data_6KJV
# 
_entry.id   6KJV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KJV         
WWPDB D_1300013074 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        '5VEW contains the same protein-ligand complex but with mutation' 
_pdbx_database_related.db_id          5VEW 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KJV 
_pdbx_database_status.recvd_initial_deposition_date   2019-07-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Song, G.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Iucrj 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2052-2525 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                996 
_citation.page_last                 1006 
_citation.title                     'Mutagenesis facilitated crystallization of GLP-1R.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2052252519013496 
_citation.pdbx_database_id_PubMed   31709055 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Xu, Y.'   1 ?                   
primary 'Wang, Y.' 2 ?                   
primary 'Wang, Y.' 3 ?                   
primary 'Liu, K.'  4 ?                   
primary 'Peng, Y.' 5 ?                   
primary 'Yao, D.'  6 ?                   
primary 'Tao, H.'  7 ?                   
primary 'Liu, H.'  8 0000-0001-7324-6632 
primary 'Song, G.' 9 ?                   
# 
_cell.angle_alpha                  91.53 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.34 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  106.49 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KJV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     65.030 
_cell.length_a_esd                 ? 
_cell.length_b                     68.300 
_cell.length_b_esd                 ? 
_cell.length_c                     83.430 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KJV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucagon-like peptide 1 receptor,Endolysin,Glucagon-like peptide 1 receptor' 52583.305 2 ? 
S193C,I196F,S225A,S271A,I317C,G318I,K346A,C347F,G361C,205-214deletion,R1011G,C1053T,C1096A,I1136R ? ? 
2 non-polymer syn 
;N-{4-[(R)-(3,3-dimethylcyclobutyl)({6-[4-(trifluoromethyl)-1H-imidazol-1-yl]pyridin-3-yl}amino)methyl]benzene-1-carbonyl}-beta-alanine
;
515.527   2 ? ?                                                                                                 ? ? 
3 non-polymer syn '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 356.540   2 ? ? ? ? 
4 water       nat water 18.015    8 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GLP-1R,Lysis protein,Lysozyme,Muramidase,GLP-1R' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALCVFFKDAALKWMGS
GDGLLSYQDSLACRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSP
SLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNS
LRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYSEQWIFRLYVAIGWGVPLLFVVPWGIVKYLYEDEGC
WTRNSNMNYWLIIRLPILFACIVNFLIFVRVICIVVSKLKANLMCKTDIAFRLAKSTLTLIPLLCTHEVIFAFVMDEHAR
GTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERWRLEHLHIQRDS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALCVFFKDAALKWMGS
GDGLLSYQDSLACRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSP
SLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNS
LRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYSEQWIFRLYVAIGWGVPLLFVVPWGIVKYLYEDEGC
WTRNSNMNYWLIIRLPILFACIVNFLIFVRVICIVVSKLKANLMCKTDIAFRLAKSTLTLIPLLCTHEVIFAFVMDEHAR
GTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERWRLEHLHIQRDS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   SER n 
1 4   LYS n 
1 5   ARG n 
1 6   GLY n 
1 7   GLU n 
1 8   ARG n 
1 9   SER n 
1 10  SER n 
1 11  PRO n 
1 12  GLU n 
1 13  GLU n 
1 14  GLN n 
1 15  LEU n 
1 16  LEU n 
1 17  PHE n 
1 18  LEU n 
1 19  TYR n 
1 20  ILE n 
1 21  ILE n 
1 22  TYR n 
1 23  THR n 
1 24  VAL n 
1 25  GLY n 
1 26  TYR n 
1 27  ALA n 
1 28  LEU n 
1 29  SER n 
1 30  PHE n 
1 31  SER n 
1 32  ALA n 
1 33  LEU n 
1 34  VAL n 
1 35  ILE n 
1 36  ALA n 
1 37  SER n 
1 38  ALA n 
1 39  ILE n 
1 40  LEU n 
1 41  LEU n 
1 42  GLY n 
1 43  PHE n 
1 44  ARG n 
1 45  HIS n 
1 46  LEU n 
1 47  HIS n 
1 48  CYS n 
1 49  THR n 
1 50  ARG n 
1 51  ASN n 
1 52  TYR n 
1 53  ILE n 
1 54  HIS n 
1 55  LEU n 
1 56  ASN n 
1 57  LEU n 
1 58  PHE n 
1 59  ALA n 
1 60  SER n 
1 61  PHE n 
1 62  ILE n 
1 63  LEU n 
1 64  ARG n 
1 65  ALA n 
1 66  LEU n 
1 67  CYS n 
1 68  VAL n 
1 69  PHE n 
1 70  PHE n 
1 71  LYS n 
1 72  ASP n 
1 73  ALA n 
1 74  ALA n 
1 75  LEU n 
1 76  LYS n 
1 77  TRP n 
1 78  MET n 
1 79  GLY n 
1 80  SER n 
1 81  GLY n 
1 82  ASP n 
1 83  GLY n 
1 84  LEU n 
1 85  LEU n 
1 86  SER n 
1 87  TYR n 
1 88  GLN n 
1 89  ASP n 
1 90  SER n 
1 91  LEU n 
1 92  ALA n 
1 93  CYS n 
1 94  ARG n 
1 95  LEU n 
1 96  VAL n 
1 97  PHE n 
1 98  LEU n 
1 99  LEU n 
1 100 MET n 
1 101 GLN n 
1 102 TYR n 
1 103 CYS n 
1 104 VAL n 
1 105 ALA n 
1 106 ALA n 
1 107 ASN n 
1 108 TYR n 
1 109 TYR n 
1 110 TRP n 
1 111 LEU n 
1 112 LEU n 
1 113 VAL n 
1 114 GLU n 
1 115 GLY n 
1 116 VAL n 
1 117 TYR n 
1 118 LEU n 
1 119 TYR n 
1 120 THR n 
1 121 LEU n 
1 122 LEU n 
1 123 ALA n 
1 124 PHE n 
1 125 ASN n 
1 126 ILE n 
1 127 PHE n 
1 128 GLU n 
1 129 MET n 
1 130 LEU n 
1 131 ARG n 
1 132 ILE n 
1 133 ASP n 
1 134 GLU n 
1 135 GLY n 
1 136 LEU n 
1 137 ARG n 
1 138 LEU n 
1 139 LYS n 
1 140 ILE n 
1 141 TYR n 
1 142 LYS n 
1 143 ASP n 
1 144 THR n 
1 145 GLU n 
1 146 GLY n 
1 147 TYR n 
1 148 TYR n 
1 149 THR n 
1 150 ILE n 
1 151 GLY n 
1 152 ILE n 
1 153 GLY n 
1 154 HIS n 
1 155 LEU n 
1 156 LEU n 
1 157 THR n 
1 158 LYS n 
1 159 SER n 
1 160 PRO n 
1 161 SER n 
1 162 LEU n 
1 163 ASN n 
1 164 ALA n 
1 165 ALA n 
1 166 LYS n 
1 167 SER n 
1 168 GLU n 
1 169 LEU n 
1 170 ASP n 
1 171 LYS n 
1 172 ALA n 
1 173 ILE n 
1 174 GLY n 
1 175 ARG n 
1 176 ASN n 
1 177 THR n 
1 178 ASN n 
1 179 GLY n 
1 180 VAL n 
1 181 ILE n 
1 182 THR n 
1 183 LYS n 
1 184 ASP n 
1 185 GLU n 
1 186 ALA n 
1 187 GLU n 
1 188 LYS n 
1 189 LEU n 
1 190 PHE n 
1 191 ASN n 
1 192 GLN n 
1 193 ASP n 
1 194 VAL n 
1 195 ASP n 
1 196 ALA n 
1 197 ALA n 
1 198 VAL n 
1 199 ARG n 
1 200 GLY n 
1 201 ILE n 
1 202 LEU n 
1 203 ARG n 
1 204 ASN n 
1 205 ALA n 
1 206 LYS n 
1 207 LEU n 
1 208 LYS n 
1 209 PRO n 
1 210 VAL n 
1 211 TYR n 
1 212 ASP n 
1 213 SER n 
1 214 LEU n 
1 215 ASP n 
1 216 ALA n 
1 217 VAL n 
1 218 ARG n 
1 219 ARG n 
1 220 ALA n 
1 221 ALA n 
1 222 LEU n 
1 223 ILE n 
1 224 ASN n 
1 225 MET n 
1 226 VAL n 
1 227 PHE n 
1 228 GLN n 
1 229 MET n 
1 230 GLY n 
1 231 GLU n 
1 232 THR n 
1 233 GLY n 
1 234 VAL n 
1 235 ALA n 
1 236 GLY n 
1 237 PHE n 
1 238 THR n 
1 239 ASN n 
1 240 SER n 
1 241 LEU n 
1 242 ARG n 
1 243 MET n 
1 244 LEU n 
1 245 GLN n 
1 246 GLN n 
1 247 LYS n 
1 248 ARG n 
1 249 TRP n 
1 250 ASP n 
1 251 GLU n 
1 252 ALA n 
1 253 ALA n 
1 254 VAL n 
1 255 ASN n 
1 256 LEU n 
1 257 ALA n 
1 258 LYS n 
1 259 SER n 
1 260 ARG n 
1 261 TRP n 
1 262 TYR n 
1 263 ASN n 
1 264 GLN n 
1 265 THR n 
1 266 PRO n 
1 267 ASN n 
1 268 ARG n 
1 269 ALA n 
1 270 LYS n 
1 271 ARG n 
1 272 VAL n 
1 273 ILE n 
1 274 THR n 
1 275 THR n 
1 276 PHE n 
1 277 ARG n 
1 278 THR n 
1 279 GLY n 
1 280 THR n 
1 281 TRP n 
1 282 ASP n 
1 283 ALA n 
1 284 TYR n 
1 285 SER n 
1 286 GLU n 
1 287 GLN n 
1 288 TRP n 
1 289 ILE n 
1 290 PHE n 
1 291 ARG n 
1 292 LEU n 
1 293 TYR n 
1 294 VAL n 
1 295 ALA n 
1 296 ILE n 
1 297 GLY n 
1 298 TRP n 
1 299 GLY n 
1 300 VAL n 
1 301 PRO n 
1 302 LEU n 
1 303 LEU n 
1 304 PHE n 
1 305 VAL n 
1 306 VAL n 
1 307 PRO n 
1 308 TRP n 
1 309 GLY n 
1 310 ILE n 
1 311 VAL n 
1 312 LYS n 
1 313 TYR n 
1 314 LEU n 
1 315 TYR n 
1 316 GLU n 
1 317 ASP n 
1 318 GLU n 
1 319 GLY n 
1 320 CYS n 
1 321 TRP n 
1 322 THR n 
1 323 ARG n 
1 324 ASN n 
1 325 SER n 
1 326 ASN n 
1 327 MET n 
1 328 ASN n 
1 329 TYR n 
1 330 TRP n 
1 331 LEU n 
1 332 ILE n 
1 333 ILE n 
1 334 ARG n 
1 335 LEU n 
1 336 PRO n 
1 337 ILE n 
1 338 LEU n 
1 339 PHE n 
1 340 ALA n 
1 341 CYS n 
1 342 ILE n 
1 343 VAL n 
1 344 ASN n 
1 345 PHE n 
1 346 LEU n 
1 347 ILE n 
1 348 PHE n 
1 349 VAL n 
1 350 ARG n 
1 351 VAL n 
1 352 ILE n 
1 353 CYS n 
1 354 ILE n 
1 355 VAL n 
1 356 VAL n 
1 357 SER n 
1 358 LYS n 
1 359 LEU n 
1 360 LYS n 
1 361 ALA n 
1 362 ASN n 
1 363 LEU n 
1 364 MET n 
1 365 CYS n 
1 366 LYS n 
1 367 THR n 
1 368 ASP n 
1 369 ILE n 
1 370 ALA n 
1 371 PHE n 
1 372 ARG n 
1 373 LEU n 
1 374 ALA n 
1 375 LYS n 
1 376 SER n 
1 377 THR n 
1 378 LEU n 
1 379 THR n 
1 380 LEU n 
1 381 ILE n 
1 382 PRO n 
1 383 LEU n 
1 384 LEU n 
1 385 CYS n 
1 386 THR n 
1 387 HIS n 
1 388 GLU n 
1 389 VAL n 
1 390 ILE n 
1 391 PHE n 
1 392 ALA n 
1 393 PHE n 
1 394 VAL n 
1 395 MET n 
1 396 ASP n 
1 397 GLU n 
1 398 HIS n 
1 399 ALA n 
1 400 ARG n 
1 401 GLY n 
1 402 THR n 
1 403 LEU n 
1 404 ARG n 
1 405 PHE n 
1 406 ILE n 
1 407 LYS n 
1 408 LEU n 
1 409 PHE n 
1 410 THR n 
1 411 GLU n 
1 412 LEU n 
1 413 SER n 
1 414 PHE n 
1 415 THR n 
1 416 SER n 
1 417 PHE n 
1 418 GLN n 
1 419 GLY n 
1 420 LEU n 
1 421 MET n 
1 422 VAL n 
1 423 ALA n 
1 424 ILE n 
1 425 LEU n 
1 426 TYR n 
1 427 CYS n 
1 428 PHE n 
1 429 VAL n 
1 430 ASN n 
1 431 ASN n 
1 432 GLU n 
1 433 VAL n 
1 434 GLN n 
1 435 LEU n 
1 436 GLU n 
1 437 PHE n 
1 438 ARG n 
1 439 LYS n 
1 440 SER n 
1 441 TRP n 
1 442 GLU n 
1 443 ARG n 
1 444 TRP n 
1 445 ARG n 
1 446 LEU n 
1 447 GLU n 
1 448 HIS n 
1 449 LEU n 
1 450 HIS n 
1 451 ILE n 
1 452 GLN n 
1 453 ARG n 
1 454 ASP n 
1 455 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   124 Human ? GLP1R ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? ? 
'Spodoptera aff. frugiperda 1 BOLD-2017' 2449148 ? ? ? ? ? ? ? ? IPLB-Sf-21-AE ? ? SF9 ? ? ? ? ? ? pfasctbac ? ? 
1 2 sample 'Biological sequence' 125 284 ?     ? ?     ? ? ? ? ? ? 'Enterobacteria phage T4' 10665 ? ? ? ? ? ? ? ? 
'Spodoptera aff. frugiperda 1 BOLD-2017' 2449148 ? ? ? ? ? ? ? ? IPLB-Sf-21-AE ? ? SF9 ? ? ? ? ? ? pfasctbac ? ? 
1 3 sample 'Biological sequence' 285 455 Human ? GLP1R ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? ? 
'Spodoptera aff. frugiperda 1 BOLD-2017' 2449148 ? ? ? ? ? ? ? ? IPLB-Sf-21-AE ? ? SF9 ? ? ? ? ? ? pfasctbac ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GLP1R_HUMAN P43220 ? 1 
;ESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYST
AAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAF
;
128 
2 UNP ENLYS_BPT4  P00720 ? 1 
;NIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRN
AKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAY

;
2   
3 UNP GLP1R_HUMAN P43220 ? 1 
;SEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLM
CKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
RLEHLHIQRDS
;
261 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6KJV A 2   ? 124 ? P43220 128 ? 257 ? 128  257  
2 2 6KJV A 125 ? 284 ? P00720 2   ? 161 ? 1001 1160 
3 3 6KJV A 285 ? 455 ? P43220 261 ? 431 ? 261  431  
4 1 6KJV B 2   ? 124 ? P43220 128 ? 257 ? 128  257  
5 2 6KJV B 125 ? 284 ? P00720 2   ? 161 ? 1001 1160 
6 3 6KJV B 285 ? 455 ? P43220 261 ? 431 ? 261  431  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6KJV SER A 1   ? UNP P43220 ?   ?   'expression tag'      127  1  
1 6KJV CYS A 67  ? UNP P43220 SER 193 'engineered mutation' 193  2  
1 6KJV PHE A 70  ? UNP P43220 ILE 196 'engineered mutation' 196  3  
1 6KJV ?   A ?   ? UNP P43220 TYR 205 deletion              ?    4  
1 6KJV ?   A ?   ? UNP P43220 SER 206 deletion              ?    5  
1 6KJV ?   A ?   ? UNP P43220 THR 207 deletion              ?    6  
1 6KJV ?   A ?   ? UNP P43220 ALA 208 deletion              ?    7  
1 6KJV ?   A ?   ? UNP P43220 ALA 209 deletion              ?    8  
1 6KJV ?   A ?   ? UNP P43220 GLN 210 deletion              ?    9  
1 6KJV ?   A ?   ? UNP P43220 GLN 211 deletion              ?    10 
1 6KJV ?   A ?   ? UNP P43220 HIS 212 deletion              ?    11 
1 6KJV ?   A ?   ? UNP P43220 GLN 213 deletion              ?    12 
1 6KJV ?   A ?   ? UNP P43220 TRP 214 deletion              ?    13 
1 6KJV GLY A 79  ? UNP P43220 ?   ?   linker                212  14 
1 6KJV SER A 80  ? UNP P43220 ?   ?   linker                213  15 
1 6KJV GLY A 81  ? UNP P43220 ?   ?   linker                214  16 
1 6KJV ALA A 92  ? UNP P43220 SER 225 'engineered mutation' 225  17 
2 6KJV GLY A 135 ? UNP P00720 ARG 12  'engineered mutation' 1011 18 
2 6KJV THR A 177 ? UNP P00720 CYS 54  'engineered mutation' 1053 19 
2 6KJV ALA A 220 ? UNP P00720 CYS 97  'engineered mutation' 1096 20 
2 6KJV ARG A 260 ? UNP P00720 ILE 137 'engineered mutation' 1136 21 
3 6KJV ALA A 295 ? UNP P43220 SER 271 'engineered mutation' 271  22 
3 6KJV CYS A 341 ? UNP P43220 ILE 317 'engineered mutation' 317  23 
3 6KJV ILE A 342 ? UNP P43220 GLY 318 'engineered mutation' 318  24 
3 6KJV ALA A 370 ? UNP P43220 LYS 346 'engineered mutation' 346  25 
3 6KJV PHE A 371 ? UNP P43220 CYS 347 'engineered mutation' 347  26 
3 6KJV CYS A 385 ? UNP P43220 GLY 361 'engineered mutation' 361  27 
4 6KJV SER B 1   ? UNP P43220 ?   ?   'expression tag'      127  28 
4 6KJV CYS B 67  ? UNP P43220 SER 193 'engineered mutation' 193  29 
4 6KJV PHE B 70  ? UNP P43220 ILE 196 'engineered mutation' 196  30 
4 6KJV ?   B ?   ? UNP P43220 TYR 205 deletion              ?    31 
4 6KJV ?   B ?   ? UNP P43220 SER 206 deletion              ?    32 
4 6KJV ?   B ?   ? UNP P43220 THR 207 deletion              ?    33 
4 6KJV ?   B ?   ? UNP P43220 ALA 208 deletion              ?    34 
4 6KJV ?   B ?   ? UNP P43220 ALA 209 deletion              ?    35 
4 6KJV ?   B ?   ? UNP P43220 GLN 210 deletion              ?    36 
4 6KJV ?   B ?   ? UNP P43220 GLN 211 deletion              ?    37 
4 6KJV ?   B ?   ? UNP P43220 HIS 212 deletion              ?    38 
4 6KJV ?   B ?   ? UNP P43220 GLN 213 deletion              ?    39 
4 6KJV ?   B ?   ? UNP P43220 TRP 214 deletion              ?    40 
4 6KJV GLY B 79  ? UNP P43220 ?   ?   linker                212  41 
4 6KJV SER B 80  ? UNP P43220 ?   ?   linker                213  42 
4 6KJV GLY B 81  ? UNP P43220 ?   ?   linker                214  43 
4 6KJV ALA B 92  ? UNP P43220 SER 225 'engineered mutation' 225  44 
5 6KJV GLY B 135 ? UNP P00720 ARG 12  'engineered mutation' 1011 45 
5 6KJV THR B 177 ? UNP P00720 CYS 54  'engineered mutation' 1053 46 
5 6KJV ALA B 220 ? UNP P00720 CYS 97  'engineered mutation' 1096 47 
5 6KJV ARG B 260 ? UNP P00720 ILE 137 'engineered mutation' 1136 48 
6 6KJV ALA B 295 ? UNP P43220 SER 271 'engineered mutation' 271  49 
6 6KJV CYS B 341 ? UNP P43220 ILE 317 'engineered mutation' 317  50 
6 6KJV ILE B 342 ? UNP P43220 GLY 318 'engineered mutation' 318  51 
6 6KJV ALA B 370 ? UNP P43220 LYS 346 'engineered mutation' 346  52 
6 6KJV PHE B 371 ? UNP P43220 CYS 347 'engineered mutation' 347  53 
6 6KJV CYS B 385 ? UNP P43220 GLY 361 'engineered mutation' 361  54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
97Y non-polymer         . 
;N-{4-[(R)-(3,3-dimethylcyclobutyl)({6-[4-(trifluoromethyl)-1H-imidazol-1-yl]pyridin-3-yl}amino)methyl]benzene-1-carbonyl}-beta-alanine
;
?                   'C26 H28 F3 N5 O3' 515.527 
ALA 'L-peptide linking' y ALANINE ?                   'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ?                   'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                   'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                   'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ?                   'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                   'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                   'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ?                   'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ?                   'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ?                   'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                   'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ?                   'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ?                   'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ?                   'C5 H11 N O2 S'    149.211 
OLC non-polymer         . '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 1-Oleoyl-R-glycerol 'C21 H40 O4'       356.540 
PHE 'L-peptide linking' y PHENYLALANINE ?                   'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ?                   'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ?                   'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ?                   'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                   'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ?                   'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ?                   'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KJV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.4-0.45 M ammonium acetate, 0.1 M sodium cacodylate, pH 6.2-6.6, 35-38% PEG400, 3% w/v aminohexanoic acid' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     80 
_diffrn.ambient_temp_details             'liquid nitrogen' 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX225HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6KJV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 45.2 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       30099 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             88.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.5 
_reflns.pdbx_Rmerge_I_obs                0.12 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.98 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3968 
_reflns_shell.percent_possible_all        79.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.57 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.62 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.entry_id                                 6KJV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.8000 
_refine.ls_d_res_low                             29.8000 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8000 
_refine.ls_number_reflns_obs                     30036 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            'Ramdon selection' 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2490 
_refine.ls_R_factor_R_work                       0.2470 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2800 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.4000 
_refine.ls_number_reflns_R_free                  1324 
_refine.ls_number_reflns_R_work                  28712 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               84.0806 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4400 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      5VEW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                216.230 
_refine.B_iso_min                                25.010 
_refine.pdbx_overall_phase_error                 37.2700 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6607 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         124 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               6739 
_refine_hist.d_res_high                       2.8000 
_refine_hist.d_res_low                        29.8000 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           6893 0.004  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          9379 0.734  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     1085 0.039  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      1141 0.005  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 3979 10.527 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.8000 2.9121  9 79.0000 2842 . 0.4101 0.4653 . 114 0.0000 2956 . 'X-RAY DIFFRACTION' 
2.9121 3.0445  9 83.0000 3026 . 0.3652 0.3814 . 106 0.0000 3132 . 'X-RAY DIFFRACTION' 
3.0445 3.2048  9 86.0000 3153 . 0.3199 0.3698 . 105 0.0000 3258 . 'X-RAY DIFFRACTION' 
3.2048 3.4053  9 89.0000 3195 . 0.2669 0.3207 . 167 0.0000 3362 . 'X-RAY DIFFRACTION' 
3.4053 3.6678  9 90.0000 3203 . 0.2445 0.2541 . 165 0.0000 3368 . 'X-RAY DIFFRACTION' 
3.6678 4.0361  9 93.0000 3314 . 0.2426 0.2731 . 177 0.0000 3491 . 'X-RAY DIFFRACTION' 
4.0361 4.6183  9 93.0000 3361 . 0.2327 0.2874 . 147 0.0000 3508 . 'X-RAY DIFFRACTION' 
4.6183 5.8115  9 94.0000 3355 . 0.2292 0.2434 . 155 0.0000 3510 . 'X-RAY DIFFRACTION' 
5.8115 29.7805 9 92.0000 3263 . 0.2109 0.2587 . 188 0.0000 3451 . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                     6KJV 
_struct.title                        'Structure of thermal-stabilised(M9) human GLP-1 receptor transmembrane domain' 
_struct.pdbx_descriptor              PROTEIN 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KJV 
_struct_keywords.text            'GPCR, seven-transmembrane, allosteric modulators, diabetes, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 10  ? PHE A 43  ? SER A 136  PHE A 169  1 ? 34 
HELX_P HELX_P2  AA2 ARG A 44  ? HIS A 47  ? ARG A 170  HIS A 173  5 ? 4  
HELX_P HELX_P3  AA3 CYS A 48  ? ALA A 74  ? CYS A 174  ALA A 200  1 ? 27 
HELX_P HELX_P4  AA4 SER A 90  ? PHE A 124 ? SER A 223  PHE A 257  1 ? 35 
HELX_P HELX_P5  AA5 ASN A 125 ? GLY A 135 ? ASN A 1001 GLY A 1011 1 ? 11 
HELX_P HELX_P6  AA6 SER A 161 ? ALA A 172 ? SER A 1037 ALA A 1048 1 ? 12 
HELX_P HELX_P7  AA7 THR A 182 ? ARG A 203 ? THR A 1058 ARG A 1079 1 ? 22 
HELX_P HELX_P8  AA8 LEU A 207 ? LEU A 214 ? LEU A 1083 LEU A 1090 1 ? 8  
HELX_P HELX_P9  AA9 ASP A 215 ? MET A 229 ? ASP A 1091 MET A 1105 1 ? 15 
HELX_P HELX_P10 AB1 GLY A 230 ? ALA A 235 ? GLY A 1106 ALA A 1111 1 ? 6  
HELX_P HELX_P11 AB2 PHE A 237 ? GLN A 246 ? PHE A 1113 GLN A 1122 1 ? 10 
HELX_P HELX_P12 AB3 ARG A 248 ? LYS A 258 ? ARG A 1124 LYS A 1134 1 ? 11 
HELX_P HELX_P13 AB4 SER A 259 ? THR A 265 ? SER A 1135 THR A 1141 1 ? 7  
HELX_P HELX_P14 AB5 THR A 265 ? GLY A 279 ? THR A 1141 GLY A 1155 1 ? 15 
HELX_P HELX_P15 AB6 TRP A 281 ? SER A 285 ? TRP A 1157 SER A 261  5 ? 5  
HELX_P HELX_P16 AB7 GLU A 286 ? TRP A 298 ? GLU A 262  TRP A 274  1 ? 13 
HELX_P HELX_P17 AB8 TRP A 298 ? TYR A 315 ? TRP A 274  TYR A 291  1 ? 18 
HELX_P HELX_P18 AB9 MET A 327 ? TYR A 329 ? MET A 303  TYR A 305  5 ? 3  
HELX_P HELX_P19 AC1 TRP A 330 ? ALA A 361 ? TRP A 306  ALA A 337  1 ? 32 
HELX_P HELX_P20 AC2 ASP A 368 ? PHE A 391 ? ASP A 344  PHE A 367  1 ? 24 
HELX_P HELX_P21 AC3 PHE A 405 ? PHE A 409 ? PHE A 381  PHE A 385  1 ? 5  
HELX_P HELX_P22 AC4 THR A 410 ? CYS A 427 ? THR A 386  CYS A 403  1 ? 18 
HELX_P HELX_P23 AC5 ASN A 430 ? LEU A 446 ? ASN A 406  LEU A 422  1 ? 17 
HELX_P HELX_P24 AC6 PRO B 11  ? PHE B 43  ? PRO B 137  PHE B 169  1 ? 33 
HELX_P HELX_P25 AC7 ARG B 44  ? HIS B 47  ? ARG B 170  HIS B 173  5 ? 4  
HELX_P HELX_P26 AC8 CYS B 48  ? LEU B 75  ? CYS B 174  LEU B 201  1 ? 28 
HELX_P HELX_P27 AC9 SER B 90  ? PHE B 124 ? SER B 223  PHE B 257  1 ? 35 
HELX_P HELX_P28 AD1 ASN B 125 ? GLY B 135 ? ASN B 1001 GLY B 1011 1 ? 11 
HELX_P HELX_P29 AD2 SER B 161 ? ALA B 172 ? SER B 1037 ALA B 1048 1 ? 12 
HELX_P HELX_P30 AD3 THR B 182 ? ARG B 203 ? THR B 1058 ARG B 1079 1 ? 22 
HELX_P HELX_P31 AD4 LEU B 207 ? LEU B 214 ? LEU B 1083 LEU B 1090 1 ? 8  
HELX_P HELX_P32 AD5 ASP B 215 ? MET B 229 ? ASP B 1091 MET B 1105 1 ? 15 
HELX_P HELX_P33 AD6 GLY B 230 ? ALA B 235 ? GLY B 1106 ALA B 1111 1 ? 6  
HELX_P HELX_P34 AD7 PHE B 237 ? GLN B 246 ? PHE B 1113 GLN B 1122 1 ? 10 
HELX_P HELX_P35 AD8 ARG B 248 ? LYS B 258 ? ARG B 1124 LYS B 1134 1 ? 11 
HELX_P HELX_P36 AD9 SER B 259 ? THR B 265 ? SER B 1135 THR B 1141 1 ? 7  
HELX_P HELX_P37 AE1 THR B 265 ? GLY B 279 ? THR B 1141 GLY B 1155 1 ? 15 
HELX_P HELX_P38 AE2 TRP B 281 ? SER B 285 ? TRP B 1157 SER B 261  5 ? 5  
HELX_P HELX_P39 AE3 GLU B 286 ? TRP B 298 ? GLU B 262  TRP B 274  1 ? 13 
HELX_P HELX_P40 AE4 TRP B 298 ? TYR B 315 ? TRP B 274  TYR B 291  1 ? 18 
HELX_P HELX_P41 AE5 MET B 327 ? TYR B 329 ? MET B 303  TYR B 305  5 ? 3  
HELX_P HELX_P42 AE6 TRP B 330 ? ALA B 361 ? TRP B 306  ALA B 337  1 ? 32 
HELX_P HELX_P43 AE7 ASP B 368 ? PHE B 391 ? ASP B 344  PHE B 367  1 ? 24 
HELX_P HELX_P44 AE8 PHE B 405 ? PHE B 409 ? PHE B 381  PHE B 385  1 ? 5  
HELX_P HELX_P45 AE9 THR B 410 ? CYS B 427 ? THR B 386  CYS B 403  1 ? 18 
HELX_P HELX_P46 AF1 ASN B 430 ? LEU B 446 ? ASN B 406  LEU B 422  1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 93  SG ? ? ? 1_555 A CYS 320 SG ? ? A CYS 226 A CYS 296 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf2 disulf ? ? A CYS 341 SG ? ? ? 1_555 A CYS 385 SG ? ? A CYS 317 A CYS 361 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf3 disulf ? ? B CYS 93  SG ? ? ? 1_555 B CYS 320 SG ? ? B CYS 226 B CYS 296 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf4 disulf ? ? B CYS 341 SG ? ? ? 1_555 B CYS 385 SG ? ? B CYS 317 B CYS 361 1_555 ? ? ? ? ? ? ? 2.024 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 137 ? LYS A 142 ? ARG A 1013 LYS A 1018 
AA1 2 TYR A 148 ? GLY A 151 ? TYR A 1024 GLY A 1027 
AA1 3 HIS A 154 ? LEU A 155 ? HIS A 1030 LEU A 1031 
AA2 1 ARG B 137 ? LYS B 142 ? ARG B 1013 LYS B 1018 
AA2 2 TYR B 148 ? GLY B 151 ? TYR B 1024 GLY B 1027 
AA2 3 HIS B 154 ? LEU B 155 ? HIS B 1030 LEU B 1031 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 141 ? N TYR A 1017 O THR A 149 ? O THR A 1025 
AA1 2 3 N ILE A 150 ? N ILE A 1026 O HIS A 154 ? O HIS A 1030 
AA2 1 2 N TYR B 141 ? N TYR B 1017 O THR B 149 ? O THR B 1025 
AA2 2 3 N ILE B 150 ? N ILE B 1026 O HIS B 154 ? O HIS B 1030 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 97Y 2001 ? 11 'binding site for residue 97Y A 2001' 
AC2 Software A OLC 2002 ? 6  'binding site for residue OLC A 2002' 
AC3 Software B 97Y 2001 ? 10 'binding site for residue 97Y B 2001' 
AC4 Software B OLC 2002 ? 6  'binding site for residue OLC B 2002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 VAL A 355 ? VAL A 331 . ? 1_555 ? 
2  AC1 11 PHE A 371 ? PHE A 347 . ? 1_555 ? 
3  AC1 11 ARG A 372 ? ARG A 348 . ? 1_555 ? 
4  AC1 11 LYS A 375 ? LYS A 351 . ? 1_555 ? 
5  AC1 11 SER A 376 ? SER A 352 . ? 1_555 ? 
6  AC1 11 LEU A 378 ? LEU A 354 . ? 1_555 ? 
7  AC1 11 THR A 379 ? THR A 355 . ? 1_555 ? 
8  AC1 11 LEU A 425 ? LEU A 401 . ? 1_555 ? 
9  AC1 11 VAL A 429 ? VAL A 405 . ? 1_555 ? 
10 AC1 11 ASN A 430 ? ASN A 406 . ? 1_555 ? 
11 AC1 11 ILE B 310 ? ILE B 286 . ? 1_555 ? 
12 AC2 6  PHE A 348 ? PHE A 324 . ? 1_555 ? 
13 AC2 6  PRO A 382 ? PRO A 358 . ? 1_555 ? 
14 AC2 6  THR A 386 ? THR A 362 . ? 1_555 ? 
15 AC2 6  GLU A 411 ? GLU A 387 . ? 1_555 ? 
16 AC2 6  LEU B 302 ? LEU B 278 . ? 1_555 ? 
17 AC2 6  VAL B 306 ? VAL B 282 . ? 1_555 ? 
18 AC3 10 ILE A 310 ? ILE A 286 . ? 1_655 ? 
19 AC3 10 VAL B 355 ? VAL B 331 . ? 1_555 ? 
20 AC3 10 VAL B 356 ? VAL B 332 . ? 1_555 ? 
21 AC3 10 ARG B 372 ? ARG B 348 . ? 1_555 ? 
22 AC3 10 LYS B 375 ? LYS B 351 . ? 1_555 ? 
23 AC3 10 SER B 376 ? SER B 352 . ? 1_555 ? 
24 AC3 10 THR B 379 ? THR B 355 . ? 1_555 ? 
25 AC3 10 LEU B 425 ? LEU B 401 . ? 1_555 ? 
26 AC3 10 VAL B 429 ? VAL B 405 . ? 1_555 ? 
27 AC3 10 ASN B 430 ? ASN B 406 . ? 1_555 ? 
28 AC4 6  LEU A 302 ? LEU A 278 . ? 1_655 ? 
29 AC4 6  VAL A 306 ? VAL A 282 . ? 1_655 ? 
30 AC4 6  PHE B 348 ? PHE B 324 . ? 1_555 ? 
31 AC4 6  PRO B 382 ? PRO B 358 . ? 1_555 ? 
32 AC4 6  THR B 386 ? THR B 362 . ? 1_555 ? 
33 AC4 6  HIS B 387 ? HIS B 363 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          6KJV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    6KJV 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.015378 
_atom_sites.fract_transf_matrix[1][2]   0.004552 
_atom_sites.fract_transf_matrix[1][3]   0.000226 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015269 
_atom_sites.fract_transf_matrix[2][3]   0.000452 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011992 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 10  ? 30.698  43.285  63.500  1.00 106.78 ?  136  SER A N   1 
ATOM   2    C CA  . SER A 1 10  ? 29.564  43.540  64.385  1.00 115.57 ?  136  SER A CA  1 
ATOM   3    C C   . SER A 1 10  ? 28.428  42.566  64.092  1.00 141.20 ?  136  SER A C   1 
ATOM   4    O O   . SER A 1 10  ? 28.136  42.274  62.932  1.00 141.72 ?  136  SER A O   1 
ATOM   5    C CB  . SER A 1 10  ? 29.087  44.984  64.239  1.00 104.90 ?  136  SER A CB  1 
ATOM   6    N N   . PRO A 1 11  ? 27.795  42.053  65.145  1.00 162.65 ?  137  PRO A N   1 
ATOM   7    C CA  . PRO A 1 11  ? 26.716  41.072  64.948  1.00 147.24 ?  137  PRO A CA  1 
ATOM   8    C C   . PRO A 1 11  ? 25.423  41.694  64.426  1.00 128.79 ?  137  PRO A C   1 
ATOM   9    O O   . PRO A 1 11  ? 24.847  41.278  63.395  1.00 96.66  ?  137  PRO A O   1 
ATOM   10   C CB  . PRO A 1 11  ? 26.535  40.484  66.355  1.00 156.65 ?  137  PRO A CB  1 
ATOM   11   C CG  . PRO A 1 11  ? 27.016  41.553  67.291  1.00 159.11 ?  137  PRO A CG  1 
ATOM   12   C CD  . PRO A 1 11  ? 28.076  42.324  66.568  1.00 167.22 ?  137  PRO A CD  1 
ATOM   13   N N   . GLU A 1 12  ? 24.997  42.753  65.123  1.00 125.67 ?  138  GLU A N   1 
ATOM   14   C CA  . GLU A 1 12  ? 23.759  43.426  64.761  1.00 122.16 ?  138  GLU A CA  1 
ATOM   15   C C   . GLU A 1 12  ? 23.873  44.073  63.393  1.00 116.91 ?  138  GLU A C   1 
ATOM   16   O O   . GLU A 1 12  ? 22.903  44.076  62.621  1.00 116.47 ?  138  GLU A O   1 
ATOM   17   C CB  . GLU A 1 12  ? 23.401  44.472  65.814  1.00 135.17 ?  138  GLU A CB  1 
ATOM   18   N N   . GLU A 1 13  ? 25.060  44.586  63.062  1.00 107.70 ?  139  GLU A N   1 
ATOM   19   C CA  . GLU A 1 13  ? 25.260  45.193  61.753  1.00 114.70 ?  139  GLU A CA  1 
ATOM   20   C C   . GLU A 1 13  ? 25.108  44.168  60.641  1.00 117.89 ?  139  GLU A C   1 
ATOM   21   O O   . GLU A 1 13  ? 24.540  44.475  59.584  1.00 119.35 ?  139  GLU A O   1 
ATOM   22   C CB  . GLU A 1 13  ? 26.641  45.846  61.680  1.00 120.82 ?  139  GLU A CB  1 
ATOM   23   N N   . GLN A 1 14  ? 25.582  42.941  60.866  1.00 134.78 ?  140  GLN A N   1 
ATOM   24   C CA  . GLN A 1 14  ? 25.407  41.894  59.867  1.00 125.74 ?  140  GLN A CA  1 
ATOM   25   C C   . GLN A 1 14  ? 23.931  41.603  59.645  1.00 124.91 ?  140  GLN A C   1 
ATOM   26   O O   . GLN A 1 14  ? 23.459  41.550  58.494  1.00 145.08 ?  140  GLN A O   1 
ATOM   27   C CB  . GLN A 1 14  ? 26.146  40.624  60.293  1.00 113.06 ?  140  GLN A CB  1 
ATOM   28   N N   . LEU A 1 15  ? 23.177  41.417  60.735  1.00 106.77 ?  141  LEU A N   1 
ATOM   29   C CA  . LEU A 1 15  ? 21.760  41.150  60.507  1.00 95.21  ?  141  LEU A CA  1 
ATOM   30   C C   . LEU A 1 15  ? 21.077  42.301  59.777  1.00 99.19  ?  141  LEU A C   1 
ATOM   31   O O   . LEU A 1 15  ? 20.293  42.051  58.847  1.00 114.90 ?  141  LEU A O   1 
ATOM   32   C CB  . LEU A 1 15  ? 21.040  40.861  61.826  1.00 85.44  ?  141  LEU A CB  1 
ATOM   33   N N   . LEU A 1 16  ? 21.429  43.550  60.102  1.00 102.82 ?  142  LEU A N   1 
ATOM   34   C CA  . LEU A 1 16  ? 20.763  44.679  59.461  1.00 98.75  ?  142  LEU A CA  1 
ATOM   35   C C   . LEU A 1 16  ? 21.079  44.755  57.974  1.00 100.46 ?  142  LEU A C   1 
ATOM   36   O O   . LEU A 1 16  ? 20.179  44.977  57.147  1.00 94.23  ?  142  LEU A O   1 
ATOM   37   C CB  . LEU A 1 16  ? 21.193  45.985  60.123  1.00 109.02 ?  142  LEU A CB  1 
ATOM   38   N N   . PHE A 1 17  ? 22.343  44.543  57.616  1.00 95.61  ?  143  PHE A N   1 
ATOM   39   C CA  . PHE A 1 17  ? 22.731  44.674  56.220  1.00 93.28  ?  143  PHE A CA  1 
ATOM   40   C C   . PHE A 1 17  ? 22.091  43.585  55.369  1.00 99.71  ?  143  PHE A C   1 
ATOM   41   O O   . PHE A 1 17  ? 21.636  43.845  54.240  1.00 94.02  ?  143  PHE A O   1 
ATOM   42   C CB  . PHE A 1 17  ? 24.251  44.633  56.102  1.00 100.25 ?  143  PHE A CB  1 
ATOM   43   C CG  . PHE A 1 17  ? 24.761  45.071  54.764  1.00 105.82 ?  143  PHE A CG  1 
ATOM   44   C CD1 . PHE A 1 17  ? 24.799  46.415  54.429  1.00 109.10 ?  143  PHE A CD1 1 
ATOM   45   C CD2 . PHE A 1 17  ? 25.215  44.144  53.842  1.00 100.21 ?  143  PHE A CD2 1 
ATOM   46   C CE1 . PHE A 1 17  ? 25.274  46.825  53.195  1.00 101.96 ?  143  PHE A CE1 1 
ATOM   47   C CE2 . PHE A 1 17  ? 25.692  44.547  52.605  1.00 115.26 ?  143  PHE A CE2 1 
ATOM   48   C CZ  . PHE A 1 17  ? 25.722  45.890  52.283  1.00 105.99 ?  143  PHE A CZ  1 
ATOM   49   N N   . LEU A 1 18  ? 22.046  42.355  55.889  1.00 100.68 ?  144  LEU A N   1 
ATOM   50   C CA  . LEU A 1 18  ? 21.362  41.314  55.130  1.00 95.70  ?  144  LEU A CA  1 
ATOM   51   C C   . LEU A 1 18  ? 19.878  41.625  54.991  1.00 100.19 ?  144  LEU A C   1 
ATOM   52   O O   . LEU A 1 18  ? 19.285  41.364  53.934  1.00 109.53 ?  144  LEU A O   1 
ATOM   53   C CB  . LEU A 1 18  ? 21.579  39.948  55.780  1.00 99.04  ?  144  LEU A CB  1 
ATOM   54   C CG  . LEU A 1 18  ? 23.001  39.411  55.584  1.00 113.46 ?  144  LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 18  ? 23.326  38.317  56.587  1.00 111.12 ?  144  LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 18  ? 23.216  38.907  54.159  1.00 118.23 ?  144  LEU A CD2 1 
ATOM   57   N N   . TYR A 1 19  ? 19.276  42.232  56.021  1.00 96.90  ?  145  TYR A N   1 
ATOM   58   C CA  . TYR A 1 19  ? 17.893  42.680  55.890  1.00 94.35  ?  145  TYR A CA  1 
ATOM   59   C C   . TYR A 1 19  ? 17.739  43.656  54.732  1.00 100.71 ?  145  TYR A C   1 
ATOM   60   O O   . TYR A 1 19  ? 16.772  43.561  53.958  1.00 94.21  ?  145  TYR A O   1 
ATOM   61   C CB  . TYR A 1 19  ? 17.429  43.328  57.202  1.00 98.17  ?  145  TYR A CB  1 
ATOM   62   C CG  . TYR A 1 19  ? 16.068  43.995  57.154  1.00 103.74 ?  145  TYR A CG  1 
ATOM   63   C CD1 . TYR A 1 19  ? 14.905  43.263  57.367  1.00 103.18 ?  145  TYR A CD1 1 
ATOM   64   C CD2 . TYR A 1 19  ? 15.947  45.361  56.914  1.00 110.29 ?  145  TYR A CD2 1 
ATOM   65   C CE1 . TYR A 1 19  ? 13.658  43.871  57.328  1.00 118.97 ?  145  TYR A CE1 1 
ATOM   66   C CE2 . TYR A 1 19  ? 14.704  45.973  56.876  1.00 112.60 ?  145  TYR A CE2 1 
ATOM   67   C CZ  . TYR A 1 19  ? 13.565  45.224  57.083  1.00 117.82 ?  145  TYR A CZ  1 
ATOM   68   O OH  . TYR A 1 19  ? 12.331  45.830  57.044  1.00 113.02 ?  145  TYR A OH  1 
ATOM   69   N N   . ILE A 1 20  ? 18.694  44.575  54.575  1.00 100.15 ?  146  ILE A N   1 
ATOM   70   C CA  . ILE A 1 20  ? 18.579  45.553  53.495  1.00 102.75 ?  146  ILE A CA  1 
ATOM   71   C C   . ILE A 1 20  ? 18.623  44.856  52.146  1.00 109.54 ?  146  ILE A C   1 
ATOM   72   O O   . ILE A 1 20  ? 17.818  45.150  51.250  1.00 101.14 ?  146  ILE A O   1 
ATOM   73   C CB  . ILE A 1 20  ? 19.672  46.632  53.580  1.00 105.00 ?  146  ILE A CB  1 
ATOM   74   C CG1 . ILE A 1 20  ? 19.474  47.498  54.814  1.00 105.19 ?  146  ILE A CG1 1 
ATOM   75   C CG2 . ILE A 1 20  ? 19.615  47.517  52.339  1.00 95.96  ?  146  ILE A CG2 1 
ATOM   76   C CD1 . ILE A 1 20  ? 18.062  48.003  54.969  1.00 103.17 ?  146  ILE A CD1 1 
ATOM   77   N N   . ILE A 1 21  ? 19.597  43.960  51.954  1.00 112.18 ?  147  ILE A N   1 
ATOM   78   C CA  . ILE A 1 21  ? 19.692  43.373  50.617  1.00 110.95 ?  147  ILE A CA  1 
ATOM   79   C C   . ILE A 1 21  ? 18.463  42.525  50.327  1.00 107.97 ?  147  ILE A C   1 
ATOM   80   O O   . ILE A 1 21  ? 17.977  42.499  49.192  1.00 131.39 ?  147  ILE A O   1 
ATOM   81   C CB  . ILE A 1 21  ? 21.007  42.589  50.403  1.00 109.43 ?  147  ILE A CB  1 
ATOM   82   C CG1 . ILE A 1 21  ? 21.220  41.498  51.456  1.00 142.09 ?  147  ILE A CG1 1 
ATOM   83   C CG2 . ILE A 1 21  ? 22.178  43.556  50.329  1.00 102.28 ?  147  ILE A CG2 1 
ATOM   84   C CD1 . ILE A 1 21  ? 20.710  40.142  51.024  1.00 144.41 ?  147  ILE A CD1 1 
ATOM   85   N N   . TYR A 1 22  ? 17.881  41.903  51.354  1.00 82.72  ?  148  TYR A N   1 
ATOM   86   C CA  . TYR A 1 22  ? 16.670  41.111  51.149  1.00 72.07  ?  148  TYR A CA  1 
ATOM   87   C C   . TYR A 1 22  ? 15.511  41.992  50.692  1.00 68.55  ?  148  TYR A C   1 
ATOM   88   O O   . TYR A 1 22  ? 14.836  41.699  49.691  1.00 69.60  ?  148  TYR A O   1 
ATOM   89   C CB  . TYR A 1 22  ? 16.323  40.386  52.454  1.00 74.89  ?  148  TYR A CB  1 
ATOM   90   C CG  . TYR A 1 22  ? 15.198  39.379  52.389  1.00 76.68  ?  148  TYR A CG  1 
ATOM   91   C CD1 . TYR A 1 22  ? 15.439  38.062  52.015  1.00 82.12  ?  148  TYR A CD1 1 
ATOM   92   C CD2 . TYR A 1 22  ? 13.900  39.734  52.736  1.00 81.22  ?  148  TYR A CD2 1 
ATOM   93   C CE1 . TYR A 1 22  ? 14.414  37.131  51.968  1.00 94.26  ?  148  TYR A CE1 1 
ATOM   94   C CE2 . TYR A 1 22  ? 12.871  38.810  52.691  1.00 82.35  ?  148  TYR A CE2 1 
ATOM   95   C CZ  . TYR A 1 22  ? 13.134  37.512  52.309  1.00 87.53  ?  148  TYR A CZ  1 
ATOM   96   O OH  . TYR A 1 22  ? 12.109  36.600  52.265  1.00 84.77  ?  148  TYR A OH  1 
ATOM   97   N N   . THR A 1 23  ? 15.276  43.092  51.404  1.00 71.95  ?  149  THR A N   1 
ATOM   98   C CA  . THR A 1 23  ? 14.112  43.910  51.081  1.00 87.71  ?  149  THR A CA  1 
ATOM   99   C C   . THR A 1 23  ? 14.283  44.627  49.746  1.00 85.29  ?  149  THR A C   1 
ATOM   100  O O   . THR A 1 23  ? 13.308  44.806  49.006  1.00 82.40  ?  149  THR A O   1 
ATOM   101  C CB  . THR A 1 23  ? 13.823  44.902  52.210  1.00 87.11  ?  149  THR A CB  1 
ATOM   102  O OG1 . THR A 1 23  ? 15.019  45.597  52.577  1.00 110.08 ?  149  THR A OG1 1 
ATOM   103  C CG2 . THR A 1 23  ? 13.257  44.172  53.433  1.00 76.68  ?  149  THR A CG2 1 
ATOM   104  N N   . VAL A 1 24  ? 15.511  45.024  49.397  1.00 82.68  ?  150  VAL A N   1 
ATOM   105  C CA  . VAL A 1 24  ? 15.671  45.663  48.093  1.00 84.32  ?  150  VAL A CA  1 
ATOM   106  C C   . VAL A 1 24  ? 15.628  44.625  46.983  1.00 92.06  ?  150  VAL A C   1 
ATOM   107  O O   . VAL A 1 24  ? 15.232  44.933  45.853  1.00 104.98 ?  150  VAL A O   1 
ATOM   108  C CB  . VAL A 1 24  ? 16.956  46.507  48.035  1.00 66.95  ?  150  VAL A CB  1 
ATOM   109  C CG1 . VAL A 1 24  ? 16.975  47.504  49.178  1.00 64.36  ?  150  VAL A CG1 1 
ATOM   110  C CG2 . VAL A 1 24  ? 18.192  45.623  48.062  1.00 70.18  ?  150  VAL A CG2 1 
ATOM   111  N N   . GLY A 1 25  ? 16.002  43.379  47.277  1.00 90.59  ?  151  GLY A N   1 
ATOM   112  C CA  . GLY A 1 25  ? 15.806  42.327  46.299  1.00 90.24  ?  151  GLY A CA  1 
ATOM   113  C C   . GLY A 1 25  ? 14.342  42.148  45.961  1.00 79.84  ?  151  GLY A C   1 
ATOM   114  O O   . GLY A 1 25  ? 13.959  42.124  44.787  1.00 72.21  ?  151  GLY A O   1 
ATOM   115  N N   . TYR A 1 26  ? 13.494  42.073  46.987  1.00 78.60  ?  152  TYR A N   1 
ATOM   116  C CA  . TYR A 1 26  ? 12.071  41.943  46.690  1.00 74.34  ?  152  TYR A CA  1 
ATOM   117  C C   . TYR A 1 26  ? 11.470  43.225  46.121  1.00 77.47  ?  152  TYR A C   1 
ATOM   118  O O   . TYR A 1 26  ? 10.524  43.144  45.335  1.00 76.82  ?  152  TYR A O   1 
ATOM   119  C CB  . TYR A 1 26  ? 11.289  41.489  47.926  1.00 68.04  ?  152  TYR A CB  1 
ATOM   120  C CG  . TYR A 1 26  ? 11.339  39.987  48.138  1.00 71.30  ?  152  TYR A CG  1 
ATOM   121  C CD1 . TYR A 1 26  ? 10.465  39.132  47.467  1.00 73.27  ?  152  TYR A CD1 1 
ATOM   122  C CD2 . TYR A 1 26  ? 12.266  39.422  49.002  1.00 71.68  ?  152  TYR A CD2 1 
ATOM   123  C CE1 . TYR A 1 26  ? 10.514  37.757  47.662  1.00 67.39  ?  152  TYR A CE1 1 
ATOM   124  C CE2 . TYR A 1 26  ? 12.321  38.054  49.201  1.00 71.49  ?  152  TYR A CE2 1 
ATOM   125  C CZ  . TYR A 1 26  ? 11.446  37.225  48.533  1.00 62.03  ?  152  TYR A CZ  1 
ATOM   126  O OH  . TYR A 1 26  ? 11.512  35.867  48.741  1.00 60.88  ?  152  TYR A OH  1 
ATOM   127  N N   . ALA A 1 27  ? 12.031  44.398  46.431  1.00 78.37  ?  153  ALA A N   1 
ATOM   128  C CA  . ALA A 1 27  ? 11.538  45.627  45.812  1.00 74.10  ?  153  ALA A CA  1 
ATOM   129  C C   . ALA A 1 27  ? 11.842  45.649  44.319  1.00 72.32  ?  153  ALA A C   1 
ATOM   130  O O   . ALA A 1 27  ? 10.952  45.896  43.491  1.00 71.28  ?  153  ALA A O   1 
ATOM   131  C CB  . ALA A 1 27  ? 12.156  46.845  46.497  1.00 73.16  ?  153  ALA A CB  1 
ATOM   132  N N   . LEU A 1 28  ? 13.104  45.403  43.958  1.00 69.11  ?  154  LEU A N   1 
ATOM   133  C CA  . LEU A 1 28  ? 13.466  45.343  42.550  1.00 72.34  ?  154  LEU A CA  1 
ATOM   134  C C   . LEU A 1 28  ? 12.675  44.261  41.832  1.00 82.28  ?  154  LEU A C   1 
ATOM   135  O O   . LEU A 1 28  ? 12.203  44.486  40.713  1.00 74.61  ?  154  LEU A O   1 
ATOM   136  C CB  . LEU A 1 28  ? 14.973  45.106  42.400  1.00 65.56  ?  154  LEU A CB  1 
ATOM   137  C CG  . LEU A 1 28  ? 15.884  46.339  42.301  1.00 61.32  ?  154  LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 28  ? 15.606  47.363  43.398  1.00 61.53  ?  154  LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 28  ? 17.358  45.939  42.312  1.00 57.08  ?  154  LEU A CD2 1 
ATOM   140  N N   . SER A 1 29  ? 12.460  43.113  42.482  1.00 92.49  ?  155  SER A N   1 
ATOM   141  C CA  . SER A 1 29  ? 11.715  42.032  41.848  1.00 75.08  ?  155  SER A CA  1 
ATOM   142  C C   . SER A 1 29  ? 10.256  42.417  41.631  1.00 64.57  ?  155  SER A C   1 
ATOM   143  O O   . SER A 1 29  ? 9.704   42.193  40.552  1.00 50.98  ?  155  SER A O   1 
ATOM   144  C CB  . SER A 1 29  ? 11.819  40.761  42.691  1.00 73.24  ?  155  SER A CB  1 
ATOM   145  O OG  . SER A 1 29  ? 13.149  40.272  42.733  1.00 73.49  ?  155  SER A OG  1 
ATOM   146  N N   . PHE A 1 30  ? 9.613   42.994  42.648  1.00 64.77  ?  156  PHE A N   1 
ATOM   147  C CA  . PHE A 1 30  ? 8.217   43.395  42.511  1.00 66.96  ?  156  PHE A CA  1 
ATOM   148  C C   . PHE A 1 30  ? 8.057   44.418  41.394  1.00 66.29  ?  156  PHE A C   1 
ATOM   149  O O   . PHE A 1 30  ? 7.197   44.268  40.514  1.00 59.39  ?  156  PHE A O   1 
ATOM   150  C CB  . PHE A 1 30  ? 7.700   43.954  43.842  1.00 67.63  ?  156  PHE A CB  1 
ATOM   151  C CG  . PHE A 1 30  ? 6.243   44.345  43.816  1.00 70.90  ?  156  PHE A CG  1 
ATOM   152  C CD1 . PHE A 1 30  ? 5.254   43.433  44.158  1.00 79.05  ?  156  PHE A CD1 1 
ATOM   153  C CD2 . PHE A 1 30  ? 5.864   45.629  43.457  1.00 60.99  ?  156  PHE A CD2 1 
ATOM   154  C CE1 . PHE A 1 30  ? 3.915   43.797  44.131  1.00 77.90  ?  156  PHE A CE1 1 
ATOM   155  C CE2 . PHE A 1 30  ? 4.530   45.995  43.428  1.00 69.55  ?  156  PHE A CE2 1 
ATOM   156  C CZ  . PHE A 1 30  ? 3.555   45.080  43.767  1.00 82.80  ?  156  PHE A CZ  1 
ATOM   157  N N   . SER A 1 31  ? 8.892   45.459  41.401  1.00 75.49  ?  157  SER A N   1 
ATOM   158  C CA  . SER A 1 31  ? 8.772   46.499  40.385  1.00 77.37  ?  157  SER A CA  1 
ATOM   159  C C   . SER A 1 31  ? 9.038   45.936  38.992  1.00 78.81  ?  157  SER A C   1 
ATOM   160  O O   . SER A 1 31  ? 8.294   46.217  38.044  1.00 77.27  ?  157  SER A O   1 
ATOM   161  C CB  . SER A 1 31  ? 9.720   47.655  40.707  1.00 74.46  ?  157  SER A CB  1 
ATOM   162  O OG  . SER A 1 31  ? 9.414   48.222  41.970  1.00 70.84  ?  157  SER A OG  1 
ATOM   163  N N   . ALA A 1 32  ? 10.084  45.115  38.854  1.00 71.42  ?  158  ALA A N   1 
ATOM   164  C CA  . ALA A 1 32  ? 10.416  44.555  37.550  1.00 65.65  ?  158  ALA A CA  1 
ATOM   165  C C   . ALA A 1 32  ? 9.330   43.611  37.054  1.00 79.72  ?  158  ALA A C   1 
ATOM   166  O O   . ALA A 1 32  ? 9.015   43.599  35.862  1.00 78.43  ?  158  ALA A O   1 
ATOM   167  C CB  . ALA A 1 32  ? 11.760  43.833  37.612  1.00 55.76  ?  158  ALA A CB  1 
ATOM   168  N N   . LEU A 1 33  ? 8.741   42.814  37.946  1.00 77.12  ?  159  LEU A N   1 
ATOM   169  C CA  . LEU A 1 33  ? 7.724   41.872  37.504  1.00 72.53  ?  159  LEU A CA  1 
ATOM   170  C C   . LEU A 1 33  ? 6.441   42.588  37.114  1.00 76.39  ?  159  LEU A C   1 
ATOM   171  O O   . LEU A 1 33  ? 5.792   42.195  36.139  1.00 82.84  ?  159  LEU A O   1 
ATOM   172  C CB  . LEU A 1 33  ? 7.459   40.833  38.593  1.00 66.84  ?  159  LEU A CB  1 
ATOM   173  C CG  . LEU A 1 33  ? 8.601   39.830  38.798  1.00 65.63  ?  159  LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 33  ? 8.519   39.185  40.168  1.00 60.45  ?  159  LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 33  ? 8.614   38.766  37.712  1.00 59.45  ?  159  LEU A CD2 1 
ATOM   176  N N   . VAL A 1 34  ? 6.086   43.664  37.819  1.00 74.94  ?  160  VAL A N   1 
ATOM   177  C CA  . VAL A 1 34  ? 4.896   44.410  37.420  1.00 76.20  ?  160  VAL A CA  1 
ATOM   178  C C   . VAL A 1 34  ? 5.141   45.133  36.102  1.00 75.45  ?  160  VAL A C   1 
ATOM   179  O O   . VAL A 1 34  ? 4.275   45.142  35.220  1.00 61.29  ?  160  VAL A O   1 
ATOM   180  C CB  . VAL A 1 34  ? 4.460   45.378  38.537  1.00 74.83  ?  160  VAL A CB  1 
ATOM   181  C CG1 . VAL A 1 34  ? 3.273   46.221  38.090  1.00 59.14  ?  160  VAL A CG1 1 
ATOM   182  C CG2 . VAL A 1 34  ? 4.097   44.602  39.795  1.00 72.96  ?  160  VAL A CG2 1 
ATOM   183  N N   . ILE A 1 35  ? 6.337   45.703  35.921  1.00 77.85  ?  161  ILE A N   1 
ATOM   184  C CA  . ILE A 1 35  ? 6.662   46.357  34.653  1.00 76.68  ?  161  ILE A CA  1 
ATOM   185  C C   . ILE A 1 35  ? 6.629   45.349  33.509  1.00 78.58  ?  161  ILE A C   1 
ATOM   186  O O   . ILE A 1 35  ? 6.071   45.614  32.437  1.00 78.26  ?  161  ILE A O   1 
ATOM   187  C CB  . ILE A 1 35  ? 8.030   47.059  34.743  1.00 67.94  ?  161  ILE A CB  1 
