 5 113 ? 9.310   41.466 -4.788  1.00 158.16 ? 40  DT  I "O4'" 1 
ATOM   8353  C  "C3'" . DT  I 5 113 ? 7.459   40.103 -4.571  1.00 161.05 ? 40  DT  I "C3'" 1 
ATOM   8354  O  "O3'" . DT  I 5 113 ? 6.976   38.875 -4.046  1.00 165.37 ? 40  DT  I "O3'" 1 
ATOM   8355  C  "C2'" . DT  I 5 113 ? 7.284   41.237 -3.575  1.00 160.03 ? 40  DT  I "C2'" 1 
ATOM   8356  C  "C1'" . DT  I 5 113 ? 8.411   42.189 -3.965  1.00 159.08 ? 40  DT  I "C1'" 1 
ATOM   8357  N  N1    . DT  I 5 113 ? 7.929   43.406 -4.681  1.00 159.32 ? 40  DT  I N1    1 
ATOM   8358  C  C2    . DT  I 5 113 ? 7.811   44.597 -3.978  1.00 159.31 ? 40  DT  I C2    1 
ATOM   8359  O  O2    . DT  I 5 113 ? 8.157   44.738 -2.809  1.00 158.88 ? 40  DT  I O2    1 
ATOM   8360  N  N3    . DT  I 5 113 ? 7.330   45.646 -4.722  1.00 159.62 ? 40  DT  I N3    1 
ATOM   8361  C  C4    . DT  I 5 113 ? 6.905   45.621 -6.041  1.00 159.93 ? 40  DT  I C4    1 
ATOM   8362  O  O4    . DT  I 5 113 ? 6.493   46.658 -6.558  1.00 160.25 ? 40  DT  I O4    1 
ATOM   8363  C  C5    . DT  I 5 113 ? 6.998   44.329 -6.699  1.00 159.83 ? 40  DT  I C5    1 
ATOM   8364  C  C7    . DT  I 5 113 ? 6.575   44.167 -8.130  1.00 160.01 ? 40  DT  I C7    1 
ATOM   8365  C  C6    . DT  I 5 113 ? 7.464   43.294 -5.985  1.00 159.46 ? 40  DT  I C6    1 
ATOM   8366  P  P     . DA  I 5 114 ? 5.488   38.369 -4.392  1.00 169.16 ? 41  DA  I P     1 
ATOM   8367  O  OP1   . DA  I 5 114 ? 5.351   36.982 -3.878  1.00 169.42 ? 41  DA  I OP1   1 
ATOM   8368  O  OP2   . DA  I 5 114 ? 5.233   38.654 -5.831  1.00 169.34 ? 41  DA  I OP2   1 
ATOM   8369  O  "O5'" . DA  I 5 114 ? 4.549   39.341 -3.521  1.00 171.48 ? 41  DA  I "O5'" 1 
ATOM   8370  C  "C5'" . DA  I 5 114 ? 4.506   39.218 -2.102  1.00 173.83 ? 41  DA  I "C5'" 1 
ATOM   8371  C  "C4'" . DA  I 5 114 ? 3.898   40.453 -1.468  1.00 176.53 ? 41  DA  I "C4'" 1 
ATOM   8372  O  "O4'" . DA  I 5 114 ? 4.596   41.626 -1.921  1.00 176.86 ? 41  DA  I "O4'" 1 
ATOM   8373  C  "C3'" . DA  I 5 114 ? 2.446   40.705 -1.815  1.00 179.15 ? 41  DA  I "C3'" 1 
ATOM   8374  O  "O3'" . DA  I 5 114 ? 1.610   39.973 -0.920  1.00 182.60 ? 41  DA  I "O3'" 1 
ATOM   8375  C  "C2'" . DA  I 5 114 ? 2.316   42.207 -1.593  1.00 178.38 ? 41  DA  I "C2'" 1 
ATOM   8376  C  "C1'" . DA  I 5 114 ? 3.707   42.724 -1.967  1.00 177.52 ? 41  DA  I "C1'" 1 
ATOM   8377  N  N9    . DA  I 5 114 ? 3.765   43.333 -3.294  1.00 177.39 ? 41  DA  I N9    1 
ATOM   8378  C  C8    . DA  I 5 114 ? 3.984   42.699 -4.489  1.00 177.43 ? 41  DA  I C8    1 
ATOM   8379  N  N7    . DA  I 5 114 ? 3.966   43.500 -5.527  1.00 177.36 ? 41  DA  I N7    1 
ATOM   8380  C  C5    . DA  I 5 114 ? 3.700   44.745 -4.982  1.00 177.39 ? 41  DA  I C5    1 
ATOM   8381  C  C6    . DA  I 5 114 ? 3.543   46.031 -5.560  1.00 177.51 ? 41  DA  I C6    1 
ATOM   8382  N  N6    . DA  I 5 114 ? 3.649   46.260 -6.871  1.00 177.71 ? 41  DA  I N6    1 
ATOM   8383  N  N1    . DA  I 5 114 ? 3.294   47.078 -4.728  1.00 177.32 ? 41  DA  I N1    1 
ATOM   8384  C  C2    . DA  I 5 114 ? 3.188   46.840 -3.410  1.00 177.26 ? 41  DA  I C2    1 
ATOM   8385  N  N3    . DA  I 5 114 ? 3.311   45.678 -2.753  1.00 177.26 ? 41  DA  I N3    1 
ATOM   8386  C  C4    . DA  I 5 114 ? 3.567   44.660 -3.605  1.00 177.31 ? 41  DA  I C4    1 
ATOM   8387  P  P     . DG  I 5 115 ? 0.232   39.324 -1.429  1.00 185.58 ? 42  DG  I P     1 
ATOM   8388  O  OP1   . DG  I 5 115 ? -0.172  38.282 -0.449  1.00 185.86 ? 42  DG  I OP1   1 
ATOM   8389  O  OP2   . DG  I 5 115 ? 0.389   38.965 -2.865  1.00 185.63 ? 42  DG  I OP2   1 
ATOM   8390  O  "O5'" . DG  I 5 115 ? -0.792  40.553 -1.336  1.00 187.35 ? 42  DG  I "O5'" 1 
ATOM   8391  C  "C5'" . DG  I 5 115 ? -1.156  41.106 -0.066  1.00 189.09 ? 42  DG  I "C5'" 1 
ATOM   8392  C  "C4'" . DG  I 5 115 ? -2.020  42.348 -0.246  1.00 191.01 ? 42  DG  I "C4'" 1 
ATOM   8393  O  "O4'" . DG  I 5 115 ? -1.366  43.271 -1.156  1.00 191.74 ? 42  DG  I "O4'" 1 
ATOM   8394  C  "C3'" . DG  I 5 115 ? -3.426  42.104 -0.817  1.00 192.31 ? 42  DG  I "C3'" 1 
ATOM   8395  O  "O3'" . DG  I 5 115 ? -4.385  42.939 -0.133  1.00 193.51 ? 42  DG  I "O3'" 1 
ATOM   8396  C  "C2'" . DG  I 5 115 ? -3.276  42.505 -2.284  1.00 192.40 ? 42  DG  I "C2'" 1 
ATOM   8397  C  "C1'" . DG  I 5 115 ? -2.259  43.634 -2.188  1.00 192.63 ? 42  DG  I "C1'" 1 
ATOM   8398  N  N9    . DG  I 5 115 ? -1.496  43.864 -3.422  1.00 193.81 ? 42  DG  I N9    1 
ATOM   8399  C  C8    . DG  I 5 115 ? -0.988  42.912 -4.285  1.00 194.15 ? 42  DG  I C8    1 
ATOM   8400  N  N7    . DG  I 5 115 ? -0.369  43.417 -5.319  1.00 194.39 ? 42  DG  I N7    1 
ATOM   8401  C  C5    . DG  I 5 115 ? -0.460  44.792 -5.131  1.00 194.61 ? 42  DG  I C5    1 
ATOM   8402  C  C6    . DG  I 5 115 ? 0.036   45.862 -5.928  1.00 194.83 ? 42  DG  I C6    1 
ATOM   8403  O  O6    . DG  I 5 115 ? 0.671   45.795 -6.990  1.00 194.77 ? 42  DG  I O6    1 
ATOM   8404  N  N1    . DG  I 5 115 ? -0.270  47.114 -5.372  1.00 194.99 ? 42  DG  I N1    1 
ATOM   8405  C  C2    . DG  I 5 115 ? -0.968  47.305 -4.193  1.00 194.98 ? 42  DG  I C2    1 
ATOM   8406  N  N2    . DG  I 5 115 ? -1.184  48.577 -3.826  1.00 195.17 ? 42  DG  I N2    1 
ATOM   8407  N  N3    . DG  I 5 115 ? -1.446  46.313 -3.442  1.00 194.73 ? 42  DG  I N3    1 
ATOM   8408  C  C4    . DG  I 5 115 ? -1.155  45.085 -3.968  1.00 194.46 ? 42  DG  I C4    1 
ATOM   8409  P  P     . DG  I 5 116 ? -5.966  42.597 -0.131  1.00 194.31 ? 43  DG  I P     1 
ATOM   8410  O  OP1   . DG  I 5 116 ? -6.353  42.184 1.247   1.00 194.37 ? 43  DG  I OP1   1 
ATOM   8411  O  OP2   . DG  I 5 116 ? -6.261  41.705 -1.286  1.00 194.37 ? 43  DG  I OP2   1 
ATOM   8412  O  "O5'" . DG  I 5 116 ? -6.635  44.023 -0.438  1.00 194.04 ? 43  DG  I "O5'" 1 
ATOM   8413  C  "C5'" . DG  I 5 116 ? -6.227  45.192 0.288   1.00 193.32 ? 43  DG  I "C5'" 1 
ATOM   8414  C  "C4'" . DG  I 5 116 ? -6.052  46.375 -0.652  1.00 192.52 ? 43  DG  I "C4'" 1 
ATOM   8415  O  "O4'" . DG  I 5 116 ? -5.141  46.019 -1.723  1.00 192.35 ? 43  DG  I "O4'" 1 
ATOM   8416  C  "C3'" . DG  I 5 116 ? -7.341  46.857 -1.327  1.00 191.89 ? 43  DG  I "C3'" 1 
ATOM   8417  O  "O3'" . DG  I 5 116 ? -7.572  48.231 -1.022  1.00 191.17 ? 43  DG  I "O3'" 1 
ATOM   8418  C  "C2'" . DG  I 5 116 ? -7.099  46.628 -2.826  1.00 192.02 ? 43  DG  I "C2'" 1 
ATOM   8419  C  "C1'" . DG  I 5 116 ? -5.583  46.619 -2.912  1.00 192.17 ? 43  DG  I "C1'" 1 
ATOM   8420  N  N9    . DG  I 5 116 ? -5.058  45.865 -4.057  1.00 192.16 ? 43  DG  I N9    1 
ATOM   8421  C  C8    . DG  I 5 116 ? -5.178  44.511 -4.296  1.00 192.13 ? 43  DG  I C8    1 
ATOM   8422  N  N7    . DG  I 5 116 ? -4.610  44.122 -5.408  1.00 192.09 ? 43  DG  I N7    1 
ATOM   8423  C  C5    . DG  I 5 116 ? -4.107  45.295 -5.962  1.00 192.07 ? 43  DG  I C5    1 
ATOM   8424  C  C6    . DG  I 5 116 ? -3.385  45.508 -7.175  1.00 191.85 ? 43  DG  I C6    1 
ATOM   8425  O  O6    . DG  I 5 116 ? -3.058  44.674 -8.030  1.00 191.66 ? 43  DG  I O6    1 
ATOM   8426  N  N1    . DG  I 5 116 ? -3.072  46.863 -7.365  1.00 191.82 ? 43  DG  I N1    1 
ATOM   8427  C  C2    . DG  I 5 116 ? -3.407  47.880 -6.486  1.00 191.79 ? 43  DG  I C2    1 
ATOM   8428  N  N2    . DG  I 5 116 ? -3.011  49.114 -6.817  1.00 191.67 ? 43  DG  I N2    1 
ATOM   8429  N  N3    . DG  I 5 116 ? -4.066  47.691 -5.344  1.00 191.88 ? 43  DG  I N3    1 
ATOM   8430  C  C4    . DG  I 5 116 ? -4.387  46.380 -5.146  1.00 192.08 ? 43  DG  I C4    1 
ATOM   8431  P  P     . DG  I 5 117 ? -9.005  48.902 -1.303  1.00 190.42 ? 44  DG  I P     1 
ATOM   8432  O  OP1   . DG  I 5 117 ? -9.193  50.011 -0.331  1.00 190.22 ? 44  DG  I OP1   1 
ATOM   8433  O  OP2   . DG  I 5 117 ? -10.021 47.823 -1.397  1.00 190.51 ? 44  DG  I OP2   1 
ATOM   8434  O  "O5'" . DG  I 5 117 ? -8.816  49.515 -2.772  1.00 189.50 ? 44  DG  I "O5'" 1 
ATOM   8435  C  "C5'" . DG  I 5 117 ? -7.904  50.604 -2.993  1.00 188.28 ? 44  DG  I "C5'" 1 
ATOM   8436  C  "C4'" . DG  I 5 117 ? -7.784  50.933 -4.474  1.00 186.83 ? 44  DG  I "C4'" 1 
ATOM   8437  O  "O4'" . DG  I 5 117 ? -7.116  49.854 -5.148  1.00 186.53 ? 44  DG  I "O4'" 1 
ATOM   8438  C  "C3'" . DG  I 5 117 ? -9.112  51.148 -5.212  1.00 185.63 ? 44  DG  I "C3'" 1 
ATOM   8439  O  "O3'" . DG  I 5 117 ? -9.274  52.549 -5.538  1.00 184.05 ? 44  DG  I "O3'" 1 
ATOM   8440  C  "C2'" . DG  I 5 117 ? -9.014  50.260 -6.463  1.00 185.92 ? 44  DG  I "C2'" 1 
ATOM   8441  C  "C1'" . DG  I 5 117 ? -7.559  49.800 -6.473  1.00 186.35 ? 44  DG  I "C1'" 1 
ATOM   8442  N  N9    . DG  I 5 117 ? -7.379  48.431 -6.953  1.00 186.70 ? 44  DG  I N9    1 
ATOM   8443  C  C8    . DG  I 5 117 ? -7.865  47.274 -6.379  1.00 186.84 ? 44  DG  I C8    1 
ATOM   8444  N  N7    . DG  I 5 117 ? -7.527  46.188 -7.023  1.00 187.02 ? 44  DG  I N7    1 
ATOM   8445  C  C5    . DG  I 5 117 ? -6.749  46.649 -8.081  1.00 187.12 ? 44  DG  I C5    1 
ATOM   8446  C  C6    . DG  I 5 117 ? -6.094  45.931 -9.128  1.00 187.02 ? 44  DG  I C6    1 
ATOM   8447  O  O6    . DG  I 5 117 ? -6.061  44.704 -9.314  1.00 186.99 ? 44  DG  I O6    1 
ATOM   8448  N  N1    . DG  I 5 117 ? -5.408  46.790 -9.999  1.00 186.86 ? 44  DG  I N1    1 
ATOM   8449  C  C2    . DG  I 5 117 ? -5.373  48.168 -9.879  1.00 186.94 ? 44  DG  I C2    1 
ATOM   8450  N  N2    . DG  I 5 117 ? -4.669  48.830 -10.800 1.00 186.98 ? 44  DG  I N2    1 
ATOM   8451  N  N3    . DG  I 5 117 ? -5.980  48.848 -8.907  1.00 186.96 ? 44  DG  I N3    1 
ATOM   8452  C  C4    . DG  I 5 117 ? -6.649  48.031 -8.049  1.00 186.96 ? 44  DG  I C4    1 
ATOM   8453  P  P     . DT  I 5 118 ? -10.669 53.141 -6.105  1.00 182.07 ? 45  DT  I P     1 
ATOM   8454  O  OP1   . DT  I 5 118 ? -10.737 54.578 -5.732  1.00 181.67 ? 45  DT  I OP1   1 
ATOM   8455  O  OP2   . DT  I 5 118 ? -11.773 52.227 -5.722  1.00 182.30 ? 45  DT  I OP2   1 
ATOM   8456  O  "O5'" . DT  I 5 118 ? -10.470 53.024 -7.691  1.00 179.80 ? 45  DT  I "O5'" 1 
ATOM   8457  C  "C5'" . DT  I 5 118 ? -9.324  53.624 -8.308  1.00 177.17 ? 45  DT  I "C5'" 1 
ATOM   8458  C  "C4'" . DT  I 5 118 ? -9.083  53.058 -9.690  1.00 174.21 ? 45  DT  I "C4'" 1 
ATOM   8459  O  "O4'" . DT  I 5 118 ? -8.821  51.636 -9.600  1.00 174.06 ? 45  DT  I "O4'" 1 
ATOM   8460  C  "C3'" . DT  I 5 118 ? -10.247 53.227 -10.673 1.00 171.58 ? 45  DT  I "C3'" 1 
ATOM   8461  O  "O3'" . DT  I 5 118 ? -9.766  53.780 -11.891 1.00 167.84 ? 45  DT  I "O3'" 1 
ATOM   8462  C  "C2'" . DT  I 5 118 ? -10.752 51.795 -10.870 1.00 172.82 ? 45  DT  I "C2'" 1 
ATOM   8463  C  "C1'" . DT  I 5 118 ? -9.470  51.000 -10.666 1.00 174.20 ? 45  DT  I "C1'" 1 
ATOM   8464  N  N1    . DT  I 5 118 ? -9.667  49.537 -10.322 1.00 175.84 ? 45  DT  I N1    1 
ATOM   8465  C  C2    . DT  I 5 118 ? -8.871  48.577 -10.944 1.00 176.39 ? 45  DT  I C2    1 
ATOM   8466  O  O2    . DT  I 5 118 ? -8.006  48.844 -11.766 1.00 176.24 ? 45  DT  I O2    1 
ATOM   8467  N  N3    . DT  I 5 118 ? -9.126  47.279 -10.553 1.00 177.09 ? 45  DT  I N3    1 
ATOM   8468  C  C4    . DT  I 5 118 ? -10.072 46.846 -9.618  1.00 177.64 ? 45  DT  I C4    1 
ATOM   8469  O  O4    . DT  I 5 118 ? -10.174 45.640 -9.373  1.00 178.07 ? 45  DT  I O4    1 
ATOM   8470  C  C5    . DT  I 5 118 ? -10.873 47.901 -9.005  1.00 177.38 ? 45  DT  I C5    1 
ATOM   8471  C  C7    . DT  I 5 118 ? -11.932 47.567 -7.986  1.00 177.39 ? 45  DT  I C7    1 
ATOM   8472  C  C6    . DT  I 5 118 ? -10.635 49.175 -9.386  1.00 176.81 ? 45  DT  I C6    1 
ATOM   8473  P  P     . DT  I 5 119 ? -9.943  55.338 -12.216 1.00 164.00 ? 46  DT  I P     1 
ATOM   8474  O  OP1   . DT  I 5 119 ? -8.986  56.094 -11.372 1.00 163.71 ? 46  DT  I OP1   1 
ATOM   8475  O  OP2   . DT  I 5 119 ? -11.387 55.662 -12.165 1.00 163.91 ? 46  DT  I OP2   1 
ATOM   8476  O  "O5'" . DT  I 5 119 ? -9.476  55.416 -13.749 1.00 160.97 ? 46  DT  I "O5'" 1 
ATOM   8477  C  "C5'" . DT  I 5 119 ? -8.103  55.204 -14.096 1.00 158.17 ? 46  DT  I "C5'" 1 
ATOM   8478  C  "C4'" . DT  I 5 119 ? -7.941  54.030 -15.054 1.00 155.48 ? 46  DT  I "C4'" 1 
ATOM   8479  O  "O4'" . DT  I 5 119 ? -8.436  52.812 -14.443 1.00 155.27 ? 46  DT  I "O4'" 1 
ATOM   8480  C  "C3'" . DT  I 5 119 ? -8.664  54.166 -16.398 1.00 153.02 ? 46  DT  I "C3'" 1 
ATOM   8481  O  "O3'" . DT  I 5 119 ? -7.740  53.990 -17.466 1.00 149.44 ? 46  DT  I "O3'" 1 
ATOM   8482  C  "C2'" . DT  I 5 119 ? -9.704  53.044 -16.370 1.00 154.04 ? 46  DT  I "C2'" 1 
ATOM   8483  C  "C1'" . DT  I 5 119 ? -9.055  52.034 -15.433 1.00 155.12 ? 46  DT  I "C1'" 1 
ATOM   8484  N  N1    . DT  I 5 119 ? -10.034 51.078 -14.769 1.00 156.29 ? 46  DT  I N1    1 
ATOM   8485  C  C2    . DT  I 5 119 ? -9.666  49.746 -14.547 1.00 157.12 ? 46  DT  I C2    1 
ATOM   8486  O  O2    . DT  I 5 119 ? -8.566  49.282 -14.828 1.00 157.11 ? 46  DT  I O2    1 
ATOM   8487  N  N3    . DT  I 5 119 ? -10.643 48.976 -13.950 1.00 157.72 ? 46  DT  I N3    1 
ATOM   8488  C  C4    . DT  I 5 119 ? -11.924 49.383 -13.561 1.00 157.74 ? 46  DT  I C4    1 
ATOM   8489  O  O4    . DT  I 5 119 ? -12.686 48.565 -13.036 1.00 158.01 ? 46  DT  I O4    1 
ATOM   8490  C  C5    . DT  I 5 119 ? -12.245 50.778 -13.836 1.00 157.03 ? 46  DT  I C5    1 
ATOM   8491  C  C7    . DT  I 5 119 ? -13.589 51.339 -13.469 1.00 156.86 ? 46  DT  I C7    1 
ATOM   8492  C  C6    . DT  I 5 119 ? -11.298 51.544 -14.411 1.00 156.69 ? 46  DT  I C6    1 
ATOM   8493  P  P     . DA  I 5 120 ? -7.905  54.815 -18.830 1.00 146.08 ? 47  DA  I P     1 
ATOM   8494  O  OP1   . DA  I 5 120 ? -7.147  56.077 -18.693 1.00 145.93 ? 47  DA  I OP1   1 
ATOM   8495  O  OP2   . DA  I 5 120 ? -9.343  54.846 -19.184 1.00 145.83 ? 47  DA  I OP2   1 
ATOM   8496  O  "O5'" . DA  I 5 120 ? -7.170  53.894 -19.901 1.00 144.16 ? 47  DA  I "O5'" 1 
ATOM   8497  C  "C5'" . DA  I 5 120 ? -6.026  53.141 -19.528 1.00 142.16 ? 47  DA  I "C5'" 1 
ATOM   8498  C  "C4'" . DA  I 5 120 ? -6.213  51.663 -19.841 1.00 139.86 ? 47  DA  I "C4'" 1 
ATOM   8499  O  "O4'" . DA  I 5 120 ? -7.305  51.111 -19.066 1.00 139.79 ? 47  DA  I "O4'" 1 
ATOM   8500  C  "C3'" . DA  I 5 120 ? -6.516  51.323 -21.304 1.00 137.80 ? 47  DA  I "C3'" 1 
ATOM   8501  O  "O3'" . DA  I 5 120 ? -5.671  50.270 -21.707 1.00 134.84 ? 47  DA  I "O3'" 1 
ATOM   8502  C  "C2'" . DA  I 5 120 ? -7.981  50.879 -21.268 1.00 138.85 ? 47  DA  I "C2'" 1 
ATOM   8503  C  "C1'" . DA  I 5 120 ? -8.045  50.248 -19.893 1.00 140.05 ? 47  DA  I "C1'" 1 
ATOM   8504  N  N9    . DA  I 5 120 ? -9.390  50.104 -19.345 1.00 141.86 ? 47  DA  I N9    1 
ATOM   8505  C  C8    . DA  I 5 120 ? -10.279 51.108 -19.033 1.00 142.82 ? 47  DA  I C8    1 
ATOM   8506  N  N7    . DA  I 5 120 ? -11.378 50.687 -18.439 1.00 142.92 ? 47  DA  I N7    1 
ATOM   8507  C  C5    . DA  I 5 120 ? -11.202 49.312 -18.363 1.00 142.70 ? 47  DA  I C5    1 
ATOM   8508  C  C6    . DA  I 5 120 ? -12.012 48.268 -17.845 1.00 142.77 ? 47  DA  I C6    1 
ATOM   8509  N  N6    . DA  I 5 120 ? -13.218 48.463 -17.309 1.00 142.43 ? 47  DA  I N6    1 
ATOM   8510  N  N1    . DA  I 5 120 ? -11.530 47.007 -17.923 1.00 143.40 ? 47  DA  I N1    1 
ATOM   8511  C  C2    . DA  I 5 120 ? -10.316 46.803 -18.480 1.00 143.48 ? 47  DA  I C2    1 
ATOM   8512  N  N3    . DA  I 5 120 ? -9.459  47.701 -18.978 1.00 142.82 ? 47  DA  I N3    1 
ATOM   8513  C  C4    . DA  I 5 120 ? -9.971  48.942 -18.906 1.00 142.30 ? 47  DA  I C4    1 
ATOM   8514  P  P     . DG  I 5 121 ? -5.366  49.931 -23.246 1.00 131.71 ? 48  DG  I P     1 
ATOM   8515  O  OP1   . DG  I 5 121 ? -3.946  49.587 -23.348 1.00 130.91 ? 48  DG  I OP1   1 
ATOM   8516  O  OP2   . DG  I 5 121 ? -5.940  50.998 -24.068 1.00 131.67 ? 48  DG  I OP2   1 
ATOM   8517  O  "O5'" . DG  I 5 121 ? -6.303  48.674 -23.503 1.00 130.51 ? 48  DG  I "O5'" 1 
ATOM   8518  C  "C5'" . DG  I 5 121 ? -5.986  47.404 -22.910 1.00 129.25 ? 48  DG  I "C5'" 1 
ATOM   8519  C  "C4'" . DG  I 5 121 ? -7.002  46.363 -23.309 1.00 128.00 ? 48  DG  I "C4'" 1 
ATOM   8520  O  "O4'" . DG  I 5 121 ? -8.262  46.699 -22.692 1.00 128.18 ? 48  DG  I "O4'" 1 
ATOM   8521  C  "C3'" . DG  I 5 121 ? -7.292  46.277 -24.803 1.00 127.39 ? 48  DG  I "C3'" 1 
ATOM   8522  O  "O3'" . DG  I 5 121 ? -7.782  44.971 -25.111 1.00 126.80 ? 48  DG  I "O3'" 1 
ATOM   8523  C  "C2'" . DG  I 5 121 ? -8.481  47.201 -24.947 1.00 127.93 ? 48  DG  I "C2'" 1 
ATOM   8524  C  "C1'" . DG  I 5 121 ? -9.249  46.836 -23.695 1.00 128.95 ? 48  DG  I "C1'" 1 
ATOM   8525  N  N9    . DG  I 5 121 ? -10.219 47.825 -23.237 1.00 130.79 ? 48  DG  I N9    1 
ATOM   8526  C  C8    . DG  I 5 121 ? -10.279 49.150 -23.591 1.00 131.51 ? 48  DG  I C8    1 
ATOM   8527  N  N7    . DG  I 5 121 ? -11.254 49.793 -23.009 1.00 131.54 ? 48  DG  I N7    1 
ATOM   8528  C  C5    . DG  I 5 121 ? -11.878 48.833 -22.226 1.00 131.96 ? 48  DG  I C5    1 
ATOM   8529  C  C6    . DG  I 5 121 ? -13.004 48.940 -21.365 1.00 133.02 ? 48  DG  I C6    1 
ATOM   8530  O  O6    . DG  I 5 121 ? -13.694 49.934 -21.119 1.00 133.29 ? 48  DG  I O6    1 
ATOM   8531  N  N1    . DG  I 5 121 ? -13.311 47.721 -20.770 1.00 133.36 ? 48  DG  I N1    1 
ATOM   8532  C  C2    . DG  I 5 121 ? -12.616 46.553 -20.968 1.00 133.57 ? 48  DG  I C2    1 
ATOM   8533  N  N2    . DG  I 5 121 ? -13.058 45.486 -20.291 1.00 134.25 ? 48  DG  I N2    1 
ATOM   8534  N  N3    . DG  I 5 121 ? -11.564 46.441 -21.765 1.00 132.19 ? 48  DG  I N3    1 
ATOM   8535  C  C4    . DG  I 5 121 ? -11.253 47.612 -22.359 1.00 131.48 ? 48  DG  I C4    1 
ATOM   8536  P  P     . DG  I 5 122 ? -6.917  43.929 -25.937 1.00 126.35 ? 49  DG  I P     1 
ATOM   8537  O  OP1   . DG  I 5 122 ? -5.605  43.809 -25.301 1.00 125.32 ? 49  DG  I OP1   1 
ATOM   8538  O  OP2   . DG  I 5 122 ? -7.036  44.264 -27.354 1.00 125.83 ? 49  DG  I OP2   1 
ATOM   8539  O  "O5'" . DG  I 5 122 ? -7.682  42.563 -25.687 1.00 129.21 ? 49  DG  I "O5'" 1 
ATOM   8540  C  "C5'" . DG  I 5 122 ? -7.851  42.053 -24.354 1.00 132.31 ? 49  DG  I "C5'" 1 
ATOM   8541  C  "C4'" . DG  I 5 122 ? -9.132  41.259 -24.259 1.00 135.54 ? 49  DG  I "C4'" 1 
ATOM   8542  O  "O4'" . DG  I 5 122 ? -10.218 42.151 -23.920 1.00 136.44 ? 49  DG  I "O4'" 1 
ATOM   8543  C  "C3'" . DG  I 5 122 ? -9.555  40.584 -25.560 1.00 138.56 ? 49  DG  I "C3'" 1 
ATOM   8544  O  "O3'" . DG  I 5 122 ? -10.357 39.447 -25.256 1.00 142.50 ? 49  DG  I "O3'" 1 
ATOM   8545  C  "C2'" . DG  I 5 122 ? -10.489 41.607 -26.166 1.00 138.00 ? 49  DG  I "C2'" 1 
ATOM   8546  C  "C1'" . DG  I 5 122 ? -11.211 42.080 -24.928 1.00 137.63 ? 49  DG  I "C1'" 1 
ATOM   8547  N  N9    . DG  I 5 122 ? -11.805 43.400 -25.065 1.00 138.44 ? 49  DG  I N9    1 
ATOM   8548  C  C8    . DG  I 5 122 ? -11.453 44.375 -25.965 1.00 138.93 ? 49  DG  I C8    1 
ATOM   8549  N  N7    . DG  I 5 122 ? -12.171 45.458 -25.854 1.00 139.44 ? 49  DG  I N7    1 
ATOM   8550  C  C5    . DG  I 5 122 ? -13.059 45.176 -24.826 1.00 139.62 ? 49  DG  I C5    1 
ATOM   8551  C  C6    . DG  I 5 122 ? -14.080 45.977 -24.247 1.00 139.89 ? 49  DG  I C6    1 
ATOM   8552  O  O6    . DG  I 5 122 ? -14.426 47.121 -24.555 1.00 139.64 ? 49  DG  I O6    1 
ATOM   8553  N  N1    . DG  I 5 122 ? -14.753 45.298 -23.238 1.00 140.28 ? 49  DG  I N1    1 
ATOM   8554  C  C2    . DG  I 5 122 ? -14.468 44.019 -22.825 1.00 140.28 ? 49  DG  I C2    1 
ATOM   8555  N  N2    . DG  I 5 122 ? -15.219 43.541 -21.825 1.00 140.54 ? 49  DG  I N2    1 
ATOM   8556  N  N3    . DG  I 5 122 ? -13.511 43.268 -23.347 1.00 139.67 ? 49  DG  I N3    1 
ATOM   8557  C  C4    . DG  I 5 122 ? -12.849 43.906 -24.334 1.00 139.27 ? 49  DG  I C4    1 
ATOM   8558  P  P     . DG  I 5 123 ? -10.468 38.238 -26.272 1.00 146.09 ? 50  DG  I P     1 
ATOM   8559  O  OP1   . DG  I 5 123 ? -9.471  37.237 -25.872 1.00 146.25 ? 50  DG  I OP1   1 
ATOM   8560  O  OP2   . DG  I 5 123 ? -10.466 38.758 -27.650 1.00 146.03 ? 50  DG  I OP2   1 
ATOM   8561  O  "O5'" . DG  I 5 123 ? -11.944 37.716 -26.011 1.00 149.58 ? 50  DG  I "O5'" 1 
ATOM   8562  C  "C5'" . DG  I 5 123 ? -12.632 38.066 -24.803 1.00 153.13 ? 50  DG  I "C5'" 1 
ATOM   8563  C  "C4'" . DG  I 5 123 ? -14.062 38.464 -25.085 1.00 157.13 ? 50  DG  I "C4'" 1 
ATOM   8564  O  "O4'" . DG  I 5 123 ? -14.140 39.891 -25.304 1.00 158.38 ? 50  DG  I "O4'" 1 
ATOM   8565  C  "C3'" . DG  I 5 123 ? -14.737 37.808 -26.298 1.00 160.00 ? 50  DG  I "C3'" 1 
ATOM   8566  O  "O3'" . DG  I 5 123 ? -15.998 37.270 -25.864 1.00 162.97 ? 50  DG  I "O3'" 1 
ATOM   8567  C  "C2'" . DG  I 5 123 ? -14.931 38.971 -27.258 1.00 159.91 ? 50  DG  I "C2'" 1 
ATOM   8568  C  "C1'" . DG  I 5 123 ? -15.114 40.111 -26.292 1.00 159.80 ? 50  DG  I "C1'" 1 
ATOM   8569  N  N9    . DG  I 5 123 ? -14.923 41.449 -26.836 1.00 161.30 ? 50  DG  I N9    1 
ATOM   8570  C  C8    . DG  I 5 123 ? -14.081 41.831 -27.852 1.00 162.04 ? 50  DG  I C8    1 
ATOM   8571  N  N7    . DG  I 5 123 ? -14.161 43.103 -28.132 1.00 162.44 ? 50  DG  I N7    1 
ATOM   8572  C  C5    . DG  I 5 123 ? -15.114 43.589 -27.249 1.00 162.66 ? 50  DG  I C5    1 
ATOM   8573  C  C6    . DG  I 5 123 ? -15.621 44.905 -27.074 1.00 163.31 ? 50  DG  I C6    1 
ATOM   8574  O  O6    . DG  I 5 123 ? -15.314 45.936 -27.682 1.00 163.68 ? 50  DG  I O6    1 
ATOM   8575  N  N1    . DG  I 5 123 ? -16.571 44.958 -26.060 1.00 163.29 ? 50  DG  I N1    1 
ATOM   8576  C  C2    . DG  I 5 123 ? -16.982 43.882 -25.312 1.00 163.00 ? 50  DG  I C2    1 