ATOM   188  C CG1 . ILE A 1 35  ? 7.936   48.317  35.604  1.00 65.63  ?  161  ILE A CG1 1 
ATOM   189  C CG2 . ILE A 1 35  ? 8.553   47.405  33.354  1.00 55.47  ?  161  ILE A CG2 1 
ATOM   190  C CD1 . ILE A 1 35  ? 9.272   48.998  35.821  1.00 72.17  ?  161  ILE A CD1 1 
ATOM   191  N N   . ALA A 1 36  ? 7.238   44.179  33.719  1.00 70.06  ?  162  ALA A N   1 
ATOM   192  C CA  . ALA A 1 36  ? 7.334   43.175  32.664  1.00 74.75  ?  162  ALA A CA  1 
ATOM   193  C C   . ALA A 1 36  ? 5.967   42.606  32.307  1.00 80.14  ?  162  ALA A C   1 
ATOM   194  O O   . ALA A 1 36  ? 5.655   42.396  31.127  1.00 81.93  ?  162  ALA A O   1 
ATOM   195  C CB  . ALA A 1 36  ? 8.283   42.060  33.095  1.00 82.32  ?  162  ALA A CB  1 
ATOM   196  N N   . SER A 1 37  ? 5.145   42.312  33.317  1.00 74.79  ?  163  SER A N   1 
ATOM   197  C CA  . SER A 1 37  ? 3.790   41.866  33.030  1.00 76.47  ?  163  SER A CA  1 
ATOM   198  C C   . SER A 1 37  ? 2.993   42.953  32.327  1.00 85.48  ?  163  SER A C   1 
ATOM   199  O O   . SER A 1 37  ? 2.181   42.651  31.444  1.00 97.03  ?  163  SER A O   1 
ATOM   200  C CB  . SER A 1 37  ? 3.090   41.440  34.321  1.00 74.79  ?  163  SER A CB  1 
ATOM   201  O OG  . SER A 1 37  ? 3.197   42.438  35.325  1.00 94.95  ?  163  SER A OG  1 
ATOM   202  N N   . ALA A 1 38  ? 3.239   44.221  32.673  1.00 76.14  ?  164  ALA A N   1 
ATOM   203  C CA  . ALA A 1 38  ? 2.583   45.321  31.978  1.00 77.80  ?  164  ALA A CA  1 
ATOM   204  C C   . ALA A 1 38  ? 3.016   45.383  30.522  1.00 83.69  ?  164  ALA A C   1 
ATOM   205  O O   . ALA A 1 38  ? 2.216   45.727  29.649  1.00 89.49  ?  164  ALA A O   1 
ATOM   206  C CB  . ALA A 1 38  ? 2.889   46.643  32.681  1.00 73.71  ?  164  ALA A CB  1 
ATOM   207  N N   . ILE A 1 39  ? 4.279   45.061  30.242  1.00 74.99  ?  165  ILE A N   1 
ATOM   208  C CA  . ILE A 1 39  ? 4.739   45.021  28.855  1.00 72.68  ?  165  ILE A CA  1 
ATOM   209  C C   . ILE A 1 39  ? 4.063   43.879  28.107  1.00 72.57  ?  165  ILE A C   1 
ATOM   210  O O   . ILE A 1 39  ? 3.537   44.060  27.004  1.00 65.61  ?  165  ILE A O   1 
ATOM   211  C CB  . ILE A 1 39  ? 6.271   44.898  28.788  1.00 68.25  ?  165  ILE A CB  1 
ATOM   212  C CG1 . ILE A 1 39  ? 6.934   46.141  29.376  1.00 63.28  ?  165  ILE A CG1 1 
ATOM   213  C CG2 . ILE A 1 39  ? 6.719   44.676  27.350  1.00 63.25  ?  165  ILE A CG2 1 
ATOM   214  C CD1 . ILE A 1 39  ? 8.428   46.009  29.528  1.00 72.11  ?  165  ILE A CD1 1 
ATOM   215  N N   . LEU A 1 40  ? 4.084   42.680  28.693  1.00 77.82  ?  166  LEU A N   1 
ATOM   216  C CA  . LEU A 1 40  ? 3.488   41.520  28.034  1.00 78.29  ?  166  LEU A CA  1 
ATOM   217  C C   . LEU A 1 40  ? 1.999   41.727  27.772  1.00 80.50  ?  166  LEU A C   1 
ATOM   218  O O   . LEU A 1 40  ? 1.474   41.272  26.749  1.00 71.03  ?  166  LEU A O   1 
ATOM   219  C CB  . LEU A 1 40  ? 3.716   40.258  28.869  1.00 79.72  ?  166  LEU A CB  1 
ATOM   220  C CG  . LEU A 1 40  ? 5.152   39.737  28.976  1.00 65.39  ?  166  LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 40  ? 5.154   38.371  29.630  1.00 56.35  ?  166  LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 40  ? 5.845   39.678  27.620  1.00 68.23  ?  166  LEU A CD2 1 
ATOM   223  N N   . LEU A 1 41  ? 1.301   42.417  28.676  1.00 87.16  ?  167  LEU A N   1 
ATOM   224  C CA  . LEU A 1 41  ? -0.127  42.647  28.477  1.00 89.67  ?  167  LEU A CA  1 
ATOM   225  C C   . LEU A 1 41  ? -0.396  43.826  27.547  1.00 93.32  ?  167  LEU A C   1 
ATOM   226  O O   . LEU A 1 41  ? -1.368  43.807  26.784  1.00 87.79  ?  167  LEU A O   1 
ATOM   227  C CB  . LEU A 1 41  ? -0.812  42.874  29.824  1.00 71.93  ?  167  LEU A CB  1 
ATOM   228  C CG  . LEU A 1 41  ? -0.941  41.664  30.750  1.00 71.27  ?  167  LEU A CG  1 
ATOM   229  C CD1 . LEU A 1 41  ? -1.472  42.099  32.103  1.00 63.58  ?  167  LEU A CD1 1 
ATOM   230  C CD2 . LEU A 1 41  ? -1.846  40.608  30.137  1.00 67.60  ?  167  LEU A CD2 1 
ATOM   231  N N   . GLY A 1 42  ? 0.438   44.861  27.607  1.00 83.47  ?  168  GLY A N   1 
ATOM   232  C CA  . GLY A 1 42  ? 0.226   46.083  26.856  1.00 73.14  ?  168  GLY A CA  1 
ATOM   233  C C   . GLY A 1 42  ? 0.289   45.927  25.352  1.00 76.54  ?  168  GLY A C   1 
ATOM   234  O O   . GLY A 1 42  ? -0.642  46.313  24.639  1.00 83.62  ?  168  GLY A O   1 
ATOM   235  N N   . PHE A 1 43  ? 1.388   45.369  24.854  1.00 72.06  ?  169  PHE A N   1 
ATOM   236  C CA  . PHE A 1 43  ? 1.549   45.164  23.422  1.00 65.19  ?  169  PHE A CA  1 
ATOM   237  C C   . PHE A 1 43  ? 0.728   43.961  22.975  1.00 69.92  ?  169  PHE A C   1 
ATOM   238  O O   . PHE A 1 43  ? 0.843   42.872  23.547  1.00 85.63  ?  169  PHE A O   1 
ATOM   239  C CB  . PHE A 1 43  ? 3.023   44.963  23.076  1.00 66.84  ?  169  PHE A CB  1 
ATOM   240  C CG  . PHE A 1 43  ? 3.903   46.122  23.457  1.00 72.53  ?  169  PHE A CG  1 
ATOM   241  C CD1 . PHE A 1 43  ? 3.951   47.258  22.668  1.00 86.92  ?  169  PHE A CD1 1 
ATOM   242  C CD2 . PHE A 1 43  ? 4.690   46.069  24.596  1.00 77.94  ?  169  PHE A CD2 1 
ATOM   243  C CE1 . PHE A 1 43  ? 4.760   48.323  23.009  1.00 93.06  ?  169  PHE A CE1 1 
ATOM   244  C CE2 . PHE A 1 43  ? 5.503   47.130  24.944  1.00 92.52  ?  169  PHE A CE2 1 
ATOM   245  C CZ  . PHE A 1 43  ? 5.539   48.259  24.148  1.00 95.27  ?  169  PHE A CZ  1 
ATOM   246  N N   . ARG A 1 44  ? -0.102  44.164  21.948  1.00 80.12  ?  170  ARG A N   1 
ATOM   247  C CA  . ARG A 1 44  ? -0.998  43.107  21.494  1.00 75.23  ?  170  ARG A CA  1 
ATOM   248  C C   . ARG A 1 44  ? -0.238  41.955  20.851  1.00 80.15  ?  170  ARG A C   1 
ATOM   249  O O   . ARG A 1 44  ? -0.697  40.808  20.902  1.00 76.41  ?  170  ARG A O   1 
ATOM   250  C CB  . ARG A 1 44  ? -2.027  43.680  20.517  1.00 65.46  ?  170  ARG A CB  1 
ATOM   251  N N   . HIS A 1 45  ? 0.917   42.234  20.242  1.00 87.23  ?  171  HIS A N   1 
ATOM   252  C CA  . HIS A 1 45  ? 1.650   41.195  19.529  1.00 93.32  ?  171  HIS A CA  1 
ATOM   253  C C   . HIS A 1 45  ? 2.280   40.170  20.465  1.00 97.81  ?  171  HIS A C   1 
ATOM   254  O O   . HIS A 1 45  ? 2.712   39.110  20.000  1.00 97.38  ?  171  HIS A O   1 
ATOM   255  C CB  . HIS A 1 45  ? 2.725   41.821  18.638  1.00 101.57 ?  171  HIS A CB  1 
ATOM   256  C CG  . HIS A 1 45  ? 2.174   42.609  17.488  1.00 119.16 ?  171  HIS A CG  1 
ATOM   257  N ND1 . HIS A 1 45  ? 1.649   43.874  17.637  1.00 127.88 ?  171  HIS A ND1 1 
ATOM   258  C CD2 . HIS A 1 45  ? 2.067   42.310  16.171  1.00 111.38 ?  171  HIS A CD2 1 
ATOM   259  C CE1 . HIS A 1 45  ? 1.242   44.322  16.462  1.00 113.86 ?  171  HIS A CE1 1 
ATOM   260  N NE2 . HIS A 1 45  ? 1.483   43.392  15.556  1.00 101.83 ?  171  HIS A NE2 1 
ATOM   261  N N   . LEU A 1 46  ? 2.337   40.448  21.764  1.00 84.35  ?  172  LEU A N   1 
ATOM   262  C CA  . LEU A 1 46  ? 2.921   39.534  22.736  1.00 69.31  ?  172  LEU A CA  1 
ATOM   263  C C   . LEU A 1 46  ? 1.892   38.591  23.359  1.00 66.51  ?  172  LEU A C   1 
ATOM   264  O O   . LEU A 1 46  ? 2.220   37.882  24.316  1.00 74.08  ?  172  LEU A O   1 
ATOM   265  C CB  . LEU A 1 46  ? 3.638   40.330  23.833  1.00 64.62  ?  172  LEU A CB  1 
ATOM   266  C CG  . LEU A 1 46  ? 4.667   41.356  23.340  1.00 65.80  ?  172  LEU A CG  1 
ATOM   267  C CD1 . LEU A 1 46  ? 5.209   42.186  24.492  1.00 68.92  ?  172  LEU A CD1 1 
ATOM   268  C CD2 . LEU A 1 46  ? 5.802   40.667  22.600  1.00 50.32  ?  172  LEU A CD2 1 
ATOM   269  N N   . HIS A 1 47  ? 0.663   38.566  22.839  1.00 55.69  ?  173  HIS A N   1 
ATOM   270  C CA  . HIS A 1 47  ? -0.425  37.757  23.395  1.00 57.21  ?  173  HIS A CA  1 
ATOM   271  C C   . HIS A 1 47  ? -0.384  36.351  22.801  1.00 55.48  ?  173  HIS A C   1 
ATOM   272  O O   . HIS A 1 47  ? -1.079  36.028  21.835  1.00 70.46  ?  173  HIS A O   1 
ATOM   273  C CB  . HIS A 1 47  ? -1.773  38.412  23.119  1.00 65.10  ?  173  HIS A CB  1 
ATOM   274  C CG  . HIS A 1 47  ? -2.060  39.614  23.964  1.00 67.29  ?  173  HIS A CG  1 
ATOM   275  N ND1 . HIS A 1 47  ? -1.241  40.721  23.992  1.00 73.21  ?  173  HIS A ND1 1 
ATOM   276  C CD2 . HIS A 1 47  ? -3.093  39.887  24.797  1.00 71.73  ?  173  HIS A CD2 1 
ATOM   277  C CE1 . HIS A 1 47  ? -1.753  41.622  24.813  1.00 72.79  ?  173  HIS A CE1 1 
ATOM   278  N NE2 . HIS A 1 47  ? -2.876  41.140  25.314  1.00 73.18  ?  173  HIS A NE2 1 
ATOM   279  N N   . CYS A 1 48  ? 0.444   35.495  23.395  1.00 55.40  ?  174  CYS A N   1 
ATOM   280  C CA  . CYS A 1 48  ? 0.532   34.098  22.997  1.00 49.83  ?  174  CYS A CA  1 
ATOM   281  C C   . CYS A 1 48  ? 0.622   33.222  24.240  1.00 47.50  ?  174  CYS A C   1 
ATOM   282  O O   . CYS A 1 48  ? 0.902   33.700  25.342  1.00 38.20  ?  174  CYS A O   1 
ATOM   283  C CB  . CYS A 1 48  ? 1.732   33.842  22.068  1.00 50.17  ?  174  CYS A CB  1 
ATOM   284  S SG  . CYS A 1 48  ? 3.319   34.406  22.720  1.00 72.57  ?  174  CYS A SG  1 
ATOM   285  N N   . THR A 1 49  ? 0.357   31.926  24.049  1.00 50.47  ?  175  THR A N   1 
ATOM   286  C CA  . THR A 1 49  ? 0.294   30.989  25.170  1.00 50.53  ?  175  THR A CA  1 
ATOM   287  C C   . THR A 1 49  ? 1.578   31.001  25.994  1.00 44.38  ?  175  THR A C   1 
ATOM   288  O O   . THR A 1 49  ? 1.544   30.900  27.228  1.00 45.32  ?  175  THR A O   1 
ATOM   289  C CB  . THR A 1 49  ? 0.013   29.578  24.644  1.00 55.37  ?  175  THR A CB  1 
ATOM   290  O OG1 . THR A 1 49  ? 1.095   29.151  23.809  1.00 89.59  ?  175  THR A OG1 1 
ATOM   291  C CG2 . THR A 1 49  ? -1.249  29.554  23.802  1.00 49.59  ?  175  THR A CG2 1 
ATOM   292  N N   . ARG A 1 50  ? 2.725   31.116  25.322  1.00 39.81  ?  176  ARG A N   1 
ATOM   293  C CA  . ARG A 1 50  ? 4.008   31.178  26.018  1.00 44.02  ?  176  ARG A CA  1 
ATOM   294  C C   . ARG A 1 50  ? 4.032   32.318  27.031  1.00 53.18  ?  176  ARG A C   1 
ATOM   295  O O   . ARG A 1 50  ? 4.361   32.122  28.213  1.00 81.73  ?  176  ARG A O   1 
ATOM   296  C CB  . ARG A 1 50  ? 5.133   31.331  24.988  1.00 42.06  ?  176  ARG A CB  1 
ATOM   297  C CG  . ARG A 1 50  ? 6.520   31.550  25.559  1.00 46.83  ?  176  ARG A CG  1 
ATOM   298  C CD  . ARG A 1 50  ? 7.593   31.501  24.474  1.00 48.68  ?  176  ARG A CD  1 
ATOM   299  N NE  . ARG A 1 50  ? 7.254   32.291  23.290  1.00 71.98  ?  176  ARG A NE  1 
ATOM   300  C CZ  . ARG A 1 50  ? 7.471   33.598  23.168  1.00 69.68  ?  176  ARG A CZ  1 
ATOM   301  N NH1 . ARG A 1 50  ? 8.018   34.280  24.165  1.00 64.66  ?  176  ARG A NH1 1 
ATOM   302  N NH2 . ARG A 1 50  ? 7.136   34.226  22.048  1.00 51.85  ?  176  ARG A NH2 1 
ATOM   303  N N   . ASN A 1 51  ? 3.636   33.511  26.598  1.00 44.45  ?  177  ASN A N   1 
ATOM   304  C CA  . ASN A 1 51  ? 3.669   34.654  27.498  1.00 48.33  ?  177  ASN A CA  1 
ATOM   305  C C   . ASN A 1 51  ? 2.560   34.592  28.542  1.00 48.79  ?  177  ASN A C   1 
ATOM   306  O O   . ASN A 1 51  ? 2.708   35.159  29.629  1.00 44.88  ?  177  ASN A O   1 
ATOM   307  C CB  . ASN A 1 51  ? 3.613   35.955  26.690  1.00 55.65  ?  177  ASN A CB  1 
ATOM   308  C CG  . ASN A 1 51  ? 4.904   36.207  25.926  1.00 56.45  ?  177  ASN A CG  1 
ATOM   309  O OD1 . ASN A 1 51  ? 5.947   35.642  26.263  1.00 55.89  ?  177  ASN A OD1 1 
ATOM   310  N ND2 . ASN A 1 51  ? 4.843   37.046  24.895  1.00 59.85  ?  177  ASN A ND2 1 
ATOM   311  N N   . TYR A 1 52  ? 1.460   33.897  28.256  1.00 56.63  ?  178  TYR A N   1 
ATOM   312  C CA  . TYR A 1 52  ? 0.441   33.694  29.284  1.00 62.28  ?  178  TYR A CA  1 
ATOM   313  C C   . TYR A 1 52  ? 0.974   32.819  30.417  1.00 57.51  ?  178  TYR A C   1 
ATOM   314  O O   . TYR A 1 52  ? 0.757   33.110  31.607  1.00 44.60  ?  178  TYR A O   1 
ATOM   315  C CB  . TYR A 1 52  ? -0.814  33.075  28.660  1.00 67.93  ?  178  TYR A CB  1 
ATOM   316  C CG  . TYR A 1 52  ? -1.572  33.999  27.725  1.00 74.13  ?  178  TYR A CG  1 
ATOM   317  C CD1 . TYR A 1 52  ? -1.868  35.308  28.094  1.00 66.84  ?  178  TYR A CD1 1 
ATOM   318  C CD2 . TYR A 1 52  ? -2.000  33.561  26.477  1.00 84.22  ?  178  TYR A CD2 1 
ATOM   319  C CE1 . TYR A 1 52  ? -2.565  36.154  27.241  1.00 79.83  ?  178  TYR A CE1 1 
ATOM   320  C CE2 . TYR A 1 52  ? -2.697  34.399  25.622  1.00 88.06  ?  178  TYR A CE2 1 
ATOM   321  C CZ  . TYR A 1 52  ? -2.975  35.696  26.007  1.00 89.36  ?  178  TYR A CZ  1 
ATOM   322  O OH  . TYR A 1 52  ? -3.667  36.534  25.158  1.00 93.92  ?  178  TYR A OH  1 
ATOM   323  N N   . ILE A 1 53  ? 1.692   31.749  30.060  1.00 52.15  ?  179  ILE A N   1 
ATOM   324  C CA  . ILE A 1 53  ? 2.366   30.930  31.066  1.00 58.44  ?  179  ILE A CA  1 
ATOM   325  C C   . ILE A 1 53  ? 3.345   31.784  31.866  1.00 51.64  ?  179  ILE A C   1 
ATOM   326  O O   . ILE A 1 53  ? 3.436   31.678  33.104  1.00 49.29  ?  179  ILE A O   1 
ATOM   327  C CB  . ILE A 1 53  ? 3.066   29.736  30.386  1.00 51.83  ?  179  ILE A CB  1 
ATOM   328  C CG1 . ILE A 1 53  ? 2.027   28.844  29.709  1.00 41.99  ?  179  ILE A CG1 1 
ATOM   329  C CG2 . ILE A 1 53  ? 3.897   28.944  31.386  1.00 45.91  ?  179  ILE A CG2 1 
ATOM   330  C CD1 . ILE A 1 53  ? 2.601   27.741  28.857  1.00 37.93  ?  179  ILE A CD1 1 
ATOM   331  N N   . HIS A 1 54  ? 4.079   32.662  31.168  1.00 48.62  ?  180  HIS A N   1 
ATOM   332  C CA  . HIS A 1 54  ? 4.959   33.603  31.860  1.00 49.04  ?  180  HIS A CA  1 
ATOM   333  C C   . HIS A 1 54  ? 4.184   34.467  32.848  1.00 52.36  ?  180  HIS A C   1 
ATOM   334  O O   . HIS A 1 54  ? 4.676   34.767  33.939  1.00 56.19  ?  180  HIS A O   1 
ATOM   335  C CB  . HIS A 1 54  ? 5.697   34.506  30.862  1.00 51.67  ?  180  HIS A CB  1 
ATOM   336  C CG  . HIS A 1 54  ? 6.708   33.789  30.022  1.00 65.85  ?  180  HIS A CG  1 
ATOM   337  N ND1 . HIS A 1 54  ? 6.739   32.417  29.916  1.00 77.18  ?  180  HIS A ND1 1 
ATOM   338  C CD2 . HIS A 1 54  ? 7.723   34.248  29.249  1.00 57.31  ?  180  HIS A CD2 1 
ATOM   339  C CE1 . HIS A 1 54  ? 7.726   32.058  29.116  1.00 71.69  ?  180  HIS A CE1 1 
ATOM   340  N NE2 . HIS A 1 54  ? 8.341   33.150  28.699  1.00 70.38  ?  180  HIS A NE2 1 
ATOM   341  N N   . LEU A 1 55  ? 2.995   34.924  32.459  1.00 48.92  ?  181  LEU A N   1 
ATOM   342  C CA  . LEU A 1 55  ? 2.240   35.821  33.327  1.00 56.81  ?  181  LEU A CA  1 
ATOM   343  C C   . LEU A 1 55  ? 1.806   35.112  34.599  1.00 61.31  ?  181  LEU A C   1 
ATOM   344  O O   . LEU A 1 55  ? 1.819   35.702  35.687  1.00 57.24  ?  181  LEU A O   1 
ATOM   345  C CB  . LEU A 1 55  ? 1.031   36.379  32.582  1.00 56.82  ?  181  LEU A CB  1 
ATOM   346  C CG  . LEU A 1 55  ? 1.376   37.429  31.527  1.00 59.16  ?  181  LEU A CG  1 
ATOM   347  C CD1 . LEU A 1 55  ? 0.190   37.676  30.619  1.00 69.27  ?  181  LEU A CD1 1 
ATOM   348  C CD2 . LEU A 1 55  ? 1.842   38.733  32.170  1.00 50.77  ?  181  LEU A CD2 1 
ATOM   349  N N   . ASN A 1 56  ? 1.430   33.839  34.487  1.00 63.69  ?  182  ASN A N   1 
ATOM   350  C CA  . ASN A 1 56  ? 1.092   33.101  35.705  1.00 60.01  ?  182  ASN A CA  1 
ATOM   351  C C   . ASN A 1 56  ? 2.315   32.936  36.608  1.00 61.57  ?  182  ASN A C   1 
ATOM   352  O O   . ASN A 1 56  ? 2.222   33.127  37.833  1.00 72.00  ?  182  ASN A O   1 
ATOM   353  C CB  . ASN A 1 56  ? 0.469   31.751  35.355  1.00 59.12  ?  182  ASN A CB  1 
ATOM   354  C CG  . ASN A 1 56  ? -0.931  31.895  34.777  1.00 58.71  ?  182  ASN A CG  1 
ATOM   355  O OD1 . ASN A 1 56  ? -1.932  31.654  35.454  1.00 44.84  ?  182  ASN A OD1 1 
ATOM   356  N ND2 . ASN A 1 56  ? -1.003  32.299  33.518  1.00 60.53  ?  182  ASN A ND2 1 
ATOM   357  N N   . LEU A 1 57  ? 3.482   32.644  36.019  1.00 55.20  ?  183  LEU A N   1 
ATOM   358  C CA  . LEU A 1 57  ? 4.702   32.547  36.827  1.00 52.71  ?  183  LEU A CA  1 
ATOM   359  C C   . LEU A 1 57  ? 5.023   33.877  37.514  1.00 57.02  ?  183  LEU A C   1 
ATOM   360  O O   . LEU A 1 57  ? 5.346   33.922  38.717  1.00 61.47  ?  183  LEU A O   1 
ATOM   361  C CB  . LEU A 1 57  ? 5.867   32.113  35.937  1.00 49.71  ?  183  LEU A CB  1 
ATOM   362  C CG  . LEU A 1 57  ? 7.234   31.813  36.552  1.00 50.03  ?  183  LEU A CG  1 
ATOM   363  C CD1 . LEU A 1 57  ? 7.214   30.480  37.281  1.00 38.65  ?  183  LEU A CD1 1 
ATOM   364  C CD2 . LEU A 1 57  ? 8.308   31.819  35.477  1.00 40.46  ?  183  LEU A CD2 1 
ATOM   365  N N   . PHE A 1 58  ? 4.903   34.975  36.763  1.00 62.17  ?  184  PHE A N   1 
ATOM   366  C CA  . PHE A 1 58  ? 5.128   36.304  37.316  1.00 56.53  ?  184  PHE A CA  1 
ATOM   367  C C   . PHE A 1 58  ? 4.192   36.574  38.477  1.00 67.45  ?  184  PHE A C   1 
ATOM   368  O O   . PHE A 1 58  ? 4.593   37.182  39.472  1.00 76.66  ?  184  PHE A O   1 
ATOM   369  C CB  . PHE A 1 58  ? 4.900   37.379  36.254  1.00 57.94  ?  184  PHE A CB  1 
ATOM   370  C CG  . PHE A 1 58  ? 5.867   37.346  35.113  1.00 64.38  ?  184  PHE A CG  1 
ATOM   371  C CD1 . PHE A 1 58  ? 7.094   36.712  35.221  1.00 64.76  ?  184  PHE A CD1 1 
ATOM   372  C CD2 . PHE A 1 58  ? 5.547   37.976  33.923  1.00 63.97  ?  184  PHE A CD2 1 
ATOM   373  C CE1 . PHE A 1 58  ? 7.972   36.702  34.152  1.00 63.79  ?  184  PHE A CE1 1 
ATOM   374  C CE2 . PHE A 1 58  ? 6.418   37.968  32.860  1.00 59.82  ?  184  PHE A CE2 1 
ATOM   375  C CZ  . PHE A 1 58  ? 7.631   37.331  32.972  1.00 63.07  ?  184  PHE A CZ  1 
ATOM   376  N N   . ALA A 1 59  ? 2.927   36.178  38.340  1.00 73.63  ?  185  ALA A N   1 
ATOM   377  C CA  . ALA A 1 59  ? 1.960   36.429  39.399  1.00 62.65  ?  185  ALA A CA  1 
ATOM   378  C C   . ALA A 1 59  ? 2.325   35.667  40.659  1.00 59.22  ?  185  ALA A C   1 
ATOM   379  O O   . ALA A 1 59  ? 2.162   36.181  41.772  1.00 67.50  ?  185  ALA A O   1 
ATOM   380  C CB  . ALA A 1 59  ? 0.556   36.052  38.933  1.00 54.15  ?  185  ALA A CB  1 
ATOM   381  N N   . SER A 1 60  ? 2.812   34.432  40.512  1.00 55.08  ?  186  SER A N   1 
ATOM   382  C CA  . SER A 1 60  ? 3.248   33.730  41.715  1.00 60.93  ?  186  SER A CA  1 
ATOM   383  C C   . SER A 1 60  ? 4.391   34.475  42.398  1.00 61.05  ?  186  SER A C   1 
ATOM   384  O O   . SER A 1 60  ? 4.378   34.641  43.629  1.00 63.49  ?  186  SER A O   1 
ATOM   385  C CB  . SER A 1 60  ? 3.637   32.282  41.398  1.00 55.99  ?  186  SER A CB  1 
ATOM   386  O OG  . SER A 1 60  ? 4.733   32.189  40.507  1.00 54.64  ?  186  SER A OG  1 
ATOM   387  N N   . PHE A 1 61  ? 5.341   35.004  41.620  1.00 51.37  ?  187  PHE A N   1 
ATOM   388  C CA  . PHE A 1 61  ? 6.440   35.723  42.270  1.00 61.58  ?  187  PHE A CA  1 
ATOM   389  C C   . PHE A 1 61  ? 5.975   37.053  42.873  1.00 65.63  ?  187  PHE A C   1 
ATOM   390  O O   . PHE A 1 61  ? 6.429   37.444  43.960  1.00 81.45  ?  187  PHE A O   1 
ATOM   391  C CB  . PHE A 1 61  ? 7.596   35.927  41.288  1.00 57.07  ?  187  PHE A CB  1 
ATOM   392  C CG  . PHE A 1 61  ? 8.490   34.723  41.162  1.00 47.67  ?  187  PHE A CG  1 
ATOM   393  C CD1 . PHE A 1 61  ? 9.486   34.479  42.096  1.00 51.47  ?  187  PHE A CD1 1 
ATOM   394  C CD2 . PHE A 1 61  ? 8.319   33.821  40.126  1.00 48.70  ?  187  PHE A CD2 1 
ATOM   395  C CE1 . PHE A 1 61  ? 10.301  33.362  41.991  1.00 48.11  ?  187  PHE A CE1 1 
ATOM   396  C CE2 . PHE A 1 61  ? 9.131   32.706  40.013  1.00 53.16  ?  187  PHE A CE2 1 
ATOM   397  C CZ  . PHE A 1 61  ? 10.122  32.474  40.947  1.00 48.87  ?  187  PHE A CZ  1 
ATOM   398  N N   . ILE A 1 62  ? 5.040   37.733  42.205  1.00 59.69  ?  188  ILE A N   1 
ATOM   399  C CA  . ILE A 1 62  ? 4.500   38.993  42.716  1.00 65.84  ?  188  ILE A CA  1 
ATOM   400  C C   . ILE A 1 62  ? 3.777   38.764  44.037  1.00 63.71  ?  188  ILE A C   1 
ATOM   401  O O   . ILE A 1 62  ? 3.923   39.542  44.986  1.00 55.98  ?  188  ILE A O   1 
ATOM   402  C CB  . ILE A 1 62  ? 3.565   39.647  41.680  1.00 68.28  ?  188  ILE A CB  1 
ATOM   403  C CG1 . ILE A 1 62  ? 4.353   40.151  40.473  1.00 66.83  ?  188  ILE A CG1 1 
ATOM   404  C CG2 . ILE A 1 62  ? 2.763   40.787  42.309  1.00 54.31  ?  188  ILE A CG2 1 
ATOM   405  C CD1 . ILE A 1 62  ? 3.481   40.739  39.386  1.00 57.69  ?  188  ILE A CD1 1 
ATOM   406  N N   . LEU A 1 63  ? 2.956   37.714  44.104  1.00 70.07  ?  189  LEU A N   1 
ATOM   407  C CA  . LEU A 1 63  ? 2.250   37.399  45.343  1.00 73.33  ?  189  LEU A CA  1 
ATOM   408  C C   . LEU A 1 63  ? 3.223   37.039  46.459  1.00 66.29  ?  189  LEU A C   1 
ATOM   409  O O   . LEU A 1 63  ? 3.012   37.403  47.624  1.00 60.49  ?  189  LEU A O   1 
ATOM   410  C CB  . LEU A 1 63  ? 1.267   36.254  45.107  1.00 66.91  ?  189  LEU A CB  1 
ATOM   411  C CG  . LEU A 1 63  ? -0.213  36.578  44.883  1.00 71.05  ?  189  LEU A CG  1 
ATOM   412  C CD1 . LEU A 1 63  ? -0.456  37.448  43.650  1.00 77.60  ?  189  LEU A CD1 1 
ATOM   413  C CD2 . LEU A 1 63  ? -1.018  35.291  44.796  1.00 73.71  ?  189  LEU A CD2 1 
ATOM   414  N N   . ARG A 1 64  ? 4.283   36.298  46.127  1.00 61.99  ?  190  ARG A N   1 
ATOM   415  C CA  . ARG A 1 64  ? 5.321   36.026  47.118  1.00 62.33  ?  190  ARG A CA  1 
ATOM   416  C C   . ARG A 1 64  ? 5.886   37.325  47.687  1.00 61.43  ?  190  ARG A C   1 
ATOM   417  O O   . ARG A 1 64  ? 6.021   37.484  48.911  1.00 61.25  ?  190  ARG A O   1 
ATOM   418  C CB  . ARG A 1 64  ? 6.430   35.187  46.480  1.00 73.85  ?  190  ARG A CB  1 
ATOM   419  C CG  . ARG A 1 64  ? 7.531   34.755  47.419  1.00 77.81  ?  190  ARG A CG  1 
ATOM   420  C CD  . ARG A 1 64  ? 8.457   33.767  46.735  1.00 73.43  ?  190  ARG A CD  1 
ATOM   421  N NE  . ARG A 1 64  ? 9.549   33.354  47.605  1.00 70.79  ?  190  ARG A NE  1 
ATOM   422  C CZ  . ARG A 1 64  ? 10.447  32.428  47.289  1.00 70.59  ?  190  ARG A CZ  1 
ATOM   423  N NH1 . ARG A 1 64  ? 10.387  31.808  46.116  1.00 67.78  ?  190  ARG A NH1 1 
ATOM   424  N NH2 . ARG A 1 64  ? 11.404  32.122  48.153  1.00 74.33  ?  190  ARG A NH2 1 
ATOM   425  N N   . ALA A 1 65  ? 6.178   38.287  46.809  1.00 57.82  ?  191  ALA A N   1 
ATOM   426  C CA  . ALA A 1 65  ? 6.690   39.576  47.269  1.00 60.57  ?  191  ALA A CA  1 
ATOM   427  C C   . ALA A 1 65  ? 5.664   40.313  48.124  1.00 60.70  ?  191  ALA A C   1 
ATOM   428  O O   . ALA A 1 65  ? 6.022   40.971  49.110  1.00 66.80  ?  191  ALA A O   1 
ATOM   429  C CB  . ALA A 1 65  ? 7.095   40.436  46.074  1.00 68.85  ?  191  ALA A CB  1 
ATOM   430  N N   . LEU A 1 66  ? 4.387   40.241  47.745  1.00 67.13  ?  192  LEU A N   1 
ATOM   431  C CA  . LEU A 1 66  ? 3.342   40.883  48.540  1.00 67.70  ?  192  LEU A CA  1 
ATOM   432  C C   . LEU A 1 66  ? 3.299   40.310  49.950  1.00 71.97  ?  192  LEU A C   1 
ATOM   433  O O   . LEU A 1 66  ? 3.150   41.052  50.929  1.00 74.50  ?  192  LEU A O   1 
ATOM   434  C CB  . LEU A 1 66  ? 1.980   40.723  47.861  1.00 77.80  ?  192  LEU A CB  1 
ATOM   435  C CG  . LEU A 1 66  ? 1.763   41.455  46.536  1.00 92.49  ?  192  LEU A CG  1 
ATOM   436  C CD1 . LEU A 1 66  ? 0.507   40.946  45.845  1.00 82.73  ?  192  LEU A CD1 1 
ATOM   437  C CD2 . LEU A 1 66  ? 1.685   42.962  46.742  1.00 80.73  ?  192  LEU A CD2 1 
ATOM   438  N N   . CYS A 1 67  ? 3.430   38.988  50.071  1.00 57.88  ?  193  CYS A N   1 
ATOM   439  C CA  . CYS A 1 67  ? 3.500   38.373  51.392  1.00 56.79  ?  193  CYS A CA  1 
ATOM   440  C C   . CYS A 1 67  ? 4.695   38.898  52.174  1.00 70.54  ?  193  CYS A C   1 
ATOM   441  O O   . CYS A 1 67  ? 4.588   39.190  53.372  1.00 77.67  ?  193  CYS A O   1 
ATOM   442  C CB  . CYS A 1 67  ? 3.588   36.855  51.262  1.00 62.96  ?  193  CYS A CB  1 
ATOM   443  S SG  . CYS A 1 67  ? 2.083   36.079  50.655  1.00 66.05  ?  193  CYS A SG  1 
ATOM   444  N N   . VAL A 1 68  ? 5.844   39.035  51.508  1.00 71.56  ?  194  VAL A N   1 
ATOM   445  C CA  . VAL A 1 68  ? 7.042   39.494  52.211  1.00 86.44  ?  194  VAL A CA  1 
ATOM   446  C C   . VAL A 1 68  ? 6.838   40.910  52.742  1.00 93.86  ?  194  VAL A C   1 
ATOM   447  O O   . VAL A 1 68  ? 7.116   41.197  53.916  1.00 100.55 ?  194  VAL A O   1 
ATOM   448  C CB  . VAL A 1 68  ? 8.276   39.395  51.292  1.00 79.89  ?  194  VAL A CB  1 
ATOM   449  C CG1 . VAL A 1 68  ? 9.495   40.034  51.941  1.00 63.11  ?  194  VAL A CG1 1 
ATOM   450  C CG2 . VAL A 1 68  ? 8.565   37.940  50.958  1.00 102.89 ?  194  VAL A CG2 1 
ATOM   451  N N   . PHE A 1 69  ? 6.302   41.801  51.902  1.00 90.04  ?  195  PHE A N   1 
ATOM   452  C CA  . PHE A 1 69  ? 6.089   43.180  52.331  1.00 84.82  ?  195  PHE A CA  1 
ATOM   453  C C   . PHE A 1 69  ? 5.021   43.268  53.410  1.00 87.05  ?  195  PHE A C   1 
ATOM   454  O O   . PHE A 1 69  ? 5.112   44.117  54.300  1.00 82.31  ?  195  PHE A O   1 
ATOM   455  C CB  . PHE A 1 69  ? 5.691   44.063  51.147  1.00 82.54  ?  195  PHE A CB  1 
ATOM   456  C CG  . PHE A 1 69  ? 6.729   44.138  50.064  1.00 93.63  ?  195  PHE A CG  1 
ATOM   457  C CD1 . PHE A 1 69  ? 8.046   44.448  50.360  1.00 90.74  ?  195  PHE A CD1 1 
ATOM   458  C CD2 . PHE A 1 69  ? 6.382   43.903  48.744  1.00 103.76 ?  195  PHE A CD2 1 
ATOM   459  C CE1 . PHE A 1 69  ? 8.997   44.516  49.357  1.00 101.19 ?  195  PHE A CE1 1 
ATOM   460  C CE2 . PHE A 1 69  ? 7.327   43.964  47.740  1.00 96.07  ?  195  PHE A CE2 1 
ATOM   461  C CZ  . PHE A 1 69  ? 8.636   44.272  48.045  1.00 95.39  ?  195  PHE A CZ  1 
ATOM   462  N N   . PHE A 1 70  ? 4.016   42.393  53.359  1.00 80.29  ?  196  PHE A N   1 
ATOM   463  C CA  . PHE A 1 70  ? 2.963   42.427  54.366  1.00 79.56  ?  196  PHE A CA  1 
ATOM   464  C C   . PHE A 1 70  ? 3.500   41.979  55.718  1.00 87.71  ?  196  PHE A C   1 
ATOM   465  O O   . PHE A 1 70  ? 3.209   42.598  56.751  1.00 107.53 ?  196  PHE A O   1 
ATOM   466  C CB  . PHE A 1 70  ? 1.802   41.540  53.913  1.00 85.76  ?  196  PHE A CB  1 
ATOM   467  C CG  . PHE A 1 70  ? 0.514   41.775  54.657  1.00 104.44 ?  196  PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 70  ? 0.247   41.100  55.836  1.00 102.91 ?  196  PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 70  ? -0.445  42.643  54.158  1.00 106.11 ?  196  PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 70  ? -0.944  41.301  56.516  1.00 97.10  ?  196  PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 70  ? -1.640  42.848  54.835  1.00 99.79  ?  196  PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 70  ? -1.887  42.176  56.015  1.00 97.27  ?  196  PHE A CZ  1 
ATOM   473  N N   . LYS A 1 71  ? 4.307   40.915  55.725  1.00 85.01  ?  197  LYS A N   1 
ATOM   474  C CA  . LYS A 1 71  ? 4.917   40.463  56.970  1.00 86.23  ?  197  LYS A CA  1 
ATOM   475  C C   . LYS A 1 71  ? 5.834   41.532  57.542  1.00 79.24  ?  197  LYS A C   1 
ATOM   476  O O   . LYS A 1 71  ? 5.863   41.749  58.758  1.00 77.37  ?  197  LYS A O   1 
ATOM   477  C CB  . LYS A 1 71  ? 5.690   39.161  56.743  1.00 86.67  ?  197  LYS A CB  1 
ATOM   478  C CG  . LYS A 1 71  ? 6.354   38.585  57.989  1.00 87.17  ?  197  LYS A CG  1 
ATOM   479  C CD  . LYS A 1 71  ? 7.192   37.358  57.642  1.00 84.66  ?  197  LYS A CD  1 
ATOM   480  C CE  . LYS A 1 71  ? 7.964   36.833  58.844  1.00 76.90  ?  197  LYS A CE  1 
ATOM   481  N NZ  . LYS A 1 71  ? 9.229   37.588  59.080  1.00 90.70  ?  197  LYS A NZ  1 
ATOM   482  N N   . ASP A 1 72  ? 6.586   42.220  56.679  1.00 81.72  ?  198  ASP A N   1 
ATOM   483  C CA  . ASP A 1 72  ? 7.477   43.262  57.183  1.00 94.51  ?  198  ASP A CA  1 
ATOM   484  C C   . ASP A 1 72  ? 6.692   44.467  57.695  1.00 98.80  ?  198  ASP A C   1 
ATOM   485  O O   . ASP A 1 72  ? 7.055   45.060  58.718  1.00 120.08 ?  198  ASP A O   1 
ATOM   486  C CB  . ASP A 1 72  ? 8.466   43.688  56.097  1.00 101.94 ?  198  ASP A CB  1 
ATOM   487  C CG  . ASP A 1 72  ? 9.402   44.797  56.559  1.00 113.40 ?  198  ASP A CG  1 
ATOM   488  O OD1 . ASP A 1 72  ? 9.679   44.890  57.772  1.00 127.92 ?  198  ASP A OD1 1 
ATOM   489  O OD2 . ASP A 1 72  ? 9.854   45.592  55.710  1.00 125.71 -1 198  ASP A OD2 1 
ATOM   490  N N   . ALA A 1 73  ? 5.611   44.843  57.005  1.00 92.31  ?  199  ALA A N   1 
ATOM   491  C CA  . ALA A 1 73  ? 4.824   46.003  57.402  1.00 94.46  ?  199  ALA A CA  1 
ATOM   492  C C   . ALA A 1 73  ? 3.998   45.749  58.655  1.00 98.32  ?  199  ALA A C   1 
ATOM   493  O O   . ALA A 1 73  ? 3.627   46.709  59.339  1.00 112.60 ?  199  ALA A O   1 
ATOM   494  C CB  . ALA A 1 73  ? 3.906   46.428  56.256  1.00 93.82  ?  199  ALA A CB  1 
ATOM   495  N N   . ALA A 1 74  ? 3.691   44.487  58.963  1.00 109.74 ?  200  ALA A N   1 
ATOM   496  C CA  . ALA A 1 74  ? 2.995   44.182  60.205  1.00 113.95 ?  200  ALA A CA  1 
ATOM   497  C C   . ALA A 1 74  ? 3.900   44.279  61.428  1.00 110.31 ?  200  ALA A C   1 
ATOM   498  O O   . ALA A 1 74  ? 3.392   44.281  62.556  1.00 121.88 ?  200  ALA A O   1 
ATOM   499  C CB  . ALA A 1 74  ? 2.371   42.787  60.127  1.00 103.25 ?  200  ALA A CB  1 
ATOM   500  N N   . LEU A 1 75  ? 5.221   44.360  61.236  1.00 107.19 ?  201  LEU A N   1 
ATOM   501  C CA  . LEU A 1 75  ? 6.116   44.549  62.373  1.00 122.91 ?  201  LEU A CA  1 
ATOM   502  C C   . LEU A 1 75  ? 5.895   45.903  63.032  1.00 138.08 ?  201  LEU A C   1 
ATOM   503  O O   . LEU A 1 75  ? 6.086   46.041  64.245  1.00 147.61 ?  201  LEU A O   1 
ATOM   504  C CB  . LEU A 1 75  ? 7.572   44.401  61.933  1.00 130.55 ?  201  LEU A CB  1 
ATOM   505  C CG  . LEU A 1 75  ? 7.973   43.064  61.310  1.00 137.05 ?  201  LEU A CG  1 
ATOM   506  C CD1 . LEU A 1 75  ? 9.428   43.099  60.861  1.00 141.99 ?  201  LEU A CD1 1 
ATOM   507  C CD2 . LEU A 1 75  ? 7.735   41.923  62.287  1.00 117.35 ?  201  LEU A CD2 1 
ATOM   508  N N   . LYS A 1 76  ? 5.497   46.907  62.255  1.00 139.06 ?  202  LYS A N   1 
ATOM   509  C CA  . LYS A 1 76  ? 5.127   48.211  62.797  1.00 135.05 ?  202  LYS A CA  1 
ATOM   510  C C   . LYS A 1 76  ? 3.718   48.097  63.367  1.00 132.87 ?  202  LYS A C   1 
ATOM   511  O O   . LYS A 1 76  ? 2.745   47.952  62.623  1.00 97.88  ?  202  LYS A O   1 
ATOM   512  C CB  . LYS A 1 76  ? 5.227   49.283  61.718  1.00 145.32 ?  202  LYS A CB  1 
ATOM   513  C CG  . LYS A 1 76  ? 5.004   50.696  62.218  1.00 152.44 ?  202  LYS A CG  1 
ATOM   514  C CD  . LYS A 1 76  ? 5.498   51.735  61.220  1.00 132.46 ?  202  LYS A CD  1 
ATOM   515  C CE  . LYS A 1 76  ? 5.233   53.149  61.720  1.00 122.22 ?  202  LYS A CE  1 
ATOM   516  N NZ  . LYS A 1 76  ? 6.046   54.158  60.984  1.00 112.44 ?  202  LYS A NZ  1 
ATOM   517  N N   . TRP A 1 77  ? 3.621   48.146  64.697  1.00 158.51 ?  203  TRP A N   1 
ATOM   518  C CA  . TRP A 1 77  ? 2.370   47.971  65.440  1.00 155.44 ?  203  TRP A CA  1 
ATOM   519  C C   . TRP A 1 77  ? 1.801   46.570  65.237  1.00 140.06 ?  203  TRP A C   1 
ATOM   520  O O   . TRP A 1 77  ? 2.320   45.593  65.775  1.00 111.78 ?  203  TRP A O   1 
ATOM   521  C CB  . TRP A 1 77  ? 1.332   49.028  65.038  1.00 154.83 ?  203  TRP A CB  1 
ATOM   522  N N   . LEU A 1 85  ? -0.674  41.575  72.252  1.00 163.91 ?  218  LEU A N   1 
ATOM   523  C CA  . LEU A 1 85  ? -0.325  40.311  71.609  1.00 161.38 ?  218  LEU A CA  1 
ATOM   524  C C   . LEU A 1 85  ? 0.699   40.532  70.502  1.00 149.98 ?  218  LEU A C   1 
ATOM   525  O O   . LEU A 1 85  ? 0.478   41.333  69.594  1.00 142.37 ?  218  LEU A O   1 
ATOM   526  C CB  . LEU A 1 85  ? -1.574  39.637  71.043  1.00 163.51 ?  218  LEU A CB  1 
ATOM   527  C CG  . LEU A 1 85  ? -2.671  39.276  72.044  1.00 165.58 ?  218  LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 85  ? -3.907  38.770  71.316  1.00 138.87 ?  218  LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 85  ? -2.173  38.241  73.042  1.00 165.32 ?  218  LEU A CD2 1 
ATOM   530  N N   . SER A 1 86  ? 1.818   39.818  70.588  1.00 147.13 ?  219  SER A N   1 
ATOM   531  C CA  . SER A 1 86  ? 2.848   39.918  69.566  1.00 153.08 ?  219  SER A CA  1 
ATOM   532  C C   . SER A 1 86  ? 2.344   39.359  68.237  1.00 169.47 ?  219  SER A C   1 
ATOM   533  O O   . SER A 1 86  ? 1.359   38.618  68.172  1.00 187.28 ?  219  SER A O   1 
ATOM   534  C CB  . SER A 1 86  ? 4.117   39.185  70.004  1.00 145.62 ?  219  SER A CB  1 
ATOM   535  O OG  . SER A 1 86  ? 5.139   39.307  69.031  1.00 141.58 ?  219  SER A OG  1 
ATOM   536  N N   . TYR A 1 87  ? 3.043   39.732  67.163  1.00 164.87 ?  220  TYR A N   1 
ATOM   537  C CA  . TYR A 1 87  ? 2.646   39.299  65.827  1.00 147.10 ?  220  TYR A CA  1 
ATOM   538  C C   . TYR A 1 87  ? 2.815   37.797  65.648  1.00 147.91 ?  220  TYR A C   1 
ATOM   539  O O   . TYR A 1 87  ? 2.078   37.178  64.872  1.00 164.09 ?  220  TYR A O   1 
ATOM   540  C CB  . TYR A 1 87  ? 3.451   40.067  64.776  1.00 148.24 ?  220  TYR A CB  1 
ATOM   541  C CG  . TYR A 1 87  ? 3.179   39.665  63.344  1.00 148.40 ?  220  TYR A CG  1 
ATOM   542  C CD1 . TYR A 1 87  ? 1.946   39.912  62.753  1.00 149.14 ?  220  TYR A CD1 1 
ATOM   543  C CD2 . TYR A 1 87  ? 4.163   39.052  62.578  1.00 143.18 ?  220  TYR A CD2 1 
ATOM   544  C CE1 . TYR A 1 87  ? 1.697   39.547  61.443  1.00 156.55 ?  220  TYR A CE1 1 
ATOM   545  C CE2 . TYR A 1 87  ? 3.923   38.686  61.269  1.00 145.07 ?  220  TYR A CE2 1 
ATOM   546  C CZ  . TYR A 1 87  ? 2.689   38.934  60.706  1.00 150.71 ?  220  TYR A CZ  1 
ATOM   547  O OH  . TYR A 1 87  ? 2.449   38.570  59.403  1.00 143.45 ?  220  TYR A OH  1 
ATOM   548  N N   . GLN A 1 88  ? 3.772   37.194  66.354  1.00 130.43 ?  221  GLN A N   1 
ATOM   549  C CA  . GLN A 1 88  ? 3.987   35.758  66.237  1.00 128.12 ?  221  GLN A CA  1 
ATOM   550  C C   . GLN A 1 88  ? 2.829   34.951  66.806  1.00 129.13 ?  221  GLN A C   1 
ATOM   551  O O   . GLN A 1 88  ? 2.633   33.802  66.396  1.00 111.53 ?  221  GLN A O   1 
ATOM   552  C CB  . GLN A 1 88  ? 5.292   35.361  66.931  1.00 134.31 ?  221  GLN A CB  1 
ATOM   553  N N   . ASP A 1 89  ? 2.054   35.523  67.728  1.00 145.09 ?  222  ASP A N   1 
ATOM   554  C CA  . ASP A 1 89  ? 0.943   34.808  68.341  1.00 138.44 ?  222  ASP A CA  1 
ATOM   555  C C   . ASP A 1 89  ? -0.367  34.972  67.585  1.00 135.91 ?  222  ASP A C   1 
ATOM   556  O O   . ASP A 1 89  ? -1.275  34.154  67.766  1.00 140.00 ?  222  ASP A O   1 
ATOM   557  C CB  . ASP A 1 89  ? 0.745   35.274  69.787  1.00 140.93 ?  222  ASP A CB  1 
ATOM   558  C CG  . ASP A 1 89  ? 2.009   35.162  70.614  1.00 150.72 ?  222  ASP A CG  1 
ATOM   559  O OD1 . ASP A 1 89  ? 2.887   34.351  70.254  1.00 160.93 ?  222  ASP A OD1 1 
ATOM   560  O OD2 . ASP A 1 89  ? 2.126   35.886  71.624  1.00 163.46 -1 222  ASP A OD2 1 
ATOM   561  N N   . SER A 1 90  ? -0.491  36.003  66.755  1.00 139.75 ?  223  SER A N   1 
ATOM   562  C CA  . SER A 1 90  ? -1.729  36.250  66.033  1.00 142.20 ?  223  SER A CA  1 
ATOM   563  C C   . SER A 1 90  ? -1.983  35.167  64.987  1.00 127.34 ?  223  SER A C   1 
ATOM   564  O O   . SER A 1 90  ? -1.095  34.392  64.620  1.00 118.00 ?  223  SER A O   1 
ATOM   565  C CB  . SER A 1 90  ? -1.686  37.621  65.357  1.00 146.62 ?  223  SER A CB  1 
ATOM   566  O OG  . SER A 1 90  ? -0.696  37.648  64.341  1.00 139.37 ?  223  SER A OG  1 
ATOM   567  N N   . LEU A 1 91  ? -3.226  35.127  64.506  1.00 118.92 ?  224  LEU A N   1 
ATOM   568  C CA  . LEU A 1 91  ? -3.606  34.218  63.433  1.00 115.05 ?  224  LEU A CA  1 
ATOM   569  C C   . LEU A 1 91  ? -3.366  34.810  62.050  1.00 122.06 ?  224  LEU A C   1 
ATOM   570  O O   . LEU A 1 91  ? -3.153  34.054  61.090  1.00 130.75 ?  224  LEU A O   1 
ATOM   571  C CB  . LEU A 1 91  ? -5.081  33.822  63.579  1.00 109.90 ?  224  LEU A CB  1 
ATOM   572  C CG  . LEU A 1 91  ? -5.625  32.740  62.643  1.00 120.57 ?  224  LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 91  ? -6.386  31.689  63.434  1.00 120.23 ?  224  LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 91  ? -6.516  33.349  61.571  1.00 123.01 ?  224  LEU A CD2 1 
ATOM   575  N N   . ALA A 1 92  ? -3.388  36.141  61.931  1.00 114.64 ?  225  ALA A N   1 
ATOM   576  C CA  . ALA A 1 92  ? -3.078  36.780  60.656  1.00 109.10 ?  225  ALA A CA  1 
ATOM   577  C C   . ALA A 1 92  ? -1.694  36.380  60.162  1.00 102.01 ?  225  ALA A C   1 
ATOM   578  O O   . ALA A 1 92  ? -1.488  36.176  58.960  1.00 112.35 ?  225  ALA A O   1 
ATOM   579  C CB  . ALA A 1 92  ? -3.177  38.299  60.794  1.00 125.38 ?  225  ALA A CB  1 
ATOM   580  N N   . CYS A 1 93  ? -0.732  36.264  61.081  1.00 93.93  ?  226  CYS A N   1 
ATOM   581  C CA  . CYS A 1 93  ? 0.612   35.828  60.711  1.00 90.47  ?  226  CYS A CA  1 
ATOM   582  C C   . CYS A 1 93  ? 0.596   34.421  60.131  1.00 90.41  ?  226  CYS A C   1 
ATOM   583  O O   . CYS A 1 93  ? 1.258   34.146  59.123  1.00 72.77  ?  226  CYS A O   1 
ATOM   584  C CB  . CYS A 1 93  ? 1.530   35.882  61.932  1.00 84.76  ?  226  CYS A CB  1 
ATOM   585  S SG  . CYS A 1 93  ? 3.204   35.231  61.677  1.00 81.63  ?  226  CYS A SG  1 
ATOM   586  N N   . ARG A 1 94  ? -0.155  33.514  60.755  1.00 99.48  ?  227  ARG A N   1 
ATOM   587  C CA  . ARG A 1 94  ? -0.227  32.153  60.244  1.00 93.03  ?  227  ARG A CA  1 
ATOM   588  C C   . ARG A 1 94  ? -0.897  32.114  58.878  1.00 84.11  ?  227  ARG A C   1 
ATOM   589  O O   . ARG A 1 94  ? -0.497  31.327  58.012  1.00 82.38  ?  227  ARG A O   1 
ATOM   590  C CB  . ARG A 1 94  ? -0.961  31.272  61.250  1.00 100.04 ?  227  ARG A CB  1 
ATOM   591  C CG  . ARG A 1 94  ? -0.455  31.489  62.667  1.00 100.97 ?  227  ARG A CG  1 
ATOM   592  C CD  . ARG A 1 94  ? -1.246  30.706  63.695  1.00 115.06 ?  227  ARG A CD  1 
ATOM   593  N NE  . ARG A 1 94  ? -0.923  31.144  65.050  1.00 127.83 ?  227  ARG A NE  1 
ATOM   594  C CZ  . ARG A 1 94  ? 0.119   30.707  65.747  1.00 126.43 ?  227  ARG A CZ  1 
ATOM   595  N NH1 . ARG A 1 94  ? 0.945   29.813  65.219  1.00 141.27 ?  227  ARG A NH1 1 
ATOM   596  N NH2 . ARG A 1 94  ? 0.336   31.165  66.972  1.00 139.43 ?  227  ARG A NH2 1 
ATOM   597  N N   . LEU A 1 95  ? -1.871  32.993  58.644  1.00 78.14  ?  228  LEU A N   1 
ATOM   598  C CA  . LEU A 1 95  ? -2.492  33.048  57.324  1.00 76.13  ?  228  LEU A CA  1 
ATOM   599  C C   . LEU A 1 95  ? -1.518  33.576  56.276  1.00 79.06  ?  228  LEU A C   1 
ATOM   600  O O   . LEU A 1 95  ? -1.458  33.057  55.155  1.00 101.22 ?  228  LEU A O   1 
ATOM   601  C CB  . LEU A 1 95  ? -3.752  33.908  57.369  1.00 87.16  ?  228  LEU A CB  1 
ATOM   602  C CG  . LEU A 1 95  ? -4.930  33.296  58.119  1.00 95.90  ?  228  LEU A CG  1 
ATOM   603  C CD1 . LEU A 1 95  ? -6.116  34.233  58.048  1.00 105.71 ?  228  LEU A CD1 1 
ATOM   604  C CD2 . LEU A 1 95  ? -5.293  31.924  57.560  1.00 89.20  ?  228  LEU A CD2 1 
ATOM   605  N N   . VAL A 1 96  ? -0.756  34.620  56.613  1.00 72.57  ?  229  VAL A N   1 
ATOM   606  C CA  . VAL A 1 96  ? 0.197   35.170  55.649  1.00 70.07  ?  229  VAL A CA  1 
ATOM   607  C C   . VAL A 1 96  ? 1.279   34.143  55.340  1.00 67.88  ?  229  VAL A C   1 
ATOM   608  O O   . VAL A 1 96  ? 1.724   34.009  54.192  1.00 77.19  ?  229  VAL A O   1 
ATOM   609  C CB  . VAL A 1 96  ? 0.786   36.499  56.163  1.00 73.77  ?  229  VAL A CB  1 
ATOM   610  C CG1 . VAL A 1 96  ? 1.859   37.009  55.221  1.00 71.56  ?  229  VAL A CG1 1 
ATOM   611  C CG2 . VAL A 1 96  ? -0.317  37.547  56.299  1.00 72.85  ?  229  VAL A CG2 1 
ATOM   612  N N   . PHE A 1 97  ? 1.679   33.366  56.349  1.00 67.24  ?  230  PHE A N   1 
ATOM   613  C CA  . PHE A 1 97  ? 2.682   32.326  56.145  1.00 72.12  ?  230  PHE A CA  1 
ATOM   614  C C   . PHE A 1 97  ? 2.137   31.191  55.281  1.00 77.70  ?  230  PHE A C   1 
ATOM   615  O O   . PHE A 1 97  ? 2.850   30.661  54.418  1.00 75.18  ?  230  PHE A O   1 
ATOM   616  C CB  . PHE A 1 97  ? 3.162   31.815  57.503  1.00 65.17  ?  230  PHE A CB  1 
ATOM   617  C CG  . PHE A 1 97  ? 4.231   30.770  57.420  1.00 61.12  ?  230  PHE A CG  1 
ATOM   618  C CD1 . PHE A 1 97  ? 5.405   31.010  56.727  1.00 62.11  ?  230  PHE A CD1 1 
ATOM   619  C CD2 . PHE A 1 97  ? 4.071   29.553  58.055  1.00 64.52  ?  230  PHE A CD2 1 
ATOM   620  C CE1 . PHE A 1 97  ? 6.394   30.046  56.658  1.00 68.52  ?  230  PHE A CE1 1 
ATOM   621  C CE2 . PHE A 1 97  ? 5.055   28.586  57.993  1.00 73.33  ?  230  PHE A CE2 1 
ATOM   622  C CZ  . PHE A 1 97  ? 6.218   28.832  57.292  1.00 69.61  ?  230  PHE A CZ  1 
ATOM   623  N N   . LEU A 1 98  ? 0.870   30.821  55.481  1.00 80.20  ?  231  LEU A N   1 
ATOM   624  C CA  . LEU A 1 98  ? 0.255   29.807  54.629  1.00 77.73  ?  231  LEU A CA  1 
ATOM   625  C C   . LEU A 1 98  ? 0.159   30.284  53.184  1.00 73.90  ?  231  LEU A C   1 
ATOM   626  O O   . LEU A 1 98  ? 0.436   29.522  52.246  1.00 59.15  ?  231  LEU A O   1 
ATOM   627  C CB  . LEU A 1 98  ? -1.128  29.443  55.168  1.00 72.69  ?  231  LEU A CB  1 
ATOM   628  C CG  . LEU A 1 98  ? -1.829  28.275  54.478  1.00 79.08  ?  231  LEU A CG  1 
ATOM   629  C CD1 . LEU A 1 98  ? -1.038  26.996  54.682  1.00 73.63  ?  231  LEU A CD1 1 
ATOM   630  C CD2 . LEU A 1 98  ? -3.249  28.113  54.987  1.00 75.50  ?  231  LEU A CD2 1 
ATOM   631  N N   . LEU A 1 99  ? -0.220  31.548  52.986  1.00 63.55  ?  232  LEU A N   1 
ATOM   632  C CA  . LEU A 1 99  ? -0.300  32.086  51.633  1.00 62.56  ?  232  LEU A CA  1 
ATOM   633  C C   . LEU A 1 99  ? 1.074   32.114  50.969  1.00 63.77  ?  232  LEU A C   1 
ATOM   634  O O   . LEU A 1 99  ? 1.204   31.825  49.771  1.00 53.07  ?  232  LEU A O   1 
ATOM   635  C CB  . LEU A 1 99  ? -0.916  33.483  51.661  1.00 64.59  ?  232  LEU A CB  1 
ATOM   636  C CG  . LEU A 1 99  ? -1.193  34.087  50.283  1.00 73.94  ?  232  LEU A CG  1 
ATOM   637  C CD1 . LEU A 1 99  ? -2.192  33.227  49.522  1.00 67.56  ?  232  LEU A CD1 1 
ATOM   638  C CD2 . LEU A 1 99  ? -1.679  35.527  50.392  1.00 69.01  ?  232  LEU A CD2 1 
ATOM   639  N N   . MET A 1 100 ? 2.114   32.456  51.734  1.00 59.15  ?  233  MET A N   1 
ATOM   640  C CA  . MET A 1 100 ? 3.469   32.441  51.189  1.00 60.92  ?  233  MET A CA  1 
ATOM   641  C C   . MET A 1 100 ? 3.890   31.031  50.788  1.00 60.57  ?  233  MET A C   1 
ATOM   642  O O   . MET A 1 100 ? 4.509   30.828  49.734  1.00 61.89  ?  233  MET A O   1 
ATOM   643  C CB  . MET A 1 100 ? 4.454   33.017  52.202  1.00 55.89  ?  233  MET A CB  1 
ATOM   644  C CG  . MET A 1 100 ? 5.898   32.838  51.787  1.00 58.80  ?  233  MET A CG  1 
ATOM   645  S SD  . MET A 1 100 ? 6.835   34.372  51.824  1.00 87.55  ?  233  MET A SD  1 
ATOM   646  C CE  . MET A 1 100 ? 8.329   33.837  50.999  1.00 75.66  ?  233  MET A CE  1 
ATOM   647  N N   . GLN A 1 101 ? 3.605   30.048  51.647  1.00 62.02  ?  234  GLN A N   1 
ATOM   648  C CA  . GLN A 1 101 ? 3.900   28.658  51.309  1.00 62.68  ?  234  GLN A CA  1 
ATOM   649  C C   . GLN A 1 101 ? 3.209   28.251  50.014  1.00 57.13  ?  234  GLN A C   1 
ATOM   650  O O   . GLN A 1 101 ? 3.824   27.605  49.142  1.00 52.42  ?  234  GLN A O   1 
ATOM   651  C CB  . GLN A 1 101 ? 3.470   27.753  52.467  1.00 77.18  ?  234  GLN A CB  1 
ATOM   652  C CG  . GLN A 1 101 ? 4.129   26.380  52.498  1.00 90.60  ?  234  GLN A CG  1 
ATOM   653  C CD  . GLN A 1 101 ? 5.639   26.438  52.305  1.00 93.05  ?  234  GLN A CD  1 
ATOM   654  O OE1 . GLN A 1 101 ? 6.132   26.366  51.178  1.00 92.51  ?  234  GLN A OE1 1 
ATOM   655  N NE2 . GLN A 1 101 ? 6.378   26.564  53.404  1.00 67.21  ?  234  GLN A NE2 1 
ATOM   656  N N   . TYR A 1 102 ? 1.949   28.666  49.855  1.00 41.67  ?  235  TYR A N   1 
ATOM   657  C CA  . TYR A 1 102 ? 1.239   28.421  48.605  1.00 42.38  ?  235  TYR A CA  1 
ATOM   658  C C   . TYR A 1 102 ? 1.964   29.051  47.423  1.00 52.15  ?  235  TYR A C   1 
ATOM   659  O O   . TYR A 1 102 ? 2.118   28.418  46.371  1.00 51.66  ?  235  TYR A O   1 
ATOM   660  C CB  . TYR A 1 102 ? -0.190  28.959  48.692  1.00 43.18  ?  235  TYR A CB  1 
ATOM   661  C CG  . TYR A 1 102 ? -0.984  28.727  47.430  1.00 49.11  ?  235  TYR A CG  1 
ATOM   662  C CD1 . TYR A 1 102 ? -1.524  27.480  47.155  1.00 58.77  ?  235  TYR A CD1 1 
ATOM   663  C CD2 . TYR A 1 102 ? -1.180  29.745  46.504  1.00 41.15  ?  235  TYR A CD2 1 
ATOM   664  C CE1 . TYR A 1 102 ? -2.244  27.253  45.999  1.00 59.76  ?  235  TYR A CE1 1 
ATOM   665  C CE2 . TYR A 1 102 ? -1.902  29.524  45.341  1.00 47.64  ?  235  TYR A CE2 1 
ATOM   666  C CZ  . TYR A 1 102 ? -2.430  28.276  45.098  1.00 57.84  ?  235  TYR A CZ  1 
ATOM   667  O OH  . TYR A 1 102 ? -3.148  28.041  43.950  1.00 51.65  ?  235  TYR A OH  1 
ATOM   668  N N   . CYS A 1 103 ? 2.411   30.300  47.578  1.00 51.79  ?  236  CYS A N   1 
ATOM   669  C CA  . CYS A 1 103 ? 3.116   30.979  46.493  1.00 52.93  ?  236  CYS A CA  1 
ATOM   670  C C   . CYS A 1 103 ? 4.402   30.249  46.113  1.00 57.88  ?  236  CYS A C   1 
ATOM   671  O O   . CYS A 1 103 ? 4.761   30.182  44.931  1.00 70.43  ?  236  CYS A O   1 
ATOM   672  C CB  . CYS A 1 103 ? 3.426   32.422  46.886  1.00 71.16  ?  236  CYS A CB  1 
ATOM   673  S SG  . CYS A 1 103 ? 1.987   33.492  46.946  1.00 76.69  ?  236  CYS A SG  1 
ATOM   674  N N   . VAL A 1 104 ? 5.114   29.706  47.102  1.00 53.12  ?  237  VAL A N   1 
ATOM   675  C CA  . VAL A 1 104 ? 6.359   28.989  46.816  1.00 47.70  ?  237  VAL A CA  1 
ATOM   676  C C   . VAL A 1 104 ? 6.075   27.736  45.991  1.00 52.92  ?  237  VAL A C   1 
ATOM   677  O O   . VAL A 1 104 ? 6.718   27.477  44.957  1.00 60.57  ?  237  VAL A O   1 
ATOM   678  C CB  . VAL A 1 104 ? 7.098   28.651  48.123  1.00 47.04  ?  237  VAL A CB  1 
ATOM   679  C CG1 . VAL A 1 104 ? 8.253   27.714  47.848  1.00 46.18  ?  237  VAL A CG1 1 
ATOM   680  C CG2 . VAL A 1 104 ? 7.587   29.928  48.785  1.00 52.05  ?  237  VAL A CG2 1 
ATOM   681  N N   . ALA A 1 105 ? 5.109   26.931  46.446  1.00 46.94  ?  238  ALA A N   1 
ATOM   682  C CA  . ALA A 1 105 ? 4.736   25.755  45.663  1.00 42.53  ?  238  ALA A CA  1 
ATOM   683  C C   . ALA A 1 105 ? 4.256   26.148  44.268  1.00 42.37  ?  238  ALA A C   1 
ATOM   684  O O   . ALA A 1 105 ? 4.505   25.424  43.293  1.00 29.96  ?  238  ALA A O   1 
ATOM   685  C CB  . ALA A 1 105 ? 3.661   24.948  46.394  1.00 46.88  ?  238  ALA A CB  1 
ATOM   686  N N   . ALA A 1 106 ? 3.603   27.308  44.149  1.00 44.97  ?  239  ALA A N   1 
ATOM   687  C CA  . ALA A 1 106 ? 3.167   27.786  42.842  1.00 54.89  ?  239  ALA A CA  1 
ATOM   688  C C   . ALA A 1 106 ? 4.355   28.118  41.950  1.00 54.55  ?  239  ALA A C   1 
ATOM   689  O O   . ALA A 1 106 ? 4.340   27.826  40.750  1.00 60.78  ?  239  ALA A O   1 
ATOM   690  C CB  . ALA A 1 106 ? 2.271   29.011  43.004  1.00 61.98  ?  239  ALA A CB  1 
ATOM   691  N N   . ASN A 1 107 ? 5.378   28.764  42.511  1.00 43.78  ?  240  ASN A N   1 
ATOM   692  C CA  . ASN A 1 107 ? 6.596   29.014  41.748  1.00 44.21  ?  240  ASN A CA  1 
ATOM   693  C C   . ASN A 1 107 ? 7.126   27.718  41.168  1.00 48.88  ?  240  ASN A C   1 
ATOM   694  O O   . ASN A 1 107 ? 7.388   27.620  39.962  1.00 47.09  ?  240  ASN A O   1 
ATOM   695  C CB  . ASN A 1 107 ? 7.663   29.663  42.628  1.00 58.21  ?  240  ASN A CB  1 
ATOM   696  C CG  . ASN A 1 107 ? 7.221   30.988  43.191  1.00 59.34  ?  240  ASN A CG  1 
ATOM   697  O OD1 . ASN A 1 107 ? 6.353   31.649  42.627  1.00 64.00  ?  240  ASN A OD1 1 
ATOM   698  N ND2 . ASN A 1 107 ? 7.820   31.392  44.303  1.00 47.45  ?  240  ASN A ND2 1 
ATOM   699  N N   . TYR A 1 108 ? 7.246   26.691  42.011  1.00 58.75  ?  241  TYR A N   1 
ATOM   700  C CA  . TYR A 1 108 ? 7.879   25.471  41.514  1.00 51.51  ?  241  TYR A CA  1 
ATOM   701  C C   . TYR A 1 108 ? 7.000   24.746  40.496  1.00 47.26  ?  241  TYR A C   1 
ATOM   702  O O   . TYR A 1 108 ? 7.516   24.204  39.510  1.00 48.59  ?  241  TYR A O   1 
ATOM   703  C CB  . TYR A 1 108 ? 8.277   24.552  42.674  1.00 58.65  ?  241  TYR A CB  1 
ATOM   704  C CG  . TYR A 1 108 ? 9.474   25.092  43.434  1.00 72.23  ?  241  TYR A CG  1 
ATOM   705  C CD1 . TYR A 1 108 ? 10.776  24.815  43.025  1.00 87.71  ?  241  TYR A CD1 1 
ATOM   706  C CD2 . TYR A 1 108 ? 9.299   25.912  44.540  1.00 87.29  ?  241  TYR A CD2 1 
ATOM   707  C CE1 . TYR A 1 108 ? 11.866  25.331  43.711  1.00 84.86  ?  241  TYR A CE1 1 
ATOM   708  C CE2 . TYR A 1 108 ? 10.380  26.428  45.229  1.00 95.50  ?  241  TYR A CE2 1 
ATOM   709  C CZ  . TYR A 1 108 ? 11.662  26.136  44.810  1.00 88.54  ?  241  TYR A CZ  1 
ATOM   710  O OH  . TYR A 1 108 ? 12.745  26.645  45.487  1.00 93.30  ?  241  TYR A OH  1 
ATOM   711  N N   . TYR A 1 109 ? 5.679   24.777  40.657  1.00 39.47  ?  242  TYR A N   1 
ATOM   712  C CA  . TYR A 1 109 ? 4.859   24.023  39.711  1.00 45.99  ?  242  TYR A CA  1 
ATOM   713  C C   . TYR A 1 109 ? 4.578   24.781  38.418  1.00 44.75  ?  242  TYR A C   1 
ATOM   714  O O   . TYR A 1 109 ? 4.430   24.155  37.358  1.00 48.11  ?  242  TYR A O   1 
ATOM   715  C CB  . TYR A 1 109 ? 3.553   23.574  40.373  1.00 48.80  ?  242  TYR A CB  1 
ATOM   716  C CG  . TYR A 1 109 ? 3.743   22.284  41.141  1.00 42.37  ?  242  TYR A CG  1 
ATOM   717  C CD1 . TYR A 1 109 ? 3.565   21.048  40.530  1.00 40.94  ?  242  TYR A CD1 1 
ATOM   718  C CD2 . TYR A 1 109 ? 4.142   22.304  42.470  1.00 33.11  ?  242  TYR A CD2 1 
ATOM   719  C CE1 . TYR A 1 109 ? 3.760   19.869  41.237  1.00 39.99  ?  242  TYR A CE1 1 
ATOM   720  C CE2 . TYR A 1 109 ? 4.338   21.137  43.177  1.00 42.62  ?  242  TYR A CE2 1 
ATOM   721  C CZ  . TYR A 1 109 ? 4.146   19.920  42.556  1.00 41.18  ?  242  TYR A CZ  1 
ATOM   722  O OH  . TYR A 1 109 ? 4.334   18.742  43.239  1.00 32.91  ?  242  TYR A OH  1 
ATOM   723  N N   . TRP A 1 110 ? 4.530   26.112  38.455  1.00 47.20  ?  243  TRP A N   1 
ATOM   724  C CA  . TRP A 1 110 ? 4.508   26.845  37.199  1.00 55.13  ?  243  TRP A CA  1 
ATOM   725  C C   . TRP A 1 110 ? 5.851   26.759  36.491  1.00 64.03  ?  243  TRP A C   1 
ATOM   726  O O   . TRP A 1 110 ? 5.883   26.774  35.258  1.00 66.69  ?  243  TRP A O   1 
ATOM   727  C CB  . TRP A 1 110 ? 4.085   28.307  37.420  1.00 62.14  ?  243  TRP A CB  1 
ATOM   728  C CG  . TRP A 1 110 ? 2.579   28.469  37.486  1.00 66.63  ?  243  TRP A CG  1 
ATOM   729  C CD1 . TRP A 1 110 ? 1.821   28.685  38.600  1.00 58.17  ?  243  TRP A CD1 1 
ATOM   730  C CD2 . TRP A 1 110 ? 1.659   28.401  36.386  1.00 68.97  ?  243  TRP A CD2 1 
ATOM   731  N NE1 . TRP A 1 110 ? 0.490   28.763  38.260  1.00 64.35  ?  243  TRP A NE1 1 
ATOM   732  C CE2 . TRP A 1 110 ? 0.365   28.591  36.907  1.00 64.71  ?  243  TRP A CE2 1 
ATOM   733  C CE3 . TRP A 1 110 ? 1.808   28.213  35.011  1.00 74.00  ?  243  TRP A CE3 1 
ATOM   734  C CZ2 . TRP A 1 110 ? -0.773  28.588  36.100  1.00 67.06  ?  243  TRP A CZ2 1 
ATOM   735  C CZ3 . TRP A 1 110 ? 0.680   28.204  34.212  1.00 67.93  ?  243  TRP A CZ3 1 
ATOM   736  C CH2 . TRP A 1 110 ? -0.594  28.393  34.759  1.00 60.92  ?  243  TRP A CH2 1 
ATOM   737  N N   . LEU A 1 111 ? 6.953   26.593  37.231  1.00 66.44  ?  244  LEU A N   1 
ATOM   738  C CA  . LEU A 1 111 ? 8.210   26.256  36.571  1.00 58.88  ?  244  LEU A CA  1 
ATOM   739  C C   . LEU A 1 111 ? 8.136   24.874  35.935  1.00 58.43  ?  244  LEU A C   1 
ATOM   740  O O   . LEU A 1 111 ? 8.690   24.649  34.847  1.00 55.64  ?  244  LEU A O   1 
ATOM   741  C CB  . LEU A 1 111 ? 9.357   26.312  37.579  1.00 66.26  ?  244  LEU A CB  1 
ATOM   742  C CG  . LEU A 1 111 ? 10.783  26.124  37.066  1.00 61.51  ?  244  LEU A CG  1 
ATOM   743  C CD1 . LEU A 1 111 ? 11.149  27.207  36.066  1.00 59.25  ?  244  LEU A CD1 1 
ATOM   744  C CD2 . LEU A 1 111 ? 11.768  26.117  38.224  1.00 67.81  ?  244  LEU A CD2 1 
ATOM   745  N N   . LEU A 1 112 ? 7.427   23.947  36.581  1.00 56.01  ?  245  LEU A N   1 
ATOM   746  C CA  . LEU A 1 112 ? 7.256   22.623  35.996  1.00 40.39  ?  245  LEU A CA  1 
ATOM   747  C C   . LEU A 1 112 ? 6.492   22.703  34.679  1.00 40.87  ?  245  LEU A C   1 
ATOM   748  O O   . LEU A 1 112 ? 6.885   22.082  33.685  1.00 41.71  ?  245  LEU A O   1 
ATOM   749  C CB  . LEU A 1 112 ? 6.534   21.697  36.971  1.00 49.40  ?  245  LEU A CB  1 
ATOM   750  C CG  . LEU A 1 112 ? 6.248   20.306  36.396  1.00 45.56  ?  245  LEU A CG  1 
ATOM   751  C CD1 . LEU A 1 112 ? 7.520   19.678  35.845  1.00 43.79  ?  245  LEU A CD1 1 
ATOM   752  C CD2 . LEU A 1 112 ? 5.607   19.388  37.425  1.00 42.97  ?  245  LEU A CD2 1 
ATOM   753  N N   . VAL A 1 113 ? 5.387   23.451  34.654  1.00 43.41  ?  246  VAL A N   1 
ATOM   754  C CA  . VAL A 1 113 ? 4.646   23.551  33.396  1.00 54.18  ?  246  VAL A CA  1 
ATOM   755  C C   . VAL A 1 113 ? 5.435   24.364  32.378  1.00 51.96  ?  246  VAL A C   1 
ATOM   756  O O   . VAL A 1 113 ? 5.296   24.150  31.170  1.00 42.30  ?  246  VAL A O   1 
ATOM   757  C CB  . VAL A 1 113 ? 3.230   24.129  33.592  1.00 53.91  ?  246  VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 113 ? 2.522   23.466  34.765  1.00 58.71  ?  246  VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 113 ? 3.282   25.619  33.750  1.00 54.33  ?  246  VAL A CG2 1 
ATOM   760  N N   . GLU A 1 114 ? 6.291   25.283  32.837  1.00 57.30  ?  247  GLU A N   1 
ATOM   761  C CA  . GLU A 1 114 ? 7.182   25.979  31.917  1.00 57.72  ?  247  GLU A CA  1 
ATOM   762  C C   . GLU A 1 114 ? 8.060   24.977  31.178  1.00 59.11  ?  247  GLU A C   1 
ATOM   763  O O   . GLU A 1 114 ? 8.145   24.998  29.939  1.00 58.63  ?  247  GLU A O   1 
ATOM   764  C CB  . GLU A 1 114 ? 8.023   26.996  32.700  1.00 65.86  ?  247  GLU A CB  1 
ATOM   765  C CG  . GLU A 1 114 ? 8.748   28.052  31.873  1.00 85.30  ?  247  GLU A CG  1 
ATOM   766  C CD  . GLU A 1 114 ? 7.811   29.034  31.181  1.00 87.11  ?  247  GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 114 ? 7.099   29.788  31.878  1.00 79.87  ?  247  GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 114 ? 7.791   29.050  29.930  1.00 110.39 -1 247  GLU A OE2 1 
ATOM   769  N N   . GLY A 1 115 ? 8.629   24.025  31.916  1.00 51.74  ?  248  GLY A N   1 
ATOM   770  C CA  . GLY A 1 115 ? 9.456   22.997  31.309  1.00 50.08  ?  248  GLY A CA  1 
ATOM   771  C C   . GLY A 1 115 ? 8.686   22.042  30.413  1.00 51.68  ?  248  GLY A C   1 
ATOM   772  O O   . GLY A 1 115 ? 9.160   21.666  29.333  1.00 52.26  ?  248  GLY A O   1 
ATOM   773  N N   . VAL A 1 116 ? 7.483   21.652  30.848  1.00 54.83  ?  249  VAL A N   1 
ATOM   774  C CA  . VAL A 1 116 ? 6.655   20.740  30.054  1.00 52.73  ?  249  VAL A CA  1 
ATOM   775  C C   . VAL A 1 116 ? 6.275   21.390  28.729  1.00 49.79  ?  249  VAL A C   1 
ATOM   776  O O   . VAL A 1 116 ? 6.335   20.762  27.660  1.00 55.25  ?  249  VAL A O   1 
ATOM   777  C CB  . VAL A 1 116 ? 5.406   20.316  30.852  1.00 47.94  ?  249  VAL A CB  1 
ATOM   778  C CG1 . VAL A 1 116 ? 4.475   19.457  29.996  1.00 36.47  ?  249  VAL A CG1 1 
ATOM   779  C CG2 . VAL A 1 116 ? 5.812   19.570  32.112  1.00 45.94  ?  249  VAL A CG2 1 
ATOM   780  N N   . TYR A 1 117 ? 5.848   22.652  28.789  1.00 43.98  ?  250  TYR A N   1 
ATOM   781  C CA  . TYR A 1 117 ? 5.526   23.404  27.585  1.00 53.01  ?  250  TYR A CA  1 
ATOM   782  C C   . TYR A 1 117 ? 6.730   23.497  26.660  1.00 59.55  ?  250  TYR A C   1 
ATOM   783  O O   . TYR A 1 117 ? 6.598   23.364  25.439  1.00 62.46  ?  250  TYR A O   1 
ATOM   784  C CB  . TYR A 1 117 ? 5.028   24.797  27.967  1.00 47.69  ?  250  TYR A CB  1 
ATOM   785  C CG  . TYR A 1 117 ? 4.822   25.708  26.790  1.00 57.84  ?  250  TYR A CG  1 
ATOM   786  C CD1 . TYR A 1 117 ? 3.697   25.588  25.989  1.00 54.47  ?  250  TYR A CD1 1 
ATOM   787  C CD2 . TYR A 1 117 ? 5.752   26.687  26.476  1.00 57.23  ?  250  TYR A CD2 1 
ATOM   788  C CE1 . TYR A 1 117 ? 3.502   26.415  24.905  1.00 57.64  ?  250  TYR A CE1 1 
ATOM   789  C CE2 . TYR A 1 117 ? 5.567   27.519  25.394  1.00 51.79  ?  250  TYR A CE2 1 
ATOM   790  C CZ  . TYR A 1 117 ? 4.441   27.380  24.611  1.00 58.96  ?  250  TYR A CZ  1 
ATOM   791  O OH  . TYR A 1 117 ? 4.258   28.211  23.533  1.00 71.95  ?  250  TYR A OH  1 
ATOM   792  N N   . LEU A 1 118 ? 7.914   23.750  27.224  1.00 63.33  ?  251  LEU A N   1 
ATOM   793  C CA  . LEU A 1 118 ? 9.118   23.787  26.396  1.00 60.83  ?  251  LEU A CA  1 
ATOM   794  C C   . LEU A 1 118 ? 9.339   22.458  25.683  1.00 56.77  ?  251  LEU A C   1 
ATOM   795  O O   . LEU A 1 118 ? 9.655   22.424  24.483  1.00 44.10  ?  251  LEU A O   1 
ATOM   796  C CB  . LEU A 1 118 ? 10.334  24.135  27.253  1.00 55.39  ?  251  LEU A CB  1 
ATOM   797  C CG  . LEU A 1 118 ? 11.693  24.160  26.554  1.00 47.35  ?  251  LEU A CG  1 
ATOM   798  C CD1 . LEU A 1 118 ? 11.758  25.256  25.495  1.00 36.43  ?  251  LEU A CD1 1 
ATOM   799  C CD2 . LEU A 1 118 ? 12.808  24.328  27.575  1.00 50.30  ?  251  LEU A CD2 1 
ATOM   800  N N   . TYR A 1 119 ? 9.172   21.350  26.411  1.00 53.87  ?  252  TYR A N   1 
ATOM   801  C CA  . TYR A 1 119 ? 9.377   20.034  25.814  1.00 56.36  ?  252  TYR A CA  1 
ATOM   802  C C   . TYR A 1 119 ? 8.436   19.824  24.634  1.00 64.10  ?  252  TYR A C   1 
ATOM   803  O O   . TYR A 1 119 ? 8.860   19.443  23.533  1.00 79.18  ?  252  TYR A O   1 
ATOM   804  C CB  . TYR A 1 119 ? 9.171   18.939  26.866  1.00 56.24  ?  252  TYR A CB  1 
ATOM   805  C CG  . TYR A 1 119 ? 9.444   17.542  26.350  1.00 60.53  ?  252  TYR A CG  1 
ATOM   806  C CD1 . TYR A 1 119 ? 10.719  16.994  26.419  1.00 64.93  ?  252  TYR A CD1 1 
ATOM   807  C CD2 . TYR A 1 119 ? 8.432   16.775  25.782  1.00 65.62  ?  252  TYR A CD2 1 
ATOM   808  C CE1 . TYR A 1 119 ? 10.979  15.723  25.941  1.00 86.26  ?  252  TYR A CE1 1 
ATOM   809  C CE2 . TYR A 1 119 ? 8.687   15.500  25.301  1.00 77.26  ?  252  TYR A CE2 1 
ATOM   810  C CZ  . TYR A 1 119 ? 9.961   14.983  25.387  1.00 96.01  ?  252  TYR A CZ  1 
ATOM   811  O OH  . TYR A 1 119 ? 10.218  13.723  24.914  1.00 117.60 ?  252  TYR A OH  1 
ATOM   812  N N   . THR A 1 120 ? 7.147   20.078  24.845  1.00 67.74  ?  253  THR A N   1 
ATOM   813  C CA  . THR A 1 120 ? 6.198   19.858  23.757  1.00 72.44  ?  253  THR A CA  1 
ATOM   814  C C   . THR A 1 120 ? 6.418   20.843  22.615  1.00 69.59  ?  253  THR A C   1 
ATOM   815  O O   . THR A 1 120 ? 6.129   20.523  21.455  1.00 67.38  ?  253  THR A O   1 
ATOM   816  C CB  . THR A 1 120 ? 4.760   19.947  24.271  1.00 77.52  ?  253  THR A CB  1 
ATOM   817  O OG1 . THR A 1 120 ? 4.540   21.223  24.883  1.00 95.77  ?  253  THR A OG1 1 
ATOM   818  C CG2 . THR A 1 120 ? 4.489   18.842  25.288  1.00 77.11  ?  253  THR A CG2 1 
ATOM   819  N N   . LEU A 1 121 ? 6.929   22.037  22.919  1.00 66.06  ?  254  LEU A N   1 
ATOM   820  C CA  . LEU A 1 121 ? 7.287   22.978  21.867  1.00 56.13  ?  254  LEU A CA  1 
ATOM   821  C C   . LEU A 1 121 ? 8.406   22.423  21.001  1.00 58.77  ?  254  LEU A C   1 
ATOM   822  O O   . LEU A 1 121 ? 8.415   22.629  19.781  1.00 59.53  ?  254  LEU A O   1 
ATOM   823  C CB  . LEU A 1 121 ? 7.702   24.312  22.485  1.00 60.92  ?  254  LEU A CB  1 
ATOM   824  C CG  . LEU A 1 121 ? 7.765   25.524  21.556  1.00 63.87  ?  254  LEU A CG  1 
ATOM   825  C CD1 . LEU A 1 121 ? 6.392   25.829  20.985  1.00 69.59  ?  254  LEU A CD1 1 
ATOM   826  C CD2 . LEU A 1 121 ? 8.312   26.726  22.301  1.00 59.55  ?  254  LEU A CD2 1 
ATOM   827  N N   . LEU A 1 122 ? 9.351   21.706  21.610  1.00 67.22  ?  255  LEU A N   1 
ATOM   828  C CA  . LEU A 1 122 ? 10.382  21.041  20.823  1.00 57.06  ?  255  LEU A CA  1 
ATOM   829  C C   . LEU A 1 122 ? 9.861   19.807  20.094  1.00 57.71  ?  255  LEU A C   1 
ATOM   830  O O   . LEU A 1 122 ? 10.462  19.390  19.098  1.00 63.62  ?  255  LEU A O   1 
ATOM   831  C CB  . LEU A 1 122 ? 11.559  20.655  21.715  1.00 52.09  ?  255  LEU A CB  1 
ATOM   832  C CG  . LEU A 1 122 ? 12.261  21.826  22.401  1.00 50.22  ?  255  LEU A CG  1 
ATOM   833  C CD1 . LEU A 1 122 ? 13.099  21.311  23.550  1.00 56.54  ?  255  LEU A CD1 1 
ATOM   834  C CD2 . LEU A 1 122 ? 13.123  22.602  21.415  1.00 36.49  ?  255  LEU A CD2 1 
ATOM   835  N N   . ALA A 1 123 ? 8.757   19.221  20.549  1.00 55.83  ?  256  ALA A N   1 
ATOM   836  C CA  . ALA A 1 123 ? 8.250   18.023  19.891  1.00 61.53  ?  256  ALA A CA  1 
ATOM   837  C C   . ALA A 1 123 ? 7.316   18.309  18.714  1.00 68.74  ?  256  ALA A C   1 
ATOM   838  O O   . ALA A 1 123 ? 7.033   17.388  17.939  1.00 59.24  ?  256  ALA A O   1 
ATOM   839  C CB  . ALA A 1 123 ? 7.534   17.129  20.906  1.00 73.14  ?  256  ALA A CB  1 
ATOM   840  N N   . PHE A 1 124 ? 6.827   19.537  18.550  1.00 62.93  ?  257  PHE A N   1 
ATOM   841  C CA  . PHE A 1 124 ? 5.938   19.845  17.437  1.00 54.41  ?  257  PHE A CA  1 
ATOM   842  C C   . PHE A 1 124 ? 6.744   20.339  16.242  1.00 62.05  ?  257  PHE A C   1 
ATOM   843  O O   . PHE A 1 124 ? 7.784   20.987  16.396  1.00 76.24  ?  257  PHE A O   1 
ATOM   844  C CB  . PHE A 1 124 ? 4.894   20.890  17.837  1.00 55.29  ?  257  PHE A CB  1 
ATOM   845  C CG  . PHE A 1 124 ? 3.622   20.824  17.025  1.00 66.31  ?  257  PHE A CG  1 
ATOM   846  C CD1 . PHE A 1 124 ? 2.633   19.904  17.341  1.00 63.41  ?  257  PHE A CD1 1 
ATOM   847  C CD2 . PHE A 1 124 ? 3.409   21.684  15.958  1.00 66.20  ?  257  PHE A CD2 1 
ATOM   848  C CE1 . PHE A 1 124 ? 1.459   19.836  16.606  1.00 54.06  ?  257  PHE A CE1 1 
ATOM   849  C CE2 . PHE A 1 124 ? 2.232   21.621  15.214  1.00 60.94  ?  257  PHE A CE2 1 
ATOM   850  C CZ  . PHE A 1 124 ? 1.256   20.695  15.542  1.00 70.12  ?  257  PHE A CZ  1 
ATOM   851  N N   . ASN A 1 125 ? 6.263   20.015  15.044  1.00 68.38  ?  1001 ASN A N   1 
ATOM   852  C CA  . ASN A 1 125 ? 6.957   20.388  13.813  1.00 56.27  ?  1001 ASN A CA  1 
ATOM   853  C C   . ASN A 1 125 ? 5.989   20.290  12.635  1.00 60.69  ?  1001 ASN A C   1 
ATOM   854  O O   . ASN A 1 125 ? 4.779   20.109  12.810  1.00 53.07  ?  1001 ASN A O   1 
ATOM   855  C CB  . ASN A 1 125 ? 8.201   19.516  13.604  1.00 56.14  ?  1001 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 125 ? 7.890   18.028  13.633  1.00 65.85  ?  1001 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 125 ? 6.815   17.590  13.217  1.00 93.07  ?  1001 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 125 ? 8.840   17.242  14.122  1.00 78.71  ?  1001 ASN A ND2 1 
ATOM   859  N N   . ILE A 1 126 ? 6.540   20.407  11.422  1.00 55.33  ?  1002 ILE A N   1 
ATOM   860  C CA  . ILE A 1 126 ? 5.724   20.376  10.211  1.00 56.03  ?  1002 ILE A CA  1 
ATOM   861  C C   . ILE A 1 126 ? 5.075   19.011  10.036  1.00 55.30  ?  1002 ILE A C   1 
ATOM   862  O O   . ILE A 1 126 ? 3.958   18.905  9.519   1.00 55.89  ?  1002 ILE A O   1 
ATOM   863  C CB  . ILE A 1 126 ? 6.570   20.763  8.981   1.00 55.76  ?  1002 ILE A CB  1 
ATOM   864  C CG1 . ILE A 1 126 ? 5.730   20.705  7.700   1.00 55.61  ?  1002 ILE A CG1 1 
ATOM   865  C CG2 . ILE A 1 126 ? 7.803   19.877  8.864   1.00 56.11  ?  1002 ILE A CG2 1 
ATOM   866  C CD1 . ILE A 1 126 ? 4.611   21.719  7.658   1.00 47.27  ?  1002 ILE A CD1 1 
ATOM   867  N N   . PHE A 1 127 ? 5.761   17.945  10.450  1.00 60.54  ?  1003 PHE A N   1 
ATOM   868  C CA  . PHE A 1 127 ? 5.186   16.615  10.285  1.00 67.32  ?  1003 PHE A CA  1 
ATOM   869  C C   . PHE A 1 127 ? 3.912   16.470  11.106  1.00 72.29  ?  1003 PHE A C   1 
ATOM   870  O O   . PHE A 1 127 ? 2.899   15.967  10.608  1.00 80.38  ?  1003 PHE A O   1 
ATOM   871  C CB  . PHE A 1 127 ? 6.220   15.548  10.652  1.00 69.46  ?  1003 PHE A CB  1 
ATOM   872  C CG  . PHE A 1 127 ? 7.450   15.578  9.779   1.00 73.97  ?  1003 PHE A CG  1 
ATOM   873  C CD1 . PHE A 1 127 ? 7.486   14.892  8.573   1.00 75.64  ?  1003 PHE A CD1 1 
ATOM   874  C CD2 . PHE A 1 127 ? 8.568   16.303  10.161  1.00 58.82  ?  1003 PHE A CD2 1 
ATOM   875  C CE1 . PHE A 1 127 ? 8.617   14.927  7.767   1.00 71.98  ?  1003 PHE A CE1 1 
ATOM   876  C CE2 . PHE A 1 127 ? 9.699   16.342  9.361   1.00 54.42  ?  1003 PHE A CE2 1 
ATOM   877  C CZ  . PHE A 1 127 ? 9.724   15.653  8.164   1.00 59.05  ?  1003 PHE A CZ  1 
ATOM   878  N N   . GLU A 1 128 ? 3.910   16.994  12.332  1.00 71.34  ?  1004 GLU A N   1 
ATOM   879  C CA  . GLU A 1 128 ? 2.712   16.912  13.159  1.00 80.92  ?  1004 GLU A CA  1 
ATOM   880  C C   . GLU A 1 128 ? 1.638   17.891  12.692  1.00 80.15  ?  1004 GLU A C   1 
ATOM   881  O O   . GLU A 1 128 ? 0.449   17.541  12.665  1.00 74.72  ?  1004 GLU A O   1 
ATOM   882  C CB  . GLU A 1 128 ? 3.084   17.160  14.623  1.00 86.36  ?  1004 GLU A CB  1 
ATOM   883  C CG  . GLU A 1 128 ? 4.297   16.354  15.080  1.00 89.22  ?  1004 GLU A CG  1 
ATOM   884  C CD  . GLU A 1 128 ? 4.113   14.858  14.890  1.00 97.76  ?  1004 GLU A CD  1 
ATOM   885  O OE1 . GLU A 1 128 ? 2.987   14.365  15.109  1.00 103.98 ?  1004 GLU A OE1 1 
ATOM   886  O OE2 . GLU A 1 128 ? 5.087   14.174  14.512  1.00 108.67 -1 1004 GLU A OE2 1 
ATOM   887  N N   . MET A 1 129 ? 2.047   19.096  12.288  1.00 78.83  ?  1005 MET A N   1 
ATOM   888  C CA  . MET A 1 129 ? 1.135   20.055  11.668  1.00 65.46  ?  1005 MET A CA  1 
ATOM   889  C C   . MET A 1 129 ? 0.370   19.410  10.515  1.00 68.05  ?  1005 MET A C   1 
ATOM   890  O O   . MET A 1 129 ? -0.868  19.441  10.467  1.00 75.17  ?  1005 MET A O   1 
ATOM   891  C CB  . MET A 1 129 ? 1.947   21.260  11.175  1.00 56.86  ?  1005 MET A CB  1 
ATOM   892  C CG  . MET A 1 129 ? 1.168   22.451  10.639  1.00 51.02  ?  1005 MET A CG  1 
ATOM   893  S SD  . MET A 1 129 ? 2.304   23.722  10.031  1.00 69.48  ?  1005 MET A SD  1 
ATOM   894  C CE  . MET A 1 129 ? 1.199   25.104  9.780   1.00 70.61  ?  1005 MET A CE  1 
ATOM   895  N N   . LEU A 1 130 ? 1.100   18.789  9.587   1.00 67.70  ?  1006 LEU A N   1 
ATOM   896  C CA  . LEU A 1 130 ? 0.474   18.185  8.418   1.00 69.69  ?  1006 LEU A CA  1 
ATOM   897  C C   . LEU A 1 130 ? -0.315  16.932  8.767   1.00 71.72  ?  1006 LEU A C   1 
ATOM   898  O O   . LEU A 1 130 ? -1.333  16.657  8.129   1.00 75.98  ?  1006 LEU A O   1 
ATOM   899  C CB  . LEU A 1 130 ? 1.532   17.861  7.367   1.00 66.53  ?  1006 LEU A CB  1 
ATOM   900  C CG  . LEU A 1 130 ? 2.092   19.029  6.557   1.00 68.44  ?  1006 LEU A CG  1 
ATOM   901  C CD1 . LEU A 1 130 ? 3.192   18.529  5.644   1.00 55.06  ?  1006 LEU A CD1 1 
ATOM   902  C CD2 . LEU A 1 130 ? 0.999   19.717  5.749   1.00 62.35  ?  1006 LEU A CD2 1 
ATOM   903  N N   . ARG A 1 131 ? 0.130   16.147  9.750   1.00 67.03  ?  1007 ARG A N   1 
ATOM   904  C CA  . ARG A 1 131 ? -0.679  15.003  10.148  1.00 61.10  ?  1007 ARG A CA  1 
ATOM   905  C C   . ARG A 1 131 ? -1.997  15.440  10.769  1.00 61.52  ?  1007 ARG A C   1 
ATOM   906  O O   . ARG A 1 131 ? -2.985  14.701  10.695  1.00 63.47  ?  1007 ARG A O   1 
ATOM   907  C CB  . ARG A 1 131 ? 0.095   14.112  11.120  1.00 55.32  ?  1007 ARG A CB  1 
ATOM   908  N N   . ILE A 1 132 ? -2.044  16.631  11.358  1.00 62.35  ?  1008 ILE A N   1 
ATOM   909  C CA  . ILE A 1 132 ? -3.327  17.142  11.824  1.00 57.67  ?  1008 ILE A CA  1 
ATOM   910  C C   . ILE A 1 132 ? -4.169  17.616  10.645  1.00 60.53  ?  1008 ILE A C   1 
ATOM   911  O O   . ILE A 1 132 ? -5.352  17.280  10.536  1.00 65.79  ?  1008 ILE A O   1 
ATOM   912  C CB  . ILE A 1 132 ? -3.139  18.264  12.864  1.00 59.19  ?  1008 ILE A CB  1 
ATOM   913  C CG1 . ILE A 1 132 ? -2.378  17.753  14.083  1.00 62.73  ?  1008 ILE A CG1 1 
ATOM   914  C CG2 . ILE A 1 132 ? -4.495  18.784  13.311  1.00 51.74  ?  1008 ILE A CG2 1 
ATOM   915  C CD1 . ILE A 1 132 ? -3.060  16.608  14.789  1.00 76.39  ?  1008 ILE A CD1 1 
ATOM   916  N N   . ASP A 1 133 ? -3.574  18.394  9.739   1.00 63.21  ?  1009 ASP A N   1 
ATOM   917  C CA  . ASP A 1 133 ? -4.368  19.041  8.693   1.00 62.49  ?  1009 ASP A CA  1 
ATOM   918  C C   . ASP A 1 133 ? -4.838  18.051  7.628   1.00 68.32  ?  1009 ASP A C   1 
ATOM   919  O O   . ASP A 1 133 ? -6.005  18.078  7.218   1.00 97.56  ?  1009 ASP A O   1 
ATOM   920  C CB  . ASP A 1 133 ? -3.566  20.174  8.062   1.00 68.14  ?  1009 ASP A CB  1 
ATOM   921  C CG  . ASP A 1 133 ? -3.428  21.357  8.986   1.00 81.27  ?  1009 ASP A CG  1 
ATOM   922  O OD1 . ASP A 1 133 ? -4.222  21.464  9.945   1.00 67.80  ?  1009 ASP A OD1 1 
ATOM   923  O OD2 . ASP A 1 133 ? -2.536  22.193  8.749   1.00 89.23  -1 1009 ASP A OD2 1 
ATOM   924  N N   . GLU A 1 134 ? -3.944  17.178  7.164   1.00 73.84  ?  1010 GLU A N   1 
ATOM   925  C CA  . GLU A 1 134 ? -4.196  16.310  6.018   1.00 68.95  ?  1010 GLU A CA  1 
ATOM   926  C C   . GLU A 1 134 ? -4.877  14.994  6.373   1.00 78.11  ?  1010 GLU A C   1 
ATOM   927  O O   . GLU A 1 134 ? -5.455  14.356  5.484   1.00 100.17 ?  1010 GLU A O   1 
ATOM   928  C CB  . GLU A 1 134 ? -2.881  16.001  5.289   1.00 78.82  ?  1010 GLU A CB  1 
ATOM   929  C CG  . GLU A 1 134 ? -2.215  17.210  4.661   1.00 95.65  ?  1010 GLU A CG  1 
ATOM   930  C CD  . GLU A 1 134 ? -2.921  17.685  3.404   1.00 97.75  ?  1010 GLU A CD  1 
ATOM   931  O OE1 . GLU A 1 134 ? -3.818  16.967  2.912   1.00 113.38 ?  1010 GLU A OE1 1 
ATOM   932  O OE2 . GLU A 1 134 ? -2.581  18.778  2.907   1.00 110.38 -1 1010 GLU A OE2 1 
ATOM   933  N N   . GLY A 1 135 ? -4.804  14.558  7.628   1.00 81.75  ?  1011 GLY A N   1 
ATOM   934  C CA  . GLY A 1 135 ? -5.418  13.312  8.034   1.00 61.21  ?  1011 GLY A CA  1 
ATOM   935  C C   . GLY A 1 135 ? -4.615  12.103  7.595   1.00 64.03  ?  1011 GLY A C   1 
ATOM   936  O O   . GLY A 1 135 ? -3.594  12.198  6.913   1.00 66.90  ?  1011 GLY A O   1 
ATOM   937  N N   . LEU A 1 136 ? -5.091  10.933  8.014   1.00 76.64  ?  1012 LEU A N   1 
ATOM   938  C CA  . LEU A 1 136 ? -4.488  9.658   7.649   1.00 82.41  ?  1012 LEU A CA  1 
ATOM   939  C C   . LEU A 1 136 ? -5.524  8.761   6.987   1.00 82.01  ?  1012 LEU A C   1 
ATOM   940  O O   . LEU A 1 136 ? -6.628  8.581   7.514   1.00 83.33  ?  1012 LEU A O   1 
ATOM   941  C CB  . LEU A 1 136 ? -3.892  8.958   8.874   1.00 86.58  ?  1012 LEU A CB  1 
ATOM   942  C CG  . LEU A 1 136 ? -3.250  7.596   8.594   1.00 95.45  ?  1012 LEU A CG  1 
ATOM   943  C CD1 . LEU A 1 136 ? -2.118  7.735   7.585   1.00 94.54  ?  1012 LEU A CD1 1 
ATOM   944  C CD2 . LEU A 1 136 ? -2.756  6.949   9.882   1.00 94.07  ?  1012 LEU A CD2 1 
ATOM   945  N N   . ARG A 1 137 ? -5.159  8.191   5.842   1.00 72.56  ?  1013 ARG A N   1 
ATOM   946  C CA  . ARG A 1 137 ? -6.011  7.266   5.109   1.00 78.21  ?  1013 ARG A CA  1 
ATOM   947  C C   . ARG A 1 137 ? -5.322  5.915   4.999   1.00 81.50  ?  1013 ARG A C   1 
ATOM   948  O O   . ARG A 1 137 ? -4.121  5.839   4.718   1.00 82.07  ?  1013 ARG A O   1 
ATOM   949  C CB  . ARG A 1 137 ? -6.335  7.784   3.705   1.00 84.83  ?  1013 ARG A CB  1 
ATOM   950  C CG  . ARG A 1 137 ? -7.368  8.885   3.661   1.00 84.38  ?  1013 ARG A CG  1 
ATOM   951  C CD  . ARG A 1 137 ? -7.818  9.129   2.235   1.00 74.28  ?  1013 ARG A CD  1 
ATOM   952  N NE  . ARG A 1 137 ? -8.638  10.330  2.125   1.00 66.78  ?  1013 ARG A NE  1 
ATOM   953  C CZ  . ARG A 1 137 ? -9.948  10.365  2.348   1.00 68.15  ?  1013 ARG A CZ  1 
ATOM   954  N NH1 . ARG A 1 137 ? -10.592 9.260   2.698   1.00 66.89  ?  1013 ARG A NH1 1 
ATOM   955  N NH2 . ARG A 1 137 ? -10.614 11.505  2.224   1.00 82.05  ?  1013 ARG A NH2 1 
ATOM   956  N N   . LEU A 1 138 ? -6.091  4.849   5.210   1.00 87.37  ?  1014 LEU A N   1 
ATOM   957  C CA  . LEU A 1 138 ? -5.562  3.496   5.098   1.00 104.75 ?  1014 LEU A CA  1 
ATOM   958  C C   . LEU A 1 138 ? -5.774  2.911   3.705   1.00 112.78 ?  1014 LEU A C   1 
ATOM   959  O O   . LEU A 1 138 ? -4.917  2.175   3.204   1.00 101.15 ?  1014 LEU A O   1 
ATOM   960  C CB  . LEU A 1 138 ? -6.210  2.588   6.148   1.00 121.58 ?  1014 LEU A CB  1 
ATOM   961  C CG  . LEU A 1 138 ? -5.410  1.361   6.597   1.00 144.75 ?  1014 LEU A CG  1 
ATOM   962  C CD1 . LEU A 1 138 ? -4.221  1.785   7.441   1.00 142.05 ?  1014 LEU A CD1 1 
ATOM   963  C CD2 . LEU A 1 138 ? -6.295  0.394   7.366   1.00 163.73 ?  1014 LEU A CD2 1 
ATOM   964  N N   . LYS A 1 139 ? -6.900  3.221   3.069   1.00 130.79 ?  1015 LYS A N   1 
ATOM   965  C CA  . LYS A 1 139 ? -7.245  2.700   1.755   1.00 126.17 ?  1015 LYS A CA  1 
ATOM   966  C C   . LYS A 1 139 ? -7.299  3.827   0.730   1.00 120.11 ?  1015 LYS A C   1 
ATOM   967  O O   . LYS A 1 139 ? -7.396  5.008   1.072   1.00 120.94 ?  1015 LYS A O   1 
ATOM   968  C CB  . LYS A 1 139 ? -8.591  1.965   1.796   1.00 107.65 ?  1015 LYS A CB  1 
ATOM   969  C CG  . LYS A 1 139 ? -8.628  0.779   2.747   1.00 115.89 ?  1015 LYS A CG  1 
ATOM   970  C CD  . LYS A 1 139 ? -10.034 0.209   2.870   1.00 131.44 ?  1015 LYS A CD  1 
ATOM   971  C CE  . LYS A 1 139 ? -10.062 -0.991  3.805   1.00 130.23 ?  1015 LYS A CE  1 
ATOM   972  N NZ  . LYS A 1 139 ? -11.448 -1.361  4.211   1.00 123.76 ?  1015 LYS A NZ  1 
ATOM   973  N N   . ILE A 1 140 ? -7.229  3.440   -0.546  1.00 117.54 ?  1016 ILE A N   1 
ATOM   974  C CA  . ILE A 1 140 ? -7.318  4.420   -1.622  1.00 113.62 ?  1016 ILE A CA  1 
ATOM   975  C C   . ILE A 1 140 ? -8.704  5.051   -1.622  1.00 115.01 ?  1016 ILE A C   1 
ATOM   976  O O   . ILE A 1 140 ? -9.720  4.373   -1.421  1.00 109.76 ?  1016 ILE A O   1 
ATOM   977  C CB  . ILE A 1 140 ? -7.002  3.771   -2.981  1.00 104.38 ?  1016 ILE A CB  1 
ATOM   978  C CG1 . ILE A 1 140 ? -5.600  3.157   -2.976  1.00 102.13 ?  1016 ILE A CG1 1 
ATOM   979  C CG2 . ILE A 1 140 ? -7.121  4.791   -4.110  1.00 115.51 ?  1016 ILE A CG2 1 
ATOM   980  C CD1 . ILE A 1 140 ? -5.084  2.810   -4.360  1.00 85.74  ?  1016 ILE A CD1 1 
ATOM   981  N N   . TYR A 1 141 ? -8.750  6.362   -1.846  1.00 106.19 ?  1017 TYR A N   1 
ATOM   982  C CA  . TYR A 1 141 ? -10.000 7.106   -1.879  1.00 97.96  ?  1017 TYR A CA  1 
ATOM   983  C C   . TYR A 1 141 ? -9.946  8.148   -2.987  1.00 100.74 ?  1017 TYR A C   1 
ATOM   984  O O   . TYR A 1 141 ? -8.913  8.790   -3.197  1.00 103.36 ?  1017 TYR A O   1 
ATOM   985  C CB  . TYR A 1 141 ? -10.269 7.781   -0.528  1.00 92.26  ?  1017 TYR A CB  1 
ATOM   986  C CG  . TYR A 1 141 ? -11.564 8.557   -0.454  1.00 91.80  ?  1017 TYR A CG  1 
ATOM   987  C CD1 . TYR A 1 141 ? -12.776 7.910   -0.244  1.00 92.03  ?  1017 TYR A CD1 1 
ATOM   988  C CD2 . TYR A 1 141 ? -11.573 9.941   -0.575  1.00 98.52  ?  1017 TYR A CD2 1 
ATOM   989  C CE1 . TYR A 1 141 ? -13.962 8.621   -0.170  1.00 93.25  ?  1017 TYR A CE1 1 
ATOM   990  C CE2 . TYR A 1 141 ? -12.752 10.657  -0.501  1.00 91.02  ?  1017 TYR A CE2 1 
ATOM   991  C CZ  . TYR A 1 141 ? -13.943 9.994   -0.298  1.00 95.49  ?  1017 TYR A CZ  1 
ATOM   992  O OH  . TYR A 1 141 ? -15.120 10.706  -0.225  1.00 94.72  ?  1017 TYR A OH  1 
ATOM   993  N N   . LYS A 1 142 ? -11.065 8.313   -3.690  1.00 92.18  ?  1018 LYS A N   1 
ATOM   994  C CA  . LYS A 1 142 ? -11.186 9.309   -4.751  1.00 78.44  ?  1018 LYS A CA  1 
ATOM   995  C C   . LYS A 1 142 ? -11.738 10.594  -4.141  1.00 77.75  ?  1018 LYS A C   1 
ATOM   996  O O   . LYS A 1 142 ? -12.900 10.642  -3.726  1.00 71.25  ?  1018 LYS A O   1 
ATOM   997  C CB  . LYS A 1 142 ? -12.082 8.796   -5.876  1.00 93.04  ?  1018 LYS A CB  1 
ATOM   998  N N   . ASP A 1 143 ? -10.908 11.633  -4.094  1.00 91.29  ?  1019 ASP A N   1 
ATOM   999  C CA  . ASP A 1 143 ? -11.252 12.874  -3.420  1.00 110.72 ?  1019 ASP A CA  1 
ATOM   1000 C C   . ASP A 1 143 ? -12.151 13.748  -4.301  1.00 111.54 ?  1019 ASP A C   1 
ATOM   1001 O O   . ASP A 1 143 ? -12.382 13.468  -5.482  1.00 100.25 ?  1019 ASP A O   1 
ATOM   1002 C CB  . ASP A 1 143 ? -9.977  13.619  -3.018  1.00 111.77 ?  1019 ASP A CB  1 
ATOM   1003 C CG  . ASP A 1 143 ? -10.184 14.529  -1.825  1.00 121.38 ?  1019 ASP A CG  1 
ATOM   1004 O OD1 . ASP A 1 143 ? -11.346 14.715  -1.411  1.00 128.71 ?  1019 ASP A OD1 1 
ATOM   1005 O OD2 . ASP A 1 143 ? -9.184  15.055  -1.293  1.00 120.98 -1 1019 ASP A OD2 1 
ATOM   1006 N N   . THR A 1 144 ? -12.663 14.826  -3.694  1.00 120.98 ?  1020 THR A N   1 
ATOM   1007 C CA  . THR A 1 144 ? -13.667 15.666  -4.343  1.00 94.66  ?  1020 THR A CA  1 
ATOM   1008 C C   . THR A 1 144 ? -13.182 16.238  -5.670  1.00 95.22  ?  1020 THR A C   1 
ATOM   1009 O O   . THR A 1 144 ? -13.992 16.488  -6.571  1.00 102.63 ?  1020 THR A O   1 
ATOM   1010 C CB  . THR A 1 144 ? -14.086 16.800  -3.404  1.00 75.86  ?  1020 THR A CB  1 
ATOM   1011 N N   . GLU A 1 145 ? -11.879 16.449  -5.816  1.00 96.65  ?  1021 GLU A N   1 
ATOM   1012 C CA  . GLU A 1 145 ? -11.341 17.105  -6.999  1.00 90.20  ?  1021 GLU A CA  1 
ATOM   1013 C C   . GLU A 1 145 ? -11.078 16.143  -8.151  1.00 74.21  ?  1021 GLU A C   1 
ATOM   1014 O O   . GLU A 1 145 ? -10.745 16.595  -9.254  1.00 87.30  ?  1021 GLU A O   1 
ATOM   1015 C CB  . GLU A 1 145 ? -10.043 17.842  -6.649  1.00 92.63  ?  1021 GLU A CB  1 
ATOM   1016 C CG  . GLU A 1 145 ? -10.141 18.745  -5.433  1.00 103.66 ?  1021 GLU A CG  1 
ATOM   1017 C CD  . GLU A 1 145 ? -9.978  17.989  -4.132  1.00 116.28 ?  1021 GLU A CD  1 
ATOM   1018 O OE1 . GLU A 1 145 ? -9.300  16.941  -4.137  1.00 124.53 ?  1021 GLU A OE1 1 
ATOM   1019 O OE2 . GLU A 1 145 ? -10.548 18.423  -3.112  1.00 109.56 -1 1021 GLU A OE2 1 
ATOM   1020 N N   . GLY A 1 146 ? -11.223 14.839  -7.929  1.00 75.33  ?  1022 GLY A N   1 
ATOM   1021 C CA  . GLY A 1 146 ? -10.944 13.840  -8.934  1.00 72.41  ?  1022 GLY A CA  1 
ATOM   1022 C C   . GLY A 1 146 ? -9.639  13.102  -8.737  1.00 88.93  ?  1022 GLY A C   1 
ATOM   1023 O O   . GLY A 1 146 ? -9.355  12.167  -9.497  1.00 100.60 ?  1022 GLY A O   1 
ATOM   1024 N N   . TYR A 1 147 ? -8.838  13.498  -7.751  1.00 97.95  ?  1023 TYR A N   1 
ATOM   1025 C CA  . TYR A 1 147 ? -7.558  12.860  -7.483  1.00 97.21  ?  1023 TYR A CA  1 
ATOM   1026 C C   . TYR A 1 147 ? -7.729  11.705  -6.502  1.00 89.70  ?  1023 TYR A C   1 
ATOM   1027 O O   . TYR A 1 147 ? -8.493  11.802  -5.538  1.00 89.04  ?  1023 TYR A O   1 
ATOM   1028 C CB  . TYR A 1 147 ? -6.554  13.870  -6.916  1.00 108.61 ?  1023 TYR A CB  1 
ATOM   1029 C CG  . TYR A 1 147 ? -6.241  15.055  -7.812  1.00 118.95 ?  1023 TYR A CG  1 
ATOM   1030 C CD1 . TYR A 1 147 ? -5.179  15.012  -8.707  1.00 122.13 ?  1023 TYR A CD1 1 
ATOM   1031 C CD2 . TYR A 1 147 ? -6.990  16.226  -7.743  1.00 132.34 ?  1023 TYR A CD2 1 
ATOM   1032 C CE1 . TYR A 1 147 ? -4.880  16.094  -9.519  1.00 119.52 ?  1023 TYR A CE1 1 
ATOM   1033 C CE2 . TYR A 1 147 ? -6.695  17.314  -8.554  1.00 134.54 ?  1023 TYR A CE2 1 
ATOM   1034 C CZ  . TYR A 1 147 ? -5.640  17.241  -9.438  1.00 131.92 ?  1023 TYR A CZ  1 
ATOM   1035 O OH  . TYR A 1 147 ? -5.347  18.318  -10.244 1.00 144.42 ?  1023 TYR A OH  1 
ATOM   1036 N N   . TYR A 1 148 ? -7.014  10.609  -6.758  1.00 83.16  ?  1024 TYR A N   1 
ATOM   1037 C CA  . TYR A 1 148 ? -6.961  9.475   -5.841  1.00 96.27  ?  1024 TYR A CA  1 
ATOM   1038 C C   . TYR A 1 148 ? -5.863  9.708   -4.807  1.00 93.98  ?  1024 TYR A C   1 
ATOM   1039 O O   . TYR A 1 148 ? -4.730  10.044  -5.164  1.00 96.00  ?  1024 TYR A O   1 
ATOM   1040 C CB  . TYR A 1 148 ? -6.703  8.171   -6.601  1.00 116.69 ?  1024 TYR A CB  1 
ATOM   1041 C CG  . TYR A 1 148 ? -7.895  7.627   -7.363  1.00 134.47 ?  1024 TYR A CG  1 
ATOM   1042 C CD1 . TYR A 1 148 ? -8.821  6.798   -6.740  1.00 138.58 ?  1024 TYR A CD1 1 
ATOM   1043 C CD2 . TYR A 1 148 ? -8.085  7.924   -8.709  1.00 136.18 ?  1024 TYR A CD2 1 
ATOM   1044 C CE1 . TYR A 1 148 ? -9.907  6.291   -7.431  1.00 120.65 ?  1024 TYR A CE1 1 
ATOM   1045 C CE2 . TYR A 1 148 ? -9.171  7.419   -9.409  1.00 126.02 ?  1024 TYR A CE2 1 
ATOM   1046 C CZ  . TYR A 1 148 ? -10.078 6.604   -8.765  1.00 117.58 ?  1024 TYR A CZ  1 
ATOM   1047 O OH  . TYR A 1 148 ? -11.159 6.099   -9.452  1.00 107.40 ?  1024 TYR A OH  1 
ATOM   1048 N N   . THR A 1 149 ? -6.197  9.525   -3.529  1.00 94.44  ?  1025 THR A N   1 
ATOM   1049 C CA  . THR A 1 149 ? -5.290  9.855   -2.439  1.00 89.22  ?  1025 THR A CA  1 
ATOM   1050 C C   . THR A 1 149 ? -5.220  8.708   -1.440  1.00 97.38  ?  1025 THR A C   1 
ATOM   1051 O O   . THR A 1 149 ? -6.107  7.853   -1.378  1.00 110.23 ?  1025 THR A O   1 
ATOM   1052 C CB  . THR A 1 149 ? -5.719  11.137  -1.717  1.00 94.64  ?  1025 THR A CB  1 
ATOM   1053 O OG1 . THR A 1 149 ? -4.784  11.432  -0.672  1.00 109.64 ?  1025 THR A OG1 1 
ATOM   1054 C CG2 . THR A 1 149 ? -7.107  10.967  -1.121  1.00 106.05 ?  1025 THR A CG2 1 
ATOM   1055 N N   . ILE A 1 150 ? -4.136  8.700   -0.663  1.00 94.81  ?  1026 ILE A N   1 
ATOM   1056 C CA  . ILE A 1 150 ? -3.904  7.700   0.374   1.00 99.25  ?  1026 ILE A CA  1 
ATOM   1057 C C   . ILE A 1 150 ? -2.817  8.209   1.315   1.00 121.13 ?  1026 ILE A C   1 
ATOM   1058 O O   . ILE A 1 150 ? -2.059  9.121   0.966   1.00 141.45 ?  1026 ILE A O   1 
ATOM   1059 C CB  . ILE A 1 150 ? -3.525  6.338   -0.237  1.00 99.77  ?  1026 ILE A CB  1 
ATOM   1060 C CG1 . ILE A 1 150 ? -3.765  5.205   0.767   1.00 98.20  ?  1026 ILE A CG1 1 
ATOM   1061 C CG2 . ILE A 1 150 ? -2.084  6.358   -0.724  1.00 84.39  ?  1026 ILE A CG2 1 
ATOM   1062 C CD1 . ILE A 1 150 ? -3.633  3.826   0.168   1.00 106.43 ?  1026 ILE A CD1 1 
ATOM   1063 N N   . GLY A 1 151 ? -2.751  7.646   2.520   1.00 112.88 ?  1027 GLY A N   1 
ATOM   1064 C CA  . GLY A 1 151 ? -1.673  7.990   3.440   1.00 94.17  ?  1027 GLY A CA  1 
ATOM   1065 C C   . GLY A 1 151 ? -1.908  9.341   4.087   1.00 84.81  ?  1027 GLY A C   1 
ATOM   1066 O O   . GLY A 1 151 ? -3.022  9.664   4.513   1.00 98.71  ?  1027 GLY A O   1 
ATOM   1067 N N   . ILE A 1 152 ? -0.852  10.148  4.175   1.00 80.61  ?  1028 ILE A N   1 
ATOM   1068 C CA  . ILE A 1 152 ? -0.993  11.498  4.707   1.00 87.12  ?  1028 ILE A CA  1 
ATOM   1069 C C   . ILE A 1 152 ? -0.904  12.480  3.547   1.00 88.50  ?  1028 ILE A C   1 
ATOM   1070 O O   . ILE A 1 152 ? 0.185   12.944  3.185   1.00 78.92  ?  1028 ILE A O   1 
ATOM   1071 C CB  . ILE A 1 152 ? 0.062   11.812  5.788   1.00 96.87  ?  1028 ILE A CB  1 
ATOM   1072 C CG1 . ILE A 1 152 ? 0.022   10.782  6.920   1.00 111.46 ?  1028 ILE A CG1 1 
ATOM   1073 C CG2 . ILE A 1 152 ? -0.148  13.208  6.360   1.00 92.13  ?  1028 ILE A CG2 1 
ATOM   1074 C CD1 . ILE A 1 152 ? 1.031   9.661   6.770   1.00 123.88 ?  1028 ILE A CD1 1 
ATOM   1075 N N   . GLY A 1 153 ? -2.055  12.803  2.965   1.00 75.82  ?  1029 GLY A N   1 
ATOM   1076 C CA  . GLY A 1 153 ? -2.113  13.770  1.886   1.00 78.22  ?  1029 GLY A CA  1 
ATOM   1077 C C   . GLY A 1 153 ? -1.295  13.417  0.663   1.00 72.85  ?  1029 GLY A C   1 
ATOM   1078 O O   . GLY A 1 153 ? -0.786  14.321  -0.005  1.00 66.12  ?  1029 GLY A O   1 
ATOM   1079 N N   . HIS A 1 154 ? -1.160  12.130  0.339   1.00 65.39  ?  1030 HIS A N   1 
ATOM   1080 C CA  . HIS A 1 154 ? -0.400  11.709  -0.841  1.00 85.52  ?  1030 HIS A CA  1 
ATOM   1081 C C   . HIS A 1 154 ? -1.352  11.531  -2.020  1.00 93.74  ?  1030 HIS A C   1 
ATOM   1082 O O   . HIS A 1 154 ? -2.004  10.495  -2.157  1.00 96.07  ?  1030 HIS A O   1 
ATOM   1083 C CB  . HIS A 1 154 ? 0.385   10.427  -0.578  1.00 87.44  ?  1030 HIS A CB  1 
ATOM   1084 C CG  . HIS A 1 154 ? 1.321   10.070  -1.693  1.00 94.63  ?  1030 HIS A CG  1 
ATOM   1085 N ND1 . HIS A 1 154 ? 2.504   10.741  -1.911  1.00 81.43  ?  1030 HIS A ND1 1 
ATOM   1086 C CD2 . HIS A 1 154 ? 1.234   9.135   -2.670  1.00 87.88  ?  1030 HIS A CD2 1 
ATOM   1087 C CE1 . HIS A 1 154 ? 3.114   10.227  -2.965  1.00 78.99  ?  1030 HIS A CE1 1 
ATOM   1088 N NE2 . HIS A 1 154 ? 2.363   9.253   -3.445  1.00 84.22  ?  1030 HIS A NE2 1 
ATOM   1089 N N   . LEU A 1 155 ? -1.428  12.544  -2.879  1.00 89.24  ?  1031 LEU A N   1 
ATOM   1090 C CA  . LEU A 1 155 ? -2.252  12.473  -4.081  1.00 92.25  ?  1031 LEU A CA  1 
ATOM   1091 C C   . LEU A 1 155 ? -1.518  11.720  -5.184  1.00 82.34  ?  1031 LEU A C   1 
ATOM   1092 O O   . LEU A 1 155 ? -0.322  11.931  -5.402  1.00 77.41  ?  1031 LEU A O   1 
ATOM   1093 C CB  . LEU A 1 155 ? -2.608  13.880  -4.561  1.00 97.18  ?  1031 LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 155 ? -3.754  14.644  -3.885  1.00 93.27  ?  1031 LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 155 ? -3.471  14.929  -2.417  1.00 100.19 ?  1031 LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 155 ? -4.017  15.937  -4.638  1.00 97.49  ?  1031 LEU A CD2 1 
ATOM   1097 N N   . LEU A 1 156 ? -2.228  10.819  -5.874  1.00 95.13  ?  1032 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 156 ? -1.532  10.047  -6.898  1.00 111.98 ?  1032 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 156 ? -1.694  10.581  -8.315  1.00 134.88 ?  1032 LEU A C   1 
ATOM   1100 O O   . LEU A 1 156 ? -0.773  11.206  -8.851  1.00 145.49 ?  1032 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 156 ? -2.021  8.599   -6.863  1.00 108.60 ?  1032 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 156 ? -1.849  7.885   -5.524  1.00 96.92  ?  1032 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 156 ? -2.719  6.644   -5.466  1.00 109.98 ?  1032 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 156 ? -0.391  7.531   -5.320  1.00 91.60  ?  1032 LEU A CD2 1 
ATOM   1105 N N   . THR A 1 157 ? -2.875  10.388  -8.906  1.00 164.29 ?  1033 THR A N   1 
ATOM   1106 C CA  . THR A 1 157 ? -3.159  10.812  -10.271 1.00 180.97 ?  1033 THR A CA  1 
ATOM   1107 C C   . THR A 1 157 ? -4.641  11.117  -10.410 1.00 176.95 ?  1033 THR A C   1 
ATOM   1108 O O   . THR A 1 157 ? -5.491  10.423  -9.845  1.00 165.37 ?  1033 THR A O   1 
ATOM   1109 C CB  . THR A 1 157 ? -2.766  9.750   -11.336 1.00 174.73 ?  1033 THR A CB  1 
ATOM   1110 O OG1 . THR A 1 157 ? -3.292  8.469   -10.969 1.00 157.13 ?  1033 THR A OG1 1 
ATOM   1111 C CG2 . THR A 1 157 ? -1.250  9.661   -11.518 1.00 166.27 ?  1033 THR A CG2 1 
ATOM   1112 N N   . LYS A 1 158 ? -4.943  12.145  -11.200 1.00 162.19 ?  1034 LYS A N   1 
ATOM   1113 C CA  . LYS A 1 158 ? -6.322  12.526  -11.466 1.00 130.20 ?  1034 LYS A CA  1 
ATOM   1114 C C   . LYS A 1 158 ? -7.011  11.581  -12.441 1.00 141.18 ?  1034 LYS A C   1 
ATOM   1115 O O   . LYS A 1 158 ? -8.231  11.679  -12.613 1.00 159.01 ?  1034 LYS A O   1 
ATOM   1116 C CB  . LYS A 1 158 ? -6.361  13.960  -12.002 1.00 103.05 ?  1034 LYS A CB  1 
ATOM   1117 C CG  . LYS A 1 158 ? -7.714  14.642  -11.924 1.00 83.18  ?  1034 LYS A CG  1 
ATOM   1118 C CD  . LYS A 1 158 ? -7.600  16.102  -12.322 1.00 89.49  ?  1034 LYS A CD  1 
ATOM   1119 C CE  . LYS A 1 158 ? -8.914  16.844  -12.140 1.00 108.54 ?  1034 LYS A CE  1 
ATOM   1120 N NZ  . LYS A 1 158 ? -9.870  16.616  -13.262 1.00 112.51 ?  1034 LYS A NZ  1 
ATOM   1121 N N   . SER A 1 159 ? -6.264  10.676  -13.072 1.00 152.51 ?  1035 SER A N   1 
ATOM   1122 C CA  . SER A 1 159 ? -6.814  9.717   -14.017 1.00 142.67 ?  1035 SER A CA  1 
ATOM   1123 C C   . SER A 1 159 ? -7.964  8.940   -13.378 1.00 143.62 ?  1035 SER A C   1 
ATOM   1124 O O   . SER A 1 159 ? -7.745  8.230   -12.386 1.00 107.87 ?  1035 SER A O   1 
ATOM   1125 C CB  . SER A 1 159 ? -5.728  8.754   -14.489 1.00 136.46 ?  1035 SER A CB  1 
ATOM   1126 O OG  . SER A 1 159 ? -4.672  9.449   -15.126 1.00 138.63 ?  1035 SER A OG  1 
ATOM   1127 N N   . PRO A 1 160 ? -9.186  9.051   -13.904 1.00 181.19 ?  1036 PRO A N   1 
ATOM   1128 C CA  . PRO A 1 160 ? -10.321 8.348   -13.290 1.00 180.22 ?  1036 PRO A CA  1 
ATOM   1129 C C   . PRO A 1 160 ? -10.263 6.845   -13.516 1.00 173.84 ?  1036 PRO A C   1 
ATOM   1130 O O   . PRO A 1 160 ? -11.042 6.305   -14.308 1.00 167.47 ?  1036 PRO A O   1 
ATOM   1131 C CB  . PRO A 1 160 ? -11.536 8.979   -13.985 1.00 188.20 ?  1036 PRO A CB  1 
ATOM   1132 C CG  . PRO A 1 160 ? -11.012 9.411   -15.319 1.00 175.84 ?  1036 PRO A CG  1 
ATOM   1133 C CD  . PRO A 1 160 ? -9.591  9.847   -15.076 1.00 181.80 ?  1036 PRO A CD  1 
ATOM   1134 N N   . SER A 1 161 ? -9.345  6.160   -12.825 1.00 163.67 ?  1037 SER A N   1 
ATOM   1135 C CA  . SER A 1 161 ? -9.151  4.724   -13.030 1.00 153.90 ?  1037 SER A CA  1 
ATOM   1136 C C   . SER A 1 161 ? -8.557  4.132   -11.749 1.00 142.67 ?  1037 SER A C   1 
ATOM   1137 O O   . SER A 1 161 ? -7.372  4.327   -11.468 1.00 158.37 ?  1037 SER A O   1 
ATOM   1138 C CB  . SER A 1 161 ? -8.258  4.464   -14.232 1.00 164.85 ?  1037 SER A CB  1 
ATOM   1139 O OG  . SER A 1 161 ? -7.073  5.235   -14.150 1.00 161.87 ?  1037 SER A OG  1 
ATOM   1140 N N   . LEU A 1 162 ? -9.393  3.419   -10.988 1.00 129.89 ?  1038 LEU A N   1 
ATOM   1141 C CA  . LEU A 1 162 ? -8.933  2.799   -9.749  1.00 128.45 ?  1038 LEU A CA  1 
ATOM   1142 C C   . LEU A 1 162 ? -7.865  1.752   -10.020 1.00 136.70 ?  1038 LEU A C   1 
ATOM   1143 O O   . LEU A 1 162 ? -6.922  1.601   -9.234  1.00 150.26 ?  1038 LEU A O   1 
ATOM   1144 C CB  . LEU A 1 162 ? -10.121 2.174   -9.013  1.00 116.52 ?  1038 LEU A CB  1 
ATOM   1145 C CG  . LEU A 1 162 ? -9.908  1.593   -7.614  1.00 121.38 ?  1038 LEU A CG  1 
ATOM   1146 C CD1 . LEU A 1 162 ? -9.403  2.653   -6.650  1.00 116.17 ?  1038 LEU A CD1 1 
ATOM   1147 C CD2 . LEU A 1 162 ? -11.205 0.985   -7.106  1.00 130.96 ?  1038 LEU A CD2 1 
ATOM   1148 N N   . ASN A 1 163 ? -7.990  1.037   -11.140 1.00 153.31 ?  1039 ASN A N   1 
ATOM   1149 C CA  . ASN A 1 163 ? -6.995  0.047   -11.535 1.00 156.70 ?  1039 ASN A CA  1 
ATOM   1150 C C   . ASN A 1 163 ? -5.627  0.696   -11.721 1.00 149.19 ?  1039 ASN A C   1 
ATOM   1151 O O   . ASN A 1 163 ? -4.640  0.297   -11.079 1.00 153.27 ?  1039 ASN A O   1 
ATOM   1152 C CB  . ASN A 1 163 ? -7.473  -0.627  -12.829 1.00 164.48 ?  1039 ASN A CB  1 
ATOM   1153 C CG  . ASN A 1 163 ? -6.675  -1.863  -13.205 1.00 163.13 ?  1039 ASN A CG  1 
ATOM   1154 O OD1 . ASN A 1 163 ? -5.964  -2.442  -12.385 1.00 174.76 ?  1039 ASN A OD1 1 
ATOM   1155 N ND2 . ASN A 1 163 ? -6.805  -2.282  -14.463 1.00 165.03 ?  1039 ASN A ND2 1 
ATOM   1156 N N   . ALA A 1 164 ? -5.566  1.739   -12.549 1.00 135.96 ?  1040 ALA A N   1 
ATOM   1157 C CA  . ALA A 1 164 ? -4.309  2.431   -12.792 1.00 137.12 ?  1040 ALA A CA  1 
ATOM   1158 C C   . ALA A 1 164 ? -3.828  3.178   -11.558 1.00 139.59 ?  1040 ALA A C   1 
ATOM   1159 O O   . ALA A 1 164 ? -2.620  3.334   -11.372 1.00 151.90 ?  1040 ALA A O   1 
ATOM   1160 C CB  . ALA A 1 164 ? -4.455  3.402   -13.965 1.00 132.11 ?  1040 ALA A CB  1 
ATOM   1161 N N   . ALA A 1 165 ? -4.738  3.622   -10.691 1.00 135.59 ?  1041 ALA A N   1 
ATOM   1162 C CA  . ALA A 1 165 ? -4.298  4.284   -9.467  1.00 128.72 ?  1041 ALA A CA  1 
ATOM   1163 C C   . ALA A 1 165 ? -3.632  3.298   -8.515  1.00 135.82 ?  1041 ALA A C   1 
ATOM   1164 O O   . ALA A 1 165 ? -2.596  3.608   -7.912  1.00 152.39 ?  1041 ALA A O   1 
ATOM   1165 C CB  . ALA A 1 165 ? -5.478  4.977   -8.791  1.00 142.29 ?  1041 ALA A CB  1 
ATOM   1166 N N   . LYS A 1 166 ? -4.194  2.095   -8.384  1.00 116.34 ?  1042 LYS A N   1 
ATOM   1167 C CA  . LYS A 1 166 ? -3.544  1.085   -7.560  1.00 110.75 ?  1042 LYS A CA  1 