ATOM   8577  N  N2    . DG  I 5 123 ? -17.913 44.130 -24.382 1.00 163.11 ? 50  DG  I N2    1 
ATOM   8578  N  N3    . DG  I 5 123 ? -16.520 42.652 -25.467 1.00 162.46 ? 50  DG  I N3    1 
ATOM   8579  C  C4    . DG  I 5 123 ? -15.596 42.579 -26.446 1.00 162.09 ? 50  DG  I C4    1 
ATOM   8580  P  P     . DT  I 5 124 ? -16.898 36.347 -26.815 1.00 165.61 ? 51  DT  I P     1 
ATOM   8581  O  OP1   . DT  I 5 124 ? -17.337 35.179 -26.013 1.00 165.92 ? 51  DT  I OP1   1 
ATOM   8582  O  OP2   . DT  I 5 124 ? -16.162 36.124 -28.087 1.00 165.81 ? 51  DT  I OP2   1 
ATOM   8583  O  "O5'" . DT  I 5 124 ? -18.166 37.281 -27.129 1.00 167.27 ? 51  DT  I "O5'" 1 
ATOM   8584  C  "C5'" . DT  I 5 124 ? -19.206 37.390 -26.176 1.00 169.12 ? 51  DT  I "C5'" 1 
ATOM   8585  C  "C4'" . DT  I 5 124 ? -19.883 38.747 -26.225 1.00 171.24 ? 51  DT  I "C4'" 1 
ATOM   8586  O  "O4'" . DT  I 5 124 ? -18.929 39.808 -26.429 1.00 171.42 ? 51  DT  I "O4'" 1 
ATOM   8587  C  "C3'" . DT  I 5 124 ? -20.862 38.963 -27.353 1.00 173.18 ? 51  DT  I "C3'" 1 
ATOM   8588  O  "O3'" . DT  I 5 124 ? -22.088 38.261 -27.107 1.00 175.33 ? 51  DT  I "O3'" 1 
ATOM   8589  C  "C2'" . DT  I 5 124 ? -21.055 40.475 -27.267 1.00 172.61 ? 51  DT  I "C2'" 1 
ATOM   8590  C  "C1'" . DT  I 5 124 ? -19.662 40.960 -26.840 1.00 171.80 ? 51  DT  I "C1'" 1 
ATOM   8591  N  N1    . DT  I 5 124 ? -18.928 41.693 -27.936 1.00 171.43 ? 51  DT  I N1    1 
ATOM   8592  C  C2    . DT  I 5 124 ? -19.323 42.985 -28.269 1.00 171.18 ? 51  DT  I C2    1 
ATOM   8593  O  O2    . DT  I 5 124 ? -20.194 43.602 -27.674 1.00 170.88 ? 51  DT  I O2    1 
ATOM   8594  N  N3    . DT  I 5 124 ? -18.592 43.564 -29.275 1.00 171.38 ? 51  DT  I N3    1 
ATOM   8595  C  C4    . DT  I 5 124 ? -17.560 42.989 -30.003 1.00 171.59 ? 51  DT  I C4    1 
ATOM   8596  O  O4    . DT  I 5 124 ? -17.011 43.642 -30.887 1.00 171.82 ? 51  DT  I O4    1 
ATOM   8597  C  C5    . DT  I 5 124 ? -17.229 41.621 -29.642 1.00 171.57 ? 51  DT  I C5    1 
ATOM   8598  C  C7    . DT  I 5 124 ? -16.142 40.885 -30.374 1.00 171.65 ? 51  DT  I C7    1 
ATOM   8599  C  C6    . DT  I 5 124 ? -17.937 41.039 -28.653 1.00 171.48 ? 51  DT  I C6    1 
ATOM   8600  P  P     . DT  I 5 125 ? -23.017 37.785 -28.333 1.00 177.00 ? 52  DT  I P     1 
ATOM   8601  O  OP1   . DT  I 5 125 ? -24.144 37.004 -27.764 1.00 177.53 ? 52  DT  I OP1   1 
ATOM   8602  O  OP2   . DT  I 5 125 ? -22.144 37.169 -29.368 1.00 176.84 ? 52  DT  I OP2   1 
ATOM   8603  O  "O5'" . DT  I 5 125 ? -23.593 39.169 -28.919 1.00 177.56 ? 52  DT  I "O5'" 1 
ATOM   8604  C  "C5'" . DT  I 5 125 ? -24.573 39.910 -28.182 1.00 178.12 ? 52  DT  I "C5'" 1 
ATOM   8605  C  "C4'" . DT  I 5 125 ? -24.826 41.270 -28.811 1.00 178.85 ? 52  DT  I "C4'" 1 
ATOM   8606  O  "O4'" . DT  I 5 125 ? -23.565 41.931 -29.108 1.00 178.91 ? 52  DT  I "O4'" 1 
ATOM   8607  C  "C3'" . DT  I 5 125 ? -25.615 41.249 -30.133 1.00 179.60 ? 52  DT  I "C3'" 1 
ATOM   8608  O  "O3'" . DT  I 5 125 ? -26.807 42.053 -30.019 1.00 180.56 ? 52  DT  I "O3'" 1 
ATOM   8609  C  "C2'" . DT  I 5 125 ? -24.634 41.840 -31.149 1.00 179.36 ? 52  DT  I "C2'" 1 
ATOM   8610  C  "C1'" . DT  I 5 125 ? -23.761 42.703 -30.259 1.00 179.13 ? 52  DT  I "C1'" 1 
ATOM   8611  N  N1    . DT  I 5 125 ? -22.438 43.075 -30.878 1.00 179.15 ? 52  DT  I N1    1 
ATOM   8612  C  C2    . DT  I 5 125 ? -22.167 44.413 -31.138 1.00 179.25 ? 52  DT  I C2    1 
ATOM   8613  O  O2    . DT  I 5 125 ? -22.897 45.333 -30.793 1.00 179.35 ? 52  DT  I O2    1 
ATOM   8614  N  N3    . DT  I 5 125 ? -20.969 44.641 -31.774 1.00 179.25 ? 52  DT  I N3    1 
ATOM   8615  C  C4    . DT  I 5 125 ? -20.051 43.690 -32.206 1.00 179.26 ? 52  DT  I C4    1 
ATOM   8616  O  O4    . DT  I 5 125 ? -19.027 44.061 -32.778 1.00 179.27 ? 52  DT  I O4    1 
ATOM   8617  C  C5    . DT  I 5 125 ? -20.418 42.305 -31.946 1.00 179.18 ? 52  DT  I C5    1 
ATOM   8618  C  C7    . DT  I 5 125 ? -19.524 41.182 -32.384 1.00 179.12 ? 52  DT  I C7    1 
ATOM   8619  C  C6    . DT  I 5 125 ? -21.580 42.070 -31.309 1.00 179.18 ? 52  DT  I C6    1 
ATOM   8620  P  P     . DA  I 5 126 ? -28.049 41.943 -31.041 1.00 181.42 ? 53  DA  I P     1 
ATOM   8621  O  OP1   . DA  I 5 126 ? -29.284 42.104 -30.253 1.00 181.59 ? 53  DA  I OP1   1 
ATOM   8622  O  OP2   . DA  I 5 126 ? -27.854 40.729 -31.859 1.00 181.41 ? 53  DA  I OP2   1 
ATOM   8623  O  "O5'" . DA  I 5 126 ? -27.790 43.220 -31.954 1.00 181.96 ? 53  DA  I "O5'" 1 
ATOM   8624  C  "C5'" . DA  I 5 126 ? -27.168 44.361 -31.339 1.00 182.71 ? 53  DA  I "C5'" 1 
ATOM   8625  C  "C4'" . DA  I 5 126 ? -26.791 45.413 -32.354 1.00 183.59 ? 53  DA  I "C4'" 1 
ATOM   8626  O  "O4'" . DA  I 5 126 ? -25.373 45.316 -32.633 1.00 183.98 ? 53  DA  I "O4'" 1 
ATOM   8627  C  "C3'" . DA  I 5 126 ? -27.484 45.308 -33.713 1.00 184.12 ? 53  DA  I "C3'" 1 
ATOM   8628  O  "O3'" . DA  I 5 126 ? -27.525 46.622 -34.293 1.00 184.57 ? 53  DA  I "O3'" 1 
ATOM   8629  C  "C2'" . DA  I 5 126 ? -26.464 44.540 -34.525 1.00 184.24 ? 53  DA  I "C2'" 1 
ATOM   8630  C  "C1'" . DA  I 5 126 ? -25.214 45.248 -34.039 1.00 184.24 ? 53  DA  I "C1'" 1 
ATOM   8631  N  N9    . DA  I 5 126 ? -23.936 44.602 -34.329 1.00 184.27 ? 53  DA  I N9    1 
ATOM   8632  C  C8    . DA  I 5 126 ? -23.570 43.297 -34.123 1.00 184.28 ? 53  DA  I C8    1 
ATOM   8633  N  N7    . DA  I 5 126 ? -22.349 43.023 -34.512 1.00 184.32 ? 53  DA  I N7    1 
ATOM   8634  C  C5    . DA  I 5 126 ? -21.881 44.229 -35.013 1.00 184.45 ? 53  DA  I C5    1 
ATOM   8635  C  C6    . DA  I 5 126 ? -20.647 44.607 -35.564 1.00 184.70 ? 53  DA  I C6    1 
ATOM   8636  N  N6    . DA  I 5 126 ? -19.618 43.772 -35.723 1.00 184.58 ? 53  DA  I N6    1 
ATOM   8637  N  N1    . DA  I 5 126 ? -20.503 45.892 -35.956 1.00 184.92 ? 53  DA  I N1    1 
ATOM   8638  C  C2    . DA  I 5 126 ? -21.532 46.731 -35.791 1.00 184.81 ? 53  DA  I C2    1 
ATOM   8639  N  N3    . DA  I 5 126 ? -22.738 46.493 -35.284 1.00 184.61 ? 53  DA  I N3    1 
ATOM   8640  C  C4    . DA  I 5 126 ? -22.849 45.209 -34.907 1.00 184.38 ? 53  DA  I C4    1 
ATOM   8641  P  P     . DG  I 5 127 ? -28.830 47.142 -35.059 1.00 185.07 ? 54  DG  I P     1 
ATOM   8642  O  OP1   . DG  I 5 127 ? -29.757 47.678 -34.043 1.00 185.30 ? 54  DG  I OP1   1 
ATOM   8643  O  OP2   . DG  I 5 127 ? -29.279 46.088 -35.988 1.00 185.03 ? 54  DG  I OP2   1 
ATOM   8644  O  "O5'" . DG  I 5 127 ? -28.282 48.320 -35.975 1.00 185.15 ? 54  DG  I "O5'" 1 
ATOM   8645  C  "C5'" . DG  I 5 127 ? -28.516 49.700 -35.648 1.00 185.12 ? 54  DG  I "C5'" 1 
ATOM   8646  C  "C4'" . DG  I 5 127 ? -27.674 50.587 -36.534 1.00 185.04 ? 54  DG  I "C4'" 1 
ATOM   8647  O  "O4'" . DG  I 5 127 ? -26.367 49.986 -36.685 1.00 185.08 ? 54  DG  I "O4'" 1 
ATOM   8648  C  "C3'" . DG  I 5 127 ? -28.197 50.733 -37.957 1.00 184.79 ? 54  DG  I "C3'" 1 
ATOM   8649  O  "O3'" . DG  I 5 127 ? -27.767 52.025 -38.412 1.00 184.29 ? 54  DG  I "O3'" 1 
ATOM   8650  C  "C2'" . DG  I 5 127 ? -27.606 49.505 -38.623 1.00 184.86 ? 54  DG  I "C2'" 1 
ATOM   8651  C  "C1'" . DG  I 5 127 ? -26.228 49.447 -37.997 1.00 185.00 ? 54  DG  I "C1'" 1 
ATOM   8652  N  N9    . DG  I 5 127 ? -25.699 48.094 -37.876 1.00 185.09 ? 54  DG  I N9    1 
ATOM   8653  C  C8    . DG  I 5 127 ? -26.298 47.025 -37.256 1.00 185.29 ? 54  DG  I C8    1 
ATOM   8654  N  N7    . DG  I 5 127 ? -25.588 45.932 -37.318 1.00 185.22 ? 54  DG  I N7    1 
ATOM   8655  C  C5    . DG  I 5 127 ? -24.456 46.299 -38.029 1.00 184.90 ? 54  DG  I C5    1 
ATOM   8656  C  C6    . DG  I 5 127 ? -23.323 45.532 -38.410 1.00 184.44 ? 54  DG  I C6    1 
ATOM   8657  O  O6    . DG  I 5 127 ? -23.087 44.341 -38.179 1.00 184.00 ? 54  DG  I O6    1 
ATOM   8658  N  N1    . DG  I 5 127 ? -22.400 46.298 -39.114 1.00 184.68 ? 54  DG  I N1    1 
ATOM   8659  C  C2    . DG  I 5 127 ? -22.548 47.631 -39.410 1.00 184.99 ? 54  DG  I C2    1 
ATOM   8660  N  N2    . DG  I 5 127 ? -21.553 48.194 -40.107 1.00 185.12 ? 54  DG  I N2    1 
ATOM   8661  N  N3    . DG  I 5 127 ? -23.605 48.354 -39.072 1.00 185.03 ? 54  DG  I N3    1 
ATOM   8662  C  C4    . DG  I 5 127 ? -24.512 47.630 -38.385 1.00 185.04 ? 54  DG  I C4    1 
ATOM   8663  P  P     . DG  I 5 128 ? -27.753 52.589 -39.984 1.00 183.50 ? 55  DG  I P     1 
ATOM   8664  O  OP1   . DG  I 5 128 ? -27.937 54.053 -39.949 1.00 183.50 ? 55  DG  I OP1   1 
ATOM   8665  O  OP2   . DG  I 5 128 ? -28.644 51.730 -40.798 1.00 183.56 ? 55  DG  I OP2   1 
ATOM   8666  O  "O5'" . DG  I 5 128 ? -26.265 52.273 -40.454 1.00 182.05 ? 55  DG  I "O5'" 1 
ATOM   8667  C  "C5'" . DG  I 5 128 ? -25.193 53.201 -40.201 1.00 180.32 ? 55  DG  I "C5'" 1 
ATOM   8668  C  "C4'" . DG  I 5 128 ? -24.108 53.029 -41.237 1.00 178.51 ? 55  DG  I "C4'" 1 
ATOM   8669  O  "O4'" . DG  I 5 128 ? -23.712 51.640 -41.266 1.00 178.29 ? 55  DG  I "O4'" 1 
ATOM   8670  C  "C3'" . DG  I 5 128 ? -24.541 53.350 -42.662 1.00 176.88 ? 55  DG  I "C3'" 1 
ATOM   8671  O  "O3'" . DG  I 5 128 ? -23.398 53.677 -43.447 1.00 174.56 ? 55  DG  I "O3'" 1 
ATOM   8672  C  "C2'" . DG  I 5 128 ? -25.075 52.019 -43.148 1.00 177.56 ? 55  DG  I "C2'" 1 
ATOM   8673  C  "C1'" . DG  I 5 128 ? -24.124 51.035 -42.485 1.00 178.27 ? 55  DG  I "C1'" 1 
ATOM   8674  N  N9    . DG  I 5 128 ? -24.717 49.746 -42.156 1.00 179.07 ? 55  DG  I N9    1 
ATOM   8675  C  C8    . DG  I 5 128 ? -25.939 49.532 -41.569 1.00 179.38 ? 55  DG  I C8    1 
ATOM   8676  N  N7    . DG  I 5 128 ? -26.189 48.271 -41.349 1.00 179.68 ? 55  DG  I N7    1 
ATOM   8677  C  C5    . DG  I 5 128 ? -25.075 47.609 -41.846 1.00 180.01 ? 55  DG  I C5    1 
ATOM   8678  C  C6    . DG  I 5 128 ? -24.761 46.221 -41.864 1.00 180.56 ? 55  DG  I C6    1 
ATOM   8679  O  O6    . DG  I 5 128 ? -25.451 45.271 -41.482 1.00 180.87 ? 55  DG  I O6    1 
ATOM   8680  N  N1    . DG  I 5 128 ? -23.511 45.986 -42.428 1.00 180.31 ? 55  DG  I N1    1 
ATOM   8681  C  C2    . DG  I 5 128 ? -22.665 46.960 -42.898 1.00 179.85 ? 55  DG  I C2    1 
ATOM   8682  N  N2    . DG  I 5 128 ? -21.503 46.535 -43.402 1.00 179.38 ? 55  DG  I N2    1 
ATOM   8683  N  N3    . DG  I 5 128 ? -22.935 48.256 -42.865 1.00 179.85 ? 55  DG  I N3    1 
ATOM   8684  C  C4    . DG  I 5 128 ? -24.147 48.508 -42.326 1.00 179.65 ? 55  DG  I C4    1 
ATOM   8685  P  P     . DG  I 5 129 ? -23.102 55.184 -43.832 1.00 171.84 ? 56  DG  I P     1 
ATOM   8686  O  OP1   . DG  I 5 129 ? -22.921 55.941 -42.576 1.00 171.82 ? 56  DG  I OP1   1 
ATOM   8687  O  OP2   . DG  I 5 129 ? -24.116 55.605 -44.816 1.00 171.94 ? 56  DG  I OP2   1 
ATOM   8688  O  "O5'" . DG  I 5 129 ? -21.704 55.099 -44.586 1.00 168.48 ? 56  DG  I "O5'" 1 
ATOM   8689  C  "C5'" . DG  I 5 129 ? -20.527 54.669 -43.880 1.00 164.88 ? 56  DG  I "C5'" 1 
ATOM   8690  C  "C4'" . DG  I 5 129 ? -19.876 53.488 -44.563 1.00 161.25 ? 56  DG  I "C4'" 1 
ATOM   8691  O  "O4'" . DG  I 5 129 ? -20.708 52.312 -44.471 1.00 160.46 ? 56  DG  I "O4'" 1 
ATOM   8692  C  "C3'" . DG  I 5 129 ? -19.566 53.679 -46.049 1.00 158.45 ? 56  DG  I "C3'" 1 
ATOM   8693  O  "O3'" . DG  I 5 129 ? -18.171 53.468 -46.213 1.00 155.03 ? 56  DG  I "O3'" 1 
ATOM   8694  C  "C2'" . DG  I 5 129 ? -20.352 52.576 -46.737 1.00 159.21 ? 56  DG  I "C2'" 1 
ATOM   8695  C  "C1'" . DG  I 5 129 ? -20.506 51.552 -45.639 1.00 160.02 ? 56  DG  I "C1'" 1 
ATOM   8696  N  N9    . DG  I 5 129 ? -21.636 50.640 -45.783 1.00 160.67 ? 56  DG  I N9    1 
ATOM   8697  C  C8    . DG  I 5 129 ? -22.968 50.954 -45.669 1.00 160.79 ? 56  DG  I C8    1 
ATOM   8698  N  N7    . DG  I 5 129 ? -23.752 49.921 -45.811 1.00 160.99 ? 56  DG  I N7    1 
ATOM   8699  C  C5    . DG  I 5 129 ? -22.888 48.863 -46.055 1.00 161.03 ? 56  DG  I C5    1 
ATOM   8700  C  C6    . DG  I 5 129 ? -23.159 47.488 -46.298 1.00 161.14 ? 56  DG  I C6    1 
ATOM   8701  O  O6    . DG  I 5 129 ? -24.253 46.918 -46.365 1.00 161.43 ? 56  DG  I O6    1 
ATOM   8702  N  N1    . DG  I 5 129 ? -21.991 46.760 -46.482 1.00 160.94 ? 56  DG  I N1    1 
ATOM   8703  C  C2    . DG  I 5 129 ? -20.724 47.284 -46.451 1.00 160.86 ? 56  DG  I C2    1 
ATOM   8704  N  N2    . DG  I 5 129 ? -19.725 46.411 -46.632 1.00 160.60 ? 56  DG  I N2    1 
ATOM   8705  N  N3    . DG  I 5 129 ? -20.455 48.562 -46.222 1.00 161.06 ? 56  DG  I N3    1 
ATOM   8706  C  C4    . DG  I 5 129 ? -21.577 49.289 -46.035 1.00 160.97 ? 56  DG  I C4    1 
ATOM   8707  P  P     . DT  I 5 130 ? -17.394 54.147 -47.401 1.00 151.30 ? 57  DT  I P     1 
ATOM   8708  O  OP1   . DT  I 5 130 ? -16.935 55.463 -46.953 1.00 151.58 ? 57  DT  I OP1   1 
ATOM   8709  O  OP2   . DT  I 5 130 ? -18.185 54.016 -48.629 1.00 150.41 ? 57  DT  I OP2   1 
ATOM   8710  O  "O5'" . DT  I 5 130 ? -16.070 53.283 -47.486 1.00 148.68 ? 57  DT  I "O5'" 1 
ATOM   8711  C  "C5'" . DT  I 5 130 ? -15.746 52.369 -46.423 1.00 146.31 ? 57  DT  I "C5'" 1 
ATOM   8712  C  "C4'" . DT  I 5 130 ? -15.530 50.985 -46.988 1.00 143.96 ? 57  DT  I "C4'" 1 
ATOM   8713  O  "O4'" . DT  I 5 130 ? -16.811 50.343 -47.173 1.00 143.29 ? 57  DT  I "O4'" 1 
ATOM   8714  C  "C3'" . DT  I 5 130 ? -14.845 50.981 -48.357 1.00 141.92 ? 57  DT  I "C3'" 1 
ATOM   8715  O  "O3'" . DT  I 5 130 ? -13.743 50.072 -48.322 1.00 138.96 ? 57  DT  I "O3'" 1 
ATOM   8716  C  "C2'" . DT  I 5 130 ? -15.958 50.595 -49.314 1.00 142.36 ? 57  DT  I "C2'" 1 
ATOM   8717  C  "C1'" . DT  I 5 130 ? -16.828 49.731 -48.443 1.00 143.11 ? 57  DT  I "C1'" 1 
ATOM   8718  N  N1    . DT  I 5 130 ? -18.219 49.639 -48.892 1.00 143.92 ? 57  DT  I N1    1 
ATOM   8719  C  C2    . DT  I 5 130 ? -18.773 48.385 -49.004 1.00 144.42 ? 57  DT  I C2    1 
ATOM   8720  O  O2    . DT  I 5 130 ? -18.175 47.364 -48.710 1.00 144.02 ? 57  DT  I O2    1 
ATOM   8721  N  N3    . DT  I 5 130 ? -20.073 48.372 -49.438 1.00 144.90 ? 57  DT  I N3    1 
ATOM   8722  C  C4    . DT  I 5 130 ? -20.849 49.460 -49.782 1.00 145.31 ? 57  DT  I C4    1 
ATOM   8723  O  O4    . DT  I 5 130 ? -22.002 49.291 -50.162 1.00 146.19 ? 57  DT  I O4    1 
ATOM   8724  C  C5    . DT  I 5 130 ? -20.198 50.743 -49.660 1.00 144.48 ? 57  DT  I C5    1 
ATOM   8725  C  C7    . DT  I 5 130 ? -20.955 51.980 -50.024 1.00 144.32 ? 57  DT  I C7    1 
ATOM   8726  C  C6    . DT  I 5 130 ? -18.928 50.767 -49.237 1.00 143.99 ? 57  DT  I C6    1 
ATOM   8727  P  P     . DT  I 5 131 ? -12.751 49.941 -49.550 1.00 137.53 ? 58  DT  I P     1 
ATOM   8728  O  OP1   . DT  I 5 131 ? -11.393 49.812 -49.003 1.00 137.08 ? 58  DT  I OP1   1 
ATOM   8729  O  OP2   . DT  I 5 131 ? -13.031 50.997 -50.545 1.00 137.97 ? 58  DT  I OP2   1 
ATOM   8730  O  "O5'" . DT  I 5 131 ? -13.197 48.545 -50.188 1.00 139.02 ? 58  DT  I "O5'" 1 
ATOM   8731  C  "C5'" . DT  I 5 131 ? -13.205 47.363 -49.368 1.00 140.30 ? 58  DT  I "C5'" 1 
ATOM   8732  C  "C4'" . DT  I 5 131 ? -14.159 46.314 -49.901 1.00 141.22 ? 58  DT  I "C4'" 1 
ATOM   8733  O  "O4'" . DT  I 5 131 ? -15.488 46.859 -50.061 1.00 141.16 ? 58  DT  I "O4'" 1 
ATOM   8734  C  "C3'" . DT  I 5 131 ? -13.770 45.708 -51.246 1.00 142.62 ? 58  DT  I "C3'" 1 
ATOM   8735  O  "O3'" . DT  I 5 131 ? -13.635 44.303 -51.092 1.00 144.46 ? 58  DT  I "O3'" 1 
ATOM   8736  C  "C2'" . DT  I 5 131 ? -14.936 46.073 -52.173 1.00 141.95 ? 58  DT  I "C2'" 1 
ATOM   8737  C  "C1'" . DT  I 5 131 ? -16.073 46.269 -51.186 1.00 141.67 ? 58  DT  I "C1'" 1 
ATOM   8738  N  N1    . DT  I 5 131 ? -17.166 47.144 -51.693 1.00 142.64 ? 58  DT  I N1    1 
ATOM   8739  C  C2    . DT  I 5 131 ? -18.430 46.609 -51.868 1.00 143.08 ? 58  DT  I C2    1 
ATOM   8740  O  O2    . DT  I 5 131 ? -18.719 45.458 -51.581 1.00 142.88 ? 58  DT  I O2    1 
ATOM   8741  N  N3    . DT  I 5 131 ? -19.356 47.482 -52.393 1.00 143.86 ? 58  DT  I N3    1 
ATOM   8742  C  C4    . DT  I 5 131 ? -19.156 48.821 -52.740 1.00 144.85 ? 58  DT  I C4    1 
ATOM   8743  O  O4    . DT  I 5 131 ? -20.100 49.485 -53.176 1.00 145.73 ? 58  DT  I O4    1 
ATOM   8744  C  C5    . DT  I 5 131 ? -17.805 49.324 -52.530 1.00 144.30 ? 58  DT  I C5    1 
ATOM   8745  C  C7    . DT  I 5 131 ? -17.463 50.758 -52.863 1.00 143.91 ? 58  DT  I C7    1 
ATOM   8746  C  C6    . DT  I 5 131 ? -16.883 48.465 -52.043 1.00 143.54 ? 58  DT  I C6    1 
ATOM   8747  P  P     . DA  I 5 132 ? -12.750 43.431 -52.099 1.00 146.49 ? 59  DA  I P     1 
ATOM   8748  O  OP1   . DA  I 5 132 ? -11.785 42.657 -51.291 1.00 146.01 ? 59  DA  I OP1   1 
ATOM   8749  O  OP2   . DA  I 5 132 ? -12.260 44.307 -53.196 1.00 146.14 ? 59  DA  I OP2   1 
ATOM   8750  O  "O5'" . DA  I 5 132 ? -13.845 42.429 -52.703 1.00 149.65 ? 59  DA  I "O5'" 1 
ATOM   8751  C  "C5'" . DA  I 5 132 ? -14.915 41.967 -51.864 1.00 152.46 ? 59  DA  I "C5'" 1 
ATOM   8752  C  "C4'" . DA  I 5 132 ? -16.211 41.757 -52.637 1.00 155.20 ? 59  DA  I "C4'" 1 
ATOM   8753  O  "O4'" . DA  I 5 132 ? -16.854 43.012 -52.954 1.00 155.63 ? 59  DA  I "O4'" 1 
ATOM   8754  C  "C3'" . DA  I 5 132 ? -16.098 40.993 -53.960 1.00 157.57 ? 59  DA  I "C3'" 1 
ATOM   8755  O  "O3'" . DA  I 5 132 ? -16.803 39.753 -53.833 1.00 160.69 ? 59  DA  I "O3'" 1 
ATOM   8756  C  "C2'" . DA  I 5 132 ? -16.762 41.933 -54.988 1.00 156.85 ? 59  DA  I "C2'" 1 
ATOM   8757  C  "C1'" . DA  I 5 132 ? -17.635 42.781 -54.089 1.00 156.38 ? 59  DA  I "C1'" 1 
ATOM   8758  N  N9    . DA  I 5 132 ? -18.068 44.051 -54.666 1.00 157.05 ? 59  DA  I N9    1 
ATOM   8759  C  C8    . DA  I 5 132 ? -17.364 45.228 -54.725 1.00 157.48 ? 59  DA  I C8    1 
ATOM   8760  N  N7    . DA  I 5 132 ? -18.047 46.238 -55.225 1.00 157.49 ? 59  DA  I N7    1 
ATOM   8761  C  C5    . DA  I 5 132 ? -19.285 45.686 -55.514 1.00 157.76 ? 59  DA  I C5    1 
ATOM   8762  C  C6    . DA  I 5 132 ? -20.468 46.224 -56.090 1.00 158.20 ? 59  DA  I C6    1 
ATOM   8763  N  N6    . DA  I 5 132 ? -20.583 47.500 -56.489 1.00 158.12 ? 59  DA  I N6    1 
ATOM   8764  N  N1    . DA  I 5 132 ? -21.533 45.385 -56.245 1.00 158.31 ? 59  DA  I N1    1 
ATOM   8765  C  C2    . DA  I 5 132 ? -21.415 44.098 -55.862 1.00 157.79 ? 59  DA  I C2    1 
ATOM   8766  N  N3    . DA  I 5 132 ? -20.364 43.485 -55.308 1.00 157.48 ? 59  DA  I N3    1 
ATOM   8767  C  C4    . DA  I 5 132 ? -19.315 44.335 -55.175 1.00 157.41 ? 59  DA  I C4    1 
ATOM   8768  P  P     . DG  I 5 133 ? -16.497 38.514 -54.803 1.00 163.52 ? 60  DG  I P     1 
ATOM   8769  O  OP1   . DG  I 5 133 ? -16.764 37.267 -54.047 1.00 163.41 ? 60  DG  I OP1   1 
ATOM   8770  O  OP2   . DG  I 5 133 ? -15.168 38.720 -55.434 1.00 163.55 ? 60  DG  I OP2   1 
ATOM   8771  O  "O5'" . DG  I 5 133 ? -17.617 38.692 -55.931 1.00 166.41 ? 60  DG  I "O5'" 1 
ATOM   8772  C  "C5'" . DG  I 5 133 ? -18.996 38.563 -55.587 1.00 169.23 ? 60  DG  I "C5'" 1 
ATOM   8773  C  "C4'" . DG  I 5 133 ? -19.884 39.050 -56.711 1.00 172.09 ? 60  DG  I "C4'" 1 
ATOM   8774  O  "O4'" . DG  I 5 133 ? -19.623 40.448 -56.965 1.00 172.88 ? 60  DG  I "O4'" 1 
ATOM   8775  C  "C3'" . DG  I 5 133 ? -19.713 38.321 -58.052 1.00 174.46 ? 60  DG  I "C3'" 1 
ATOM   8776  O  "O3'" . DG  I 5 133 ? -20.998 37.847 -58.508 1.00 177.23 ? 60  DG  I "O3'" 1 
ATOM   8777  C  "C2'" . DG  I 5 133 ? -19.128 39.398 -58.981 1.00 174.14 ? 60  DG  I "C2'" 1 
ATOM   8778  C  "C1'" . DG  I 5 133 ? -19.658 40.675 -58.349 1.00 173.88 ? 60  DG  I "C1'" 1 
ATOM   8779  N  N9    . DG  I 5 133 ? -18.867 41.872 -58.645 1.00 174.64 ? 60  DG  I N9    1 
ATOM   8780  C  C8    . DG  I 5 133 ? -17.493 41.991 -58.626 1.00 174.90 ? 60  DG  I C8    1 
ATOM   8781  N  N7    . DG  I 5 133 ? -17.069 43.195 -58.892 1.00 175.06 ? 60  DG  I N7    1 
ATOM   8782  C  C5    . DG  I 5 133 ? -18.231 43.931 -59.081 1.00 175.29 ? 60  DG  I C5    1 
ATOM   8783  C  C6    . DG  I 5 133 ? -18.403 45.310 -59.399 1.00 175.75 ? 60  DG  I C6    1 
ATOM   8784  O  O6    . DG  I 5 133 ? -17.528 46.173 -59.576 1.00 176.04 ? 60  DG  I O6    1 
ATOM   8785  N  N1    . DG  I 5 133 ? -19.758 45.659 -59.493 1.00 175.71 ? 60  DG  I N1    1 
ATOM   8786  C  C2    . DG  I 5 133 ? -20.811 44.782 -59.318 1.00 175.60 ? 60  DG  I C2    1 
ATOM   8787  N  N2    . DG  I 5 133 ? -22.043 45.301 -59.436 1.00 175.75 ? 60  DG  I N2    1 
ATOM   8788  N  N3    . DG  I 5 133 ? -20.663 43.488 -59.024 1.00 175.26 ? 60  DG  I N3    1 
ATOM   8789  C  C4    . DG  I 5 133 ? -19.350 43.132 -58.923 1.00 175.06 ? 60  DG  I C4    1 
ATOM   8790  P  P     . DG  I 5 134 ? -21.136 36.734 -59.665 1.00 179.78 ? 61  DG  I P     1 
ATOM   8791  O  OP1   . DG  I 5 134 ? -21.997 35.636 -59.150 1.00 179.85 ? 61  DG  I OP1   1 
ATOM   8792  O  OP2   . DG  I 5 134 ? -19.784 36.418 -60.195 1.00 179.96 ? 61  DG  I OP2   1 
ATOM   8793  O  "O5'" . DG  I 5 134 ? -21.934 37.531 -60.805 1.00 181.52 ? 61  DG  I "O5'" 1 
ATOM   8794  C  "C5'" . DG  I 5 134 ? -23.293 37.926 -60.593 1.00 183.14 ? 61  DG  I "C5'" 1 
ATOM   8795  C  "C4'" . DG  I 5 134 ? -23.660 39.110 -61.470 1.00 184.82 ? 61  DG  I "C4'" 1 
ATOM   8796  O  "O4'" . DG  I 5 134 ? -22.751 40.210 -61.212 1.00 184.89 ? 61  DG  I "O4'" 1 
ATOM   8797  C  "C3'" . DG  I 5 134 ? -23.599 38.854 -62.992 1.00 186.41 ? 61  DG  I "C3'" 1 
ATOM   8798  O  "O3'" . DG  I 5 134 ? -24.878 39.149 -63.605 1.00 188.54 ? 61  DG  I "O3'" 1 
ATOM   8799  C  "C2'" . DG  I 5 134 ? -22.505 39.814 -63.472 1.00 185.78 ? 61  DG  I "C2'" 1 
ATOM   8800  C  "C1'" . DG  I 5 134 ? -22.582 40.896 -62.415 1.00 185.26 ? 61  DG  I "C1'" 1 