ATOM   1168 C C   . LYS A 1 166 ? -2.202  0.672   -8.150  1.00 119.04 ?  1042 LYS A C   1 
ATOM   1169 O O   . LYS A 1 166 ? -1.246  0.440   -7.402  1.00 140.01 ?  1042 LYS A O   1 
ATOM   1170 C CB  . LYS A 1 166 ? -4.454  -0.134  -7.389  1.00 105.11 ?  1042 LYS A CB  1 
ATOM   1171 N N   . SER A 1 167 ? -2.089  0.618   -9.480  1.00 120.09 ?  1043 SER A N   1 
ATOM   1172 C CA  . SER A 1 167 ? -0.777  0.291   -10.038 1.00 133.55 ?  1043 SER A CA  1 
ATOM   1173 C C   . SER A 1 167 ? 0.228   1.418   -9.805  1.00 125.41 ?  1043 SER A C   1 
ATOM   1174 O O   . SER A 1 167 ? 1.385   1.164   -9.425  1.00 129.68 ?  1043 SER A O   1 
ATOM   1175 C CB  . SER A 1 167 ? -0.892  -0.019  -11.531 1.00 144.82 ?  1043 SER A CB  1 
ATOM   1176 O OG  . SER A 1 167 ? 0.362   -0.393  -12.069 1.00 138.26 ?  1043 SER A OG  1 
ATOM   1177 N N   . GLU A 1 168 ? -0.206  2.665   -10.011 1.00 144.99 ?  1044 GLU A N   1 
ATOM   1178 C CA  . GLU A 1 168 ? 0.660   3.817   -9.797  1.00 161.59 ?  1044 GLU A CA  1 
ATOM   1179 C C   . GLU A 1 168 ? 1.104   3.916   -8.347  1.00 163.89 ?  1044 GLU A C   1 
ATOM   1180 O O   . GLU A 1 168 ? 2.188   4.435   -8.060  1.00 175.23 ?  1044 GLU A O   1 
ATOM   1181 C CB  . GLU A 1 168 ? -0.065  5.097   -10.213 1.00 174.32 ?  1044 GLU A CB  1 
ATOM   1182 N N   . LEU A 1 169 ? 0.276   3.434   -7.422  1.00 152.22 ?  1045 LEU A N   1 
ATOM   1183 C CA  . LEU A 1 169 ? 0.694   3.360   -6.031  1.00 133.80 ?  1045 LEU A CA  1 
ATOM   1184 C C   . LEU A 1 169 ? 1.627   2.182   -5.791  1.00 124.71 ?  1045 LEU A C   1 
ATOM   1185 O O   . LEU A 1 169 ? 2.534   2.276   -4.957  1.00 126.71 ?  1045 LEU A O   1 
ATOM   1186 C CB  . LEU A 1 169 ? -0.532  3.260   -5.124  1.00 134.23 ?  1045 LEU A CB  1 
ATOM   1187 C CG  . LEU A 1 169 ? -0.293  3.254   -3.615  1.00 122.79 ?  1045 LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1 169 ? 0.380   4.538   -3.164  1.00 113.60 ?  1045 LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1 169 ? -1.610  3.057   -2.894  1.00 114.52 ?  1045 LEU A CD2 1 
ATOM   1190 N N   . ASP A 1 170 ? 1.427   1.078   -6.516  1.00 128.26 ?  1046 ASP A N   1 
ATOM   1191 C CA  . ASP A 1 170 ? 2.285   -0.089  -6.344  1.00 118.07 ?  1046 ASP A CA  1 
ATOM   1192 C C   . ASP A 1 170 ? 3.727   0.224   -6.718  1.00 112.56 ?  1046 ASP A C   1 
ATOM   1193 O O   . ASP A 1 170 ? 4.659   -0.167  -6.005  1.00 112.43 ?  1046 ASP A O   1 
ATOM   1194 C CB  . ASP A 1 170 ? 1.754   -1.260  -7.171  1.00 110.45 ?  1046 ASP A CB  1 
ATOM   1195 N N   . LYS A 1 171 ? 3.939   0.931   -7.829  1.00 115.26 ?  1047 LYS A N   1 
ATOM   1196 C CA  . LYS A 1 171 ? 5.317   1.273   -8.178  1.00 130.63 ?  1047 LYS A CA  1 
ATOM   1197 C C   . LYS A 1 171 ? 5.911   2.281   -7.196  1.00 133.49 ?  1047 LYS A C   1 
ATOM   1198 O O   . LYS A 1 171 ? 7.124   2.275   -6.956  1.00 140.43 ?  1047 LYS A O   1 
ATOM   1199 C CB  . LYS A 1 171 ? 5.391   1.801   -9.614  1.00 141.88 ?  1047 LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 171 ? 6.630   2.637   -9.946  1.00 133.34 ?  1047 LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 171 ? 7.936   1.843   -9.941  1.00 125.74 ?  1047 LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 171 ? 9.101   2.729   -10.371 1.00 142.97 ?  1047 LYS A CE  1 
ATOM   1203 N NZ  . LYS A 1 171 ? 10.328  2.534   -9.547  1.00 133.95 ?  1047 LYS A NZ  1 
ATOM   1204 N N   . ALA A 1 172 ? 5.082   3.133   -6.604  1.00 111.64 ?  1048 ALA A N   1 
ATOM   1205 C CA  . ALA A 1 172 ? 5.549   4.154   -5.678  1.00 102.72 ?  1048 ALA A CA  1 
ATOM   1206 C C   . ALA A 1 172 ? 5.595   3.680   -4.226  1.00 102.59 ?  1048 ALA A C   1 
ATOM   1207 O O   . ALA A 1 172 ? 5.784   4.505   -3.326  1.00 106.53 ?  1048 ALA A O   1 
ATOM   1208 C CB  . ALA A 1 172 ? 4.665   5.397   -5.785  1.00 98.49  ?  1048 ALA A CB  1 
ATOM   1209 N N   . ILE A 1 173 ? 5.405   2.385   -3.971  1.00 113.24 ?  1049 ILE A N   1 
ATOM   1210 C CA  . ILE A 1 173 ? 5.550   1.859   -2.618  1.00 123.87 ?  1049 ILE A CA  1 
ATOM   1211 C C   . ILE A 1 173 ? 6.545   0.705   -2.621  1.00 147.41 ?  1049 ILE A C   1 
ATOM   1212 O O   . ILE A 1 173 ? 7.240   0.464   -1.627  1.00 145.31 ?  1049 ILE A O   1 
ATOM   1213 C CB  . ILE A 1 173 ? 4.186   1.418   -2.054  1.00 119.36 ?  1049 ILE A CB  1 
ATOM   1214 C CG1 . ILE A 1 173 ? 4.297   1.109   -0.565  1.00 110.46 ?  1049 ILE A CG1 1 
ATOM   1215 C CG2 . ILE A 1 173 ? 3.648   0.207   -2.814  1.00 150.74 ?  1049 ILE A CG2 1 
ATOM   1216 C CD1 . ILE A 1 173 ? 4.512   2.338   0.271   1.00 118.03 ?  1049 ILE A CD1 1 
ATOM   1217 N N   . GLY A 1 174 ? 6.631   0.000   -3.745  1.00 160.68 ?  1050 GLY A N   1 
ATOM   1218 C CA  . GLY A 1 174 ? 7.558   -1.100  -3.913  1.00 152.83 ?  1050 GLY A CA  1 
ATOM   1219 C C   . GLY A 1 174 ? 6.895   -2.461  -3.987  1.00 155.85 ?  1050 GLY A C   1 
ATOM   1220 O O   . GLY A 1 174 ? 7.230   -3.276  -4.853  1.00 186.17 ?  1050 GLY A O   1 
ATOM   1221 N N   . ARG A 1 175 ? 5.935   -2.713  -3.101  1.00 141.21 ?  1051 ARG A N   1 
ATOM   1222 C CA  . ARG A 1 175 ? 5.253   -3.995  -3.051  1.00 130.86 ?  1051 ARG A CA  1 
ATOM   1223 C C   . ARG A 1 175 ? 3.887   -3.881  -3.722  1.00 149.13 ?  1051 ARG A C   1 
ATOM   1224 O O   . ARG A 1 175 ? 3.520   -2.839  -4.272  1.00 158.01 ?  1051 ARG A O   1 
ATOM   1225 C CB  . ARG A 1 175 ? 5.132   -4.477  -1.606  1.00 98.18  ?  1051 ARG A CB  1 
ATOM   1226 N N   . ASN A 1 176 ? 3.124   -4.970  -3.687  1.00 157.09 ?  1052 ASN A N   1 
ATOM   1227 C CA  . ASN A 1 176 ? 1.764   -4.944  -4.199  1.00 165.95 ?  1052 ASN A CA  1 
ATOM   1228 C C   . ASN A 1 176 ? 0.848   -4.272  -3.187  1.00 173.10 ?  1052 ASN A C   1 
ATOM   1229 O O   . ASN A 1 176 ? 0.916   -4.541  -1.984  1.00 180.03 ?  1052 ASN A O   1 
ATOM   1230 C CB  . ASN A 1 176 ? 1.269   -6.358  -4.511  1.00 167.79 ?  1052 ASN A CB  1 
ATOM   1231 C CG  . ASN A 1 176 ? -0.075  -6.360  -5.207  1.00 189.12 ?  1052 ASN A CG  1 
ATOM   1232 O OD1 . ASN A 1 176 ? -0.542  -5.324  -5.679  1.00 202.53 ?  1052 ASN A OD1 1 
ATOM   1233 N ND2 . ASN A 1 176 ? -0.704  -7.529  -5.280  1.00 201.35 ?  1052 ASN A ND2 1 
ATOM   1234 N N   . THR A 1 177 ? -0.017  -3.393  -3.686  1.00 184.54 ?  1053 THR A N   1 
ATOM   1235 C CA  . THR A 1 177 ? -0.847  -2.579  -2.806  1.00 190.70 ?  1053 THR A CA  1 
ATOM   1236 C C   . THR A 1 177 ? -2.110  -3.317  -2.378  1.00 181.01 ?  1053 THR A C   1 
ATOM   1237 O O   . THR A 1 177 ? -2.373  -3.478  -1.180  1.00 158.62 ?  1053 THR A O   1 
ATOM   1238 C CB  . THR A 1 177 ? -1.217  -1.268  -3.506  1.00 202.27 ?  1053 THR A CB  1 
ATOM   1239 O OG1 . THR A 1 177 ? -1.752  -1.552  -4.807  1.00 211.58 ?  1053 THR A OG1 1 
ATOM   1240 C CG2 . THR A 1 177 ? 0.002   -0.379  -3.645  1.00 178.49 ?  1053 THR A CG2 1 
ATOM   1241 N N   . ASN A 1 178 ? -2.928  -3.711  -3.359  1.00 167.60 ?  1054 ASN A N   1 
ATOM   1242 C CA  . ASN A 1 178 ? -4.239  -4.332  -3.181  1.00 155.70 ?  1054 ASN A CA  1 
ATOM   1243 C C   . ASN A 1 178 ? -5.241  -3.310  -2.653  1.00 144.80 ?  1054 ASN A C   1 
ATOM   1244 O O   . ASN A 1 178 ? -6.454  -3.508  -2.759  1.00 143.64 ?  1054 ASN A O   1 
ATOM   1245 C CB  . ASN A 1 178 ? -4.155  -5.544  -2.239  1.00 151.43 ?  1054 ASN A CB  1 
ATOM   1246 C CG  . ASN A 1 178 ? -5.515  -6.157  -1.933  1.00 147.00 ?  1054 ASN A CG  1 
ATOM   1247 O OD1 . ASN A 1 178 ? -6.416  -6.164  -2.772  1.00 136.62 ?  1054 ASN A OD1 1 
ATOM   1248 N ND2 . ASN A 1 178 ? -5.666  -6.678  -0.719  1.00 147.94 ?  1054 ASN A ND2 1 
ATOM   1249 N N   . GLY A 1 179 ? -4.751  -2.171  -2.173  1.00 146.92 ?  1055 GLY A N   1 
ATOM   1250 C CA  . GLY A 1 179 ? -5.611  -1.117  -1.677  1.00 155.04 ?  1055 GLY A CA  1 
ATOM   1251 C C   . GLY A 1 179 ? -5.307  -0.646  -0.267  1.00 150.24 ?  1055 GLY A C   1 
ATOM   1252 O O   . GLY A 1 179 ? -5.366  0.558   -0.002  1.00 145.96 ?  1055 GLY A O   1 
ATOM   1253 N N   . VAL A 1 180 ? -4.962  -1.560  0.640   1.00 126.88 ?  1056 VAL A N   1 
ATOM   1254 C CA  . VAL A 1 180 ? -4.708  -1.203  2.033   1.00 125.17 ?  1056 VAL A CA  1 
ATOM   1255 C C   . VAL A 1 180 ? -3.208  -1.033  2.233   1.00 113.91 ?  1056 VAL A C   1 
ATOM   1256 O O   . VAL A 1 180 ? -2.413  -1.879  1.805   1.00 105.88 ?  1056 VAL A O   1 
ATOM   1257 C CB  . VAL A 1 180 ? -5.280  -2.258  2.996   1.00 147.49 ?  1056 VAL A CB  1 
ATOM   1258 C CG1 . VAL A 1 180 ? -5.117  -1.794  4.444   1.00 159.60 ?  1056 VAL A CG1 1 
ATOM   1259 C CG2 . VAL A 1 180 ? -6.742  -2.537  2.689   1.00 152.20 ?  1056 VAL A CG2 1 
ATOM   1260 N N   . ILE A 1 181 ? -2.821  0.062   2.885   1.00 106.39 ?  1057 ILE A N   1 
ATOM   1261 C CA  . ILE A 1 181 ? -1.421  0.405   3.109   1.00 105.54 ?  1057 ILE A CA  1 
ATOM   1262 C C   . ILE A 1 181 ? -1.217  0.641   4.600   1.00 125.73 ?  1057 ILE A C   1 
ATOM   1263 O O   . ILE A 1 181 ? -1.986  1.378   5.226   1.00 151.90 ?  1057 ILE A O   1 
ATOM   1264 C CB  . ILE A 1 181 ? -0.999  1.642   2.288   1.00 103.06 ?  1057 ILE A CB  1 
ATOM   1265 C CG1 . ILE A 1 181 ? -0.486  1.228   0.902   1.00 116.94 ?  1057 ILE A CG1 1 
ATOM   1266 C CG2 . ILE A 1 181 ? 0.056   2.460   3.019   1.00 90.94  ?  1057 ILE A CG2 1 
ATOM   1267 C CD1 . ILE A 1 181 ? -1.561  0.769   -0.059  1.00 134.14 ?  1057 ILE A CD1 1 
ATOM   1268 N N   . THR A 1 182 ? -0.185  0.017   5.164   1.00 128.15 ?  1058 THR A N   1 
ATOM   1269 C CA  . THR A 1 182 ? 0.066   0.082   6.595   1.00 112.75 ?  1058 THR A CA  1 
ATOM   1270 C C   . THR A 1 182 ? 0.519   1.485   7.010   1.00 107.97 ?  1058 THR A C   1 
ATOM   1271 O O   . THR A 1 182 ? 0.817   2.350   6.181   1.00 103.30 ?  1058 THR A O   1 
ATOM   1272 C CB  . THR A 1 182 ? 1.110   -0.963  6.994   1.00 112.56 ?  1058 THR A CB  1 
ATOM   1273 O OG1 . THR A 1 182 ? 2.348   -0.685  6.328   1.00 116.35 ?  1058 THR A OG1 1 
ATOM   1274 C CG2 . THR A 1 182 ? 0.635   -2.362  6.606   1.00 112.58 ?  1058 THR A CG2 1 
ATOM   1275 N N   . LYS A 1 183 ? 0.561   1.705   8.329   1.00 95.08  ?  1059 LYS A N   1 
ATOM   1276 C CA  . LYS A 1 183 ? 0.929   3.019   8.851   1.00 102.66 ?  1059 LYS A CA  1 
ATOM   1277 C C   . LYS A 1 183 ? 2.386   3.354   8.559   1.00 115.47 ?  1059 LYS A C   1 
ATOM   1278 O O   . LYS A 1 183 ? 2.712   4.515   8.270   1.00 118.00 ?  1059 LYS A O   1 
ATOM   1279 C CB  . LYS A 1 183 ? 0.652   3.085   10.356  1.00 101.40 ?  1059 LYS A CB  1 
ATOM   1280 C CG  . LYS A 1 183 ? 0.891   4.457   10.972  1.00 120.85 ?  1059 LYS A CG  1 
ATOM   1281 C CD  . LYS A 1 183 ? 0.359   4.535   12.397  1.00 125.20 ?  1059 LYS A CD  1 
ATOM   1282 C CE  . LYS A 1 183 ? 0.737   5.840   13.083  1.00 118.12 ?  1059 LYS A CE  1 
ATOM   1283 N NZ  . LYS A 1 183 ? 2.194   5.895   13.383  1.00 110.42 ?  1059 LYS A NZ  1 
ATOM   1284 N N   . ASP A 1 184 ? 3.266   2.350   8.600   1.00 109.61 ?  1060 ASP A N   1 
ATOM   1285 C CA  . ASP A 1 184 ? 4.681   2.580   8.323   1.00 98.05  ?  1060 ASP A CA  1 
ATOM   1286 C C   . ASP A 1 184 ? 4.901   3.037   6.884   1.00 91.74  ?  1060 ASP A C   1 
ATOM   1287 O O   . ASP A 1 184 ? 5.662   3.983   6.634   1.00 96.14  ?  1060 ASP A O   1 
ATOM   1288 C CB  . ASP A 1 184 ? 5.487   1.307   8.602   1.00 113.01 ?  1060 ASP A CB  1 
ATOM   1289 C CG  . ASP A 1 184 ? 5.714   1.060   10.087  1.00 128.67 ?  1060 ASP A CG  1 
ATOM   1290 O OD1 . ASP A 1 184 ? 4.743   1.152   10.869  1.00 137.51 ?  1060 ASP A OD1 1 
ATOM   1291 O OD2 . ASP A 1 184 ? 6.857   0.731   10.471  1.00 138.17 -1 1060 ASP A OD2 1 
ATOM   1292 N N   . GLU A 1 185 ? 4.255   2.369   5.925   1.00 94.86  ?  1061 GLU A N   1 
ATOM   1293 C CA  . GLU A 1 185 ? 4.402   2.754   4.524   1.00 99.32  ?  1061 GLU A CA  1 
ATOM   1294 C C   . GLU A 1 185 ? 3.913   4.182   4.298   1.00 86.32  ?  1061 GLU A C   1 
ATOM   1295 O O   . GLU A 1 185 ? 4.525   4.956   3.541   1.00 74.59  ?  1061 GLU A O   1 
ATOM   1296 C CB  . GLU A 1 185 ? 3.649   1.753   3.643   1.00 111.81 ?  1061 GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 185 ? 4.107   0.307   3.852   1.00 132.16 ?  1061 GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 185 ? 3.406   -0.693  2.946   1.00 134.23 ?  1061 GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 185 ? 2.342   -0.362  2.383   1.00 139.20 ?  1061 GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 185 ? 3.931   -1.818  2.797   1.00 123.86 -1 1061 GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 186 ? 2.830   4.558   4.980   1.00 71.64  ?  1062 ALA A N   1 
ATOM   1302 C CA  . ALA A 1 186 ? 2.330   5.921   4.872   1.00 76.04  ?  1062 ALA A CA  1 
ATOM   1303 C C   . ALA A 1 186 ? 3.321   6.925   5.448   1.00 86.10  ?  1062 ALA A C   1 
ATOM   1304 O O   . ALA A 1 186 ? 3.511   8.005   4.883   1.00 79.28  ?  1062 ALA A O   1 
ATOM   1305 C CB  . ALA A 1 186 ? 0.975   6.045   5.566   1.00 76.96  ?  1062 ALA A CB  1 
ATOM   1306 N N   . GLU A 1 187 ? 3.965   6.597   6.570   1.00 96.05  ?  1063 GLU A N   1 
ATOM   1307 C CA  . GLU A 1 187 ? 4.943   7.535   7.123   1.00 87.52  ?  1063 GLU A CA  1 
ATOM   1308 C C   . GLU A 1 187 ? 6.149   7.685   6.196   1.00 87.09  ?  1063 GLU A C   1 
ATOM   1309 O O   . GLU A 1 187 ? 6.691   8.791   6.028   1.00 83.97  ?  1063 GLU A O   1 
ATOM   1310 C CB  . GLU A 1 187 ? 5.372   7.092   8.524   1.00 83.69  ?  1063 GLU A CB  1 
ATOM   1311 C CG  . GLU A 1 187 ? 4.289   7.269   9.596   1.00 94.32  ?  1063 GLU A CG  1 
ATOM   1312 C CD  . GLU A 1 187 ? 4.066   8.725   10.010  1.00 116.45 ?  1063 GLU A CD  1 
ATOM   1313 O OE1 . GLU A 1 187 ? 4.713   9.634   9.444   1.00 122.45 ?  1063 GLU A OE1 1 
ATOM   1314 O OE2 . GLU A 1 187 ? 3.244   8.965   10.916  1.00 115.77 -1 1063 GLU A OE2 1 
ATOM   1315 N N   . LYS A 1 188 ? 6.559   6.587   5.557   1.00 87.97  ?  1064 LYS A N   1 
ATOM   1316 C CA  . LYS A 1 188 ? 7.638   6.651   4.571   1.00 86.90  ?  1064 LYS A CA  1 
ATOM   1317 C C   . LYS A 1 188 ? 7.282   7.613   3.434   1.00 94.86  ?  1064 LYS A C   1 
ATOM   1318 O O   . LYS A 1 188 ? 8.037   8.554   3.120   1.00 87.94  ?  1064 LYS A O   1 
ATOM   1319 C CB  . LYS A 1 188 ? 7.911   5.237   4.039   1.00 99.00  ?  1064 LYS A CB  1 
ATOM   1320 C CG  . LYS A 1 188 ? 9.207   5.042   3.277   1.00 104.80 ?  1064 LYS A CG  1 
ATOM   1321 C CD  . LYS A 1 188 ? 9.159   3.778   2.418   1.00 101.64 ?  1064 LYS A CD  1 
ATOM   1322 C CE  . LYS A 1 188 ? 8.999   2.526   3.273   1.00 111.74 ?  1064 LYS A CE  1 
ATOM   1323 N NZ  . LYS A 1 188 ? 8.534   1.352   2.478   1.00 100.57 ?  1064 LYS A NZ  1 
ATOM   1324 N N   . LEU A 1 189 ? 6.103   7.413   2.833   1.00 85.84  ?  1065 LEU A N   1 
ATOM   1325 C CA  . LEU A 1 189 ? 5.672   8.296   1.750   1.00 84.47  ?  1065 LEU A CA  1 
ATOM   1326 C C   . LEU A 1 189 ? 5.517   9.738   2.225   1.00 79.80  ?  1065 LEU A C   1 
ATOM   1327 O O   . LEU A 1 189 ? 5.756   10.680  1.457   1.00 71.38  ?  1065 LEU A O   1 
ATOM   1328 C CB  . LEU A 1 189 ? 4.358   7.792   1.151   1.00 84.08  ?  1065 LEU A CB  1 
ATOM   1329 N N   . PHE A 1 190 ? 5.128   9.928   3.488   1.00 83.57  ?  1066 PHE A N   1 
ATOM   1330 C CA  . PHE A 1 190 ? 4.966   11.271  4.038   1.00 78.55  ?  1066 PHE A CA  1 
ATOM   1331 C C   . PHE A 1 190 ? 6.297   12.009  4.103   1.00 86.83  ?  1066 PHE A C   1 
ATOM   1332 O O   . PHE A 1 190 ? 6.387   13.193  3.738   1.00 97.57  ?  1066 PHE A O   1 
ATOM   1333 C CB  . PHE A 1 190 ? 4.326   11.165  5.422   1.00 76.21  ?  1066 PHE A CB  1 
ATOM   1334 C CG  . PHE A 1 190 ? 4.046   12.485  6.072   1.00 77.79  ?  1066 PHE A CG  1 
ATOM   1335 C CD1 . PHE A 1 190 ? 3.343   13.474  5.404   1.00 76.43  ?  1066 PHE A CD1 1 
ATOM   1336 C CD2 . PHE A 1 190 ? 4.467   12.727  7.367   1.00 90.07  ?  1066 PHE A CD2 1 
ATOM   1337 C CE1 . PHE A 1 190 ? 3.081   14.689  6.015   1.00 73.27  ?  1066 PHE A CE1 1 
ATOM   1338 C CE2 . PHE A 1 190 ? 4.209   13.936  7.981   1.00 87.68  ?  1066 PHE A CE2 1 
ATOM   1339 C CZ  . PHE A 1 190 ? 3.515   14.917  7.306   1.00 86.25  ?  1066 PHE A CZ  1 
ATOM   1340 N N   . ASN A 1 191 ? 7.339   11.323  4.578   1.00 93.70  ?  1067 ASN A N   1 
ATOM   1341 C CA  . ASN A 1 191 ? 8.673   11.917  4.555   1.00 93.67  ?  1067 ASN A CA  1 
ATOM   1342 C C   . ASN A 1 191 ? 9.079   12.281  3.133   1.00 91.95  ?  1067 ASN A C   1 
ATOM   1343 O O   . ASN A 1 191 ? 9.636   13.365  2.889   1.00 84.30  ?  1067 ASN A O   1 
ATOM   1344 C CB  . ASN A 1 191 ? 9.693   10.963  5.182   1.00 92.52  ?  1067 ASN A CB  1 
ATOM   1345 C CG  . ASN A 1 191 ? 9.692   11.024  6.705   1.00 97.12  ?  1067 ASN A CG  1 
ATOM   1346 O OD1 . ASN A 1 191 ? 8.649   10.867  7.342   1.00 117.96 ?  1067 ASN A OD1 1 
ATOM   1347 N ND2 . ASN A 1 191 ? 10.858  11.275  7.293   1.00 100.13 ?  1067 ASN A ND2 1 
ATOM   1348 N N   . GLN A 1 192 ? 8.778   11.401  2.174   1.00 82.90  ?  1068 GLN A N   1 
ATOM   1349 C CA  . GLN A 1 192 ? 9.111   11.711  0.784   1.00 94.18  ?  1068 GLN A CA  1 
ATOM   1350 C C   . GLN A 1 192 ? 8.425   12.995  0.327   1.00 89.17  ?  1068 GLN A C   1 
ATOM   1351 O O   . GLN A 1 192 ? 9.050   13.869  -0.292  1.00 76.77  ?  1068 GLN A O   1 
ATOM   1352 C CB  . GLN A 1 192 ? 8.719   10.548  -0.124  1.00 114.38 ?  1068 GLN A CB  1 
ATOM   1353 C CG  . GLN A 1 192 ? 9.476   9.266   0.159   1.00 114.13 ?  1068 GLN A CG  1 
ATOM   1354 C CD  . GLN A 1 192 ? 8.961   8.109   -0.668  1.00 120.03 ?  1068 GLN A CD  1 
ATOM   1355 O OE1 . GLN A 1 192 ? 8.087   8.282   -1.518  1.00 121.13 ?  1068 GLN A OE1 1 
ATOM   1356 N NE2 . GLN A 1 192 ? 9.495   6.918   -0.422  1.00 126.10 ?  1068 GLN A NE2 1 
ATOM   1357 N N   . ASP A 1 193 ? 7.132   13.121  0.629   1.00 81.92  ?  1069 ASP A N   1 
ATOM   1358 C CA  . ASP A 1 193 ? 6.381   14.288  0.179   1.00 86.34  ?  1069 ASP A CA  1 
ATOM   1359 C C   . ASP A 1 193 ? 6.929   15.573  0.794   1.00 86.45  ?  1069 ASP A C   1 
ATOM   1360 O O   . ASP A 1 193 ? 7.046   16.601  0.112   1.00 81.99  ?  1069 ASP A O   1 
ATOM   1361 C CB  . ASP A 1 193 ? 4.901   14.115  0.513   1.00 98.12  ?  1069 ASP A CB  1 
ATOM   1362 C CG  . ASP A 1 193 ? 4.289   12.904  -0.166  1.00 106.98 ?  1069 ASP A CG  1 
ATOM   1363 O OD1 . ASP A 1 193 ? 4.772   12.518  -1.251  1.00 102.98 ?  1069 ASP A OD1 1 
ATOM   1364 O OD2 . ASP A 1 193 ? 3.319   12.338  0.382   1.00 104.05 -1 1069 ASP A OD2 1 
ATOM   1365 N N   . VAL A 1 194 ? 7.280   15.534  2.081   1.00 85.52  ?  1070 VAL A N   1 
ATOM   1366 C CA  . VAL A 1 194 ? 7.745   16.758  2.733   1.00 81.36  ?  1070 VAL A CA  1 
ATOM   1367 C C   . VAL A 1 194 ? 9.109   17.180  2.188   1.00 87.29  ?  1070 VAL A C   1 
ATOM   1368 O O   . VAL A 1 194 ? 9.370   18.379  1.970   1.00 81.15  ?  1070 VAL A O   1 
ATOM   1369 C CB  . VAL A 1 194 ? 7.765   16.575  4.262   1.00 70.83  ?  1070 VAL A CB  1 
ATOM   1370 C CG1 . VAL A 1 194 ? 8.323   17.813  4.944   1.00 72.12  ?  1070 VAL A CG1 1 
ATOM   1371 C CG2 . VAL A 1 194 ? 6.362   16.292  4.774   1.00 76.74  ?  1070 VAL A CG2 1 
ATOM   1372 N N   . ASP A 1 195 ? 9.997   16.208  1.948   1.00 84.05  ?  1071 ASP A N   1 
ATOM   1373 C CA  . ASP A 1 195 ? 11.279  16.552  1.336   1.00 83.83  ?  1071 ASP A CA  1 
ATOM   1374 C C   . ASP A 1 195 ? 11.090  17.133  -0.060  1.00 91.53  ?  1071 ASP A C   1 
ATOM   1375 O O   . ASP A 1 195 ? 11.783  18.092  -0.438  1.00 89.31  ?  1071 ASP A O   1 
ATOM   1376 C CB  . ASP A 1 195 ? 12.188  15.324  1.273   1.00 79.76  ?  1071 ASP A CB  1 
ATOM   1377 N N   . ALA A 1 196 ? 10.151  16.581  -0.834  1.00 86.95  ?  1072 ALA A N   1 
ATOM   1378 C CA  . ALA A 1 196 ? 9.884   17.160  -2.144  1.00 78.49  ?  1072 ALA A CA  1 
ATOM   1379 C C   . ALA A 1 196 ? 9.394   18.592  -2.019  1.00 72.57  ?  1072 ALA A C   1 
ATOM   1380 O O   . ALA A 1 196 ? 9.779   19.449  -2.823  1.00 65.42  ?  1072 ALA A O   1 
ATOM   1381 C CB  . ALA A 1 196 ? 8.854   16.323  -2.899  1.00 60.61  ?  1072 ALA A CB  1 
ATOM   1382 N N   . ALA A 1 197 ? 8.586   18.877  -0.996  1.00 68.12  ?  1073 ALA A N   1 
ATOM   1383 C CA  . ALA A 1 197 ? 8.092   20.238  -0.825  1.00 66.78  ?  1073 ALA A CA  1 
ATOM   1384 C C   . ALA A 1 197 ? 9.236   21.209  -0.574  1.00 68.86  ?  1073 ALA A C   1 
ATOM   1385 O O   . ALA A 1 197 ? 9.313   22.274  -1.209  1.00 77.25  ?  1073 ALA A O   1 
ATOM   1386 C CB  . ALA A 1 197 ? 7.094   20.296  0.328   1.00 57.46  ?  1073 ALA A CB  1 
ATOM   1387 N N   . VAL A 1 198 ? 10.149  20.850  0.329   1.00 67.75  ?  1074 VAL A N   1 
ATOM   1388 C CA  . VAL A 1 198 ? 11.220  21.804  0.611   1.00 84.03  ?  1074 VAL A CA  1 
ATOM   1389 C C   . VAL A 1 198 ? 12.139  21.962  -0.603  1.00 98.25  ?  1074 VAL A C   1 
ATOM   1390 O O   . VAL A 1 198 ? 12.606  23.077  -0.892  1.00 105.97 ?  1074 VAL A O   1 
ATOM   1391 C CB  . VAL A 1 198 ? 12.014  21.429  1.879   1.00 69.55  ?  1074 VAL A CB  1 
ATOM   1392 C CG1 . VAL A 1 198 ? 11.110  21.455  3.106   1.00 67.56  ?  1074 VAL A CG1 1 
ATOM   1393 C CG2 . VAL A 1 198 ? 12.697  20.080  1.744   1.00 96.00  ?  1074 VAL A CG2 1 
ATOM   1394 N N   . ARG A 1 199 ? 12.397  20.881  -1.348  1.00 97.13  ?  1075 ARG A N   1 
ATOM   1395 C CA  . ARG A 1 199 ? 13.236  21.021  -2.535  1.00 83.64  ?  1075 ARG A CA  1 
ATOM   1396 C C   . ARG A 1 199 ? 12.552  21.883  -3.584  1.00 102.12 ?  1075 ARG A C   1 
ATOM   1397 O O   . ARG A 1 199 ? 13.212  22.620  -4.329  1.00 95.01  ?  1075 ARG A O   1 
ATOM   1398 C CB  . ARG A 1 199 ? 13.589  19.650  -3.104  1.00 74.41  ?  1075 ARG A CB  1 
ATOM   1399 C CG  . ARG A 1 199 ? 14.690  18.953  -2.325  1.00 83.63  ?  1075 ARG A CG  1 
ATOM   1400 C CD  . ARG A 1 199 ? 15.175  17.700  -3.028  1.00 86.54  ?  1075 ARG A CD  1 
ATOM   1401 N NE  . ARG A 1 199 ? 14.127  16.692  -3.124  1.00 91.00  ?  1075 ARG A NE  1 
ATOM   1402 C CZ  . ARG A 1 199 ? 13.948  15.724  -2.234  1.00 107.26 ?  1075 ARG A CZ  1 
ATOM   1403 N NH1 . ARG A 1 199 ? 14.752  15.635  -1.183  1.00 90.95  ?  1075 ARG A NH1 1 
ATOM   1404 N NH2 . ARG A 1 199 ? 12.969  14.846  -2.393  1.00 118.36 ?  1075 ARG A NH2 1 
ATOM   1405 N N   . GLY A 1 200 ? 11.226  21.804  -3.653  1.00 102.11 ?  1076 GLY A N   1 
ATOM   1406 C CA  . GLY A 1 200 ? 10.493  22.710  -4.515  1.00 82.14  ?  1076 GLY A CA  1 
ATOM   1407 C C   . GLY A 1 200 ? 10.702  24.160  -4.130  1.00 91.54  ?  1076 GLY A C   1 
ATOM   1408 O O   . GLY A 1 200 ? 10.987  25.006  -4.979  1.00 71.06  ?  1076 GLY A O   1 
ATOM   1409 N N   . ILE A 1 201 ? 10.568  24.465  -2.837  1.00 99.27  ?  1077 ILE A N   1 
ATOM   1410 C CA  . ILE A 1 201 ? 10.695  25.856  -2.395  1.00 88.61  ?  1077 ILE A CA  1 
ATOM   1411 C C   . ILE A 1 201 ? 12.094  26.391  -2.689  1.00 95.75  ?  1077 ILE A C   1 
ATOM   1412 O O   . ILE A 1 201 ? 12.257  27.516  -3.176  1.00 83.83  ?  1077 ILE A O   1 
ATOM   1413 C CB  . ILE A 1 201 ? 10.345  25.989  -0.904  1.00 82.42  ?  1077 ILE A CB  1 
ATOM   1414 C CG1 . ILE A 1 201 ? 8.887   25.606  -0.669  1.00 79.82  ?  1077 ILE A CG1 1 
ATOM   1415 C CG2 . ILE A 1 201 ? 10.580  27.408  -0.437  1.00 74.21  ?  1077 ILE A CG2 1 
ATOM   1416 C CD1 . ILE A 1 201 ? 8.541   25.428  0.791   1.00 86.87  ?  1077 ILE A CD1 1 
ATOM   1417 N N   . LEU A 1 202 ? 13.128  25.601  -2.389  1.00 114.91 ?  1078 LEU A N   1 
ATOM   1418 C CA  . LEU A 1 202 ? 14.485  26.090  -2.619  1.00 112.69 ?  1078 LEU A CA  1 
ATOM   1419 C C   . LEU A 1 202 ? 14.831  26.191  -4.101  1.00 124.65 ?  1078 LEU A C   1 
ATOM   1420 O O   . LEU A 1 202 ? 15.793  26.883  -4.453  1.00 118.35 ?  1078 LEU A O   1 
ATOM   1421 C CB  . LEU A 1 202 ? 15.497  25.193  -1.913  1.00 100.98 ?  1078 LEU A CB  1 
ATOM   1422 C CG  . LEU A 1 202 ? 15.363  25.104  -0.394  1.00 83.75  ?  1078 LEU A CG  1 
ATOM   1423 C CD1 . LEU A 1 202 ? 16.208  23.956  0.127   1.00 81.13  ?  1078 LEU A CD1 1 
ATOM   1424 C CD2 . LEU A 1 202 ? 15.760  26.416  0.271   1.00 84.23  ?  1078 LEU A CD2 1 
ATOM   1425 N N   . ARG A 1 203 ? 14.075  25.526  -4.973  1.00 133.83 ?  1079 ARG A N   1 
ATOM   1426 C CA  . ARG A 1 203 ? 14.278  25.606  -6.413  1.00 122.60 ?  1079 ARG A CA  1 
ATOM   1427 C C   . ARG A 1 203 ? 13.342  26.607  -7.078  1.00 111.19 ?  1079 ARG A C   1 
ATOM   1428 O O   . ARG A 1 203 ? 13.196  26.587  -8.305  1.00 121.41 ?  1079 ARG A O   1 
ATOM   1429 C CB  . ARG A 1 203 ? 14.106  24.224  -7.043  1.00 116.31 ?  1079 ARG A CB  1 
ATOM   1430 N N   . ASN A 1 204 ? 12.700  27.469  -6.297  1.00 100.12 ?  1080 ASN A N   1 
ATOM   1431 C CA  . ASN A 1 204 ? 11.812  28.504  -6.805  1.00 80.33  ?  1080 ASN A CA  1 
ATOM   1432 C C   . ASN A 1 204 ? 12.445  29.863  -6.541  1.00 74.66  ?  1080 ASN A C   1 
ATOM   1433 O O   . ASN A 1 204 ? 12.923  30.127  -5.432  1.00 85.58  ?  1080 ASN A O   1 
ATOM   1434 C CB  . ASN A 1 204 ? 10.435  28.402  -6.143  1.00 86.07  ?  1080 ASN A CB  1 
ATOM   1435 C CG  . ASN A 1 204 ? 9.405   29.319  -6.779  1.00 90.45  ?  1080 ASN A CG  1 
ATOM   1436 O OD1 . ASN A 1 204 ? 9.592   30.534  -6.855  1.00 72.75  ?  1080 ASN A OD1 1 
ATOM   1437 N ND2 . ASN A 1 204 ? 8.306   28.735  -7.241  1.00 79.53  ?  1080 ASN A ND2 1 
ATOM   1438 N N   . ALA A 1 205 ? 12.442  30.724  -7.559  1.00 80.54  ?  1081 ALA A N   1 
ATOM   1439 C CA  . ALA A 1 205 ? 13.133  32.003  -7.446  1.00 83.08  ?  1081 ALA A CA  1 
ATOM   1440 C C   . ALA A 1 205 ? 12.373  33.001  -6.582  1.00 90.76  ?  1081 ALA A C   1 
ATOM   1441 O O   . ALA A 1 205 ? 12.989  33.888  -5.981  1.00 114.31 ?  1081 ALA A O   1 
ATOM   1442 C CB  . ALA A 1 205 ? 13.375  32.595  -8.834  1.00 95.26  ?  1081 ALA A CB  1 
ATOM   1443 N N   . LYS A 1 206 ? 11.050  32.875  -6.501  1.00 95.27  ?  1082 LYS A N   1 
ATOM   1444 C CA  . LYS A 1 206 ? 10.230  33.777  -5.705  1.00 110.93 ?  1082 LYS A CA  1 
ATOM   1445 C C   . LYS A 1 206 ? 9.958   33.250  -4.302  1.00 110.43 ?  1082 LYS A C   1 
ATOM   1446 O O   . LYS A 1 206 ? 9.322   33.946  -3.506  1.00 111.27 ?  1082 LYS A O   1 
ATOM   1447 C CB  . LYS A 1 206 ? 8.901   34.048  -6.418  1.00 105.53 ?  1082 LYS A CB  1 
ATOM   1448 N N   . LEU A 1 207 ? 10.420  32.046  -3.976  1.00 100.51 ?  1083 LEU A N   1 
ATOM   1449 C CA  . LEU A 1 207 ? 10.177  31.462  -2.665  1.00 82.41  ?  1083 LEU A CA  1 
ATOM   1450 C C   . LEU A 1 207 ? 11.434  31.248  -1.837  1.00 84.32  ?  1083 LEU A C   1 
ATOM   1451 O O   . LEU A 1 207 ? 11.341  31.207  -0.609  1.00 73.44  ?  1083 LEU A O   1 
ATOM   1452 C CB  . LEU A 1 207 ? 9.439   30.126  -2.811  1.00 69.12  ?  1083 LEU A CB  1 
ATOM   1453 C CG  . LEU A 1 207 ? 8.006   30.210  -3.346  1.00 67.73  ?  1083 LEU A CG  1 
ATOM   1454 C CD1 . LEU A 1 207 ? 7.415   28.818  -3.508  1.00 54.00  ?  1083 LEU A CD1 1 
ATOM   1455 C CD2 . LEU A 1 207 ? 7.131   31.063  -2.436  1.00 67.64  ?  1083 LEU A CD2 1 
ATOM   1456 N N   . LYS A 1 208 ? 12.600  31.090  -2.466  1.00 78.35  ?  1084 LYS A N   1 
ATOM   1457 C CA  . LYS A 1 208 ? 13.820  30.895  -1.683  1.00 93.63  ?  1084 LYS A CA  1 
ATOM   1458 C C   . LYS A 1 208 ? 14.202  32.118  -0.860  1.00 98.02  ?  1084 LYS A C   1 
ATOM   1459 O O   . LYS A 1 208 ? 14.538  31.944  0.322   1.00 122.42 ?  1084 LYS A O   1 
ATOM   1460 C CB  . LYS A 1 208 ? 14.986  30.458  -2.576  1.00 95.53  ?  1084 LYS A CB  1 
ATOM   1461 C CG  . LYS A 1 208 ? 16.235  30.114  -1.766  1.00 104.06 ?  1084 LYS A CG  1 
ATOM   1462 C CD  . LYS A 1 208 ? 17.381  29.616  -2.630  1.00 112.49 ?  1084 LYS A CD  1 
ATOM   1463 C CE  . LYS A 1 208 ? 18.112  30.768  -3.301  1.00 126.25 ?  1084 LYS A CE  1 
ATOM   1464 N NZ  . LYS A 1 208 ? 18.558  31.793  -2.314  1.00 121.09 ?  1084 LYS A NZ  1 
ATOM   1465 N N   . PRO A 1 209 ? 14.222  33.347  -1.394  1.00 95.07  ?  1085 PRO A N   1 
ATOM   1466 C CA  . PRO A 1 209 ? 14.581  34.482  -0.525  1.00 92.66  ?  1085 PRO A CA  1 
ATOM   1467 C C   . PRO A 1 209 ? 13.686  34.611  0.696   1.00 91.21  ?  1085 PRO A C   1 
ATOM   1468 O O   . PRO A 1 209 ? 14.191  34.769  1.819   1.00 101.36 ?  1085 PRO A O   1 
ATOM   1469 C CB  . PRO A 1 209 ? 14.454  35.701  -1.456  1.00 81.76  ?  1085 PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 209 ? 13.701  35.242  -2.631  1.00 82.95  ?  1085 PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 209 ? 14.005  33.786  -2.783  1.00 94.47  ?  1085 PRO A CD  1 
ATOM   1472 N N   . VAL A 1 210 ? 12.372  34.480  0.520   1.00 90.37  ?  1086 VAL A N   1 
ATOM   1473 C CA  . VAL A 1 210 ? 11.457  34.658  1.642   1.00 94.60  ?  1086 VAL A CA  1 
ATOM   1474 C C   . VAL A 1 210 ? 11.554  33.481  2.607   1.00 97.85  ?  1086 VAL A C   1 
ATOM   1475 O O   . VAL A 1 210 ? 11.503  33.665  3.826   1.00 88.26  ?  1086 VAL A O   1 
ATOM   1476 C CB  . VAL A 1 210 ? 10.018  34.875  1.128   1.00 81.69  ?  1086 VAL A CB  1 
ATOM   1477 C CG1 . VAL A 1 210 ? 9.570   33.716  0.254   1.00 86.08  ?  1086 VAL A CG1 1 
ATOM   1478 C CG2 . VAL A 1 210 ? 9.048   35.082  2.283   1.00 80.32  ?  1086 VAL A CG2 1 
ATOM   1479 N N   . TYR A 1 211 ? 11.728  32.261  2.089   1.00 86.30  ?  1087 TYR A N   1 
ATOM   1480 C CA  . TYR A 1 211 ? 11.895  31.108  2.972   1.00 74.28  ?  1087 TYR A CA  1 
ATOM   1481 C C   . TYR A 1 211 ? 13.181  31.220  3.780   1.00 71.83  ?  1087 TYR A C   1 
ATOM   1482 O O   . TYR A 1 211 ? 13.209  30.892  4.972   1.00 90.09  ?  1087 TYR A O   1 
ATOM   1483 C CB  . TYR A 1 211 ? 11.877  29.811  2.154   1.00 69.73  ?  1087 TYR A CB  1 
ATOM   1484 C CG  . TYR A 1 211 ? 12.133  28.544  2.951   1.00 64.76  ?  1087 TYR A CG  1 
ATOM   1485 C CD1 . TYR A 1 211 ? 11.090  27.859  3.568   1.00 63.83  ?  1087 TYR A CD1 1 
ATOM   1486 C CD2 . TYR A 1 211 ? 13.419  28.025  3.075   1.00 69.52  ?  1087 TYR A CD2 1 
ATOM   1487 C CE1 . TYR A 1 211 ? 11.326  26.702  4.295   1.00 73.13  ?  1087 TYR A CE1 1 
ATOM   1488 C CE2 . TYR A 1 211 ? 13.660  26.874  3.801   1.00 60.82  ?  1087 TYR A CE2 1 
ATOM   1489 C CZ  . TYR A 1 211 ? 12.611  26.215  4.404   1.00 75.61  ?  1087 TYR A CZ  1 
ATOM   1490 O OH  . TYR A 1 211 ? 12.851  25.069  5.124   1.00 72.47  ?  1087 TYR A OH  1 
ATOM   1491 N N   . ASP A 1 212 ? 14.257  31.685  3.146   1.00 81.80  ?  1088 ASP A N   1 
ATOM   1492 C CA  . ASP A 1 212 ? 15.515  31.883  3.849   1.00 86.38  ?  1088 ASP A CA  1 
ATOM   1493 C C   . ASP A 1 212 ? 15.433  33.016  4.859   1.00 83.39  ?  1088 ASP A C   1 
ATOM   1494 O O   . ASP A 1 212 ? 16.204  33.024  5.825   1.00 80.00  ?  1088 ASP A O   1 
ATOM   1495 C CB  . ASP A 1 212 ? 16.639  32.146  2.846   1.00 85.51  ?  1088 ASP A CB  1 
ATOM   1496 C CG  . ASP A 1 212 ? 16.939  30.938  1.984   1.00 104.49 ?  1088 ASP A CG  1 
ATOM   1497 O OD1 . ASP A 1 212 ? 16.365  29.864  2.256   1.00 115.21 ?  1088 ASP A OD1 1 
ATOM   1498 O OD2 . ASP A 1 212 ? 17.746  31.056  1.039   1.00 134.72 -1 1088 ASP A OD2 1 
ATOM   1499 N N   . SER A 1 213 ? 14.519  33.966  4.672   1.00 68.39  ?  1089 SER A N   1 
ATOM   1500 C CA  . SER A 1 213 ? 14.345  34.992  5.691   1.00 70.21  ?  1089 SER A CA  1 
ATOM   1501 C C   . SER A 1 213 ? 13.382  34.582  6.803   1.00 70.25  ?  1089 SER A C   1 
ATOM   1502 O O   . SER A 1 213 ? 13.402  35.197  7.876   1.00 63.96  ?  1089 SER A O   1 
ATOM   1503 C CB  . SER A 1 213 ? 13.872  36.302  5.049   1.00 70.58  ?  1089 SER A CB  1 
ATOM   1504 O OG  . SER A 1 213 ? 12.610  36.159  4.423   1.00 72.43  ?  1089 SER A OG  1 
ATOM   1505 N N   . LEU A 1 214 ? 12.552  33.562  6.590   1.00 60.11  ?  1090 LEU A N   1 
ATOM   1506 C CA  . LEU A 1 214 ? 11.557  33.184  7.586   1.00 54.45  ?  1090 LEU A CA  1 
ATOM   1507 C C   . LEU A 1 214 ? 12.157  32.325  8.696   1.00 66.76  ?  1090 LEU A C   1 
ATOM   1508 O O   . LEU A 1 214 ? 13.113  31.572  8.485   1.00 70.23  ?  1090 LEU A O   1 
ATOM   1509 C CB  . LEU A 1 214 ? 10.399  32.435  6.927   1.00 52.25  ?  1090 LEU A CB  1 
ATOM   1510 C CG  . LEU A 1 214 ? 9.421   33.257  6.084   1.00 54.17  ?  1090 LEU A CG  1 
ATOM   1511 C CD1 . LEU A 1 214 ? 8.322   32.365  5.524   1.00 56.47  ?  1090 LEU A CD1 1 
ATOM   1512 C CD2 . LEU A 1 214 ? 8.830   34.405  6.885   1.00 51.08  ?  1090 LEU A CD2 1 
ATOM   1513 N N   . ASP A 1 215 ? 11.580  32.450  9.891   1.00 62.60  ?  1091 ASP A N   1 
ATOM   1514 C CA  . ASP A 1 215 ? 11.931  31.591  11.013  1.00 53.19  ?  1091 ASP A CA  1 
ATOM   1515 C C   . ASP A 1 215 ? 11.323  30.201  10.834  1.00 56.39  ?  1091 ASP A C   1 
ATOM   1516 O O   . ASP A 1 215 ? 10.456  29.977  9.983   1.00 65.85  ?  1091 ASP A O   1 
ATOM   1517 C CB  . ASP A 1 215 ? 11.464  32.204  12.333  1.00 53.90  ?  1091 ASP A CB  1 
ATOM   1518 C CG  . ASP A 1 215 ? 10.042  32.707  12.269  1.00 67.37  ?  1091 ASP A CG  1 
ATOM   1519 O OD1 . ASP A 1 215 ? 9.837   33.860  11.838  1.00 65.94  ?  1091 ASP A OD1 1 
ATOM   1520 O OD2 . ASP A 1 215 ? 9.129   31.942  12.631  1.00 65.18  -1 1091 ASP A OD2 1 
ATOM   1521 N N   . ALA A 1 216 ? 11.791  29.261  11.663  1.00 64.89  ?  1092 ALA A N   1 
ATOM   1522 C CA  . ALA A 1 216 ? 11.414  27.860  11.497  1.00 49.94  ?  1092 ALA A CA  1 
ATOM   1523 C C   . ALA A 1 216 ? 9.905   27.669  11.524  1.00 56.01  ?  1092 ALA A C   1 
ATOM   1524 O O   . ALA A 1 216 ? 9.361   26.887  10.736  1.00 53.15  ?  1092 ALA A O   1 
ATOM   1525 C CB  . ALA A 1 216 ? 12.065  27.006  12.586  1.00 51.31  ?  1092 ALA A CB  1 
ATOM   1526 N N   . VAL A 1 217 ? 9.207   28.410  12.385  1.00 47.88  ?  1093 VAL A N   1 
ATOM   1527 C CA  . VAL A 1 217 ? 7.758   28.273  12.498  1.00 53.73  ?  1093 VAL A CA  1 
ATOM   1528 C C   . VAL A 1 217 ? 7.072   28.796  11.241  1.00 60.71  ?  1093 VAL A C   1 
ATOM   1529 O O   . VAL A 1 217 ? 6.263   28.098  10.610  1.00 62.66  ?  1093 VAL A O   1 
ATOM   1530 C CB  . VAL A 1 217 ? 7.261   29.003  13.763  1.00 56.19  ?  1093 VAL A CB  1 
ATOM   1531 C CG1 . VAL A 1 217 ? 5.837   28.590  14.123  1.00 57.43  ?  1093 VAL A CG1 1 
ATOM   1532 C CG2 . VAL A 1 217 ? 8.207   28.746  14.925  1.00 54.22  ?  1093 VAL A CG2 1 
ATOM   1533 N N   . ARG A 1 218 ? 7.408   30.021  10.833  1.00 69.25  ?  1094 ARG A N   1 
ATOM   1534 C CA  . ARG A 1 218 ? 6.838   30.542  9.598   1.00 65.49  ?  1094 ARG A CA  1 
ATOM   1535 C C   . ARG A 1 218 ? 7.336   29.771  8.378   1.00 72.60  ?  1094 ARG A C   1 
ATOM   1536 O O   . ARG A 1 218 ? 6.614   29.673  7.374   1.00 95.16  ?  1094 ARG A O   1 
ATOM   1537 C CB  . ARG A 1 218 ? 7.135   32.043  9.485   1.00 63.08  ?  1094 ARG A CB  1 
ATOM   1538 C CG  . ARG A 1 218 ? 6.350   32.886  10.507  1.00 85.02  ?  1094 ARG A CG  1 
ATOM   1539 C CD  . ARG A 1 218 ? 6.584   34.389  10.368  1.00 80.79  ?  1094 ARG A CD  1 
ATOM   1540 N NE  . ARG A 1 218 ? 7.383   34.933  11.467  1.00 71.17  ?  1094 ARG A NE  1 
ATOM   1541 C CZ  . ARG A 1 218 ? 6.885   35.599  12.506  1.00 72.74  ?  1094 ARG A CZ  1 
ATOM   1542 N NH1 . ARG A 1 218 ? 5.580   35.817  12.597  1.00 72.86  ?  1094 ARG A NH1 1 
ATOM   1543 N NH2 . ARG A 1 218 ? 7.693   36.056  13.455  1.00 62.41  ?  1094 ARG A NH2 1 
ATOM   1544 N N   . ARG A 1 219 ? 8.527   29.171  8.464   1.00 63.93  ?  1095 ARG A N   1 
ATOM   1545 C CA  . ARG A 1 219 ? 8.974   28.254  7.420   1.00 56.16  ?  1095 ARG A CA  1 
ATOM   1546 C C   . ARG A 1 219 ? 8.020   27.076  7.283   1.00 66.63  ?  1095 ARG A C   1 
ATOM   1547 O O   . ARG A 1 219 ? 7.638   26.695  6.168   1.00 76.12  ?  1095 ARG A O   1 
ATOM   1548 C CB  . ARG A 1 219 ? 10.383  27.746  7.725   1.00 49.58  ?  1095 ARG A CB  1 
ATOM   1549 C CG  . ARG A 1 219 ? 11.507  28.686  7.337   1.00 51.66  ?  1095 ARG A CG  1 
ATOM   1550 C CD  . ARG A 1 219 ? 12.834  27.954  7.423   1.00 51.85  ?  1095 ARG A CD  1 
ATOM   1551 N NE  . ARG A 1 219 ? 13.982  28.817  7.179   1.00 57.08  ?  1095 ARG A NE  1 
ATOM   1552 C CZ  . ARG A 1 219 ? 15.239  28.386  7.160   1.00 67.26  ?  1095 ARG A CZ  1 
ATOM   1553 N NH1 . ARG A 1 219 ? 15.506  27.102  7.368   1.00 61.42  ?  1095 ARG A NH1 1 
ATOM   1554 N NH2 . ARG A 1 219 ? 16.229  29.237  6.935   1.00 61.35  ?  1095 ARG A NH2 1 
ATOM   1555 N N   . ALA A 1 220 ? 7.648   26.466  8.409   1.00 82.86  ?  1096 ALA A N   1 
ATOM   1556 C CA  . ALA A 1 220 ? 6.693   25.367  8.350   1.00 73.72  ?  1096 ALA A CA  1 
ATOM   1557 C C   . ALA A 1 220 ? 5.356   25.826  7.784   1.00 69.45  ?  1096 ALA A C   1 
ATOM   1558 O O   . ALA A 1 220 ? 4.689   25.065  7.076   1.00 57.90  ?  1096 ALA A O   1 
ATOM   1559 C CB  . ALA A 1 220 ? 6.499   24.748  9.733   1.00 65.33  ?  1096 ALA A CB  1 
ATOM   1560 N N   . ALA A 1 221 ? 4.962   27.072  8.051   1.00 59.04  ?  1097 ALA A N   1 
ATOM   1561 C CA  . ALA A 1 221 ? 3.724   27.567  7.442   1.00 62.18  ?  1097 ALA A CA  1 
ATOM   1562 C C   . ALA A 1 221 ? 3.829   27.608  5.915   1.00 58.36  ?  1097 ALA A C   1 
ATOM   1563 O O   . ALA A 1 221 ? 2.922   27.143  5.195   1.00 64.91  ?  1097 ALA A O   1 
ATOM   1564 C CB  . ALA A 1 221 ? 3.393   28.953  7.988   1.00 55.13  ?  1097 ALA A CB  1 
ATOM   1565 N N   . LEU A 1 222 ? 4.941   28.142  5.404   1.00 54.10  ?  1098 LEU A N   1 
ATOM   1566 C CA  . LEU A 1 222 ? 5.129   28.193  3.955   1.00 54.43  ?  1098 LEU A CA  1 
ATOM   1567 C C   . LEU A 1 222 ? 5.130   26.789  3.356   1.00 57.48  ?  1098 LEU A C   1 
ATOM   1568 O O   . LEU A 1 222 ? 4.495   26.541  2.316   1.00 60.32  ?  1098 LEU A O   1 
ATOM   1569 C CB  . LEU A 1 222 ? 6.433   28.922  3.623   1.00 65.71  ?  1098 LEU A CB  1 
ATOM   1570 C CG  . LEU A 1 222 ? 6.729   29.265  2.163   1.00 71.06  ?  1098 LEU A CG  1 
ATOM   1571 C CD1 . LEU A 1 222 ? 5.581   30.048  1.552   1.00 67.53  ?  1098 LEU A CD1 1 
ATOM   1572 C CD2 . LEU A 1 222 ? 8.023   30.056  2.040   1.00 75.10  ?  1098 LEU A CD2 1 
ATOM   1573 N N   . ILE A 1 223 ? 5.820   25.854  4.016   1.00 59.41  ?  1099 ILE A N   1 
ATOM   1574 C CA  . ILE A 1 223 ? 5.853   24.470  3.547   1.00 61.44  ?  1099 ILE A CA  1 
ATOM   1575 C C   . ILE A 1 223 ? 4.450   23.884  3.521   1.00 68.99  ?  1099 ILE A C   1 
ATOM   1576 O O   . ILE A 1 223 ? 4.112   23.086  2.642   1.00 70.34  ?  1099 ILE A O   1 
ATOM   1577 C CB  . ILE A 1 223 ? 6.786   23.617  4.425   1.00 67.85  ?  1099 ILE A CB  1 
ATOM   1578 C CG1 . ILE A 1 223 ? 8.206   24.165  4.415   1.00 71.20  ?  1099 ILE A CG1 1 
ATOM   1579 C CG2 . ILE A 1 223 ? 6.781   22.171  3.945   1.00 65.11  ?  1099 ILE A CG2 1 
ATOM   1580 C CD1 . ILE A 1 223 ? 9.097   23.498  5.440   1.00 67.80  ?  1099 ILE A CD1 1 
ATOM   1581 N N   . ASN A 1 224 ? 3.627   24.235  4.512   1.00 73.15  ?  1100 ASN A N   1 
ATOM   1582 C CA  . ASN A 1 224 ? 2.253   23.743  4.559   1.00 81.33  ?  1100 ASN A CA  1 
ATOM   1583 C C   . ASN A 1 224 ? 1.485   24.165  3.316   1.00 76.96  ?  1100 ASN A C   1 
ATOM   1584 O O   . ASN A 1 224 ? 0.829   23.344  2.654   1.00 86.56  ?  1100 ASN A O   1 
ATOM   1585 C CB  . ASN A 1 224 ? 1.557   24.265  5.817   1.00 70.80  ?  1100 ASN A CB  1 
ATOM   1586 C CG  . ASN A 1 224 ? 0.236   23.567  6.087   1.00 68.61  ?  1100 ASN A CG  1 
ATOM   1587 O OD1 . ASN A 1 224 ? -0.741  23.757  5.361   1.00 81.64  ?  1100 ASN A OD1 1 
ATOM   1588 N ND2 . ASN A 1 224 ? 0.203   22.743  7.132   1.00 68.68  ?  1100 ASN A ND2 1 
ATOM   1589 N N   . MET A 1 225 ? 1.564   25.452  2.982   1.00 63.06  ?  1101 MET A N   1 
ATOM   1590 C CA  . MET A 1 225 ? 0.917   25.911  1.756   1.00 76.71  ?  1101 MET A CA  1 
ATOM   1591 C C   . MET A 1 225 ? 1.410   25.117  0.551   1.00 92.00  ?  1101 MET A C   1 
ATOM   1592 O O   . MET A 1 225 ? 0.610   24.654  -0.271  1.00 89.24  ?  1101 MET A O   1 
ATOM   1593 C CB  . MET A 1 225 ? 1.161   27.402  1.545   1.00 70.66  ?  1101 MET A CB  1 
ATOM   1594 C CG  . MET A 1 225 ? 0.393   28.283  2.498   1.00 69.62  ?  1101 MET A CG  1 
ATOM   1595 S SD  . MET A 1 225 ? 0.804   30.019  2.248   1.00 93.41  ?  1101 MET A SD  1 
ATOM   1596 C CE  . MET A 1 225 ? 0.025   30.314  0.665   1.00 83.29  ?  1101 MET A CE  1 
ATOM   1597 N N   . VAL A 1 226 ? 2.728   24.918  0.446   1.00 75.41  ?  1102 VAL A N   1 
ATOM   1598 C CA  . VAL A 1 226 ? 3.250   24.174  -0.708  1.00 69.83  ?  1102 VAL A CA  1 
ATOM   1599 C C   . VAL A 1 226 ? 2.754   22.729  -0.719  1.00 77.91  ?  1102 VAL A C   1 
ATOM   1600 O O   . VAL A 1 226 ? 2.494   22.159  -1.787  1.00 92.79  ?  1102 VAL A O   1 
ATOM   1601 C CB  . VAL A 1 226 ? 4.789   24.241  -0.752  1.00 70.49  ?  1102 VAL A CB  1 
ATOM   1602 C CG1 . VAL A 1 226 ? 5.328   23.338  -1.846  1.00 61.60  ?  1102 VAL A CG1 1 
ATOM   1603 C CG2 . VAL A 1 226 ? 5.229   25.672  -0.994  1.00 58.15  ?  1102 VAL A CG2 1 
ATOM   1604 N N   . PHE A 1 227 ? 2.611   22.117  0.456   1.00 71.97  ?  1103 PHE A N   1 
ATOM   1605 C CA  . PHE A 1 227 ? 2.121   20.744  0.527   1.00 68.96  ?  1103 PHE A CA  1 
ATOM   1606 C C   . PHE A 1 227 ? 0.678   20.653  0.051   1.00 75.30  ?  1103 PHE A C   1 
ATOM   1607 O O   . PHE A 1 227 ? 0.287   19.665  -0.584  1.00 67.91  ?  1103 PHE A O   1 
ATOM   1608 C CB  . PHE A 1 227 ? 2.246   20.216  1.956   1.00 54.10  ?  1103 PHE A CB  1 
ATOM   1609 C CG  . PHE A 1 227 ? 2.187   18.716  2.062   1.00 47.40  ?  1103 PHE A CG  1 
ATOM   1610 C CD1 . PHE A 1 227 ? 0.970   18.056  2.107   1.00 59.92  ?  1103 PHE A CD1 1 
ATOM   1611 C CD2 . PHE A 1 227 ? 3.352   17.967  2.135   1.00 48.54  ?  1103 PHE A CD2 1 
ATOM   1612 C CE1 . PHE A 1 227 ? 0.913   16.680  2.209   1.00 60.59  ?  1103 PHE A CE1 1 
ATOM   1613 C CE2 . PHE A 1 227 ? 3.301   16.591  2.241   1.00 61.46  ?  1103 PHE A CE2 1 
ATOM   1614 C CZ  . PHE A 1 227 ? 2.081   15.947  2.275   1.00 56.69  ?  1103 PHE A CZ  1 
ATOM   1615 N N   . GLN A 1 228 ? -0.133  21.667  0.350   1.00 81.07  ?  1104 GLN A N   1 
ATOM   1616 C CA  . GLN A 1 228 ? -1.513  21.614  -0.124  1.00 86.12  ?  1104 GLN A CA  1 
ATOM   1617 C C   . GLN A 1 228 ? -1.629  22.046  -1.586  1.00 90.55  ?  1104 GLN A C   1 
ATOM   1618 O O   . GLN A 1 228 ? -2.157  21.298  -2.417  1.00 77.69  ?  1104 GLN A O   1 
ATOM   1619 C CB  . GLN A 1 228 ? -2.414  22.470  0.764   1.00 85.96  ?  1104 GLN A CB  1 
ATOM   1620 C CG  . GLN A 1 228 ? -3.888  22.380  0.402   1.00 82.47  ?  1104 GLN A CG  1 
ATOM   1621 C CD  . GLN A 1 228 ? -4.732  23.340  1.211   1.00 89.39  ?  1104 GLN A CD  1 
ATOM   1622 O OE1 . GLN A 1 228 ? -4.218  24.306  1.774   1.00 87.43  ?  1104 GLN A OE1 1 
ATOM   1623 N NE2 . GLN A 1 228 ? -6.033  23.078  1.280   1.00 102.26 ?  1104 GLN A NE2 1 
ATOM   1624 N N   . MET A 1 229 ? -1.158  23.251  -1.920  1.00 81.26  ?  1105 MET A N   1 
ATOM   1625 C CA  . MET A 1 229 ? -1.327  23.782  -3.282  1.00 70.16  ?  1105 MET A CA  1 
ATOM   1626 C C   . MET A 1 229 ? -0.242  23.304  -4.238  1.00 77.08  ?  1105 MET A C   1 
ATOM   1627 O O   . MET A 1 229 ? -0.529  22.588  -5.210  1.00 82.06  ?  1105 MET A O   1 
ATOM   1628 C CB  . MET A 1 229 ? -1.384  25.311  -3.227  1.00 59.37  ?  1105 MET A CB  1 
ATOM   1629 C CG  . MET A 1 229 ? -2.444  25.847  -2.271  1.00 70.42  ?  1105 MET A CG  1 
ATOM   1630 S SD  . MET A 1 229 ? -2.418  27.645  -2.122  1.00 92.36  ?  1105 MET A SD  1 
ATOM   1631 C CE  . MET A 1 229 ? -2.994  28.123  -3.749  1.00 121.22 ?  1105 MET A CE  1 
ATOM   1632 N N   . GLY A 1 230 ? 1.001   23.680  -3.991  1.00 81.73  ?  1106 GLY A N   1 
ATOM   1633 C CA  . GLY A 1 230 ? 2.090   23.324  -4.882  1.00 78.95  ?  1106 GLY A CA  1 
ATOM   1634 C C   . GLY A 1 230 ? 3.131   24.420  -4.954  1.00 94.33  ?  1106 GLY A C   1 
ATOM   1635 O O   . GLY A 1 230 ? 2.927   25.545  -4.502  1.00 97.41  ?  1106 GLY A O   1 
ATOM   1636 N N   . GLU A 1 231 ? 4.270   24.066  -5.557  1.00 92.95  ?  1107 GLU A N   1 
ATOM   1637 C CA  . GLU A 1 231 ? 5.408   24.979  -5.611  1.00 104.33 ?  1107 GLU A CA  1 
ATOM   1638 C C   . GLU A 1 231 ? 5.098   26.205  -6.460  1.00 104.79 ?  1107 GLU A C   1 
ATOM   1639 O O   . GLU A 1 231 ? 5.258   27.344  -6.010  1.00 113.73 ?  1107 GLU A O   1 
ATOM   1640 C CB  . GLU A 1 231 ? 6.638   24.248  -6.146  1.00 107.86 ?  1107 GLU A CB  1 
ATOM   1641 N N   . THR A 1 232 ? 4.661   25.992  -7.699  1.00 101.15 ?  1108 THR A N   1 
ATOM   1642 C CA  . THR A 1 232 ? 4.308   27.114  -8.559  1.00 119.71 ?  1108 THR A CA  1 
ATOM   1643 C C   . THR A 1 232 ? 2.999   27.775  -8.143  1.00 118.45 ?  1108 THR A C   1 
ATOM   1644 O O   . THR A 1 232 ? 2.751   28.925  -8.525  1.00 127.88 ?  1108 THR A O   1 
ATOM   1645 C CB  . THR A 1 232 ? 4.221   26.653  -10.019 1.00 112.54 ?  1108 THR A CB  1 
ATOM   1646 O OG1 . THR A 1 232 ? 3.383   25.495  -10.108 1.00 128.49 ?  1108 THR A OG1 1 
ATOM   1647 C CG2 . THR A 1 232 ? 5.602   26.309  -10.558 1.00 108.89 ?  1108 THR A CG2 1 
ATOM   1648 N N   . GLY A 1 233 ? 2.155   27.072  -7.389  1.00 105.71 ?  1109 GLY A N   1 
ATOM   1649 C CA  . GLY A 1 233 ? 0.896   27.616  -6.917  1.00 90.73  ?  1109 GLY A CA  1 
ATOM   1650 C C   . GLY A 1 233 ? 1.045   28.774  -5.951  1.00 99.55  ?  1109 GLY A C   1 
ATOM   1651 O O   . GLY A 1 233 ? 0.535   29.870  -6.205  1.00 101.47 ?  1109 GLY A O   1 
ATOM   1652 N N   . VAL A 1 234 ? 1.745   28.547  -4.835  1.00 93.93  ?  1110 VAL A N   1 
ATOM   1653 C CA  . VAL A 1 234 ? 1.883   29.594  -3.829  1.00 86.15  ?  1110 VAL A CA  1 
ATOM   1654 C C   . VAL A 1 234 ? 2.826   30.697  -4.286  1.00 90.29  ?  1110 VAL A C   1 
ATOM   1655 O O   . VAL A 1 234 ? 2.814   31.791  -3.711  1.00 82.97  ?  1110 VAL A O   1 
ATOM   1656 C CB  . VAL A 1 234 ? 2.359   29.008  -2.486  1.00 68.43  ?  1110 VAL A CB  1 
ATOM   1657 C CG1 . VAL A 1 234 ? 1.454   27.867  -2.051  1.00 89.33  ?  1110 VAL A CG1 1 