ATOM   8801  N  N9    . DG  I 5 134 ? -21.409 41.764 -62.351 1.00 185.30 ? 61  DG  I N9    1 
ATOM   8802  C  C8    . DG  I 5 134 ? -20.084 41.389 -62.249 1.00 185.21 ? 61  DG  I C8    1 
ATOM   8803  N  N7    . DG  I 5 134 ? -19.251 42.396 -62.322 1.00 185.24 ? 61  DG  I N7    1 
ATOM   8804  C  C5    . DG  I 5 134 ? -20.073 43.507 -62.510 1.00 185.33 ? 61  DG  I C5    1 
ATOM   8805  C  C6    . DG  I 5 134 ? -19.746 44.890 -62.668 1.00 185.15 ? 61  DG  I C6    1 
ATOM   8806  O  O6    . DG  I 5 134 ? -18.626 45.421 -62.656 1.00 184.97 ? 61  DG  I O6    1 
ATOM   8807  N  N1    . DG  I 5 134 ? -20.892 45.687 -62.832 1.00 185.20 ? 61  DG  I N1    1 
ATOM   8808  C  C2    . DG  I 5 134 ? -22.191 45.206 -62.852 1.00 185.32 ? 61  DG  I C2    1 
ATOM   8809  N  N2    . DG  I 5 134 ? -23.166 46.110 -63.029 1.00 185.35 ? 61  DG  I N2    1 
ATOM   8810  N  N3    . DG  I 5 134 ? -22.507 43.920 -62.719 1.00 185.47 ? 61  DG  I N3    1 
ATOM   8811  C  C4    . DG  I 5 134 ? -21.402 43.128 -62.549 1.00 185.44 ? 61  DG  I C4    1 
ATOM   8812  P  P     . DG  I 5 135 ? -25.199 38.734 -65.134 1.00 190.46 ? 62  DG  I P     1 
ATOM   8813  O  OP1   . DG  I 5 135 ? -26.606 38.257 -65.188 1.00 190.41 ? 62  DG  I OP1   1 
ATOM   8814  O  OP2   . DG  I 5 135 ? -24.111 37.848 -65.627 1.00 190.38 ? 62  DG  I OP2   1 
ATOM   8815  O  "O5'" . DG  I 5 135 ? -25.084 40.144 -65.911 1.00 191.94 ? 62  DG  I "O5'" 1 
ATOM   8816  C  "C5'" . DG  I 5 135 ? -26.268 40.894 -66.237 1.00 193.39 ? 62  DG  I "C5'" 1 
ATOM   8817  C  "C4'" . DG  I 5 135 ? -25.959 42.362 -66.519 1.00 194.90 ? 62  DG  I "C4'" 1 
ATOM   8818  O  "O4'" . DG  I 5 135 ? -25.038 42.893 -65.527 1.00 195.29 ? 62  DG  I "O4'" 1 
ATOM   8819  C  "C3'" . DG  I 5 135 ? -25.282 42.651 -67.846 1.00 195.96 ? 62  DG  I "C3'" 1 
ATOM   8820  O  "O3'" . DG  I 5 135 ? -26.240 42.669 -68.919 1.00 197.05 ? 62  DG  I "O3'" 1 
ATOM   8821  C  "C2'" . DG  I 5 135 ? -24.698 44.034 -67.571 1.00 195.77 ? 62  DG  I "C2'" 1 
ATOM   8822  C  "C1'" . DG  I 5 135 ? -24.197 43.868 -66.140 1.00 195.72 ? 62  DG  I "C1'" 1 
ATOM   8823  N  N9    . DG  I 5 135 ? -22.795 43.420 -66.059 1.00 196.33 ? 62  DG  I N9    1 
ATOM   8824  C  C8    . DG  I 5 135 ? -22.336 42.117 -66.004 1.00 196.46 ? 62  DG  I C8    1 
ATOM   8825  N  N7    . DG  I 5 135 ? -21.034 42.017 -65.940 1.00 196.54 ? 62  DG  I N7    1 
ATOM   8826  C  C5    . DG  I 5 135 ? -20.589 43.335 -65.994 1.00 196.67 ? 62  DG  I C5    1 
ATOM   8827  C  C6    . DG  I 5 135 ? -19.262 43.862 -65.956 1.00 196.63 ? 62  DG  I C6    1 
ATOM   8828  O  O6    . DG  I 5 135 ? -18.189 43.241 -65.887 1.00 196.67 ? 62  DG  I O6    1 
ATOM   8829  N  N1    . DG  I 5 135 ? -19.253 45.262 -66.027 1.00 196.46 ? 62  DG  I N1    1 
ATOM   8830  C  C2    . DG  I 5 135 ? -20.381 46.055 -66.115 1.00 196.46 ? 62  DG  I C2    1 
ATOM   8831  N  N2    . DG  I 5 135 ? -20.172 47.375 -66.201 1.00 196.46 ? 62  DG  I N2    1 
ATOM   8832  N  N3    . DG  I 5 135 ? -21.629 45.578 -66.155 1.00 196.49 ? 62  DG  I N3    1 
ATOM   8833  C  C4    . DG  I 5 135 ? -21.660 44.214 -66.089 1.00 196.57 ? 62  DG  I C4    1 
ATOM   8834  P  P     . DT  I 5 136 ? -25.799 42.256 -70.418 1.00 197.88 ? 63  DT  I P     1 
ATOM   8835  O  OP1   . DT  I 5 136 ? -27.030 42.147 -71.241 1.00 197.94 ? 63  DT  I OP1   1 
ATOM   8836  O  OP2   . DT  I 5 136 ? -24.870 41.096 -70.331 1.00 197.76 ? 63  DT  I OP2   1 
ATOM   8837  O  "O5'" . DT  I 5 136 ? -24.952 43.535 -70.911 1.00 198.21 ? 63  DT  I "O5'" 1 
ATOM   8838  C  "C5'" . DT  I 5 136 ? -25.594 44.812 -71.064 1.00 198.32 ? 63  DT  I "C5'" 1 
ATOM   8839  C  "C4'" . DT  I 5 136 ? -24.603 45.967 -70.957 1.00 198.50 ? 63  DT  I "C4'" 1 
ATOM   8840  O  "O4'" . DT  I 5 136 ? -23.492 45.626 -70.100 1.00 198.44 ? 63  DT  I "O4'" 1 
ATOM   8841  C  "C3'" . DT  I 5 136 ? -23.986 46.423 -72.278 1.00 198.83 ? 63  DT  I "C3'" 1 
ATOM   8842  O  "O3'" . DT  I 5 136 ? -24.566 47.672 -72.671 1.00 199.61 ? 63  DT  I "O3'" 1 
ATOM   8843  C  "C2'" . DT  I 5 136 ? -22.479 46.555 -71.980 1.00 198.51 ? 63  DT  I "C2'" 1 
ATOM   8844  C  "C1'" . DT  I 5 136 ? -22.405 46.435 -70.462 1.00 198.38 ? 63  DT  I "C1'" 1 
ATOM   8845  N  N1    . DT  I 5 136 ? -21.104 45.807 -69.964 1.00 198.21 ? 63  DT  I N1    1 
ATOM   8846  C  C2    . DT  I 5 136 ? -20.103 46.624 -69.437 1.00 198.04 ? 63  DT  I C2    1 
ATOM   8847  O  O2    . DT  I 5 136 ? -20.222 47.830 -69.279 1.00 198.03 ? 63  DT  I O2    1 
ATOM   8848  N  N3    . DT  I 5 136 ? -18.956 45.962 -69.067 1.00 197.88 ? 63  DT  I N3    1 
ATOM   8849  C  C4    . DT  I 5 136 ? -18.691 44.603 -69.186 1.00 197.83 ? 63  DT  I C4    1 
ATOM   8850  O  O4    . DT  I 5 136 ? -17.612 44.166 -68.790 1.00 197.72 ? 63  DT  I O4    1 
ATOM   8851  C  C5    . DT  I 5 136 ? -19.767 43.804 -69.761 1.00 197.89 ? 63  DT  I C5    1 
ATOM   8852  C  C7    . DT  I 5 136 ? -19.607 42.319 -69.938 1.00 197.82 ? 63  DT  I C7    1 
ATOM   8853  C  C6    . DT  I 5 136 ? -20.898 44.438 -70.130 1.00 198.04 ? 63  DT  I C6    1 
ATOM   8854  P  P     . DT  I 5 137 ? -24.263 48.318 -74.114 1.00 200.15 ? 64  DT  I P     1 
ATOM   8855  O  OP1   . DT  I 5 137 ? -25.384 49.236 -74.446 1.00 200.03 ? 64  DT  I OP1   1 
ATOM   8856  O  OP2   . DT  I 5 137 ? -23.910 47.223 -75.054 1.00 200.11 ? 64  DT  I OP2   1 
ATOM   8857  O  "O5'" . DT  I 5 137 ? -22.930 49.186 -73.839 1.00 200.34 ? 64  DT  I "O5'" 1 
ATOM   8858  C  "C5'" . DT  I 5 137 ? -22.936 50.238 -72.847 1.00 200.22 ? 64  DT  I "C5'" 1 
ATOM   8859  C  "C4'" . DT  I 5 137 ? -21.532 50.754 -72.533 1.00 200.07 ? 64  DT  I "C4'" 1 
ATOM   8860  O  "O4'" . DT  I 5 137 ? -20.842 49.833 -71.671 1.00 199.92 ? 64  DT  I "O4'" 1 
ATOM   8861  C  "C3'" . DT  I 5 137 ? -20.589 50.920 -73.711 1.00 200.23 ? 64  DT  I "C3'" 1 
ATOM   8862  O  "O3'" . DT  I 5 137 ? -20.866 52.146 -74.403 1.00 200.70 ? 64  DT  I "O3'" 1 
ATOM   8863  C  "C2'" . DT  I 5 137 ? -19.227 50.963 -73.013 1.00 200.04 ? 64  DT  I "C2'" 1 
ATOM   8864  C  "C1'" . DT  I 5 137 ? -19.451 50.101 -71.758 1.00 199.92 ? 64  DT  I "C1'" 1 
ATOM   8865  N  N1    . DT  I 5 137 ? -18.672 48.794 -71.759 1.00 199.80 ? 64  DT  I N1    1 
ATOM   8866  C  C2    . DT  I 5 137 ? -17.495 48.701 -71.024 1.00 199.61 ? 64  DT  I C2    1 
ATOM   8867  O  O2    . DT  I 5 137 ? -17.047 49.612 -70.348 1.00 199.52 ? 64  DT  I O2    1 
ATOM   8868  N  N3    . DT  I 5 137 ? -16.862 47.482 -71.104 1.00 199.59 ? 64  DT  I N3    1 
ATOM   8869  C  C4    . DT  I 5 137 ? -17.255 46.375 -71.847 1.00 199.68 ? 64  DT  I C4    1 
ATOM   8870  O  O4    . DT  I 5 137 ? -16.568 45.353 -71.815 1.00 199.72 ? 64  DT  I O4    1 
ATOM   8871  C  C5    . DT  I 5 137 ? -18.485 46.540 -72.608 1.00 199.69 ? 64  DT  I C5    1 
ATOM   8872  C  C7    . DT  I 5 137 ? -19.023 45.415 -73.446 1.00 199.59 ? 64  DT  I C7    1 
ATOM   8873  C  C6    . DT  I 5 137 ? -19.113 47.732 -72.543 1.00 199.80 ? 64  DT  I C6    1 
ATOM   8874  P  P     . DA  I 5 138 ? -20.554 52.296 -75.979 1.00 201.06 ? 65  DA  I P     1 
ATOM   8875  O  OP1   . DA  I 5 138 ? -21.287 53.486 -76.477 1.00 200.88 ? 65  DA  I OP1   1 
ATOM   8876  O  OP2   . DA  I 5 138 ? -20.769 50.980 -76.631 1.00 201.23 ? 65  DA  I OP2   1 
ATOM   8877  O  "O5'" . DA  I 5 138 ? -18.979 52.599 -76.009 1.00 200.95 ? 65  DA  I "O5'" 1 
ATOM   8878  C  "C5'" . DA  I 5 138 ? -18.464 53.826 -75.478 1.00 200.67 ? 65  DA  I "C5'" 1 
ATOM   8879  C  "C4'" . DA  I 5 138 ? -16.980 53.704 -75.177 1.00 200.34 ? 65  DA  I "C4'" 1 
ATOM   8880  O  "O4'" . DA  I 5 138 ? -16.741 52.485 -74.442 1.00 200.20 ? 65  DA  I "O4'" 1 
ATOM   8881  C  "C3'" . DA  I 5 138 ? -16.074 53.650 -76.409 1.00 200.19 ? 65  DA  I "C3'" 1 
ATOM   8882  O  "O3'" . DA  I 5 138 ? -15.244 54.813 -76.462 1.00 200.10 ? 65  DA  I "O3'" 1 
ATOM   8883  C  "C2'" . DA  I 5 138 ? -15.251 52.365 -76.238 1.00 200.16 ? 65  DA  I "C2'" 1 
ATOM   8884  C  "C1'" . DA  I 5 138 ? -15.481 51.982 -74.784 1.00 200.22 ? 65  DA  I "C1'" 1 
ATOM   8885  N  N9    . DA  I 5 138 ? -15.479 50.534 -74.568 1.00 200.38 ? 65  DA  I N9    1 
ATOM   8886  C  C8    . DA  I 5 138 ? -16.363 49.621 -75.086 1.00 200.44 ? 65  DA  I C8    1 
ATOM   8887  N  N7    . DA  I 5 138 ? -16.079 48.375 -74.788 1.00 200.45 ? 65  DA  I N7    1 
ATOM   8888  C  C5    . DA  I 5 138 ? -14.923 48.469 -74.033 1.00 200.47 ? 65  DA  I C5    1 
ATOM   8889  C  C6    . DA  I 5 138 ? -14.112 47.493 -73.410 1.00 200.54 ? 65  DA  I C6    1 
ATOM   8890  N  N6    . DA  I 5 138 ? -14.373 46.183 -73.462 1.00 200.57 ? 65  DA  I N6    1 
ATOM   8891  N  N1    . DA  I 5 138 ? -13.011 47.921 -72.737 1.00 200.54 ? 65  DA  I N1    1 
ATOM   8892  C  C2    . DA  I 5 138 ? -12.756 49.242 -72.679 1.00 200.48 ? 65  DA  I C2    1 
ATOM   8893  N  N3    . DA  I 5 138 ? -13.442 50.251 -73.229 1.00 200.47 ? 65  DA  I N3    1 
ATOM   8894  C  C4    . DA  I 5 138 ? -14.526 49.793 -73.901 1.00 200.45 ? 65  DA  I C4    1 
ATOM   8895  P  P     . DG  I 5 139 ? -14.392 55.177 -77.784 1.00 200.11 ? 66  DG  I P     1 
ATOM   8896  O  OP1   . DG  I 5 139 ? -14.416 56.650 -77.952 1.00 200.25 ? 66  DG  I OP1   1 
ATOM   8897  O  OP2   . DG  I 5 139 ? -14.840 54.311 -78.901 1.00 200.26 ? 66  DG  I OP2   1 
ATOM   8898  O  "O5'" . DG  I 5 139 ? -12.911 54.723 -77.375 1.00 199.45 ? 66  DG  I "O5'" 1 
ATOM   8899  C  "C5'" . DG  I 5 139 ? -12.317 55.230 -76.181 1.00 198.98 ? 66  DG  I "C5'" 1 
ATOM   8900  C  "C4'" . DG  I 5 139 ? -11.311 54.248 -75.613 1.00 198.73 ? 66  DG  I "C4'" 1 
ATOM   8901  O  "O4'" . DG  I 5 139 ? -11.864 52.906 -75.616 1.00 198.87 ? 66  DG  I "O4'" 1 
ATOM   8902  C  "C3'" . DG  I 5 139 ? -9.979  54.166 -76.368 1.00 198.41 ? 66  DG  I "C3'" 1 
ATOM   8903  O  "O3'" . DG  I 5 139 ? -8.891  54.321 -75.443 1.00 197.92 ? 66  DG  I "O3'" 1 
ATOM   8904  C  "C2'" . DG  I 5 139 ? -10.001 52.764 -76.988 1.00 198.61 ? 66  DG  I "C2'" 1 
ATOM   8905  C  "C1'" . DG  I 5 139 ? -10.846 52.006 -75.976 1.00 198.83 ? 66  DG  I "C1'" 1 
ATOM   8906  N  N9    . DG  I 5 139 ? -11.451 50.762 -76.481 1.00 198.88 ? 66  DG  I N9    1 
ATOM   8907  C  C8    . DG  I 5 139 ? -12.387 50.637 -77.487 1.00 198.73 ? 66  DG  I C8    1 
ATOM   8908  N  N7    . DG  I 5 139 ? -12.777 49.406 -77.692 1.00 198.74 ? 66  DG  I N7    1 
ATOM   8909  C  C5    . DG  I 5 139 ? -12.059 48.658 -76.761 1.00 198.89 ? 66  DG  I C5    1 
ATOM   8910  C  C6    . DG  I 5 139 ? -12.061 47.252 -76.509 1.00 198.77 ? 66  DG  I C6    1 
ATOM   8911  O  O6    . DG  I 5 139 ? -12.722 46.371 -77.079 1.00 198.66 ? 66  DG  I O6    1 
ATOM   8912  N  N1    . DG  I 5 139 ? -11.178 46.902 -75.474 1.00 198.73 ? 66  DG  I N1    1 
ATOM   8913  C  C2    . DG  I 5 139 ? -10.387 47.795 -74.774 1.00 198.67 ? 66  DG  I C2    1 
ATOM   8914  N  N2    . DG  I 5 139 ? -9.608  47.275 -73.811 1.00 198.46 ? 66  DG  I N2    1 
ATOM   8915  N  N3    . DG  I 5 139 ? -10.378 49.115 -74.995 1.00 198.83 ? 66  DG  I N3    1 
ATOM   8916  C  C4    . DG  I 5 139 ? -11.237 49.477 -76.001 1.00 198.94 ? 66  DG  I C4    1 
ATOM   8917  P  P     . DG  I 5 140 ? -7.459  54.873 -75.927 1.00 197.27 ? 67  DG  I P     1 
ATOM   8918  O  OP1   . DG  I 5 140 ? -6.965  55.822 -74.897 1.00 197.34 ? 67  DG  I OP1   1 
ATOM   8919  O  OP2   . DG  I 5 140 ? -7.574  55.309 -77.343 1.00 197.27 ? 67  DG  I OP2   1 
ATOM   8920  O  "O5'" . DG  I 5 140 ? -6.549  53.561 -75.895 1.00 196.12 ? 67  DG  I "O5'" 1 
ATOM   8921  C  "C5'" . DG  I 5 140 ? -6.340  52.866 -74.671 1.00 194.92 ? 67  DG  I "C5'" 1 
ATOM   8922  C  "C4'" . DG  I 5 140 ? -6.118  51.388 -74.921 1.00 193.77 ? 67  DG  I "C4'" 1 
ATOM   8923  O  "O4'" . DG  I 5 140 ? -7.299  50.805 -75.503 1.00 193.55 ? 67  DG  I "O4'" 1 
ATOM   8924  C  "C3'" . DG  I 5 140 ? -5.018  51.052 -75.918 1.00 192.86 ? 67  DG  I "C3'" 1 
ATOM   8925  O  "O3'" . DG  I 5 140 ? -3.736  50.981 -75.249 1.00 191.41 ? 67  DG  I "O3'" 1 
ATOM   8926  C  "C2'" . DG  I 5 140 ? -5.455  49.683 -76.468 1.00 193.31 ? 67  DG  I "C2'" 1 
ATOM   8927  C  "C1'" . DG  I 5 140 ? -6.925  49.560 -76.046 1.00 193.53 ? 67  DG  I "C1'" 1 
ATOM   8928  N  N9    . DG  I 5 140 ? -7.818  49.203 -77.152 1.00 193.69 ? 67  DG  I N9    1 
ATOM   8929  C  C8    . DG  I 5 140 ? -8.338  50.048 -78.108 1.00 193.83 ? 67  DG  I C8    1 
ATOM   8930  N  N7    . DG  I 5 140 ? -9.063  49.441 -79.009 1.00 193.84 ? 67  DG  I N7    1 
ATOM   8931  C  C5    . DG  I 5 140 ? -8.956  48.096 -78.678 1.00 193.78 ? 67  DG  I C5    1 
ATOM   8932  C  C6    . DG  I 5 140 ? -9.514  46.951 -79.309 1.00 193.69 ? 67  DG  I C6    1 
ATOM   8933  O  O6    . DG  I 5 140 ? -10.237 46.907 -80.315 1.00 193.68 ? 67  DG  I O6    1 
ATOM   8934  N  N1    . DG  I 5 140 ? -9.154  45.766 -78.653 1.00 193.57 ? 67  DG  I N1    1 
ATOM   8935  C  C2    . DG  I 5 140 ? -8.370  45.697 -77.517 1.00 193.47 ? 67  DG  I C2    1 
ATOM   8936  N  N2    . DG  I 5 140 ? -8.132  44.470 -77.030 1.00 193.36 ? 67  DG  I N2    1 
ATOM   8937  N  N3    . DG  I 5 140 ? -7.840  46.762 -76.915 1.00 193.53 ? 67  DG  I N3    1 
ATOM   8938  C  C4    . DG  I 5 140 ? -8.172  47.928 -77.549 1.00 193.68 ? 67  DG  I C4    1 
ATOM   8939  P  P     . DG  I 5 141 ? -2.355  51.113 -76.077 1.00 189.68 ? 68  DG  I P     1 
ATOM   8940  O  OP1   . DG  I 5 141 ? -1.283  51.475 -75.119 1.00 189.67 ? 68  DG  I OP1   1 
ATOM   8941  O  OP2   . DG  I 5 141 ? -2.602  51.972 -77.265 1.00 189.57 ? 68  DG  I OP2   1 
ATOM   8942  O  "O5'" . DG  I 5 141 ? -2.095  49.614 -76.605 1.00 187.94 ? 68  DG  I "O5'" 1 
ATOM   8943  C  "C5'" . DG  I 5 141 ? -1.981  48.508 -75.683 1.00 185.80 ? 68  DG  I "C5'" 1 
ATOM   8944  C  "C4'" . DG  I 5 141 ? -2.194  47.174 -76.399 1.00 183.71 ? 68  DG  I "C4'" 1 
ATOM   8945  O  "O4'" . DG  I 5 141 ? -3.427  47.206 -77.170 1.00 182.94 ? 68  DG  I "O4'" 1 
ATOM   8946  C  "C3'" . DG  I 5 141 ? -1.086  46.759 -77.369 1.00 182.64 ? 68  DG  I "C3'" 1 
ATOM   8947  O  "O3'" . DG  I 5 141 ? -0.745  45.390 -77.152 1.00 181.92 ? 68  DG  I "O3'" 1 
ATOM   8948  C  "C2'" . DG  I 5 141 ? -1.708  46.977 -78.751 1.00 182.46 ? 68  DG  I "C2'" 1 
ATOM   8949  C  "C1'" . DG  I 5 141 ? -3.192  46.757 -78.489 1.00 182.45 ? 68  DG  I "C1'" 1 
ATOM   8950  N  N9    . DG  I 5 141 ? -4.064  47.511 -79.403 1.00 182.13 ? 68  DG  I N9    1 
ATOM   8951  C  C8    . DG  I 5 141 ? -3.997  48.859 -79.682 1.00 182.06 ? 68  DG  I C8    1 
ATOM   8952  N  N7    . DG  I 5 141 ? -4.890  49.265 -80.540 1.00 182.03 ? 68  DG  I N7    1 
ATOM   8953  C  C5    . DG  I 5 141 ? -5.605  48.119 -80.858 1.00 182.09 ? 68  DG  I C5    1 
ATOM   8954  C  C6    . DG  I 5 141 ? -6.708  47.946 -81.744 1.00 182.09 ? 68  DG  I C6    1 
ATOM   8955  O  O6    . DG  I 5 141 ? -7.283  48.809 -82.427 1.00 182.12 ? 68  DG  I O6    1 
ATOM   8956  N  N1    . DG  I 5 141 ? -7.144  46.612 -81.786 1.00 181.93 ? 68  DG  I N1    1 
ATOM   8957  C  C2    . DG  I 5 141 ? -6.585  45.577 -81.058 1.00 181.82 ? 68  DG  I C2    1 
ATOM   8958  N  N2    . DG  I 5 141 ? -7.129  44.364 -81.236 1.00 181.63 ? 68  DG  I N2    1 
ATOM   8959  N  N3    . DG  I 5 141 ? -5.546  45.726 -80.226 1.00 181.94 ? 68  DG  I N3    1 
ATOM   8960  C  C4    . DG  I 5 141 ? -5.107  47.021 -80.175 1.00 182.05 ? 68  DG  I C4    1 
ATOM   8961  P  P     . DT  I 5 142 ? 0.632   44.760 -77.706 1.00 181.01 ? 69  DT  I P     1 
ATOM   8962  O  OP1   . DT  I 5 142 ? 1.425   44.311 -76.538 1.00 180.74 ? 69  DT  I OP1   1 
ATOM   8963  O  OP2   . DT  I 5 142 ? 1.233   45.697 -78.689 1.00 181.03 ? 69  DT  I OP2   1 
ATOM   8964  O  "O5'" . DT  I 5 142 ? 0.126   43.473 -78.513 1.00 180.25 ? 69  DT  I "O5'" 1 
ATOM   8965  C  "C5'" . DT  I 5 142 ? -0.874  42.616 -77.951 1.00 179.46 ? 69  DT  I "C5'" 1 
ATOM   8966  C  "C4'" . DT  I 5 142 ? -1.765  42.032 -79.030 1.00 178.71 ? 69  DT  I "C4'" 1 
ATOM   8967  O  "O4'" . DT  I 5 142 ? -2.503  43.086 -79.679 1.00 178.51 ? 69  DT  I "O4'" 1 
ATOM   8968  C  "C3'" . DT  I 5 142 ? -1.025  41.298 -80.146 1.00 178.41 ? 69  DT  I "C3'" 1 
ATOM   8969  O  "O3'" . DT  I 5 142 ? -1.184  39.892 -79.988 1.00 178.15 ? 69  DT  I "O3'" 1 
ATOM   8970  C  "C2'" . DT  I 5 142 ? -1.662  41.815 -81.453 1.00 178.51 ? 69  DT  I "C2'" 1 
ATOM   8971  C  "C1'" . DT  I 5 142 ? -2.847  42.647 -80.969 1.00 178.47 ? 69  DT  I "C1'" 1 
ATOM   8972  N  N1    . DT  I 5 142 ? -3.169  43.855 -81.860 1.00 178.26 ? 69  DT  I N1    1 
ATOM   8973  C  C2    . DT  I 5 142 ? -4.225  43.779 -82.771 1.00 177.89 ? 69  DT  I C2    1 
ATOM   8974  O  O2    . DT  I 5 142 ? -4.954  42.805 -82.892 1.00 177.42 ? 69  DT  I O2    1 
ATOM   8975  N  N3    . DT  I 5 142 ? -4.423  44.921 -83.513 1.00 178.20 ? 69  DT  I N3    1 
ATOM   8976  C  C4    . DT  I 5 142 ? -3.685  46.104 -83.466 1.00 178.38 ? 69  DT  I C4    1 
ATOM   8977  O  O4    . DT  I 5 142 ? -3.987  47.036 -84.216 1.00 178.43 ? 69  DT  I O4    1 
ATOM   8978  C  C5    . DT  I 5 142 ? -2.577  46.110 -82.518 1.00 178.25 ? 69  DT  I C5    1 
ATOM   8979  C  C7    . DT  I 5 142 ? -1.692  47.320 -82.389 1.00 178.03 ? 69  DT  I C7    1 
ATOM   8980  C  C6    . DT  I 5 142 ? -2.374  45.000 -81.776 1.00 178.29 ? 69  DT  I C6    1 
ATOM   8981  P  P     . DG  I 5 143 ? -0.129  38.874 -80.632 1.00 178.31 ? 70  DG  I P     1 
ATOM   8982  O  OP1   . DG  I 5 143 ? -0.295  37.574 -79.958 1.00 178.17 ? 70  DG  I OP1   1 
ATOM   8983  O  OP2   . DG  I 5 143 ? 1.202   39.523 -80.652 1.00 177.82 ? 70  DG  I OP2   1 
ATOM   8984  O  "O5'" . DG  I 5 143 ? -0.638  38.742 -82.148 1.00 180.06 ? 70  DG  I "O5'" 1 
ATOM   8985  C  "C5'" . DG  I 5 143 ? -1.894  38.089 -82.446 1.00 181.72 ? 70  DG  I "C5'" 1 
ATOM   8986  C  "C4'" . DG  I 5 143 ? -2.315  38.308 -83.899 1.00 183.19 ? 70  DG  I "C4'" 1 
ATOM   8987  O  "O4'" . DG  I 5 143 ? -2.508  39.725 -84.145 1.00 183.33 ? 70  DG  I "O4'" 1 
ATOM   8988  C  "C3'" . DG  I 5 143 ? -1.315  37.821 -84.962 1.00 184.72 ? 70  DG  I "C3'" 1 
ATOM   8989  O  "O3'" . DG  I 5 143 ? -2.002  37.121 -86.009 1.00 186.84 ? 70  DG  I "O3'" 1 
ATOM   8990  C  "C2'" . DG  I 5 143 ? -0.700  39.118 -85.476 1.00 184.21 ? 70  DG  I "C2'" 1 
ATOM   8991  C  "C1'" . DG  I 5 143 ? -1.878  40.064 -85.351 1.00 183.83 ? 70  DG  I "C1'" 1 
ATOM   8992  N  N9    . DG  I 5 143 ? -1.504  41.472 -85.326 1.00 184.12 ? 70  DG  I N9    1 
ATOM   8993  C  C8    . DG  I 5 143 ? -0.296  42.004 -84.933 1.00 184.22 ? 70  DG  I C8    1 
ATOM   8994  N  N7    . DG  I 5 143 ? -0.212  43.290 -85.109 1.00 184.34 ? 70  DG  I N7    1 
ATOM   8995  C  C5    . DG  I 5 143 ? -1.432  43.635 -85.670 1.00 184.59 ? 70  DG  I C5    1 
ATOM   8996  C  C6    . DG  I 5 143 ? -1.921  44.904 -86.087 1.00 185.08 ? 70  DG  I C6    1 
ATOM   8997  O  O6    . DG  I 5 143 ? -1.356  46.005 -86.014 1.00 185.23 ? 70  DG  I O6    1 
ATOM   8998  N  N1    . DG  I 5 143 ? -3.220  44.818 -86.606 1.00 185.34 ? 70  DG  I N1    1 
ATOM   8999  C  C2    . DG  I 5 143 ? -3.950  43.649 -86.715 1.00 185.39 ? 70  DG  I C2    1 
ATOM   9000  N  N2    . DG  I 5 143 ? -5.177  43.758 -87.254 1.00 185.64 ? 70  DG  I N2    1 
ATOM   9001  N  N3    . DG  I 5 143 ? -3.498  42.453 -86.331 1.00 184.92 ? 70  DG  I N3    1 
ATOM   9002  C  C4    . DG  I 5 143 ? -2.234  42.522 -85.823 1.00 184.48 ? 70  DG  I C4    1 
ATOM   9003  P  P     . DA  I 5 144 ? -1.229  36.064 -86.946 1.00 189.01 ? 71  DA  I P     1 
ATOM   9004  O  OP1   . DA  I 5 144 ? -1.383  34.721 -86.337 1.00 189.05 ? 71  DA  I OP1   1 
ATOM   9005  O  OP2   . DA  I 5 144 ? 0.130   36.585 -87.234 1.00 188.98 ? 71  DA  I OP2   1 
ATOM   9006  O  "O5'" . DA  I 5 144 ? -2.064  36.122 -88.318 1.00 191.12 ? 71  DA  I "O5'" 1 
ATOM   9007  C  "C5'" . DA  I 5 144 ? -3.430  35.691 -88.359 1.00 193.10 ? 71  DA  I "C5'" 1 
ATOM   9008  C  "C4'" . DA  I 5 144 ? -4.316  36.740 -89.019 1.00 194.96 ? 71  DA  I "C4'" 1 
ATOM   9009  O  "O4'" . DA  I 5 144 ? -3.919  38.070 -88.585 1.00 195.32 ? 71  DA  I "O4'" 1 
ATOM   9010  C  "C3'" . DA  I 5 144 ? -4.296  36.757 -90.553 1.00 196.58 ? 71  DA  I "C3'" 1 
ATOM   9011  O  "O3'" . DA  I 5 144 ? -5.658  36.839 -91.061 1.00 198.57 ? 71  DA  I "O3'" 1 
ATOM   9012  C  "C2'" . DA  I 5 144 ? -3.481  38.013 -90.881 1.00 196.22 ? 71  DA  I "C2'" 1 
ATOM   9013  C  "C1'" . DA  I 5 144 ? -3.811  38.920 -89.702 1.00 195.88 ? 71  DA  I "C1'" 1 
ATOM   9014  N  N9    . DA  I 5 144 ? -2.788  39.939 -89.428 1.00 196.19 ? 71  DA  I N9    1 
ATOM   9015  C  C8    . DA  I 5 144 ? -1.526  39.733 -88.930 1.00 196.29 ? 71  DA  I C8    1 
ATOM   9016  N  N7    . DA  I 5 144 ? -0.823  40.834 -88.780 1.00 196.34 ? 71  DA  I N7    1 
ATOM   9017  C  C5    . DA  I 5 144 ? -1.671  41.836 -89.225 1.00 196.42 ? 71  DA  I C5    1 
ATOM   9018  C  C6    . DA  I 5 144 ? -1.520  43.246 -89.326 1.00 196.48 ? 71  DA  I C6    1 
ATOM   9019  N  N6    . DA  I 5 144 ? -0.398  43.893 -88.985 1.00 196.43 ? 71  DA  I N6    1 
ATOM   9020  N  N1    . DA  I 5 144 ? -2.566  43.960 -89.824 1.00 196.51 ? 71  DA  I N1    1 
ATOM   9021  C  C2    . DA  I 5 144 ? -3.688  43.306 -90.186 1.00 196.45 ? 71  DA  I C2    1 
ATOM   9022  N  N3    . DA  I 5 144 ? -3.953  41.993 -90.119 1.00 196.41 ? 71  DA  I N3    1 
ATOM   9023  C  C4    . DA  I 5 144 ? -2.891  41.304 -89.633 1.00 196.36 ? 71  DA  I C4    1 
ATOM   9024  P  P     . DT  I 5 145 ? -6.020  36.495 -92.599 1.00 200.24 ? 72  DT  I P     1 
ATOM   9025  O  OP1   . DT  I 5 145 ? -7.461  36.144 -92.655 1.00 200.25 ? 72  DT  I OP1   1 
ATOM   9026  O  OP2   . DT  I 5 145 ? -5.009  35.539 -93.118 1.00 200.41 ? 72  DT  I OP2   1 
ATOM   9027  O  "O5'" . DT  I 5 145 ? -5.804  37.905 -93.338 1.00 201.26 ? 72  DT  I "O5'" 1 
ATOM   9028  C  "C5'" . DT  I 5 145 ? -6.200  38.091 -94.705 1.00 202.30 ? 72  DT  I "C5'" 1 
ATOM   9029  C  "C4'" . DT  I 5 145 ? -6.217  39.572 -95.064 1.00 203.39 ? 72  DT  I "C4'" 1 
ATOM   9030  O  "O4'" . DT  I 5 145 ? -5.387  40.307 -94.127 1.00 203.93 ? 72  DT  I "O4'" 1 
ATOM   9031  C  "C3'" . DT  I 5 145 ? -5.700  39.917 -96.473 1.00 203.81 ? 72  DT  I "C3'" 1 
ATOM   9032  O  "O3'" . DT  I 5 145 ? -6.717  40.589 -97.232 1.00 203.57 ? 72  DT  I "O3'" 1 
ATOM   9033  C  "C2'" . DT  I 5 145 ? -4.483  40.824 -96.224 1.00 204.28 ? 72  DT  I "C2'" 1 
ATOM   9034  C  "C1'" . DT  I 5 145 ? -4.729  41.343 -94.807 1.00 204.49 ? 72  DT  I "C1'" 1 
ATOM   9035  N  N1    . DT  I 5 145 ? -3.458  41.715 -94.043 1.00 205.08 ? 72  DT  I N1    1 
ATOM   9036  C  C2    . DT  I 5 145 ? -3.159  43.060 -93.822 1.00 205.48 ? 72  DT  I C2    1 
ATOM   9037  O  O2    . DT  I 5 145 ? -3.870  43.984 -94.192 1.00 205.56 ? 72  DT  I O2    1 
ATOM   9038  N  N3    . DT  I 5 145 ? -1.988  43.283 -93.131 1.00 205.67 ? 72  DT  I N3    1 
ATOM   9039  C  C4    . DT  I 5 145 ? -1.097  42.329 -92.650 1.00 205.73 ? 72  DT  I C4    1 
ATOM   9040  O  O4    . DT  I 5 145 ? -0.084  42.696 -92.053 1.00 205.92 ? 72  DT  I O4    1 
ATOM   9041  C  C5    . DT  I 5 145 ? -1.461  40.943 -92.916 1.00 205.43 ? 72  DT  I C5    1 
ATOM   9042  C  C7    . DT  I 5 145 ? -0.576  39.821 -92.444 1.00 205.35 ? 72  DT  I C7    1 
ATOM   9043  C  C6    . DT  I 5 145 ? -2.608  40.706 -93.589 1.00 205.23 ? 72  DT  I C6    1 
ATOM   9044  O  "O5'" . DA  J 6 1   ? 4.114   52.333 -91.039 1.00 226.45 ? -72 DA  J "O5'" 1 
ATOM   9045  C  "C5'" . DA  J 6 1   ? 3.572   53.227 -92.015 1.00 226.61 ? -72 DA  J "C5'" 1 
ATOM   9046  C  "C4'" . DA  J 6 1   ? 2.414   52.585 -92.772 1.00 226.71 ? -72 DA  J "C4'" 1 
ATOM   9047  O  "O4'" . DA  J 6 1   ? 2.809   51.276 -93.269 1.00 226.75 ? -72 DA  J "O4'" 1 
ATOM   9048  C  "C3'" . DA  J 6 1   ? 1.127   52.372 -91.955 1.00 226.64 ? -72 DA  J "C3'" 1 
ATOM   9049  O  "O3'" . DA  J 6 1   ? -0.018  52.860 -92.688 1.00 226.29 ? -72 DA  J "O3'" 1 
ATOM   9050  C  "C2'" . DA  J 6 1   ? 1.069   50.852 -91.770 1.00 226.70 ? -72 DA  J "C2'" 1 
ATOM   9051  C  "C1'" . DA  J 6 1   ? 1.770   50.355 -93.026 1.00 226.68 ? -72 DA  J "C1'" 1 
ATOM   9052  N  N9    . DA  J 6 1   ? 2.338   49.011 -92.878 1.00 226.52 ? -72 DA  J N9    1 
ATOM   9053  C  C8    . DA  J 6 1   ? 3.587   48.687 -92.409 1.00 226.47 ? -72 DA  J C8    1 
ATOM   9054  N  N7    . DA  J 6 1   ? 3.808   47.395 -92.332 1.00 226.39 ? -72 DA  J N7    1 
ATOM   9055  C  C5    . DA  J 6 1   ? 2.617   46.826 -92.753 1.00 226.30 ? -72 DA  J C5    1 
ATOM   9056  C  C6    . DA  J 6 1   ? 2.201   45.480 -92.900 1.00 226.07 ? -72 DA  J C6    1 
ATOM   9057  N  N6    . DA  J 6 1   ? 2.986   44.436 -92.620 1.00 225.96 ? -72 DA  J N6    1 
ATOM   9058  N  N1    . DA  J 6 1   ? 0.939   45.253 -93.349 1.00 225.99 ? -72 DA  J N1    1 
ATOM   9059  C  C2    . DA  J 6 1   ? 0.146   46.305 -93.620 1.00 226.00 ? -72 DA  J C2    1 
ATOM   9060  N  N3    . DA  J 6 1   ? 0.427   47.612 -93.531 1.00 226.12 ? -72 DA  J N3    1 
ATOM   9061  C  C4    . DA  J 6 1   ? 1.691   47.808 -93.084 1.00 226.34 ? -72 DA  J C4    1 
ATOM   9062  P  P     . DT  J 6 2   ? -1.288  53.500 -91.927 1.00 225.62 ? -71 DT  J P     1 
ATOM   9063  O  OP1   . DT  J 6 2   ? -1.025  54.946 -91.742 1.00 225.85 ? -71 DT  J OP1   1 
ATOM   9064  O  OP2   . DT  J 6 2   ? -1.606  52.653 -90.746 1.00 225.63 ? -71 DT  J OP2   1 
ATOM   9065  O  "O5'" . DT  J 6 2   ? -2.463  53.323 -93.013 1.00 224.16 ? -71 DT  J "O5'" 1 
ATOM   9066  C  "C5'" . DT  J 6 2   ? -3.832  53.222 -92.605 1.00 222.67 ? -71 DT  J "C5'" 1 
ATOM   9067  C  "C4'" . DT  J 6 2   ? -4.488  51.991 -93.219 1.00 221.16 ? -71 DT  J "C4'" 1 
ATOM   9068  O  "O4'" . DT  J 6 2   ? -3.613  50.841 -93.056 1.00 220.83 ? -71 DT  J "O4'" 1 
ATOM   9069  C  "C3'" . DT  J 6 2   ? -5.841  51.603 -92.616 1.00 220.02 ? -71 DT  J "C3'" 1 
ATOM   9070  O  "O3'" . DT  J 6 2   ? -6.802  51.342 -93.659 1.00 218.61 ? -71 DT  J "O3'" 1 
ATOM   9071  C  "C2'" . DT  J 6 2   ? -5.533  50.351 -91.784 1.00 220.26 ? -71 DT  J "C2'" 1 
ATOM   9072  C  "C1'" . DT  J 6 2   ? -4.325  49.755 -92.499 1.00 220.45 ? -71 DT  J "C1'" 1 
ATOM   9073  N  N1    . DT  J 6 2   ? -3.390  48.970 -91.580 1.00 220.26 ? -71 DT  J N1    1 
ATOM   9074  C  C2    . DT  J 6 2   ? -3.282  47.589 -91.722 1.00 220.21 ? -71 DT  J C2    1 
ATOM   9075  O  O2    . DT  J 6 2   ? -3.885  46.945 -92.565 1.00 220.25 ? -71 DT  J O2    1 
ATOM   9076  N  N3    . DT  J 6 2   ? -2.410  46.988 -90.843 1.00 220.13 ? -71 DT  J N3    1 
ATOM   9077  C  C4    . DT  J 6 2   ? -1.660  47.602 -89.848 1.00 220.09 ? -71 DT  J C4    1 
ATOM   9078  O  O4    . DT  J 6 2   ? -0.926  46.916 -89.140 1.00 220.11 ? -71 DT  J O4    1 
ATOM   9079  C  C5    . DT  J 6 2   ? -1.825  49.045 -89.744 1.00 220.04 ? -71 DT  J C5    1 
ATOM   9080  C  C7    . DT  J 6 2   ? -1.068  49.829 -88.711 1.00 219.99 ? -71 DT  J C7    1 
ATOM   9081  C  C6    . DT  J 6 2   ? -2.673  49.646 -90.599 1.00 220.13 ? -71 DT  J C6    1 
ATOM   9082  P  P     . DC  J 6 3   ? -8.379  51.571 -93.413 1.00 217.22 ? -70 DC  J P     1 
ATOM   9083  O  OP1   . DC  J 6 3   ? -9.067  51.371 -94.712 1.00 217.27 ? -70 DC  J OP1   1 
ATOM   9084  O  OP2   . DC  J 6 3   ? -8.554  52.850 -92.682 1.00 217.16 ? -70 DC  J OP2   1 
ATOM   9085  O  "O5'" . DC  J 6 3   ? -8.767  50.367 -92.412 1.00 215.74 ? -70 DC  J "O5'" 1 
ATOM   9086  C  "C5'" . DC  J 6 3   ? -9.968  49.588 -92.605 1.00 214.25 ? -70 DC  J "C5'" 1 
ATOM   9087  C  "C4'" . DC  J 6 3   ? -9.820  48.171 -92.043 1.00 212.81 ? -70 DC  J "C4'" 1 
ATOM   9088  O  "O4'" . DC  J 6 3   ? -8.494  47.987 -91.469 1.00 212.43 ? -70 DC  J "O4'" 1 
ATOM   9089  C  "C3'" . DC  J 6 3   ? -10.825 47.789 -90.942 1.00 211.76 ? -70 DC  J "C3'" 1 
ATOM   9090  O  "O3'" . DC  J 6 3   ? -11.515 46.566 -91.289 1.00 210.56 ? -70 DC  J "O3'" 1 
ATOM   9091  C  "C2'" . DC  J 6 3   ? -9.954  47.613 -89.690 1.00 211.87 ? -70 DC  J "C2'" 1 
ATOM   9092  C  "C1'" . DC  J 6 3   ? -8.604  47.230 -90.286 1.00 211.89 ? -70 DC  J "C1'" 1 
ATOM   9093  N  N1    . DC  J 6 3   ? -7.409  47.531 -89.380 1.00 211.24 ? -70 DC  J N1    1 
ATOM   9094  C  C2    . DC  J 6 3   ? -6.555  46.482 -88.955 1.00 210.90 ? -70 DC  J C2    1 
ATOM   9095  O  O2    . DC  J 6 3   ? -6.771  45.319 -89.331 1.00 210.75 ? -70 DC  J O2    1 
ATOM   9096  N  N3    . DC  J 6 3   ? -5.497  46.784 -88.150 1.00 210.78 ? -70 DC  J N3    1 
ATOM   9097  C  C4    . DC  J 6 3   ? -5.284  48.050 -87.759 1.00 210.71 ? -70 DC  J C4    1 
ATOM   9098  N  N4    . DC  J 6 3   ? -4.238  48.291 -86.965 1.00 210.63 ? -70 DC  J N4    1 
ATOM   9099  C  C5    . DC  J 6 3   ? -6.138  49.122 -88.166 1.00 210.81 ? -70 DC  J C5    1 
ATOM   9100  C  C6    . DC  J 6 3   ? -7.179  48.822 -88.958 1.00 211.00 ? -70 DC  J C6    1 
ATOM   9101  P  P     . DA  J 6 4   ? -12.942 46.144 -90.627 1.00 209.43 ? -69 DA  J P     1 
ATOM   9102  O  OP1   . DA  J 6 4   ? -13.969 46.172 -91.683 1.00 209.30 ? -69 DA  J OP1   1 
ATOM   9103  O  OP2   . DA  J 6 4   ? -13.135 46.932 -89.392 1.00 209.38 ? -69 DA  J OP2   1 
ATOM   9104  O  "O5'" . DA  J 6 4   ? -12.688 44.639 -90.173 1.00 208.68 ? -69 DA  J "O5'" 1 
ATOM   9105  C  "C5'" . DA  J 6 4   ? -11.428 44.272 -89.564 1.00 207.81 ? -69 DA  J "C5'" 1 
ATOM   9106  C  "C4'" . DA  J 6 4   ? -11.443 42.859 -89.023 1.00 206.78 ? -69 DA  J "C4'" 1 
ATOM   9107  O  "O4'" . DA  J 6 4   ? -10.258 42.672 -88.225 1.00 206.85 ? -69 DA  J "O4'" 1 
ATOM   9108  C  "C3'" . DA  J 6 4   ? -12.578 42.551 -88.059 1.00 205.58 ? -69 DA  J "C3'" 1 
ATOM   9109  O  "O3'" . DA  J 6 4   ? -12.668 41.135 -87.895 1.00 203.84 ? -69 DA  J "O3'" 1 
ATOM   9110  C  "C2'" . DA  J 6 4   ? -12.072 43.167 -86.770 1.00 206.17 ? -69 DA  J "C2'" 1 
ATOM   9111  C  "C1'" . DA  J 6 4   ? -10.552 43.035 -86.879 1.00 206.86 ? -69 DA  J "C1'" 1 
ATOM   9112  N  N9    . DA  J 6 4   ? -9.848  44.282 -86.586 1.00 207.67 ? -69 DA  J N9    1 
ATOM   9113  C  C8    . DA  J 6 4   ? -10.166 45.542 -87.024 1.00 207.93 ? -69 DA  J C8    1 
ATOM   9114  N  N7    . DA  J 6 4   ? -9.351  46.474 -86.595 1.00 208.18 ? -69 DA  J N7    1 
ATOM   9115  C  C5    . DA  J 6 4   ? -8.449  45.784 -85.797 1.00 208.43 ? -69 DA  J C5    1 
ATOM   9116  C  C6    . DA  J 6 4   ? -7.339  46.203 -85.042 1.00 208.72 ? -69 DA  J C6    1 
ATOM   9117  N  N6    . DA  J 6 4   ? -6.932  47.471 -84.963 1.00 208.79 ? -69 DA  J N6    1 
ATOM   9118  N  N1    . DA  J 6 4   ? -6.652  45.261 -84.360 1.00 208.77 ? -69 DA  J N1    1 
ATOM   9119  C  C2    . DA  J 6 4   ? -7.057  43.988 -84.444 1.00 208.73 ? -69 DA  J C2    1 
ATOM   9120  N  N3    . DA  J 6 4   ? -8.071  43.469 -85.132 1.00 208.58 ? -69 DA  J N3    1 
ATOM   9121  C  C4    . DA  J 6 4   ? -8.745  44.434 -85.781 1.00 208.26 ? -69 DA  J C4    1 
ATOM   9122  P  P     . DC  J 6 5   ? -13.757 40.507 -86.914 1.00 202.09 ? -68 DC  J P     1 
ATOM   9123  O  OP1   . DC  J 6 5   ? -14.056 39.136 -87.376 1.00 202.14 ? -68 DC  J OP1   1 
ATOM   9124  O  OP2   . DC  J 6 5   ? -14.856 41.483 -86.749 1.00 202.05 ? -68 DC  J OP2   1 
ATOM   9125  O  "O5'" . DC  J 6 5   ? -12.968 40.339 -85.540 1.00 200.01 ? -68 DC  J "O5'" 1 
ATOM   9126  C  "C5'" . DC  J 6 5   ? -12.197 39.150 -85.274 1.00 197.50 ? -68 DC  J "C5'" 1 
ATOM   9127  C  "C4'" . DC  J 6 5   ? -11.568 39.213 -83.902 1.00 194.94 ? -68 DC  J "C4'" 1 
ATOM   9128  O  "O4'" . DC  J 6 5   ? -10.923 40.494 -83.713 1.00 194.14 ? -68 DC  J "O4'" 1 
ATOM   9129  C  "C3'" . DC  J 6 5   ? -12.547 39.057 -82.739 1.00 193.43 ? -68 DC  J "C3'" 1 
ATOM   9130  O  "O3'" . DC  J 6 5   ? -11.909 38.279 -81.729 1.00 192.10 ? -68 DC  J "O3'" 1 
ATOM   9131  C  "C2'" . DC  J 6 5   ? -12.766 40.487 -82.277 1.00 193.44 ? -68 DC  J "C2'" 1 
ATOM   9132  C  "C1'" . DC  J 6 5   ? -11.395 41.090 -82.516 1.00 193.65 ? -68 DC  J "C1'" 1 
ATOM   9133  N  N1    . DC  J 6 5   ? -11.355 42.547 -82.695 1.00 193.45 ? -68 DC  J N1    1 
ATOM   9134  C  C2    . DC  J 6 5   ? -10.118 43.189 -82.632 1.00 193.26 ? -68 DC  J C2    1 
ATOM   9135  O  O2    . DC  J 6 5   ? -9.103  42.512 -82.420 1.00 192.97 ? -68 DC  J O2    1 
ATOM   9136  N  N3    . DC  J 6 5   ? -10.056 44.528 -82.811 1.00 193.42 ? -68 DC  J N3    1 
ATOM   9137  C  C4    . DC  J 6 5   ? -11.173 45.222 -83.038 1.00 193.43 ? -68 DC  J C4    1 
ATOM   9138  N  N4    . DC  J 6 5   ? -11.066 46.541 -83.203 1.00 193.38 ? -68 DC  J N4    1 
ATOM   9139  C  C5    . DC  J 6 5   ? -12.450 44.593 -83.101 1.00 193.43 ? -68 DC  J C5    1 
ATOM   9140  C  C6    . DC  J 6 5   ? -12.494 43.265 -82.929 1.00 193.45 ? -68 DC  J C6    1 
ATOM   9141  P  P     . DC  J 6 6   ? -12.694 37.110 -81.000 1.00 190.74 ? -67 DC  J P     1 
ATOM   9142  O  OP1   . DC  J 6 6   ? -12.607 35.894 -81.838 1.00 190.83 ? -67 DC  J OP1   1 
ATOM   9143  O  OP2   . DC  J 6 6   ? -14.008 37.628 -80.567 1.00 190.61 ? -67 DC  J OP2   1 
ATOM   9144  O  "O5'" . DC  J 6 6   ? -11.808 36.836 -79.712 1.00 189.47 ? -67 DC  J "O5'" 1 
ATOM   9145  C  "C5'" . DC  J 6 6   ? -10.387 36.685 -79.831 1.00 188.31 ? -67 DC  J "C5'" 1 
ATOM   9146  C  "C4'" . DC  J 6 6   ? -9.696  37.478 -78.747 1.00 187.22 ? -67 DC  J "C4'" 1 
ATOM   9147  O  "O4'" . DC  J 6 6   ? -9.630  38.871 -79.129 1.00 186.95 ? -67 DC  J "O4'" 1 
ATOM   9148  C  "C3'" . DC  J 6 6   ? -10.377 37.439 -77.373 1.00 186.31 ? -67 DC  J "C3'" 1 
ATOM   9149  O  "O3'" . DC  J 6 6   ? -9.440  36.947 -76.408 1.00 185.35 ? -67 DC  J "O3'" 1 
ATOM   9150  C  "C2'" . DC  J 6 6   ? -10.799 38.880 -77.131 1.00 186.49 ? -67 DC  J "C2'" 1 
ATOM   9151  C  "C1'" . DC  J 6 6   ? -9.788  39.636 -77.961 1.00 186.93 ? -67 DC  J "C1'" 1 
ATOM   9152  N  N1    . DC  J 6 6   ? -10.163 41.001 -78.353 1.00 187.56 ? -67 DC  J N1    1 
ATOM   9153  C  C2    . DC  J 6 6   ? -9.256  41.754 -79.099 1.00 187.91 ? -67 DC  J C2    1 
ATOM   9154  O  O2    . DC  J 6 6   ? -8.186  41.230 -79.443 1.00 187.95 ? -67 DC  J O2    1 
ATOM   9155  N  N3    . DC  J 6 6   ? -9.571  43.026 -79.435 1.00 188.05 ? -67 DC  J N3    1 
ATOM   9156  C  C4    . DC  J 6 6   ? -10.738 43.547 -79.054 1.00 187.99 ? -67 DC  J C4    1 
ATOM   9157  N  N4    . DC  J 6 6   ? -11.011 44.802 -79.415 1.00 187.95 ? -67 DC  J N4    1 
ATOM   9158  C  C5    . DC  J 6 6   ? -11.674 42.807 -78.277 1.00 187.95 ? -67 DC  J C5    1 
ATOM   9159  C  C6    . DC  J 6 6   ? -11.352 41.546 -77.959 1.00 187.82 ? -67 DC  J C6    1 
ATOM   9160  P  P     . DC  J 6 7   ? -9.897  36.645 -74.909 1.00 184.66 ? -66 DC  J P     1 
ATOM   9161  O  OP1   . DC  J 6 7   ? -9.188  35.431 -74.431 1.00 184.74 ? -66 DC  J OP1   1 
ATOM   9162  O  OP2   . DC  J 6 7   ? -11.379 36.703 -74.838 1.00 184.45 ? -66 DC  J OP2   1 
ATOM   9163  O  "O5'" . DC  J 6 7   ? -9.317  37.918 -74.135 1.00 184.01 ? -66 DC  J "O5'" 1 
ATOM   9164  C  "C5'" . DC  J 6 7   ? -7.911  38.203 -74.178 1.00 183.14 ? -66 DC  J "C5'" 1 
ATOM   9165  C  "C4'" . DC  J 6 7   ? -7.638  39.650 -73.824 1.00 182.21 ? -66 DC  J "C4'" 1 
ATOM   9166  O  "O4'" . DC  J 6 7   ? -8.368  40.509 -74.718 1.00 182.16 ? -66 DC  J "O4'" 1 
ATOM   9167  C  "C3'" . DC  J 6 7   ? -8.100  40.067 -72.445 1.00 181.63 ? -66 DC  J "C3'" 1 
ATOM   9168  O  "O3'" . DC  J 6 7   ? -7.091  39.740 -71.474 1.00 180.86 ? -66 DC  J "O3'" 1 
ATOM   9169  C  "C2'" . DC  J 6 7   ? -8.279  41.581 -72.598 1.00 181.96 ? -66 DC  J "C2'" 1 
ATOM   9170  C  "C1'" . DC  J 6 7   ? -8.573  41.761 -74.092 1.00 182.11 ? -66 DC  J "C1'" 1 
ATOM   9171  N  N1    . DC  J 6 7   ? -9.982  42.263 -74.391 1.00 182.17 ? -66 DC  J N1    1 
ATOM   9172  C  C2    . DC  J 6 7   ? -10.219 43.650 -74.571 1.00 182.01 ? -66 DC  J C2    1 
ATOM   9173  O  O2    . DC  J 6 7   ? -9.273  44.452 -74.491 1.00 181.78 ? -66 DC  J O2    1 
ATOM   9174  N  N3    . DC  J 6 7   ? -11.493 44.071 -74.835 1.00 182.06 ? -66 DC  J N3    1 
ATOM   9175  C  C4    . DC  J 6 7   ? -12.498 43.180 -74.919 1.00 182.06 ? -66 DC  J C4    1 
ATOM   9176  N  N4    . DC  J 6 7   ? -13.726 43.643 -75.179 1.00 181.99 ? -66 DC  J N4    1 
ATOM   9177  C  C5    . DC  J 6 7   ? -12.285 41.777 -74.720 1.00 182.11 ? -66 DC  J C5    1 
ATOM   9178  C  C6    . DC  J 6 7   ? -11.029 41.368 -74.460 1.00 182.23 ? -66 DC  J C6    1 
ATOM   9179  P  P     . DT  J 6 8   ? -7.466  39.545 -69.917 1.00 179.85 ? -65 DT  J P     1 
ATOM   9180  O  OP1   . DT  J 6 8   ? -6.382  38.756 -69.274 1.00 179.77 ? -65 DT  J OP1   1 
ATOM   9181  O  OP2   . DT  J 6 8   ? -8.872  39.076 -69.829 1.00 179.87 ? -65 DT  J OP2   1 
ATOM   9182  O  "O5'" . DT  J 6 8   ? -7.419  41.038 -69.349 1.00 178.56 ? -65 DT  J "O5'" 1 
ATOM   9183  C  "C5'" . DT  J 6 8   ? -6.232  41.806 -69.463 1.00 177.59 ? -65 DT  J "C5'" 1 
ATOM   9184  C  "C4'" . DT  J 6 8   ? -6.546  43.278 -69.333 1.00 176.99 ? -65 DT  J "C4'" 1 
ATOM   9185  O  "O4'" . DT  J 6 8   ? -7.613  43.635 -70.251 1.00 176.83 ? -65 DT  J "O4'" 1 
ATOM   9186  C  "C3'" . DT  J 6 8   ? -7.004  43.724 -67.943 1.00 176.84 ? -65 DT  J "C3'" 1 
ATOM   9187  O  "O3'" . DT  J 6 8   ? -6.307  44.912 -67.583 1.00 177.03 ? -65 DT  J "O3'" 1 
ATOM   9188  C  "C2'" . DT  J 6 8   ? -8.502  43.977 -68.132 1.00 176.73 ? -65 DT  J "C2'" 1 
ATOM   9189  C  "C1'" . DT  J 6 8   ? -8.549  44.440 -69.582 1.00 176.68 ? -65 DT  J "C1'" 1 
ATOM   9190  N  N1    . DT  J 6 8   ? -9.915  44.304 -70.258 1.00 176.48 ? -65 DT  J N1    1 
ATOM   9191  C  C2    . DT  J 6 8   ? -10.444 45.386 -70.969 1.00 176.39 ? -65 DT  J C2    1 
ATOM   9192  O  O2    . DT  J 6 8   ? -9.862  46.454 -71.116 1.00 176.21 ? -65 DT  J O2    1 
ATOM   9193  N  N3    . DT  J 6 8   ? -11.686 45.159 -71.527 1.00 176.35 ? -65 DT  J N3    1 
ATOM   9194  C  C4    . DT  J 6 8   ? -12.448 43.996 -71.447 1.00 176.22 ? -65 DT  J C4    1 
ATOM   9195  O  O4    . DT  J 6 8   ? -13.549 43.960 -71.997 1.00 175.90 ? -65 DT  J O4    1 
ATOM   9196  C  C5    . DT  J 6 8   ? -11.842 42.902 -70.686 1.00 176.23 ? -65 DT  J C5    1 
ATOM   9197  C  C7    . DT  J 6 8   ? -12.561 41.590 -70.528 1.00 176.00 ? -65 DT  J C7    1 
ATOM   9198  C  C6    . DT  J 6 8   ? -10.625 43.109 -70.137 1.00 176.34 ? -65 DT  J C6    1 
ATOM   9199  P  P     . DA  J 6 9   ? -6.158  45.378 -66.054 1.00 177.47 ? -64 DA  J P     1 
ATOM   9200  O  OP1   . DA  J 6 9   ? -4.731  45.262 -65.683 1.00 177.44 ? -64 DA  J OP1   1 
ATOM   9201  O  OP2   . DA  J 6 9   ? -7.189  44.696 -65.237 1.00 177.14 ? -64 DA  J OP2   1 
ATOM   9202  O  "O5'" . DA  J 6 9   ? -6.544  46.927 -66.122 1.00 178.92 ? -64 DA  J "O5'" 1 
ATOM   9203  C  "C5'" . DA  J 6 9   ? -6.434  47.657 -67.356 1.00 180.33 ? -64 DA  J "C5'" 1 
ATOM   9204  C  "C4'" . DA  J 6 9   ? -7.621  48.591 -67.550 1.00 181.80 ? -64 DA  J "C4'" 1 
ATOM   9205  O  "O4'" . DA  J 6 9   ? -8.728  47.866 -68.141 1.00 182.11 ? -64 DA  J "O4'" 1 
ATOM   9206  C  "C3'" . DA  J 6 9   ? -8.163  49.235 -66.269 1.00 183.05 ? -64 DA  J "C3'" 1 
ATOM   9207  O  "O3'" . DA  J 6 9   ? -8.135  50.654 -66.389 1.00 184.47 ? -64 DA  J "O3'" 1 
ATOM   9208  C  "C2'" . DA  J 6 9   ? -9.592  48.684 -66.138 1.00 182.80 ? -64 DA  J "C2'" 1 
ATOM   9209  C  "C1'" . DA  J 6 9   ? -9.932  48.323 -67.573 1.00 182.52 ? -64 DA  J "C1'" 1 
ATOM   9210  N  N9    . DA  J 6 9   ? -10.942 47.264 -67.696 1.00 182.66 ? -64 DA  J N9    1 
ATOM   9211  C  C8    . DA  J 6 9   ? -10.890 46.002 -67.160 1.00 182.60 ? -64 DA  J C8    1 
ATOM   9212  N  N7    . DA  J 6 9   ? -11.918 45.246 -67.463 1.00 182.63 ? -64 DA  J N7    1 
ATOM   9213  C  C5    . DA  J 6 9   ? -12.727 46.074 -68.223 1.00 182.75 ? -64 DA  J C5    1 
ATOM   9214  C  C6    . DA  J 6 9   ? -13.982 45.872 -68.852 1.00 182.77 ? -64 DA  J C6    1 
ATOM   9215  N  N6    . DA  J 6 9   ? -14.664 44.724 -68.779 1.00 182.67 ? -64 DA  J N6    1 
ATOM   9216  N  N1    . DA  J 6 9   ? -14.528 46.919 -69.526 1.00 182.92 ? -64 DA  J N1    1 
ATOM   9217  C  C2    . DA  J 6 9   ? -13.857 48.087 -69.571 1.00 182.98 ? -64 DA  J C2    1 
ATOM   9218  N  N3    . DA  J 6 9   ? -12.657 48.387 -69.055 1.00 182.96 ? -64 DA  J N3    1 
ATOM   9219  C  C4    . DA  J 6 9   ? -12.144 47.330 -68.375 1.00 182.85 ? -64 DA  J C4    1 
ATOM   9220  P  P     . DA  J 6 10  ? -8.403  51.597 -65.117 1.00 185.81 ? -63 DA  J P     1 
ATOM   9221  O  OP1   . DA  J 6 10  ? -7.686  52.873 -65.342 1.00 186.01 ? -63 DA  J OP1   1 
ATOM   9222  O  OP2   . DA  J 6 10  ? -8.142  50.822 -63.881 1.00 185.59 ? -63 DA  J OP2   1 
ATOM   9223  O  "O5'" . DA  J 6 10  ? -9.983  51.861 -65.204 1.00 186.98 ? -63 DA  J "O5'" 1 
ATOM   9224  C  "C5'" . DA  J 6 10  ? -10.588 52.286 -66.432 1.00 188.14 ? -63 DA  J "C5'" 1 
ATOM   9225  C  "C4'" . DA  J 6 10  ? -12.104 52.300 -66.317 1.00 189.70 ? -63 DA  J "C4'" 1 
ATOM   9226  O  "O4'" . DA  J 6 10  ? -12.637 50.986 -66.621 1.00 189.95 ? -63 DA  J "O4'" 1 
ATOM   9227  C  "C3'" . DA  J 6 10  ? -12.665 52.678 -64.931 1.00 191.32 ? -63 DA  J "C3'" 1 
ATOM   9228  O  "O3'" . DA  J 6 10  ? -13.567 53.800 -65.045 1.00 193.58 ? -63 DA  J "O3'" 1 
ATOM   9229  C  "C2'" . DA  J 6 10  ? -13.397 51.411 -64.480 1.00 190.76 ? -63 DA  J "C2'" 1 
ATOM   9230  C  "C1'" . DA  J 6 10  ? -13.765 50.786 -65.813 1.00 190.47 ? -63 DA  J "C1'" 1 
ATOM   9231  N  N9    . DA  J 6 10  ? -14.084 49.355 -65.734 1.00 190.86 ? -63 DA  J N9    1 
ATOM   9232  C  C8    . DA  J 6 10  ? -13.450 48.407 -64.968 1.00 190.93 ? -63 DA  J C8    1 
ATOM   9233  N  N7    . DA  J 6 10  ? -13.997 47.215 -65.032 1.00 191.03 ? -63 DA  J N7    1 
ATOM   9234  C  C5    . DA  J 6 10  ? -15.084 47.388 -65.875 1.00 191.22 ? -63 DA  J C5    1 
ATOM   9235  C  C6    . DA  J 6 10  ? -16.085 46.495 -66.347 1.00 191.37 ? -63 DA  J C6    1 
ATOM   9236  N  N6    . DA  J 6 10  ? -16.120 45.194 -66.029 1.00 191.35 ? -63 DA  J N6    1 
ATOM   9237  N  N1    . DA  J 6 10  ? -17.028 46.990 -67.195 1.00 191.36 ? -63 DA  J N1    1 
ATOM   9238  C  C2    . DA  J 6 10  ? -16.978 48.291 -67.533 1.00 191.19 ? -63 DA  J C2    1 
ATOM   9239  N  N3    . DA  J 6 10  ? -16.098 49.229 -67.145 1.00 191.10 ? -63 DA  J N3    1 
ATOM   9240  C  C4    . DA  J 6 10  ? -15.168 48.709 -66.305 1.00 191.10 ? -63 DA  J C4    1 
ATOM   9241  P  P     . DC  J 6 11  ? -13.926 54.732 -63.774 1.00 195.36 ? -62 DC  J P     1 
ATOM   9242  O  OP1   . DC  J 6 11  ? -13.412 56.097 -64.050 1.00 195.37 ? -62 DC  J OP1   1 
ATOM   9243  O  OP2   . DC  J 6 11  ? -13.514 54.031 -62.530 1.00 195.43 ? -62 DC  J OP2   1 
ATOM   9244  O  "O5'" . DC  J 6 11  ? -15.530 54.759 -63.808 1.00 196.47 ? -62 DC  J "O5'" 1 
ATOM   9245  C  "C5'" . DC  J 6 11  ? -16.206 55.543 -64.784 1.00 197.78 ? -62 DC  J "C5'" 1 
ATOM   9246  C  "C4'" . DC  J 6 11  ? -17.396 54.803 -65.374 1.00 199.23 ? -62 DC  J "C4'" 1 
ATOM   9247  O  "O4'" . DC  J 6 11  ? -17.015 53.468 -65.780 1.00 199.58 ? -62 DC  J "O4'" 1 
ATOM   9248  C  "C3'" . DC  J 6 11  ? -18.555 54.560 -64.434 1.00 200.32 ? -62 DC  J "C3'" 1 