ATOM   1658 C CG2 . VAL A 1 234 ? 3.795   28.545  -2.591  1.00 73.65  ?  1110 VAL A CG2 1 
ATOM   1659 N N   . ALA A 1 235 ? 3.655   30.441  -5.300  1.00 100.95 ?  1111 ALA A N   1 
ATOM   1660 C CA  . ALA A 1 235 ? 4.495   31.497  -5.855  1.00 105.96 ?  1111 ALA A CA  1 
ATOM   1661 C C   . ALA A 1 235 ? 3.667   32.606  -6.489  1.00 106.25 ?  1111 ALA A C   1 
ATOM   1662 O O   . ALA A 1 235 ? 4.195   33.694  -6.744  1.00 85.33  ?  1111 ALA A O   1 
ATOM   1663 C CB  . ALA A 1 235 ? 5.472   30.915  -6.881  1.00 104.59 ?  1111 ALA A CB  1 
ATOM   1664 N N   . GLY A 1 236 ? 2.383   32.352  -6.752  1.00 104.15 ?  1112 GLY A N   1 
ATOM   1665 C CA  . GLY A 1 236 ? 1.497   33.372  -7.280  1.00 105.35 ?  1112 GLY A CA  1 
ATOM   1666 C C   . GLY A 1 236 ? 1.126   34.447  -6.281  1.00 123.78 ?  1112 GLY A C   1 
ATOM   1667 O O   . GLY A 1 236 ? 0.684   35.529  -6.688  1.00 151.89 ?  1112 GLY A O   1 
ATOM   1668 N N   . PHE A 1 237 ? 1.301   34.181  -4.985  1.00 126.79 ?  1113 PHE A N   1 
ATOM   1669 C CA  . PHE A 1 237 ? 0.968   35.160  -3.957  1.00 108.44 ?  1113 PHE A CA  1 
ATOM   1670 C C   . PHE A 1 237 ? 2.042   36.236  -3.881  1.00 106.90 ?  1113 PHE A C   1 
ATOM   1671 O O   . PHE A 1 237 ? 2.588   36.493  -2.805  1.00 118.45 ?  1113 PHE A O   1 
ATOM   1672 C CB  . PHE A 1 237 ? 0.815   34.485  -2.591  1.00 93.96  ?  1113 PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 237 ? -0.370  33.569  -2.484  1.00 83.42  ?  1113 PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 237 ? -0.268  32.238  -2.850  1.00 75.65  ?  1113 PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 237 ? -1.578  34.033  -1.991  1.00 79.84  ?  1113 PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 237 ? -1.354  31.388  -2.741  1.00 70.20  ?  1113 PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 237 ? -2.668  33.189  -1.879  1.00 81.77  ?  1113 PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 237 ? -2.555  31.864  -2.254  1.00 69.74  ?  1113 PHE A CZ  1 
ATOM   1679 N N   . THR A 1 238 ? 2.342   36.865  -5.021  1.00 105.53 ?  1114 THR A N   1 
ATOM   1680 C CA  . THR A 1 238 ? 3.351   37.920  -5.077  1.00 99.58  ?  1114 THR A CA  1 
ATOM   1681 C C   . THR A 1 238 ? 3.141   38.942  -3.963  1.00 107.02 ?  1114 THR A C   1 
ATOM   1682 O O   . THR A 1 238 ? 4.069   39.254  -3.193  1.00 95.20  ?  1114 THR A O   1 
ATOM   1683 C CB  . THR A 1 238 ? 3.283   38.591  -6.457  1.00 95.16  ?  1114 THR A CB  1 
ATOM   1684 O OG1 . THR A 1 238 ? 3.496   37.608  -7.478  1.00 81.14  ?  1114 THR A OG1 1 
ATOM   1685 C CG2 . THR A 1 238 ? 4.313   39.706  -6.593  1.00 81.87  ?  1114 THR A CG2 1 
ATOM   1686 N N   . ASN A 1 239 ? 1.892   39.395  -3.809  1.00 131.76 ?  1115 ASN A N   1 
ATOM   1687 C CA  . ASN A 1 239 ? 1.551   40.478  -2.891  1.00 137.98 ?  1115 ASN A CA  1 
ATOM   1688 C C   . ASN A 1 239 ? 1.869   40.111  -1.448  1.00 139.53 ?  1115 ASN A C   1 
ATOM   1689 O O   . ASN A 1 239 ? 2.363   40.947  -0.684  1.00 135.77 ?  1115 ASN A O   1 
ATOM   1690 C CB  . ASN A 1 239 ? 0.063   40.812  -3.046  1.00 150.89 ?  1115 ASN A CB  1 
ATOM   1691 C CG  . ASN A 1 239 ? -0.286  42.219  -2.589  1.00 170.02 ?  1115 ASN A CG  1 
ATOM   1692 O OD1 . ASN A 1 239 ? 0.575   43.095  -2.515  1.00 189.43 ?  1115 ASN A OD1 1 
ATOM   1693 N ND2 . ASN A 1 239 ? -1.565  42.443  -2.293  1.00 174.26 ?  1115 ASN A ND2 1 
ATOM   1694 N N   . SER A 1 240 ? 1.583   38.871  -1.052  1.00 132.94 ?  1116 SER A N   1 
ATOM   1695 C CA  . SER A 1 240 ? 1.822   38.468  0.329   1.00 112.04 ?  1116 SER A CA  1 
ATOM   1696 C C   . SER A 1 240 ? 3.286   38.126  0.566   1.00 111.30 ?  1116 SER A C   1 
ATOM   1697 O O   . SER A 1 240 ? 3.827   38.407  1.644   1.00 111.70 ?  1116 SER A O   1 
ATOM   1698 C CB  . SER A 1 240 ? 0.937   37.274  0.693   1.00 108.31 ?  1116 SER A CB  1 
ATOM   1699 O OG  . SER A 1 240 ? -0.440  37.594  0.565   1.00 98.05  ?  1116 SER A OG  1 
ATOM   1700 N N   . LEU A 1 241 ? 3.931   37.501  -0.420  1.00 95.25  ?  1117 LEU A N   1 
ATOM   1701 C CA  . LEU A 1 241 ? 5.325   37.117  -0.250  1.00 80.58  ?  1117 LEU A CA  1 
ATOM   1702 C C   . LEU A 1 241 ? 6.210   38.336  -0.037  1.00 83.73  ?  1117 LEU A C   1 
ATOM   1703 O O   . LEU A 1 241 ? 7.117   38.303  0.810   1.00 89.83  ?  1117 LEU A O   1 
ATOM   1704 C CB  . LEU A 1 241 ? 5.803   36.308  -1.459  1.00 78.73  ?  1117 LEU A CB  1 
ATOM   1705 C CG  . LEU A 1 241 ? 5.121   34.958  -1.716  1.00 83.92  ?  1117 LEU A CG  1 
ATOM   1706 C CD1 . LEU A 1 241 ? 5.546   34.369  -3.057  1.00 72.67  ?  1117 LEU A CD1 1 
ATOM   1707 C CD2 . LEU A 1 241 ? 5.389   33.968  -0.590  1.00 90.76  ?  1117 LEU A CD2 1 
ATOM   1708 N N   . ARG A 1 242 ? 5.940   39.434  -0.751  1.00 97.00  ?  1118 ARG A N   1 
ATOM   1709 C CA  . ARG A 1 242 ? 6.780   40.616  -0.565  1.00 116.16 ?  1118 ARG A CA  1 
ATOM   1710 C C   . ARG A 1 242 ? 6.738   41.097  0.881   1.00 123.29 ?  1118 ARG A C   1 
ATOM   1711 O O   . ARG A 1 242 ? 7.783   41.347  1.492   1.00 114.00 ?  1118 ARG A O   1 
ATOM   1712 C CB  . ARG A 1 242 ? 6.355   41.740  -1.511  1.00 136.73 ?  1118 ARG A CB  1 
ATOM   1713 C CG  . ARG A 1 242 ? 7.113   43.050  -1.291  1.00 162.51 ?  1118 ARG A CG  1 
ATOM   1714 C CD  . ARG A 1 242 ? 8.613   42.896  -1.543  1.00 186.08 ?  1118 ARG A CD  1 
ATOM   1715 N NE  . ARG A 1 242 ? 9.299   44.185  -1.493  1.00 181.77 ?  1118 ARG A NE  1 
ATOM   1716 C CZ  . ARG A 1 242 ? 10.610  44.354  -1.644  1.00 185.31 ?  1118 ARG A CZ  1 
ATOM   1717 N NH1 . ARG A 1 242 ? 11.404  43.311  -1.857  1.00 176.23 ?  1118 ARG A NH1 1 
ATOM   1718 N NH2 . ARG A 1 242 ? 11.129  45.574  -1.583  1.00 179.57 ?  1118 ARG A NH2 1 
ATOM   1719 N N   . MET A 1 243 ? 5.541   41.211  1.455   1.00 128.56 ?  1119 MET A N   1 
ATOM   1720 C CA  . MET A 1 243 ? 5.422   41.734  2.809   1.00 123.00 ?  1119 MET A CA  1 
ATOM   1721 C C   . MET A 1 243 ? 5.776   40.707  3.875   1.00 118.29 ?  1119 MET A C   1 
ATOM   1722 O O   . MET A 1 243 ? 6.016   41.087  5.027   1.00 121.08 ?  1119 MET A O   1 
ATOM   1723 C CB  . MET A 1 243 ? 4.010   42.272  3.045   1.00 118.60 ?  1119 MET A CB  1 
ATOM   1724 C CG  . MET A 1 243 ? 2.905   41.406  2.471   1.00 143.22 ?  1119 MET A CG  1 
ATOM   1725 S SD  . MET A 1 243 ? 1.312   42.254  2.441   1.00 160.49 ?  1119 MET A SD  1 
ATOM   1726 C CE  . MET A 1 243 ? 1.656   43.589  1.297   1.00 160.66 ?  1119 MET A CE  1 
ATOM   1727 N N   . LEU A 1 244 ? 5.806   39.419  3.529   1.00 111.50 ?  1120 LEU A N   1 
ATOM   1728 C CA  . LEU A 1 244 ? 6.400   38.450  4.443   1.00 111.53 ?  1120 LEU A CA  1 
ATOM   1729 C C   . LEU A 1 244 ? 7.907   38.640  4.520   1.00 117.97 ?  1120 LEU A C   1 
ATOM   1730 O O   . LEU A 1 244 ? 8.493   38.572  5.607   1.00 124.00 ?  1120 LEU A O   1 
ATOM   1731 C CB  . LEU A 1 244 ? 6.063   37.026  4.010   1.00 95.94  ?  1120 LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 244 ? 4.678   36.489  4.366   1.00 93.18  ?  1120 LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 244 ? 4.504   35.119  3.753   1.00 70.12  ?  1120 LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 244 ? 4.479   36.424  5.873   1.00 87.49  ?  1120 LEU A CD2 1 
ATOM   1735 N N   . GLN A 1 245 ? 8.554   38.897  3.381   1.00 121.24 ?  1121 GLN A N   1 
ATOM   1736 C CA  . GLN A 1 245 ? 9.995   39.121  3.423   1.00 115.82 ?  1121 GLN A CA  1 
ATOM   1737 C C   . GLN A 1 245 ? 10.360  40.413  4.151   1.00 107.44 ?  1121 GLN A C   1 
ATOM   1738 O O   . GLN A 1 245 ? 11.500  40.552  4.608   1.00 92.96  ?  1121 GLN A O   1 
ATOM   1739 C CB  . GLN A 1 245 ? 10.571  39.127  2.007   1.00 115.91 ?  1121 GLN A CB  1 
ATOM   1740 C CG  . GLN A 1 245 ? 12.087  38.986  1.944   1.00 118.01 ?  1121 GLN A CG  1 
ATOM   1741 C CD  . GLN A 1 245 ? 12.578  38.803  0.523   1.00 114.19 ?  1121 GLN A CD  1 
ATOM   1742 O OE1 . GLN A 1 245 ? 11.787  38.535  -0.379  1.00 107.90 ?  1121 GLN A OE1 1 
ATOM   1743 N NE2 . GLN A 1 245 ? 13.884  38.951  0.313   1.00 126.99 ?  1121 GLN A NE2 1 
ATOM   1744 N N   . GLN A 1 246 ? 9.421   41.347  4.290   1.00 102.45 ?  1122 GLN A N   1 
ATOM   1745 C CA  . GLN A 1 246 ? 9.682   42.634  4.924   1.00 100.93 ?  1122 GLN A CA  1 
ATOM   1746 C C   . GLN A 1 246 ? 9.351   42.651  6.414   1.00 97.67  ?  1122 GLN A C   1 
ATOM   1747 O O   . GLN A 1 246 ? 9.274   43.734  7.002   1.00 80.50  ?  1122 GLN A O   1 
ATOM   1748 C CB  . GLN A 1 246 ? 8.891   43.738  4.219   1.00 109.82 ?  1122 GLN A CB  1 
ATOM   1749 C CG  . GLN A 1 246 ? 9.278   43.969  2.768   1.00 119.26 ?  1122 GLN A CG  1 
ATOM   1750 C CD  . GLN A 1 246 ? 8.492   45.108  2.130   1.00 118.21 ?  1122 GLN A CD  1 
ATOM   1751 O OE1 . GLN A 1 246 ? 7.301   45.283  2.394   1.00 110.45 ?  1122 GLN A OE1 1 
ATOM   1752 N NE2 . GLN A 1 246 ? 9.162   45.892  1.293   1.00 126.07 ?  1122 GLN A NE2 1 
ATOM   1753 N N   . LYS A 1 247 ? 9.138   41.485  7.028   1.00 92.99  ?  1123 LYS A N   1 
ATOM   1754 C CA  . LYS A 1 247 ? 8.784   41.314  8.437   1.00 88.09  ?  1123 LYS A CA  1 
ATOM   1755 C C   . LYS A 1 247 ? 7.449   41.951  8.803   1.00 94.98  ?  1123 LYS A C   1 
ATOM   1756 O O   . LYS A 1 247 ? 7.137   42.064  9.994   1.00 116.69 ?  1123 LYS A O   1 
ATOM   1757 C CB  . LYS A 1 247 ? 9.869   41.858  9.376   1.00 87.58  ?  1123 LYS A CB  1 
ATOM   1758 C CG  . LYS A 1 247 ? 11.280  41.405  9.046   1.00 81.86  ?  1123 LYS A CG  1 
ATOM   1759 C CD  . LYS A 1 247 ? 11.434  39.897  9.126   1.00 84.53  ?  1123 LYS A CD  1 
ATOM   1760 C CE  . LYS A 1 247 ? 12.885  39.496  8.917   1.00 84.84  ?  1123 LYS A CE  1 
ATOM   1761 N NZ  . LYS A 1 247 ? 13.058  38.022  8.808   1.00 104.11 ?  1123 LYS A NZ  1 
ATOM   1762 N N   . ARG A 1 248 ? 6.649   42.374  7.824   1.00 90.03  ?  1124 ARG A N   1 
ATOM   1763 C CA  . ARG A 1 248 ? 5.347   42.988  8.095   1.00 95.53  ?  1124 ARG A CA  1 
ATOM   1764 C C   . ARG A 1 248 ? 4.290   41.890  8.094   1.00 96.59  ?  1124 ARG A C   1 
ATOM   1765 O O   . ARG A 1 248 ? 3.651   41.608  7.080   1.00 91.21  ?  1124 ARG A O   1 
ATOM   1766 C CB  . ARG A 1 248 ? 5.041   44.082  7.081   1.00 109.30 ?  1124 ARG A CB  1 
ATOM   1767 C CG  . ARG A 1 248 ? 5.991   45.268  7.159   1.00 119.71 ?  1124 ARG A CG  1 
ATOM   1768 C CD  . ARG A 1 248 ? 5.510   46.433  6.309   1.00 116.18 ?  1124 ARG A CD  1 
ATOM   1769 N NE  . ARG A 1 248 ? 5.384   46.076  4.900   1.00 125.85 ?  1124 ARG A NE  1 
ATOM   1770 C CZ  . ARG A 1 248 ? 4.977   46.916  3.954   1.00 145.98 ?  1124 ARG A CZ  1 
ATOM   1771 N NH1 . ARG A 1 248 ? 4.654   48.164  4.268   1.00 158.91 ?  1124 ARG A NH1 1 
ATOM   1772 N NH2 . ARG A 1 248 ? 4.891   46.508  2.695   1.00 159.70 ?  1124 ARG A NH2 1 
ATOM   1773 N N   . TRP A 1 249 ? 4.098   41.273  9.262   1.00 100.34 ?  1125 TRP A N   1 
ATOM   1774 C CA  . TRP A 1 249 ? 3.297   40.054  9.343   1.00 96.27  ?  1125 TRP A CA  1 
ATOM   1775 C C   . TRP A 1 249 ? 1.804   40.351  9.260   1.00 106.87 ?  1125 TRP A C   1 
ATOM   1776 O O   . TRP A 1 249 ? 1.062   39.656  8.556   1.00 100.56 ?  1125 TRP A O   1 
ATOM   1777 C CB  . TRP A 1 249 ? 3.616   39.304  10.638  1.00 87.93  ?  1125 TRP A CB  1 
ATOM   1778 C CG  . TRP A 1 249 ? 5.091   39.182  10.939  1.00 77.02  ?  1125 TRP A CG  1 
ATOM   1779 C CD1 . TRP A 1 249 ? 5.754   39.701  12.014  1.00 74.56  ?  1125 TRP A CD1 1 
ATOM   1780 C CD2 . TRP A 1 249 ? 6.079   38.504  10.149  1.00 74.78  ?  1125 TRP A CD2 1 
ATOM   1781 N NE1 . TRP A 1 249 ? 7.090   39.385  11.945  1.00 76.43  ?  1125 TRP A NE1 1 
ATOM   1782 C CE2 . TRP A 1 249 ? 7.316   38.652  10.810  1.00 76.85  ?  1125 TRP A CE2 1 
ATOM   1783 C CE3 . TRP A 1 249 ? 6.037   37.786  8.949   1.00 76.91  ?  1125 TRP A CE3 1 
ATOM   1784 C CZ2 . TRP A 1 249 ? 8.499   38.110  10.311  1.00 77.22  ?  1125 TRP A CZ2 1 
ATOM   1785 C CZ3 . TRP A 1 249 ? 7.215   37.248  8.455   1.00 74.18  ?  1125 TRP A CZ3 1 
ATOM   1786 C CH2 . TRP A 1 249 ? 8.429   37.413  9.136   1.00 80.37  ?  1125 TRP A CH2 1 
ATOM   1787 N N   . ASP A 1 250 ? 1.340   41.366  9.993   1.00 100.43 ?  1126 ASP A N   1 
ATOM   1788 C CA  . ASP A 1 250 ? -0.097  41.601  10.114  1.00 103.69 ?  1126 ASP A CA  1 
ATOM   1789 C C   . ASP A 1 250 ? -0.710  42.045  8.786   1.00 109.50 ?  1126 ASP A C   1 
ATOM   1790 O O   . ASP A 1 250 ? -1.816  41.599  8.420   1.00 121.41 ?  1126 ASP A O   1 
ATOM   1791 C CB  . ASP A 1 250 ? -0.347  42.628  11.223  1.00 110.65 ?  1126 ASP A CB  1 
ATOM   1792 C CG  . ASP A 1 250 ? 0.294   42.224  12.552  1.00 122.43 ?  1126 ASP A CG  1 
ATOM   1793 O OD1 . ASP A 1 250 ? 1.495   42.508  12.749  1.00 138.01 ?  1126 ASP A OD1 1 
ATOM   1794 O OD2 . ASP A 1 250 ? -0.404  41.629  13.401  1.00 139.63 -1 1126 ASP A OD2 1 
ATOM   1795 N N   . GLU A 1 251 ? 0.013   42.882  8.035   1.00 105.39 ?  1127 GLU A N   1 
ATOM   1796 C CA  . GLU A 1 251 ? -0.421  43.268  6.697   1.00 110.59 ?  1127 GLU A CA  1 
ATOM   1797 C C   . GLU A 1 251 ? -0.580  42.040  5.810   1.00 118.00 ?  1127 GLU A C   1 
ATOM   1798 O O   . GLU A 1 251 ? -1.587  41.895  5.104   1.00 131.99 ?  1127 GLU A O   1 
ATOM   1799 C CB  . GLU A 1 251 ? 0.599   44.244  6.097   1.00 123.55 ?  1127 GLU A CB  1 
ATOM   1800 C CG  . GLU A 1 251 ? 0.182   44.973  4.823   1.00 137.53 ?  1127 GLU A CG  1 
ATOM   1801 C CD  . GLU A 1 251 ? 1.197   46.033  4.398   1.00 140.13 ?  1127 GLU A CD  1 
ATOM   1802 O OE1 . GLU A 1 251 ? 2.065   46.388  5.220   1.00 117.37 ?  1127 GLU A OE1 1 
ATOM   1803 O OE2 . GLU A 1 251 ? 1.134   46.507  3.244   1.00 139.39 -1 1127 GLU A OE2 1 
ATOM   1804 N N   . ALA A 1 252 ? 0.377   41.115  5.884   1.00 119.57 ?  1128 ALA A N   1 
ATOM   1805 C CA  . ALA A 1 252 ? 0.294   39.907  5.075   1.00 119.67 ?  1128 ALA A CA  1 
ATOM   1806 C C   . ALA A 1 252 ? -0.832  38.996  5.541   1.00 115.53 ?  1128 ALA A C   1 
ATOM   1807 O O   . ALA A 1 252 ? -1.418  38.281  4.728   1.00 114.00 ?  1128 ALA A O   1 
ATOM   1808 C CB  . ALA A 1 252 ? 1.624   39.154  5.099   1.00 116.83 ?  1128 ALA A CB  1 
ATOM   1809 N N   . ALA A 1 253 ? -1.161  39.007  6.832   1.00 109.84 ?  1129 ALA A N   1 
ATOM   1810 C CA  . ALA A 1 253 ? -2.291  38.204  7.290   1.00 104.30 ?  1129 ALA A CA  1 
ATOM   1811 C C   . ALA A 1 253 ? -3.583  38.686  6.648   1.00 98.57  ?  1129 ALA A C   1 
ATOM   1812 O O   . ALA A 1 253 ? -4.339  37.900  6.046   1.00 77.61  ?  1129 ALA A O   1 
ATOM   1813 C CB  . ALA A 1 253 ? -2.392  38.259  8.813   1.00 90.10  ?  1129 ALA A CB  1 
ATOM   1814 N N   . VAL A 1 254 ? -3.838  39.993  6.734   1.00 109.54 ?  1130 VAL A N   1 
ATOM   1815 C CA  . VAL A 1 254 ? -5.083  40.473  6.140   1.00 123.24 ?  1130 VAL A CA  1 
ATOM   1816 C C   . VAL A 1 254 ? -5.035  40.296  4.627   1.00 125.91 ?  1130 VAL A C   1 
ATOM   1817 O O   . VAL A 1 254 ? -6.072  40.079  3.990   1.00 133.55 ?  1130 VAL A O   1 
ATOM   1818 C CB  . VAL A 1 254 ? -5.400  41.932  6.536   1.00 111.36 ?  1130 VAL A CB  1 
ATOM   1819 C CG1 . VAL A 1 254 ? -4.400  42.913  5.944   1.00 88.34  ?  1130 VAL A CG1 1 
ATOM   1820 C CG2 . VAL A 1 254 ? -6.812  42.303  6.104   1.00 101.26 ?  1130 VAL A CG2 1 
ATOM   1821 N N   . ASN A 1 255 ? -3.839  40.333  4.030   1.00 116.08 ?  1131 ASN A N   1 
ATOM   1822 C CA  . ASN A 1 255 ? -3.755  40.153  2.583   1.00 105.81 ?  1131 ASN A CA  1 
ATOM   1823 C C   . ASN A 1 255 ? -4.032  38.707  2.188   1.00 106.96 ?  1131 ASN A C   1 
ATOM   1824 O O   . ASN A 1 255 ? -4.682  38.453  1.169   1.00 126.89 ?  1131 ASN A O   1 
ATOM   1825 C CB  . ASN A 1 255 ? -2.389  40.604  2.054   1.00 108.79 ?  1131 ASN A CB  1 
ATOM   1826 C CG  . ASN A 1 255 ? -2.372  40.733  0.531   1.00 115.09 ?  1131 ASN A CG  1 
ATOM   1827 O OD1 . ASN A 1 255 ? -2.935  41.677  -0.032  1.00 127.75 ?  1131 ASN A OD1 1 
ATOM   1828 N ND2 . ASN A 1 255 ? -1.736  39.779  -0.140  1.00 113.95 ?  1131 ASN A ND2 1 
ATOM   1829 N N   . LEU A 1 256 ? -3.550  37.745  2.978   1.00 105.20 ?  1132 LEU A N   1 
ATOM   1830 C CA  . LEU A 1 256 ? -3.786  36.337  2.689   1.00 103.04 ?  1132 LEU A CA  1 
ATOM   1831 C C   . LEU A 1 256 ? -5.234  35.943  2.908   1.00 102.60 ?  1132 LEU A C   1 
ATOM   1832 O O   . LEU A 1 256 ? -5.691  34.953  2.324   1.00 101.02 ?  1132 LEU A O   1 
ATOM   1833 C CB  . LEU A 1 256 ? -2.882  35.456  3.552   1.00 120.56 ?  1132 LEU A CB  1 
ATOM   1834 C CG  . LEU A 1 256 ? -1.429  35.286  3.104   1.00 114.59 ?  1132 LEU A CG  1 
ATOM   1835 C CD1 . LEU A 1 256 ? -0.605  34.701  4.233   1.00 114.39 ?  1132 LEU A CD1 1 
ATOM   1836 C CD2 . LEU A 1 256 ? -1.344  34.397  1.872   1.00 118.51 ?  1132 LEU A CD2 1 
ATOM   1837 N N   . ALA A 1 257 ? -5.967  36.686  3.736   1.00 109.33 ?  1133 ALA A N   1 
ATOM   1838 C CA  . ALA A 1 257 ? -7.393  36.386  3.835   1.00 111.92 ?  1133 ALA A CA  1 
ATOM   1839 C C   . ALA A 1 257 ? -8.136  36.703  2.535   1.00 110.94 ?  1133 ALA A C   1 
ATOM   1840 O O   . ALA A 1 257 ? -9.161  36.076  2.244   1.00 118.82 ?  1133 ALA A O   1 
ATOM   1841 C CB  . ALA A 1 257 ? -8.012  37.139  5.007   1.00 93.52  ?  1133 ALA A CB  1 
ATOM   1842 N N   . LYS A 1 258 ? -7.641  37.646  1.730   1.00 109.13 ?  1134 LYS A N   1 
ATOM   1843 C CA  . LYS A 1 258 ? -8.299  37.948  0.455   1.00 106.11 ?  1134 LYS A CA  1 
ATOM   1844 C C   . LYS A 1 258 ? -7.856  37.028  -0.674  1.00 109.26 ?  1134 LYS A C   1 
ATOM   1845 O O   . LYS A 1 258 ? -7.519  37.502  -1.763  1.00 108.87 ?  1134 LYS A O   1 
ATOM   1846 C CB  . LYS A 1 258 ? -8.041  39.400  0.062   1.00 101.36 ?  1134 LYS A CB  1 
ATOM   1847 C CG  . LYS A 1 258 ? -8.055  40.416  1.179   1.00 83.87  ?  1134 LYS A CG  1 
ATOM   1848 C CD  . LYS A 1 258 ? -7.517  41.748  0.662   1.00 79.90  ?  1134 LYS A CD  1 
ATOM   1849 C CE  . LYS A 1 258 ? -7.290  42.747  1.782   1.00 66.97  ?  1134 LYS A CE  1 
ATOM   1850 N NZ  . LYS A 1 258 ? -8.569  43.147  2.432   1.00 81.41  ?  1134 LYS A NZ  1 
ATOM   1851 N N   . SER A 1 259 ? -7.885  35.720  -0.465  1.00 108.35 ?  1135 SER A N   1 
ATOM   1852 C CA  . SER A 1 259 ? -7.330  34.766  -1.411  1.00 101.11 ?  1135 SER A CA  1 
ATOM   1853 C C   . SER A 1 259 ? -8.383  33.758  -1.848  1.00 89.42  ?  1135 SER A C   1 
ATOM   1854 O O   . SER A 1 259 ? -9.435  33.595  -1.223  1.00 72.62  ?  1135 SER A O   1 
ATOM   1855 C CB  . SER A 1 259 ? -6.130  34.035  -0.797  1.00 102.15 ?  1135 SER A CB  1 
ATOM   1856 O OG  . SER A 1 259 ? -5.092  34.941  -0.474  1.00 125.84 ?  1135 SER A OG  1 
ATOM   1857 N N   . ARG A 1 260 ? -8.070  33.073  -2.948  1.00 97.27  ?  1136 ARG A N   1 
ATOM   1858 C CA  . ARG A 1 260 ? -8.833  31.890  -3.319  1.00 107.83 ?  1136 ARG A CA  1 
ATOM   1859 C C   . ARG A 1 260 ? -8.601  30.768  -2.317  1.00 111.06 ?  1136 ARG A C   1 
ATOM   1860 O O   . ARG A 1 260 ? -9.530  30.017  -1.986  1.00 116.00 ?  1136 ARG A O   1 
ATOM   1861 C CB  . ARG A 1 260 ? -8.457  31.447  -4.740  1.00 114.24 ?  1136 ARG A CB  1 
ATOM   1862 C CG  . ARG A 1 260 ? -7.037  30.877  -4.932  1.00 143.50 ?  1136 ARG A CG  1 
ATOM   1863 C CD  . ARG A 1 260 ? -5.944  31.954  -4.977  1.00 148.34 ?  1136 ARG A CD  1 
ATOM   1864 N NE  . ARG A 1 260 ? -4.648  31.395  -5.363  1.00 140.96 ?  1136 ARG A NE  1 
ATOM   1865 C CZ  . ARG A 1 260 ? -3.551  32.114  -5.590  1.00 127.80 ?  1136 ARG A CZ  1 
ATOM   1866 N NH1 . ARG A 1 260 ? -3.577  33.435  -5.471  1.00 130.64 ?  1136 ARG A NH1 1 
ATOM   1867 N NH2 . ARG A 1 260 ? -2.423  31.507  -5.941  1.00 115.54 ?  1136 ARG A NH2 1 
ATOM   1868 N N   . TRP A 1 261 ? -7.373  30.673  -1.802  1.00 116.80 ?  1137 TRP A N   1 
ATOM   1869 C CA  . TRP A 1 261 ? -7.018  29.641  -0.837  1.00 96.51  ?  1137 TRP A CA  1 
ATOM   1870 C C   . TRP A 1 261 ? -7.826  29.784  0.445   1.00 96.19  ?  1137 TRP A C   1 
ATOM   1871 O O   . TRP A 1 261 ? -8.266  28.786  1.027   1.00 86.23  ?  1137 TRP A O   1 
ATOM   1872 C CB  . TRP A 1 261 ? -5.515  29.721  -0.563  1.00 96.61  ?  1137 TRP A CB  1 
ATOM   1873 C CG  . TRP A 1 261 ? -5.021  28.932  0.604   1.00 96.93  ?  1137 TRP A CG  1 
ATOM   1874 C CD1 . TRP A 1 261 ? -5.161  27.593  0.814   1.00 94.58  ?  1137 TRP A CD1 1 
ATOM   1875 C CD2 . TRP A 1 261 ? -4.265  29.435  1.709   1.00 80.19  ?  1137 TRP A CD2 1 
ATOM   1876 N NE1 . TRP A 1 261 ? -4.552  27.232  1.993   1.00 94.48  ?  1137 TRP A NE1 1 
ATOM   1877 C CE2 . TRP A 1 261 ? -3.996  28.347  2.563   1.00 86.97  ?  1137 TRP A CE2 1 
ATOM   1878 C CE3 . TRP A 1 261 ? -3.805  30.704  2.068   1.00 79.63  ?  1137 TRP A CE3 1 
ATOM   1879 C CZ2 . TRP A 1 261 ? -3.281  28.490  3.748   1.00 90.95  ?  1137 TRP A CZ2 1 
ATOM   1880 C CZ3 . TRP A 1 261 ? -3.098  30.844  3.239   1.00 88.21  ?  1137 TRP A CZ3 1 
ATOM   1881 C CH2 . TRP A 1 261 ? -2.841  29.744  4.067   1.00 96.22  ?  1137 TRP A CH2 1 
ATOM   1882 N N   . TYR A 1 262 ? -8.052  31.021  0.888   1.00 99.65  ?  1138 TYR A N   1 
ATOM   1883 C CA  . TYR A 1 262 ? -8.756  31.232  2.147   1.00 98.64  ?  1138 TYR A CA  1 
ATOM   1884 C C   . TYR A 1 262 ? -10.234 30.890  2.023   1.00 102.88 ?  1138 TYR A C   1 
ATOM   1885 O O   . TYR A 1 262 ? -10.843 30.394  2.978   1.00 116.37 ?  1138 TYR A O   1 
ATOM   1886 C CB  . TYR A 1 262 ? -8.582  32.677  2.613   1.00 105.68 ?  1138 TYR A CB  1 
ATOM   1887 C CG  . TYR A 1 262 ? -9.258  32.960  3.933   1.00 109.67 ?  1138 TYR A CG  1 
ATOM   1888 C CD1 . TYR A 1 262 ? -8.624  32.667  5.134   1.00 110.72 ?  1138 TYR A CD1 1 
ATOM   1889 C CD2 . TYR A 1 262 ? -10.537 33.504  3.981   1.00 121.37 ?  1138 TYR A CD2 1 
ATOM   1890 C CE1 . TYR A 1 262 ? -9.238  32.912  6.341   1.00 120.67 ?  1138 TYR A CE1 1 
ATOM   1891 C CE2 . TYR A 1 262 ? -11.158 33.751  5.188   1.00 127.19 ?  1138 TYR A CE2 1 
ATOM   1892 C CZ  . TYR A 1 262 ? -10.502 33.453  6.362   1.00 124.25 ?  1138 TYR A CZ  1 
ATOM   1893 O OH  . TYR A 1 262 ? -11.111 33.695  7.566   1.00 127.91 ?  1138 TYR A OH  1 
ATOM   1894 N N   . ASN A 1 263 ? -10.835 31.165  0.866   1.00 103.96 ?  1139 ASN A N   1 
ATOM   1895 C CA  . ASN A 1 263 ? -12.261 30.906  0.708   1.00 87.69  ?  1139 ASN A CA  1 
ATOM   1896 C C   . ASN A 1 263 ? -12.547 29.456  0.339   1.00 86.12  ?  1139 ASN A C   1 
ATOM   1897 O O   . ASN A 1 263 ? -13.647 28.962  0.614   1.00 103.03 ?  1139 ASN A O   1 
ATOM   1898 C CB  . ASN A 1 263 ? -12.864 31.859  -0.330  1.00 86.06  ?  1139 ASN A CB  1 
ATOM   1899 C CG  . ASN A 1 263 ? -12.820 33.313  0.121   1.00 90.52  ?  1139 ASN A CG  1 
ATOM   1900 O OD1 . ASN A 1 263 ? -11.876 33.731  0.793   1.00 96.54  ?  1139 ASN A OD1 1 
ATOM   1901 N ND2 . ASN A 1 263 ? -13.843 34.087  -0.239  1.00 78.63  ?  1139 ASN A ND2 1 
ATOM   1902 N N   . GLN A 1 264 ? -11.593 28.761  -0.285  1.00 87.87  ?  1140 GLN A N   1 
ATOM   1903 C CA  . GLN A 1 264 ? -11.827 27.360  -0.625  1.00 92.99  ?  1140 GLN A CA  1 
ATOM   1904 C C   . GLN A 1 264 ? -11.721 26.459  0.605   1.00 102.00 ?  1140 GLN A C   1 
ATOM   1905 O O   . GLN A 1 264 ? -12.611 25.643  0.863   1.00 114.46 ?  1140 GLN A O   1 
ATOM   1906 C CB  . GLN A 1 264 ? -10.852 26.906  -1.714  1.00 100.96 ?  1140 GLN A CB  1 
ATOM   1907 C CG  . GLN A 1 264 ? -11.079 25.478  -2.205  1.00 99.58  ?  1140 GLN A CG  1 
ATOM   1908 C CD  . GLN A 1 264 ? -12.191 25.360  -3.241  1.00 103.75 ?  1140 GLN A CD  1 
ATOM   1909 O OE1 . GLN A 1 264 ? -13.365 25.593  -2.947  1.00 127.96 ?  1140 GLN A OE1 1 
ATOM   1910 N NE2 . GLN A 1 264 ? -11.819 24.996  -4.464  1.00 93.02  ?  1140 GLN A NE2 1 
ATOM   1911 N N   . THR A 1 265 ? -10.639 26.590  1.373   1.00 98.10  ?  1141 THR A N   1 
ATOM   1912 C CA  . THR A 1 265 ? -10.415 25.802  2.590   1.00 94.97  ?  1141 THR A CA  1 
ATOM   1913 C C   . THR A 1 265 ? -10.131 26.750  3.750   1.00 86.28  ?  1141 THR A C   1 
ATOM   1914 O O   . THR A 1 265 ? -8.968  27.029  4.075   1.00 75.85  ?  1141 THR A O   1 
ATOM   1915 C CB  . THR A 1 265 ? -9.269  24.804  2.406   1.00 100.14 ?  1141 THR A CB  1 
ATOM   1916 O OG1 . THR A 1 265 ? -8.109  25.491  1.920   1.00 114.65 ?  1141 THR A OG1 1 
ATOM   1917 C CG2 . THR A 1 265 ? -9.659  23.701  1.424   1.00 100.78 ?  1141 THR A CG2 1 
ATOM   1918 N N   . PRO A 1 266 ? -11.178 27.249  4.415   1.00 85.08  ?  1142 PRO A N   1 
ATOM   1919 C CA  . PRO A 1 266 ? -10.968 28.329  5.395   1.00 92.32  ?  1142 PRO A CA  1 
ATOM   1920 C C   . PRO A 1 266 ? -10.368 27.869  6.715   1.00 92.90  ?  1142 PRO A C   1 
ATOM   1921 O O   . PRO A 1 266 ? -9.522  28.582  7.273   1.00 70.86  ?  1142 PRO A O   1 
ATOM   1922 C CB  . PRO A 1 266 ? -12.380 28.898  5.580   1.00 79.28  ?  1142 PRO A CB  1 
ATOM   1923 C CG  . PRO A 1 266 ? -13.289 27.729  5.301   1.00 70.86  ?  1142 PRO A CG  1 
ATOM   1924 C CD  . PRO A 1 266 ? -12.600 26.888  4.261   1.00 73.90  ?  1142 PRO A CD  1 
ATOM   1925 N N   . ASN A 1 267 ? -10.765 26.699  7.226   1.00 81.58  ?  1143 ASN A N   1 
ATOM   1926 C CA  . ASN A 1 267 ? -10.306 26.270  8.546   1.00 80.30  ?  1143 ASN A CA  1 
ATOM   1927 C C   . ASN A 1 267 ? -8.806  25.994  8.566   1.00 87.98  ?  1143 ASN A C   1 
ATOM   1928 O O   . ASN A 1 267 ? -8.144  26.242  9.582   1.00 78.51  ?  1143 ASN A O   1 
ATOM   1929 C CB  . ASN A 1 267 ? -11.083 25.027  9.000   1.00 76.26  ?  1143 ASN A CB  1 
ATOM   1930 C CG  . ASN A 1 267 ? -12.576 25.291  9.161   1.00 74.08  ?  1143 ASN A CG  1 
ATOM   1931 O OD1 . ASN A 1 267 ? -13.013 26.442  9.227   1.00 69.94  ?  1143 ASN A OD1 1 
ATOM   1932 N ND2 . ASN A 1 267 ? -13.361 24.221  9.242   1.00 71.86  ?  1143 ASN A ND2 1 
ATOM   1933 N N   . ARG A 1 268 ? -8.256  25.482  7.465   1.00 86.96  ?  1144 ARG A N   1 
ATOM   1934 C CA  . ARG A 1 268 ? -6.818  25.247  7.375   1.00 72.26  ?  1144 ARG A CA  1 
ATOM   1935 C C   . ARG A 1 268 ? -6.068  26.552  7.127   1.00 68.28  ?  1144 ARG A C   1 
ATOM   1936 O O   . ARG A 1 268 ? -4.988  26.788  7.698   1.00 72.47  ?  1144 ARG A O   1 
ATOM   1937 C CB  . ARG A 1 268 ? -6.543  24.234  6.258   1.00 63.45  ?  1144 ARG A CB  1 
ATOM   1938 C CG  . ARG A 1 268 ? -5.101  23.796  6.103   1.00 53.21  ?  1144 ARG A CG  1 
ATOM   1939 C CD  . ARG A 1 268 ? -4.896  23.079  4.779   1.00 75.95  ?  1144 ARG A CD  1 
ATOM   1940 N NE  . ARG A 1 268 ? -3.495  22.740  4.556   1.00 76.71  ?  1144 ARG A NE  1 
ATOM   1941 C CZ  . ARG A 1 268 ? -3.020  21.500  4.509   1.00 79.08  ?  1144 ARG A CZ  1 
ATOM   1942 N NH1 . ARG A 1 268 ? -3.835  20.464  4.655   1.00 76.28  ?  1144 ARG A NH1 1 
ATOM   1943 N NH2 . ARG A 1 268 ? -1.728  21.296  4.303   1.00 83.76  ?  1144 ARG A NH2 1 
ATOM   1944 N N   . ALA A 1 269 ? -6.656  27.419  6.299   1.00 66.20  ?  1145 ALA A N   1 
ATOM   1945 C CA  . ALA A 1 269 ? -6.021  28.685  5.958   1.00 73.63  ?  1145 ALA A CA  1 
ATOM   1946 C C   . ALA A 1 269 ? -5.876  29.580  7.179   1.00 62.61  ?  1145 ALA A C   1 
ATOM   1947 O O   . ALA A 1 269 ? -4.851  30.247  7.338   1.00 60.79  ?  1145 ALA A O   1 
ATOM   1948 C CB  . ALA A 1 269 ? -6.818  29.397  4.866   1.00 78.39  ?  1145 ALA A CB  1 
ATOM   1949 N N   . LYS A 1 270 ? -6.887  29.614  8.052   1.00 59.89  ?  1146 LYS A N   1 
ATOM   1950 C CA  . LYS A 1 270 ? -6.771  30.455  9.241   1.00 53.78  ?  1146 LYS A CA  1 
ATOM   1951 C C   . LYS A 1 270 ? -5.656  29.972  10.160  1.00 57.81  ?  1146 LYS A C   1 
ATOM   1952 O O   . LYS A 1 270 ? -4.930  30.789  10.736  1.00 66.88  ?  1146 LYS A O   1 
ATOM   1953 C CB  . LYS A 1 270 ? -8.102  30.508  9.993   1.00 44.56  ?  1146 LYS A CB  1 
ATOM   1954 N N   . ARG A 1 271 ? -5.487  28.655  10.290  1.00 60.36  ?  1147 ARG A N   1 
ATOM   1955 C CA  . ARG A 1 271 ? -4.388  28.138  11.098  1.00 59.18  ?  1147 ARG A CA  1 
ATOM   1956 C C   . ARG A 1 271 ? -3.047  28.568  10.518  1.00 64.90  ?  1147 ARG A C   1 
ATOM   1957 O O   . ARG A 1 271 ? -2.175  29.077  11.240  1.00 68.80  ?  1147 ARG A O   1 
ATOM   1958 C CB  . ARG A 1 271 ? -4.462  26.611  11.191  1.00 69.14  ?  1147 ARG A CB  1 
ATOM   1959 C CG  . ARG A 1 271 ? -5.646  26.084  11.991  1.00 63.83  ?  1147 ARG A CG  1 
ATOM   1960 C CD  . ARG A 1 271 ? -5.557  24.575  12.222  1.00 68.74  ?  1147 ARG A CD  1 
ATOM   1961 N NE  . ARG A 1 271 ? -5.822  23.800  11.012  1.00 73.52  ?  1147 ARG A NE  1 
ATOM   1962 C CZ  . ARG A 1 271 ? -7.004  23.273  10.707  1.00 85.80  ?  1147 ARG A CZ  1 
ATOM   1963 N NH1 . ARG A 1 271 ? -8.034  23.435  11.527  1.00 75.99  ?  1147 ARG A NH1 1 
ATOM   1964 N NH2 . ARG A 1 271 ? -7.158  22.582  9.585   1.00 96.47  ?  1147 ARG A NH2 1 
ATOM   1965 N N   . VAL A 1 272 ? -2.876  28.399  9.204   1.00 55.82  ?  1148 VAL A N   1 
ATOM   1966 C CA  . VAL A 1 272 ? -1.593  28.755  8.597   1.00 57.32  ?  1148 VAL A CA  1 
ATOM   1967 C C   . VAL A 1 272 ? -1.339  30.258  8.708   1.00 54.05  ?  1148 VAL A C   1 
ATOM   1968 O O   . VAL A 1 272 ? -0.211  30.696  8.973   1.00 54.48  ?  1148 VAL A O   1 
ATOM   1969 C CB  . VAL A 1 272 ? -1.528  28.267  7.137   1.00 61.98  ?  1148 VAL A CB  1 
ATOM   1970 C CG1 . VAL A 1 272 ? -0.204  28.659  6.501   1.00 48.47  ?  1148 VAL A CG1 1 
ATOM   1971 C CG2 . VAL A 1 272 ? -1.713  26.754  7.077   1.00 45.81  ?  1148 VAL A CG2 1 
ATOM   1972 N N   . ILE A 1 273 ? -2.381  31.070  8.524   1.00 54.62  ?  1149 ILE A N   1 
ATOM   1973 C CA  . ILE A 1 273 ? -2.217  32.518  8.580   1.00 69.81  ?  1149 ILE A CA  1 
ATOM   1974 C C   . ILE A 1 273 ? -1.893  32.967  9.995   1.00 71.36  ?  1149 ILE A C   1 
ATOM   1975 O O   . ILE A 1 273 ? -1.112  33.902  10.195  1.00 69.98  ?  1149 ILE A O   1 
ATOM   1976 C CB  . ILE A 1 273 ? -3.475  33.223  8.041   1.00 65.10  ?  1149 ILE A CB  1 
ATOM   1977 C CG1 . ILE A 1 273 ? -3.676  32.911  6.561   1.00 58.54  ?  1149 ILE A CG1 1 
ATOM   1978 C CG2 . ILE A 1 273 ? -3.390  34.731  8.246   1.00 64.01  ?  1149 ILE A CG2 1 
ATOM   1979 C CD1 . ILE A 1 273 ? -4.974  33.461  6.007   1.00 56.84  ?  1149 ILE A CD1 1 
ATOM   1980 N N   . THR A 1 274 ? -2.502  32.329  10.997  1.00 74.96  ?  1150 THR A N   1 
ATOM   1981 C CA  . THR A 1 274 ? -2.128  32.615  12.375  1.00 73.79  ?  1150 THR A CA  1 
ATOM   1982 C C   . THR A 1 274 ? -0.662  32.298  12.602  1.00 75.87  ?  1150 THR A C   1 
ATOM   1983 O O   . THR A 1 274 ? 0.059   33.072  13.246  1.00 64.84  ?  1150 THR A O   1 
ATOM   1984 C CB  . THR A 1 274 ? -3.003  31.812  13.339  1.00 66.85  ?  1150 THR A CB  1 
ATOM   1985 O OG1 . THR A 1 274 ? -4.374  32.195  13.182  1.00 72.25  ?  1150 THR A OG1 1 
ATOM   1986 C CG2 . THR A 1 274 ? -2.583  32.047  14.785  1.00 66.14  ?  1150 THR A CG2 1 
ATOM   1987 N N   . THR A 1 275 ? -0.203  31.158  12.077  1.00 67.07  ?  1151 THR A N   1 
ATOM   1988 C CA  . THR A 1 275 ? 1.204   30.800  12.230  1.00 57.96  ?  1151 THR A CA  1 
ATOM   1989 C C   . THR A 1 275 ? 2.109   31.849  11.593  1.00 56.25  ?  1151 THR A C   1 
ATOM   1990 O O   . THR A 1 275 ? 3.179   32.160  12.126  1.00 57.85  ?  1151 THR A O   1 
ATOM   1991 C CB  . THR A 1 275 ? 1.473   29.421  11.629  1.00 50.78  ?  1151 THR A CB  1 
ATOM   1992 O OG1 . THR A 1 275 ? 0.596   28.458  12.223  1.00 53.29  ?  1151 THR A OG1 1 
ATOM   1993 C CG2 . THR A 1 275 ? 2.915   28.997  11.889  1.00 50.71  ?  1151 THR A CG2 1 
ATOM   1994 N N   . PHE A 1 276 ? 1.704   32.388  10.439  1.00 63.47  ?  1152 PHE A N   1 
ATOM   1995 C CA  . PHE A 1 276 ? 2.468   33.470  9.816   1.00 69.83  ?  1152 PHE A CA  1 
ATOM   1996 C C   . PHE A 1 276 ? 2.453   34.724  10.681  1.00 65.51  ?  1152 PHE A C   1 
ATOM   1997 O O   . PHE A 1 276 ? 3.490   35.364  10.890  1.00 65.51  ?  1152 PHE A O   1 
ATOM   1998 C CB  . PHE A 1 276 ? 1.911   33.794  8.426   1.00 77.93  ?  1152 PHE A CB  1 
ATOM   1999 C CG  . PHE A 1 276 ? 2.399   32.878  7.341   1.00 74.32  ?  1152 PHE A CG  1 
ATOM   2000 C CD1 . PHE A 1 276 ? 3.745   32.818  7.012   1.00 89.23  ?  1152 PHE A CD1 1 
ATOM   2001 C CD2 . PHE A 1 276 ? 1.505   32.098  6.628   1.00 68.32  ?  1152 PHE A CD2 1 
ATOM   2002 C CE1 . PHE A 1 276 ? 4.190   31.975  6.004   1.00 84.34  ?  1152 PHE A CE1 1 
ATOM   2003 C CE2 . PHE A 1 276 ? 1.944   31.258  5.620   1.00 82.32  ?  1152 PHE A CE2 1 
ATOM   2004 C CZ  . PHE A 1 276 ? 3.286   31.196  5.307   1.00 74.99  ?  1152 PHE A CZ  1 
ATOM   2005 N N   . ARG A 1 277 ? 1.272   35.094  11.175  1.00 60.39  ?  1153 ARG A N   1 
ATOM   2006 C CA  . ARG A 1 277 ? 1.098   36.364  11.869  1.00 57.54  ?  1153 ARG A CA  1 
ATOM   2007 C C   . ARG A 1 277 ? 1.869   36.392  13.183  1.00 70.48  ?  1153 ARG A C   1 
ATOM   2008 O O   . ARG A 1 277 ? 2.487   37.406  13.525  1.00 86.94  ?  1153 ARG A O   1 
ATOM   2009 C CB  . ARG A 1 277 ? -0.393  36.613  12.106  1.00 59.17  ?  1153 ARG A CB  1 
ATOM   2010 C CG  . ARG A 1 277 ? -0.744  37.944  12.739  1.00 63.92  ?  1153 ARG A CG  1 
ATOM   2011 C CD  . ARG A 1 277 ? -2.253  38.099  12.879  1.00 70.25  ?  1153 ARG A CD  1 
ATOM   2012 N NE  . ARG A 1 277 ? -2.830  37.083  13.756  1.00 72.16  ?  1153 ARG A NE  1 
ATOM   2013 C CZ  . ARG A 1 277 ? -2.826  37.159  15.083  1.00 92.54  ?  1153 ARG A CZ  1 
ATOM   2014 N NH1 . ARG A 1 277 ? -2.272  38.203  15.683  1.00 89.23  ?  1153 ARG A NH1 1 
ATOM   2015 N NH2 . ARG A 1 277 ? -3.372  36.193  15.810  1.00 97.63  ?  1153 ARG A NH2 1 
ATOM   2016 N N   . THR A 1 278 ? 1.853   35.287  13.926  1.00 71.48  ?  1154 THR A N   1 
ATOM   2017 C CA  . THR A 1 278 ? 2.429   35.244  15.264  1.00 67.34  ?  1154 THR A CA  1 
ATOM   2018 C C   . THR A 1 278 ? 3.755   34.502  15.336  1.00 57.52  ?  1154 THR A C   1 
ATOM   2019 O O   . THR A 1 278 ? 4.589   34.824  16.190  1.00 51.80  ?  1154 THR A O   1 
ATOM   2020 C CB  . THR A 1 278 ? 1.443   34.582  16.231  1.00 80.74  ?  1154 THR A CB  1 
ATOM   2021 O OG1 . THR A 1 278 ? 1.210   33.231  15.818  1.00 81.14  ?  1154 THR A OG1 1 
ATOM   2022 C CG2 . THR A 1 278 ? 0.113   35.320  16.237  1.00 85.77  ?  1154 THR A CG2 1 
ATOM   2023 N N   . GLY A 1 279 ? 3.970   33.517  14.469  1.00 53.12  ?  1155 GLY A N   1 
ATOM   2024 C CA  . GLY A 1 279 ? 5.156   32.696  14.572  1.00 48.59  ?  1155 GLY A CA  1 
ATOM   2025 C C   . GLY A 1 279 ? 5.087   31.634  15.640  1.00 59.17  ?  1155 GLY A C   1 
ATOM   2026 O O   . GLY A 1 279 ? 6.129   31.210  16.148  1.00 65.53  ?  1155 GLY A O   1 
ATOM   2027 N N   . THR A 1 280 ? 3.889   31.185  16.000  1.00 52.05  ?  1156 THR A N   1 
ATOM   2028 C CA  . THR A 1 280 ? 3.692   30.201  17.055  1.00 56.09  ?  1156 THR A CA  1 
ATOM   2029 C C   . THR A 1 280 ? 2.801   29.072  16.543  1.00 52.25  ?  1156 THR A C   1 
ATOM   2030 O O   . THR A 1 280 ? 2.280   29.113  15.425  1.00 48.86  ?  1156 THR A O   1 
ATOM   2031 C CB  . THR A 1 280 ? 3.071   30.844  18.302  1.00 53.65  ?  1156 THR A CB  1 
ATOM   2032 O OG1 . THR A 1 280 ? 1.771   31.349  17.975  1.00 57.41  ?  1156 THR A OG1 1 
ATOM   2033 C CG2 . THR A 1 280 ? 3.935   31.996  18.808  1.00 56.24  ?  1156 THR A CG2 1 
ATOM   2034 N N   . TRP A 1 281 ? 2.616   28.057  17.389  1.00 48.83  ?  1157 TRP A N   1 
ATOM   2035 C CA  . TRP A 1 281 ? 1.769   26.910  17.087  1.00 49.19  ?  1157 TRP A CA  1 
ATOM   2036 C C   . TRP A 1 281 ? 0.397   27.013  17.742  1.00 52.32  ?  1157 TRP A C   1 
ATOM   2037 O O   . TRP A 1 281 ? -0.294  25.997  17.878  1.00 39.44  ?  1157 TRP A O   1 
ATOM   2038 C CB  . TRP A 1 281 ? 2.442   25.610  17.536  1.00 46.76  ?  1157 TRP A CB  1 
ATOM   2039 C CG  . TRP A 1 281 ? 3.760   25.344  16.897  1.00 50.68  ?  1157 TRP A CG  1 
ATOM   2040 C CD1 . TRP A 1 281 ? 4.972   25.270  17.517  1.00 43.48  ?  1157 TRP A CD1 1 
ATOM   2041 C CD2 . TRP A 1 281 ? 4.001   25.106  15.510  1.00 48.03  ?  1157 TRP A CD2 1 
ATOM   2042 N NE1 . TRP A 1 281 ? 5.957   25.007  16.597  1.00 46.28  ?  1157 TRP A NE1 1 
ATOM   2043 C CE2 . TRP A 1 281 ? 5.387   24.899  15.356  1.00 47.46  ?  1157 TRP A CE2 1 
ATOM   2044 C CE3 . TRP A 1 281 ? 3.181   25.053  14.380  1.00 44.98  ?  1157 TRP A CE3 1 
ATOM   2045 C CZ2 . TRP A 1 281 ? 5.968   24.644  14.118  1.00 45.77  ?  1157 TRP A CZ2 1 
ATOM   2046 C CZ3 . TRP A 1 281 ? 3.759   24.801  13.154  1.00 45.20  ?  1157 TRP A CZ3 1 
ATOM   2047 C CH2 . TRP A 1 281 ? 5.138   24.597  13.032  1.00 50.16  ?  1157 TRP A CH2 1 
ATOM   2048 N N   . ASP A 1 282 ? -0.006  28.213  18.166  1.00 52.02  ?  1158 ASP A N   1 
ATOM   2049 C CA  . ASP A 1 282 ? -1.210  28.337  18.984  1.00 55.18  ?  1158 ASP A CA  1 
ATOM   2050 C C   . ASP A 1 282 ? -2.462  27.896  18.238  1.00 66.48  ?  1158 ASP A C   1 
ATOM   2051 O O   . ASP A 1 282 ? -3.421  27.435  18.864  1.00 82.54  ?  1158 ASP A O   1 
ATOM   2052 C CB  . ASP A 1 282 ? -1.359  29.772  19.489  1.00 63.97  ?  1158 ASP A CB  1 
ATOM   2053 C CG  . ASP A 1 282 ? -0.309  30.133  20.520  1.00 80.80  ?  1158 ASP A CG  1 
ATOM   2054 O OD1 . ASP A 1 282 ? 0.638   29.342  20.697  1.00 95.37  ?  1158 ASP A OD1 1 
ATOM   2055 O OD2 . ASP A 1 282 ? -0.434  31.196  21.164  1.00 73.24  -1 1158 ASP A OD2 1 
ATOM   2056 N N   . ALA A 1 283 ? -2.481  28.034  16.916  1.00 62.57  ?  1159 ALA A N   1 
ATOM   2057 C CA  . ALA A 1 283 ? -3.634  27.623  16.123  1.00 51.77  ?  1159 ALA A CA  1 
ATOM   2058 C C   . ALA A 1 283 ? -3.733  26.112  15.948  1.00 56.28  ?  1159 ALA A C   1 
ATOM   2059 O O   . ALA A 1 283 ? -4.687  25.637  15.323  1.00 47.50  ?  1159 ALA A O   1 
ATOM   2060 C CB  . ALA A 1 283 ? -3.591  28.298  14.751  1.00 41.21  ?  1159 ALA A CB  1 
ATOM   2061 N N   . TYR A 1 284 ? -2.783  25.349  16.483  1.00 50.61  ?  1160 TYR A N   1 
ATOM   2062 C CA  . TYR A 1 284 ? -2.855  23.896  16.480  1.00 48.10  ?  1160 TYR A CA  1 
ATOM   2063 C C   . TYR A 1 284 ? -2.913  23.322  17.886  1.00 55.51  ?  1160 TYR A C   1 
ATOM   2064 O O   . TYR A 1 284 ? -2.864  22.097  18.046  1.00 63.21  ?  1160 TYR A O   1 
ATOM   2065 C CB  . TYR A 1 284 ? -1.658  23.299  15.726  1.00 38.11  ?  1160 TYR A CB  1 
ATOM   2066 C CG  . TYR A 1 284 ? -1.709  23.521  14.230  1.00 43.19  ?  1160 TYR A CG  1 
ATOM   2067 C CD1 . TYR A 1 284 ? -1.353  24.744  13.681  1.00 47.48  ?  1160 TYR A CD1 1 
ATOM   2068 C CD2 . TYR A 1 284 ? -2.113  22.507  13.367  1.00 52.09  ?  1160 TYR A CD2 1 
ATOM   2069 C CE1 . TYR A 1 284 ? -1.397  24.953  12.316  1.00 54.25  ?  1160 TYR A CE1 1 
ATOM   2070 C CE2 . TYR A 1 284 ? -2.158  22.709  11.997  1.00 50.10  ?  1160 TYR A CE2 1 
ATOM   2071 C CZ  . TYR A 1 284 ? -1.802  23.933  11.479  1.00 61.98  ?  1160 TYR A CZ  1 
ATOM   2072 O OH  . TYR A 1 284 ? -1.848  24.131  10.120  1.00 63.54  ?  1160 TYR A OH  1 
ATOM   2073 N N   . SER A 1 285 ? -3.000  24.170  18.903  1.00 75.66  ?  261  SER A N   1 
ATOM   2074 C CA  . SER A 1 285 ? -3.033  23.721  20.284  1.00 83.85  ?  261  SER A CA  1 
ATOM   2075 C C   . SER A 1 285 ? -4.459  23.402  20.712  1.00 80.30  ?  261  SER A C   1 
ATOM   2076 O O   . SER A 1 285 ? -5.417  24.050  20.284  1.00 99.73  ?  261  SER A O   1 
ATOM   2077 C CB  . SER A 1 285 ? -2.438  24.793  21.202  1.00 79.98  ?  261  SER A CB  1 
ATOM   2078 O OG  . SER A 1 285 ? -2.400  24.352  22.547  1.00 103.53 ?  261  SER A OG  1 
ATOM   2079 N N   . GLU A 1 286 ? -4.590  22.387  21.564  1.00 73.69  ?  262  GLU A N   1 
ATOM   2080 C CA  . GLU A 1 286 ? -5.856  22.086  22.217  1.00 70.31  ?  262  GLU A CA  1 
ATOM   2081 C C   . GLU A 1 286 ? -5.983  22.921  23.485  1.00 66.27  ?  262  GLU A C   1 
ATOM   2082 O O   . GLU A 1 286 ? -5.025  23.056  24.252  1.00 75.37  ?  262  GLU A O   1 
ATOM   2083 C CB  . GLU A 1 286 ? -5.965  20.595  22.547  1.00 68.38  ?  262  GLU A CB  1 
ATOM   2084 C CG  . GLU A 1 286 ? -6.107  19.699  21.328  1.00 73.91  ?  262  GLU A CG  1 
ATOM   2085 C CD  . GLU A 1 286 ? -6.458  18.270  21.692  1.00 93.13  ?  262  GLU A CD  1 
ATOM   2086 O OE1 . GLU A 1 286 ? -5.573  17.545  22.190  1.00 92.58  ?  262  GLU A OE1 1 
ATOM   2087 O OE2 . GLU A 1 286 ? -7.627  17.877  21.491  1.00 106.54 -1 262  GLU A OE2 1 
ATOM   2088 N N   . GLN A 1 287 ? -7.176  23.480  23.701  1.00 67.48  ?  263  GLN A N   1 
ATOM   2089 C CA  . GLN A 1 287 ? -7.370  24.473  24.750  1.00 56.64  ?  263  GLN A CA  1 
ATOM   2090 C C   . GLN A 1 287 ? -7.545  23.868  26.135  1.00 56.29  ?  263  GLN A C   1 
ATOM   2091 O O   . GLN A 1 287 ? -7.438  24.601  27.125  1.00 56.15  ?  263  GLN A O   1 
ATOM   2092 C CB  . GLN A 1 287 ? -8.581  25.350  24.422  1.00 64.11  ?  263  GLN A CB  1 
ATOM   2093 N N   . TRP A 1 288 ? -7.818  22.564  26.239  1.00 52.56  ?  264  TRP A N   1 
ATOM   2094 C CA  . TRP A 1 288 ? -7.907  21.944  27.556  1.00 55.21  ?  264  TRP A CA  1 
ATOM   2095 C C   . TRP A 1 288 ? -6.528  21.713  28.166  1.00 69.92  ?  264  TRP A C   1 
ATOM   2096 O O   . TRP A 1 288 ? -6.411  21.580  29.393  1.00 86.58  ?  264  TRP A O   1 
ATOM   2097 C CB  . TRP A 1 288 ? -8.707  20.636  27.475  1.00 49.94  ?  264  TRP A CB  1 
ATOM   2098 C CG  . TRP A 1 288 ? -8.106  19.539  26.633  1.00 53.13  ?  264  TRP A CG  1 
ATOM   2099 C CD1 . TRP A 1 288 ? -8.318  19.310  25.303  1.00 64.98  ?  264  TRP A CD1 1 
ATOM   2100 C CD2 . TRP A 1 288 ? -7.221  18.504  27.080  1.00 51.03  ?  264  TRP A CD2 1 
ATOM   2101 N NE1 . TRP A 1 288 ? -7.608  18.206  24.894  1.00 58.51  ?  264  TRP A NE1 1 
ATOM   2102 C CE2 . TRP A 1 288 ? -6.927  17.693  25.966  1.00 59.77  ?  264  TRP A CE2 1 
ATOM   2103 C CE3 . TRP A 1 288 ? -6.645  18.190  28.313  1.00 62.53  ?  264  TRP A CE3 1 
ATOM   2104 C CZ2 . TRP A 1 288 ? -6.083  16.590  26.048  1.00 61.97  ?  264  TRP A CZ2 1 
ATOM   2105 C CZ3 . TRP A 1 288 ? -5.808  17.096  28.393  1.00 76.94  ?  264  TRP A CZ3 1 
ATOM   2106 C CH2 . TRP A 1 288 ? -5.534  16.309  27.268  1.00 70.06  ?  264  TRP A CH2 1 
ATOM   2107 N N   . ILE A 1 289 ? -5.482  21.694  27.337  1.00 60.35  ?  265  ILE A N   1 
ATOM   2108 C CA  . ILE A 1 289 ? -4.119  21.532  27.839  1.00 63.04  ?  265  ILE A CA  1 
ATOM   2109 C C   . ILE A 1 289 ? -3.735  22.702  28.739  1.00 61.26  ?  265  ILE A C   1 
ATOM   2110 O O   . ILE A 1 289 ? -3.092  22.525  29.782  1.00 70.26  ?  265  ILE A O   1 
ATOM   2111 C CB  . ILE A 1 289 ? -3.141  21.377  26.657  1.00 65.61  ?  265  ILE A CB  1 
ATOM   2112 C CG1 . ILE A 1 289 ? -3.454  20.100  25.877  1.00 59.27  ?  265  ILE A CG1 1 
ATOM   2113 C CG2 . ILE A 1 289 ? -1.699  21.376  27.136  1.00 46.46  ?  265  ILE A CG2 1 
ATOM   2114 C CD1 . ILE A 1 289 ? -3.198  18.838  26.662  1.00 71.00  ?  265  ILE A CD1 1 
ATOM   2115 N N   . PHE A 1 290 ? -4.109  23.918  28.342  1.00 56.79  ?  266  PHE A N   1 
ATOM   2116 C CA  . PHE A 1 290 ? -3.782  25.087  29.148  1.00 45.32  ?  266  PHE A CA  1 
ATOM   2117 C C   . PHE A 1 290 ? -4.532  25.062  30.472  1.00 64.51  ?  266  PHE A C   1 
ATOM   2118 O O   . PHE A 1 290 ? -4.003  25.505  31.504  1.00 97.47  ?  266  PHE A O   1 
ATOM   2119 C CB  . PHE A 1 290 ? -4.105  26.355  28.357  1.00 43.21  ?  266  PHE A CB  1 
ATOM   2120 C CG  . PHE A 1 290 ? -3.531  27.610  28.946  1.00 47.51  ?  266  PHE A CG  1 
ATOM   2121 C CD1 . PHE A 1 290 ? -2.261  28.042  28.592  1.00 44.92  ?  266  PHE A CD1 1 
ATOM   2122 C CD2 . PHE A 1 290 ? -4.272  28.375  29.829  1.00 54.31  ?  266  PHE A CD2 1 
ATOM   2123 C CE1 . PHE A 1 290 ? -1.739  29.210  29.123  1.00 57.61  ?  266  PHE A CE1 1 
ATOM   2124 C CE2 . PHE A 1 290 ? -3.757  29.541  30.361  1.00 58.96  ?  266  PHE A CE2 1 
ATOM   2125 C CZ  . PHE A 1 290 ? -2.489  29.959  30.007  1.00 59.42  ?  266  PHE A CZ  1 
ATOM   2126 N N   . ARG A 1 291 ? -5.744  24.504  30.471  1.00 62.24  ?  267  ARG A N   1 
ATOM   2127 C CA  . ARG A 1 291 ? -6.454  24.315  31.723  1.00 58.26  ?  267  ARG A CA  1 
ATOM   2128 C C   . ARG A 1 291 ? -5.792  23.265  32.596  1.00 63.16  ?  267  ARG A C   1 
ATOM   2129 O O   . ARG A 1 291 ? -5.792  23.403  33.824  1.00 76.06  ?  267  ARG A O   1 
ATOM   2130 C CB  . ARG A 1 291 ? -7.903  23.911  31.458  1.00 57.44  ?  267  ARG A CB  1 
ATOM   2131 C CG  . ARG A 1 291 ? -8.687  24.893  30.621  1.00 55.77  ?  267  ARG A CG  1 
ATOM   2132 C CD  . ARG A 1 291 ? -8.763  26.239  31.304  1.00 57.28  ?  267  ARG A CD  1 
ATOM   2133 N NE  . ARG A 1 291 ? -9.810  27.089  30.743  1.00 61.65  ?  267  ARG A NE  1 
ATOM   2134 C CZ  . ARG A 1 291 ? -11.079 27.063  31.138  1.00 64.40  ?  267  ARG A CZ  1 
ATOM   2135 N NH1 . ARG A 1 291 ? -11.459 26.222  32.089  1.00 57.47  ?  267  ARG A NH1 1 
ATOM   2136 N NH2 . ARG A 1 291 ? -11.971 27.873  30.583  1.00 62.36  ?  267  ARG A NH2 1 
ATOM   2137 N N   . LEU A 1 292 ? -5.162  22.260  31.998  1.00 66.04  ?  268  LEU A N   1 
ATOM   2138 C CA  . LEU A 1 292 ? -4.405  21.340  32.834  1.00 65.83  ?  268  LEU A CA  1 
ATOM   2139 C C   . LEU A 1 292 ? -3.160  22.001  33.408  1.00 65.18  ?  268  LEU A C   1 
ATOM   2140 O O   . LEU A 1 292 ? -2.790  21.732  34.559  1.00 66.75  ?  268  LEU A O   1 
ATOM   2141 C CB  . LEU A 1 292 ? -4.008  20.093  32.044  1.00 76.89  ?  268  LEU A CB  1 
ATOM   2142 C CG  . LEU A 1 292 ? -3.998  18.806  32.877  1.00 78.83  ?  268  LEU A CG  1 
ATOM   2143 C CD1 . LEU A 1 292 ? -5.171  18.801  33.841  1.00 74.49  ?  268  LEU A CD1 1 
ATOM   2144 C CD2 . LEU A 1 292 ? -4.047  17.573  31.988  1.00 75.92  ?  268  LEU A CD2 1 
ATOM   2145 N N   . TYR A 1 293 ? -2.533  22.900  32.647  1.00 59.50  ?  269  TYR A N   1 
ATOM   2146 C CA  . TYR A 1 293 ? -1.421  23.661  33.211  1.00 55.36  ?  269  TYR A CA  1 
ATOM   2147 C C   . TYR A 1 293 ? -1.878  24.482  34.405  1.00 57.68  ?  269  TYR A C   1 
ATOM   2148 O O   . TYR A 1 293 ? -1.187  24.544  35.427  1.00 71.00  ?  269  TYR A O   1 
ATOM   2149 C CB  . TYR A 1 293 ? -0.798  24.595  32.176  1.00 53.72  ?  269  TYR A CB  1 
ATOM   2150 C CG  . TYR A 1 293 ? -0.141  23.911  31.011  1.00 45.16  ?  269  TYR A CG  1 
ATOM   2151 C CD1 . TYR A 1 293 ? 0.312   22.602  31.107  1.00 35.24  ?  269  TYR A CD1 1 
ATOM   2152 C CD2 . TYR A 1 293 ? 0.020   24.574  29.804  1.00 47.08  ?  269  TYR A CD2 1 
ATOM   2153 C CE1 . TYR A 1 293 ? 0.908   21.977  30.033  1.00 43.55  ?  269  TYR A CE1 1 
ATOM   2154 C CE2 . TYR A 1 293 ? 0.614   23.957  28.727  1.00 49.38  ?  269  TYR A CE2 1 
ATOM   2155 C CZ  . TYR A 1 293 ? 1.055   22.661  28.846  1.00 53.49  ?  269  TYR A CZ  1 
ATOM   2156 O OH  . TYR A 1 293 ? 1.645   22.052  27.768  1.00 76.64  ?  269  TYR A OH  1 
ATOM   2157 N N   . VAL A 1 294 ? -3.028  25.150  34.284  1.00 49.56  ?  270  VAL A N   1 
ATOM   2158 C CA  . VAL A 1 294 ? -3.458  25.989  35.399  1.00 58.16  ?  270  VAL A CA  1 
ATOM   2159 C C   . VAL A 1 294 ? -3.910  25.124  36.569  1.00 47.91  ?  270  VAL A C   1 
ATOM   2160 O O   . VAL A 1 294 ? -3.846  25.552  37.729  1.00 63.98  ?  270  VAL A O   1 
ATOM   2161 C CB  . VAL A 1 294 ? -4.545  27.007  34.979  1.00 69.85  ?  270  VAL A CB  1 
ATOM   2162 C CG1 . VAL A 1 294 ? -4.043  27.924  33.867  1.00 58.44  ?  270  VAL A CG1 1 
ATOM   2163 C CG2 . VAL A 1 294 ? -5.835  26.334  34.564  1.00 95.75  ?  270  VAL A CG2 1 
ATOM   2164 N N   . ALA A 1 295 ? -4.347  23.894  36.302  1.00 51.20  ?  271  ALA A N   1 
ATOM   2165 C CA  . ALA A 1 295 ? -4.644  22.989  37.401  1.00 50.98  ?  271  ALA A CA  1 
ATOM   2166 C C   . ALA A 1 295 ? -3.381  22.448  38.057  1.00 55.28  ?  271  ALA A C   1 
ATOM   2167 O O   . ALA A 1 295 ? -3.436  21.999  39.208  1.00 67.97  ?  271  ALA A O   1 
ATOM   2168 C CB  . ALA A 1 295 ? -5.514  21.832  36.914  1.00 41.66  ?  271  ALA A CB  1 
ATOM   2169 N N   . ILE A 1 296 ? -2.252  22.475  37.356  1.00 53.92  ?  272  ILE A N   1 
ATOM   2170 C CA  . ILE A 1 296 ? -0.990  22.067  37.970  1.00 39.73  ?  272  ILE A CA  1 
ATOM   2171 C C   . ILE A 1 296 ? -0.365  23.211  38.764  1.00 45.69  ?  272  ILE A C   1 
ATOM   2172 O O   . ILE A 1 296 ? -0.023  23.047  39.938  1.00 41.69  ?  272  ILE A O   1 
ATOM   2173 C CB  . ILE A 1 296 ? -0.010  21.532  36.905  1.00 34.60  ?  272  ILE A CB  1 
ATOM   2174 C CG1 . ILE A 1 296 ? -0.525  20.224  36.301  1.00 33.90  ?  272  ILE A CG1 1 
ATOM   2175 C CG2 . ILE A 1 296 ? 1.348   21.299  37.532  1.00 36.82  ?  272  ILE A CG2 1 
ATOM   2176 C CD1 . ILE A 1 296 ? 0.372   19.661  35.219  1.00 38.12  ?  272  ILE A CD1 1 
ATOM   2177 N N   . GLY A 1 297 ? -0.207  24.382  38.136  1.00 51.62  ?  273  GLY A N   1 
ATOM   2178 C CA  . GLY A 1 297 ? 0.512   25.483  38.771  1.00 41.20  ?  273  GLY A CA  1 
ATOM   2179 C C   . GLY A 1 297 ? -0.186  26.027  40.005  1.00 48.05  ?  273  GLY A C   1 
ATOM   2180 O O   . GLY A 1 297 ? 0.454   26.305  41.024  1.00 53.26  ?  273  GLY A O   1 
ATOM   2181 N N   . TRP A 1 298 ? -1.507  26.201  39.928  1.00 50.05  ?  274  TRP A N   1 
ATOM   2182 C CA  . TRP A 1 298 ? -2.283  26.723  41.045  1.00 40.91  ?  274  TRP A CA  1 
ATOM   2183 C C   . TRP A 1 298 ? -3.057  25.658  41.806  1.00 47.60  ?  274  TRP A C   1 
ATOM   2184 O O   . TRP A 1 298 ? -3.336  25.846  42.991  1.00 37.78  ?  274  TRP A O   1 
ATOM   2185 C CB  . TRP A 1 298 ? -3.280  27.782  40.558  1.00 43.15  ?  274  TRP A CB  1 
ATOM   2186 C CG  . TRP A 1 298 ? -2.678  28.984  39.885  1.00 44.74  ?  274  TRP A CG  1 
ATOM   2187 C CD1 . TRP A 1 298 ? -2.803  29.335  38.572  1.00 42.34  ?  274  TRP A CD1 1 
ATOM   2188 C CD2 . TRP A 1 298 ? -1.887  30.010  40.501  1.00 42.01  ?  274  TRP A CD2 1 
ATOM   2189 N NE1 . TRP A 1 298 ? -2.131  30.508  38.330  1.00 45.91  ?  274  TRP A NE1 1 
ATOM   2190 C CE2 . TRP A 1 298 ? -1.557  30.942  39.496  1.00 44.36  ?  274  TRP A CE2 1 
ATOM   2191 C CE3 . TRP A 1 298 ? -1.420  30.227  41.801  1.00 39.76  ?  274  TRP A CE3 1 
ATOM   2192 C CZ2 . TRP A 1 298 ? -0.786  32.073  39.751  1.00 41.21  ?  274  TRP A CZ2 1 
ATOM   2193 C CZ3 . TRP A 1 298 ? -0.652  31.354  42.052  1.00 59.84  ?  274  TRP A CZ3 1 
ATOM   2194 C CH2 . TRP A 1 298 ? -0.345  32.261  41.033  1.00 53.98  ?  274  TRP A CH2 1 
ATOM   2195 N N   . GLY A 1 299 ? -3.408  24.548  41.165  1.00 52.22  ?  275  GLY A N   1 
ATOM   2196 C CA  . GLY A 1 299 ? -4.259  23.558  41.797  1.00 44.51  ?  275  GLY A CA  1 
ATOM   2197 C C   . GLY A 1 299 ? -3.535  22.564  42.681  1.00 51.39  ?  275  GLY A C   1 
ATOM   2198 O O   . GLY A 1 299 ? -3.954  22.315  43.814  1.00 61.02  ?  275  GLY A O   1 
ATOM   2199 N N   . VAL A 1 300 ? -2.452  21.983  42.175  1.00 57.03  ?  276  VAL A N   1 
ATOM   2200 C CA  . VAL A 1 300 ? -1.712  20.941  42.891  1.00 64.42  ?  276  VAL A CA  1 
ATOM   2201 C C   . VAL A 1 300 ? -1.054  21.478  44.162  1.00 60.58  ?  276  VAL A C   1 
ATOM   2202 O O   . VAL A 1 300 ? -1.035  20.760  45.172  1.00 67.07  ?  276  VAL A O   1 
ATOM   2203 C CB  . VAL A 1 300 ? -0.680  20.267  41.971  1.00 58.78  ?  276  VAL A CB  1 
ATOM   2204 C CG1 . VAL A 1 300 ? 0.230   19.345  42.766  1.00 50.17  ?  276  VAL A CG1 1 
ATOM   2205 C CG2 . VAL A 1 300 ? -1.395  19.484  40.873  1.00 52.74  ?  276  VAL A CG2 1 
ATOM   2206 N N   . PRO A 1 301 ? -0.487  22.696  44.183  1.00 59.07  ?  277  PRO A N   1 
ATOM   2207 C CA  . PRO A 1 301 ? -0.058  23.256  45.478  1.00 59.07  ?  277  PRO A CA  1 
ATOM   2208 C C   . PRO A 1 301 ? -1.156  23.229  46.526  1.00 66.88  ?  277  PRO A C   1 
ATOM   2209 O O   . PRO A 1 301 ? -0.897  22.907  47.690  1.00 47.94  ?  277  PRO A O   1 
ATOM   2210 C CB  . PRO A 1 301 ? 0.351   24.688  45.116  1.00 47.87  ?  277  PRO A CB  1 
ATOM   2211 C CG  . PRO A 1 301 ? 0.833   24.578  43.722  1.00 58.57  ?  277  PRO A CG  1 
ATOM   2212 C CD  . PRO A 1 301 ? -0.045  23.548  43.063  1.00 55.30  ?  277  PRO A CD  1 
ATOM   2213 N N   . LEU A 1 302 ? -2.385  23.560  46.130  1.00 61.40  ?  278  LEU A N   1 
ATOM   2214 C CA  . LEU A 1 302 ? -3.523  23.519  47.036  1.00 56.73  ?  278  LEU A CA  1 
ATOM   2215 C C   . LEU A 1 302 ? -3.739  22.130  47.622  1.00 65.32  ?  278  LEU A C   1 
ATOM   2216 O O   . LEU A 1 302 ? -4.353  22.001  48.688  1.00 79.40  ?  278  LEU A O   1 
ATOM   2217 C CB  . LEU A 1 302 ? -4.765  23.981  46.275  1.00 50.31  ?  278  LEU A CB  1 
ATOM   2218 C CG  . LEU A 1 302 ? -5.943  24.624  47.000  1.00 45.57  ?  278  LEU A CG  1 
ATOM   2219 C CD1 . LEU A 1 302 ? -5.463  25.749  47.888  1.00 48.90  ?  278  LEU A CD1 1 
ATOM   2220 C CD2 . LEU A 1 302 ? -6.932  25.144  45.970  1.00 39.65  ?  278  LEU A CD2 1 
ATOM   2221 N N   . LEU A 1 303 ? -3.219  21.094  46.964  1.00 67.60  ?  279  LEU A N   1 
ATOM   2222 C CA  . LEU A 1 303 ? -3.489  19.716  47.339  1.00 54.29  ?  279  LEU A CA  1 
ATOM   2223 C C   . LEU A 1 303 ? -2.581  19.203  48.448  1.00 41.62  ?  279  LEU A C   1 
ATOM   2224 O O   . LEU A 1 303 ? -2.940  18.233  49.124  1.00 48.80  ?  279  LEU A O   1 
ATOM   2225 C CB  . LEU A 1 303 ? -3.357  18.826  46.099  1.00 80.05  ?  279  LEU A CB  1 
ATOM   2226 C CG  . LEU A 1 303 ? -3.887  17.389  46.073  1.00 82.95  ?  279  LEU A CG  1 
ATOM   2227 C CD1 . LEU A 1 303 ? -4.512  17.103  44.717  1.00 69.00  ?  279  LEU A CD1 1 
ATOM   2228 C CD2 . LEU A 1 303 ? -2.776  16.394  46.350  1.00 106.56 ?  279  LEU A CD2 1 
ATOM   2229 N N   . PHE A 1 304 ? -1.411  19.812  48.653  1.00 51.09  ?  280  PHE A N   1 
ATOM   2230 C CA  . PHE A 1 304 ? -0.568  19.449  49.782  1.00 53.14  ?  280  PHE A CA  1 
ATOM   2231 C C   . PHE A 1 304 ? -0.286  20.602  50.733  1.00 59.19  ?  280  PHE A C   1 
ATOM   2232 O O   . PHE A 1 304 ? 0.239   20.358  51.824  1.00 62.55  ?  280  PHE A O   1 
ATOM   2233 C CB  . PHE A 1 304 ? 0.764   18.834  49.305  1.00 49.23  ?  280  PHE A CB  1 
ATOM   2234 C CG  . PHE A 1 304 ? 1.602   19.737  48.431  1.00 60.10  ?  280  PHE A CG  1 
ATOM   2235 C CD1 . PHE A 1 304 ? 2.581   20.558  48.978  1.00 69.20  ?  280  PHE A CD1 1 
ATOM   2236 C CD2 . PHE A 1 304 ? 1.445   19.725  47.055  1.00 67.43  ?  280  PHE A CD2 1 
ATOM   2237 C CE1 . PHE A 1 304 ? 3.361   21.374  48.165  1.00 55.44  ?  280  PHE A CE1 1 
ATOM   2238 C CE2 . PHE A 1 304 ? 2.220   20.532  46.241  1.00 58.06  ?  280  PHE A CE2 1 
ATOM   2239 C CZ  . PHE A 1 304 ? 3.179   21.356  46.795  1.00 49.29  ?  280  PHE A CZ  1 
ATOM   2240 N N   . VAL A 1 305 ? -0.619  21.840  50.362  1.00 58.56  ?  281  VAL A N   1 
ATOM   2241 C CA  . VAL A 1 305 ? -0.392  22.960  51.269  1.00 53.66  ?  281  VAL A CA  1 
ATOM   2242 C C   . VAL A 1 305 ? -1.438  22.979  52.378  1.00 68.43  ?  281  VAL A C   1 
ATOM   2243 O O   . VAL A 1 305 ? -1.104  23.171  53.554  1.00 95.50  ?  281  VAL A O   1 
ATOM   2244 C CB  . VAL A 1 305 ? -0.351  24.289  50.487  1.00 56.02  ?  281  VAL A CB  1 
ATOM   2245 C CG1 . VAL A 1 305 ? -0.450  25.483  51.431  1.00 49.85  ?  281  VAL A CG1 1 
ATOM   2246 C CG2 . VAL A 1 305 ? 0.933   24.387  49.682  1.00 42.90  ?  281  VAL A CG2 1 
ATOM   2247 N N   . VAL A 1 306 ? -2.707  22.760  52.038  1.00 54.98  ?  282  VAL A N   1 
ATOM   2248 C CA  . VAL A 1 306 ? -3.767  22.927  53.031  1.00 45.85  ?  282  VAL A CA  1 
ATOM   2249 C C   . VAL A 1 306 ? -3.774  21.800  54.067  1.00 44.82  ?  282  VAL A C   1 
ATOM   2250 O O   . VAL A 1 306 ? -4.064  22.083  55.240  1.00 67.03  ?  282  VAL A O   1 
ATOM   2251 C CB  . VAL A 1 306 ? -5.147  23.113  52.362  1.00 47.09  ?  282  VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 306 ? -5.067  24.156  51.250  1.00 44.37  ?  282  VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 306 ? -5.731  21.826  51.815  1.00 49.87  ?  282  VAL A CG2 1 
ATOM   2254 N N   . PRO A 1 307 ? -3.460  20.535  53.746  1.00 40.49  ?  283  PRO A N   1 
ATOM   2255 C CA  . PRO A 1 307 ? -3.370  19.559  54.843  1.00 52.07  ?  283  PRO A CA  1 
ATOM   2256 C C   . PRO A 1 307 ? -2.212  19.851  55.779  1.00 70.69  ?  283  PRO A C   1 
ATOM   2257 O O   . PRO A 1 307 ? -2.301  19.564  56.981  1.00 73.06  ?  283  PRO A O   1 
ATOM   2258 C CB  . PRO A 1 307 ? -3.197  18.216  54.118  1.00 37.22  ?  283  PRO A CB  1 
ATOM   2259 C CG  . PRO A 1 307 ? -3.657  18.467  52.729  1.00 41.37  ?  283  PRO A CG  1 
ATOM   2260 C CD  . PRO A 1 307 ? -3.201  19.863  52.459  1.00 43.57  ?  283  PRO A CD  1 
ATOM   2261 N N   . TRP A 1 308 ? -1.132  20.435  55.259  1.00 67.74  ?  284  TRP A N   1 
ATOM   2262 C CA  . TRP A 1 308 ? -0.041  20.881  56.117  1.00 58.68  ?  284  TRP A CA  1 
ATOM   2263 C C   . TRP A 1 308 ? -0.517  21.960  57.076  1.00 60.86  ?  284  TRP A C   1 
ATOM   2264 O O   . TRP A 1 308 ? -0.214  21.919  58.275  1.00 49.51  ?  284  TRP A O   1 
ATOM   2265 C CB  . TRP A 1 308 ? 1.119   21.401  55.265  1.00 61.94  ?  284  TRP A CB  1 
ATOM   2266 C CG  . TRP A 1 308 ? 2.183   22.115  56.047  1.00 65.53  ?  284  TRP A CG  1 
ATOM   2267 C CD1 . TRP A 1 308 ? 3.235   21.550  56.712  1.00 60.09  ?  284  TRP A CD1 1 
ATOM   2268 C CD2 . TRP A 1 308 ? 2.303   23.532  56.241  1.00 61.39  ?  284  TRP A CD2 1 
ATOM   2269 N NE1 . TRP A 1 308 ? 3.997   22.526  57.311  1.00 67.84  ?  284  TRP A NE1 1 
ATOM   2270 C CE2 . TRP A 1 308 ? 3.446   23.750  57.037  1.00 60.86  ?  284  TRP A CE2 1 
ATOM   2271 C CE3 . TRP A 1 308 ? 1.555   24.636  55.820  1.00 66.49  ?  284  TRP A CE3 1 
ATOM   2272 C CZ2 . TRP A 1 308 ? 3.857   25.024  57.419  1.00 53.30  ?  284  TRP A CZ2 1 
ATOM   2273 C CZ3 . TRP A 1 308 ? 1.967   25.900  56.201  1.00 78.58  ?  284  TRP A CZ3 1 
ATOM   2274 C CH2 . TRP A 1 308 ? 3.105   26.082  56.989  1.00 65.18  ?  284  TRP A CH2 1 
ATOM   2275 N N   . GLY A 1 309 ? -1.254  22.941  56.557  1.00 63.18  ?  285  GLY A N   1 
ATOM   2276 C CA  . GLY A 1 309 ? -1.829  23.950  57.426  1.00 66.64  ?  285  GLY A CA  1 
ATOM   2277 C C   . GLY A 1 309 ? -2.736  23.350  58.481  1.00 68.73  ?  285  GLY A C   1 
ATOM   2278 O O   . GLY A 1 309 ? -2.702  23.755  59.643  1.00 78.49  ?  285  GLY A O   1 
ATOM   2279 N N   . ILE A 1 310 ? -3.525  22.344  58.102  1.00 61.66  ?  286  ILE A N   1 
ATOM   2280 C CA  . ILE A 1 310 ? -4.454  21.731  59.047  1.00 52.99  ?  286  ILE A CA  1 
ATOM   2281 C C   . ILE A 1 310 ? -3.693  21.036  60.171  1.00 57.61  ?  286  ILE A C   1 
ATOM   2282 O O   . ILE A 1 310 ? -4.004  21.210  61.359  1.00 53.93  ?  286  ILE A O   1 
ATOM   2283 C CB  . ILE A 1 310 ? -5.389  20.759  58.305  1.00 50.91  ?  286  ILE A CB  1 
ATOM   2284 C CG1 . ILE A 1 310 ? -6.392  21.546  57.461  1.00 51.07  ?  286  ILE A CG1 1 
ATOM   2285 C CG2 . ILE A 1 310 ? -6.107  19.839  59.273  1.00 44.80  ?  286  ILE A CG2 1 
ATOM   2286 C CD1 . ILE A 1 310 ? -7.192  20.702  56.484  1.00 50.88  ?  286  ILE A CD1 1 
ATOM   2287 N N   . VAL A 1 311 ? -2.675  20.250  59.818  1.00 58.29  ?  287  VAL A N   1 
ATOM   2288 C CA  . VAL A 1 311 ? -1.958  19.530  60.864  1.00 59.36  ?  287  VAL A CA  1 
ATOM   2289 C C   . VAL A 1 311 ? -1.091  20.476  61.688  1.00 64.11  ?  287  VAL A C   1 
ATOM   2290 O O   . VAL A 1 311 ? -0.882  20.240  62.880  1.00 56.73  ?  287  VAL A O   1 
ATOM   2291 C CB  . VAL A 1 311 ? -1.130  18.368  60.284  1.00 59.17  ?  287  VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 311 ? -2.041  17.323  59.655  1.00 55.70  ?  287  VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 311 ? -0.096  18.859  59.282  1.00 69.66  ?  287  VAL A CG2 1 
ATOM   2294 N N   . LYS A 1 312 ? -0.588  21.564  61.100  1.00 68.17  ?  288  LYS A N   1 
ATOM   2295 C CA  . LYS A 1 312 ? 0.175   22.519  61.896  1.00 78.90  ?  288  LYS A CA  1 
ATOM   2296 C C   . LYS A 1 312 ? -0.739  23.343  62.791  1.00 85.14  ?  288  LYS A C   1 
ATOM   2297 O O   . LYS A 1 312 ? -0.311  23.830  63.839  1.00 117.57 ?  288  LYS A O   1 
ATOM   2298 C CB  . LYS A 1 312 ? 1.004   23.431  60.987  1.00 85.58  ?  288  LYS A CB  1 
ATOM   2299 C CG  . LYS A 1 312 ? 2.160   22.732  60.265  1.00 78.35  ?  288  LYS A CG  1 
ATOM   2300 C CD  . LYS A 1 312 ? 3.264   22.302  61.226  1.00 85.40  ?  288  LYS A CD  1 
ATOM   2301 C CE  . LYS A 1 312 ? 4.073   23.496  61.701  1.00 83.62  ?  288  LYS A CE  1 
ATOM   2302 N NZ  . LYS A 1 312 ? 5.123   23.127  62.687  1.00 101.28 ?  288  LYS A NZ  1 
ATOM   2303 N N   . TYR A 1 313 ? -2.002  23.505  62.413  1.00 77.89  ?  289  TYR A N   1 
ATOM   2304 C CA  . TYR A 1 313 ? -2.910  24.229  63.290  1.00 72.30  ?  289  TYR A CA  1 
ATOM   2305 C C   . TYR A 1 313 ? -3.386  23.347  64.438  1.00 74.05  ?  289  TYR A C   1 
ATOM   2306 O O   . TYR A 1 313 ? -3.474  23.810  65.581  1.00 73.97  ?  289  TYR A O   1 
ATOM   2307 C CB  . TYR A 1 313 ? -4.088  24.770  62.479  1.00 73.58  ?  289  TYR A CB  1 
ATOM   2308 C CG  . TYR A 1 313 ? -5.104  25.572  63.264  1.00 74.59  ?  289  TYR A CG  1 
ATOM   2309 C CD1 . TYR A 1 313 ? -4.814  26.851  63.729  1.00 68.94  ?  289  TYR A CD1 1 
ATOM   2310 C CD2 . TYR A 1 313 ? -6.370  25.061  63.507  1.00 65.92  ?  289  TYR A CD2 1 
ATOM   2311 C CE1 . TYR A 1 313 ? -5.759  27.585  64.438  1.00 60.60  ?  289  TYR A CE1 1 
ATOM   2312 C CE2 . TYR A 1 313 ? -7.315  25.783  64.211  1.00 75.55  ?  289  TYR A CE2 1 
ATOM   2313 C CZ  . TYR A 1 313 ? -7.008  27.043  64.675  1.00 75.55  ?  289  TYR A CZ  1 
ATOM   2314 O OH  . TYR A 1 313 ? -7.957  27.757  65.375  1.00 76.05  ?  289  TYR A OH  1 
ATOM   2315 N N   . LEU A 1 314 ? -3.668  22.072  64.166  1.00 61.19  ?  290  LEU A N   1 
ATOM   2316 C CA  . LEU A 1 314 ? -4.212  21.211  65.211  1.00 65.62  ?  290  LEU A CA  1 
ATOM   2317 C C   . LEU A 1 314 ? -3.135  20.580  66.089  1.00 74.98  ?  290  LEU A C   1 
ATOM   2318 O O   . LEU A 1 314 ? -3.392  20.315  67.268  1.00 83.95  ?  290  LEU A O   1 
ATOM   2319 C CB  . LEU A 1 314 ? -5.075  20.112  64.594  1.00 58.99  ?  290  LEU A CB  1 
ATOM   2320 C CG  . LEU A 1 314 ? -6.314  20.577  63.832  1.00 58.44  ?  290  LEU A CG  1 
ATOM   2321 C CD1 . LEU A 1 314 ? -7.034  19.383  63.241  1.00 47.13  ?  290  LEU A CD1 1 
ATOM   2322 C CD2 . LEU A 1 314 ? -7.243  21.369  64.734  1.00 69.11  ?  290  LEU A CD2 1 
ATOM   2323 N N   . TYR A 1 315 ? -1.937  20.324  65.554  1.00 86.39  ?  291  TYR A N   1 
ATOM   2324 C CA  . TYR A 1 315 ? -0.945  19.527  66.266  1.00 86.71  ?  291  TYR A CA  1 
ATOM   2325 C C   . TYR A 1 315 ? 0.438   20.162  66.404  1.00 82.98  ?  291  TYR A C   1 
ATOM   2326 O O   . TYR A 1 315 ? 1.242   19.647  67.190  1.00 90.80  ?  291  TYR A O   1 
ATOM   2327 C CB  . TYR A 1 315 ? -0.793  18.148  65.594  1.00 84.80  ?  291  TYR A CB  1 
ATOM   2328 C CG  . TYR A 1 315 ? -2.086  17.349  65.511  1.00 81.24  ?  291  TYR A CG  1 
ATOM   2329 C CD1 . TYR A 1 315 ? -2.491  16.525  66.559  1.00 78.59  ?  291  TYR A CD1 1 
ATOM   2330 C CD2 . TYR A 1 315 ? -2.899  17.417  64.383  1.00 95.62  ?  291  TYR A CD2 1 
ATOM   2331 C CE1 . TYR A 1 315 ? -3.668  15.799  66.486  1.00 79.74  ?  291  TYR A CE1 1 
ATOM   2332 C CE2 . TYR A 1 315 ? -4.076  16.692  64.305  1.00 90.07  ?  291  TYR A CE2 1 
ATOM   2333 C CZ  . TYR A 1 315 ? -4.453  15.887  65.357  1.00 89.21  ?  291  TYR A CZ  1 
ATOM   2334 O OH  . TYR A 1 315 ? -5.619  15.167  65.284  1.00 85.65  ?  291  TYR A OH  1 
ATOM   2335 N N   . GLU A 1 316 ? 0.762   21.239  65.663  1.00 91.25  ?  292  GLU A N   1 
ATOM   2336 C CA  . GLU A 1 316 ? 2.001   21.987  65.946  1.00 88.75  ?  292  GLU A CA  1 
ATOM   2337 C C   . GLU A 1 316 ? 1.747   23.482  65.724  1.00 88.39  ?  292  GLU A C   1 
ATOM   2338 O O   . GLU A 1 316 ? 2.082   24.040  64.677  1.00 99.05  ?  292  GLU A O   1 
ATOM   2339 C CB  . GLU A 1 316 ? 3.164   21.533  65.066  1.00 91.99  ?  292  GLU A CB  1 
ATOM   2340 C CG  . GLU A 1 316 ? 3.733   20.169  65.344  1.00 107.07 ?  292  GLU A CG  1 
ATOM   2341 C CD  . GLU A 1 316 ? 4.894   19.866  64.428  1.00 107.55 ?  292  GLU A CD  1 
ATOM   2342 O OE1 . GLU A 1 316 ? 5.528   20.826  63.943  1.00 94.45  ?  292  GLU A OE1 1 
ATOM   2343 O OE2 . GLU A 1 316 ? 5.176   18.676  64.187  1.00 103.07 -1 292  GLU A OE2 1 
ATOM   2344 N N   . ASP A 1 317 ? 1.248   24.156  66.758  1.00 89.54  ?  293  ASP A N   1 
ATOM   2345 C CA  . ASP A 1 317 ? 0.878   25.569  66.668  1.00 112.29 ?  293  ASP A CA  1 
ATOM   2346 C C   . ASP A 1 317 ? 1.690   26.362  67.690  1.00 134.35 ?  293  ASP A C   1 
ATOM   2347 O O   . ASP A 1 317 ? 1.304   26.463  68.859  1.00 153.13 ?  293  ASP A O   1 
ATOM   2348 C CB  . ASP A 1 317 ? -0.624  25.753  66.878  1.00 104.10 ?  293  ASP A CB  1 
ATOM   2349 C CG  . ASP A 1 317 ? -1.084  27.164  66.572  1.00 105.10 ?  293  ASP A CG  1 
ATOM   2350 O OD1 . ASP A 1 317 ? -0.811  27.652  65.455  1.00 98.99  ?  293  ASP A OD1 1 
ATOM   2351 O OD2 . ASP A 1 317 ? -1.721  27.786  67.448  1.00 112.64 -1 293  ASP A OD2 1 
ATOM   2352 N N   . GLU A 1 318 ? 2.812   26.933  67.245  1.00 124.55 ?  294  GLU A N   1 
ATOM   2353 C CA  . GLU A 1 318 ? 3.680   27.698  68.141  1.00 115.46 ?  294  GLU A CA  1 
ATOM   2354 C C   . GLU A 1 318 ? 4.478   28.695  67.297  1.00 115.95 ?  294  GLU A C   1 
ATOM   2355 O O   . GLU A 1 318 ? 5.441   28.308  66.630  1.00 101.20 ?  294  GLU A O   1 
ATOM   2356 C CB  . GLU A 1 318 ? 4.597   26.777  68.931  1.00 91.48  ?  294  GLU A CB  1 
ATOM   2357 N N   . GLY A 1 319 ? 4.077   29.966  67.347  1.00 119.38 ?  295  GLY A N   1 
ATOM   2358 C CA  . GLY A 1 319 ? 4.788   31.033  66.664  1.00 116.58 ?  295  GLY A CA  1 
ATOM   2359 C C   . GLY A 1 319 ? 4.701   30.984  65.152  1.00 116.20 ?  295  GLY A C   1 
ATOM   2360 O O   . GLY A 1 319 ? 5.712   30.791  64.467  1.00 131.97 ?  295  GLY A O   1 
ATOM   2361 N N   . CYS A 1 320 ? 3.487   31.164  64.626  1.00 107.66 ?  296  CYS A N   1 
ATOM   2362 C CA  . CYS A 1 320 ? 3.214   31.110  63.185  1.00 100.20 ?  296  CYS A CA  1 
ATOM   2363 C C   . CYS A 1 320 ? 3.778   29.841  62.554  1.00 93.10  ?  296  CYS A C   1 
ATOM   2364 O O   . CYS A 1 320 ? 4.132   29.828  61.371  1.00 100.21 ?  296  CYS A O   1 
ATOM   2365 C CB  . CYS A 1 320 ? 3.758   32.340  62.450  1.00 87.75  ?  296  CYS A CB  1 
ATOM   2366 S SG  . CYS A 1 320 ? 3.483   33.944  63.234  1.00 122.37 ?  296  CYS A SG  1 
ATOM   2367 N N   . TRP A 1 321 ? 3.894   28.777  63.351  1.00 90.04  ?  297  TRP A N   1 
ATOM   2368 C CA  . TRP A 1 321 ? 4.411   27.489  62.890  1.00 110.22 ?  297  TRP A CA  1 
ATOM   2369 C C   . TRP A 1 321 ? 5.855   27.597  62.407  1.00 123.45 ?  297  TRP A C   1 
ATOM   2370 O O   . TRP A 1 321 ? 6.266   26.882  61.491  1.00 132.08 ?  297  TRP A O   1 
ATOM   2371 C CB  . TRP A 1 321 ? 3.524   26.902  61.789  1.00 122.95 ?  297  TRP A CB  1 
ATOM   2372 C CG  . TRP A 1 321 ? 2.058   26.987  62.095  1.00 119.11 ?  297  TRP A CG  1 
ATOM   2373 C CD1 . TRP A 1 321 ? 1.455   26.777  63.302  1.00 125.92 ?  297  TRP A CD1 1 
ATOM   2374 C CD2 . TRP A 1 321 ? 1.012   27.335  61.180  1.00 114.28 ?  297  TRP A CD2 1 
ATOM   2375 N NE1 . TRP A 1 321 ? 0.097   26.960  63.191  1.00 125.81 ?  297  TRP A NE1 1 
ATOM   2376 C CE2 . TRP A 1 321 ? -0.200  27.304  61.899  1.00 113.98 ?  297  TRP A CE2 1 
ATOM   2377 C CE3 . TRP A 1 321 ? 0.982   27.666  59.822  1.00 105.22 ?  297  TRP A CE3 1 
ATOM   2378 C CZ2 . TRP A 1 321 ? -1.427  27.588  61.306  1.00 104.39 ?  297  TRP A CZ2 1 
ATOM   2379 C CZ3 . TRP A 1 321 ? -0.237  27.948  59.235  1.00 105.76 ?  297  TRP A CZ3 1 
ATOM   2380 C CH2 . TRP A 1 321 ? -1.424  27.906  59.975  1.00 98.72  ?  297  TRP A CH2 1 
ATOM   2381 N N   . THR A 1 322 ? 6.636   28.492  63.019  1.00 129.66 ?  298  THR A N   1 
ATOM   2382 C CA  . THR A 1 322 ? 8.045   28.626  62.662  1.00 123.87 ?  298  THR A CA  1 
ATOM   2383 C C   . THR A 1 322 ? 8.886   27.488  63.227  1.00 132.37 ?  298  THR A C   1 
ATOM   2384 O O   . THR A 1 322 ? 9.916   27.133  62.643  1.00 136.14 ?  298  THR A O   1 
ATOM   2385 C CB  . THR A 1 322 ? 8.592   29.971  63.150  1.00 102.75 ?  298  THR A CB  1 
ATOM   2386 N N   . ARG A 1 323 ? 8.477   26.915  64.357  1.00 150.45 ?  299  ARG A N   1 
ATOM   2387 C CA  . ARG A 1 323 ? 9.173   25.774  64.947  1.00 148.84 ?  299  ARG A CA  1 
ATOM   2388 C C   . ARG A 1 323 ? 8.689   24.477  64.297  1.00 148.46 ?  299  ARG A C   1 
ATOM   2389 O O   . ARG A 1 323 ? 8.057   23.622  64.917  1.00 140.80 ?  299  ARG A O   1 
ATOM   2390 C CB  . ARG A 1 323 ? 8.970   25.758  66.456  1.00 122.96 ?  299  ARG A CB  1 
ATOM   2391 N N   . ASN A 1 324 ? 8.992   24.353  63.008  1.00 148.56 ?  300  ASN A N   1 
ATOM   2392 C CA  . ASN A 1 324 ? 8.591   23.187  62.226  1.00 159.20 ?  300  ASN A CA  1 
ATOM   2393 C C   . ASN A 1 324 ? 9.657   22.092  62.303  1.00 170.63 ?  300  ASN A C   1 
ATOM   2394 O O   . ASN A 1 324 ? 10.187  21.627  61.295  1.00 191.34 ?  300  ASN A O   1 
ATOM   2395 C CB  . ASN A 1 324 ? 8.315   23.594  60.782  1.00 149.74 ?  300  ASN A CB  1 
ATOM   2396 N N   . SER A 1 325 ? 9.974   21.667  63.540  1.00 151.80 ?  301  SER A N   1 
ATOM   2397 C CA  . SER A 1 325 ? 10.846  20.504  63.733  1.00 143.43 ?  301  SER A CA  1 
ATOM   2398 C C   . SER A 1 325 ? 10.213  19.593  64.788  1.00 138.84 ?  301  SER A C   1 
ATOM   2399 O O   . SER A 1 325 ? 10.604  19.595  65.959  1.00 152.24 ?  301  SER A O   1 
ATOM   2400 C CB  . SER A 1 325 ? 12.254  20.941  64.143  1.00 128.88 ?  301  SER A CB  1 
ATOM   2401 N N   . ASN A 1 326 ? 9.219   18.804  64.372  1.00 127.06 ?  302  ASN A N   1 
ATOM   2402 C CA  . ASN A 1 326 ? 8.685   17.791  65.275  1.00 143.36 ?  302  ASN A CA  1 
ATOM   2403 C C   . ASN A 1 326 ? 8.488   16.407  64.651  1.00 148.93 ?  302  ASN A C   1 
ATOM   2404 O O   . ASN A 1 326 ? 9.007   15.411  65.166  1.00 155.70 ?  302  ASN A O   1 
ATOM   2405 C CB  . ASN A 1 326 ? 7.371   18.300  65.861  1.00 161.55 ?  302  ASN A CB  1 
ATOM   2406 C CG  . ASN A 1 326 ? 6.786   17.363  66.891  1.00 182.54 ?  302  ASN A CG  1 
ATOM   2407 O OD1 . ASN A 1 326 ? 7.504   16.583  67.507  1.00 209.18 ?  302  ASN A OD1 1 
ATOM   2408 N ND2 . ASN A 1 326 ? 5.468   17.429  67.081  1.00 165.09 ?  302  ASN A ND2 1 
ATOM   2409 N N   . MET A 1 327 ? 7.746   16.338  63.550  1.00 142.70 ?  303  MET A N   1 
ATOM   2410 C CA  . MET A 1 327 ? 7.193   15.075  63.045  1.00 131.59 ?  303  MET A CA  1 
ATOM   2411 C C   . MET A 1 327 ? 7.174   15.114  61.516  1.00 123.88 ?  303  MET A C   1 
ATOM   2412 O O   . MET A 1 327 ? 7.838   15.941  60.882  1.00 109.84 ?  303  MET A O   1 
ATOM   2413 C CB  . MET A 1 327 ? 5.800   14.805  63.647  1.00 127.99 ?  303  MET A CB  1 
ATOM   2414 C CG  . MET A 1 327 ? 5.454   13.315  63.767  1.00 126.76 ?  303  MET A CG  1 
ATOM   2415 S SD  . MET A 1 327 ? 3.740   12.964  64.215  1.00 137.42 ?  303  MET A SD  1 
ATOM   2416 C CE  . MET A 1 327 ? 3.939   11.365  64.996  1.00 111.81 ?  303  MET A CE  1 
ATOM   2417 N N   . ASN A 1 328 ? 6.411   14.194  60.907  1.00 126.06 ?  304  ASN A N   1 
ATOM   2418 C CA  . ASN A 1 328 ? 6.271   14.066  59.454  1.00 115.91 ?  304  ASN A CA  1 
ATOM   2419 C C   . ASN A 1 328 ? 5.696   15.310  58.789  1.00 106.59 ?  304  ASN A C   1 
ATOM   2420 O O   . ASN A 1 328 ? 5.612   15.368  57.557  1.00 98.85  ?  304  ASN A O   1 
ATOM   2421 C CB  . ASN A 1 328 ? 5.351   12.894  59.088  1.00 115.77 ?  304  ASN A CB  1 
ATOM   2422 C CG  . ASN A 1 328 ? 5.607   11.661  59.916  1.00 112.07 ?  304  ASN A CG  1 
ATOM   2423 O OD1 . ASN A 1 328 ? 6.216   11.735  60.980  1.00 124.21 ?  304  ASN A OD1 1 
ATOM   2424 N ND2 . ASN A 1 328 ? 5.131   10.513  59.438  1.00 95.46  ?  304  ASN A ND2 1 
ATOM   2425 N N   . TYR A 1 329 ? 5.269   16.292  59.585  1.00 102.71 ?  305  TYR A N   1 
ATOM   2426 C CA  . TYR A 1 329 ? 4.572   17.452  59.040  1.00 99.91  ?  305  TYR A CA  1 
ATOM   2427 C C   . TYR A 1 329 ? 5.477   18.307  58.166  1.00 96.62  ?  305  TYR A C   1 
ATOM   2428 O O   . TYR A 1 329 ? 4.978   19.062  57.324  1.00 87.37  ?  305  TYR A O   1 
ATOM   2429 C CB  . TYR A 1 329 ? 3.978   18.272  60.186  1.00 81.28  ?  305  TYR A CB  1 
ATOM   2430 C CG  . TYR A 1 329 ? 3.141   17.428  61.121  1.00 88.61  ?  305  TYR A CG  1 
ATOM   2431 C CD1 . TYR A 1 329 ? 2.282   16.452  60.625  1.00 102.24 ?  305  TYR A CD1 1 
ATOM   2432 C CD2 . TYR A 1 329 ? 3.229   17.581  62.496  1.00 89.22  ?  305  TYR A CD2 1 
ATOM   2433 C CE1 . TYR A 1 329 ? 1.524   15.670  61.471  1.00 97.64  ?  305  TYR A CE1 1 
ATOM   2434 C CE2 . TYR A 1 329 ? 2.477   16.801  63.349  1.00 80.13  ?  305  TYR A CE2 1 
ATOM   2435 C CZ  . TYR A 1 329 ? 1.627   15.848  62.833  1.00 95.55  ?  305  TYR A CZ  1 
ATOM   2436 O OH  . TYR A 1 329 ? 0.878   15.075  63.685  1.00 95.92  ?  305  TYR A OH  1 
ATOM   2437 N N   . TRP A 1 330 ? 6.793   18.198  58.343  1.00 87.03  ?  306  TRP A N   1 
ATOM   2438 C CA  . TRP A 1 330 ? 7.726   18.879  57.455  1.00 80.09  ?  306  TRP A CA  1 
ATOM   2439 C C   . TRP A 1 330 ? 7.809   18.190  56.100  1.00 68.53  ?  306  TRP A C   1 
ATOM   2440 O O   . TRP A 1 330 ? 8.084   18.844  55.088  1.00 60.98  ?  306  TRP A O   1 
ATOM   2441 C CB  . TRP A 1 330 ? 9.104   18.939  58.119  1.00 95.58  ?  306  TRP A CB  1 
ATOM   2442 C CG  . TRP A 1 330 ? 10.172  19.671  57.353  1.00 116.29 ?  306  TRP A CG  1 
ATOM   2443 C CD1 . TRP A 1 330 ? 10.352  21.022  57.280  1.00 121.63 ?  306  TRP A CD1 1 
ATOM   2444 C CD2 . TRP A 1 330 ? 11.234  19.084  56.586  1.00 136.89 ?  306  TRP A CD2 1 
ATOM   2445 N NE1 . TRP A 1 330 ? 11.448  21.313  56.500  1.00 122.36 ?  306  TRP A NE1 1 
ATOM   2446 C CE2 . TRP A 1 330 ? 12.006  20.141  56.062  1.00 137.07 ?  306  TRP A CE2 1 
ATOM   2447 C CE3 . TRP A 1 330 ? 11.598  17.768  56.283  1.00 127.05 ?  306  TRP A CE3 1 
ATOM   2448 C CZ2 . TRP A 1 330 ? 13.123  19.922  55.256  1.00 134.90 ?  306  TRP A CZ2 1 
ATOM   2449 C CZ3 . TRP A 1 330 ? 12.706  17.554  55.479  1.00 126.75 ?  306  TRP A CZ3 1 
ATOM   2450 C CH2 . TRP A 1 330 ? 13.454  18.625  54.975  1.00 131.74 ?  306  TRP A CH2 1 
ATOM   2451 N N   . LEU A 1 331 ? 7.563   16.879  56.058  1.00 74.19  ?  307  LEU A N   1 
ATOM   2452 C CA  . LEU A 1 331 ? 7.703   16.132  54.816  1.00 63.67  ?  307  LEU A CA  1 
ATOM   2453 C C   . LEU A 1 331 ? 6.563   16.384  53.841  1.00 72.01  ?  307  LEU A C   1 
ATOM   2454 O O   . LEU A 1 331 ? 6.818   16.500  52.637  1.00 83.23  ?  307  LEU A O   1 
ATOM   2455 C CB  . LEU A 1 331 ? 7.806   14.635  55.118  1.00 68.45  ?  307  LEU A CB  1 
ATOM   2456 C CG  . LEU A 1 331 ? 9.194   14.178  55.574  1.00 78.95  ?  307  LEU A CG  1 
ATOM   2457 C CD1 . LEU A 1 331 ? 9.164   12.833  56.296  1.00 71.88  ?  307  LEU A CD1 1 
ATOM   2458 C CD2 . LEU A 1 331 ? 10.133  14.122  54.380  1.00 80.91  ?  307  LEU A CD2 1 
ATOM   2459 N N   . ILE A 1 332 ? 5.326   16.535  54.329  1.00 70.56  ?  308  ILE A N   1 
ATOM   2460 C CA  . ILE A 1 332 ? 4.186   16.690  53.426  1.00 70.95  ?  308  ILE A CA  1 
ATOM   2461 C C   . ILE A 1 332 ? 4.225   18.000  52.657  1.00 72.83  ?  308  ILE A C   1 
ATOM   2462 O O   . ILE A 1 332 ? 3.431   18.186  51.726  1.00 65.91  ?  308  ILE A O   1 
ATOM   2463 C CB  . ILE A 1 332 ? 2.849   16.593  54.185  1.00 81.66  ?  308  ILE A CB  1 
ATOM   2464 C CG1 . ILE A 1 332 ? 2.761   17.689  55.249  1.00 80.43  ?  308  ILE A CG1 1 
ATOM   2465 C CG2 . ILE A 1 332 ? 2.686   15.218  54.824  1.00 102.69 ?  308  ILE A CG2 1 
ATOM   2466 C CD1 . ILE A 1 332 ? 1.543   17.581  56.136  1.00 71.54  ?  308  ILE A CD1 1 
ATOM   2467 N N   . ILE A 1 333 ? 5.130   18.913  53.012  1.00 76.41  ?  309  ILE A N   1 
ATOM   2468 C CA  . ILE A 1 333 ? 5.357   20.129  52.237  1.00 78.81  ?  309  ILE A CA  1 
ATOM   2469 C C   . ILE A 1 333 ? 6.671   20.099  51.468  1.00 89.52  ?  309  ILE A C   1 
ATOM   2470 O O   . ILE A 1 333 ? 6.857   20.925  50.558  1.00 81.71  ?  309  ILE A O   1 
ATOM   2471 C CB  . ILE A 1 333 ? 5.304   21.387  53.131  1.00 68.88  ?  309  ILE A CB  1 
ATOM   2472 C CG1 . ILE A 1 333 ? 5.103   22.649  52.286  1.00 67.91  ?  309  ILE A CG1 1 
ATOM   2473 C CG2 . ILE A 1 333 ? 6.567   21.505  53.971  1.00 89.15  ?  309  ILE A CG2 1 
ATOM   2474 C CD1 . ILE A 1 333 ? 3.668   22.899  51.905  1.00 78.12  ?  309  ILE A CD1 1 
ATOM   2475 N N   . ARG A 1 334 ? 7.581   19.172  51.785  1.00 83.49  ?  310  ARG A N   1 
ATOM   2476 C CA  . ARG A 1 334 ? 8.893   19.126  51.151  1.00 82.59  ?  310  ARG A CA  1 
ATOM   2477 C C   . ARG A 1 334 ? 9.072   17.984  50.158  1.00 86.32  ?  310  ARG A C   1 
ATOM   2478 O O   . ARG A 1 334 ? 9.940   18.084  49.283  1.00 95.52  ?  310  ARG A O   1 
ATOM   2479 C CB  . ARG A 1 334 ? 9.997   19.045  52.218  1.00 87.91  ?  310  ARG A CB  1 
ATOM   2480 C CG  . ARG A 1 334 ? 10.082  20.274  53.103  1.00 86.10  ?  310  ARG A CG  1 
ATOM   2481 C CD  . ARG A 1 334 ? 11.231  21.173  52.683  1.00 88.88  ?  310  ARG A CD  1 
ATOM   2482 N NE  . ARG A 1 334 ? 10.906  22.032  51.549  1.00 110.83 ?  310  ARG A NE  1 
ATOM   2483 C CZ  . ARG A 1 334 ? 10.429  23.267  51.665  1.00 121.91 ?  310  ARG A CZ  1 
ATOM   2484 N NH1 . ARG A 1 334 ? 10.212  23.788  52.866  1.00 98.37  ?  310  ARG A NH1 1 
ATOM   2485 N NH2 . ARG A 1 334 ? 10.167  23.982  50.580  1.00 113.88 ?  310  ARG A NH2 1 
ATOM   2486 N N   . LEU A 1 335 ? 8.281   16.917  50.263  1.00 78.59  ?  311  LEU A N   1 
ATOM   2487 C CA  . LEU A 1 335 ? 8.320   15.820  49.301  1.00 81.25  ?  311  LEU A CA  1 
ATOM   2488 C C   . LEU A 1 335 ? 7.664   16.193  47.972  1.00 70.90  ?  311  LEU A C   1 
ATOM   2489 O O   . LEU A 1 335 ? 8.183   15.803  46.918  1.00 84.09  ?  311  LEU A O   1 
ATOM   2490 C CB  . LEU A 1 335 ? 7.658   14.565  49.875  1.00 80.26  ?  311  LEU A CB  1 
ATOM   2491 C CG  . LEU A 1 335 ? 8.547   13.731  50.798  1.00 85.34  ?  311  LEU A CG  1 
ATOM   2492 C CD1 . LEU A 1 335 ? 7.753   12.609  51.445  1.00 91.46  ?  311  LEU A CD1 1 
ATOM   2493 C CD2 . LEU A 1 335 ? 9.727   13.179  50.018  1.00 83.83  ?  311  LEU A CD2 1 
ATOM   2494 N N   . PRO A 1 336 ? 6.526   16.903  47.954  1.00 54.29  ?  312  PRO A N   1 
ATOM   2495 C CA  . PRO A 1 336 ? 6.001   17.362  46.658  1.00 57.82  ?  312  PRO A CA  1 
ATOM   2496 C C   . PRO A 1 336 ? 6.954   18.286  45.927  1.00 56.02  ?  312  PRO A C   1 
ATOM   2497 O O   . PRO A 1 336 ? 7.217   18.066  44.736  1.00 71.19  ?  312  PRO A O   1 
ATOM   2498 C CB  . PRO A 1 336 ? 4.699   18.075  47.045  1.00 61.38  ?  312  PRO A CB  1 
ATOM   2499 C CG  . PRO A 1 336 ? 4.279   17.405  48.281  1.00 51.86  ?  312  PRO A CG  1 
ATOM   2500 C CD  . PRO A 1 336 ? 5.554   17.166  49.032  1.00 59.24  ?  312  PRO A CD  1 
ATOM   2501 N N   . ILE A 1 337 ? 7.534   19.271  46.621  1.00 53.83  ?  313  ILE A N   1 
ATOM   2502 C CA  . ILE A 1 337 ? 8.470   20.169  45.955  1.00 48.40  ?  313  ILE A CA  1 
ATOM   2503 C C   . ILE A 1 337 ? 9.658   19.386  45.421  1.00 51.82  ?  313  ILE A C   1 
ATOM   2504 O O   . ILE A 1 337 ? 10.030  19.548  44.249  1.00 55.94  ?  313  ILE A O   1 
ATOM   2505 C CB  . ILE A 1 337 ? 8.912   21.301  46.901  1.00 39.08  ?  313  ILE A CB  1 
ATOM   2506 C CG1 . ILE A 1 337 ? 7.716   22.190  47.243  1.00 42.56  ?  313  ILE A CG1 1 
ATOM   2507 C CG2 . ILE A 1 337 ? 10.038  22.116  46.267  1.00 36.44  ?  313  ILE A CG2 1 
ATOM   2508 C CD1 . ILE A 1 337 ? 8.044   23.346  48.143  1.00 48.05  ?  313  ILE A CD1 1 
ATOM   2509 N N   . LEU A 1 338 ? 10.213  18.466  46.226  1.00 58.44  ?  314  LEU A N   1 
ATOM   2510 C CA  . LEU A 1 338 ? 11.275  17.599  45.723  1.00 51.72  ?  314  LEU A CA  1 
ATOM   2511 C C   . LEU A 1 338 ? 10.833  16.901  44.448  1.00 52.73  ?  314  LEU A C   1 
ATOM   2512 O O   . LEU A 1 338 ? 11.549  16.941  43.438  1.00 52.80  ?  314  LEU A O   1 
ATOM   2513 C CB  . LEU A 1 338 ? 11.687  16.564  46.775  1.00 53.81  ?  314  LEU A CB  1 
ATOM   2514 C CG  . LEU A 1 338 ? 12.933  15.763  46.376  1.00 51.14  ?  314  LEU A CG  1 
ATOM   2515 C CD1 . LEU A 1 338 ? 14.129  16.699  46.267  1.00 55.52  ?  314  LEU A CD1 1 
ATOM   2516 C CD2 . LEU A 1 338 ? 13.214  14.635  47.356  1.00 37.80  ?  314  LEU A CD2 1 
ATOM   2517 N N   . PHE A 1 339 ? 9.611   16.350  44.447  1.00 56.98  ?  315  PHE A N   1 
ATOM   2518 C CA  . PHE A 1 339 ? 9.072   15.744  43.233  1.00 54.53  ?  315  PHE A CA  1 
ATOM   2519 C C   . PHE A 1 339 ? 9.152   16.719  42.065  1.00 59.27  ?  315  PHE A C   1 
ATOM   2520 O O   . PHE A 1 339 ? 9.807   16.427  41.054  1.00 72.78  ?  315  PHE A O   1 
ATOM   2521 C CB  . PHE A 1 339 ? 7.626   15.287  43.468  1.00 50.29  ?  315  PHE A CB  1 
ATOM   2522 C CG  . PHE A 1 339 ? 6.979   14.648  42.260  1.00 51.30  ?  315  PHE A CG  1 
ATOM   2523 C CD1 . PHE A 1 339 ? 7.255   13.331  41.925  1.00 58.28  ?  315  PHE A CD1 1 
ATOM   2524 C CD2 . PHE A 1 339 ? 6.089   15.361  41.468  1.00 59.41  ?  315  PHE A CD2 1 
ATOM   2525 C CE1 . PHE A 1 339 ? 6.664   12.740  40.821  1.00 55.32  ?  315  PHE A CE1 1 
ATOM   2526 C CE2 . PHE A 1 339 ? 5.495   14.772  40.361  1.00 53.63  ?  315  PHE A CE2 1 
ATOM   2527 C CZ  . PHE A 1 339 ? 5.783   13.460  40.040  1.00 55.93  ?  315  PHE A CZ  1 
ATOM   2528 N N   . ALA A 1 340 ? 8.597   17.929  42.235  1.00 53.69  ?  316  ALA A N   1 
ATOM   2529 C CA  . ALA A 1 340 ? 8.610   18.922  41.162  1.00 55.80  ?  316  ALA A CA  1 
ATOM   2530 C C   . ALA A 1 340 ? 10.026  19.279  40.726  1.00 58.85  ?  316  ALA A C   1 
ATOM   2531 O O   . ALA A 1 340 ? 10.243  19.607  39.554  1.00 51.69  ?  316  ALA A O   1 
ATOM   2532 C CB  . ALA A 1 340 ? 7.865   20.190  41.590  1.00 62.64  ?  316  ALA A CB  1 
ATOM   2533 N N   . CYS A 1 341 ? 11.007  19.209  41.628  1.00 50.15  ?  317  CYS A N   1 
ATOM   2534 C CA  . CYS A 1 341 ? 12.368  19.481  41.181  1.00 47.67  ?  317  CYS A CA  1 
ATOM   2535 C C   . CYS A 1 341 ? 12.964  18.277  40.462  1.00 55.81  ?  317  CYS A C   1 
ATOM   2536 O O   . CYS A 1 341 ? 13.616  18.440  39.422  1.00 52.36  ?  317  CYS A O   1 
ATOM   2537 C CB  . CYS A 1 341 ? 13.240  19.920  42.355  1.00 53.50  ?  317  CYS A CB  1 
ATOM   2538 S SG  . CYS A 1 341 ? 12.902  21.625  42.787  1.00 63.74  ?  317  CYS A SG  1 
ATOM   2539 N N   . ILE A 1 342 ? 12.696  17.060  40.956  1.00 46.05  ?  318  ILE A N   1 
ATOM   2540 C CA  . ILE A 1 342 ? 13.233  15.866  40.302  1.00 36.10  ?  318  ILE A CA  1 
ATOM   2541 C C   . ILE A 1 342 ? 12.827  15.853  38.838  1.00 38.35  ?  318  ILE A C   1 
ATOM   2542 O O   . ILE A 1 342 ? 13.680  15.857  37.938  1.00 42.58  ?  318  ILE A O   1 
ATOM   2543 C CB  . ILE A 1 342 ? 12.777  14.588  41.033  1.00 42.08  ?  318  ILE A CB  1 
ATOM   2544 C CG1 . ILE A 1 342 ? 13.580  14.441  42.321  1.00 43.99  ?  318  ILE A CG1 1 
ATOM   2545 C CG2 . ILE A 1 342 ? 12.932  13.357  40.137  1.00 42.97  ?  318  ILE A CG2 1 
ATOM   2546 C CD1 . ILE A 1 342 ? 13.163  13.309  43.219  1.00 51.86  ?  318  ILE A CD1 1 
ATOM   2547 N N   . VAL A 1 343 ? 11.522  15.941  38.578  1.00 41.87  ?  319  VAL A N   1 
ATOM   2548 C CA  . VAL A 1 343 ? 11.055  15.990  37.200  1.00 60.00  ?  319  VAL A CA  1 
ATOM   2549 C C   . VAL A 1 343 ? 11.677  17.175  36.469  1.00 60.76  ?  319  VAL A C   1 
ATOM   2550 O O   . VAL A 1 343 ? 12.150  17.034  35.334  1.00 64.91  ?  319  VAL A O   1 
ATOM   2551 C CB  . VAL A 1 343 ? 9.517   16.024  37.158  1.00 67.50  ?  319  VAL A CB  1 
ATOM   2552 C CG1 . VAL A 1 343 ? 8.955   14.733  37.716  1.00 65.76  ?  319  VAL A CG1 1 
ATOM   2553 C CG2 . VAL A 1 343 ? 8.988   17.181  37.964  1.00 76.21  ?  319  VAL A CG2 1 
ATOM   2554 N N   . ASN A 1 344 ? 11.752  18.341  37.126  1.00 67.65  ?  320  ASN A N   1 
ATOM   2555 C CA  . ASN A 1 344 ? 12.311  19.517  36.465  1.00 69.35  ?  320  ASN A CA  1 
ATOM   2556 C C   . ASN A 1 344 ? 13.747  19.287  36.029  1.00 66.27  ?  320  ASN A C   1 
ATOM   2557 O O   . ASN A 1 344 ? 14.174  19.831  35.003  1.00 70.25  ?  320  ASN A O   1 
ATOM   2558 C CB  . ASN A 1 344 ? 12.227  20.743  37.373  1.00 74.28  ?  320  ASN A CB  1 
ATOM   2559 C CG  . ASN A 1 344 ? 11.006  21.583  37.086  1.00 83.46  ?  320  ASN A CG  1 
ATOM   2560 O OD1 . ASN A 1 344 ? 10.503  21.595  35.964  1.00 87.48  ?  320  ASN A OD1 1 
ATOM   2561 N ND2 . ASN A 1 344 ? 10.518  22.288  38.099  1.00 71.29  ?  320  ASN A ND2 1 
ATOM   2562 N N   . PHE A 1 345 ? 14.504  18.478  36.773  1.00 55.35  ?  321  PHE A N   1 
ATOM   2563 C CA  . PHE A 1 345 ? 15.849  18.184  36.299  1.00 50.97  ?  321  PHE A CA  1 
ATOM   2564 C C   . PHE A 1 345 ? 15.839  17.136  35.198  1.00 58.49  ?  321  PHE A C   1 
ATOM   2565 O O   . PHE A 1 345 ? 16.593  17.273  34.227  1.00 65.08  ?  321  PHE A O   1 
ATOM   2566 C CB  . PHE A 1 345 ? 16.755  17.770  37.459  1.00 43.33  ?  321  PHE A CB  1 
ATOM   2567 C CG  . PHE A 1 345 ? 17.386  18.939  38.150  1.00 40.68  ?  321  PHE A CG  1 
ATOM   2568 C CD1 . PHE A 1 345 ? 18.282  19.743  37.467  1.00 50.31  ?  321  PHE A CD1 1 
ATOM   2569 C CD2 . PHE A 1 345 ? 17.068  19.255  39.459  1.00 39.14  ?  321  PHE A CD2 1 
ATOM   2570 C CE1 . PHE A 1 345 ? 18.862  20.830  38.074  1.00 44.08  ?  321  PHE A CE1 1 
ATOM   2571 C CE2 . PHE A 1 345 ? 17.644  20.352  40.077  1.00 49.54  ?  321  PHE A CE2 1 
ATOM   2572 C CZ  . PHE A 1 345 ? 18.544  21.140  39.380  1.00 51.32  ?  321  PHE A CZ  1 
ATOM   2573 N N   . LEU A 1 346 ? 14.959  16.131  35.284  1.00 56.34  ?  322  LEU A N   1 
ATOM   2574 C CA  . LEU A 1 346 ? 14.885  15.164  34.194  1.00 54.23  ?  322  LEU A CA  1 
ATOM   2575 C C   . LEU A 1 346 ? 14.499  15.848  32.890  1.00 52.12  ?  322  LEU A C   1 
ATOM   2576 O O   . LEU A 1 346 ? 15.188  15.673  31.876  1.00 46.58  ?  322  LEU A O   1 
ATOM   2577 C CB  . LEU A 1 346 ? 13.901  14.045  34.545  1.00 59.73  ?  322  LEU A CB  1 
ATOM   2578 C CG  . LEU A 1 346 ? 14.319  13.263  35.797  1.00 72.37  ?  322  LEU A CG  1 
ATOM   2579 C CD1 . LEU A 1 346 ? 13.270  12.243  36.227  1.00 55.12  ?  322  LEU A CD1 1 
ATOM   2580 C CD2 . LEU A 1 346 ? 15.670  12.592  35.582  1.00 67.38  ?  322  LEU A CD2 1 
ATOM   2581 N N   . ILE A 1 347 ? 13.473  16.705  32.924  1.00 54.12  ?  323  ILE A N   1 
ATOM   2582 C CA  . ILE A 1 347 ? 13.184  17.559  31.777  1.00 49.29  ?  323  ILE A CA  1 
ATOM   2583 C C   . ILE A 1 347 ? 14.439  18.321  31.373  1.00 58.40  ?  323  ILE A C   1 
ATOM   2584 O O   . ILE A 1 347 ? 14.869  18.259  30.213  1.00 63.59  ?  323  ILE A O   1 
ATOM   2585 C CB  . ILE A 1 347 ? 12.022  18.521  32.096  1.00 45.99  ?  323  ILE A CB  1 
ATOM   2586 C CG1 . ILE A 1 347 ? 10.765  17.750  32.492  1.00 60.61  ?  323  ILE A CG1 1 
ATOM   2587 C CG2 . ILE A 1 347 ? 11.747  19.436  30.907  1.00 51.31  ?  323  ILE A CG2 1 
ATOM   2588 C CD1 . ILE A 1 347 ? 10.420  16.641  31.535  1.00 70.93  ?  323  ILE A CD1 1 
ATOM   2589 N N   . PHE A 1 348 ? 15.083  18.983  32.347  1.00 59.47  ?  324  PHE A N   1 
ATOM   2590 C CA  . PHE A 1 348 ? 16.334  19.702  32.108  1.00 69.75  ?  324  PHE A CA  1 
ATOM   2591 C C   . PHE A 1 348 ? 17.299  18.867  31.276  1.00 67.78  ?  324  PHE A C   1 
ATOM   2592 O O   . PHE A 1 348 ? 17.872  19.353  30.297  1.00 67.14  ?  324  PHE A O   1 
ATOM   2593 C CB  . PHE A 1 348 ? 16.980  20.097  33.445  1.00 66.09  ?  324  PHE A CB  1 
ATOM   2594 C CG  . PHE A 1 348 ? 18.343  20.750  33.309  1.00 65.44  ?  324  PHE A CG  1 
ATOM   2595 C CD1 . PHE A 1 348 ? 19.505  19.986  33.274  1.00 59.05  ?  324  PHE A CD1 1 
ATOM   2596 C CD2 . PHE A 1 348 ? 18.462  22.129  33.237  1.00 75.91  ?  324  PHE A CD2 1 
ATOM   2597 C CE1 . PHE A 1 348 ? 20.755  20.588  33.152  1.00 82.33  ?  324  PHE A CE1 1 
ATOM   2598 C CE2 . PHE A 1 348 ? 19.708  22.735  33.116  1.00 81.45  ?  324  PHE A CE2 1 
ATOM   2599 C CZ  . PHE A 1 348 ? 20.854  21.964  33.073  1.00 86.31  ?  324  PHE A CZ  1 
ATOM   2600 N N   . VAL A 1 349 ? 17.467  17.591  31.631  1.00 63.66  ?  325  VAL A N   1 
ATOM   2601 C CA  . VAL A 1 349 ? 18.401  16.752  30.887  1.00 59.06  ?  325  VAL A CA  1 
ATOM   2602 C C   . VAL A 1 349 ? 17.846  16.437  29.503  1.00 58.61  ?  325  VAL A C   1 
ATOM   2603 O O   . VAL A 1 349 ? 18.518  16.655  28.485  1.00 71.72  ?  325  VAL A O   1 
ATOM   2604 C CB  . VAL A 1 349 ? 18.723  15.475  31.688  1.00 66.48  ?  325  VAL A CB  1 
ATOM   2605 C CG1 . VAL A 1 349 ? 19.526  14.500  30.849  1.00 68.29  ?  325  VAL A CG1 1 
ATOM   2606 C CG2 . VAL A 1 349 ? 19.485  15.842  32.954  1.00 52.72  ?  325  VAL A CG2 1 
ATOM   2607 N N   . ARG A 1 350 ? 16.594  15.973  29.437  1.00 61.17  ?  326  ARG A N   1 
ATOM   2608 C CA  . ARG A 1 350 ? 16.029  15.538  28.160  1.00 66.62  ?  326  ARG A CA  1 
ATOM   2609 C C   . ARG A 1 350 ? 16.043  16.671  27.139  1.00 61.82  ?  326  ARG A C   1 
ATOM   2610 O O   . ARG A 1 350 ? 16.540  16.501  26.015  1.00 50.31  ?  326  ARG A O   1 
ATOM   2611 C CB  . ARG A 1 350 ? 14.610  15.000  28.384  1.00 72.40  ?  326  ARG A CB  1 
ATOM   2612 C CG  . ARG A 1 350 ? 13.898  14.394  27.172  1.00 79.40  ?  326  ARG A CG  1 
ATOM   2613 C CD  . ARG A 1 350 ? 14.789  13.512  26.312  1.00 97.08  ?  326  ARG A CD  1 
ATOM   2614 N NE  . ARG A 1 350 ? 15.570  12.532  27.061  1.00 126.21 ?  326  ARG A NE  1 
ATOM   2615 C CZ  . ARG A 1 350 ? 16.459  11.726  26.490  1.00 142.99 ?  326  ARG A CZ  1 
ATOM   2616 N NH1 . ARG A 1 350 ? 16.653  11.795  25.179  1.00 155.19 ?  326  ARG A NH1 1 
ATOM   2617 N NH2 . ARG A 1 350 ? 17.148  10.855  27.217  1.00 124.24 ?  326  ARG A NH2 1 
ATOM   2618 N N   . VAL A 1 351 ? 15.561  17.851  27.540  1.00 60.29  ?  327  VAL A N   1 
ATOM   2619 C CA  . VAL A 1 351 ? 15.576  19.023  26.667  1.00 58.84  ?  327  VAL A CA  1 
ATOM   2620 C C   . VAL A 1 351 ? 16.957  19.228  26.066  1.00 57.50  ?  327  VAL A C   1 
ATOM   2621 O O   . VAL A 1 351 ? 17.091  19.447  24.853  1.00 65.49  ?  327  VAL A O   1 
ATOM   2622 C CB  . VAL A 1 351 ? 15.116  20.273  27.441  1.00 56.17  ?  327  VAL A CB  1 
ATOM   2623 C CG1 . VAL A 1 351 ? 15.493  21.532  26.684  1.00 48.59  ?  327  VAL A CG1 1 
ATOM   2624 C CG2 . VAL A 1 351 ? 13.615  20.218  27.684  1.00 59.33  ?  327  VAL A CG2 1 
ATOM   2625 N N   . ILE A 1 352 ? 18.008  19.120  26.888  1.00 52.18  ?  328  ILE A N   1 
ATOM   2626 C CA  . ILE A 1 352 ? 19.354  19.356  26.373  1.00 53.66  ?  328  ILE A CA  1 
ATOM   2627 C C   . ILE A 1 352 ? 19.651  18.392  25.230  1.00 56.59  ?  328  ILE A C   1 
ATOM   2628 O O   . ILE A 1 352 ? 19.999  18.816  24.119  1.00 51.43  ?  328  ILE A O   1 
ATOM   2629 C CB  . ILE A 1 352 ? 20.401  19.268  27.498  1.00 49.49  ?  328  ILE A CB  1 
ATOM   2630 C CG1 . ILE A 1 352 ? 20.159  20.390  28.507  1.00 58.14  ?  328  ILE A CG1 1 
ATOM   2631 C CG2 . ILE A 1 352 ? 21.792  19.400  26.913  1.00 50.29  ?  328  ILE A CG2 1 
ATOM   2632 C CD1 . ILE A 1 352 ? 21.187  20.490  29.592  1.00 53.86  ?  328  ILE A CD1 1 
ATOM   2633 N N   . CYS A 1 353 ? 19.400  17.093  25.452  1.00 52.45  ?  329  CYS A N   1 
ATOM   2634 C CA  . CYS A 1 353 ? 19.621  16.106  24.396  1.00 55.33  ?  329  CYS A CA  1 
ATOM   2635 C C   . CYS A 1 353 ? 18.894  16.495  23.117  1.00 66.42  ?  329  CYS A C   1 
ATOM   2636 O O   . CYS A 1 353 ? 19.419  16.310  22.012  1.00 77.06  ?  329  CYS A O   1 
ATOM   2637 C CB  . CYS A 1 353 ? 19.154  14.726  24.850  1.00 68.82  ?  329  CYS A CB  1 
ATOM   2638 S SG  . CYS A 1 353 ? 20.137  13.977  26.151  1.00 95.52  ?  329  CYS A SG  1 
ATOM   2639 N N   . ILE A 1 354 ? 17.696  17.065  23.251  1.00 58.36  ?  330  ILE A N   1 