ATOM   9249  O  "O3'" . DC  J 6 11  ? -19.328 55.755 -64.255 1.00 201.43 ? -62 DC  J "O3'" 1 
ATOM   9250  C  "C2'" . DC  J 6 11  ? -19.322 53.492 -65.206 1.00 200.16 ? -62 DC  J "C2'" 1 
ATOM   9251  C  "C1'" . DC  J 6 11  ? -18.184 52.650 -65.797 1.00 199.90 ? -62 DC  J "C1'" 1 
ATOM   9252  N  N1    . DC  J 6 11  ? -17.927 51.350 -65.035 1.00 199.87 ? -62 DC  J N1    1 
ATOM   9253  C  C2    . DC  J 6 11  ? -18.705 50.198 -65.317 1.00 199.77 ? -62 DC  J C2    1 
ATOM   9254  O  O2    . DC  J 6 11  ? -19.558 50.235 -66.219 1.00 199.72 ? -62 DC  J O2    1 
ATOM   9255  N  N3    . DC  J 6 11  ? -18.461 49.054 -64.613 1.00 199.75 ? -62 DC  J N3    1 
ATOM   9256  C  C4    . DC  J 6 11  ? -17.513 49.031 -63.663 1.00 199.76 ? -62 DC  J C4    1 
ATOM   9257  N  N4    . DC  J 6 11  ? -17.314 47.885 -63.005 1.00 199.73 ? -62 DC  J N4    1 
ATOM   9258  C  C5    . DC  J 6 11  ? -16.735 50.189 -63.343 1.00 199.79 ? -62 DC  J C5    1 
ATOM   9259  C  C6    . DC  J 6 11  ? -16.982 51.317 -64.033 1.00 199.86 ? -62 DC  J C6    1 
ATOM   9260  P  P     . DC  J 6 12  ? -20.067 56.040 -62.852 1.00 202.24 ? -61 DC  J P     1 
ATOM   9261  O  OP1   . DC  J 6 12  ? -20.576 57.434 -62.883 1.00 202.30 ? -61 DC  J OP1   1 
ATOM   9262  O  OP2   . DC  J 6 12  ? -19.162 55.615 -61.752 1.00 202.28 ? -61 DC  J OP2   1 
ATOM   9263  O  "O5'" . DC  J 6 12  ? -21.313 55.017 -62.884 1.00 202.51 ? -61 DC  J "O5'" 1 
ATOM   9264  C  "C5'" . DC  J 6 12  ? -22.378 55.197 -63.834 1.00 202.67 ? -61 DC  J "C5'" 1 
ATOM   9265  C  "C4'" . DC  J 6 12  ? -23.180 53.915 -64.042 1.00 202.82 ? -61 DC  J "C4'" 1 
ATOM   9266  O  "O4'" . DC  J 6 12  ? -22.309 52.824 -64.431 1.00 202.90 ? -61 DC  J "O4'" 1 
ATOM   9267  C  "C3'" . DC  J 6 12  ? -23.899 53.376 -62.823 1.00 202.84 ? -61 DC  J "C3'" 1 
ATOM   9268  O  "O3'" . DC  J 6 12  ? -25.095 54.109 -62.580 1.00 202.72 ? -61 DC  J "O3'" 1 
ATOM   9269  C  "C2'" . DC  J 6 12  ? -24.191 51.948 -63.275 1.00 202.87 ? -61 DC  J "C2'" 1 
ATOM   9270  C  "C1'" . DC  J 6 12  ? -22.908 51.591 -64.036 1.00 202.77 ? -61 DC  J "C1'" 1 
ATOM   9271  N  N1    . DC  J 6 12  ? -21.921 50.762 -63.206 1.00 202.39 ? -61 DC  J N1    1 
ATOM   9272  C  C2    . DC  J 6 12  ? -22.104 49.359 -63.093 1.00 202.18 ? -61 DC  J C2    1 
ATOM   9273  O  O2    . DC  J 6 12  ? -23.033 48.807 -63.709 1.00 202.12 ? -61 DC  J O2    1 
ATOM   9274  N  N3    . DC  J 6 12  ? -21.238 48.645 -62.315 1.00 201.95 ? -61 DC  J N3    1 
ATOM   9275  C  C4    . DC  J 6 12  ? -20.246 49.267 -61.661 1.00 201.75 ? -61 DC  J C4    1 
ATOM   9276  N  N4    . DC  J 6 12  ? -19.436 48.523 -60.903 1.00 201.56 ? -61 DC  J N4    1 
ATOM   9277  C  C5    . DC  J 6 12  ? -20.055 50.684 -61.744 1.00 201.88 ? -61 DC  J C5    1 
ATOM   9278  C  C6    . DC  J 6 12  ? -20.907 51.386 -62.510 1.00 202.10 ? -61 DC  J C6    1 
ATOM   9279  P  P     . DC  J 6 13  ? -25.534 54.471 -61.076 1.00 202.46 ? -60 DC  J P     1 
ATOM   9280  O  OP1   . DC  J 6 13  ? -26.707 55.381 -61.158 1.00 202.72 ? -60 DC  J OP1   1 
ATOM   9281  O  OP2   . DC  J 6 13  ? -24.321 54.891 -60.327 1.00 202.32 ? -60 DC  J OP2   1 
ATOM   9282  O  "O5'" . DC  J 6 13  ? -26.006 53.065 -60.475 1.00 201.61 ? -60 DC  J "O5'" 1 
ATOM   9283  C  "C5'" . DC  J 6 13  ? -27.101 52.350 -61.057 1.00 200.71 ? -60 DC  J "C5'" 1 
ATOM   9284  C  "C4'" . DC  J 6 13  ? -27.059 50.891 -60.637 1.00 199.77 ? -60 DC  J "C4'" 1 
ATOM   9285  O  "O4'" . DC  J 6 13  ? -25.683 50.416 -60.663 1.00 199.60 ? -60 DC  J "O4'" 1 
ATOM   9286  C  "C3'" . DC  J 6 13  ? -27.582 50.623 -59.226 1.00 199.02 ? -60 DC  J "C3'" 1 
ATOM   9287  O  "O3'" . DC  J 6 13  ? -28.467 49.507 -59.223 1.00 198.21 ? -60 DC  J "O3'" 1 
ATOM   9288  C  "C2'" . DC  J 6 13  ? -26.319 50.347 -58.414 1.00 199.22 ? -60 DC  J "C2'" 1 
ATOM   9289  C  "C1'" . DC  J 6 13  ? -25.395 49.741 -59.463 1.00 199.44 ? -60 DC  J "C1'" 1 
ATOM   9290  N  N1    . DC  J 6 13  ? -23.906 49.877 -59.141 1.00 199.45 ? -60 DC  J N1    1 
ATOM   9291  C  C2    . DC  J 6 13  ? -23.082 48.720 -59.111 1.00 199.42 ? -60 DC  J C2    1 
ATOM   9292  O  O2    . DC  J 6 13  ? -23.565 47.615 -59.408 1.00 199.29 ? -60 DC  J O2    1 
ATOM   9293  N  N3    . DC  J 6 13  ? -21.762 48.858 -58.786 1.00 199.34 ? -60 DC  J N3    1 
ATOM   9294  C  C4    . DC  J 6 13  ? -21.264 50.068 -58.482 1.00 199.21 ? -60 DC  J C4    1 
ATOM   9295  N  N4    . DC  J 6 13  ? -19.965 50.147 -58.178 1.00 199.08 ? -60 DC  J N4    1 
ATOM   9296  C  C5    . DC  J 6 13  ? -22.080 51.251 -58.490 1.00 199.19 ? -60 DC  J C5    1 
ATOM   9297  C  C6    . DC  J 6 13  ? -23.378 51.113 -58.819 1.00 199.27 ? -60 DC  J C6    1 
ATOM   9298  P  P     . DT  J 6 14  ? -29.795 49.533 -58.321 1.00 197.51 ? -59 DT  J P     1 
ATOM   9299  O  OP1   . DT  J 6 14  ? -30.947 49.815 -59.210 1.00 197.56 ? -59 DT  J OP1   1 
ATOM   9300  O  OP2   . DT  J 6 14  ? -29.538 50.401 -57.143 1.00 197.46 ? -59 DT  J OP2   1 
ATOM   9301  O  "O5'" . DT  J 6 14  ? -29.911 48.029 -57.791 1.00 196.57 ? -59 DT  J "O5'" 1 
ATOM   9302  C  "C5'" . DT  J 6 14  ? -29.832 46.929 -58.695 1.00 195.56 ? -59 DT  J "C5'" 1 
ATOM   9303  C  "C4'" . DT  J 6 14  ? -28.904 45.861 -58.143 1.00 194.54 ? -59 DT  J "C4'" 1 
ATOM   9304  O  "O4'" . DT  J 6 14  ? -27.582 46.421 -57.970 1.00 194.46 ? -59 DT  J "O4'" 1 
ATOM   9305  C  "C3'" . DT  J 6 14  ? -29.320 45.286 -56.787 1.00 193.56 ? -59 DT  J "C3'" 1 
ATOM   9306  O  "O3'" . DT  J 6 14  ? -29.433 43.872 -56.862 1.00 192.30 ? -59 DT  J "O3'" 1 
ATOM   9307  C  "C2'" . DT  J 6 14  ? -28.219 45.725 -55.817 1.00 193.91 ? -59 DT  J "C2'" 1 
ATOM   9308  C  "C1'" . DT  J 6 14  ? -27.039 46.011 -56.740 1.00 194.35 ? -59 DT  J "C1'" 1 
ATOM   9309  N  N1    . DT  J 6 14  ? -26.106 47.112 -56.238 1.00 194.64 ? -59 DT  J N1    1 
ATOM   9310  C  C2    . DT  J 6 14  ? -24.736 47.004 -56.464 1.00 194.57 ? -59 DT  J C2    1 
ATOM   9311  O  O2    . DT  J 6 14  ? -24.222 46.064 -57.051 1.00 194.30 ? -59 DT  J O2    1 
ATOM   9312  N  N3    . DT  J 6 14  ? -23.986 48.059 -55.980 1.00 194.79 ? -59 DT  J N3    1 
ATOM   9313  C  C4    . DT  J 6 14  ? -24.454 49.196 -55.316 1.00 194.86 ? -59 DT  J C4    1 
ATOM   9314  O  O4    . DT  J 6 14  ? -23.650 50.053 -54.942 1.00 194.84 ? -59 DT  J O4    1 
ATOM   9315  C  C5    . DT  J 6 14  ? -25.897 49.241 -55.098 1.00 194.75 ? -59 DT  J C5    1 
ATOM   9316  C  C7    . DT  J 6 14  ? -26.526 50.406 -54.385 1.00 194.59 ? -59 DT  J C7    1 
ATOM   9317  C  C6    . DT  J 6 14  ? -26.642 48.219 -55.574 1.00 194.76 ? -59 DT  J C6    1 
ATOM   9318  P  P     . DA  J 6 15  ? -30.290 43.061 -55.769 1.00 190.91 ? -58 DA  J P     1 
ATOM   9319  O  OP1   . DA  J 6 15  ? -30.927 41.903 -56.451 1.00 190.93 ? -58 DA  J OP1   1 
ATOM   9320  O  OP2   . DA  J 6 15  ? -31.132 44.025 -55.014 1.00 191.07 ? -58 DA  J OP2   1 
ATOM   9321  O  "O5'" . DA  J 6 15  ? -29.155 42.529 -54.775 1.00 188.63 ? -58 DA  J "O5'" 1 
ATOM   9322  C  "C5'" . DA  J 6 15  ? -28.159 41.633 -55.252 1.00 186.26 ? -58 DA  J "C5'" 1 
ATOM   9323  C  "C4'" . DA  J 6 15  ? -26.908 41.679 -54.394 1.00 183.98 ? -58 DA  J "C4'" 1 
ATOM   9324  O  "O4'" . DA  J 6 15  ? -26.198 42.913 -54.613 1.00 183.46 ? -58 DA  J "O4'" 1 
ATOM   9325  C  "C3'" . DA  J 6 15  ? -27.123 41.665 -52.894 1.00 182.16 ? -58 DA  J "C3'" 1 
ATOM   9326  O  "O3'" . DA  J 6 15  ? -27.422 40.330 -52.433 1.00 179.65 ? -58 DA  J "O3'" 1 
ATOM   9327  C  "C2'" . DA  J 6 15  ? -25.757 42.143 -52.408 1.00 182.65 ? -58 DA  J "C2'" 1 
ATOM   9328  C  "C1'" . DA  J 6 15  ? -25.329 43.121 -53.511 1.00 182.95 ? -58 DA  J "C1'" 1 
ATOM   9329  N  N9    . DA  J 6 15  ? -25.391 44.523 -53.100 1.00 182.61 ? -58 DA  J N9    1 
ATOM   9330  C  C8    . DA  J 6 15  ? -26.487 45.205 -52.649 1.00 182.53 ? -58 DA  J C8    1 
ATOM   9331  N  N7    . DA  J 6 15  ? -26.237 46.443 -52.300 1.00 182.56 ? -58 DA  J N7    1 
ATOM   9332  C  C5    . DA  J 6 15  ? -24.878 46.582 -52.513 1.00 182.42 ? -58 DA  J C5    1 
ATOM   9333  C  C6    . DA  J 6 15  ? -23.992 47.675 -52.353 1.00 182.29 ? -58 DA  J C6    1 
ATOM   9334  N  N6    . DA  J 6 15  ? -24.379 48.879 -51.911 1.00 182.33 ? -58 DA  J N6    1 
ATOM   9335  N  N1    . DA  J 6 15  ? -22.685 47.474 -52.650 1.00 182.21 ? -58 DA  J N1    1 
ATOM   9336  C  C2    . DA  J 6 15  ? -22.299 46.264 -53.087 1.00 182.29 ? -58 DA  J C2    1 
ATOM   9337  N  N3    . DA  J 6 15  ? -23.040 45.169 -53.286 1.00 182.41 ? -58 DA  J N3    1 
ATOM   9338  C  C4    . DA  J 6 15  ? -24.334 45.399 -52.985 1.00 182.46 ? -58 DA  J C4    1 
ATOM   9339  P  P     . DA  J 6 16  ? -28.015 40.069 -50.949 1.00 176.74 ? -57 DA  J P     1 
ATOM   9340  O  OP1   . DA  J 6 16  ? -28.888 38.872 -51.008 1.00 176.96 ? -57 DA  J OP1   1 
ATOM   9341  O  OP2   . DA  J 6 16  ? -28.555 41.352 -50.423 1.00 176.85 ? -57 DA  J OP2   1 
ATOM   9342  O  "O5'" . DA  J 6 16  ? -26.709 39.702 -50.098 1.00 172.85 ? -57 DA  J "O5'" 1 
ATOM   9343  C  "C5'" . DA  J 6 16  ? -25.725 38.813 -50.631 1.00 168.95 ? -57 DA  J "C5'" 1 
ATOM   9344  C  "C4'" . DA  J 6 16  ? -24.340 39.178 -50.122 1.00 165.09 ? -57 DA  J "C4'" 1 
ATOM   9345  O  "O4'" . DA  J 6 16  ? -24.054 40.576 -50.394 1.00 164.06 ? -57 DA  J "O4'" 1 
ATOM   9346  C  "C3'" . DA  J 6 16  ? -24.125 38.978 -48.624 1.00 162.23 ? -57 DA  J "C3'" 1 
ATOM   9347  O  "O3'" . DA  J 6 16  ? -22.892 38.328 -48.413 1.00 159.09 ? -57 DA  J "O3'" 1 
ATOM   9348  C  "C2'" . DA  J 6 16  ? -24.108 40.403 -48.071 1.00 162.72 ? -57 DA  J "C2'" 1 
ATOM   9349  C  "C1'" . DA  J 6 16  ? -23.527 41.182 -49.239 1.00 163.51 ? -57 DA  J "C1'" 1 
ATOM   9350  N  N9    . DA  J 6 16  ? -23.889 42.602 -49.241 1.00 164.11 ? -57 DA  J N9    1 
ATOM   9351  C  C8    . DA  J 6 16  ? -25.150 43.135 -49.126 1.00 164.49 ? -57 DA  J C8    1 
ATOM   9352  N  N7    . DA  J 6 16  ? -25.183 44.448 -49.152 1.00 164.51 ? -57 DA  J N7    1 
ATOM   9353  C  C5    . DA  J 6 16  ? -23.856 44.807 -49.272 1.00 164.52 ? -57 DA  J C5    1 
ATOM   9354  C  C6    . DA  J 6 16  ? -23.222 46.062 -49.350 1.00 164.65 ? -57 DA  J C6    1 
ATOM   9355  N  N6    . DA  J 6 16  ? -23.891 47.213 -49.288 1.00 164.57 ? -57 DA  J N6    1 
ATOM   9356  N  N1    . DA  J 6 16  ? -21.864 46.086 -49.456 1.00 164.86 ? -57 DA  J N1    1 
ATOM   9357  C  C2    . DA  J 6 16  ? -21.195 44.917 -49.494 1.00 164.79 ? -57 DA  J C2    1 
ATOM   9358  N  N3    . DA  J 6 16  ? -21.685 43.669 -49.439 1.00 164.66 ? -57 DA  J N3    1 
ATOM   9359  C  C4    . DA  J 6 16  ? -23.036 43.683 -49.320 1.00 164.45 ? -57 DA  J C4    1 
ATOM   9360  P  P     . DC  J 6 17  ? -22.689 37.311 -47.191 1.00 156.10 ? -56 DC  J P     1 
ATOM   9361  O  OP1   . DC  J 6 17  ? -22.997 35.945 -47.678 1.00 156.48 ? -56 DC  J OP1   1 
ATOM   9362  O  OP2   . DC  J 6 17  ? -23.409 37.852 -46.005 1.00 155.66 ? -56 DC  J OP2   1 
ATOM   9363  O  "O5'" . DC  J 6 17  ? -21.103 37.400 -46.907 1.00 152.56 ? -56 DC  J "O5'" 1 
ATOM   9364  C  "C5'" . DC  J 6 17  ? -20.218 38.060 -47.843 1.00 148.78 ? -56 DC  J "C5'" 1 
ATOM   9365  C  "C4'" . DC  J 6 17  ? -19.464 39.217 -47.185 1.00 145.21 ? -56 DC  J "C4'" 1 
ATOM   9366  O  "O4'" . DC  J 6 17  ? -20.286 40.418 -47.146 1.00 144.68 ? -56 DC  J "O4'" 1 
ATOM   9367  C  "C3'" . DC  J 6 17  ? -19.001 38.976 -45.752 1.00 142.24 ? -56 DC  J "C3'" 1 
ATOM   9368  O  "O3'" . DC  J 6 17  ? -17.700 39.451 -45.603 1.00 138.58 ? -56 DC  J "O3'" 1 
ATOM   9369  C  "C2'" . DC  J 6 17  ? -19.980 39.797 -44.921 1.00 143.16 ? -56 DC  J "C2'" 1 
ATOM   9370  C  "C1'" . DC  J 6 17  ? -20.244 40.971 -45.850 1.00 144.24 ? -56 DC  J "C1'" 1 
ATOM   9371  N  N1    . DC  J 6 17  ? -21.546 41.711 -45.579 1.00 145.27 ? -56 DC  J N1    1 
ATOM   9372  C  C2    . DC  J 6 17  ? -21.677 43.077 -45.958 1.00 146.34 ? -56 DC  J C2    1 
ATOM   9373  O  O2    . DC  J 6 17  ? -20.729 43.660 -46.518 1.00 146.87 ? -56 DC  J O2    1 
ATOM   9374  N  N3    . DC  J 6 17  ? -22.853 43.722 -45.692 1.00 146.19 ? -56 DC  J N3    1 
ATOM   9375  C  C4    . DC  J 6 17  ? -23.857 43.074 -45.082 1.00 145.71 ? -56 DC  J C4    1 
ATOM   9376  N  N4    . DC  J 6 17  ? -24.982 43.753 -44.851 1.00 145.60 ? -56 DC  J N4    1 
ATOM   9377  C  C5    . DC  J 6 17  ? -23.744 41.703 -44.678 1.00 145.36 ? -56 DC  J C5    1 
ATOM   9378  C  C6    . DC  J 6 17  ? -22.584 41.070 -44.934 1.00 145.21 ? -56 DC  J C6    1 
ATOM   9379  P  P     . DC  J 6 18  ? -16.661 38.663 -44.697 1.00 135.11 ? -55 DC  J P     1 
ATOM   9380  O  OP1   . DC  J 6 18  ? -15.870 37.788 -45.585 1.00 134.02 ? -55 DC  J OP1   1 
ATOM   9381  O  OP2   . DC  J 6 18  ? -17.399 38.101 -43.541 1.00 134.89 ? -55 DC  J OP2   1 
ATOM   9382  O  "O5'" . DC  J 6 18  ? -15.711 39.821 -44.147 1.00 133.67 ? -55 DC  J "O5'" 1 
ATOM   9383  C  "C5'" . DC  J 6 18  ? -15.279 40.870 -45.012 1.00 132.12 ? -55 DC  J "C5'" 1 
ATOM   9384  C  "C4'" . DC  J 6 18  ? -15.320 42.215 -44.298 1.00 130.56 ? -55 DC  J "C4'" 1 
ATOM   9385  O  "O4'" . DC  J 6 18  ? -16.693 42.678 -44.144 1.00 129.91 ? -55 DC  J "O4'" 1 
ATOM   9386  C  "C3'" . DC  J 6 18  ? -14.698 42.232 -42.904 1.00 129.94 ? -55 DC  J "C3'" 1 
ATOM   9387  O  "O3'" . DC  J 6 18  ? -13.930 43.385 -42.762 1.00 130.01 ? -55 DC  J "O3'" 1 
ATOM   9388  C  "C2'" . DC  J 6 18  ? -15.910 42.255 -41.977 1.00 129.73 ? -55 DC  J "C2'" 1 
ATOM   9389  C  "C1'" . DC  J 6 18  ? -16.907 43.055 -42.805 1.00 130.31 ? -55 DC  J "C1'" 1 
ATOM   9390  N  N1    . DC  J 6 18  ? -18.338 42.809 -42.460 1.00 132.14 ? -55 DC  J N1    1 
ATOM   9391  C  C2    . DC  J 6 18  ? -19.271 43.853 -42.581 1.00 133.12 ? -55 DC  J C2    1 
ATOM   9392  O  O2    . DC  J 6 18  ? -18.887 44.981 -42.951 1.00 133.44 ? -55 DC  J O2    1 
ATOM   9393  N  N3    . DC  J 6 18  ? -20.581 43.602 -42.265 1.00 133.64 ? -55 DC  J N3    1 
ATOM   9394  C  C4    . DC  J 6 18  ? -20.962 42.385 -41.849 1.00 133.74 ? -55 DC  J C4    1 
ATOM   9395  N  N4    . DC  J 6 18  ? -22.255 42.198 -41.559 1.00 133.84 ? -55 DC  J N4    1 
ATOM   9396  C  C5    . DC  J 6 18  ? -20.028 41.311 -41.709 1.00 133.98 ? -55 DC  J C5    1 
ATOM   9397  C  C6    . DC  J 6 18  ? -18.740 41.562 -42.023 1.00 133.60 ? -55 DC  J C6    1 
ATOM   9398  P  P     . DC  J 6 19  ? -12.538 43.359 -42.016 1.00 130.32 ? -54 DC  J P     1 
ATOM   9399  O  OP1   . DC  J 6 19  ? -11.513 42.965 -42.996 1.00 129.63 ? -54 DC  J OP1   1 
ATOM   9400  O  OP2   . DC  J 6 19  ? -12.692 42.609 -40.760 1.00 129.62 ? -54 DC  J OP2   1 
ATOM   9401  O  "O5'" . DC  J 6 19  ? -12.343 44.895 -41.633 1.00 133.52 ? -54 DC  J "O5'" 1 
ATOM   9402  C  "C5'" . DC  J 6 19  ? -12.592 45.904 -42.588 1.00 136.69 ? -54 DC  J "C5'" 1 
ATOM   9403  C  "C4'" . DC  J 6 19  ? -13.694 46.823 -42.108 1.00 140.51 ? -54 DC  J "C4'" 1 
ATOM   9404  O  "O4'" . DC  J 6 19  ? -14.851 46.055 -41.743 1.00 141.84 ? -54 DC  J "O4'" 1 
ATOM   9405  C  "C3'" . DC  J 6 19  ? -13.356 47.669 -40.886 1.00 142.91 ? -54 DC  J "C3'" 1 
ATOM   9406  O  "O3'" . DC  J 6 19  ? -13.221 49.002 -41.287 1.00 145.66 ? -54 DC  J "O3'" 1 
ATOM   9407  C  "C2'" . DC  J 6 19  ? -14.555 47.487 -39.931 1.00 142.73 ? -54 DC  J "C2'" 1 
ATOM   9408  C  "C1'" . DC  J 6 19  ? -15.593 46.797 -40.810 1.00 142.50 ? -54 DC  J "C1'" 1 
ATOM   9409  N  N1    . DC  J 6 19  ? -16.531 45.851 -40.065 1.00 143.07 ? -54 DC  J N1    1 
ATOM   9410  C  C2    . DC  J 6 19  ? -17.921 46.103 -40.048 1.00 143.06 ? -54 DC  J C2    1 
ATOM   9411  O  O2    . DC  J 6 19  ? -18.367 47.109 -40.604 1.00 143.49 ? -54 DC  J O2    1 
ATOM   9412  N  N3    . DC  J 6 19  ? -18.741 45.228 -39.408 1.00 143.13 ? -54 DC  J N3    1 
ATOM   9413  C  C4    . DC  J 6 19  ? -18.237 44.132 -38.819 1.00 143.51 ? -54 DC  J C4    1 
ATOM   9414  N  N4    . DC  J 6 19  ? -19.092 43.296 -38.230 1.00 143.46 ? -54 DC  J N4    1 
ATOM   9415  C  C5    . DC  J 6 19  ? -16.832 43.837 -38.833 1.00 143.87 ? -54 DC  J C5    1 
ATOM   9416  C  C6    . DC  J 6 19  ? -16.023 44.718 -39.454 1.00 143.84 ? -54 DC  J C6    1 
ATOM   9417  P  P     . DT  J 6 20  ? -12.188 49.969 -40.560 1.00 148.11 ? -53 DT  J P     1 
ATOM   9418  O  OP1   . DT  J 6 20  ? -11.965 51.124 -41.458 1.00 148.46 ? -53 DT  J OP1   1 
ATOM   9419  O  OP2   . DT  J 6 20  ? -11.037 49.172 -40.092 1.00 148.16 ? -53 DT  J OP2   1 
ATOM   9420  O  "O5'" . DT  J 6 20  ? -13.012 50.441 -39.276 1.00 150.74 ? -53 DT  J "O5'" 1 
ATOM   9421  C  "C5'" . DT  J 6 20  ? -13.925 51.520 -39.381 1.00 152.97 ? -53 DT  J "C5'" 1 
ATOM   9422  C  "C4'" . DT  J 6 20  ? -14.911 51.504 -38.238 1.00 155.34 ? -53 DT  J "C4'" 1 
ATOM   9423  O  "O4'" . DT  J 6 20  ? -15.521 50.198 -38.116 1.00 155.74 ? -53 DT  J "O4'" 1 
ATOM   9424  C  "C3'" . DT  J 6 20  ? -14.336 51.843 -36.850 1.00 157.68 ? -53 DT  J "C3'" 1 
ATOM   9425  O  "O3'" . DT  J 6 20  ? -15.093 52.930 -36.294 1.00 160.71 ? -53 DT  J "O3'" 1 
ATOM   9426  C  "C2'" . DT  J 6 20  ? -14.567 50.547 -36.055 1.00 157.11 ? -53 DT  J "C2'" 1 
ATOM   9427  C  "C1'" . DT  J 6 20  ? -15.801 50.012 -36.764 1.00 156.79 ? -53 DT  J "C1'" 1 
ATOM   9428  N  N1    . DT  J 6 20  ? -16.172 48.555 -36.490 1.00 157.74 ? -53 DT  J N1    1 
ATOM   9429  C  C2    . DT  J 6 20  ? -17.525 48.198 -36.454 1.00 157.91 ? -53 DT  J C2    1 
ATOM   9430  O  O2    . DT  J 6 20  ? -18.437 48.977 -36.678 1.00 157.95 ? -53 DT  J O2    1 
ATOM   9431  N  N3    . DT  J 6 20  ? -17.769 46.880 -36.162 1.00 158.05 ? -53 DT  J N3    1 
ATOM   9432  C  C4    . DT  J 6 20  ? -16.834 45.890 -35.889 1.00 158.63 ? -53 DT  J C4    1 
ATOM   9433  O  O4    . DT  J 6 20  ? -17.227 44.745 -35.647 1.00 158.91 ? -53 DT  J O4    1 
ATOM   9434  C  C5    . DT  J 6 20  ? -15.432 46.318 -35.929 1.00 158.63 ? -53 DT  J C5    1 
ATOM   9435  C  C7    . DT  J 6 20  ? -14.321 45.327 -35.664 1.00 158.64 ? -53 DT  J C7    1 
ATOM   9436  C  C6    . DT  J 6 20  ? -15.174 47.617 -36.221 1.00 158.17 ? -53 DT  J C6    1 
ATOM   9437  P  P     . DA  J 6 21  ? -14.402 54.122 -35.464 1.00 162.99 ? -52 DA  J P     1 
ATOM   9438  O  OP1   . DA  J 6 21  ? -13.862 55.107 -36.430 1.00 163.15 ? -52 DA  J OP1   1 
ATOM   9439  O  OP2   . DA  J 6 21  ? -13.513 53.522 -34.438 1.00 163.05 ? -52 DA  J OP2   1 
ATOM   9440  O  "O5'" . DA  J 6 21  ? -15.652 54.781 -34.715 1.00 164.59 ? -52 DA  J "O5'" 1 
ATOM   9441  C  "C5'" . DA  J 6 21  ? -16.873 54.985 -35.416 1.00 166.59 ? -52 DA  J "C5'" 1 
ATOM   9442  C  "C4'" . DA  J 6 21  ? -18.026 54.289 -34.714 1.00 169.09 ? -52 DA  J "C4'" 1 
ATOM   9443  O  "O4'" . DA  J 6 21  ? -17.852 52.852 -34.773 1.00 169.51 ? -52 DA  J "O4'" 1 
ATOM   9444  C  "C3'" . DA  J 6 21  ? -18.195 54.640 -33.231 1.00 171.28 ? -52 DA  J "C3'" 1 
ATOM   9445  O  "O3'" . DA  J 6 21  ? -19.460 55.283 -33.010 1.00 173.95 ? -52 DA  J "O3'" 1 
ATOM   9446  C  "C2'" . DA  J 6 21  ? -18.109 53.292 -32.509 1.00 170.66 ? -52 DA  J "C2'" 1 
ATOM   9447  C  "C1'" . DA  J 6 21  ? -18.409 52.293 -33.612 1.00 170.08 ? -52 DA  J "C1'" 1 
ATOM   9448  N  N9    . DA  J 6 21  ? -17.811 50.969 -33.371 1.00 170.16 ? -52 DA  J N9    1 
ATOM   9449  C  C8    . DA  J 6 21  ? -16.493 50.693 -33.106 1.00 170.00 ? -52 DA  J C8    1 
ATOM   9450  N  N7    . DA  J 6 21  ? -16.251 49.430 -32.853 1.00 169.99 ? -52 DA  J N7    1 
ATOM   9451  C  C5    . DA  J 6 21  ? -17.497 48.830 -32.921 1.00 169.98 ? -52 DA  J C5    1 
ATOM   9452  C  C6    . DA  J 6 21  ? -17.924 47.485 -32.762 1.00 169.78 ? -52 DA  J C6    1 
ATOM   9453  N  N6    . DA  J 6 21  ? -17.092 46.478 -32.477 1.00 169.58 ? -52 DA  J N6    1 
ATOM   9454  N  N1    . DA  J 6 21  ? -19.249 47.223 -32.892 1.00 169.81 ? -52 DA  J N1    1 
ATOM   9455  C  C2    . DA  J 6 21  ? -20.087 48.237 -33.167 1.00 169.98 ? -52 DA  J C2    1 
ATOM   9456  N  N3    . DA  J 6 21  ? -19.805 49.535 -33.348 1.00 170.17 ? -52 DA  J N3    1 
ATOM   9457  C  C4    . DA  J 6 21  ? -18.479 49.768 -33.212 1.00 170.15 ? -52 DA  J C4    1 
ATOM   9458  P  P     . DA  J 6 22  ? -19.726 56.147 -31.678 1.00 176.06 ? -51 DA  J P     1 
ATOM   9459  O  OP1   . DA  J 6 22  ? -21.063 56.783 -31.816 1.00 176.15 ? -51 DA  J OP1   1 
ATOM   9460  O  OP2   . DA  J 6 22  ? -18.531 56.995 -31.430 1.00 176.08 ? -51 DA  J OP2   1 
ATOM   9461  O  "O5'" . DA  J 6 22  ? -19.779 55.007 -30.534 1.00 177.74 ? -51 DA  J "O5'" 1 
ATOM   9462  C  "C5'" . DA  J 6 22  ? -20.820 54.987 -29.556 1.00 179.45 ? -51 DA  J "C5'" 1 
ATOM   9463  C  "C4'" . DA  J 6 22  ? -21.593 53.670 -29.572 1.00 181.11 ? -51 DA  J "C4'" 1 
ATOM   9464  O  "O4'" . DA  J 6 22  ? -20.997 52.729 -30.501 1.00 181.26 ? -51 DA  J "O4'" 1 
ATOM   9465  C  "C3'" . DA  J 6 22  ? -21.623 52.927 -28.251 1.00 182.67 ? -51 DA  J "C3'" 1 
ATOM   9466  O  "O3'" . DA  J 6 22  ? -22.632 53.486 -27.392 1.00 184.78 ? -51 DA  J "O3'" 1 
ATOM   9467  C  "C2'" . DA  J 6 22  ? -21.987 51.521 -28.713 1.00 182.14 ? -51 DA  J "C2'" 1 
ATOM   9468  C  "C1'" . DA  J 6 22  ? -21.193 51.406 -30.017 1.00 181.67 ? -51 DA  J "C1'" 1 
ATOM   9469  N  N9    . DA  J 6 22  ? -19.886 50.761 -29.847 1.00 181.70 ? -51 DA  J N9    1 
ATOM   9470  C  C8    . DA  J 6 22  ? -18.668 51.378 -29.737 1.00 181.68 ? -51 DA  J C8    1 
ATOM   9471  N  N7    . DA  J 6 22  ? -17.659 50.552 -29.588 1.00 181.51 ? -51 DA  J N7    1 
ATOM   9472  C  C5    . DA  J 6 22  ? -18.255 49.308 -29.545 1.00 181.43 ? -51 DA  J C5    1 
ATOM   9473  C  C6    . DA  J 6 22  ? -17.727 48.013 -29.380 1.00 181.28 ? -51 DA  J C6    1 
ATOM   9474  N  N6    . DA  J 6 22  ? -16.425 47.772 -29.232 1.00 181.21 ? -51 DA  J N6    1 
ATOM   9475  N  N1    . DA  J 6 22  ? -18.595 46.970 -29.381 1.00 181.28 ? -51 DA  J N1    1 
ATOM   9476  C  C2    . DA  J 6 22  ? -19.909 47.219 -29.539 1.00 181.32 ? -51 DA  J C2    1 
ATOM   9477  N  N3    . DA  J 6 22  ? -20.525 48.397 -29.700 1.00 181.40 ? -51 DA  J N3    1 
ATOM   9478  C  C4    . DA  J 6 22  ? -19.632 49.413 -29.697 1.00 181.55 ? -51 DA  J C4    1 
ATOM   9479  P  P     . DC  J 6 23  ? -22.289 53.887 -25.868 1.00 186.47 ? -50 DC  J P     1 
ATOM   9480  O  OP1   . DC  J 6 23  ? -23.303 54.880 -25.418 1.00 186.15 ? -50 DC  J OP1   1 
ATOM   9481  O  OP2   . DC  J 6 23  ? -20.842 54.222 -25.786 1.00 186.59 ? -50 DC  J OP2   1 
ATOM   9482  O  "O5'" . DC  J 6 23  ? -22.511 52.512 -25.072 1.00 187.59 ? -50 DC  J "O5'" 1 
ATOM   9483  C  "C5'" . DC  J 6 23  ? -23.817 51.937 -24.966 1.00 188.47 ? -50 DC  J "C5'" 1 
ATOM   9484  C  "C4'" . DC  J 6 23  ? -23.740 50.419 -24.907 1.00 189.26 ? -50 DC  J "C4'" 1 
ATOM   9485  O  "O4'" . DC  J 6 23  ? -22.818 49.940 -25.906 1.00 189.54 ? -50 DC  J "O4'" 1 
ATOM   9486  C  "C3'" . DC  J 6 23  ? -23.218 49.846 -23.602 1.00 189.79 ? -50 DC  J "C3'" 1 
ATOM   9487  O  "O3'" . DC  J 6 23  ? -24.293 49.731 -22.661 1.00 190.39 ? -50 DC  J "O3'" 1 
ATOM   9488  C  "C2'" . DC  J 6 23  ? -22.711 48.470 -24.036 1.00 189.86 ? -50 DC  J "C2'" 1 
ATOM   9489  C  "C1'" . DC  J 6 23  ? -22.289 48.694 -25.495 1.00 189.94 ? -50 DC  J "C1'" 1 
ATOM   9490  N  N1    . DC  J 6 23  ? -20.786 48.681 -25.705 1.00 190.44 ? -50 DC  J N1    1 
ATOM   9491  C  C2    . DC  J 6 23  ? -20.121 47.452 -25.938 1.00 190.69 ? -50 DC  J C2    1 
ATOM   9492  O  O2    . DC  J 6 23  ? -20.777 46.401 -25.993 1.00 190.89 ? -50 DC  J O2    1 
ATOM   9493  N  N3    . DC  J 6 23  ? -18.766 47.458 -26.107 1.00 190.67 ? -50 DC  J N3    1 
ATOM   9494  C  C4    . DC  J 6 23  ? -18.081 48.608 -26.037 1.00 190.70 ? -50 DC  J C4    1 
ATOM   9495  N  N4    . DC  J 6 23  ? -16.757 48.556 -26.208 1.00 190.63 ? -50 DC  J N4    1 
ATOM   9496  C  C5    . DC  J 6 23  ? -18.733 49.866 -25.796 1.00 190.73 ? -50 DC  J C5    1 
ATOM   9497  C  C6    . DC  J 6 23  ? -20.069 49.855 -25.628 1.00 190.61 ? -50 DC  J C6    1 
ATOM   9498  P  P     . DC  J 6 24  ? -24.078 50.113 -21.115 1.00 190.84 ? -49 DC  J P     1 
ATOM   9499  O  OP1   . DC  J 6 24  ? -25.400 50.035 -20.440 1.00 190.77 ? -49 DC  J OP1   1 
ATOM   9500  O  OP2   . DC  J 6 24  ? -23.298 51.371 -21.055 1.00 191.33 ? -49 DC  J OP2   1 
ATOM   9501  O  "O5'" . DC  J 6 24  ? -23.136 48.936 -20.573 1.00 190.31 ? -49 DC  J "O5'" 1 
ATOM   9502  C  "C5'" . DC  J 6 24  ? -23.629 47.603 -20.479 1.00 189.80 ? -49 DC  J "C5'" 1 
ATOM   9503  C  "C4'" . DC  J 6 24  ? -22.486 46.614 -20.386 1.00 189.36 ? -49 DC  J "C4'" 1 
ATOM   9504  O  "O4'" . DC  J 6 24  ? -21.456 46.963 -21.343 1.00 189.31 ? -49 DC  J "O4'" 1 
ATOM   9505  C  "C3'" . DC  J 6 24  ? -21.804 46.542 -19.016 1.00 188.99 ? -49 DC  J "C3'" 1 
ATOM   9506  O  "O3'" . DC  J 6 24  ? -21.879 45.209 -18.509 1.00 188.35 ? -49 DC  J "O3'" 1 
ATOM   9507  C  "C2'" . DC  J 6 24  ? -20.352 46.962 -19.290 1.00 189.21 ? -49 DC  J "C2'" 1 
ATOM   9508  C  "C1'" . DC  J 6 24  ? -20.201 46.688 -20.784 1.00 189.35 ? -49 DC  J "C1'" 1 
ATOM   9509  N  N1    . DC  J 6 24  ? -19.151 47.550 -21.477 1.00 189.65 ? -49 DC  J N1    1 
ATOM   9510  C  C2    . DC  J 6 24  ? -18.058 46.938 -22.149 1.00 189.76 ? -49 DC  J C2    1 
ATOM   9511  O  O2    . DC  J 6 24  ? -17.974 45.701 -22.190 1.00 189.70 ? -49 DC  J O2    1 
ATOM   9512  N  N3    . DC  J 6 24  ? -17.124 47.736 -22.748 1.00 189.86 ? -49 DC  J N3    1 
ATOM   9513  C  C4    . DC  J 6 24  ? -17.239 49.076 -22.688 1.00 189.94 ? -49 DC  J C4    1 
ATOM   9514  N  N4    . DC  J 6 24  ? -16.298 49.813 -23.291 1.00 189.86 ? -49 DC  J N4    1 
ATOM   9515  C  C5    . DC  J 6 24  ? -18.333 49.715 -22.012 1.00 189.93 ? -49 DC  J C5    1 
ATOM   9516  C  C6    . DC  J 6 24  ? -19.256 48.926 -21.431 1.00 189.81 ? -49 DC  J C6    1 
ATOM   9517  P  P     . DC  J 6 25  ? -22.268 44.924 -16.974 1.00 187.40 ? -48 DC  J P     1 
ATOM   9518  O  OP1   . DC  J 6 25  ? -23.695 44.529 -16.935 1.00 187.51 ? -48 DC  J OP1   1 
ATOM   9519  O  OP2   . DC  J 6 25  ? -21.797 46.066 -16.150 1.00 187.45 ? -48 DC  J OP2   1 
ATOM   9520  O  "O5'" . DC  J 6 25  ? -21.368 43.647 -16.598 1.00 186.05 ? -48 DC  J "O5'" 1 
ATOM   9521  C  "C5'" . DC  J 6 25  ? -20.994 42.690 -17.604 1.00 184.74 ? -48 DC  J "C5'" 1 
ATOM   9522  C  "C4'" . DC  J 6 25  ? -19.477 42.518 -17.676 1.00 183.50 ? -48 DC  J "C4'" 1 
ATOM   9523  O  "O4'" . DC  J 6 25  ? -18.866 43.645 -18.368 1.00 182.91 ? -48 DC  J "O4'" 1 
ATOM   9524  C  "C3'" . DC  J 6 25  ? -18.751 42.412 -16.321 1.00 182.69 ? -48 DC  J "C3'" 1 
ATOM   9525  O  "O3'" . DC  J 6 25  ? -17.940 41.232 -16.279 1.00 181.90 ? -48 DC  J "O3'" 1 
ATOM   9526  C  "C2'" . DC  J 6 25  ? -17.892 43.677 -16.276 1.00 182.49 ? -48 DC  J "C2'" 1 
ATOM   9527  C  "C1'" . DC  J 6 25  ? -17.630 43.892 -17.755 1.00 182.37 ? -48 DC  J "C1'" 1 
ATOM   9528  N  N1    . DC  J 6 25  ? -17.124 45.269 -18.133 1.00 181.81 ? -48 DC  J N1    1 
ATOM   9529  C  C2    . DC  J 6 25  ? -16.424 45.442 -19.350 1.00 181.43 ? -48 DC  J C2    1 
ATOM   9530  O  O2    . DC  J 6 25  ? -16.290 44.480 -20.120 1.00 181.21 ? -48 DC  J O2    1 
ATOM   9531  N  N3    . DC  J 6 25  ? -15.921 46.675 -19.652 1.00 181.32 ? -48 DC  J N3    1 
ATOM   9532  C  C4    . DC  J 6 25  ? -16.088 47.698 -18.799 1.00 181.39 ? -48 DC  J C4    1 
ATOM   9533  N  N4    . DC  J 6 25  ? -15.606 48.894 -19.154 1.00 181.37 ? -48 DC  J N4    1 
ATOM   9534  C  C5    . DC  J 6 25  ? -16.775 47.540 -17.550 1.00 181.49 ? -48 DC  J C5    1 
ATOM   9535  C  C6    . DC  J 6 25  ? -17.263 46.323 -17.257 1.00 181.62 ? -48 DC  J C6    1 
ATOM   9536  P  P     . DT  J 6 26  ? -17.879 40.351 -14.940 1.00 180.87 ? -47 DT  J P     1 
ATOM   9537  O  OP1   . DT  J 6 26  ? -19.029 39.412 -14.966 1.00 181.30 ? -47 DT  J OP1   1 
ATOM   9538  O  OP2   . DT  J 6 26  ? -17.708 41.278 -13.791 1.00 181.23 ? -47 DT  J OP2   1 
ATOM   9539  O  "O5'" . DT  J 6 26  ? -16.520 39.515 -15.094 1.00 178.27 ? -47 DT  J "O5'" 1 
ATOM   9540  C  "C5'" . DT  J 6 26  ? -16.139 38.988 -16.349 1.00 175.98 ? -47 DT  J "C5'" 1 
ATOM   9541  C  "C4'" . DT  J 6 26  ? -14.821 39.588 -16.796 1.00 173.92 ? -47 DT  J "C4'" 1 
ATOM   9542  O  "O4'" . DT  J 6 26  ? -14.917 41.029 -16.818 1.00 173.57 ? -47 DT  J "O4'" 1 
ATOM   9543  C  "C3'" . DT  J 6 26  ? -13.623 39.263 -15.902 1.00 172.15 ? -47 DT  J "C3'" 1 
ATOM   9544  O  "O3'" . DT  J 6 26  ? -12.715 38.440 -16.608 1.00 170.09 ? -47 DT  J "O3'" 1 
ATOM   9545  C  "C2'" . DT  J 6 26  ? -13.007 40.633 -15.557 1.00 172.60 ? -47 DT  J "C2'" 1 
ATOM   9546  C  "C1'" . DT  J 6 26  ? -13.633 41.549 -16.597 1.00 173.14 ? -47 DT  J "C1'" 1 
ATOM   9547  N  N1    . DT  J 6 26  ? -13.741 43.011 -16.173 1.00 173.28 ? -47 DT  J N1    1 
ATOM   9548  C  C2    . DT  J 6 26  ? -13.021 43.977 -16.868 1.00 173.28 ? -47 DT  J C2    1 
ATOM   9549  O  O2    . DT  J 6 26  ? -12.288 43.725 -17.811 1.00 173.25 ? -47 DT  J O2    1 
ATOM   9550  N  N3    . DT  J 6 26  ? -13.208 45.266 -16.424 1.00 173.38 ? -47 DT  J N3    1 
ATOM   9551  C  C4    . DT  J 6 26  ? -14.005 45.688 -15.370 1.00 173.50 ? -47 DT  J C4    1 
ATOM   9552  O  O4    . DT  J 6 26  ? -14.046 46.885 -15.093 1.00 173.43 ? -47 DT  J O4    1 
ATOM   9553  C  C5    . DT  J 6 26  ? -14.722 44.629 -14.666 1.00 173.57 ? -47 DT  J C5    1 
ATOM   9554  C  C7    . DT  J 6 26  ? -15.615 44.954 -13.500 1.00 173.61 ? -47 DT  J C7    1 
ATOM   9555  C  C6    . DT  J 6 26  ? -14.551 43.359 -15.093 1.00 173.45 ? -47 DT  J C6    1 
ATOM   9556  P  P     . DA  J 6 27  ? -11.568 37.642 -15.827 1.00 168.20 ? -46 DA  J P     1 
ATOM   9557  O  OP1   . DA  J 6 27  ? -11.253 36.413 -16.601 1.00 168.25 ? -46 DA  J OP1   1 
ATOM   9558  O  OP2   . DA  J 6 27  ? -11.967 37.546 -14.397 1.00 167.99 ? -46 DA  J OP2   1 
ATOM   9559  O  "O5'" . DA  J 6 27  ? -10.318 38.636 -15.927 1.00 166.08 ? -46 DA  J "O5'" 1 
ATOM   9560  C  "C5'" . DA  J 6 27  ? -9.689  38.886 -17.197 1.00 163.60 ? -46 DA  J "C5'" 1 
ATOM   9561  C  "C4'" . DA  J 6 27  ? -8.719  40.059 -17.109 1.00 160.88 ? -46 DA  J "C4'" 1 
ATOM   9562  O  "O4'" . DA  J 6 27  ? -9.403  41.230 -16.575 1.00 160.46 ? -46 DA  J "O4'" 1 
ATOM   9563  C  "C3'" . DA  J 6 27  ? -7.503  39.821 -16.216 1.00 158.50 ? -46 DA  J "C3'" 1 
ATOM   9564  O  "O3'" . DA  J 6 27  ? -6.319  40.255 -16.868 1.00 155.73 ? -46 DA  J "O3'" 1 
ATOM   9565  C  "C2'" . DA  J 6 27  ? -7.805  40.655 -14.971 1.00 159.30 ? -46 DA  J "C2'" 1 
ATOM   9566  C  "C1'" . DA  J 6 27  ? -8.633  41.797 -15.543 1.00 160.20 ? -46 DA  J "C1'" 1 
ATOM   9567  N  N9    . DA  J 6 27  ? -9.543  42.413 -14.579 1.00 161.18 ? -46 DA  J N9    1 
ATOM   9568  C  C8    . DA  J 6 27  ? -10.199 41.795 -13.545 1.00 161.67 ? -46 DA  J C8    1 
ATOM   9569  N  N7    . DA  J 6 27  ? -10.967 42.598 -12.843 1.00 162.05 ? -46 DA  J N7    1 
ATOM   9570  C  C5    . DA  J 6 27  ? -10.829 43.824 -13.473 1.00 162.25 ? -46 DA  J C5    1 
ATOM   9571  C  C6    . DA  J 6 27  ? -11.392 45.105 -13.213 1.00 162.63 ? -46 DA  J C6    1 
ATOM   9572  N  N6    . DA  J 6 27  ? -12.255 45.342 -12.217 1.00 163.10 ? -46 DA  J N6    1 
ATOM   9573  N  N1    . DA  J 6 27  ? -11.037 46.131 -14.032 1.00 162.34 ? -46 DA  J N1    1 
ATOM   9574  C  C2    . DA  J 6 27  ? -10.183 45.884 -15.039 1.00 162.44 ? -46 DA  J C2    1 
ATOM   9575  N  N3    . DA  J 6 27  ? -9.597  44.724 -15.388 1.00 162.26 ? -46 DA  J N3    1 
ATOM   9576  C  C4    . DA  J 6 27  ? -9.958  43.727 -14.552 1.00 161.90 ? -46 DA  J C4    1 
ATOM   9577  P  P     . DA  J 6 28  ? -4.971  39.403 -16.735 1.00 153.07 ? -45 DA  J P     1 
ATOM   9578  O  OP1   . DA  J 6 28  ? -4.967  38.382 -17.804 1.00 153.57 ? -45 DA  J OP1   1 
ATOM   9579  O  OP2   . DA  J 6 28  ? -4.838  38.990 -15.320 1.00 153.13 ? -45 DA  J OP2   1 
ATOM   9580  O  "O5'" . DA  J 6 28  ? -3.810  40.469 -17.041 1.00 149.91 ? -45 DA  J "O5'" 1 
ATOM   9581  C  "C5'" . DA  J 6 28  ? -3.827  41.254 -18.244 1.00 146.62 ? -45 DA  J "C5'" 1 
ATOM   9582  C  "C4'" . DA  J 6 28  ? -3.694  42.742 -17.923 1.00 143.31 ? -45 DA  J "C4'" 1 
ATOM   9583  O  "O4'" . DA  J 6 28  ? -4.775  43.151 -17.038 1.00 142.58 ? -45 DA  J "O4'" 1 
ATOM   9584  C  "C3'" . DA  J 6 28  ? -2.390  43.148 -17.223 1.00 140.77 ? -45 DA  J "C3'" 1 
ATOM   9585  O  "O3'" . DA  J 6 28  ? -1.848  44.322 -17.820 1.00 137.32 ? -45 DA  J "O3'" 1 
ATOM   9586  C  "C2'" . DA  J 6 28  ? -2.827  43.409 -15.782 1.00 141.65 ? -45 DA  J "C2'" 1 
ATOM   9587  C  "C1'" . DA  J 6 28  ? -4.248  43.909 -15.977 1.00 142.51 ? -45 DA  J "C1'" 1 
ATOM   9588  N  N9    . DA  J 6 28  ? -5.104  43.740 -14.804 1.00 143.57 ? -45 DA  J N9    1 
ATOM   9589  C  C8    . DA  J 6 28  ? -5.266  42.607 -14.052 1.00 143.76 ? -45 DA  J C8    1 
ATOM   9590  N  N7    . DA  J 6 28  ? -6.106  42.743 -13.052 1.00 143.71 ? -45 DA  J N7    1 
ATOM   9591  C  C5    . DA  J 6 28  ? -6.514  44.062 -13.140 1.00 144.02 ? -45 DA  J C5    1 
ATOM   9592  C  C6    . DA  J 6 28  ? -7.384  44.848 -12.341 1.00 144.52 ? -45 DA  J C6    1 
ATOM   9593  N  N6    . DA  J 6 28  ? -8.048  44.364 -11.281 1.00 144.53 ? -45 DA  J N6    1 
ATOM   9594  N  N1    . DA  J 6 28  ? -7.554  46.156 -12.689 1.00 144.96 ? -45 DA  J N1    1 
ATOM   9595  C  C2    . DA  J 6 28  ? -6.883  46.639 -13.757 1.00 144.99 ? -45 DA  J C2    1 
ATOM   9596  N  N3    . DA  J 6 28  ? -6.041  45.995 -14.581 1.00 144.76 ? -45 DA  J N3    1 
ATOM   9597  C  C4    . DA  J 6 28  ? -5.894  44.699 -14.210 1.00 144.19 ? -45 DA  J C4    1 
ATOM   9598  P  P     . DC  J 6 29  ? -0.266  44.527 -17.921 1.00 134.38 ? -44 DC  J P     1 
ATOM   9599  O  OP1   . DC  J 6 29  ? 0.108   44.335 -19.334 1.00 134.10 ? -44 DC  J OP1   1 
ATOM   9600  O  OP2   . DC  J 6 29  ? 0.391   43.729 -16.864 1.00 133.71 ? -44 DC  J OP2   1 
ATOM   9601  O  "O5'" . DC  J 6 29  ? -0.062  46.058 -17.533 1.00 133.81 ? -44 DC  J "O5'" 1 
ATOM   9602  C  "C5'" . DC  J 6 29  ? -0.852  47.086 -18.135 1.00 133.71 ? -44 DC  J "C5'" 1 
ATOM   9603  C  "C4'" . DC  J 6 29  ? -1.195  48.173 -17.118 1.00 133.61 ? -44 DC  J "C4'" 1 
ATOM   9604  O  "O4'" . DC  J 6 29  ? -2.072  47.626 -16.098 1.00 133.93 ? -44 DC  J "O4'" 1 
ATOM   9605  C  "C3'" . DC  J 6 29  ? -0.003  48.780 -16.363 1.00 133.31 ? -44 DC  J "C3'" 1 
ATOM   9606  O  "O3'" . DC  J 6 29  ? -0.154  50.187 -16.263 1.00 132.86 ? -44 DC  J "O3'" 1 
ATOM   9607  C  "C2'" . DC  J 6 29  ? -0.087  48.117 -14.993 1.00 133.63 ? -44 DC  J "C2'" 1 
ATOM   9608  C  "C1'" . DC  J 6 29  ? -1.588  47.989 -14.828 1.00 134.41 ? -44 DC  J "C1'" 1 
ATOM   9609  N  N1    . DC  J 6 29  ? -2.025  46.958 -13.818 1.00 136.00 ? -44 DC  J N1    1 
ATOM   9610  C  C2    . DC  J 6 29  ? -3.221  47.153 -13.093 1.00 137.24 ? -44 DC  J C2    1 
ATOM   9611  O  O2    . DC  J 6 29  ? -3.914  48.168 -13.306 1.00 137.50 ? -44 DC  J O2    1 
ATOM   9612  N  N3    . DC  J 6 29  ? -3.587  46.212 -12.174 1.00 137.97 ? -44 DC  J N3    1 
ATOM   9613  C  C4    . DC  J 6 29  ? -2.821  45.118 -11.981 1.00 138.10 ? -44 DC  J C4    1 
ATOM   9614  N  N4    . DC  J 6 29  ? -3.221  44.222 -11.075 1.00 138.86 ? -44 DC  J N4    1 
ATOM   9615  C  C5    . DC  J 6 29  ? -1.601  44.914 -12.693 1.00 137.07 ? -44 DC  J C5    1 
ATOM   9616  C  C6    . DC  J 6 29  ? -1.253  45.839 -13.600 1.00 136.50 ? -44 DC  J C6    1 
ATOM   9617  P  P     . DC  J 6 30  ? 1.117   51.138 -16.021 1.00 133.53 ? -43 DC  J P     1 
ATOM   9618  O  OP1   . DC  J 6 30  ? 1.475   51.757 -17.320 1.00 133.45 ? -43 DC  J OP1   1 
ATOM   9619  O  OP2   . DC  J 6 30  ? 2.143   50.390 -15.260 1.00 132.67 ? -43 DC  J OP2   1 
ATOM   9620  O  "O5'" . DC  J 6 30  ? 0.542   52.278 -15.048 1.00 136.29 ? -43 DC  J "O5'" 1 
ATOM   9621  C  "C5'" . DC  J 6 30  ? -0.883  52.425 -14.817 1.00 138.53 ? -43 DC  J "C5'" 1 
ATOM   9622  C  "C4'" . DC  J 6 30  ? -1.186  52.668 -13.343 1.00 140.47 ? -43 DC  J "C4'" 1 
ATOM   9623  O  "O4'" . DC  J 6 30  ? -1.519  51.410 -12.692 1.00 140.33 ? -43 DC  J "O4'" 1 
ATOM   9624  C  "C3'" . DC  J 6 30  ? -0.037  53.285 -12.537 1.00 143.08 ? -43 DC  J "C3'" 1 
ATOM   9625  O  "O3'" . DC  J 6 30  ? -0.472  54.487 -11.897 1.00 147.15 ? -43 DC  J "O3'" 1 
ATOM   9626  C  "C2'" . DC  J 6 30  ? 0.348   52.191 -11.534 1.00 141.96 ? -43 DC  J "C2'" 1 
ATOM   9627  C  "C1'" . DC  J 6 30  ? -0.941  51.394 -11.416 1.00 141.11 ? -43 DC  J "C1'" 1 
ATOM   9628  N  N1    . DC  J 6 30  ? -0.750  49.965 -10.961 1.00 141.69 ? -43 DC  J N1    1 
ATOM   9629  C  C2    . DC  J 6 30  ? -1.362  49.519 -9.770  1.00 142.62 ? -43 DC  J C2    1 
ATOM   9630  O  O2    . DC  J 6 30  ? -2.074  50.302 -9.119  1.00 143.29 ? -43 DC  J O2    1 
ATOM   9631  N  N3    . DC  J 6 30  ? -1.155  48.230 -9.360  1.00 142.63 ? -43 DC  J N3    1 
ATOM   9632  C  C4    . DC  J 6 30  ? -0.359  47.420 -10.067 1.00 142.68 ? -43 DC  J C4    1 
ATOM   9633  N  N4    . DC  J 6 30  ? -0.185  46.170 -9.625  1.00 142.69 ? -43 DC  J N4    1 
ATOM   9634  C  C5    . DC  J 6 30  ? 0.294   47.861 -11.260 1.00 142.59 ? -43 DC  J C5    1 
ATOM   9635  C  C6    . DC  J 6 30  ? 0.085   49.131 -11.655 1.00 142.20 ? -43 DC  J C6    1 
ATOM   9636  P  P     . DC  J 6 31  ? 0.586   55.550 -11.304 1.00 151.13 ? -42 DC  J P     1 
ATOM   9637  O  OP1   . DC  J 6 31  ? 0.105   56.918 -11.634 1.00 151.02 ? -42 DC  J OP1   1 
ATOM   9638  O  OP2   . DC  J 6 31  ? 1.955   55.131 -11.709 1.00 151.21 ? -42 DC  J OP2   1 
ATOM   9639  O  "O5'" . DC  J 6 31  ? 0.449   55.325 -9.720  1.00 154.30 ? -42 DC  J "O5'" 1 
ATOM   9640  C  "C5'" . DC  J 6 31  ? -0.764  55.705 -9.036  1.00 157.26 ? -42 DC  J "C5'" 1 
ATOM   9641  C  "C4'" . DC  J 6 31  ? -0.773  55.230 -7.588  1.00 160.06 ? -42 DC  J "C4'" 1 
ATOM   9642  O  "O4'" . DC  J 6 31  ? -0.727  53.787 -7.542  1.00 160.34 ? -42 DC  J "O4'" 1 
ATOM   9643  C  "C3'" . DC  J 6 31  ? 0.368   55.750 -6.714  1.00 162.97 ? -42 DC  J "C3'" 1 
ATOM   9644  O  "O3'" . DC  J 6 31  ? -0.166  56.427 -5.568  1.00 167.24 ? -42 DC  J "O3'" 1 
ATOM   9645  C  "C2'" . DC  J 6 31  ? 1.170   54.502 -6.334  1.00 161.89 ? -42 DC  J "C2'" 1 
ATOM   9646  C  "C1'" . DC  J 6 31  ? 0.191   53.354 -6.572  1.00 161.04 ? -42 DC  J "C1'" 1 
ATOM   9647  N  N1    . DC  J 6 31  ? 0.847   52.096 -7.090  1.00 161.17 ? -42 DC  J N1    1 
ATOM   9648  C  C2    . DC  J 6 31  ? 0.490   50.837 -6.553  1.00 161.21 ? -42 DC  J C2    1 
ATOM   9649  O  O2    . DC  J 6 31  ? -0.348  50.774 -5.648  1.00 160.96 ? -42 DC  J O2    1 
ATOM   9650  N  N3    . DC  J 6 31  ? 1.084   49.713 -7.057  1.00 161.71 ? -42 DC  J N3    1 
ATOM   9651  C  C4    . DC  J 6 31  ? 1.978   49.811 -8.062  1.00 161.87 ? -42 DC  J C4    1 
ATOM   9652  N  N4    . DC  J 6 31  ? 2.529   48.683 -8.525  1.00 161.82 ? -42 DC  J N4    1 
ATOM   9653  C  C5    . DC  J 6 31  ? 2.351   51.078 -8.624  1.00 161.75 ? -42 DC  J C5    1 
ATOM   9654  C  C6    . DC  J 6 31  ? 1.760   52.178 -8.123  1.00 161.53 ? -42 DC  J C6    1 
ATOM   9655  P  P     . DT  J 6 32  ? 0.736   57.435 -4.685  1.00 171.08 ? -41 DT  J P     1 
ATOM   9656  O  OP1   . DT  J 6 32  ? -0.184  58.374 -3.989  1.00 171.11 ? -41 DT  J OP1   1 
ATOM   9657  O  OP2   . DT  J 6 32  ? 1.834   57.974 -5.534  1.00 171.23 ? -41 DT  J OP2   1 
ATOM   9658  O  "O5'" . DT  J 6 32  ? 1.388   56.441 -3.603  1.00 173.67 ? -41 DT  J "O5'" 1 
ATOM   9659  C  "C5'" . DT  J 6 32  ? 0.540   55.663 -2.737  1.00 175.69 ? -41 DT  J "C5'" 1 
ATOM   9660  C  "C4'" . DT  J 6 32  ? 1.288   54.495 -2.111  1.00 177.70 ? -41 DT  J "C4'" 1 
ATOM   9661  O  "O4'" . DT  J 6 32  ? 1.665   53.547 -3.118  1.00 178.39 ? -41 DT  J "O4'" 1 
ATOM   9662  C  "C3'" . DT  J 6 32  ? 2.594   54.840 -1.393  1.00 179.33 ? -41 DT  J "C3'" 1 
ATOM   9663  O  "O3'" . DT  J 6 32  ? 2.333   55.063 0.014   1.00 181.22 ? -41 DT  J "O3'" 1 
ATOM   9664  C  "C2'" . DT  J 6 32  ? 3.487   53.600 -1.634  1.00 179.16 ? -41 DT  J "C2'" 1 
ATOM   9665  C  "C1'" . DT  J 6 32  ? 2.633   52.709 -2.548  1.00 178.95 ? -41 DT  J "C1'" 1 
ATOM   9666  N  N1    . DT  J 6 32  ? 3.410   51.976 -3.645  1.00 179.18 ? -41 DT  J N1    1 
ATOM   9667  C  C2    . DT  J 6 32  ? 3.584   50.601 -3.545  1.00 179.44 ? -41 DT  J C2    1 
ATOM   9668  O  O2    . DT  J 6 32  ? 3.149   49.935 -2.623  1.00 179.49 ? -41 DT  J O2    1 
ATOM   9669  N  N3    . DT  J 6 32  ? 4.284   50.026 -4.583  1.00 179.77 ? -41 DT  J N3    1 
ATOM   9670  C  C4    . DT  J 6 32  ? 4.845   50.672 -5.680  1.00 179.95 ? -41 DT  J C4    1 
ATOM   9671  O  O4    . DT  J 6 32  ? 5.462   50.013 -6.519  1.00 180.02 ? -41 DT  J O4    1 
ATOM   9672  C  C5    . DT  J 6 32  ? 4.637   52.114 -5.727  1.00 179.78 ? -41 DT  J C5    1 
ATOM   9673  C  C7    . DT  J 6 32  ? 5.184   52.923 -6.872  1.00 179.82 ? -41 DT  J C7    1 
ATOM   9674  C  C6    . DT  J 6 32  ? 3.942   52.690 -4.717  1.00 179.44 ? -41 DT  J C6    1 
ATOM   9675  P  P     . DA  J 6 33  ? 3.439   55.726 0.988   1.00 182.65 ? -40 DA  J P     1 
ATOM   9676  O  OP1   . DA  J 6 33  ? 2.727   56.340 2.140   1.00 182.16 ? -40 DA  J OP1   1 
ATOM   9677  O  OP2   . DA  J 6 33  ? 4.359   56.553 0.169   1.00 182.95 ? -40 DA  J OP2   1 
ATOM   9678  O  "O5'" . DA  J 6 33  ? 4.258   54.443 1.500   1.00 183.61 ? -40 DA  J "O5'" 1 
ATOM   9679  C  "C5'" . DA  J 6 33  ? 3.579   53.399 2.215   1.00 184.28 ? -40 DA  J "C5'" 1 
ATOM   9680  C  "C4'" . DA  J 6 33  ? 4.432   52.148 2.324   1.00 184.86 ? -40 DA  J "C4'" 1 
ATOM   9681  O  "O4'" . DA  J 6 33  ? 4.590   51.550 1.024   1.00 184.89 ? -40 DA  J "O4'" 1 
ATOM   9682  C  "C3'" . DA  J 6 33  ? 5.852   52.352 2.878   1.00 185.70 ? -40 DA  J "C3'" 1 
ATOM   9683  O  "O3'" . DA  J 6 33  ? 6.052   51.511 4.018   1.00 187.22 ? -40 DA  J "O3'" 1 
ATOM   9684  C  "C2'" . DA  J 6 33  ? 6.761   51.949 1.714   1.00 185.20 ? -40 DA  J "C2'" 1 
ATOM   9685  C  "C1'" . DA  J 6 33  ? 5.861   50.977 0.971   1.00 185.01 ? -40 DA  J "C1'" 1 
ATOM   9686  N  N9    . DA  J 6 33  ? 6.226   50.742 -0.425  1.00 184.89 ? -40 DA  J N9    1 
ATOM   9687  C  C8    . DA  J 6 33  ? 6.498   51.679 -1.390  1.00 184.84 ? -40 DA  J C8    1 
ATOM   9688  N  N7    . DA  J 6 33  ? 6.806   51.167 -2.559  1.00 184.79 ? -40 DA  J N7    1 
ATOM   9689  C  C5    . DA  J 6 33  ? 6.731   49.798 -2.350  1.00 184.83 ? -40 DA  J C5    1 
ATOM   9690  C  C6    . DA  J 6 33  ? 6.948   48.683 -3.199  1.00 184.63 ? -40 DA  J C6    1 
ATOM   9691  N  N6    . DA  J 6 33  ? 7.295   48.793 -4.486  1.00 184.43 ? -40 DA  J N6    1 
ATOM   9692  N  N1    . DA  J 6 33  ? 6.778   47.445 -2.669  1.00 184.61 ? -40 DA  J N1    1 
ATOM   9693  C  C2    . DA  J 6 33  ? 6.434   47.329 -1.376  1.00 184.71 ? -40 DA  J C2    1 
ATOM   9694  N  N3    . DA  J 6 33  ? 6.206   48.297 -0.482  1.00 184.78 ? -40 DA  J N3    1 
ATOM   9695  C  C4    . DA  J 6 33  ? 6.370   49.520 -1.038  1.00 184.85 ? -40 DA  J C4    1 
ATOM   9696  P  P     . DA  J 6 34  ? 7.030   51.956 5.220   1.00 188.59 ? -39 DA  J P     1 