ATOM   2640 C CA  . ILE A 1 354 ? 16.924  17.440  22.072  1.00 50.23  ?  330  ILE A CA  1 
ATOM   2641 C C   . ILE A 1 354 ? 17.561  18.640  21.384  1.00 50.64  ?  330  ILE A C   1 
ATOM   2642 O O   . ILE A 1 354 ? 17.809  18.619  20.171  1.00 45.77  ?  330  ILE A O   1 
ATOM   2643 C CB  . ILE A 1 354 ? 15.459  17.709  22.456  1.00 52.60  ?  330  ILE A CB  1 
ATOM   2644 C CG1 . ILE A 1 354 ? 14.875  16.471  23.131  1.00 53.42  ?  330  ILE A CG1 1 
ATOM   2645 C CG2 . ILE A 1 354 ? 14.651  18.097  21.224  1.00 50.71  ?  330  ILE A CG2 1 
ATOM   2646 C CD1 . ILE A 1 354 ? 15.116  15.204  22.339  1.00 55.07  ?  330  ILE A CD1 1 
ATOM   2647 N N   . VAL A 1 355 ? 17.898  19.677  22.155  1.00 43.94  ?  331  VAL A N   1 
ATOM   2648 C CA  . VAL A 1 355 ? 18.328  20.923  21.526  1.00 46.43  ?  331  VAL A CA  1 
ATOM   2649 C C   . VAL A 1 355 ? 19.626  20.711  20.754  1.00 57.05  ?  331  VAL A C   1 
ATOM   2650 O O   . VAL A 1 355 ? 19.711  21.025  19.559  1.00 56.90  ?  331  VAL A O   1 
ATOM   2651 C CB  . VAL A 1 355 ? 18.456  22.036  22.580  1.00 50.32  ?  331  VAL A CB  1 
ATOM   2652 C CG1 . VAL A 1 355 ? 19.152  23.249  22.000  1.00 57.43  ?  331  VAL A CG1 1 
ATOM   2653 C CG2 . VAL A 1 355 ? 17.078  22.422  23.084  1.00 48.95  ?  331  VAL A CG2 1 
ATOM   2654 N N   . VAL A 1 356 ? 20.624  20.097  21.395  1.00 64.77  ?  332  VAL A N   1 
ATOM   2655 C CA  . VAL A 1 356 ? 21.885  19.828  20.708  1.00 67.99  ?  332  VAL A CA  1 
ATOM   2656 C C   . VAL A 1 356 ? 21.679  18.902  19.517  1.00 62.80  ?  332  VAL A C   1 
ATOM   2657 O O   . VAL A 1 356 ? 22.465  18.932  18.562  1.00 68.07  ?  332  VAL A O   1 
ATOM   2658 C CB  . VAL A 1 356 ? 22.923  19.244  21.681  1.00 74.93  ?  332  VAL A CB  1 
ATOM   2659 C CG1 . VAL A 1 356 ? 23.032  20.112  22.910  1.00 62.59  ?  332  VAL A CG1 1 
ATOM   2660 C CG2 . VAL A 1 356 ? 22.556  17.822  22.061  1.00 73.73  ?  332  VAL A CG2 1 
ATOM   2661 N N   . SER A 1 357 ? 20.644  18.059  19.543  1.00 66.79  ?  333  SER A N   1 
ATOM   2662 C CA  . SER A 1 357 ? 20.311  17.320  18.333  1.00 69.47  ?  333  SER A CA  1 
ATOM   2663 C C   . SER A 1 357 ? 19.852  18.272  17.238  1.00 68.41  ?  333  SER A C   1 
ATOM   2664 O O   . SER A 1 357 ? 20.477  18.364  16.173  1.00 63.25  ?  333  SER A O   1 
ATOM   2665 C CB  . SER A 1 357 ? 19.242  16.268  18.627  1.00 61.27  ?  333  SER A CB  1 
ATOM   2666 O OG  . SER A 1 357 ? 19.788  15.200  19.379  1.00 79.60  ?  333  SER A OG  1 
ATOM   2667 N N   . LYS A 1 358 ? 18.804  19.050  17.519  1.00 68.59  ?  334  LYS A N   1 
ATOM   2668 C CA  . LYS A 1 358 ? 18.199  19.867  16.473  1.00 79.69  ?  334  LYS A CA  1 
ATOM   2669 C C   . LYS A 1 358 ? 19.151  20.944  15.967  1.00 71.09  ?  334  LYS A C   1 
ATOM   2670 O O   . LYS A 1 358 ? 19.045  21.365  14.810  1.00 81.97  ?  334  LYS A O   1 
ATOM   2671 C CB  . LYS A 1 358 ? 16.889  20.471  16.979  1.00 92.87  ?  334  LYS A CB  1 
ATOM   2672 C CG  . LYS A 1 358 ? 15.819  19.413  17.210  1.00 93.44  ?  334  LYS A CG  1 
ATOM   2673 C CD  . LYS A 1 358 ? 14.536  19.998  17.769  1.00 97.29  ?  334  LYS A CD  1 
ATOM   2674 C CE  . LYS A 1 358 ? 13.859  20.925  16.771  1.00 119.63 ?  334  LYS A CE  1 
ATOM   2675 N NZ  . LYS A 1 358 ? 13.365  20.223  15.554  1.00 132.55 ?  334  LYS A NZ  1 
ATOM   2676 N N   . LEU A 1 359 ? 20.089  21.389  16.804  1.00 69.59  ?  335  LEU A N   1 
ATOM   2677 C CA  . LEU A 1 359 ? 21.106  22.328  16.337  1.00 70.62  ?  335  LEU A CA  1 
ATOM   2678 C C   . LEU A 1 359 ? 22.108  21.652  15.405  1.00 68.07  ?  335  LEU A C   1 
ATOM   2679 O O   . LEU A 1 359 ? 22.500  22.233  14.384  1.00 73.34  ?  335  LEU A O   1 
ATOM   2680 C CB  . LEU A 1 359 ? 21.828  22.967  17.527  1.00 68.04  ?  335  LEU A CB  1 
ATOM   2681 C CG  . LEU A 1 359 ? 21.018  24.007  18.304  1.00 62.41  ?  335  LEU A CG  1 
ATOM   2682 C CD1 . LEU A 1 359 ? 21.715  24.373  19.602  1.00 64.85  ?  335  LEU A CD1 1 
ATOM   2683 C CD2 . LEU A 1 359 ? 20.787  25.245  17.449  1.00 66.89  ?  335  LEU A CD2 1 
ATOM   2684 N N   . LYS A 1 360 ? 22.541  20.429  15.737  1.00 62.01  ?  336  LYS A N   1 
ATOM   2685 C CA  . LYS A 1 360 ? 23.541  19.766  14.901  1.00 69.59  ?  336  LYS A CA  1 
ATOM   2686 C C   . LYS A 1 360 ? 22.971  19.378  13.542  1.00 77.66  ?  336  LYS A C   1 
ATOM   2687 O O   . LYS A 1 360 ? 23.655  19.503  12.520  1.00 95.05  ?  336  LYS A O   1 
ATOM   2688 C CB  . LYS A 1 360 ? 24.124  18.535  15.597  1.00 69.21  ?  336  LYS A CB  1 
ATOM   2689 C CG  . LYS A 1 360 ? 25.192  17.866  14.741  1.00 69.72  ?  336  LYS A CG  1 
ATOM   2690 C CD  . LYS A 1 360 ? 26.182  17.038  15.530  1.00 77.76  ?  336  LYS A CD  1 
ATOM   2691 C CE  . LYS A 1 360 ? 27.423  16.774  14.690  1.00 72.86  ?  336  LYS A CE  1 
ATOM   2692 N NZ  . LYS A 1 360 ? 28.331  15.762  15.289  1.00 80.20  ?  336  LYS A NZ  1 
ATOM   2693 N N   . ALA A 1 361 ? 21.728  18.899  13.508  1.00 74.27  ?  337  ALA A N   1 
ATOM   2694 C CA  . ALA A 1 361 ? 21.058  18.528  12.265  1.00 65.04  ?  337  ALA A CA  1 
ATOM   2695 C C   . ALA A 1 361 ? 20.530  19.735  11.494  1.00 70.11  ?  337  ALA A C   1 
ATOM   2696 O O   . ALA A 1 361 ? 19.819  19.555  10.496  1.00 72.06  ?  337  ALA A O   1 
ATOM   2697 C CB  . ALA A 1 361 ? 19.905  17.558  12.554  1.00 57.81  ?  337  ALA A CB  1 
ATOM   2698 N N   . ASN A 1 362 ? 20.863  20.949  11.938  1.00 73.17  ?  338  ASN A N   1 
ATOM   2699 C CA  . ASN A 1 362 ? 20.394  22.190  11.318  1.00 77.99  ?  338  ASN A CA  1 
ATOM   2700 C C   . ASN A 1 362 ? 18.880  22.197  11.130  1.00 79.06  ?  338  ASN A C   1 
ATOM   2701 O O   . ASN A 1 362 ? 18.361  22.758  10.163  1.00 77.63  ?  338  ASN A O   1 
ATOM   2702 C CB  . ASN A 1 362 ? 21.111  22.460  9.994   1.00 96.60  ?  338  ASN A CB  1 
ATOM   2703 C CG  . ASN A 1 362 ? 22.269  23.431  10.150  1.00 124.94 ?  338  ASN A CG  1 
ATOM   2704 O OD1 . ASN A 1 362 ? 22.233  24.322  10.997  1.00 135.98 ?  338  ASN A OD1 1 
ATOM   2705 N ND2 . ASN A 1 362 ? 23.301  23.266  9.326   1.00 150.04 ?  338  ASN A ND2 1 
ATOM   2706 N N   . LEU A 1 363 ? 18.165  21.543  12.045  1.00 85.74  ?  339  LEU A N   1 
ATOM   2707 C CA  . LEU A 1 363 ? 16.724  21.716  12.143  1.00 77.72  ?  339  LEU A CA  1 
ATOM   2708 C C   . LEU A 1 363 ? 16.357  22.990  12.889  1.00 80.58  ?  339  LEU A C   1 
ATOM   2709 O O   . LEU A 1 363 ? 15.201  23.423  12.825  1.00 84.97  ?  339  LEU A O   1 
ATOM   2710 C CB  . LEU A 1 363 ? 16.093  20.510  12.844  1.00 63.70  ?  339  LEU A CB  1 
ATOM   2711 C CG  . LEU A 1 363 ? 16.345  19.147  12.198  1.00 64.17  ?  339  LEU A CG  1 
ATOM   2712 C CD1 . LEU A 1 363 ? 15.680  18.043  13.006  1.00 65.48  ?  339  LEU A CD1 1 
ATOM   2713 C CD2 . LEU A 1 363 ? 15.836  19.159  10.771  1.00 69.37  ?  339  LEU A CD2 1 
ATOM   2714 N N   . MET A 1 364 ? 17.317  23.595  13.584  1.00 72.68  ?  340  MET A N   1 
ATOM   2715 C CA  . MET A 1 364 ? 17.062  24.755  14.421  1.00 79.03  ?  340  MET A CA  1 
ATOM   2716 C C   . MET A 1 364 ? 18.284  25.661  14.408  1.00 67.36  ?  340  MET A C   1 
ATOM   2717 O O   . MET A 1 364 ? 19.421  25.185  14.442  1.00 65.85  ?  340  MET A O   1 
ATOM   2718 C CB  . MET A 1 364 ? 16.731  24.326  15.855  1.00 78.32  ?  340  MET A CB  1 
ATOM   2719 C CG  . MET A 1 364 ? 16.426  25.470  16.795  1.00 87.20  ?  340  MET A CG  1 
ATOM   2720 S SD  . MET A 1 364 ? 16.316  24.953  18.518  1.00 88.46  ?  340  MET A SD  1 
ATOM   2721 C CE  . MET A 1 364 ? 14.942  23.812  18.436  1.00 88.27  ?  340  MET A CE  1 
ATOM   2722 N N   . CYS A 1 365 ? 18.043  26.963  14.351  1.00 61.74  ?  341  CYS A N   1 
ATOM   2723 C CA  . CYS A 1 365 ? 19.084  27.963  14.529  1.00 73.85  ?  341  CYS A CA  1 
ATOM   2724 C C   . CYS A 1 365 ? 18.954  28.613  15.901  1.00 76.11  ?  341  CYS A C   1 
ATOM   2725 O O   . CYS A 1 365 ? 17.895  28.581  16.529  1.00 94.14  ?  341  CYS A O   1 
ATOM   2726 C CB  . CYS A 1 365 ? 19.005  29.030  13.435  1.00 67.16  ?  341  CYS A CB  1 
ATOM   2727 S SG  . CYS A 1 365 ? 19.711  28.555  11.855  1.00 112.10 ?  341  CYS A SG  1 
ATOM   2728 N N   . LYS A 1 366 ? 20.051  29.218  16.361  1.00 68.06  ?  342  LYS A N   1 
ATOM   2729 C CA  . LYS A 1 366 ? 20.042  29.894  17.656  1.00 70.19  ?  342  LYS A CA  1 
ATOM   2730 C C   . LYS A 1 366 ? 19.207  31.170  17.654  1.00 65.14  ?  342  LYS A C   1 
ATOM   2731 O O   . LYS A 1 366 ? 19.148  31.858  18.683  1.00 59.44  ?  342  LYS A O   1 
ATOM   2732 C CB  . LYS A 1 366 ? 21.472  30.212  18.101  1.00 64.31  ?  342  LYS A CB  1 
ATOM   2733 C CG  . LYS A 1 366 ? 22.293  28.997  18.473  1.00 67.38  ?  342  LYS A CG  1 
ATOM   2734 C CD  . LYS A 1 366 ? 23.516  29.402  19.273  1.00 56.68  ?  342  LYS A CD  1 
ATOM   2735 C CE  . LYS A 1 366 ? 24.242  28.178  19.786  1.00 62.77  ?  342  LYS A CE  1 
ATOM   2736 N NZ  . LYS A 1 366 ? 25.232  28.498  20.845  1.00 75.87  ?  342  LYS A NZ  1 
ATOM   2737 N N   . THR A 1 367 ? 18.565  31.496  16.532  1.00 69.68  ?  343  THR A N   1 
ATOM   2738 C CA  . THR A 1 367 ? 17.718  32.673  16.417  1.00 70.95  ?  343  THR A CA  1 
ATOM   2739 C C   . THR A 1 367 ? 16.235  32.367  16.608  1.00 70.72  ?  343  THR A C   1 
ATOM   2740 O O   . THR A 1 367 ? 15.428  33.300  16.647  1.00 67.75  ?  343  THR A O   1 
ATOM   2741 C CB  . THR A 1 367 ? 17.938  33.345  15.052  1.00 73.07  ?  343  THR A CB  1 
ATOM   2742 O OG1 . THR A 1 367 ? 17.351  34.650  15.059  1.00 89.01  ?  343  THR A OG1 1 
ATOM   2743 C CG2 . THR A 1 367 ? 17.314  32.520  13.933  1.00 56.33  ?  343  THR A CG2 1 
ATOM   2744 N N   . ASP A 1 368 ? 15.862  31.092  16.702  1.00 60.64  ?  344  ASP A N   1 
ATOM   2745 C CA  . ASP A 1 368 ? 14.473  30.680  16.862  1.00 57.31  ?  344  ASP A CA  1 
ATOM   2746 C C   . ASP A 1 368 ? 14.019  30.754  18.316  1.00 65.69  ?  344  ASP A C   1 
ATOM   2747 O O   . ASP A 1 368 ? 14.830  30.767  19.247  1.00 80.21  ?  344  ASP A O   1 
ATOM   2748 C CB  . ASP A 1 368 ? 14.276  29.255  16.345  1.00 68.51  ?  344  ASP A CB  1 
ATOM   2749 C CG  . ASP A 1 368 ? 14.514  29.141  14.854  1.00 77.61  ?  344  ASP A CG  1 
ATOM   2750 O OD1 . ASP A 1 368 ? 14.270  30.129  14.126  1.00 78.22  ?  344  ASP A OD1 1 
ATOM   2751 O OD2 . ASP A 1 368 ? 14.934  28.056  14.406  1.00 72.07  -1 344  ASP A OD2 1 
ATOM   2752 N N   . ILE A 1 369 ? 12.695  30.783  18.499  1.00 72.16  ?  345  ILE A N   1 
ATOM   2753 C CA  . ILE A 1 369 ? 12.122  30.910  19.837  1.00 74.95  ?  345  ILE A CA  1 
ATOM   2754 C C   . ILE A 1 369 ? 12.417  29.679  20.674  1.00 77.92  ?  345  ILE A C   1 
ATOM   2755 O O   . ILE A 1 369 ? 12.659  29.789  21.878  1.00 66.84  ?  345  ILE A O   1 
ATOM   2756 C CB  . ILE A 1 369 ? 10.605  31.171  19.779  1.00 68.27  ?  345  ILE A CB  1 
ATOM   2757 C CG1 . ILE A 1 369 ? 9.973   30.433  18.601  1.00 70.73  ?  345  ILE A CG1 1 
ATOM   2758 C CG2 . ILE A 1 369 ? 10.312  32.659  19.789  1.00 67.62  ?  345  ILE A CG2 1 
ATOM   2759 C CD1 . ILE A 1 369 ? 8.551   29.999  18.875  1.00 74.44  ?  345  ILE A CD1 1 
ATOM   2760 N N   . ALA A 1 370 ? 12.341  28.485  20.081  1.00 79.52  ?  346  ALA A N   1 
ATOM   2761 C CA  . ALA A 1 370 ? 12.567  27.293  20.890  1.00 66.09  ?  346  ALA A CA  1 
ATOM   2762 C C   . ALA A 1 370 ? 13.925  27.349  21.571  1.00 65.40  ?  346  ALA A C   1 
ATOM   2763 O O   . ALA A 1 370 ? 14.036  27.057  22.769  1.00 70.60  ?  346  ALA A O   1 
ATOM   2764 C CB  . ALA A 1 370 ? 12.454  26.031  20.036  1.00 60.76  ?  346  ALA A CB  1 
ATOM   2765 N N   . PHE A 1 371 ? 14.945  27.827  20.856  1.00 68.79  ?  347  PHE A N   1 
ATOM   2766 C CA  . PHE A 1 371 ? 16.286  27.890  21.424  1.00 68.64  ?  347  PHE A CA  1 
ATOM   2767 C C   . PHE A 1 371 ? 16.404  28.993  22.469  1.00 70.53  ?  347  PHE A C   1 
ATOM   2768 O O   . PHE A 1 371 ? 16.997  28.779  23.526  1.00 70.52  ?  347  PHE A O   1 
ATOM   2769 C CB  . PHE A 1 371 ? 17.341  28.092  20.332  1.00 61.77  ?  347  PHE A CB  1 
ATOM   2770 C CG  . PHE A 1 371 ? 18.733  28.252  20.879  1.00 58.56  ?  347  PHE A CG  1 
ATOM   2771 C CD1 . PHE A 1 371 ? 19.465  27.143  21.267  1.00 51.05  ?  347  PHE A CD1 1 
ATOM   2772 C CD2 . PHE A 1 371 ? 19.296  29.510  21.039  1.00 56.72  ?  347  PHE A CD2 1 
ATOM   2773 C CE1 . PHE A 1 371 ? 20.734  27.280  21.788  1.00 58.79  ?  347  PHE A CE1 1 
ATOM   2774 C CE2 . PHE A 1 371 ? 20.572  29.653  21.558  1.00 67.25  ?  347  PHE A CE2 1 
ATOM   2775 C CZ  . PHE A 1 371 ? 21.289  28.534  21.932  1.00 60.09  ?  347  PHE A CZ  1 
ATOM   2776 N N   . ARG A 1 372 ? 15.874  30.187  22.192  1.00 67.28  ?  348  ARG A N   1 
ATOM   2777 C CA  . ARG A 1 372 ? 15.982  31.271  23.168  1.00 66.61  ?  348  ARG A CA  1 
ATOM   2778 C C   . ARG A 1 372 ? 15.204  30.936  24.441  1.00 66.15  ?  348  ARG A C   1 
ATOM   2779 O O   . ARG A 1 372 ? 15.666  31.185  25.568  1.00 61.57  ?  348  ARG A O   1 
ATOM   2780 C CB  . ARG A 1 372 ? 15.486  32.577  22.542  1.00 74.04  ?  348  ARG A CB  1 
ATOM   2781 C CG  . ARG A 1 372 ? 16.388  33.127  21.425  1.00 81.24  ?  348  ARG A CG  1 
ATOM   2782 C CD  . ARG A 1 372 ? 15.779  34.345  20.715  1.00 69.72  ?  348  ARG A CD  1 
ATOM   2783 N NE  . ARG A 1 372 ? 14.527  34.033  20.029  1.00 75.65  ?  348  ARG A NE  1 
ATOM   2784 C CZ  . ARG A 1 372 ? 13.917  34.850  19.176  1.00 86.91  ?  348  ARG A CZ  1 
ATOM   2785 N NH1 . ARG A 1 372 ? 14.447  36.032  18.890  1.00 110.63 ?  348  ARG A NH1 1 
ATOM   2786 N NH2 . ARG A 1 372 ? 12.780  34.482  18.601  1.00 81.82  ?  348  ARG A NH2 1 
ATOM   2787 N N   . LEU A 1 373 ? 14.030  30.335  24.275  1.00 68.28  ?  349  LEU A N   1 
ATOM   2788 C CA  . LEU A 1 373 ? 13.221  29.917  25.410  1.00 59.01  ?  349  LEU A CA  1 
ATOM   2789 C C   . LEU A 1 373 ? 13.924  28.836  26.216  1.00 60.15  ?  349  LEU A C   1 
ATOM   2790 O O   . LEU A 1 373 ? 13.884  28.856  27.452  1.00 62.29  ?  349  LEU A O   1 
ATOM   2791 C CB  . LEU A 1 373 ? 11.863  29.423  24.919  1.00 56.47  ?  349  LEU A CB  1 
ATOM   2792 C CG  . LEU A 1 373 ? 10.827  29.132  25.999  1.00 48.87  ?  349  LEU A CG  1 
ATOM   2793 C CD1 . LEU A 1 373 ? 10.551  30.390  26.806  1.00 46.30  ?  349  LEU A CD1 1 
ATOM   2794 C CD2 . LEU A 1 373 ? 9.545   28.590  25.379  1.00 41.56  ?  349  LEU A CD2 1 
ATOM   2795 N N   . ALA A 1 374 ? 14.565  27.876  25.542  1.00 54.36  ?  350  ALA A N   1 
ATOM   2796 C CA  . ALA A 1 374 ? 15.384  26.924  26.279  1.00 54.63  ?  350  ALA A CA  1 
ATOM   2797 C C   . ALA A 1 374 ? 16.550  27.627  26.957  1.00 56.89  ?  350  ALA A C   1 
ATOM   2798 O O   . ALA A 1 374 ? 16.922  27.271  28.078  1.00 49.81  ?  350  ALA A O   1 
ATOM   2799 C CB  . ALA A 1 374 ? 15.886  25.824  25.343  1.00 40.75  ?  350  ALA A CB  1 
ATOM   2800 N N   . LYS A 1 375 ? 17.083  28.670  26.322  1.00 52.86  ?  351  LYS A N   1 
ATOM   2801 C CA  . LYS A 1 375 ? 18.202  29.418  26.878  1.00 52.11  ?  351  LYS A CA  1 
ATOM   2802 C C   . LYS A 1 375 ? 17.829  30.093  28.189  1.00 50.69  ?  351  LYS A C   1 
ATOM   2803 O O   . LYS A 1 375 ? 18.696  30.318  29.038  1.00 58.43  ?  351  LYS A O   1 
ATOM   2804 C CB  . LYS A 1 375 ? 18.682  30.445  25.847  1.00 51.61  ?  351  LYS A CB  1 
ATOM   2805 C CG  . LYS A 1 375 ? 19.949  31.210  26.202  1.00 56.27  ?  351  LYS A CG  1 
ATOM   2806 C CD  . LYS A 1 375 ? 20.761  31.557  24.946  1.00 63.18  ?  351  LYS A CD  1 
ATOM   2807 C CE  . LYS A 1 375 ? 20.003  32.485  24.002  1.00 68.08  ?  351  LYS A CE  1 
ATOM   2808 N NZ  . LYS A 1 375 ? 19.829  33.856  24.564  1.00 61.60  ?  351  LYS A NZ  1 
ATOM   2809 N N   . SER A 1 376 ? 16.557  30.432  28.363  1.00 52.12  ?  352  SER A N   1 
ATOM   2810 C CA  . SER A 1 376 ? 16.130  30.993  29.644  1.00 59.96  ?  352  SER A CA  1 
ATOM   2811 C C   . SER A 1 376 ? 15.702  29.913  30.645  1.00 63.13  ?  352  SER A C   1 
ATOM   2812 O O   . SER A 1 376 ? 16.077  29.958  31.828  1.00 86.64  ?  352  SER A O   1 
ATOM   2813 C CB  . SER A 1 376 ? 14.996  32.001  29.419  1.00 51.79  ?  352  SER A CB  1 
ATOM   2814 O OG  . SER A 1 376 ? 15.447  33.136  28.692  1.00 53.53  ?  352  SER A OG  1 
ATOM   2815 N N   . THR A 1 377 ? 14.917  28.935  30.186  1.00 51.35  ?  353  THR A N   1 
ATOM   2816 C CA  . THR A 1 377 ? 14.358  27.938  31.098  1.00 57.85  ?  353  THR A CA  1 
ATOM   2817 C C   . THR A 1 377 ? 15.434  27.007  31.656  1.00 53.93  ?  353  THR A C   1 
ATOM   2818 O O   . THR A 1 377 ? 15.390  26.638  32.842  1.00 47.73  ?  353  THR A O   1 
ATOM   2819 C CB  . THR A 1 377 ? 13.263  27.141  30.389  1.00 53.64  ?  353  THR A CB  1 
ATOM   2820 O OG1 . THR A 1 377 ? 12.232  28.039  29.964  1.00 47.06  ?  353  THR A OG1 1 
ATOM   2821 C CG2 . THR A 1 377 ? 12.664  26.105  31.322  1.00 41.81  ?  353  THR A CG2 1 
ATOM   2822 N N   . LEU A 1 378 ? 16.391  26.589  30.815  1.00 48.36  ?  354  LEU A N   1 
ATOM   2823 C CA  . LEU A 1 378 ? 17.517  25.782  31.269  1.00 53.90  ?  354  LEU A CA  1 
ATOM   2824 C C   . LEU A 1 378 ? 18.405  26.536  32.241  1.00 55.09  ?  354  LEU A C   1 
ATOM   2825 O O   . LEU A 1 378 ? 19.195  25.908  32.953  1.00 66.56  ?  354  LEU A O   1 
ATOM   2826 C CB  . LEU A 1 378 ? 18.364  25.325  30.078  1.00 55.27  ?  354  LEU A CB  1 
ATOM   2827 C CG  . LEU A 1 378 ? 17.806  24.263  29.130  1.00 53.40  ?  354  LEU A CG  1 
ATOM   2828 C CD1 . LEU A 1 378 ? 18.839  23.897  28.075  1.00 56.89  ?  354  LEU A CD1 1 
ATOM   2829 C CD2 . LEU A 1 378 ? 17.372  23.031  29.901  1.00 62.06  ?  354  LEU A CD2 1 
ATOM   2830 N N   . THR A 1 379 ? 18.322  27.865  32.259  1.00 48.50  ?  355  THR A N   1 
ATOM   2831 C CA  . THR A 1 379 ? 19.006  28.621  33.297  1.00 47.16  ?  355  THR A CA  1 
ATOM   2832 C C   . THR A 1 379 ? 18.215  28.575  34.595  1.00 54.91  ?  355  THR A C   1 
ATOM   2833 O O   . THR A 1 379 ? 18.774  28.315  35.666  1.00 57.17  ?  355  THR A O   1 
ATOM   2834 C CB  . THR A 1 379 ? 19.216  30.072  32.854  1.00 51.29  ?  355  THR A CB  1 
ATOM   2835 O OG1 . THR A 1 379 ? 19.980  30.109  31.641  1.00 48.06  ?  355  THR A OG1 1 
ATOM   2836 C CG2 . THR A 1 379 ? 19.941  30.854  33.940  1.00 39.87  ?  355  THR A CG2 1 
ATOM   2837 N N   . LEU A 1 380 ? 16.905  28.813  34.510  1.00 63.79  ?  356  LEU A N   1 
ATOM   2838 C CA  . LEU A 1 380 ? 16.115  28.928  35.733  1.00 58.15  ?  356  LEU A CA  1 
ATOM   2839 C C   . LEU A 1 380 ? 15.993  27.602  36.482  1.00 55.60  ?  356  LEU A C   1 
ATOM   2840 O O   . LEU A 1 380 ? 15.925  27.606  37.717  1.00 58.75  ?  356  LEU A O   1 
ATOM   2841 C CB  . LEU A 1 380 ? 14.732  29.489  35.417  1.00 53.10  ?  356  LEU A CB  1 
ATOM   2842 C CG  . LEU A 1 380 ? 14.724  30.944  34.948  1.00 49.86  ?  356  LEU A CG  1 
ATOM   2843 C CD1 . LEU A 1 380 ? 13.377  31.243  34.359  1.00 48.15  ?  356  LEU A CD1 1 
ATOM   2844 C CD2 . LEU A 1 380 ? 15.030  31.904  36.090  1.00 57.68  ?  356  LEU A CD2 1 
ATOM   2845 N N   . ILE A 1 381 ? 15.969  26.470  35.779  1.00 44.46  ?  357  ILE A N   1 
ATOM   2846 C CA  . ILE A 1 381 ? 15.712  25.197  36.464  1.00 37.35  ?  357  ILE A CA  1 
ATOM   2847 C C   . ILE A 1 381 ? 16.803  24.883  37.492  1.00 45.87  ?  357  ILE A C   1 
ATOM   2848 O O   . ILE A 1 381 ? 16.476  24.684  38.676  1.00 59.55  ?  357  ILE A O   1 
ATOM   2849 C CB  . ILE A 1 381 ? 15.535  24.036  35.470  1.00 35.97  ?  357  ILE A CB  1 
ATOM   2850 C CG1 . ILE A 1 381 ? 14.271  24.232  34.640  1.00 31.20  ?  357  ILE A CG1 1 
ATOM   2851 C CG2 . ILE A 1 381 ? 15.478  22.708  36.214  1.00 31.00  ?  357  ILE A CG2 1 
ATOM   2852 C CD1 . ILE A 1 381 ? 14.095  23.181  33.567  1.00 29.40  ?  357  ILE A CD1 1 
ATOM   2853 N N   . PRO A 1 382 ? 18.091  24.822  37.121  1.00 44.65  ?  358  PRO A N   1 
ATOM   2854 C CA  . PRO A 1 382 ? 19.121  24.584  38.143  1.00 49.04  ?  358  PRO A CA  1 
ATOM   2855 C C   . PRO A 1 382 ? 19.340  25.780  39.047  1.00 67.51  ?  358  PRO A C   1 
ATOM   2856 O O   . PRO A 1 382 ? 20.017  25.648  40.075  1.00 83.51  ?  358  PRO A O   1 
ATOM   2857 C CB  . PRO A 1 382 ? 20.371  24.277  37.313  1.00 36.83  ?  358  PRO A CB  1 
ATOM   2858 C CG  . PRO A 1 382 ? 20.186  25.088  36.095  1.00 33.93  ?  358  PRO A CG  1 
ATOM   2859 C CD  . PRO A 1 382 ? 18.707  25.018  35.795  1.00 40.84  ?  358  PRO A CD  1 
ATOM   2860 N N   . LEU A 1 383 ? 18.787  26.939  38.695  1.00 57.96  ?  359  LEU A N   1 
ATOM   2861 C CA  . LEU A 1 383 ? 18.882  28.114  39.545  1.00 52.10  ?  359  LEU A CA  1 
ATOM   2862 C C   . LEU A 1 383 ? 17.890  28.048  40.699  1.00 54.53  ?  359  LEU A C   1 
ATOM   2863 O O   . LEU A 1 383 ? 18.171  28.576  41.782  1.00 79.87  ?  359  LEU A O   1 
ATOM   2864 C CB  . LEU A 1 383 ? 18.641  29.366  38.702  1.00 67.86  ?  359  LEU A CB  1 
ATOM   2865 C CG  . LEU A 1 383 ? 19.017  30.748  39.237  1.00 66.16  ?  359  LEU A CG  1 
ATOM   2866 C CD1 . LEU A 1 383 ? 20.491  31.044  39.006  1.00 60.76  ?  359  LEU A CD1 1 
ATOM   2867 C CD2 . LEU A 1 383 ? 18.145  31.815  38.591  1.00 67.59  ?  359  LEU A CD2 1 
ATOM   2868 N N   . LEU A 1 384 ? 16.733  27.403  40.490  1.00 45.84  ?  360  LEU A N   1 
ATOM   2869 C CA  . LEU A 1 384 ? 15.668  27.372  41.483  1.00 42.67  ?  360  LEU A CA  1 
ATOM   2870 C C   . LEU A 1 384 ? 15.493  26.026  42.179  1.00 50.44  ?  360  LEU A C   1 
ATOM   2871 O O   . LEU A 1 384 ? 14.924  25.997  43.274  1.00 62.19  ?  360  LEU A O   1 
ATOM   2872 C CB  . LEU A 1 384 ? 14.324  27.772  40.848  1.00 50.04  ?  360  LEU A CB  1 
ATOM   2873 C CG  . LEU A 1 384 ? 13.913  29.252  40.758  1.00 56.02  ?  360  LEU A CG  1 
ATOM   2874 C CD1 . LEU A 1 384 ? 14.751  30.013  39.739  1.00 58.40  ?  360  LEU A CD1 1 
ATOM   2875 C CD2 . LEU A 1 384 ? 12.425  29.380  40.436  1.00 62.21  ?  360  LEU A CD2 1 
ATOM   2876 N N   . CYS A 1 385 ? 15.971  24.919  41.595  1.00 50.14  ?  361  CYS A N   1 
ATOM   2877 C CA  . CYS A 1 385 ? 15.703  23.592  42.149  1.00 55.50  ?  361  CYS A CA  1 
ATOM   2878 C C   . CYS A 1 385 ? 16.917  22.904  42.760  1.00 67.70  ?  361  CYS A C   1 
ATOM   2879 O O   . CYS A 1 385 ? 16.755  21.890  43.469  1.00 79.63  ?  361  CYS A O   1 
ATOM   2880 C CB  . CYS A 1 385 ? 15.118  22.685  41.062  1.00 55.82  ?  361  CYS A CB  1 
ATOM   2881 S SG  . CYS A 1 385 ? 13.332  22.636  41.092  1.00 80.68  ?  361  CYS A SG  1 
ATOM   2882 N N   . THR A 1 386 ? 18.118  23.432  42.524  1.00 73.90  ?  362  THR A N   1 
ATOM   2883 C CA  . THR A 1 386 ? 19.323  22.739  42.959  1.00 64.07  ?  362  THR A CA  1 
ATOM   2884 C C   . THR A 1 386 ? 19.452  22.739  44.480  1.00 52.87  ?  362  THR A C   1 
ATOM   2885 O O   . THR A 1 386 ? 19.898  21.744  45.056  1.00 49.87  ?  362  THR A O   1 
ATOM   2886 C CB  . THR A 1 386 ? 20.562  23.354  42.292  1.00 72.28  ?  362  THR A CB  1 
ATOM   2887 O OG1 . THR A 1 386 ? 21.632  22.402  42.302  1.00 81.61  ?  362  THR A OG1 1 
ATOM   2888 C CG2 . THR A 1 386 ? 21.028  24.624  42.999  1.00 61.22  ?  362  THR A CG2 1 
ATOM   2889 N N   . HIS A 1 387 ? 19.053  23.822  45.153  1.00 57.78  ?  363  HIS A N   1 
ATOM   2890 C CA  . HIS A 1 387 ? 19.094  23.823  46.613  1.00 55.79  ?  363  HIS A CA  1 
ATOM   2891 C C   . HIS A 1 387 ? 18.148  22.774  47.177  1.00 60.49  ?  363  HIS A C   1 
ATOM   2892 O O   . HIS A 1 387 ? 18.505  22.023  48.093  1.00 66.86  ?  363  HIS A O   1 
ATOM   2893 C CB  . HIS A 1 387 ? 18.749  25.204  47.178  1.00 71.01  ?  363  HIS A CB  1 
ATOM   2894 C CG  . HIS A 1 387 ? 18.688  25.228  48.676  1.00 76.01  ?  363  HIS A CG  1 
ATOM   2895 N ND1 . HIS A 1 387 ? 17.568  24.847  49.383  1.00 81.52  ?  363  HIS A ND1 1 
ATOM   2896 C CD2 . HIS A 1 387 ? 19.620  25.560  49.601  1.00 70.25  ?  363  HIS A CD2 1 
ATOM   2897 C CE1 . HIS A 1 387 ? 17.809  24.950  50.678  1.00 74.61  ?  363  HIS A CE1 1 
ATOM   2898 N NE2 . HIS A 1 387 ? 19.045  25.385  50.837  1.00 59.40  ?  363  HIS A NE2 1 
ATOM   2899 N N   . GLU A 1 388 ? 16.927  22.714  46.644  1.00 61.19  ?  364  GLU A N   1 
ATOM   2900 C CA  . GLU A 1 388 ? 15.972  21.732  47.139  1.00 54.15  ?  364  GLU A CA  1 
ATOM   2901 C C   . GLU A 1 388 ? 16.477  20.313  46.941  1.00 54.41  ?  364  GLU A C   1 
ATOM   2902 O O   . GLU A 1 388 ? 16.239  19.451  47.793  1.00 55.44  ?  364  GLU A O   1 
ATOM   2903 C CB  . GLU A 1 388 ? 14.618  21.904  46.451  1.00 45.10  ?  364  GLU A CB  1 
ATOM   2904 C CG  . GLU A 1 388 ? 13.488  21.125  47.098  1.00 76.34  ?  364  GLU A CG  1 
ATOM   2905 C CD  . GLU A 1 388 ? 13.097  21.686  48.451  1.00 81.44  ?  364  GLU A CD  1 
ATOM   2906 O OE1 . GLU A 1 388 ? 13.179  22.914  48.650  1.00 73.22  ?  364  GLU A OE1 1 
ATOM   2907 O OE2 . GLU A 1 388 ? 12.712  20.897  49.331  1.00 57.88  -1 364  GLU A OE2 1 
ATOM   2908 N N   . VAL A 1 389 ? 17.176  20.040  45.840  1.00 48.35  ?  365  VAL A N   1 
ATOM   2909 C CA  . VAL A 1 389 ? 17.651  18.667  45.675  1.00 52.76  ?  365  VAL A CA  1 
ATOM   2910 C C   . VAL A 1 389 ? 18.864  18.400  46.566  1.00 65.25  ?  365  VAL A C   1 
ATOM   2911 O O   . VAL A 1 389 ? 18.958  17.337  47.189  1.00 74.76  ?  365  VAL A O   1 
ATOM   2912 C CB  . VAL A 1 389 ? 17.941  18.341  44.198  1.00 47.00  ?  365  VAL A CB  1 
ATOM   2913 C CG1 . VAL A 1 389 ? 18.534  16.948  44.080  1.00 51.80  ?  365  VAL A CG1 1 
ATOM   2914 C CG2 . VAL A 1 389 ? 16.660  18.409  43.384  1.00 50.32  ?  365  VAL A CG2 1 
ATOM   2915 N N   . ILE A 1 390 ? 19.791  19.359  46.669  1.00 54.50  ?  366  ILE A N   1 
ATOM   2916 C CA  . ILE A 1 390 ? 21.038  19.124  47.403  1.00 52.06  ?  366  ILE A CA  1 
ATOM   2917 C C   . ILE A 1 390 ? 20.753  18.753  48.855  1.00 47.57  ?  366  ILE A C   1 
ATOM   2918 O O   . ILE A 1 390 ? 21.229  17.725  49.355  1.00 58.23  ?  366  ILE A O   1 
ATOM   2919 C CB  . ILE A 1 390 ? 21.966  20.351  47.308  1.00 64.90  ?  366  ILE A CB  1 
ATOM   2920 C CG1 . ILE A 1 390 ? 22.565  20.456  45.908  1.00 70.46  ?  366  ILE A CG1 1 
ATOM   2921 C CG2 . ILE A 1 390 ? 23.086  20.258  48.340  1.00 72.95  ?  366  ILE A CG2 1 
ATOM   2922 C CD1 . ILE A 1 390 ? 23.327  21.741  45.654  1.00 67.47  ?  366  ILE A CD1 1 
ATOM   2923 N N   . PHE A 1 391 ? 20.002  19.597  49.561  1.00 48.10  ?  367  PHE A N   1 
ATOM   2924 C CA  . PHE A 1 391 ? 19.628  19.364  50.957  1.00 56.38  ?  367  PHE A CA  1 
ATOM   2925 C C   . PHE A 1 391 ? 18.273  18.675  51.083  1.00 72.94  ?  367  PHE A C   1 
ATOM   2926 O O   . PHE A 1 391 ? 17.394  19.153  51.804  1.00 74.73  ?  367  PHE A O   1 
ATOM   2927 C CB  . PHE A 1 391 ? 19.628  20.684  51.721  1.00 52.20  ?  367  PHE A CB  1 
ATOM   2928 C CG  . PHE A 1 391 ? 20.908  21.455  51.595  1.00 56.77  ?  367  PHE A CG  1 
ATOM   2929 C CD1 . PHE A 1 391 ? 21.996  21.154  52.395  1.00 52.67  ?  367  PHE A CD1 1 
ATOM   2930 C CD2 . PHE A 1 391 ? 21.023  22.481  50.674  1.00 59.54  ?  367  PHE A CD2 1 
ATOM   2931 C CE1 . PHE A 1 391 ? 23.175  21.866  52.281  1.00 49.35  ?  367  PHE A CE1 1 
ATOM   2932 C CE2 . PHE A 1 391 ? 22.200  23.193  50.552  1.00 58.00  ?  367  PHE A CE2 1 
ATOM   2933 C CZ  . PHE A 1 391 ? 23.278  22.884  51.356  1.00 56.50  ?  367  PHE A CZ  1 
ATOM   2934 N N   . ALA A 1 392 ? 18.095  17.530  50.418  1.00 87.21  ?  368  ALA A N   1 
ATOM   2935 C CA  . ALA A 1 392 ? 16.755  16.990  50.192  1.00 82.88  ?  368  ALA A CA  1 
ATOM   2936 C C   . ALA A 1 392 ? 16.057  16.619  51.495  1.00 86.76  ?  368  ALA A C   1 
ATOM   2937 O O   . ALA A 1 392 ? 14.896  16.988  51.713  1.00 119.22 ?  368  ALA A O   1 
ATOM   2938 C CB  . ALA A 1 392 ? 16.832  15.781  49.263  1.00 77.24  ?  368  ALA A CB  1 
ATOM   2939 N N   . PHE A 1 393 ? 16.745  15.883  52.368  1.00 56.38  ?  369  PHE A N   1 
ATOM   2940 C CA  . PHE A 1 393 ? 16.184  15.392  53.623  1.00 58.28  ?  369  PHE A CA  1 
ATOM   2941 C C   . PHE A 1 393 ? 16.973  15.899  54.828  1.00 56.66  ?  369  PHE A C   1 
ATOM   2942 O O   . PHE A 1 393 ? 17.177  15.178  55.808  1.00 69.70  ?  369  PHE A O   1 
ATOM   2943 C CB  . PHE A 1 393 ? 16.128  13.865  53.633  1.00 48.99  ?  369  PHE A CB  1 
ATOM   2944 C CG  . PHE A 1 393 ? 15.166  13.282  52.636  1.00 46.36  ?  369  PHE A CG  1 
ATOM   2945 C CD1 . PHE A 1 393 ? 15.591  12.937  51.364  1.00 51.76  ?  369  PHE A CD1 1 
ATOM   2946 C CD2 . PHE A 1 393 ? 13.839  13.075  52.974  1.00 43.79  ?  369  PHE A CD2 1 
ATOM   2947 C CE1 . PHE A 1 393 ? 14.708  12.399  50.444  1.00 53.39  ?  369  PHE A CE1 1 
ATOM   2948 C CE2 . PHE A 1 393 ? 12.949  12.538  52.057  1.00 43.50  ?  369  PHE A CE2 1 
ATOM   2949 C CZ  . PHE A 1 393 ? 13.386  12.199  50.791  1.00 46.11  ?  369  PHE A CZ  1 
ATOM   2950 N N   . VAL A 1 394 ? 17.399  17.158  54.786  1.00 58.00  ?  370  VAL A N   1 
ATOM   2951 C CA  . VAL A 1 394 ? 18.168  17.775  55.863  1.00 68.05  ?  370  VAL A CA  1 
ATOM   2952 C C   . VAL A 1 394 ? 17.263  18.772  56.574  1.00 75.38  ?  370  VAL A C   1 
ATOM   2953 O O   . VAL A 1 394 ? 16.724  19.690  55.944  1.00 66.48  ?  370  VAL A O   1 
ATOM   2954 C CB  . VAL A 1 394 ? 19.439  18.459  55.333  1.00 50.69  ?  370  VAL A CB  1 
ATOM   2955 N N   . MET A 1 395 ? 17.092  18.593  57.889  1.00 95.11  ?  371  MET A N   1 
ATOM   2956 C CA  . MET A 1 395 ? 16.200  19.466  58.649  1.00 97.04  ?  371  MET A CA  1 
ATOM   2957 C C   . MET A 1 395 ? 16.852  20.812  58.942  1.00 94.88  ?  371  MET A C   1 
ATOM   2958 O O   . MET A 1 395 ? 16.308  21.863  58.583  1.00 99.49  ?  371  MET A O   1 
ATOM   2959 C CB  . MET A 1 395 ? 15.778  18.786  59.955  1.00 101.26 ?  371  MET A CB  1 
ATOM   2960 N N   . ASP A 1 396 ? 18.017  20.786  59.587  1.00 84.67  ?  372  ASP A N   1 
ATOM   2961 C CA  . ASP A 1 396 ? 18.783  21.971  59.977  1.00 81.15  ?  372  ASP A CA  1 
ATOM   2962 C C   . ASP A 1 396 ? 19.920  21.544  60.895  1.00 76.04  ?  372  ASP A C   1 
ATOM   2963 O O   . ASP A 1 396 ? 19.685  21.220  62.062  1.00 56.68  ?  372  ASP A O   1 
ATOM   2964 C CB  . ASP A 1 396 ? 17.915  23.019  60.682  1.00 66.34  ?  372  ASP A CB  1 
ATOM   2965 N N   . ARG A 1 404 ? 29.795  29.507  59.854  1.00 143.17 ?  380  ARG A N   1 
ATOM   2966 C CA  . ARG A 1 404 ? 29.146  29.338  58.559  1.00 122.41 ?  380  ARG A CA  1 
ATOM   2967 C C   . ARG A 1 404 ? 27.817  30.071  58.499  1.00 127.21 ?  380  ARG A C   1 
ATOM   2968 O O   . ARG A 1 404 ? 27.130  30.018  57.483  1.00 120.93 ?  380  ARG A O   1 
ATOM   2969 C CB  . ARG A 1 404 ? 28.925  27.851  58.262  1.00 93.16  ?  380  ARG A CB  1 
ATOM   2970 N N   . PHE A 1 405 ? 27.458  30.758  59.589  1.00 140.13 ?  381  PHE A N   1 
ATOM   2971 C CA  . PHE A 1 405 ? 26.138  31.381  59.658  1.00 138.40 ?  381  PHE A CA  1 
ATOM   2972 C C   . PHE A 1 405 ? 25.982  32.474  58.608  1.00 139.26 ?  381  PHE A C   1 
ATOM   2973 O O   . PHE A 1 405 ? 24.998  32.483  57.853  1.00 106.63 ?  381  PHE A O   1 
ATOM   2974 C CB  . PHE A 1 405 ? 25.897  31.951  61.055  1.00 140.07 ?  381  PHE A CB  1 
ATOM   2975 N N   . ILE A 1 406 ? 26.969  33.365  58.503  1.00 151.91 ?  382  ILE A N   1 
ATOM   2976 C CA  . ILE A 1 406 ? 26.879  34.461  57.544  1.00 135.31 ?  382  ILE A CA  1 
ATOM   2977 C C   . ILE A 1 406 ? 26.842  33.920  56.125  1.00 123.53 ?  382  ILE A C   1 
ATOM   2978 O O   . ILE A 1 406 ? 26.090  34.416  55.279  1.00 136.63 ?  382  ILE A O   1 
ATOM   2979 C CB  . ILE A 1 406 ? 28.052  35.445  57.732  1.00 122.22 ?  382  ILE A CB  1 
ATOM   2980 C CG1 . ILE A 1 406 ? 28.265  35.767  59.209  1.00 119.63 ?  382  ILE A CG1 1 
ATOM   2981 C CG2 . ILE A 1 406 ? 27.814  36.733  56.936  1.00 96.92  ?  382  ILE A CG2 1 
ATOM   2982 C CD1 . ILE A 1 406 ? 29.479  36.641  59.462  1.00 85.21  ?  382  ILE A CD1 1 
ATOM   2983 N N   . LYS A 1 407 ? 27.633  32.881  55.852  1.00 114.31 ?  383  LYS A N   1 
ATOM   2984 C CA  . LYS A 1 407 ? 27.783  32.396  54.484  1.00 121.01 ?  383  LYS A CA  1 
ATOM   2985 C C   . LYS A 1 407 ? 26.508  31.736  53.972  1.00 104.47 ?  383  LYS A C   1 
ATOM   2986 O O   . LYS A 1 407 ? 26.147  31.902  52.802  1.00 107.36 ?  383  LYS A O   1 
ATOM   2987 C CB  . LYS A 1 407 ? 28.967  31.432  54.403  1.00 107.87 ?  383  LYS A CB  1 
ATOM   2988 N N   . LEU A 1 408 ? 25.818  30.977  54.818  1.00 67.27  ?  384  LEU A N   1 
ATOM   2989 C CA  . LEU A 1 408 ? 24.544  30.420  54.389  1.00 83.76  ?  384  LEU A CA  1 
ATOM   2990 C C   . LEU A 1 408 ? 23.415  31.435  54.478  1.00 82.01  ?  384  LEU A C   1 
ATOM   2991 O O   . LEU A 1 408 ? 22.371  31.241  53.843  1.00 73.15  ?  384  LEU A O   1 
ATOM   2992 C CB  . LEU A 1 408 ? 24.198  29.168  55.200  1.00 76.63  ?  384  LEU A CB  1 
ATOM   2993 C CG  . LEU A 1 408 ? 23.705  28.007  54.332  1.00 67.08  ?  384  LEU A CG  1 
ATOM   2994 C CD1 . LEU A 1 408 ? 23.920  26.690  55.043  1.00 71.45  ?  384  LEU A CD1 1 
ATOM   2995 C CD2 . LEU A 1 408 ? 22.236  28.172  53.941  1.00 69.21  ?  384  LEU A CD2 1 
ATOM   2996 N N   . PHE A 1 409 ? 23.600  32.525  55.222  1.00 96.06  ?  385  PHE A N   1 
ATOM   2997 C CA  . PHE A 1 409 ? 22.582  33.560  55.116  1.00 87.34  ?  385  PHE A CA  1 
ATOM   2998 C C   . PHE A 1 409 ? 22.559  34.236  53.742  1.00 95.44  ?  385  PHE A C   1 
ATOM   2999 O O   . PHE A 1 409 ? 21.789  35.187  53.559  1.00 105.78 ?  385  PHE A O   1 
ATOM   3000 C CB  . PHE A 1 409 ? 22.776  34.603  56.213  1.00 81.32  ?  385  PHE A CB  1 
ATOM   3001 N N   . THR A 1 410 ? 23.368  33.787  52.782  1.00 93.28  ?  386  THR A N   1 
ATOM   3002 C CA  . THR A 1 410 ? 23.314  34.313  51.424  1.00 90.21  ?  386  THR A CA  1 
ATOM   3003 C C   . THR A 1 410 ? 22.253  33.630  50.571  1.00 97.64  ?  386  THR A C   1 
ATOM   3004 O O   . THR A 1 410 ? 22.092  33.990  49.399  1.00 81.16  ?  386  THR A O   1 
ATOM   3005 C CB  . THR A 1 410 ? 24.680  34.184  50.740  1.00 98.56  ?  386  THR A CB  1 
ATOM   3006 O OG1 . THR A 1 410 ? 25.036  32.801  50.602  1.00 96.41  ?  386  THR A OG1 1 
ATOM   3007 C CG2 . THR A 1 410 ? 25.754  34.918  51.541  1.00 116.13 ?  386  THR A CG2 1 
ATOM   3008 N N   . GLU A 1 411 ? 21.544  32.641  51.123  1.00 99.82  ?  387  GLU A N   1 
ATOM   3009 C CA  . GLU A 1 411 ? 20.377  32.085  50.445  1.00 83.46  ?  387  GLU A CA  1 
ATOM   3010 C C   . GLU A 1 411 ? 19.270  33.122  50.340  1.00 76.77  ?  387  GLU A C   1 
ATOM   3011 O O   . GLU A 1 411 ? 18.494  33.121  49.371  1.00 113.09 ?  387  GLU A O   1 
ATOM   3012 C CB  . GLU A 1 411 ? 19.894  30.847  51.202  1.00 100.93 ?  387  GLU A CB  1 
ATOM   3013 C CG  . GLU A 1 411 ? 18.612  30.211  50.706  1.00 134.45 ?  387  GLU A CG  1 
ATOM   3014 C CD  . GLU A 1 411 ? 18.214  29.019  51.557  1.00 140.95 ?  387  GLU A CD  1 
ATOM   3015 O OE1 . GLU A 1 411 ? 18.843  28.827  52.618  1.00 139.30 ?  387  GLU A OE1 1 
ATOM   3016 O OE2 . GLU A 1 411 ? 17.289  28.272  51.170  1.00 153.88 -1 387  GLU A OE2 1 
ATOM   3017 N N   . LEU A 1 412 ? 19.210  34.031  51.317  1.00 65.46  ?  388  LEU A N   1 
ATOM   3018 C CA  . LEU A 1 412 ? 18.179  35.057  51.330  1.00 75.94  ?  388  LEU A CA  1 
ATOM   3019 C C   . LEU A 1 412 ? 18.349  36.030  50.168  1.00 79.76  ?  388  LEU A C   1 
ATOM   3020 O O   . LEU A 1 412 ? 17.356  36.423  49.544  1.00 97.02  ?  388  LEU A O   1 
ATOM   3021 C CB  . LEU A 1 412 ? 18.208  35.782  52.679  1.00 76.72  ?  388  LEU A CB  1 
ATOM   3022 C CG  . LEU A 1 412 ? 18.119  34.824  53.878  1.00 78.88  ?  388  LEU A CG  1 
ATOM   3023 C CD1 . LEU A 1 412 ? 18.532  35.473  55.202  1.00 73.76  ?  388  LEU A CD1 1 
ATOM   3024 C CD2 . LEU A 1 412 ? 16.717  34.237  53.982  1.00 75.80  ?  388  LEU A CD2 1 
ATOM   3025 N N   . SER A 1 413 ? 19.593  36.359  49.807  1.00 72.33  ?  389  SER A N   1 
ATOM   3026 C CA  . SER A 1 413 ? 19.815  37.280  48.694  1.00 77.77  ?  389  SER A CA  1 
ATOM   3027 C C   . SER A 1 413 ? 19.302  36.698  47.382  1.00 89.90  ?  389  SER A C   1 
ATOM   3028 O O   . SER A 1 413 ? 18.603  37.379  46.618  1.00 96.93  ?  389  SER A O   1 
ATOM   3029 C CB  . SER A 1 413 ? 21.303  37.610  48.576  1.00 94.58  ?  389  SER A CB  1 
ATOM   3030 O OG  . SER A 1 413 ? 22.062  36.448  48.286  1.00 129.13 ?  389  SER A OG  1 
ATOM   3031 N N   . PHE A 1 414 ? 19.622  35.434  47.114  1.00 91.96  ?  390  PHE A N   1 
ATOM   3032 C CA  . PHE A 1 414 ? 19.199  34.832  45.857  1.00 90.33  ?  390  PHE A CA  1 
ATOM   3033 C C   . PHE A 1 414 ? 17.693  34.618  45.828  1.00 106.95 ?  390  PHE A C   1 
ATOM   3034 O O   . PHE A 1 414 ? 17.046  34.881  44.805  1.00 131.70 ?  390  PHE A O   1 
ATOM   3035 C CB  . PHE A 1 414 ? 19.948  33.520  45.621  1.00 95.38  ?  390  PHE A CB  1 
ATOM   3036 C CG  . PHE A 1 414 ? 21.153  33.671  44.733  1.00 104.81 ?  390  PHE A CG  1 
ATOM   3037 C CD1 . PHE A 1 414 ? 22.307  34.280  45.203  1.00 102.15 ?  390  PHE A CD1 1 
ATOM   3038 C CD2 . PHE A 1 414 ? 21.125  33.224  43.422  1.00 99.89  ?  390  PHE A CD2 1 
ATOM   3039 C CE1 . PHE A 1 414 ? 23.413  34.433  44.381  1.00 95.10  ?  390  PHE A CE1 1 
ATOM   3040 C CE2 . PHE A 1 414 ? 22.228  33.373  42.598  1.00 91.37  ?  390  PHE A CE2 1 
ATOM   3041 C CZ  . PHE A 1 414 ? 23.372  33.977  43.079  1.00 93.93  ?  390  PHE A CZ  1 
ATOM   3042 N N   . THR A 1 415 ? 17.108  34.156  46.938  1.00 101.81 ?  391  THR A N   1 
ATOM   3043 C CA  . THR A 1 415 ? 15.659  34.000  46.944  1.00 96.94  ?  391  THR A CA  1 
ATOM   3044 C C   . THR A 1 415 ? 14.954  35.342  46.823  1.00 93.94  ?  391  THR A C   1 
ATOM   3045 O O   . THR A 1 415 ? 13.810  35.394  46.358  1.00 109.43 ?  391  THR A O   1 
ATOM   3046 C CB  . THR A 1 415 ? 15.189  33.261  48.206  1.00 84.34  ?  391  THR A CB  1 
ATOM   3047 O OG1 . THR A 1 415 ? 15.647  33.942  49.378  1.00 97.33  ?  391  THR A OG1 1 
ATOM   3048 C CG2 . THR A 1 415 ? 15.705  31.827  48.224  1.00 71.02  ?  391  THR A CG2 1 
ATOM   3049 N N   . SER A 1 416 ? 15.616  36.431  47.203  1.00 71.17  ?  392  SER A N   1 
ATOM   3050 C CA  . SER A 1 416 ? 14.996  37.732  47.008  1.00 84.45  ?  392  SER A CA  1 
ATOM   3051 C C   . SER A 1 416 ? 15.076  38.168  45.549  1.00 90.91  ?  392  SER A C   1 
ATOM   3052 O O   . SER A 1 416 ? 14.087  38.650  44.983  1.00 118.36 ?  392  SER A O   1 
ATOM   3053 C CB  . SER A 1 416 ? 15.639  38.771  47.933  1.00 89.99  ?  392  SER A CB  1 
ATOM   3054 O OG  . SER A 1 416 ? 17.028  38.921  47.696  1.00 71.03  ?  392  SER A OG  1 
ATOM   3055 N N   . PHE A 1 417 ? 16.241  38.008  44.920  1.00 82.92  ?  393  PHE A N   1 
ATOM   3056 C CA  . PHE A 1 417 ? 16.401  38.485  43.546  1.00 70.52  ?  393  PHE A CA  1 
ATOM   3057 C C   . PHE A 1 417 ? 15.851  37.517  42.493  1.00 65.66  ?  393  PHE A C   1 
ATOM   3058 O O   . PHE A 1 417 ? 15.951  37.813  41.287  1.00 60.79  ?  393  PHE A O   1 
ATOM   3059 C CB  . PHE A 1 417 ? 17.875  38.795  43.259  1.00 74.68  ?  393  PHE A CB  1 
ATOM   3060 C CG  . PHE A 1 417 ? 18.355  40.098  43.861  1.00 78.35  ?  393  PHE A CG  1 
ATOM   3061 C CD1 . PHE A 1 417 ? 18.270  41.295  43.156  1.00 88.71  ?  393  PHE A CD1 1 
ATOM   3062 C CD2 . PHE A 1 417 ? 18.902  40.118  45.130  1.00 78.74  ?  393  PHE A CD2 1 
ATOM   3063 C CE1 . PHE A 1 417 ? 18.722  42.486  43.722  1.00 90.13  ?  393  PHE A CE1 1 
ATOM   3064 C CE2 . PHE A 1 417 ? 19.352  41.296  45.696  1.00 74.07  ?  393  PHE A CE2 1 
ATOM   3065 C CZ  . PHE A 1 417 ? 19.263  42.481  44.995  1.00 79.75  ?  393  PHE A CZ  1 
ATOM   3066 N N   . GLN A 1 418 ? 15.292  36.376  42.922  1.00 67.66  ?  394  GLN A N   1 
ATOM   3067 C CA  . GLN A 1 418 ? 14.719  35.401  41.989  1.00 56.92  ?  394  GLN A CA  1 
ATOM   3068 C C   . GLN A 1 418 ? 13.748  36.045  40.998  1.00 68.46  ?  394  GLN A C   1 
ATOM   3069 O O   . GLN A 1 418 ? 13.862  35.848  39.781  1.00 70.19  ?  394  GLN A O   1 
ATOM   3070 C CB  . GLN A 1 418 ? 14.001  34.294  42.771  1.00 70.46  ?  394  GLN A CB  1 
ATOM   3071 C CG  . GLN A 1 418 ? 14.904  33.194  43.304  1.00 66.96  ?  394  GLN A CG  1 
ATOM   3072 C CD  . GLN A 1 418 ? 14.172  32.205  44.204  1.00 72.12  ?  394  GLN A CD  1 
ATOM   3073 O OE1 . GLN A 1 418 ? 13.028  32.430  44.602  1.00 81.91  ?  394  GLN A OE1 1 
ATOM   3074 N NE2 . GLN A 1 418 ? 14.836  31.102  44.528  1.00 93.78  ?  394  GLN A NE2 1 
ATOM   3075 N N   . GLY A 1 419 ? 12.765  36.797  41.500  1.00 65.89  ?  395  GLY A N   1 
ATOM   3076 C CA  . GLY A 1 419 ? 11.743  37.341  40.617  1.00 62.77  ?  395  GLY A CA  1 
ATOM   3077 C C   . GLY A 1 419 ? 12.280  38.359  39.633  1.00 65.40  ?  395  GLY A C   1 
ATOM   3078 O O   . GLY A 1 419 ? 11.834  38.415  38.481  1.00 65.34  ?  395  GLY A O   1 
ATOM   3079 N N   . LEU A 1 420 ? 13.244  39.174  40.065  1.00 70.14  ?  396  LEU A N   1 
ATOM   3080 C CA  . LEU A 1 420 ? 13.914  40.076  39.139  1.00 69.40  ?  396  LEU A CA  1 
ATOM   3081 C C   . LEU A 1 420 ? 14.569  39.301  38.008  1.00 72.91  ?  396  LEU A C   1 
ATOM   3082 O O   . LEU A 1 420 ? 14.458  39.681  36.835  1.00 87.72  ?  396  LEU A O   1 
ATOM   3083 C CB  . LEU A 1 420 ? 14.957  40.912  39.877  1.00 64.34  ?  396  LEU A CB  1 
ATOM   3084 C CG  . LEU A 1 420 ? 15.944  41.641  38.961  1.00 57.56  ?  396  LEU A CG  1 
ATOM   3085 C CD1 . LEU A 1 420 ? 15.273  42.810  38.252  1.00 59.34  ?  396  LEU A CD1 1 
ATOM   3086 C CD2 . LEU A 1 420 ? 17.185  42.095  39.720  1.00 64.21  ?  396  LEU A CD2 1 
ATOM   3087 N N   . MET A 1 421 ? 15.264  38.209  38.337  1.00 59.44  ?  397  MET A N   1 
ATOM   3088 C CA  . MET A 1 421 ? 15.887  37.444  37.261  1.00 64.80  ?  397  MET A CA  1 
ATOM   3089 C C   . MET A 1 421 ? 14.841  36.816  36.345  1.00 70.33  ?  397  MET A C   1 
ATOM   3090 O O   . MET A 1 421 ? 15.075  36.680  35.138  1.00 70.23  ?  397  MET A O   1 
ATOM   3091 C CB  . MET A 1 421 ? 16.810  36.366  37.820  1.00 76.69  ?  397  MET A CB  1 
ATOM   3092 C CG  . MET A 1 421 ? 17.533  35.579  36.737  1.00 98.24  ?  397  MET A CG  1 
ATOM   3093 S SD  . MET A 1 421 ? 19.240  35.204  37.167  1.00 148.71 ?  397  MET A SD  1 
ATOM   3094 C CE  . MET A 1 421 ? 20.098  36.467  36.231  1.00 98.31  ?  397  MET A CE  1 
ATOM   3095 N N   . VAL A 1 422 ? 13.689  36.426  36.896  1.00 70.40  ?  398  VAL A N   1 
ATOM   3096 C CA  . VAL A 1 422 ? 12.620  35.898  36.049  1.00 58.45  ?  398  VAL A CA  1 
ATOM   3097 C C   . VAL A 1 422 ? 12.157  36.964  35.063  1.00 60.65  ?  398  VAL A C   1 
ATOM   3098 O O   . VAL A 1 422 ? 11.972  36.692  33.869  1.00 50.91  ?  398  VAL A O   1 
ATOM   3099 C CB  . VAL A 1 422 ? 11.452  35.366  36.903  1.00 55.29  ?  398  VAL A CB  1 
ATOM   3100 C CG1 . VAL A 1 422 ? 10.310  34.912  36.007  1.00 58.03  ?  398  VAL A CG1 1 
ATOM   3101 C CG2 . VAL A 1 422 ? 11.912  34.213  37.783  1.00 40.67  ?  398  VAL A CG2 1 
ATOM   3102 N N   . ALA A 1 423 ? 11.983  38.200  35.544  1.00 70.17  ?  399  ALA A N   1 
ATOM   3103 C CA  . ALA A 1 423 ? 11.552  39.287  34.665  1.00 56.78  ?  399  ALA A CA  1 
ATOM   3104 C C   . ALA A 1 423 ? 12.599  39.591  33.598  1.00 54.69  ?  399  ALA A C   1 
ATOM   3105 O O   . ALA A 1 423 ? 12.253  39.897  32.451  1.00 50.56  ?  399  ALA A O   1 
ATOM   3106 C CB  . ALA A 1 423 ? 11.244  40.539  35.485  1.00 59.35  ?  399  ALA A CB  1 
ATOM   3107 N N   . ILE A 1 424 ? 13.883  39.513  33.957  1.00 56.03  ?  400  ILE A N   1 
ATOM   3108 C CA  . ILE A 1 424 ? 14.942  39.740  32.972  1.00 69.52  ?  400  ILE A CA  1 
ATOM   3109 C C   . ILE A 1 424 ? 14.905  38.663  31.895  1.00 72.91  ?  400  ILE A C   1 
ATOM   3110 O O   . ILE A 1 424 ? 14.716  38.949  30.707  1.00 73.60  ?  400  ILE A O   1 
ATOM   3111 C CB  . ILE A 1 424 ? 16.321  39.790  33.652  1.00 85.29  ?  400  ILE A CB  1 
ATOM   3112 C CG1 . ILE A 1 424 ? 16.365  40.901  34.696  1.00 93.74  ?  400  ILE A CG1 1 
ATOM   3113 C CG2 . ILE A 1 424 ? 17.411  39.975  32.608  1.00 89.38  ?  400  ILE A CG2 1 
ATOM   3114 C CD1 . ILE A 1 424 ? 16.298  42.288  34.111  1.00 94.94  ?  400  ILE A CD1 1 
ATOM   3115 N N   . LEU A 1 425 ? 15.077  37.401  32.303  1.00 62.04  ?  401  LEU A N   1 
ATOM   3116 C CA  . LEU A 1 425 ? 15.251  36.319  31.338  1.00 60.33  ?  401  LEU A CA  1 
ATOM   3117 C C   . LEU A 1 425 ? 13.990  36.055  30.524  1.00 61.29  ?  401  LEU A C   1 
ATOM   3118 O O   . LEU A 1 425 ? 14.081  35.561  29.393  1.00 68.46  ?  401  LEU A O   1 
ATOM   3119 C CB  . LEU A 1 425 ? 15.686  35.040  32.051  1.00 64.65  ?  401  LEU A CB  1 
ATOM   3120 C CG  . LEU A 1 425 ? 17.026  35.057  32.788  1.00 70.58  ?  401  LEU A CG  1 
ATOM   3121 C CD1 . LEU A 1 425 ? 17.293  33.690  33.386  1.00 74.25  ?  401  LEU A CD1 1 
ATOM   3122 C CD2 . LEU A 1 425 ? 18.157  35.471  31.861  1.00 93.15  ?  401  LEU A CD2 1 
ATOM   3123 N N   . TYR A 1 426 ? 12.811  36.373  31.059  1.00 68.26  ?  402  TYR A N   1 
ATOM   3124 C CA  . TYR A 1 426 ? 11.580  36.112  30.328  1.00 69.17  ?  402  TYR A CA  1 
ATOM   3125 C C   . TYR A 1 426 ? 10.941  37.372  29.750  1.00 62.44  ?  402  TYR A C   1 
ATOM   3126 O O   . TYR A 1 426 ? 9.950   37.256  29.018  1.00 61.44  ?  402  TYR A O   1 
ATOM   3127 C CB  . TYR A 1 426 ? 10.575  35.380  31.227  1.00 57.67  ?  402  TYR A CB  1 
ATOM   3128 C CG  . TYR A 1 426 ? 10.785  33.880  31.343  1.00 49.09  ?  402  TYR A CG  1 
ATOM   3129 C CD1 . TYR A 1 426 ? 11.395  33.157  30.319  1.00 48.75  ?  402  TYR A CD1 1 
ATOM   3130 C CD2 . TYR A 1 426 ? 10.362  33.185  32.470  1.00 56.91  ?  402  TYR A CD2 1 
ATOM   3131 C CE1 . TYR A 1 426 ? 11.578  31.784  30.416  1.00 54.22  ?  402  TYR A CE1 1 