ATOM   9697  O  OP1   . DA  J 6 34  ? 6.272   51.859 6.496   1.00 188.57 ? -39 DA  J OP1   1 
ATOM   9698  O  OP2   . DA  J 6 34  ? 7.682   53.238 4.853   1.00 189.03 ? -39 DA  J OP2   1 
ATOM   9699  O  "O5'" . DA  J 6 34  ? 8.155   50.816 5.187   1.00 188.56 ? -39 DA  J "O5'" 1 
ATOM   9700  C  "C5'" . DA  J 6 34  ? 7.797   49.462 5.404   1.00 188.22 ? -39 DA  J "C5'" 1 
ATOM   9701  C  "C4'" . DA  J 6 34  ? 8.569   48.541 4.483   1.00 187.86 ? -39 DA  J "C4'" 1 
ATOM   9702  O  "O4'" . DA  J 6 34  ? 8.514   49.018 3.119   1.00 187.99 ? -39 DA  J "O4'" 1 
ATOM   9703  C  "C3'" . DA  J 6 34  ? 10.061  48.373 4.808   1.00 187.41 ? -39 DA  J "C3'" 1 
ATOM   9704  O  "O3'" . DA  J 6 34  ? 10.315  47.004 5.142   1.00 186.69 ? -39 DA  J "O3'" 1 
ATOM   9705  C  "C2'" . DA  J 6 34  ? 10.770  48.782 3.505   1.00 187.72 ? -39 DA  J "C2'" 1 
ATOM   9706  C  "C1'" . DA  J 6 34  ? 9.672   48.552 2.486   1.00 188.11 ? -39 DA  J "C1'" 1 
ATOM   9707  N  N9    . DA  J 6 34  ? 9.868   49.248 1.211   1.00 188.51 ? -39 DA  J N9    1 
ATOM   9708  C  C8    . DA  J 6 34  ? 10.060  50.594 1.017   1.00 188.69 ? -39 DA  J C8    1 
ATOM   9709  N  N7    . DA  J 6 34  ? 10.250  50.929 -0.241  1.00 188.63 ? -39 DA  J N7    1 
ATOM   9710  C  C5    . DA  J 6 34  ? 10.196  49.723 -0.920  1.00 188.47 ? -39 DA  J C5    1 
ATOM   9711  C  C6    . DA  J 6 34  ? 10.313  49.393 -2.292  1.00 188.28 ? -39 DA  J C6    1 
ATOM   9712  N  N6    . DA  J 6 34  ? 10.524  50.303 -3.250  1.00 188.16 ? -39 DA  J N6    1 
ATOM   9713  N  N1    . DA  J 6 34  ? 10.199  48.085 -2.639  1.00 188.17 ? -39 DA  J N1    1 
ATOM   9714  C  C2    . DA  J 6 34  ? 9.983   47.170 -1.676  1.00 188.10 ? -39 DA  J C2    1 
ATOM   9715  N  N3    . DA  J 6 34  ? 9.853   47.357 -0.358  1.00 188.17 ? -39 DA  J N3    1 
ATOM   9716  C  C4    . DA  J 6 34  ? 9.961   48.671 -0.042  1.00 188.42 ? -39 DA  J C4    1 
ATOM   9717  P  P     . DC  J 6 35  ? 11.756  46.514 5.665   1.00 185.70 ? -38 DC  J P     1 
ATOM   9718  O  OP1   . DC  J 6 35  ? 11.533  45.478 6.708   1.00 185.94 ? -38 DC  J OP1   1 
ATOM   9719  O  OP2   . DC  J 6 35  ? 12.585  47.707 5.976   1.00 185.99 ? -38 DC  J OP2   1 
ATOM   9720  O  "O5'" . DC  J 6 35  ? 12.372  45.818 4.366   1.00 183.39 ? -38 DC  J "O5'" 1 
ATOM   9721  C  "C5'" . DC  J 6 35  ? 11.787  44.631 3.857   1.00 181.01 ? -38 DC  J "C5'" 1 
ATOM   9722  C  "C4'" . DC  J 6 35  ? 12.300  44.343 2.467   1.00 178.74 ? -38 DC  J "C4'" 1 
ATOM   9723  O  "O4'" . DC  J 6 35  ? 11.918  45.407 1.585   1.00 178.04 ? -38 DC  J "O4'" 1 
ATOM   9724  C  "C3'" . DC  J 6 35  ? 13.806  44.299 2.335   1.00 177.21 ? -38 DC  J "C3'" 1 
ATOM   9725  O  "O3'" . DC  J 6 35  ? 14.290  43.028 2.736   1.00 175.59 ? -38 DC  J "O3'" 1 
ATOM   9726  C  "C2'" . DC  J 6 35  ? 14.004  44.538 0.839   1.00 177.36 ? -38 DC  J "C2'" 1 
ATOM   9727  C  "C1'" . DC  J 6 35  ? 12.766  45.362 0.453   1.00 177.42 ? -38 DC  J "C1'" 1 
ATOM   9728  N  N1    . DC  J 6 35  ? 13.081  46.762 0.003   1.00 176.72 ? -38 DC  J N1    1 
ATOM   9729  C  C2    . DC  J 6 35  ? 13.347  47.017 -1.361  1.00 176.24 ? -38 DC  J C2    1 
ATOM   9730  O  O2    . DC  J 6 35  ? 13.285  46.089 -2.182  1.00 176.01 ? -38 DC  J O2    1 
ATOM   9731  N  N3    . DC  J 6 35  ? 13.617  48.294 -1.746  1.00 176.06 ? -38 DC  J N3    1 
ATOM   9732  C  C4    . DC  J 6 35  ? 13.647  49.280 -0.843  1.00 176.01 ? -38 DC  J C4    1 
ATOM   9733  N  N4    . DC  J 6 35  ? 13.917  50.514 -1.275  1.00 175.85 ? -38 DC  J N4    1 
ATOM   9734  C  C5    . DC  J 6 35  ? 13.406  49.040 0.548   1.00 176.32 ? -38 DC  J C5    1 
ATOM   9735  C  C6    . DC  J 6 35  ? 13.144  47.779 0.925   1.00 176.51 ? -38 DC  J C6    1 
ATOM   9736  P  P     . DC  J 6 36  ? 15.750  42.880 3.386   1.00 173.91 ? -37 DC  J P     1 
ATOM   9737  O  OP1   . DC  J 6 36  ? 15.787  41.598 4.123   1.00 174.19 ? -37 DC  J OP1   1 
ATOM   9738  O  OP2   . DC  J 6 36  ? 16.081  44.144 4.090   1.00 173.85 ? -37 DC  J OP2   1 
ATOM   9739  O  "O5'" . DC  J 6 36  ? 16.702  42.765 2.106   1.00 171.83 ? -37 DC  J "O5'" 1 
ATOM   9740  C  "C5'" . DC  J 6 36  ? 16.543  41.685 1.180   1.00 169.58 ? -37 DC  J "C5'" 1 
ATOM   9741  C  "C4'" . DC  J 6 36  ? 17.150  42.037 -0.169  1.00 167.40 ? -37 DC  J "C4'" 1 
ATOM   9742  O  "O4'" . DC  J 6 36  ? 16.710  43.357 -0.583  1.00 166.52 ? -37 DC  J "O4'" 1 
ATOM   9743  C  "C3'" . DC  J 6 36  ? 18.679  42.059 -0.207  1.00 166.27 ? -37 DC  J "C3'" 1 
ATOM   9744  O  "O3'" . DC  J 6 36  ? 19.147  41.360 -1.355  1.00 165.59 ? -37 DC  J "O3'" 1 
ATOM   9745  C  "C2'" . DC  J 6 36  ? 19.018  43.547 -0.281  1.00 166.03 ? -37 DC  J "C2'" 1 
ATOM   9746  C  "C1'" . DC  J 6 36  ? 17.816  44.102 -1.030  1.00 165.92 ? -37 DC  J "C1'" 1 
ATOM   9747  N  N1    . DC  J 6 36  ? 17.552  45.581 -0.791  1.00 165.35 ? -37 DC  J N1    1 
ATOM   9748  C  C2    . DC  J 6 36  ? 17.493  46.467 -1.888  1.00 165.04 ? -37 DC  J C2    1 
ATOM   9749  O  O2    . DC  J 6 36  ? 17.634  46.028 -3.032  1.00 165.23 ? -37 DC  J O2    1 
ATOM   9750  N  N3    . DC  J 6 36  ? 17.252  47.784 -1.660  1.00 164.67 ? -37 DC  J N3    1 
ATOM   9751  C  C4    . DC  J 6 36  ? 17.088  48.230 -0.412  1.00 164.67 ? -37 DC  J C4    1 
ATOM   9752  N  N4    . DC  J 6 36  ? 16.868  49.535 -0.245  1.00 164.79 ? -37 DC  J N4    1 
ATOM   9753  C  C5    . DC  J 6 36  ? 17.154  47.356 0.721   1.00 164.76 ? -37 DC  J C5    1 
ATOM   9754  C  C6    . DC  J 6 36  ? 17.382  46.055 0.490   1.00 165.00 ? -37 DC  J C6    1 
ATOM   9755  P  P     . DC  J 6 37  ? 19.987  40.004 -1.186  1.00 164.72 ? -36 DC  J P     1 
ATOM   9756  O  OP1   . DC  J 6 37  ? 19.021  38.883 -1.069  1.00 165.33 ? -36 DC  J OP1   1 
ATOM   9757  O  OP2   . DC  J 6 37  ? 21.005  40.224 -0.121  1.00 164.68 ? -36 DC  J OP2   1 
ATOM   9758  O  "O5'" . DC  J 6 37  ? 20.760  39.866 -2.586  1.00 162.43 ? -36 DC  J "O5'" 1 
ATOM   9759  C  "C5'" . DC  J 6 37  ? 20.038  39.761 -3.819  1.00 159.88 ? -36 DC  J "C5'" 1 
ATOM   9760  C  "C4'" . DC  J 6 37  ? 20.497  40.831 -4.803  1.00 157.44 ? -36 DC  J "C4'" 1 
ATOM   9761  O  "O4'" . DC  J 6 37  ? 20.266  42.153 -4.242  1.00 156.96 ? -36 DC  J "O4'" 1 
ATOM   9762  C  "C3'" . DC  J 6 37  ? 21.984  40.790 -5.185  1.00 155.44 ? -36 DC  J "C3'" 1 
ATOM   9763  O  "O3'" . DC  J 6 37  ? 22.120  41.058 -6.569  1.00 152.90 ? -36 DC  J "O3'" 1 
ATOM   9764  C  "C2'" . DC  J 6 37  ? 22.578  41.920 -4.347  1.00 156.01 ? -36 DC  J "C2'" 1 
ATOM   9765  C  "C1'" . DC  J 6 37  ? 21.436  42.919 -4.379  1.00 156.85 ? -36 DC  J "C1'" 1 
ATOM   9766  N  N1    . DC  J 6 37  ? 21.462  43.982 -3.302  1.00 157.92 ? -36 DC  J N1    1 
ATOM   9767  C  C2    . DC  J 6 37  ? 20.740  45.181 -3.504  1.00 158.77 ? -36 DC  J C2    1 
ATOM   9768  O  O2    . DC  J 6 37  ? 20.093  45.331 -4.558  1.00 159.38 ? -36 DC  J O2    1 
ATOM   9769  N  N3    . DC  J 6 37  ? 20.774  46.147 -2.536  1.00 158.55 ? -36 DC  J N3    1 
ATOM   9770  C  C4    . DC  J 6 37  ? 21.488  45.952 -1.417  1.00 158.42 ? -36 DC  J C4    1 
ATOM   9771  N  N4    . DC  J 6 37  ? 21.478  46.921 -0.496  1.00 158.46 ? -36 DC  J N4    1 
ATOM   9772  C  C5    . DC  J 6 37  ? 22.240  44.748 -1.194  1.00 158.22 ? -36 DC  J C5    1 
ATOM   9773  C  C6    . DC  J 6 37  ? 22.194  43.798 -2.148  1.00 158.09 ? -36 DC  J C6    1 
ATOM   9774  P  P     . DT  J 6 38  ? 23.296  40.397 -7.430  1.00 150.28 ? -35 DT  J P     1 
ATOM   9775  O  OP1   . DT  J 6 38  ? 23.014  38.951 -7.562  1.00 150.26 ? -35 DT  J OP1   1 
ATOM   9776  O  OP2   . DT  J 6 38  ? 24.594  40.861 -6.882  1.00 149.70 ? -35 DT  J OP2   1 
ATOM   9777  O  "O5'" . DT  J 6 38  ? 23.099  41.075 -8.859  1.00 148.34 ? -35 DT  J "O5'" 1 
ATOM   9778  C  "C5'" . DT  J 6 38  ? 21.840  41.654 -9.214  1.00 146.23 ? -35 DT  J "C5'" 1 
ATOM   9779  C  "C4'" . DT  J 6 38  ? 21.959  43.159 -9.346  1.00 144.00 ? -35 DT  J "C4'" 1 
ATOM   9780  O  "O4'" . DT  J 6 38  ? 22.188  43.746 -8.045  1.00 143.88 ? -35 DT  J "O4'" 1 
ATOM   9781  C  "C3'" . DT  J 6 38  ? 23.108  43.633 -10.233 1.00 142.19 ? -35 DT  J "C3'" 1 
ATOM   9782  O  "O3'" . DT  J 6 38  ? 22.591  44.198 -11.434 1.00 139.88 ? -35 DT  J "O3'" 1 
ATOM   9783  C  "C2'" . DT  J 6 38  ? 23.873  44.659 -9.372  1.00 143.07 ? -35 DT  J "C2'" 1 
ATOM   9784  C  "C1'" . DT  J 6 38  ? 22.917  44.930 -8.216  1.00 143.90 ? -35 DT  J "C1'" 1 
ATOM   9785  N  N1    . DT  J 6 38  ? 23.590  45.295 -6.895  1.00 145.38 ? -35 DT  J N1    1 
ATOM   9786  C  C2    . DT  J 6 38  ? 23.348  46.549 -6.317  1.00 146.44 ? -35 DT  J C2    1 
ATOM   9787  O  O2    . DT  J 6 38  ? 22.653  47.412 -6.834  1.00 147.34 ? -35 DT  J O2    1 
ATOM   9788  N  N3    . DT  J 6 38  ? 23.959  46.756 -5.094  1.00 146.12 ? -35 DT  J N3    1 
ATOM   9789  C  C4    . DT  J 6 38  ? 24.749  45.853 -4.384  1.00 146.06 ? -35 DT  J C4    1 
ATOM   9790  O  O4    . DT  J 6 38  ? 25.229  46.192 -3.301  1.00 145.75 ? -35 DT  J O4    1 
ATOM   9791  C  C5    . DT  J 6 38  ? 24.981  44.568 -5.047  1.00 146.20 ? -35 DT  J C5    1 
ATOM   9792  C  C7    . DT  J 6 38  ? 25.850  43.523 -4.395  1.00 146.37 ? -35 DT  J C7    1 
ATOM   9793  C  C6    . DT  J 6 38  ? 24.397  44.356 -6.253  1.00 145.85 ? -35 DT  J C6    1 
ATOM   9794  P  P     . DA  J 6 39  ? 23.509  44.336 -12.740 1.00 138.10 ? -34 DA  J P     1 
ATOM   9795  O  OP1   . DA  J 6 39  ? 22.629  44.258 -13.916 1.00 137.61 ? -34 DA  J OP1   1 
ATOM   9796  O  OP2   . DA  J 6 39  ? 24.655  43.409 -12.621 1.00 137.48 ? -34 DA  J OP2   1 
ATOM   9797  O  "O5'" . DA  J 6 39  ? 24.077  45.824 -12.621 1.00 139.15 ? -34 DA  J "O5'" 1 
ATOM   9798  C  "C5'" . DA  J 6 39  ? 23.186  46.941 -12.474 1.00 140.16 ? -34 DA  J "C5'" 1 
ATOM   9799  C  "C4'" . DA  J 6 39  ? 23.897  48.146 -11.858 1.00 141.15 ? -34 DA  J "C4'" 1 
ATOM   9800  O  "O4'" . DA  J 6 39  ? 24.324  47.839 -10.508 1.00 141.09 ? -34 DA  J "O4'" 1 
ATOM   9801  C  "C3'" . DA  J 6 39  ? 25.157  48.635 -12.595 1.00 142.41 ? -34 DA  J "C3'" 1 
ATOM   9802  O  "O3'" . DA  J 6 39  ? 25.156  50.065 -12.669 1.00 144.03 ? -34 DA  J "O3'" 1 
ATOM   9803  C  "C2'" . DA  J 6 39  ? 26.289  48.133 -11.702 1.00 141.95 ? -34 DA  J "C2'" 1 
ATOM   9804  C  "C1'" . DA  J 6 39  ? 25.642  48.293 -10.346 1.00 141.92 ? -34 DA  J "C1'" 1 
ATOM   9805  N  N9    . DA  J 6 39  ? 26.281  47.553 -9.265  1.00 143.19 ? -34 DA  J N9    1 
ATOM   9806  C  C8    . DA  J 6 39  ? 26.919  46.339 -9.334  1.00 143.78 ? -34 DA  J C8    1 
ATOM   9807  N  N7    . DA  J 6 39  ? 27.380  45.913 -8.180  1.00 143.98 ? -34 DA  J N7    1 
ATOM   9808  C  C5    . DA  J 6 39  ? 27.062  46.938 -7.306  1.00 144.15 ? -34 DA  J C5    1 
ATOM   9809  C  C6    . DA  J 6 39  ? 27.308  47.128 -5.928  1.00 144.36 ? -34 DA  J C6    1 
ATOM   9810  N  N6    . DA  J 6 39  ? 27.940  46.228 -5.163  1.00 144.58 ? -34 DA  J N6    1 
ATOM   9811  N  N1    . DA  J 6 39  ? 26.830  48.263 -5.353  1.00 144.29 ? -34 DA  J N1    1 
ATOM   9812  C  C2    . DA  J 6 39  ? 26.196  49.164 -6.122  1.00 144.32 ? -34 DA  J C2    1 
ATOM   9813  N  N3    . DA  J 6 39  ? 25.905  49.096 -7.419  1.00 144.05 ? -34 DA  J N3    1 
ATOM   9814  C  C4    . DA  J 6 39  ? 26.383  47.955 -7.961  1.00 143.79 ? -34 DA  J C4    1 
ATOM   9815  P  P     . DA  J 6 40  ? 25.865  50.822 -13.886 1.00 146.08 ? -33 DA  J P     1 
ATOM   9816  O  OP1   . DA  J 6 40  ? 24.800  51.359 -14.758 1.00 145.54 ? -33 DA  J OP1   1 
ATOM   9817  O  OP2   . DA  J 6 40  ? 26.905  49.938 -14.458 1.00 145.85 ? -33 DA  J OP2   1 
ATOM   9818  O  "O5'" . DA  J 6 40  ? 26.620  52.032 -13.155 1.00 150.12 ? -33 DA  J "O5'" 1 
ATOM   9819  C  "C5'" . DA  J 6 40  ? 25.885  53.154 -12.650 1.00 153.84 ? -33 DA  J "C5'" 1 
ATOM   9820  C  "C4'" . DA  J 6 40  ? 26.276  53.470 -11.214 1.00 157.45 ? -33 DA  J "C4'" 1 
ATOM   9821  O  "O4'" . DA  J 6 40  ? 26.300  52.253 -10.430 1.00 158.68 ? -33 DA  J "O4'" 1 
ATOM   9822  C  "C3'" . DA  J 6 40  ? 27.655  54.074 -11.037 1.00 159.86 ? -33 DA  J "C3'" 1 
ATOM   9823  O  "O3'" . DA  J 6 40  ? 27.580  55.487 -11.190 1.00 162.11 ? -33 DA  J "O3'" 1 
ATOM   9824  C  "C2'" . DA  J 6 40  ? 27.991  53.696 -9.596  1.00 159.95 ? -33 DA  J "C2'" 1 
ATOM   9825  C  "C1'" . DA  J 6 40  ? 27.298  52.349 -9.427  1.00 159.84 ? -33 DA  J "C1'" 1 
ATOM   9826  N  N9    . DA  J 6 40  ? 28.201  51.208 -9.548  1.00 160.71 ? -33 DA  J N9    1 
ATOM   9827  C  C8    . DA  J 6 40  ? 28.542  50.544 -10.696 1.00 161.31 ? -33 DA  J C8    1 
ATOM   9828  N  N7    . DA  J 6 40  ? 29.339  49.521 -10.505 1.00 161.54 ? -33 DA  J N7    1 
ATOM   9829  C  C5    . DA  J 6 40  ? 29.576  49.537 -9.142  1.00 161.31 ? -33 DA  J C5    1 
ATOM   9830  C  C6    . DA  J 6 40  ? 30.357  48.710 -8.303  1.00 161.42 ? -33 DA  J C6    1 
ATOM   9831  N  N6    . DA  J 6 40  ? 31.078  47.679 -8.761  1.00 161.49 ? -33 DA  J N6    1 
ATOM   9832  N  N1    . DA  J 6 40  ? 30.392  49.007 -6.973  1.00 161.49 ? -33 DA  J N1    1 
ATOM   9833  C  C2    . DA  J 6 40  ? 29.664  50.047 -6.520  1.00 161.38 ? -33 DA  J C2    1 
ATOM   9834  N  N3    . DA  J 6 40  ? 28.882  50.888 -7.213  1.00 161.27 ? -33 DA  J N3    1 
ATOM   9835  C  C4    . DA  J 6 40  ? 28.885  50.577 -8.533  1.00 161.11 ? -33 DA  J C4    1 
ATOM   9836  P  P     . DC  J 6 41  ? 28.672  56.271 -12.057 1.00 163.85 ? -32 DC  J P     1 
ATOM   9837  O  OP1   . DC  J 6 41  ? 28.222  57.677 -12.163 1.00 163.81 ? -32 DC  J OP1   1 
ATOM   9838  O  OP2   . DC  J 6 41  ? 28.937  55.485 -13.288 1.00 164.20 ? -32 DC  J OP2   1 
ATOM   9839  O  "O5'" . DC  J 6 41  ? 29.980  56.203 -11.142 1.00 165.12 ? -32 DC  J "O5'" 1 
ATOM   9840  C  "C5'" . DC  J 6 41  ? 30.370  57.323 -10.379 1.00 166.82 ? -32 DC  J "C5'" 1 
ATOM   9841  C  "C4'" . DC  J 6 41  ? 30.730  56.916 -8.967  1.00 168.91 ? -32 DC  J "C4'" 1 
ATOM   9842  O  "O4'" . DC  J 6 41  ? 30.363  55.543 -8.740  1.00 169.42 ? -32 DC  J "O4'" 1 
ATOM   9843  C  "C3'" . DC  J 6 41  ? 32.204  56.968 -8.654  1.00 170.54 ? -32 DC  J "C3'" 1 
ATOM   9844  O  "O3'" . DC  J 6 41  ? 32.567  58.312 -8.285  1.00 172.03 ? -32 DC  J "O3'" 1 
ATOM   9845  C  "C2'" . DC  J 6 41  ? 32.312  56.006 -7.469  1.00 170.40 ? -32 DC  J "C2'" 1 
ATOM   9846  C  "C1'" . DC  J 6 41  ? 31.205  54.985 -7.750  1.00 170.13 ? -32 DC  J "C1'" 1 
ATOM   9847  N  N1    . DC  J 6 41  ? 31.714  53.635 -8.225  1.00 170.73 ? -32 DC  J N1    1 
ATOM   9848  C  C2    . DC  J 6 41  ? 32.144  52.664 -7.283  1.00 170.84 ? -32 DC  J C2    1 
ATOM   9849  O  O2    . DC  J 6 41  ? 32.098  52.920 -6.071  1.00 170.69 ? -32 DC  J O2    1 
ATOM   9850  N  N3    . DC  J 6 41  ? 32.597  51.459 -7.739  1.00 171.11 ? -32 DC  J N3    1 
ATOM   9851  C  C4    . DC  J 6 41  ? 32.612  51.196 -9.059  1.00 171.24 ? -32 DC  J C4    1 
ATOM   9852  N  N4    . DC  J 6 41  ? 33.078  50.006 -9.456  1.00 171.11 ? -32 DC  J N4    1 
ATOM   9853  C  C5    . DC  J 6 41  ? 32.174  52.160 -10.029 1.00 171.29 ? -32 DC  J C5    1 
ATOM   9854  C  C6    . DC  J 6 41  ? 31.746  53.353 -9.575  1.00 171.14 ? -32 DC  J C6    1 
ATOM   9855  P  P     . DC  J 6 42  ? 33.950  58.955 -8.785  1.00 173.30 ? -31 DC  J P     1 
ATOM   9856  O  OP1   . DC  J 6 42  ? 33.986  60.367 -8.326  1.00 173.49 ? -31 DC  J OP1   1 
ATOM   9857  O  OP2   . DC  J 6 42  ? 34.115  58.649 -10.229 1.00 173.25 ? -31 DC  J OP2   1 
ATOM   9858  O  "O5'" . DC  J 6 42  ? 35.044  58.109 -7.974  1.00 174.43 ? -31 DC  J "O5'" 1 
ATOM   9859  C  "C5'" . DC  J 6 42  ? 35.174  58.274 -6.560  1.00 175.66 ? -31 DC  J "C5'" 1 
ATOM   9860  C  "C4'" . DC  J 6 42  ? 35.929  57.115 -5.938  1.00 176.90 ? -31 DC  J "C4'" 1 
ATOM   9861  O  "O4'" . DC  J 6 42  ? 35.229  55.883 -6.195  1.00 176.95 ? -31 DC  J "O4'" 1 
ATOM   9862  C  "C3'" . DC  J 6 42  ? 37.321  56.873 -6.486  1.00 178.17 ? -31 DC  J "C3'" 1 
ATOM   9863  O  "O3'" . DC  J 6 42  ? 38.264  57.761 -5.854  1.00 179.66 ? -31 DC  J "O3'" 1 
ATOM   9864  C  "C2'" . DC  J 6 42  ? 37.556  55.419 -6.086  1.00 177.85 ? -31 DC  J "C2'" 1 
ATOM   9865  C  "C1'" . DC  J 6 42  ? 36.155  54.812 -6.194  1.00 177.43 ? -31 DC  J "C1'" 1 
ATOM   9866  N  N1    . DC  J 6 42  ? 35.955  53.959 -7.428  1.00 177.72 ? -31 DC  J N1    1 
ATOM   9867  C  C2    . DC  J 6 42  ? 36.221  52.569 -7.369  1.00 177.89 ? -31 DC  J C2    1 
ATOM   9868  O  O2    . DC  J 6 42  ? 36.593  52.063 -6.299  1.00 178.09 ? -31 DC  J O2    1 
ATOM   9869  N  N3    . DC  J 6 42  ? 36.046  51.816 -8.494  1.00 177.66 ? -31 DC  J N3    1 
ATOM   9870  C  C4    . DC  J 6 42  ? 35.653  52.396 -9.637  1.00 177.59 ? -31 DC  J C4    1 
ATOM   9871  N  N4    . DC  J 6 42  ? 35.492  51.615 -10.707 1.00 177.58 ? -31 DC  J N4    1 
ATOM   9872  C  C5    . DC  J 6 42  ? 35.379  53.800 -9.722  1.00 177.72 ? -31 DC  J C5    1 
ATOM   9873  C  C6    . DC  J 6 42  ? 35.552  54.538 -8.612  1.00 177.76 ? -31 DC  J C6    1 
ATOM   9874  P  P     . DC  J 6 43  ? 39.621  58.207 -6.606  1.00 180.81 ? -30 DC  J P     1 
ATOM   9875  O  OP1   . DC  J 6 43  ? 40.126  59.439 -5.945  1.00 181.05 ? -30 DC  J OP1   1 
ATOM   9876  O  OP2   . DC  J 6 43  ? 39.369  58.210 -8.070  1.00 180.85 ? -30 DC  J OP2   1 
ATOM   9877  O  "O5'" . DC  J 6 43  ? 40.627  56.998 -6.291  1.00 181.30 ? -30 DC  J "O5'" 1 
ATOM   9878  C  "C5'" . DC  J 6 43  ? 40.939  56.641 -4.940  1.00 181.78 ? -30 DC  J "C5'" 1 
ATOM   9879  C  "C4'" . DC  J 6 43  ? 41.508  55.233 -4.878  1.00 182.40 ? -30 DC  J "C4'" 1 
ATOM   9880  O  "O4'" . DC  J 6 43  ? 40.647  54.326 -5.612  1.00 182.55 ? -30 DC  J "O4'" 1 
ATOM   9881  C  "C3'" . DC  J 6 43  ? 42.910  55.074 -5.465  1.00 183.12 ? -30 DC  J "C3'" 1 
ATOM   9882  O  "O3'" . DC  J 6 43  ? 43.732  54.336 -4.566  1.00 184.46 ? -30 DC  J "O3'" 1 
ATOM   9883  C  "C2'" . DC  J 6 43  ? 42.682  54.327 -6.780  1.00 182.76 ? -30 DC  J "C2'" 1 
ATOM   9884  C  "C1'" . DC  J 6 43  ? 41.418  53.531 -6.484  1.00 182.59 ? -30 DC  J "C1'" 1 
ATOM   9885  N  N1    . DC  J 6 43  ? 40.596  53.203 -7.721  1.00 182.34 ? -30 DC  J N1    1 
ATOM   9886  C  C2    . DC  J 6 43  ? 40.504  51.863 -8.169  1.00 182.26 ? -30 DC  J C2    1 
ATOM   9887  O  O2    . DC  J 6 43  ? 41.053  50.956 -7.519  1.00 182.31 ? -30 DC  J O2    1 
ATOM   9888  N  N3    . DC  J 6 43  ? 39.798  51.598 -9.305  1.00 182.02 ? -30 DC  J N3    1 
ATOM   9889  C  C4    . DC  J 6 43  ? 39.211  52.594 -9.986  1.00 181.90 ? -30 DC  J C4    1 
ATOM   9890  N  N4    . DC  J 6 43  ? 38.538  52.277 -11.095 1.00 181.66 ? -30 DC  J N4    1 
ATOM   9891  C  C5    . DC  J 6 43  ? 39.304  53.963 -9.561  1.00 182.00 ? -30 DC  J C5    1 
ATOM   9892  C  C6    . DC  J 6 43  ? 40.007  54.220 -8.446  1.00 182.13 ? -30 DC  J C6    1 
ATOM   9893  P  P     . DT  J 6 44  ? 45.332  54.423 -4.665  1.00 185.88 ? -29 DT  J P     1 
ATOM   9894  O  OP1   . DT  J 6 44  ? 45.899  54.031 -3.347  1.00 185.96 ? -29 DT  J OP1   1 
ATOM   9895  O  OP2   . DT  J 6 44  ? 45.691  55.738 -5.248  1.00 186.22 ? -29 DT  J OP2   1 
ATOM   9896  O  "O5'" . DT  J 6 44  ? 45.676  53.293 -5.756  1.00 186.28 ? -29 DT  J "O5'" 1 
ATOM   9897  C  "C5'" . DT  J 6 44  ? 45.457  51.909 -5.454  1.00 186.69 ? -29 DT  J "C5'" 1 
ATOM   9898  C  "C4'" . DT  J 6 44  ? 45.572  51.035 -6.697  1.00 187.08 ? -29 DT  J "C4'" 1 
ATOM   9899  O  "O4'" . DT  J 6 44  ? 44.514  51.359 -7.632  1.00 187.38 ? -29 DT  J "O4'" 1 
ATOM   9900  C  "C3'" . DT  J 6 44  ? 46.895  51.147 -7.480  1.00 187.07 ? -29 DT  J "C3'" 1 
ATOM   9901  O  "O3'" . DT  J 6 44  ? 47.525  49.852 -7.576  1.00 186.69 ? -29 DT  J "O3'" 1 
ATOM   9902  C  "C2'" . DT  J 6 44  ? 46.456  51.662 -8.859  1.00 187.36 ? -29 DT  J "C2'" 1 
ATOM   9903  C  "C1'" . DT  J 6 44  ? 45.014  51.169 -8.925  1.00 187.68 ? -29 DT  J "C1'" 1 
ATOM   9904  N  N1    . DT  J 6 44  ? 44.127  51.900 -9.924  1.00 188.20 ? -29 DT  J N1    1 
ATOM   9905  C  C2    . DT  J 6 44  ? 43.256  51.166 -10.737 1.00 188.21 ? -29 DT  J C2    1 
ATOM   9906  O  O2    . DT  J 6 44  ? 43.138  49.949 -10.682 1.00 187.80 ? -29 DT  J O2    1 
ATOM   9907  N  N3    . DT  J 6 44  ? 42.505  51.927 -11.607 1.00 188.48 ? -29 DT  J N3    1 
ATOM   9908  C  C4    . DT  J 6 44  ? 42.533  53.312 -11.757 1.00 188.75 ? -29 DT  J C4    1 
ATOM   9909  O  O4    . DT  J 6 44  ? 41.794  53.843 -12.587 1.00 188.96 ? -29 DT  J O4    1 
ATOM   9910  C  C5    . DT  J 6 44  ? 43.468  54.016 -10.888 1.00 188.59 ? -29 DT  J C5    1 
ATOM   9911  C  C7    . DT  J 6 44  ? 43.591  55.510 -10.957 1.00 188.66 ? -29 DT  J C7    1 
ATOM   9912  C  C6    . DT  J 6 44  ? 44.202  53.288 -10.022 1.00 188.38 ? -29 DT  J C6    1 
ATOM   9913  P  P     . DA  J 6 45  ? 49.104  49.677 -7.320  1.00 186.19 ? -28 DA  J P     1 
ATOM   9914  O  OP1   . DA  J 6 45  ? 49.327  49.615 -5.853  1.00 186.15 ? -28 DA  J OP1   1 
ATOM   9915  O  OP2   . DA  J 6 45  ? 49.821  50.691 -8.129  1.00 186.26 ? -28 DA  J OP2   1 
ATOM   9916  O  "O5'" . DA  J 6 45  ? 49.409  48.237 -7.964  1.00 185.53 ? -28 DA  J "O5'" 1 
ATOM   9917  C  "C5'" . DA  J 6 45  ? 48.991  47.040 -7.296  1.00 184.93 ? -28 DA  J "C5'" 1 
ATOM   9918  C  "C4'" . DA  J 6 45  ? 48.183  46.134 -8.220  1.00 184.22 ? -28 DA  J "C4'" 1 
ATOM   9919  O  "O4'" . DA  J 6 45  ? 47.145  46.893 -8.883  1.00 183.60 ? -28 DA  J "O4'" 1 
ATOM   9920  C  "C3'" . DA  J 6 45  ? 48.985  45.421 -9.314  1.00 184.09 ? -28 DA  J "C3'" 1 
ATOM   9921  O  "O3'" . DA  J 6 45  ? 48.820  43.999 -9.192  1.00 184.42 ? -28 DA  J "O3'" 1 
ATOM   9922  C  "C2'" . DA  J 6 45  ? 48.402  45.954 -10.629 1.00 183.55 ? -28 DA  J "C2'" 1 
ATOM   9923  C  "C1'" . DA  J 6 45  ? 47.028  46.477 -10.220 1.00 183.17 ? -28 DA  J "C1'" 1 
ATOM   9924  N  N9    . DA  J 6 45  ? 46.591  47.627 -11.010 1.00 182.56 ? -28 DA  J N9    1 
ATOM   9925  C  C8    . DA  J 6 45  ? 47.081  48.901 -10.939 1.00 182.54 ? -28 DA  J C8    1 
ATOM   9926  N  N7    . DA  J 6 45  ? 46.512  49.740 -11.766 1.00 182.39 ? -28 DA  J N7    1 
ATOM   9927  C  C5    . DA  J 6 45  ? 45.586  48.969 -12.436 1.00 182.01 ? -28 DA  J C5    1 
ATOM   9928  C  C6    . DA  J 6 45  ? 44.649  49.276 -13.445 1.00 181.60 ? -28 DA  J C6    1 
ATOM   9929  N  N6    . DA  J 6 45  ? 44.511  50.497 -13.967 1.00 181.12 ? -28 DA  J N6    1 
ATOM   9930  N  N1    . DA  J 6 45  ? 43.877  48.267 -13.919 1.00 181.91 ? -28 DA  J N1    1 
ATOM   9931  C  C2    . DA  J 6 45  ? 44.026  47.036 -13.397 1.00 182.07 ? -28 DA  J C2    1 
ATOM   9932  N  N3    . DA  J 6 45  ? 44.865  46.630 -12.435 1.00 182.19 ? -28 DA  J N3    1 
ATOM   9933  C  C4    . DA  J 6 45  ? 45.622  47.656 -11.989 1.00 182.21 ? -28 DA  J C4    1 
ATOM   9934  P  P     . DA  J 6 46  ? 49.965  43.022 -9.642  1.00 184.47 ? -27 DA  J P     1 
ATOM   9935  O  OP1   . DA  J 6 46  ? 49.806  41.755 -8.893  1.00 184.42 ? -27 DA  J OP1   1 
ATOM   9936  O  OP2   . DA  J 6 46  ? 51.235  43.773 -9.588  1.00 184.57 ? -27 DA  J OP2   1 
ATOM   9937  O  "O5'" . DA  J 6 46  ? 49.638  42.798 -11.180 1.00 184.13 ? -27 DA  J "O5'" 1 
ATOM   9938  C  "C5'" . DA  J 6 46  ? 48.306  42.518 -11.632 1.00 183.64 ? -27 DA  J "C5'" 1 
ATOM   9939  C  "C4'" . DA  J 6 46  ? 48.312  42.372 -13.135 1.00 183.25 ? -27 DA  J "C4'" 1 
ATOM   9940  O  "O4'" . DA  J 6 46  ? 48.196  43.679 -13.730 1.00 183.47 ? -27 DA  J "O4'" 1 
ATOM   9941  C  "C3'" . DA  J 6 46  ? 49.611  41.817 -13.705 1.00 182.73 ? -27 DA  J "C3'" 1 
ATOM   9942  O  "O3'" . DA  J 6 46  ? 49.358  41.385 -15.037 1.00 181.67 ? -27 DA  J "O3'" 1 
ATOM   9943  C  "C2'" . DA  J 6 46  ? 50.440  43.068 -13.875 1.00 183.29 ? -27 DA  J "C2'" 1 
ATOM   9944  C  "C1'" . DA  J 6 46  ? 49.367  43.922 -14.493 1.00 183.73 ? -27 DA  J "C1'" 1 
ATOM   9945  N  N9    . DA  J 6 46  ? 49.552  45.353 -14.566 1.00 184.34 ? -27 DA  J N9    1 
ATOM   9946  C  C8    . DA  J 6 46  ? 50.600  46.206 -14.339 1.00 184.42 ? -27 DA  J C8    1 
ATOM   9947  N  N7    . DA  J 6 46  ? 50.308  47.465 -14.554 1.00 184.58 ? -27 DA  J N7    1 
ATOM   9948  C  C5    . DA  J 6 46  ? 48.981  47.432 -14.955 1.00 184.82 ? -27 DA  J C5    1 
ATOM   9949  C  C6    . DA  J 6 46  ? 48.082  48.432 -15.322 1.00 185.21 ? -27 DA  J C6    1 
ATOM   9950  N  N6    . DA  J 6 46  ? 48.393  49.727 -15.362 1.00 185.31 ? -27 DA  J N6    1 
ATOM   9951  N  N1    . DA  J 6 46  ? 46.829  48.056 -15.656 1.00 185.40 ? -27 DA  J N1    1 
ATOM   9952  C  C2    . DA  J 6 46  ? 46.525  46.759 -15.651 1.00 185.28 ? -27 DA  J C2    1 
ATOM   9953  N  N3    . DA  J 6 46  ? 47.273  45.729 -15.298 1.00 185.09 ? -27 DA  J N3    1 
ATOM   9954  C  C4    . DA  J 6 46  ? 48.507  46.138 -14.967 1.00 184.80 ? -27 DA  J C4    1 
ATOM   9955  P  P     . DC  J 6 47  ? 49.974  40.075 -15.472 1.00 180.60 ? -26 DC  J P     1 
ATOM   9956  O  OP1   . DC  J 6 47  ? 49.711  39.135 -14.359 1.00 180.67 ? -26 DC  J OP1   1 
ATOM   9957  O  OP2   . DC  J 6 47  ? 51.365  40.330 -15.912 1.00 180.49 ? -26 DC  J OP2   1 
ATOM   9958  O  "O5'" . DC  J 6 47  ? 49.124  39.617 -16.755 1.00 179.52 ? -26 DC  J "O5'" 1 
ATOM   9959  C  "C5'" . DC  J 6 47  ? 47.700  39.846 -16.797 1.00 178.33 ? -26 DC  J "C5'" 1 
ATOM   9960  C  "C4'" . DC  J 6 47  ? 47.321  40.935 -17.807 1.00 177.17 ? -26 DC  J "C4'" 1 
ATOM   9961  O  "O4'" . DC  J 6 47  ? 47.789  42.225 -17.370 1.00 176.72 ? -26 DC  J "O4'" 1 
ATOM   9962  C  "C3'" . DC  J 6 47  ? 47.889  40.770 -19.215 1.00 176.47 ? -26 DC  J "C3'" 1 
ATOM   9963  O  "O3'" . DC  J 6 47  ? 46.926  40.128 -20.058 1.00 175.69 ? -26 DC  J "O3'" 1 
ATOM   9964  C  "C2'" . DC  J 6 47  ? 48.182  42.212 -19.681 1.00 176.47 ? -26 DC  J "C2'" 1 
ATOM   9965  C  "C1'" . DC  J 6 47  ? 47.772  43.075 -18.488 1.00 176.40 ? -26 DC  J "C1'" 1 
ATOM   9966  N  N1    . DC  J 6 47  ? 48.691  44.272 -18.248 1.00 175.93 ? -26 DC  J N1    1 
ATOM   9967  C  C2    . DC  J 6 47  ? 48.204  45.593 -18.451 1.00 175.61 ? -26 DC  J C2    1 
ATOM   9968  O  O2    . DC  J 6 47  ? 47.011  45.779 -18.754 1.00 175.46 ? -26 DC  J O2    1 
ATOM   9969  N  N3    . DC  J 6 47  ? 49.054  46.639 -18.249 1.00 175.41 ? -26 DC  J N3    1 
ATOM   9970  C  C4    . DC  J 6 47  ? 50.333  46.420 -17.910 1.00 175.03 ? -26 DC  J C4    1 
ATOM   9971  N  N4    . DC  J 6 47  ? 51.115  47.483 -17.729 1.00 174.65 ? -26 DC  J N4    1 
ATOM   9972  C  C5    . DC  J 6 47  ? 50.858  45.099 -17.738 1.00 175.22 ? -26 DC  J C5    1 
ATOM   9973  C  C6    . DC  J 6 47  ? 50.020  44.065 -17.938 1.00 175.58 ? -26 DC  J C6    1 
ATOM   9974  P  P     . DC  J 6 48  ? 47.378  39.396 -21.418 1.00 174.56 ? -25 DC  J P     1 
ATOM   9975  O  OP1   . DC  J 6 48  ? 46.265  38.511 -21.854 1.00 174.51 ? -25 DC  J OP1   1 
ATOM   9976  O  OP2   . DC  J 6 48  ? 48.738  38.825 -21.218 1.00 174.76 ? -25 DC  J OP2   1 
ATOM   9977  O  "O5'" . DC  J 6 48  ? 47.508  40.617 -22.444 1.00 172.53 ? -25 DC  J "O5'" 1 
ATOM   9978  C  "C5'" . DC  J 6 48  ? 46.358  41.384 -22.802 1.00 170.52 ? -25 DC  J "C5'" 1 
ATOM   9979  C  "C4'" . DC  J 6 48  ? 46.752  42.550 -23.687 1.00 168.46 ? -25 DC  J "C4'" 1 
ATOM   9980  O  "O4'" . DC  J 6 48  ? 47.719  43.375 -22.992 1.00 167.79 ? -25 DC  J "O4'" 1 
ATOM   9981  C  "C3'" . DC  J 6 48  ? 47.400  42.167 -25.027 1.00 167.26 ? -25 DC  J "C3'" 1 
ATOM   9982  O  "O3'" . DC  J 6 48  ? 46.911  43.032 -26.065 1.00 166.24 ? -25 DC  J "O3'" 1 
ATOM   9983  C  "C2'" . DC  J 6 48  ? 48.884  42.409 -24.756 1.00 167.15 ? -25 DC  J "C2'" 1 
ATOM   9984  C  "C1'" . DC  J 6 48  ? 48.796  43.629 -23.854 1.00 167.63 ? -25 DC  J "C1'" 1 
ATOM   9985  N  N1    . DC  J 6 48  ? 50.027  43.921 -23.032 1.00 168.23 ? -25 DC  J N1    1 
ATOM   9986  C  C2    . DC  J 6 48  ? 50.473  45.255 -22.908 1.00 168.34 ? -25 DC  J C2    1 
ATOM   9987  O  O2    . DC  J 6 48  ? 49.845  46.161 -23.480 1.00 168.53 ? -25 DC  J O2    1 
ATOM   9988  N  N3    . DC  J 6 48  ? 51.580  45.514 -22.147 1.00 168.09 ? -25 DC  J N3    1 
ATOM   9989  C  C4    . DC  J 6 48  ? 52.225  44.512 -21.530 1.00 167.90 ? -25 DC  J C4    1 
ATOM   9990  N  N4    . DC  J 6 48  ? 53.303  44.818 -20.804 1.00 167.69 ? -25 DC  J N4    1 
ATOM   9991  C  C5    . DC  J 6 48  ? 51.787  43.149 -21.636 1.00 168.08 ? -25 DC  J C5    1 
ATOM   9992  C  C6    . DC  J 6 48  ? 50.691  42.901 -22.379 1.00 168.31 ? -25 DC  J C6    1 
ATOM   9993  P  P     . DC  J 6 49  ? 46.146  42.450 -27.348 1.00 164.92 ? -24 DC  J P     1 
ATOM   9994  O  OP1   . DC  J 6 49  ? 44.787  42.069 -26.915 1.00 164.75 ? -24 DC  J OP1   1 
ATOM   9995  O  OP2   . DC  J 6 49  ? 47.017  41.451 -28.002 1.00 164.66 ? -24 DC  J OP2   1 
ATOM   9996  O  "O5'" . DC  J 6 49  ? 46.064  43.719 -28.320 1.00 164.90 ? -24 DC  J "O5'" 1 
ATOM   9997  C  "C5'" . DC  J 6 49  ? 45.395  44.901 -27.901 1.00 165.44 ? -24 DC  J "C5'" 1 
ATOM   9998  C  "C4'" . DC  J 6 49  ? 46.364  46.058 -27.777 1.00 166.18 ? -24 DC  J "C4'" 1 
ATOM   9999  O  "O4'" . DC  J 6 49  ? 47.430  45.702 -26.878 1.00 166.94 ? -24 DC  J "O4'" 1 
ATOM   10000 C  "C3'" . DC  J 6 49  ? 47.080  46.437 -29.052 1.00 166.47 ? -24 DC  J "C3'" 1 
ATOM   10001 O  "O3'" . DC  J 6 49  ? 46.287  47.327 -29.805 1.00 166.62 ? -24 DC  J "O3'" 1 
ATOM   10002 C  "C2'" . DC  J 6 49  ? 48.351  47.120 -28.539 1.00 166.96 ? -24 DC  J "C2'" 1 
ATOM   10003 C  "C1'" . DC  J 6 49  ? 48.536  46.543 -27.135 1.00 167.33 ? -24 DC  J "C1'" 1 
ATOM   10004 N  N1    . DC  J 6 49  ? 49.838  45.777 -26.961 1.00 168.11 ? -24 DC  J N1    1 
ATOM   10005 C  C2    . DC  J 6 49  ? 50.999  46.467 -26.532 1.00 168.89 ? -24 DC  J C2    1 
ATOM   10006 O  O2    . DC  J 6 49  ? 50.925  47.678 -26.254 1.00 169.08 ? -24 DC  J O2    1 
ATOM   10007 N  N3    . DC  J 6 49  ? 52.175  45.769 -26.409 1.00 169.07 ? -24 DC  J N3    1 
ATOM   10008 C  C4    . DC  J 6 49  ? 52.223  44.460 -26.728 1.00 168.75 ? -24 DC  J C4    1 
ATOM   10009 N  N4    . DC  J 6 49  ? 53.395  43.823 -26.593 1.00 168.47 ? -24 DC  J N4    1 
ATOM   10010 C  C5    . DC  J 6 49  ? 51.066  43.755 -27.209 1.00 168.40 ? -24 DC  J C5    1 
ATOM   10011 C  C6    . DC  J 6 49  ? 49.916  44.448 -27.326 1.00 168.16 ? -24 DC  J C6    1 
ATOM   10012 P  P     . DT  J 6 50  ? 46.523  47.473 -31.379 1.00 167.40 ? -23 DT  J P     1 
ATOM   10013 O  OP1   . DT  J 6 50  ? 45.316  48.088 -31.960 1.00 167.33 ? -23 DT  J OP1   1 
ATOM   10014 O  OP2   . DT  J 6 50  ? 47.014  46.174 -31.891 1.00 167.12 ? -23 DT  J OP2   1 
ATOM   10015 O  "O5'" . DT  J 6 50  ? 47.718  48.519 -31.476 1.00 169.54 ? -23 DT  J "O5'" 1 
ATOM   10016 C  "C5'" . DT  J 6 50  ? 47.551  49.840 -30.961 1.00 171.65 ? -23 DT  J "C5'" 1 
ATOM   10017 C  "C4'" . DT  J 6 50  ? 48.893  50.495 -30.712 1.00 173.56 ? -23 DT  J "C4'" 1 
ATOM   10018 O  "O4'" . DT  J 6 50  ? 49.756  49.595 -29.971 1.00 173.77 ? -23 DT  J "O4'" 1 
ATOM   10019 C  "C3'" . DT  J 6 50  ? 49.652  50.887 -31.977 1.00 175.34 ? -23 DT  J "C3'" 1 
ATOM   10020 O  "O3'" . DT  J 6 50  ? 49.927  52.284 -31.955 1.00 177.81 ? -23 DT  J "O3'" 1 
ATOM   10021 C  "C2'" . DT  J 6 50  ? 50.931  50.043 -31.928 1.00 174.78 ? -23 DT  J "C2'" 1 
ATOM   10022 C  "C1'" . DT  J 6 50  ? 51.065  49.729 -30.442 1.00 174.33 ? -23 DT  J "C1'" 1 
ATOM   10023 N  N1    . DT  J 6 50  ? 51.842  48.453 -30.133 1.00 174.61 ? -23 DT  J N1    1 
ATOM   10024 C  C2    . DT  J 6 50  ? 52.941  48.503 -29.266 1.00 175.14 ? -23 DT  J C2    1 
ATOM   10025 O  O2    . DT  J 6 50  ? 53.320  49.520 -28.698 1.00 175.26 ? -23 DT  J O2    1 
ATOM   10026 N  N3    . DT  J 6 50  ? 53.582  47.299 -29.079 1.00 175.27 ? -23 DT  J N3    1 
ATOM   10027 C  C4    . DT  J 6 50  ? 53.268  46.078 -29.667 1.00 175.30 ? -23 DT  J C4    1 
ATOM   10028 O  O4    . DT  J 6 50  ? 53.950  45.088 -29.397 1.00 175.57 ? -23 DT  J O4    1 
ATOM   10029 C  C5    . DT  J 6 50  ? 52.124  46.095 -30.574 1.00 174.78 ? -23 DT  J C5    1 
ATOM   10030 C  C7    . DT  J 6 50  ? 51.690  44.836 -31.272 1.00 174.45 ? -23 DT  J C7    1 
ATOM   10031 C  C6    . DT  J 6 50  ? 51.476  47.265 -30.758 1.00 174.56 ? -23 DT  J C6    1 
ATOM   10032 P  P     . DA  J 6 51  ? 50.170  53.111 -33.313 1.00 180.32 ? -22 DA  J P     1 
ATOM   10033 O  OP1   . DA  J 6 51  ? 49.370  54.355 -33.237 1.00 180.01 ? -22 DA  J OP1   1 
ATOM   10034 O  OP2   . DA  J 6 51  ? 49.998  52.198 -34.468 1.00 180.35 ? -22 DA  J OP2   1 
ATOM   10035 O  "O5'" . DA  J 6 51  ? 51.722  53.483 -33.218 1.00 183.47 ? -22 DA  J "O5'" 1 
ATOM   10036 C  "C5'" . DA  J 6 51  ? 52.261  54.013 -32.003 1.00 186.48 ? -22 DA  J "C5'" 1 
ATOM   10037 C  "C4'" . DA  J 6 51  ? 53.705  53.587 -31.809 1.00 189.45 ? -22 DA  J "C4'" 1 
ATOM   10038 O  "O4'" . DA  J 6 51  ? 53.766  52.213 -31.392 1.00 190.06 ? -22 DA  J "O4'" 1 
ATOM   10039 C  "C3'" . DA  J 6 51  ? 54.583  53.665 -33.057 1.00 191.91 ? -22 DA  J "C3'" 1 
ATOM   10040 O  "O3'" . DA  J 6 51  ? 55.380  54.838 -33.013 1.00 194.94 ? -22 DA  J "O3'" 1 
ATOM   10041 C  "C2'" . DA  J 6 51  ? 55.439  52.386 -33.005 1.00 191.44 ? -22 DA  J "C2'" 1 
ATOM   10042 C  "C1'" . DA  J 6 51  ? 55.063  51.764 -31.664 1.00 190.99 ? -22 DA  J "C1'" 1 
ATOM   10043 N  N9    . DA  J 6 51  ? 55.093  50.296 -31.655 1.00 191.50 ? -22 DA  J N9    1 
ATOM   10044 C  C8    . DA  J 6 51  ? 54.263  49.442 -32.334 1.00 191.58 ? -22 DA  J C8    1 
ATOM   10045 N  N7    . DA  J 6 51  ? 54.545  48.170 -32.161 1.00 191.69 ? -22 DA  J N7    1 
ATOM   10046 C  C5    . DA  J 6 51  ? 55.664  48.184 -31.349 1.00 191.90 ? -22 DA  J C5    1 
ATOM   10047 C  C6    . DA  J 6 51  ? 56.455  47.148 -30.792 1.00 192.13 ? -22 DA  J C6    1 
ATOM   10048 N  N6    . DA  J 6 51  ? 56.233  45.849 -31.018 1.00 191.87 ? -22 DA  J N6    1 
ATOM   10049 N  N1    . DA  J 6 51  ? 57.510  47.508 -30.015 1.00 192.65 ? -22 DA  J N1    1 
ATOM   10050 C  C2    . DA  J 6 51  ? 57.756  48.818 -29.809 1.00 192.68 ? -22 DA  J C2    1 
ATOM   10051 N  N3    . DA  J 6 51  ? 57.077  49.879 -30.266 1.00 192.49 ? -22 DA  J N3    1 
ATOM   10052 C  C4    . DA  J 6 51  ? 56.024  49.489 -31.029 1.00 192.00 ? -22 DA  J C4    1 
ATOM   10053 P  P     . DA  J 6 52  ? 55.961  55.479 -34.362 1.00 197.87 ? -21 DA  J P     1 
ATOM   10054 O  OP1   . DA  J 6 52  ? 56.224  56.916 -34.103 1.00 197.84 ? -21 DA  J OP1   1 
ATOM   10055 O  OP2   . DA  J 6 52  ? 55.078  55.083 -35.486 1.00 197.76 ? -21 DA  J OP2   1 
ATOM   10056 O  "O5'" . DA  J 6 52  ? 57.356  54.712 -34.539 1.00 200.81 ? -21 DA  J "O5'" 1 
ATOM   10057 C  "C5'" . DA  J 6 52  ? 58.430  54.966 -33.632 1.00 203.81 ? -21 DA  J "C5'" 1 
ATOM   10058 C  "C4'" . DA  J 6 52  ? 59.435  53.825 -33.625 1.00 206.80 ? -21 DA  J "C4'" 1 
ATOM   10059 O  "O4'" . DA  J 6 52  ? 58.759  52.573 -33.404 1.00 207.27 ? -21 DA  J "O4'" 1 
ATOM   10060 C  "C3'" . DA  J 6 52  ? 60.238  53.638 -34.921 1.00 209.19 ? -21 DA  J "C3'" 1 
ATOM   10061 O  "O3'" . DA  J 6 52  ? 61.591  54.132 -34.749 1.00 212.04 ? -21 DA  J "O3'" 1 
ATOM   10062 C  "C2'" . DA  J 6 52  ? 60.209  52.117 -35.171 1.00 208.57 ? -21 DA  J "C2'" 1 
ATOM   10063 C  "C1'" . DA  J 6 52  ? 59.584  51.558 -33.897 1.00 207.88 ? -21 DA  J "C1'" 1 
ATOM   10064 N  N9    . DA  J 6 52  ? 58.782  50.360 -34.120 1.00 207.90 ? -21 DA  J N9    1 
ATOM   10065 C  C8    . DA  J 6 52  ? 57.614  50.267 -34.832 1.00 208.01 ? -21 DA  J C8    1 
ATOM   10066 N  N7    . DA  J 6 52  ? 57.125  49.051 -34.900 1.00 208.14 ? -21 DA  J N7    1 
ATOM   10067 C  C5    . DA  J 6 52  ? 58.049  48.282 -34.212 1.00 208.20 ? -21 DA  J C5    1 
ATOM   10068 C  C6    . DA  J 6 52  ? 58.113  46.895 -33.923 1.00 208.27 ? -21 DA  J C6    1 
ATOM   10069 N  N6    . DA  J 6 52  ? 57.180  46.017 -34.315 1.00 208.19 ? -21 DA  J N6    1 
ATOM   10070 N  N1    . DA  J 6 52  ? 59.182  46.448 -33.210 1.00 208.29 ? -21 DA  J N1    1 
ATOM   10071 C  C2    . DA  J 6 52  ? 60.117  47.335 -32.814 1.00 208.10 ? -21 DA  J C2    1 
ATOM   10072 N  N3    . DA  J 6 52  ? 60.160  48.659 -33.018 1.00 207.94 ? -21 DA  J N3    1 
ATOM   10073 C  C4    . DA  J 6 52  ? 59.090  49.073 -33.735 1.00 208.00 ? -21 DA  J C4    1 
ATOM   10074 P  P     . DC  J 6 53  ? 62.549  54.412 -36.018 1.00 214.72 ? -20 DC  J P     1 
ATOM   10075 O  OP1   . DC  J 6 53  ? 63.646  55.315 -35.572 1.00 214.64 ? -20 DC  J OP1   1 
ATOM   10076 O  OP2   . DC  J 6 53  ? 61.700  54.808 -37.170 1.00 214.73 ? -20 DC  J OP2   1 
ATOM   10077 O  "O5'" . DC  J 6 53  ? 63.148  52.949 -36.330 1.00 217.03 ? -20 DC  J "O5'" 1 
ATOM   10078 C  "C5'" . DC  J 6 53  ? 64.542  52.683 -36.162 1.00 219.24 ? -20 DC  J "C5'" 1 
ATOM   10079 C  "C4'" . DC  J 6 53  ? 64.813  51.228 -35.787 1.00 221.35 ? -20 DC  J "C4'" 1 
ATOM   10080 O  "O4'" . DC  J 6 53  ? 63.622  50.573 -35.306 1.00 221.78 ? -20 DC  J "O4'" 1 
ATOM   10081 C  "C3'" . DC  J 6 53  ? 65.268  50.332 -36.917 1.00 222.93 ? -20 DC  J "C3'" 1 
ATOM   10082 O  "O3'" . DC  J 6 53  ? 66.652  50.567 -37.210 1.00 224.79 ? -20 DC  J "O3'" 1 
ATOM   10083 C  "C2'" . DC  J 6 53  ? 65.042  48.944 -36.312 1.00 222.53 ? -20 DC  J "C2'" 1 
ATOM   10084 C  "C1'" . DC  J 6 53  ? 63.843  49.171 -35.376 1.00 222.22 ? -20 DC  J "C1'" 1 
ATOM   10085 N  N1    . DC  J 6 53  ? 62.586  48.468 -35.831 1.00 222.43 ? -20 DC  J N1    1 
ATOM   10086 C  C2    . DC  J 6 53  ? 62.369  47.114 -35.471 1.00 222.57 ? -20 DC  J C2    1 
ATOM   10087 O  O2    . DC  J 6 53  ? 63.188  46.533 -34.744 1.00 222.69 ? -20 DC  J O2    1 
ATOM   10088 N  N3    . DC  J 6 53  ? 61.240  46.488 -35.913 1.00 222.51 ? -20 DC  J N3    1 
ATOM   10089 C  C4    . DC  J 6 53  ? 60.368  47.140 -36.695 1.00 222.47 ? -20 DC  J C4    1 
ATOM   10090 N  N4    . DC  J 6 53  ? 59.280  46.479 -37.105 1.00 222.37 ? -20 DC  J N4    1 
ATOM   10091 C  C5    . DC  J 6 53  ? 60.578  48.504 -37.089 1.00 222.54 ? -20 DC  J C5    1 
ATOM   10092 C  C6    . DC  J 6 53  ? 61.696  49.115 -36.656 1.00 222.50 ? -20 DC  J C6    1 
ATOM   10093 P  P     . DC  J 6 54  ? 67.226  50.350 -38.698 1.00 226.43 ? -19 DC  J P     1 
ATOM   10094 O  OP1   . DC  J 6 54  ? 68.576  50.967 -38.759 1.00 226.35 ? -19 DC  J OP1   1 
ATOM   10095 O  OP2   . DC  J 6 54  ? 66.182  50.771 -39.667 1.00 226.47 ? -19 DC  J OP2   1 
ATOM   10096 O  "O5'" . DC  J 6 54  ? 67.368  48.754 -38.803 1.00 227.79 ? -19 DC  J "O5'" 1 
ATOM   10097 C  "C5'" . DC  J 6 54  ? 68.288  48.045 -37.959 1.00 229.01 ? -19 DC  J "C5'" 1 
ATOM   10098 C  "C4'" . DC  J 6 54  ? 68.063  46.542 -38.048 1.00 230.12 ? -19 DC  J "C4'" 1 
ATOM   10099 O  "O4'" . DC  J 6 54  ? 66.653  46.245 -37.865 1.00 230.40 ? -19 DC  J "O4'" 1 
ATOM   10100 C  "C3'" . DC  J 6 54  ? 68.474  45.901 -39.380 1.00 230.99 ? -19 DC  J "C3'" 1 
ATOM   10101 O  "O3'" . DC  J 6 54  ? 69.330  44.767 -39.144 1.00 232.01 ? -19 DC  J "O3'" 1 
ATOM   10102 C  "C2'" . DC  J 6 54  ? 67.141  45.491 -40.020 1.00 230.85 ? -19 DC  J "C2'" 1 
ATOM   10103 C  "C1'" . DC  J 6 54  ? 66.263  45.266 -38.798 1.00 230.72 ? -19 DC  J "C1'" 1 
ATOM   10104 N  N1    . DC  J 6 54  ? 64.774  45.397 -39.072 1.00 230.91 ? -19 DC  J N1    1 
ATOM   10105 C  C2    . DC  J 6 54  ? 64.001  44.239 -39.344 1.00 231.07 ? -19 DC  J C2    1 
ATOM   10106 O  O2    . DC  J 6 54  ? 64.545  43.123 -39.352 1.00 231.10 ? -19 DC  J O2    1 
ATOM   10107 N  N3    . DC  J 6 54  ? 62.665  44.382 -39.585 1.00 231.12 ? -19 DC  J N3    1 
ATOM   10108 C  C4    . DC  J 6 54  ? 62.101  45.600 -39.568 1.00 231.10 ? -19 DC  J C4    1 
ATOM   10109 N  N4    . DC  J 6 54  ? 60.789  45.684 -39.812 1.00 231.10 ? -19 DC  J N4    1 
ATOM   10110 C  C5    . DC  J 6 54  ? 62.866  46.786 -39.304 1.00 231.04 ? -19 DC  J C5    1 
ATOM   10111 C  C6    . DC  J 6 54  ? 64.181  46.640 -39.065 1.00 230.96 ? -19 DC  J C6    1 
ATOM   10112 P  P     . DC  J 6 55  ? 70.533  44.411 -40.160 1.00 232.94 ? -18 DC  J P     1 
ATOM   10113 O  OP1   . DC  J 6 55  ? 71.814  44.534 -39.417 1.00 232.91 ? -18 DC  J OP1   1 
ATOM   10114 O  OP2   . DC  J 6 55  ? 70.332  45.182 -41.413 1.00 233.13 ? -18 DC  J OP2   1 
ATOM   10115 O  "O5'" . DC  J 6 55  ? 70.281  42.858 -40.501 1.00 232.99 ? -18 DC  J "O5'" 1 
ATOM   10116 C  "C5'" . DC  J 6 55  ? 68.960  42.391 -40.794 1.00 232.70 ? -18 DC  J "C5'" 1 
ATOM   10117 C  "C4'" . DC  J 6 55  ? 68.973  41.166 -41.709 1.00 232.42 ? -18 DC  J "C4'" 1 
ATOM   10118 O  "O4'" . DC  J 6 55  ? 67.614  40.751 -41.963 1.00 232.26 ? -18 DC  J "O4'" 1 
ATOM   10119 C  "C3'" . DC  J 6 55  ? 69.576  41.365 -43.094 1.00 232.37 ? -18 DC  J "C3'" 1 
ATOM   10120 O  "O3'" . DC  J 6 55  ? 70.017  40.101 -43.616 1.00 232.63 ? -18 DC  J "O3'" 1 
ATOM   10121 C  "C2'" . DC  J 6 55  ? 68.398  41.918 -43.892 1.00 232.18 ? -18 DC  J "C2'" 1 
ATOM   10122 C  "C1'" . DC  J 6 55  ? 67.195  41.211 -43.242 1.00 232.09 ? -18 DC  J "C1'" 1 
ATOM   10123 N  N1    . DC  J 6 55  ? 65.960  42.093 -43.062 1.00 231.77 ? -18 DC  J N1    1 
ATOM   10124 C  C2    . DC  J 6 55  ? 64.799  41.572 -42.436 1.00 231.46 ? -18 DC  J C2    1 
ATOM   10125 O  O2    . DC  J 6 55  ? 64.787  40.396 -42.038 1.00 231.39 ? -18 DC  J O2    1 
ATOM   10126 N  N3    . DC  J 6 55  ? 63.703  42.376 -42.308 1.00 231.30 ? -18 DC  J N3    1 
ATOM   10127 C  C4    . DC  J 6 55  ? 63.736  43.640 -42.758 1.00 231.26 ? -18 DC  J C4    1 
ATOM   10128 N  N4    . DC  J 6 55  ? 62.643  44.391 -42.594 1.00 231.09 ? -18 DC  J N4    1 
ATOM   10129 C  C5    . DC  J 6 55  ? 64.899  44.189 -43.387 1.00 231.47 ? -18 DC  J C5    1 
ATOM   10130 C  C6    . DC  J 6 55  ? 65.973  43.393 -43.518 1.00 231.65 ? -18 DC  J C6    1 
ATOM   10131 P  P     . DT  J 6 56  ? 71.263  40.005 -44.632 1.00 232.99 ? -17 DT  J P     1 
ATOM   10132 O  OP1   . DT  J 6 56  ? 71.721  38.594 -44.644 1.00 233.40 ? -17 DT  J OP1   1 
ATOM   10133 O  OP2   . DT  J 6 56  ? 72.233  41.081 -44.301 1.00 233.27 ? -17 DT  J OP2   1 
ATOM   10134 O  "O5'" . DT  J 6 56  ? 70.598  40.360 -46.054 1.00 231.91 ? -17 DT  J "O5'" 1 
ATOM   10135 C  "C5'" . DT  J 6 56  ? 70.288  39.325 -46.997 1.00 230.71 ? -17 DT  J "C5'" 1 
ATOM   10136 C  "C4'" . DT  J 6 56  ? 68.958  38.687 -46.658 1.00 229.52 ? -17 DT  J "C4'" 1 
ATOM   10137 O  "O4'" . DT  J 6 56  ? 68.036  39.713 -46.264 1.00 229.42 ? -17 DT  J "O4'" 1 
ATOM   10138 C  "C3'" . DT  J 6 56  ? 68.283  37.938 -47.802 1.00 228.59 ? -17 DT  J "C3'" 1 
ATOM   10139 O  "O3'" . DT  J 6 56  ? 68.489  36.473 -47.675 1.00 227.20 ? -17 DT  J "O3'" 1 
ATOM   10140 C  "C2'" . DT  J 6 56  ? 66.806  38.390 -47.766 1.00 229.11 ? -17 DT  J "C2'" 1 
ATOM   10141 C  "C1'" . DT  J 6 56  ? 66.728  39.280 -46.524 1.00 229.47 ? -17 DT  J "C1'" 1 
ATOM   10142 N  N1    . DT  J 6 56  ? 65.834  40.506 -46.681 1.00 229.77 ? -17 DT  J N1    1 
ATOM   10143 C  C2    . DT  J 6 56  ? 64.537  40.488 -46.163 1.00 229.78 ? -17 DT  J C2    1 
ATOM   10144 O  O2    . DT  J 6 56  ? 64.038  39.519 -45.606 1.00 229.64 ? -17 DT  J O2    1 
ATOM   10145 N  N3    . DT  J 6 56  ? 63.841  41.667 -46.323 1.00 229.87 ? -17 D