ATOM   3132 C CE2 . TYR A 1 426 ? 10.541  31.818  32.571  1.00 38.19  ?  402  TYR A CE2 1 
ATOM   3133 C CZ  . TYR A 1 426 ? 11.150  31.126  31.546  1.00 48.73  ?  402  TYR A CZ  1 
ATOM   3134 O OH  . TYR A 1 426 ? 11.319  29.773  31.673  1.00 56.83  ?  402  TYR A OH  1 
ATOM   3135 N N   . CYS A 1 427 ? 11.423  38.572  30.100  1.00 65.05  ?  403  CYS A N   1 
ATOM   3136 C CA  . CYS A 1 427 ? 10.927  39.756  29.398  1.00 70.72  ?  403  CYS A CA  1 
ATOM   3137 C C   . CYS A 1 427 ? 11.999  40.657  28.786  1.00 69.62  ?  403  CYS A C   1 
ATOM   3138 O O   . CYS A 1 427 ? 12.016  40.864  27.568  1.00 63.95  ?  403  CYS A O   1 
ATOM   3139 C CB  . CYS A 1 427 ? 10.054  40.603  30.328  1.00 69.51  ?  403  CYS A CB  1 
ATOM   3140 S SG  . CYS A 1 427 ? 9.187   41.942  29.469  1.00 78.33  ?  403  CYS A SG  1 
ATOM   3141 N N   . PHE A 1 428 ? 12.911  41.179  29.616  1.00 61.99  ?  404  PHE A N   1 
ATOM   3142 C CA  . PHE A 1 428 ? 13.644  42.387  29.232  1.00 63.87  ?  404  PHE A CA  1 
ATOM   3143 C C   . PHE A 1 428 ? 14.714  42.115  28.183  1.00 73.15  ?  404  PHE A C   1 
ATOM   3144 O O   . PHE A 1 428 ? 15.086  43.025  27.430  1.00 94.03  ?  404  PHE A O   1 
ATOM   3145 C CB  . PHE A 1 428 ? 14.263  43.056  30.461  1.00 69.21  ?  404  PHE A CB  1 
ATOM   3146 C CG  . PHE A 1 428 ? 13.248  43.559  31.455  1.00 69.79  ?  404  PHE A CG  1 
ATOM   3147 C CD1 . PHE A 1 428 ? 12.330  44.537  31.103  1.00 75.72  ?  404  PHE A CD1 1 
ATOM   3148 C CD2 . PHE A 1 428 ? 13.219  43.059  32.746  1.00 73.42  ?  404  PHE A CD2 1 
ATOM   3149 C CE1 . PHE A 1 428 ? 11.393  44.995  32.019  1.00 84.80  ?  404  PHE A CE1 1 
ATOM   3150 C CE2 . PHE A 1 428 ? 12.291  43.514  33.666  1.00 80.39  ?  404  PHE A CE2 1 
ATOM   3151 C CZ  . PHE A 1 428 ? 11.375  44.482  33.303  1.00 84.91  ?  404  PHE A CZ  1 
ATOM   3152 N N   . VAL A 1 429 ? 15.239  40.889  28.131  1.00 79.07  ?  405  VAL A N   1 
ATOM   3153 C CA  . VAL A 1 429 ? 16.200  40.505  27.105  1.00 71.49  ?  405  VAL A CA  1 
ATOM   3154 C C   . VAL A 1 429 ? 15.541  39.745  25.963  1.00 71.46  ?  405  VAL A C   1 
ATOM   3155 O O   . VAL A 1 429 ? 16.236  39.285  25.045  1.00 80.84  ?  405  VAL A O   1 
ATOM   3156 C CB  . VAL A 1 429 ? 17.357  39.681  27.710  1.00 73.63  ?  405  VAL A CB  1 
ATOM   3157 C CG1 . VAL A 1 429 ? 18.173  40.537  28.667  1.00 81.24  ?  405  VAL A CG1 1 
ATOM   3158 C CG2 . VAL A 1 429 ? 16.820  38.460  28.426  1.00 80.51  ?  405  VAL A CG2 1 
ATOM   3159 N N   . ASN A 1 430 ? 14.218  39.594  25.999  1.00 70.03  ?  406  ASN A N   1 
ATOM   3160 C CA  . ASN A 1 430 ? 13.498  38.949  24.911  1.00 79.89  ?  406  ASN A CA  1 
ATOM   3161 C C   . ASN A 1 430 ? 13.528  39.840  23.678  1.00 85.93  ?  406  ASN A C   1 
ATOM   3162 O O   . ASN A 1 430 ? 13.316  41.054  23.766  1.00 105.07 ?  406  ASN A O   1 
ATOM   3163 C CB  . ASN A 1 430 ? 12.057  38.646  25.326  1.00 75.34  ?  406  ASN A CB  1 
ATOM   3164 C CG  . ASN A 1 430 ? 11.248  38.015  24.211  1.00 80.29  ?  406  ASN A CG  1 
ATOM   3165 O OD1 . ASN A 1 430 ? 10.142  38.461  23.900  1.00 77.08  ?  406  ASN A OD1 1 
ATOM   3166 N ND2 . ASN A 1 430 ? 11.799  36.976  23.596  1.00 68.77  ?  406  ASN A ND2 1 
ATOM   3167 N N   . ASN A 1 431 ? 13.810  39.231  22.525  1.00 86.53  ?  407  ASN A N   1 
ATOM   3168 C CA  . ASN A 1 431 ? 13.955  40.007  21.297  1.00 71.65  ?  407  ASN A CA  1 
ATOM   3169 C C   . ASN A 1 431 ? 12.620  40.569  20.821  1.00 73.89  ?  407  ASN A C   1 
ATOM   3170 O O   . ASN A 1 431 ? 12.572  41.680  20.275  1.00 90.45  ?  407  ASN A O   1 
ATOM   3171 C CB  . ASN A 1 431 ? 14.598  39.142  20.211  1.00 71.71  ?  407  ASN A CB  1 
ATOM   3172 C CG  . ASN A 1 431 ? 15.925  38.545  20.655  1.00 96.05  ?  407  ASN A CG  1 
ATOM   3173 O OD1 . ASN A 1 431 ? 16.200  38.451  21.851  1.00 122.79 ?  407  ASN A OD1 1 
ATOM   3174 N ND2 . ASN A 1 431 ? 16.752  38.141  19.695  1.00 81.51  ?  407  ASN A ND2 1 
ATOM   3175 N N   . GLU A 1 432 ? 11.532  39.830  21.035  1.00 71.66  ?  408  GLU A N   1 
ATOM   3176 C CA  . GLU A 1 432 ? 10.224  40.252  20.541  1.00 74.59  ?  408  GLU A CA  1 
ATOM   3177 C C   . GLU A 1 432 ? 9.767   41.558  21.198  1.00 81.54  ?  408  GLU A C   1 
ATOM   3178 O O   . GLU A 1 432 ? 9.251   42.465  20.524  1.00 100.25 ?  408  GLU A O   1 
ATOM   3179 C CB  . GLU A 1 432 ? 9.209   39.129  20.779  1.00 81.82  ?  408  GLU A CB  1 
ATOM   3180 C CG  . GLU A 1 432 ? 9.312   37.933  19.810  1.00 81.08  ?  408  GLU A CG  1 
ATOM   3181 C CD  . GLU A 1 432 ? 10.523  37.030  20.038  1.00 73.03  ?  408  GLU A CD  1 
ATOM   3182 O OE1 . GLU A 1 432 ? 11.110  37.052  21.138  1.00 60.43  ?  408  GLU A OE1 1 
ATOM   3183 O OE2 . GLU A 1 432 ? 10.892  36.289  19.105  1.00 56.76  -1 408  GLU A OE2 1 
ATOM   3184 N N   . VAL A 1 433 ? 9.972   41.690  22.510  1.00 75.47  ?  409  VAL A N   1 
ATOM   3185 C CA  . VAL A 1 433 ? 9.542   42.909  23.189  1.00 79.86  ?  409  VAL A CA  1 
ATOM   3186 C C   . VAL A 1 433 ? 10.406  44.092  22.769  1.00 82.23  ?  409  VAL A C   1 
ATOM   3187 O O   . VAL A 1 433 ? 9.915   45.228  22.663  1.00 81.23  ?  409  VAL A O   1 
ATOM   3188 C CB  . VAL A 1 433 ? 9.550   42.702  24.717  1.00 82.98  ?  409  VAL A CB  1 
ATOM   3189 C CG1 . VAL A 1 433 ? 8.917   41.372  25.063  1.00 82.41  ?  409  VAL A CG1 1 
ATOM   3190 C CG2 . VAL A 1 433 ? 10.960  42.774  25.283  1.00 85.72  ?  409  VAL A CG2 1 
ATOM   3191 N N   . GLN A 1 434 ? 11.693  43.856  22.507  1.00 78.91  ?  410  GLN A N   1 
ATOM   3192 C CA  . GLN A 1 434 ? 12.536  44.934  22.007  1.00 89.14  ?  410  GLN A CA  1 
ATOM   3193 C C   . GLN A 1 434 ? 12.062  45.387  20.632  1.00 92.82  ?  410  GLN A C   1 
ATOM   3194 O O   . GLN A 1 434 ? 12.077  46.592  20.322  1.00 80.67  ?  410  GLN A O   1 
ATOM   3195 C CB  . GLN A 1 434 ? 13.999  44.477  21.985  1.00 95.87  ?  410  GLN A CB  1 
ATOM   3196 C CG  . GLN A 1 434 ? 14.528  44.115  23.380  1.00 99.50  ?  410  GLN A CG  1 
ATOM   3197 C CD  . GLN A 1 434 ? 15.971  43.615  23.395  1.00 106.31 ?  410  GLN A CD  1 
ATOM   3198 O OE1 . GLN A 1 434 ? 16.542  43.265  22.359  1.00 99.85  ?  410  GLN A OE1 1 
ATOM   3199 N NE2 . GLN A 1 434 ? 16.564  43.579  24.584  1.00 90.81  ?  410  GLN A NE2 1 
ATOM   3200 N N   . LEU A 1 435 ? 11.583  44.439  19.822  1.00 86.34  ?  411  LEU A N   1 
ATOM   3201 C CA  . LEU A 1 435 ? 10.913  44.800  18.578  1.00 89.93  ?  411  LEU A CA  1 
ATOM   3202 C C   . LEU A 1 435 ? 9.722   45.707  18.843  1.00 92.17  ?  411  LEU A C   1 
ATOM   3203 O O   . LEU A 1 435 ? 9.524   46.702  18.142  1.00 85.84  ?  411  LEU A O   1 
ATOM   3204 C CB  . LEU A 1 435 ? 10.441  43.549  17.841  1.00 98.72  ?  411  LEU A CB  1 
ATOM   3205 C CG  . LEU A 1 435 ? 11.452  42.759  17.023  1.00 108.96 ?  411  LEU A CG  1 
ATOM   3206 C CD1 . LEU A 1 435 ? 10.787  41.505  16.502  1.00 109.50 ?  411  LEU A CD1 1 
ATOM   3207 C CD2 . LEU A 1 435 ? 11.983  43.598  15.873  1.00 107.92 ?  411  LEU A CD2 1 
ATOM   3208 N N   . GLU A 1 436 ? 8.901   45.365  19.834  1.00 88.28  ?  412  GLU A N   1 
ATOM   3209 C CA  . GLU A 1 436 ? 7.715   46.183  20.082  1.00 90.60  ?  412  GLU A CA  1 
ATOM   3210 C C   . GLU A 1 436 ? 8.099   47.609  20.475  1.00 101.31 ?  412  GLU A C   1 
ATOM   3211 O O   . GLU A 1 436 ? 7.492   48.580  20.000  1.00 112.86 ?  412  GLU A O   1 
ATOM   3212 C CB  . GLU A 1 436 ? 6.833   45.528  21.145  1.00 92.74  ?  412  GLU A CB  1 
ATOM   3213 C CG  . GLU A 1 436 ? 6.233   44.198  20.691  1.00 98.39  ?  412  GLU A CG  1 
ATOM   3214 C CD  . GLU A 1 436 ? 5.527   44.291  19.342  1.00 113.34 ?  412  GLU A CD  1 
ATOM   3215 O OE1 . GLU A 1 436 ? 4.688   45.199  19.157  1.00 115.29 ?  412  GLU A OE1 1 
ATOM   3216 O OE2 . GLU A 1 436 ? 5.821   43.456  18.461  1.00 125.52 -1 412  GLU A OE2 1 
ATOM   3217 N N   . PHE A 1 437 ? 9.141   47.759  21.298  1.00 99.78  ?  413  PHE A N   1 
ATOM   3218 C CA  . PHE A 1 437 ? 9.544   49.107  21.705  1.00 104.39 ?  413  PHE A CA  1 
ATOM   3219 C C   . PHE A 1 437 ? 10.060  49.920  20.517  1.00 111.61 ?  413  PHE A C   1 
ATOM   3220 O O   . PHE A 1 437 ? 9.674   51.087  20.336  1.00 131.44 ?  413  PHE A O   1 
ATOM   3221 C CB  . PHE A 1 437 ? 10.589  49.045  22.822  1.00 115.12 ?  413  PHE A CB  1 
ATOM   3222 C CG  . PHE A 1 437 ? 10.011  48.698  24.174  1.00 112.00 ?  413  PHE A CG  1 
ATOM   3223 C CD1 . PHE A 1 437 ? 9.428   49.671  24.972  1.00 99.40  ?  413  PHE A CD1 1 
ATOM   3224 C CD2 . PHE A 1 437 ? 10.044  47.396  24.639  1.00 120.31 ?  413  PHE A CD2 1 
ATOM   3225 C CE1 . PHE A 1 437 ? 8.890   49.345  26.210  1.00 99.06  ?  413  PHE A CE1 1 
ATOM   3226 C CE2 . PHE A 1 437 ? 9.508   47.064  25.869  1.00 115.62 ?  413  PHE A CE2 1 
ATOM   3227 C CZ  . PHE A 1 437 ? 8.932   48.038  26.656  1.00 113.83 ?  413  PHE A CZ  1 
ATOM   3228 N N   . ARG A 1 438 ? 10.917  49.325  19.682  1.00 96.24  ?  414  ARG A N   1 
ATOM   3229 C CA  . ARG A 1 438 ? 11.431  50.093  18.547  1.00 96.10  ?  414  ARG A CA  1 
ATOM   3230 C C   . ARG A 1 438 ? 10.325  50.392  17.534  1.00 94.58  ?  414  ARG A C   1 
ATOM   3231 O O   . ARG A 1 438 ? 10.281  51.486  16.959  1.00 95.54  ?  414  ARG A O   1 
ATOM   3232 C CB  . ARG A 1 438 ? 12.615  49.360  17.902  1.00 100.35 ?  414  ARG A CB  1 
ATOM   3233 C CG  . ARG A 1 438 ? 13.088  49.872  16.524  1.00 120.50 ?  414  ARG A CG  1 
ATOM   3234 C CD  . ARG A 1 438 ? 13.227  51.401  16.396  1.00 161.81 ?  414  ARG A CD  1 
ATOM   3235 N NE  . ARG A 1 438 ? 14.190  52.008  17.309  1.00 194.04 ?  414  ARG A NE  1 
ATOM   3236 C CZ  . ARG A 1 438 ? 14.422  53.316  17.367  1.00 195.23 ?  414  ARG A CZ  1 
ATOM   3237 N NH1 . ARG A 1 438 ? 13.756  54.144  16.569  1.00 180.39 ?  414  ARG A NH1 1 
ATOM   3238 N NH2 . ARG A 1 438 ? 15.315  53.798  18.221  1.00 201.25 ?  414  ARG A NH2 1 
ATOM   3239 N N   . LYS A 1 439 ? 9.403   49.448  17.325  1.00 108.52 ?  415  LYS A N   1 
ATOM   3240 C CA  . LYS A 1 439 ? 8.283   49.676  16.415  1.00 97.86  ?  415  LYS A CA  1 
ATOM   3241 C C   . LYS A 1 439 ? 7.408   50.827  16.894  1.00 91.44  ?  415  LYS A C   1 
ATOM   3242 O O   . LYS A 1 439 ? 6.956   51.644  16.082  1.00 93.63  ?  415  LYS A O   1 
ATOM   3243 C CB  . LYS A 1 439 ? 7.460   48.386  16.291  1.00 116.69 ?  415  LYS A CB  1 
ATOM   3244 C CG  . LYS A 1 439 ? 6.451   48.332  15.151  1.00 134.82 ?  415  LYS A CG  1 
ATOM   3245 C CD  . LYS A 1 439 ? 5.883   46.915  14.975  1.00 144.63 ?  415  LYS A CD  1 
ATOM   3246 C CE  . LYS A 1 439 ? 4.939   46.520  16.113  1.00 150.74 ?  415  LYS A CE  1 
ATOM   3247 N NZ  . LYS A 1 439 ? 4.376   45.146  15.946  1.00 130.94 ?  415  LYS A NZ  1 
ATOM   3248 N N   . SER A 1 440 ? 7.197   50.933  18.211  1.00 92.16  ?  416  SER A N   1 
ATOM   3249 C CA  . SER A 1 440 ? 6.383   52.023  18.743  1.00 107.98 ?  416  SER A CA  1 
ATOM   3250 C C   . SER A 1 440 ? 7.085   53.368  18.586  1.00 116.60 ?  416  SER A C   1 
ATOM   3251 O O   . SER A 1 440 ? 6.462   54.362  18.180  1.00 106.37 ?  416  SER A O   1 
ATOM   3252 C CB  . SER A 1 440 ? 6.055   51.754  20.215  1.00 99.61  ?  416  SER A CB  1 
ATOM   3253 O OG  . SER A 1 440 ? 5.147   52.707  20.740  1.00 116.52 ?  416  SER A OG  1 
ATOM   3254 N N   . TRP A 1 441 ? 8.385   53.423  18.892  1.00 113.52 ?  417  TRP A N   1 
ATOM   3255 C CA  . TRP A 1 441 ? 9.102   54.678  18.675  1.00 116.73 ?  417  TRP A CA  1 
ATOM   3256 C C   . TRP A 1 441 ? 9.067   55.080  17.207  1.00 121.19 ?  417  TRP A C   1 
ATOM   3257 O O   . TRP A 1 441 ? 8.905   56.269  16.878  1.00 123.98 ?  417  TRP A O   1 
ATOM   3258 C CB  . TRP A 1 441 ? 10.549  54.555  19.153  1.00 125.21 ?  417  TRP A CB  1 
ATOM   3259 N N   . GLU A 1 442 ? 9.163   54.094  16.316  1.00 133.64 ?  418  GLU A N   1 
ATOM   3260 C CA  . GLU A 1 442 ? 9.086   54.373  14.889  1.00 137.72 ?  418  GLU A CA  1 
ATOM   3261 C C   . GLU A 1 442 ? 7.725   54.941  14.520  1.00 139.51 ?  418  GLU A C   1 
ATOM   3262 O O   . GLU A 1 442 ? 7.634   55.865  13.704  1.00 129.66 ?  418  GLU A O   1 
ATOM   3263 C CB  . GLU A 1 442 ? 9.364   53.099  14.092  1.00 135.72 ?  418  GLU A CB  1 
ATOM   3264 C CG  . GLU A 1 442 ? 9.662   53.333  12.625  1.00 159.22 ?  418  GLU A CG  1 
ATOM   3265 C CD  . GLU A 1 442 ? 11.015  53.971  12.411  1.00 175.85 ?  418  GLU A CD  1 
ATOM   3266 O OE1 . GLU A 1 442 ? 11.913  53.749  13.251  1.00 176.34 ?  418  GLU A OE1 1 
ATOM   3267 O OE2 . GLU A 1 442 ? 11.177  54.704  11.412  1.00 191.62 -1 418  GLU A OE2 1 
ATOM   3268 N N   . ARG A 1 443 ? 6.656   54.400  15.107  1.00 145.99 ?  419  ARG A N   1 
ATOM   3269 C CA  . ARG A 1 443 ? 5.334   54.974  14.875  1.00 140.41 ?  419  ARG A CA  1 
ATOM   3270 C C   . ARG A 1 443 ? 5.274   56.422  15.339  1.00 151.57 ?  419  ARG A C   1 
ATOM   3271 O O   . ARG A 1 443 ? 4.633   57.258  14.690  1.00 174.38 ?  419  ARG A O   1 
ATOM   3272 C CB  . ARG A 1 443 ? 4.260   54.154  15.590  1.00 133.57 ?  419  ARG A CB  1 
ATOM   3273 C CG  . ARG A 1 443 ? 4.182   52.698  15.164  1.00 154.42 ?  419  ARG A CG  1 
ATOM   3274 C CD  . ARG A 1 443 ? 3.629   52.527  13.760  1.00 161.12 ?  419  ARG A CD  1 
ATOM   3275 N NE  . ARG A 1 443 ? 3.735   51.133  13.346  1.00 170.98 ?  419  ARG A NE  1 
ATOM   3276 C CZ  . ARG A 1 443 ? 2.873   50.183  13.693  1.00 168.45 ?  419  ARG A CZ  1 
ATOM   3277 N NH1 . ARG A 1 443 ? 1.827   50.475  14.455  1.00 171.54 ?  419  ARG A NH1 1 
ATOM   3278 N NH2 . ARG A 1 443 ? 3.060   48.938  13.277  1.00 164.66 ?  419  ARG A NH2 1 
ATOM   3279 N N   . TRP A 1 444 ? 5.941   56.745  16.450  1.00 148.53 ?  420  TRP A N   1 
ATOM   3280 C CA  . TRP A 1 444 ? 5.908   58.131  16.920  1.00 141.84 ?  420  TRP A CA  1 
ATOM   3281 C C   . TRP A 1 444 ? 6.637   59.062  15.957  1.00 143.47 ?  420  TRP A C   1 
ATOM   3282 O O   . TRP A 1 444 ? 6.209   60.202  15.746  1.00 139.36 ?  420  TRP A O   1 
ATOM   3283 C CB  . TRP A 1 444 ? 6.496   58.263  18.329  1.00 148.55 ?  420  TRP A CB  1 
ATOM   3284 C CG  . TRP A 1 444 ? 6.434   59.698  18.888  1.00 155.25 ?  420  TRP A CG  1 
ATOM   3285 C CD1 . TRP A 1 444 ? 7.407   60.660  18.799  1.00 143.17 ?  420  TRP A CD1 1 
ATOM   3286 C CD2 . TRP A 1 444 ? 5.343   60.308  19.605  1.00 160.79 ?  420  TRP A CD2 1 
ATOM   3287 N NE1 . TRP A 1 444 ? 6.990   61.819  19.414  1.00 144.33 ?  420  TRP A NE1 1 
ATOM   3288 C CE2 . TRP A 1 444 ? 5.731   61.630  19.918  1.00 153.56 ?  420  TRP A CE2 1 
ATOM   3289 C CE3 . TRP A 1 444 ? 4.082   59.863  20.018  1.00 168.16 ?  420  TRP A CE3 1 
ATOM   3290 C CZ2 . TRP A 1 444 ? 4.903   62.508  20.619  1.00 145.70 ?  420  TRP A CZ2 1 
ATOM   3291 C CZ3 . TRP A 1 444 ? 3.261   60.740  20.715  1.00 154.22 ?  420  TRP A CZ3 1 
ATOM   3292 C CH2 . TRP A 1 444 ? 3.676   62.046  21.007  1.00 132.63 ?  420  TRP A CH2 1 
ATOM   3293 N N   . ARG A 1 445 ? 7.741   58.606  15.367  1.00 137.23 ?  421  ARG A N   1 
ATOM   3294 C CA  . ARG A 1 445 ? 8.446   59.470  14.421  1.00 130.24 ?  421  ARG A CA  1 
ATOM   3295 C C   . ARG A 1 445 ? 7.646   59.652  13.130  1.00 150.62 ?  421  ARG A C   1 
ATOM   3296 O O   . ARG A 1 445 ? 7.398   60.784  12.695  1.00 179.08 ?  421  ARG A O   1 
ATOM   3297 C CB  . ARG A 1 445 ? 9.843   58.913  14.136  1.00 103.91 ?  421  ARG A CB  1 
ATOM   3298 N N   . LEU A 1 446 ? 7.204   58.554  12.523  1.00 160.01 ?  422  LEU A N   1 
ATOM   3299 C CA  . LEU A 1 446 ? 6.483   58.618  11.254  1.00 132.92 ?  422  LEU A CA  1 
ATOM   3300 C C   . LEU A 1 446 ? 4.975   58.729  11.467  1.00 110.05 ?  422  LEU A C   1 
ATOM   3301 O O   . LEU A 1 446 ? 4.478   59.739  11.966  1.00 109.92 ?  422  LEU A O   1 
ATOM   3302 C CB  . LEU A 1 446 ? 6.799   57.387  10.398  1.00 128.26 ?  422  LEU A CB  1 
ATOM   3303 N N   . SER B 1 10  ? 62.234  -3.006  19.004  1.00 127.05 ?  136  SER B N   1 
ATOM   3304 C CA  . SER B 1 10  ? 61.029  -3.135  18.187  1.00 125.49 ?  136  SER B CA  1 
ATOM   3305 C C   . SER B 1 10  ? 60.061  -1.991  18.464  1.00 135.17 ?  136  SER B C   1 
ATOM   3306 O O   . SER B 1 10  ? 59.847  -1.618  19.618  1.00 138.88 ?  136  SER B O   1 
ATOM   3307 C CB  . SER B 1 10  ? 60.353  -4.479  18.445  1.00 123.33 ?  136  SER B CB  1 
ATOM   3308 N N   . PRO B 1 11  ? 59.479  -1.431  17.403  1.00 148.87 ?  137  PRO B N   1 
ATOM   3309 C CA  . PRO B 1 11  ? 58.555  -0.304  17.584  1.00 146.77 ?  137  PRO B CA  1 
ATOM   3310 C C   . PRO B 1 11  ? 57.204  -0.717  18.153  1.00 150.18 ?  137  PRO B C   1 
ATOM   3311 O O   . PRO B 1 11  ? 56.690  -0.057  19.062  1.00 127.41 ?  137  PRO B O   1 
ATOM   3312 C CB  . PRO B 1 11  ? 58.420  0.260   16.166  1.00 131.64 ?  137  PRO B CB  1 
ATOM   3313 C CG  . PRO B 1 11  ? 58.632  -0.929  15.281  1.00 125.79 ?  137  PRO B CG  1 
ATOM   3314 C CD  . PRO B 1 11  ? 59.618  -1.820  15.988  1.00 140.49 ?  137  PRO B CD  1 
ATOM   3315 N N   . GLU B 1 12  ? 56.620  -1.805  17.638  1.00 163.02 ?  138  GLU B N   1 
ATOM   3316 C CA  . GLU B 1 12  ? 55.316  -2.240  18.131  1.00 151.64 ?  138  GLU B CA  1 
ATOM   3317 C C   . GLU B 1 12  ? 55.413  -2.818  19.538  1.00 141.75 ?  138  GLU B C   1 
ATOM   3318 O O   . GLU B 1 12  ? 54.458  -2.715  20.328  1.00 141.14 ?  138  GLU B O   1 
ATOM   3319 C CB  . GLU B 1 12  ? 54.713  -3.267  17.173  1.00 148.67 ?  138  GLU B CB  1 
ATOM   3320 N N   . GLU B 1 13  ? 56.561  -3.413  19.870  1.00 133.86 ?  139  GLU B N   1 
ATOM   3321 C CA  . GLU B 1 13  ? 56.735  -4.009  21.189  1.00 120.58 ?  139  GLU B CA  1 
ATOM   3322 C C   . GLU B 1 13  ? 56.683  -2.957  22.288  1.00 113.89 ?  139  GLU B C   1 
ATOM   3323 O O   . GLU B 1 13  ? 56.190  -3.236  23.387  1.00 97.90  ?  139  GLU B O   1 
ATOM   3324 C CB  . GLU B 1 13  ? 58.059  -4.770  21.254  1.00 116.22 ?  139  GLU B CB  1 
ATOM   3325 N N   . GLN B 1 14  ? 57.160  -1.743  22.007  1.00 122.92 ?  140  GLN B N   1 
ATOM   3326 C CA  . GLN B 1 14  ? 57.129  -0.683  23.011  1.00 110.22 ?  140  GLN B CA  1 
ATOM   3327 C C   . GLN B 1 14  ? 55.696  -0.309  23.369  1.00 106.68 ?  140  GLN B C   1 
ATOM   3328 O O   . GLN B 1 14  ? 55.333  -0.232  24.555  1.00 95.19  ?  140  GLN B O   1 
ATOM   3329 C CB  . GLN B 1 14  ? 57.890  0.542   22.500  1.00 106.73 ?  140  GLN B CB  1 
ATOM   3330 N N   . LEU B 1 15  ? 54.866  -0.073  22.353  1.00 93.56  ?  141  LEU B N   1 
ATOM   3331 C CA  . LEU B 1 15  ? 53.474  0.248   22.618  1.00 86.22  ?  141  LEU B CA  1 
ATOM   3332 C C   . LEU B 1 15  ? 52.756  -0.897  23.308  1.00 102.46 ?  141  LEU B C   1 
ATOM   3333 O O   . LEU B 1 15  ? 51.956  -0.644  24.218  1.00 107.77 ?  141  LEU B O   1 
ATOM   3334 C CB  . LEU B 1 15  ? 52.750  0.605   21.318  1.00 75.36  ?  141  LEU B CB  1 
ATOM   3335 N N   . LEU B 1 16  ? 53.076  -2.148  22.957  1.00 120.80 ?  142  LEU B N   1 
ATOM   3336 C CA  . LEU B 1 16  ? 52.399  -3.252  23.630  1.00 117.17 ?  142  LEU B CA  1 
ATOM   3337 C C   . LEU B 1 16  ? 52.801  -3.352  25.097  1.00 113.84 ?  142  LEU B C   1 
ATOM   3338 O O   . LEU B 1 16  ? 51.949  -3.599  25.965  1.00 97.13  ?  142  LEU B O   1 
ATOM   3339 C CB  . LEU B 1 16  ? 52.706  -4.569  22.922  1.00 127.46 ?  142  LEU B CB  1 
ATOM   3340 N N   . PHE B 1 17  ? 54.079  -3.124  25.397  1.00 112.67 ?  143  PHE B N   1 
ATOM   3341 C CA  . PHE B 1 17  ? 54.544  -3.210  26.776  1.00 110.41 ?  143  PHE B CA  1 
ATOM   3342 C C   . PHE B 1 17  ? 53.929  -2.108  27.633  1.00 112.75 ?  143  PHE B C   1 
ATOM   3343 O O   . PHE B 1 17  ? 53.498  -2.350  28.778  1.00 111.69 ?  143  PHE B O   1 
ATOM   3344 C CB  . PHE B 1 17  ? 56.071  -3.131  26.797  1.00 108.38 ?  143  PHE B CB  1 
ATOM   3345 C CG  . PHE B 1 17  ? 56.684  -3.411  28.141  1.00 111.50 ?  143  PHE B CG  1 
ATOM   3346 C CD1 . PHE B 1 17  ? 56.785  -4.709  28.617  1.00 116.05 ?  143  PHE B CD1 1 
ATOM   3347 C CD2 . PHE B 1 17  ? 57.198  -2.381  28.913  1.00 105.26 ?  143  PHE B CD2 1 
ATOM   3348 C CE1 . PHE B 1 17  ? 57.367  -4.971  29.849  1.00 111.26 ?  143  PHE B CE1 1 
ATOM   3349 C CE2 . PHE B 1 17  ? 57.779  -2.637  30.147  1.00 102.73 ?  143  PHE B CE2 1 
ATOM   3350 C CZ  . PHE B 1 17  ? 57.864  -3.935  30.613  1.00 106.66 ?  143  PHE B CZ  1 
ATOM   3351 N N   . LEU B 1 18  ? 53.883  -0.886  27.099  1.00 98.34  ?  144  LEU B N   1 
ATOM   3352 C CA  . LEU B 1 18  ? 53.212  0.182   27.831  1.00 101.12 ?  144  LEU B CA  1 
ATOM   3353 C C   . LEU B 1 18  ? 51.736  -0.132  28.022  1.00 102.11 ?  144  LEU B C   1 
ATOM   3354 O O   . LEU B 1 18  ? 51.172  0.146   29.091  1.00 105.98 ?  144  LEU B O   1 
ATOM   3355 C CB  . LEU B 1 18  ? 53.399  1.521   27.112  1.00 86.84  ?  144  LEU B CB  1 
ATOM   3356 C CG  . LEU B 1 18  ? 54.811  2.101   27.259  1.00 90.85  ?  144  LEU B CG  1 
ATOM   3357 C CD1 . LEU B 1 18  ? 55.122  3.132   26.183  1.00 87.82  ?  144  LEU B CD1 1 
ATOM   3358 C CD2 . LEU B 1 18  ? 55.012  2.704   28.644  1.00 83.04  ?  144  LEU B CD2 1 
ATOM   3359 N N   . TYR B 1 19  ? 51.110  -0.765  27.025  1.00 104.29 ?  145  TYR B N   1 
ATOM   3360 C CA  . TYR B 1 19  ? 49.728  -1.202  27.179  1.00 98.40  ?  145  TYR B CA  1 
ATOM   3361 C C   . TYR B 1 19  ? 49.586  -2.154  28.356  1.00 98.46  ?  145  TYR B C   1 
ATOM   3362 O O   . TYR B 1 19  ? 48.633  -2.038  29.141  1.00 93.97  ?  145  TYR B O   1 
ATOM   3363 C CB  . TYR B 1 19  ? 49.252  -1.877  25.883  1.00 105.39 ?  145  TYR B CB  1 
ATOM   3364 C CG  . TYR B 1 19  ? 47.876  -2.510  25.947  1.00 106.32 ?  145  TYR B CG  1 
ATOM   3365 C CD1 . TYR B 1 19  ? 46.731  -1.755  25.718  1.00 107.70 ?  145  TYR B CD1 1 
ATOM   3366 C CD2 . TYR B 1 19  ? 47.721  -3.867  26.217  1.00 105.10 ?  145  TYR B CD2 1 
ATOM   3367 C CE1 . TYR B 1 19  ? 45.469  -2.332  25.773  1.00 110.06 ?  145  TYR B CE1 1 
ATOM   3368 C CE2 . TYR B 1 19  ? 46.464  -4.447  26.272  1.00 100.36 ?  145  TYR B CE2 1 
ATOM   3369 C CZ  . TYR B 1 19  ? 45.344  -3.676  26.050  1.00 108.58 ?  145  TYR B CZ  1 
ATOM   3370 O OH  . TYR B 1 19  ? 44.097  -4.252  26.105  1.00 96.19  ?  145  TYR B OH  1 
ATOM   3371 N N   . ILE B 1 20  ? 50.537  -3.078  28.512  1.00 91.87  ?  146  ILE B N   1 
ATOM   3372 C CA  . ILE B 1 20  ? 50.445  -4.032  29.614  1.00 98.06  ?  146  ILE B CA  1 
ATOM   3373 C C   . ILE B 1 20  ? 50.496  -3.302  30.944  1.00 104.50 ?  146  ILE B C   1 
ATOM   3374 O O   . ILE B 1 20  ? 49.680  -3.556  31.842  1.00 107.59 ?  146  ILE B O   1 
ATOM   3375 C CB  . ILE B 1 20  ? 51.553  -5.097  29.541  1.00 102.43 ?  146  ILE B CB  1 
ATOM   3376 C CG1 . ILE B 1 20  ? 51.363  -5.988  28.324  1.00 95.13  ?  146  ILE B CG1 1 
ATOM   3377 C CG2 . ILE B 1 20  ? 51.526  -5.954  30.804  1.00 89.99  ?  146  ILE B CG2 1 
ATOM   3378 C CD1 . ILE B 1 20  ? 49.962  -6.532  28.192  1.00 89.89  ?  146  ILE B CD1 1 
ATOM   3379 N N   . ILE B 1 21  ? 51.488  -2.422  31.115  1.00 106.06 ?  147  ILE B N   1 
ATOM   3380 C CA  . ILE B 1 21  ? 51.605  -1.816  32.441  1.00 109.53 ?  147  ILE B CA  1 
ATOM   3381 C C   . ILE B 1 21  ? 50.385  -0.954  32.733  1.00 108.24 ?  147  ILE B C   1 
ATOM   3382 O O   . ILE B 1 21  ? 49.897  -0.926  33.867  1.00 135.36 ?  147  ILE B O   1 
ATOM   3383 C CB  . ILE B 1 21  ? 52.930  -1.042  32.625  1.00 110.41 ?  147  ILE B CB  1 
ATOM   3384 C CG1 . ILE B 1 21  ? 53.147  0.019   31.544  1.00 133.91 ?  147  ILE B CG1 1 
ATOM   3385 C CG2 . ILE B 1 21  ? 54.091  -2.020  32.701  1.00 105.20 ?  147  ILE B CG2 1 
ATOM   3386 C CD1 . ILE B 1 21  ? 52.659  1.391   31.946  1.00 160.55 ?  147  ILE B CD1 1 
ATOM   3387 N N   . TYR B 1 22  ? 49.806  -0.334  31.704  1.00 92.09  ?  148  TYR B N   1 
ATOM   3388 C CA  . TYR B 1 22  ? 48.621  0.496   31.910  1.00 80.88  ?  148  TYR B CA  1 
ATOM   3389 C C   . TYR B 1 22  ? 47.437  -0.348  32.376  1.00 80.63  ?  148  TYR B C   1 
ATOM   3390 O O   . TYR B 1 22  ? 46.778  -0.035  33.381  1.00 79.31  ?  148  TYR B O   1 
ATOM   3391 C CB  . TYR B 1 22  ? 48.295  1.225   30.602  1.00 78.64  ?  148  TYR B CB  1 
ATOM   3392 C CG  . TYR B 1 22  ? 47.203  2.269   30.660  1.00 83.72  ?  148  TYR B CG  1 
ATOM   3393 C CD1 . TYR B 1 22  ? 47.487  3.580   31.028  1.00 90.61  ?  148  TYR B CD1 1 
ATOM   3394 C CD2 . TYR B 1 22  ? 45.896  1.955   30.311  1.00 78.20  ?  148  TYR B CD2 1 
ATOM   3395 C CE1 . TYR B 1 22  ? 46.492  4.544   31.067  1.00 89.55  ?  148  TYR B CE1 1 
ATOM   3396 C CE2 . TYR B 1 22  ? 44.897  2.911   30.348  1.00 76.53  ?  148  TYR B CE2 1 
ATOM   3397 C CZ  . TYR B 1 22  ? 45.201  4.201   30.726  1.00 82.32  ?  148  TYR B CZ  1 
ATOM   3398 O OH  . TYR B 1 22  ? 44.204  5.143   30.761  1.00 88.64  ?  148  TYR B OH  1 
ATOM   3399 N N   . THR B 1 23  ? 47.166  -1.442  31.667  1.00 77.27  ?  149  THR B N   1 
ATOM   3400 C CA  . THR B 1 23  ? 45.982  -2.227  31.994  1.00 74.77  ?  149  THR B CA  1 
ATOM   3401 C C   . THR B 1 23  ? 46.136  -2.941  33.332  1.00 78.93  ?  149  THR B C   1 
ATOM   3402 O O   . THR B 1 23  ? 45.157  -3.090  34.075  1.00 72.20  ?  149  THR B O   1 
ATOM   3403 C CB  . THR B 1 23  ? 45.669  -3.220  30.873  1.00 78.38  ?  149  THR B CB  1 
ATOM   3404 O OG1 . THR B 1 23  ? 46.849  -3.949  30.511  1.00 95.60  ?  149  THR B OG1 1 
ATOM   3405 C CG2 . THR B 1 23  ? 45.118  -2.485  29.646  1.00 79.22  ?  149  THR B CG2 1 
ATOM   3406 N N   . VAL B 1 24  ? 47.354  -3.369  33.680  1.00 79.93  ?  150  VAL B N   1 
ATOM   3407 C CA  . VAL B 1 24  ? 47.495  -4.017  34.981  1.00 85.35  ?  150  VAL B CA  1 
ATOM   3408 C C   . VAL B 1 24  ? 47.472  -2.982  36.095  1.00 97.19  ?  150  VAL B C   1 
ATOM   3409 O O   . VAL B 1 24  ? 47.039  -3.278  37.216  1.00 107.48 ?  150  VAL B O   1 
ATOM   3410 C CB  . VAL B 1 24  ? 48.759  -4.891  35.040  1.00 77.71  ?  150  VAL B CB  1 
ATOM   3411 C CG1 . VAL B 1 24  ? 48.755  -5.883  33.893  1.00 86.41  ?  150  VAL B CG1 1 
ATOM   3412 C CG2 . VAL B 1 24  ? 50.019  -4.038  35.018  1.00 85.99  ?  150  VAL B CG2 1 
ATOM   3413 N N   . GLY B 1 25  ? 47.898  -1.750  35.812  1.00 92.12  ?  151  GLY B N   1 
ATOM   3414 C CA  . GLY B 1 25  ? 47.726  -0.696  36.794  1.00 78.49  ?  151  GLY B CA  1 
ATOM   3415 C C   . GLY B 1 25  ? 46.265  -0.469  37.117  1.00 74.37  ?  151  GLY B C   1 
ATOM   3416 O O   . GLY B 1 25  ? 45.871  -0.424  38.288  1.00 56.71  ?  151  GLY B O   1 
ATOM   3417 N N   . TYR B 1 26  ? 45.428  -0.373  36.081  1.00 71.53  ?  152  TYR B N   1 
ATOM   3418 C CA  . TYR B 1 26  ? 44.008  -0.180  36.359  1.00 69.59  ?  152  TYR B CA  1 
ATOM   3419 C C   . TYR B 1 26  ? 43.346  -1.430  36.933  1.00 64.11  ?  152  TYR B C   1 
ATOM   3420 O O   . TYR B 1 26  ? 42.402  -1.299  37.715  1.00 50.50  ?  152  TYR B O   1 
ATOM   3421 C CB  . TYR B 1 26  ? 43.262  0.289   35.108  1.00 70.21  ?  152  TYR B CB  1 
ATOM   3422 C CG  . TYR B 1 26  ? 43.349  1.788   34.892  1.00 73.31  ?  152  TYR B CG  1 
ATOM   3423 C CD1 . TYR B 1 26  ? 42.485  2.664   35.549  1.00 69.60  ?  152  TYR B CD1 1 
ATOM   3424 C CD2 . TYR B 1 26  ? 44.300  2.329   34.040  1.00 74.81  ?  152  TYR B CD2 1 
ATOM   3425 C CE1 . TYR B 1 26  ? 42.567  4.037   35.351  1.00 54.96  ?  152  TYR B CE1 1 
ATOM   3426 C CE2 . TYR B 1 26  ? 44.388  3.694   33.838  1.00 58.30  ?  152  TYR B CE2 1 
ATOM   3427 C CZ  . TYR B 1 26  ? 43.521  4.545   34.492  1.00 50.67  ?  152  TYR B CZ  1 
ATOM   3428 O OH  . TYR B 1 26  ? 43.619  5.900   34.283  1.00 69.55  ?  152  TYR B OH  1 
ATOM   3429 N N   . ALA B 1 27  ? 43.848  -2.630  36.626  1.00 65.03  ?  153  ALA B N   1 
ATOM   3430 C CA  . ALA B 1 27  ? 43.298  -3.831  37.252  1.00 64.80  ?  153  ALA B CA  1 
ATOM   3431 C C   . ALA B 1 27  ? 43.604  -3.858  38.745  1.00 68.81  ?  153  ALA B C   1 
ATOM   3432 O O   . ALA B 1 27  ? 42.710  -4.088  39.575  1.00 54.30  ?  153  ALA B O   1 
ATOM   3433 C CB  . ALA B 1 27  ? 43.857  -5.081  36.571  1.00 51.75  ?  153  ALA B CB  1 
ATOM   3434 N N   . LEU B 1 28  ? 44.869  -3.629  39.107  1.00 69.46  ?  154  LEU B N   1 
ATOM   3435 C CA  . LEU B 1 28  ? 45.232  -3.575  40.516  1.00 67.30  ?  154  LEU B CA  1 
ATOM   3436 C C   . LEU B 1 28  ? 44.452  -2.481  41.229  1.00 73.88  ?  154  LEU B C   1 
ATOM   3437 O O   . LEU B 1 28  ? 43.953  -2.691  42.341  1.00 82.61  ?  154  LEU B O   1 
ATOM   3438 C CB  . LEU B 1 28  ? 46.741  -3.354  40.665  1.00 57.08  ?  154  LEU B CB  1 
ATOM   3439 C CG  . LEU B 1 28  ? 47.647  -4.588  40.784  1.00 66.22  ?  154  LEU B CG  1 
ATOM   3440 C CD1 . LEU B 1 28  ? 47.308  -5.668  39.759  1.00 73.36  ?  154  LEU B CD1 1 
ATOM   3441 C CD2 . LEU B 1 28  ? 49.116  -4.196  40.671  1.00 65.17  ?  154  LEU B CD2 1 
ATOM   3442 N N   . SER B 1 29  ? 44.278  -1.329  40.576  1.00 69.00  ?  155  SER B N   1 
ATOM   3443 C CA  . SER B 1 29  ? 43.557  -0.227  41.202  1.00 66.31  ?  155  SER B CA  1 
ATOM   3444 C C   . SER B 1 29  ? 42.089  -0.576  41.417  1.00 61.42  ?  155  SER B C   1 
ATOM   3445 O O   . SER B 1 29  ? 41.540  -0.344  42.499  1.00 46.49  ?  155  SER B O   1 
ATOM   3446 C CB  . SER B 1 29  ? 43.692  1.037   40.351  1.00 62.77  ?  155  SER B CB  1 
ATOM   3447 O OG  . SER B 1 29  ? 45.041  1.468   40.272  1.00 65.03  ?  155  SER B OG  1 
ATOM   3448 N N   . PHE B 1 30  ? 41.436  -1.129  40.393  1.00 67.01  ?  156  PHE B N   1 
ATOM   3449 C CA  . PHE B 1 30  ? 40.033  -1.508  40.520  1.00 68.39  ?  156  PHE B CA  1 
ATOM   3450 C C   . PHE B 1 30  ? 39.846  -2.513  41.648  1.00 64.02  ?  156  PHE B C   1 
ATOM   3451 O O   . PHE B 1 30  ? 38.994  -2.328  42.530  1.00 55.13  ?  156  PHE B O   1 
ATOM   3452 C CB  . PHE B 1 30  ? 39.524  -2.078  39.190  1.00 75.30  ?  156  PHE B CB  1 
ATOM   3453 C CG  . PHE B 1 30  ? 38.072  -2.488  39.215  1.00 76.02  ?  156  PHE B CG  1 
ATOM   3454 C CD1 . PHE B 1 30  ? 37.071  -1.593  38.860  1.00 72.64  ?  156  PHE B CD1 1 
ATOM   3455 C CD2 . PHE B 1 30  ? 37.709  -3.772  39.588  1.00 68.51  ?  156  PHE B CD2 1 
ATOM   3456 C CE1 . PHE B 1 30  ? 35.737  -1.975  38.886  1.00 73.89  ?  156  PHE B CE1 1 
ATOM   3457 C CE2 . PHE B 1 30  ? 36.381  -4.157  39.617  1.00 71.13  ?  156  PHE B CE2 1 
ATOM   3458 C CZ  . PHE B 1 30  ? 35.394  -3.258  39.266  1.00 71.22  ?  156  PHE B CZ  1 
ATOM   3459 N N   . SER B 1 31  ? 40.645  -3.583  41.644  1.00 66.88  ?  157  SER B N   1 
ATOM   3460 C CA  . SER B 1 31  ? 40.489  -4.614  42.665  1.00 72.82  ?  157  SER B CA  1 
ATOM   3461 C C   . SER B 1 31  ? 40.753  -4.050  44.058  1.00 77.50  ?  157  SER B C   1 
ATOM   3462 O O   . SER B 1 31  ? 39.994  -4.309  45.001  1.00 84.10  ?  157  SER B O   1 
ATOM   3463 C CB  . SER B 1 31  ? 41.415  -5.791  42.358  1.00 65.55  ?  157  SER B CB  1 
ATOM   3464 O OG  . SER B 1 31  ? 41.140  -6.331  41.073  1.00 71.11  ?  157  SER B OG  1 
ATOM   3465 N N   . ALA B 1 32  ? 41.816  -3.253  44.202  1.00 65.02  ?  158  ALA B N   1 
ATOM   3466 C CA  . ALA B 1 32  ? 42.157  -2.706  45.509  1.00 67.53  ?  158  ALA B CA  1 
ATOM   3467 C C   . ALA B 1 32  ? 41.083  -1.753  46.011  1.00 70.68  ?  158  ALA B C   1 
ATOM   3468 O O   . ALA B 1 32  ? 40.748  -1.760  47.199  1.00 79.67  ?  158  ALA B O   1 
ATOM   3469 C CB  . ALA B 1 32  ? 43.511  -2.001  45.449  1.00 72.00  ?  158  ALA B CB  1 
ATOM   3470 N N   . LEU B 1 33  ? 40.526  -0.924  45.127  1.00 69.98  ?  159  LEU B N   1 
ATOM   3471 C CA  . LEU B 1 33  ? 39.525  0.030   45.582  1.00 72.73  ?  159  LEU B CA  1 
ATOM   3472 C C   . LEU B 1 33  ? 38.217  -0.662  45.935  1.00 74.07  ?  159  LEU B C   1 
ATOM   3473 O O   . LEU B 1 33  ? 37.555  -0.267  46.901  1.00 66.85  ?  159  LEU B O   1 
ATOM   3474 C CB  . LEU B 1 33  ? 39.307  1.110   44.523  1.00 69.45  ?  159  LEU B CB  1 
ATOM   3475 C CG  . LEU B 1 33  ? 40.519  2.029   44.322  1.00 71.33  ?  159  LEU B CG  1 
ATOM   3476 C CD1 . LEU B 1 33  ? 40.462  2.725   42.975  1.00 73.26  ?  159  LEU B CD1 1 
ATOM   3477 C CD2 . LEU B 1 33  ? 40.635  3.049   45.445  1.00 70.50  ?  159  LEU B CD2 1 
ATOM   3478 N N   . VAL B 1 34  ? 37.850  -1.721  45.209  1.00 74.93  ?  160  VAL B N   1 
ATOM   3479 C CA  . VAL B 1 34  ? 36.640  -2.451  45.574  1.00 79.45  ?  160  VAL B CA  1 
ATOM   3480 C C   . VAL B 1 34  ? 36.841  -3.169  46.904  1.00 77.85  ?  160  VAL B C   1 
ATOM   3481 O O   . VAL B 1 34  ? 35.962  -3.145  47.775  1.00 69.79  ?  160  VAL B O   1 
ATOM   3482 C CB  . VAL B 1 34  ? 36.230  -3.424  44.451  1.00 81.23  ?  160  VAL B CB  1 
ATOM   3483 C CG1 . VAL B 1 34  ? 35.033  -4.265  44.877  1.00 74.65  ?  160  VAL B CG1 1 
ATOM   3484 C CG2 . VAL B 1 34  ? 35.902  -2.655  43.179  1.00 79.39  ?  160  VAL B CG2 1 
ATOM   3485 N N   . ILE B 1 35  ? 38.016  -3.774  47.102  1.00 77.20  ?  161  ILE B N   1 
ATOM   3486 C CA  . ILE B 1 35  ? 38.305  -4.442  48.371  1.00 71.52  ?  161  ILE B CA  1 
ATOM   3487 C C   . ILE B 1 35  ? 38.277  -3.439  49.519  1.00 72.53  ?  161  ILE B C   1 
ATOM   3488 O O   . ILE B 1 35  ? 37.695  -3.696  50.582  1.00 62.54  ?  161  ILE B O   1 
ATOM   3489 C CB  . ILE B 1 35  ? 39.658  -5.175  48.296  1.00 78.32  ?  161  ILE B CB  1 
ATOM   3490 C CG1 . ILE B 1 35  ? 39.541  -6.442  47.451  1.00 80.11  ?  161  ILE B CG1 1 
ATOM   3491 C CG2 . ILE B 1 35  ? 40.173  -5.507  49.691  1.00 74.14  ?  161  ILE B CG2 1 
ATOM   3492 C CD1 . ILE B 1 35  ? 40.867  -7.142  47.224  1.00 73.70  ?  161  ILE B CD1 1 
ATOM   3493 N N   . ALA B 1 36  ? 38.914  -2.282  49.324  1.00 71.41  ?  162  ALA B N   1 
ATOM   3494 C CA  . ALA B 1 36  ? 39.010  -1.284  50.384  1.00 64.14  ?  162  ALA B CA  1 
ATOM   3495 C C   . ALA B 1 36  ? 37.644  -0.706  50.733  1.00 61.09  ?  162  ALA B C   1 
ATOM   3496 O O   . ALA B 1 36  ? 37.321  -0.506  51.911  1.00 56.87  ?  162  ALA B O   1 
ATOM   3497 C CB  . ALA B 1 36  ? 39.971  -0.175  49.966  1.00 74.91  ?  162  ALA B CB  1 
ATOM   3498 N N   . SER B 1 37  ? 36.836  -0.394  49.718  1.00 62.09  ?  163  SER B N   1 
ATOM   3499 C CA  . SER B 1 37  ? 35.488  0.082   49.998  1.00 64.75  ?  163  SER B CA  1 
ATOM   3500 C C   . SER B 1 37  ? 34.662  -0.987  50.694  1.00 71.28  ?  163  SER B C   1 
ATOM   3501 O O   . SER B 1 37  ? 33.864  -0.669  51.585  1.00 77.73  ?  163  SER B O   1 
ATOM   3502 C CB  . SER B 1 37  ? 34.806  0.527   48.703  1.00 65.43  ?  163  SER B CB  1 
ATOM   3503 O OG  . SER B 1 37  ? 34.935  -0.452  47.684  1.00 80.76  ?  163  SER B OG  1 
ATOM   3504 N N   . ALA B 1 38  ? 34.866  -2.257  50.330  1.00 71.75  ?  164  ALA B N   1 
ATOM   3505 C CA  . ALA B 1 38  ? 34.177  -3.343  51.016  1.00 80.01  ?  164  ALA B CA  1 
ATOM   3506 C C   . ALA B 1 38  ? 34.597  -3.423  52.476  1.00 76.97  ?  164  ALA B C   1 
ATOM   3507 O O   . ALA B 1 38  ? 33.780  -3.743  53.343  1.00 71.68  ?  164  ALA B O   1 
ATOM   3508 C CB  . ALA B 1 38  ? 34.453  -4.670  50.308  1.00 72.38  ?  164  ALA B CB  1 
ATOM   3509 N N   . ILE B 1 39  ? 35.867  -3.139  52.766  1.00 61.88  ?  165  ILE B N   1 
ATOM   3510 C CA  . ILE B 1 39  ? 36.316  -3.132  54.157  1.00 61.52  ?  165  ILE B CA  1 
ATOM   3511 C C   . ILE B 1 39  ? 35.676  -1.976  54.917  1.00 67.87  ?  165  ILE B C   1 
ATOM   3512 O O   . ILE B 1 39  ? 35.143  -2.153  56.018  1.00 70.19  ?  165  ILE B O   1 
ATOM   3513 C CB  . ILE B 1 39  ? 37.851  -3.066  54.236  1.00 58.76  ?  165  ILE B CB  1 
ATOM   3514 C CG1 . ILE B 1 39  ? 38.471  -4.334  53.652  1.00 67.14  ?  165  ILE B CG1 1 
ATOM   3515 C CG2 . ILE B 1 39  ? 38.294  -2.868  55.676  1.00 58.85  ?  165  ILE B CG2 1 
ATOM   3516 C CD1 . ILE B 1 39  ? 39.963  -4.245  53.478  1.00 67.81  ?  165  ILE B CD1 1 
ATOM   3517 N N   . LEU B 1 40  ? 35.734  -0.772  54.343  1.00 61.00  ?  166  LEU B N   1 
ATOM   3518 C CA  . LEU B 1 40  ? 35.172  0.397   55.018  1.00 65.64  ?  166  LEU B CA  1 
ATOM   3519 C C   . LEU B 1 40  ? 33.676  0.231   55.271  1.00 75.74  ?  166  LEU B C   1 
ATOM   3520 O O   . LEU B 1 40  ? 33.157  0.693   56.294  1.00 96.58  ?  166  LEU B O   1 
ATOM   3521 C CB  . LEU B 1 40  ? 35.438  1.664   54.203  1.00 65.97  ?  166  LEU B CB  1 
ATOM   3522 C CG  . LEU B 1 40  ? 36.890  2.135   54.056  1.00 54.24  ?  166  LEU B CG  1 
ATOM   3523 C CD1 . LEU B 1 40  ? 36.915  3.518   53.434  1.00 54.56  ?  166  LEU B CD1 1 
ATOM   3524 C CD2 . LEU B 1 40  ? 37.639  2.133   55.384  1.00 53.62  ?  166  LEU B CD2 1 
ATOM   3525 N N   . LEU B 1 41  ? 32.965  -0.434  54.358  1.00 85.36  ?  167  LEU B N   1 
ATOM   3526 C CA  . LEU B 1 41  ? 31.530  -0.621  54.549  1.00 88.26  ?  167  LEU B CA  1 
ATOM   3527 C C   . LEU B 1 41  ? 31.221  -1.797  55.472  1.00 85.28  ?  167  LEU B C   1 
ATOM   3528 O O   . LEU B 1 41  ? 30.249  -1.749  56.236  1.00 71.53  ?  167  LEU B O   1 
ATOM   3529 C CB  . LEU B 1 41  ? 30.844  -0.815  53.197  1.00 80.43  ?  167  LEU B CB  1 
ATOM   3530 C CG  . LEU B 1 41  ? 30.765  0.417   52.296  1.00 76.88  ?  167  LEU B CG  1 
ATOM   3531 C CD1 . LEU B 1 41  ? 30.221  0.036   50.932  1.00 71.39  ?  167  LEU B CD1 1 
ATOM   3532 C CD2 . LEU B 1 41  ? 29.906  1.501   52.929  1.00 76.99  ?  167  LEU B CD2 1 
ATOM   3533 N N   . GLY B 1 42  ? 32.022  -2.857  55.410  1.00 79.44  ?  168  GLY B N   1 
ATOM   3534 C CA  . GLY B 1 42  ? 31.772  -4.076  56.155  1.00 68.75  ?  168  GLY B CA  1 
ATOM   3535 C C   . GLY B 1 42  ? 31.821  -3.924  57.661  1.00 71.85  ?  168  GLY B C   1 
ATOM   3536 O O   . GLY B 1 42  ? 30.872  -4.291  58.362  1.00 72.47  ?  168  GLY B O   1 
ATOM   3537 N N   . PHE B 1 43  ? 32.925  -3.389  58.174  1.00 78.77  ?  169  PHE B N   1 
ATOM   3538 C CA  . PHE B 1 43  ? 33.074  -3.194  59.608  1.00 68.47  ?  169  PHE B CA  1 
ATOM   3539 C C   . PHE B 1 43  ? 32.281  -1.970  60.055  1.00 87.54  ?  169  PHE B C   1 
ATOM   3540 O O   . PHE B 1 43  ? 32.426  -0.882  59.488  1.00 96.78  ?  169  PHE B O   1 
ATOM   3541 C CB  . PHE B 1 43  ? 34.548  -3.036  59.972  1.00 62.58  ?  169  PHE B CB  1 
ATOM   3542 C CG  . PHE B 1 43  ? 35.402  -4.211  59.582  1.00 71.97  ?  169  PHE B CG  1 
ATOM   3543 C CD1 . PHE B 1 43  ? 35.397  -5.371  60.340  1.00 69.45  ?  169  PHE B CD1 1 
ATOM   3544 C CD2 . PHE B 1 43  ? 36.221  -4.148  58.467  1.00 84.55  ?  169  PHE B CD2 1 
ATOM   3545 C CE1 . PHE B 1 43  ? 36.185  -6.448  59.989  1.00 70.88  ?  169  PHE B CE1 1 
ATOM   3546 C CE2 . PHE B 1 43  ? 37.012  -5.222  58.109  1.00 95.54  ?  169  PHE B CE2 1 
ATOM   3547 C CZ  . PHE B 1 43  ? 36.994  -6.373  58.872  1.00 78.85  ?  169  PHE B CZ  1 
ATOM   3548 N N   . ARG B 1 44  ? 31.443  -2.155  61.080  1.00 90.33  ?  170  ARG B N   1 
ATOM   3549 C CA  . ARG B 1 44  ? 30.564  -1.082  61.533  1.00 89.95  ?  170  ARG B CA  1 
ATOM   3550 C C   . ARG B 1 44  ? 31.339  0.044   62.205  1.00 83.83  ?  170  ARG B C   1 
ATOM   3551 O O   . ARG B 1 44  ? 30.924  1.206   62.135  1.00 71.66  ?  170  ARG B O   1 
ATOM   3552 C CB  . ARG B 1 44  ? 29.503  -1.646  62.481  1.00 79.46  ?  170  ARG B CB  1 
ATOM   3553 N N   . HIS B 1 45  ? 32.461  -0.273  62.853  1.00 77.87  ?  171  HIS B N   1 
ATOM   3554 C CA  . HIS B 1 45  ? 33.222  0.745   63.567  1.00 83.16  ?  171  HIS B CA  1 
ATOM   3555 C C   . HIS B 1 45  ? 33.896  1.748   62.638  1.00 74.41  ?  171  HIS B C   1 
ATOM   3556 O O   . HIS B 1 45  ? 34.345  2.797   63.111  1.00 73.92  ?  171  HIS B O   1 
ATOM   3557 C CB  . HIS B 1 45  ? 34.272  0.087   64.464  1.00 98.76  ?  171  HIS B CB  1 
ATOM   3558 C CG  . HIS B 1 45  ? 33.693  -0.720  65.587  1.00 111.71 ?  171  HIS B CG  1 
ATOM   3559 N ND1 . HIS B 1 45  ? 33.171  -1.982  65.406  1.00 118.94 ?  171  HIS B ND1 1 
ATOM   3560 C CD2 . HIS B 1 45  ? 33.564  -0.447  66.908  1.00 115.45 ?  171  HIS B CD2 1 
ATOM   3561 C CE1 . HIS B 1 45  ? 32.740  -2.450  66.565  1.00 118.37 ?  171  HIS B CE1 1 
ATOM   3562 N NE2 . HIS B 1 45  ? 32.968  -1.538  67.492  1.00 124.23 ?  171  HIS B NE2 1 
ATOM   3563 N N   . LEU B 1 46  ? 33.973  1.464   61.341  1.00 58.95  ?  172  LEU B N   1 
ATOM   3564 C CA  . LEU B 1 46  ? 34.606  2.356   60.379  1.00 56.10  ?  172  LEU B CA  1 
ATOM   3565 C C   . LEU B 1 46  ? 33.623  3.333   59.738  1.00 59.30  ?  172  LEU B C   1 
ATOM   3566 O O   . LEU B 1 46  ? 33.992  4.026   58.784  1.00 75.72  ?  172  LEU B O   1 
ATOM   3567 C CB  . LEU B 1 46  ? 35.310  1.536   59.292  1.00 53.59  ?  172  LEU B CB  1 
ATOM   3568 C CG  . LEU B 1 46  ? 36.340  0.507   59.772  1.00 62.76  ?  172  LEU B CG  1 
ATOM   3569 C CD1 . LEU B 1 46  ? 36.889  -0.293  58.600  1.00 69.76  ?  172  LEU B CD1 1 
ATOM   3570 C CD2 . LEU B 1 46  ? 37.465  1.193   60.531  1.00 57.00  ?  172  LEU B CD2 1 
ATOM   3571 N N   . HIS B 1 47  ? 32.389  3.407   60.240  1.00 55.94  ?  173  HIS B N   1 
ATOM   3572 C CA  . HIS B 1 47  ? 31.347  4.254   59.654  1.00 57.16  ?  173  HIS B CA  1 
ATOM   3573 C C   . HIS B 1 47  ? 31.435  5.657   60.250  1.00 57.91  ?  173  HIS B C   1 
ATOM   3574 O O   . HIS B 1 47  ? 30.740  6.009   61.206  1.00 77.51  ?  173  HIS B O   1 
ATOM   3575 C CB  . HIS B 1 47  ? 29.969  3.645   59.888  1.00 62.46  ?  173  HIS B CB  1 
ATOM   3576 C CG  . HIS B 1 47  ? 29.685  2.430   59.061  1.00 69.00  ?  173  HIS B CG  1 
ATOM   3577 N ND1 . HIS B 1 47  ? 29.009  1.337   59.558  1.00 82.48  ?  173  HIS B ND1 1 
ATOM   3578 C CD2 . HIS B 1 47  ? 29.959  2.147   57.766  1.00 90.59  ?  173  HIS B CD2 1 
ATOM   3579 C CE1 . HIS B 1 47  ? 28.892  0.426   58.609  1.00 84.54  ?  173  HIS B CE1 1 
ATOM   3580 N NE2 . HIS B 1 47  ? 29.460  0.892   57.512  1.00 84.06  ?  173  HIS B NE2 1 
ATOM   3581 N N   . CYS B 1 48  ? 32.310  6.474   59.666  1.00 57.23  ?  174  CYS B N   1 
ATOM   3582 C CA  . CYS B 1 48  ? 32.476  7.861   60.078  1.00 51.82  ?  174  CYS B CA  1 
ATOM   3583 C C   . CYS B 1 48  ? 32.638  8.734   58.840  1.00 51.97  ?  174  CYS B C   1 
ATOM   3584 O O   . CYS B 1 48  ? 32.896  8.245   57.738  1.00 41.50  ?  174  CYS B O   1 
ATOM   3585 C CB  . CYS B 1 48  ? 33.671  8.038   61.026  1.00 55.49  ?  174  CYS B CB  1 
ATOM   3586 S SG  . CYS B 1 48  ? 35.241  7.419   60.381  1.00 86.17  ?  174  CYS B SG  1 
ATOM   3587 N N   . THR B 1 49  ? 32.466  10.043  59.035  1.00 56.47  ?  175  THR B N   1 
ATOM   3588 C CA  . THR B 1 49  ? 32.420  10.976  57.910  1.00 67.63  ?  175  THR B CA  1 
ATOM   3589 C C   . THR B 1 49  ? 33.699  10.929  57.079  1.00 59.24  ?  175  THR B C   1 
ATOM   3590 O O   . THR B 1 49  ? 33.661  11.028  55.842  1.00 58.37  ?  175  THR B O   1 
ATOM   3591 C CB  . THR B 1 49  ? 32.164  12.394  58.431  1.00 79.30  ?  175  THR B CB  1 
ATOM   3592 O OG1 . THR B 1 49  ? 33.237  12.799  59.288  1.00 134.88 ?  175  THR B OG1 1 
ATOM   3593 C CG2 . THR B 1 49  ? 30.875  12.447  59.240  1.00 58.73  ?  175  THR B CG2 1 
ATOM   3594 N N   . ARG B 1 50  ? 34.845  10.786  57.746  1.00 58.55  ?  176  ARG B N   1 
ATOM   3595 C CA  . ARG B 1 50  ? 36.115  10.672  57.036  1.00 57.48  ?  176  ARG B CA  1 
ATOM   3596 C C   . ARG B 1 50  ? 36.080  9.530   56.027  1.00 60.25  ?  176  ARG B C   1 
ATOM   3597 O O   . ARG B 1 50  ? 36.403  9.709   54.841  1.00 68.53  ?  176  ARG B O   1 
ATOM   3598 C CB  . ARG B 1 50  ? 37.248  10.477  58.047  1.00 46.21  ?  176  ARG B CB  1 
ATOM   3599 C CG  . ARG B 1 50  ? 38.571  10.050  57.449  1.00 50.45  ?  176  ARG B CG  1 
ATOM   3600 C CD  . ARG B 1 50  ? 39.687  9.950   58.489  1.00 43.44  ?  176  ARG B CD  1 
ATOM   3601 N NE  . ARG B 1 50  ? 39.242  9.415   59.775  1.00 58.24  ?  176  ARG B NE  1 
ATOM   3602 C CZ  . ARG B 1 50  ? 39.295  8.131   60.113  1.00 55.10  ?  176  ARG B CZ  1 
ATOM   3603 N NH1 . ARG B 1 50  ? 39.770  7.239   59.254  1.00 50.83  ?  176  ARG B NH1 1 
ATOM   3604 N NH2 . ARG B 1 50  ? 38.872  7.739   61.307  1.00 46.88  ?  176  ARG B NH2 1 
ATOM   3605 N N   . ASN B 1 51  ? 35.639  8.356   56.469  1.00 68.45  ?  177  ASN B N   1 
ATOM   3606 C CA  . ASN B 1 51  ? 35.627  7.206   55.579  1.00 65.97  ?  177  ASN B CA  1 
ATOM   3607 C C   . ASN B 1 51  ? 34.534  7.311   54.521  1.00 61.31  ?  177  ASN B C   1 
ATOM   3608 O O   . ASN B 1 51  ? 34.680  6.755   53.428  1.00 60.59  ?  177  ASN B O   1 
ATOM   3609 C CB  . ASN B 1 51  ? 35.495  5.917   56.397  1.00 60.23  ?  177  ASN B CB  1 
ATOM   3610 C CG  . ASN B 1 51  ? 36.762  5.603   57.184  1.00 62.75  ?  177  ASN B CG  1 
ATOM   3611 O OD1 . ASN B 1 51  ? 37.829  6.149   56.895  1.00 57.54  ?  177  ASN B OD1 1 
ATOM   3612 N ND2 . ASN B 1 51  ? 36.654  4.722   58.174  1.00 56.22  ?  177  ASN B ND2 1 
ATOM   3613 N N   . TYR B 1 52  ? 33.450  8.032   54.806  1.00 65.49  ?  178  TYR B N   1 
ATOM   3614 C CA  . TYR B 1 52  ? 32.447  8.268   53.772  1.00 73.87  ?  178  TYR B CA  1 
ATOM   3615 C C   . TYR B 1 52  ? 33.018  9.126   52.643  1.00 77.64  ?  178  TYR B C   1 
ATOM   3616 O O   . TYR B 1 52  ? 32.813  8.832   51.450  1.00 75.09  ?  178  TYR B O   1 
ATOM   3617 C CB  . TYR B 1 52  ? 31.210  8.932   54.384  1.00 73.90  ?  178  TYR B CB  1 
ATOM   3618 C CG  . TYR B 1 52  ? 30.420  8.064   55.352  1.00 89.75  ?  178  TYR B CG  1 
ATOM   3619 C CD1 . TYR B 1 52  ? 30.089  6.748   55.039  1.00 90.65  ?  178  TYR B CD1 1 
ATOM   3620 C CD2 . TYR B 1 52  ? 29.988  8.571   56.573  1.00 102.96 ?  178  TYR B CD2 1 
ATOM   3621 C CE1 . TYR B 1 52  ? 29.358  5.962   55.923  1.00 91.87  ?  178  TYR B CE1 1 
ATOM   3622 C CE2 . TYR B 1 52  ? 29.259  7.793   57.458  1.00 103.95 ?  178  TYR B CE2 1 
ATOM   3623 C CZ  . TYR B 1 52  ? 28.949  6.488   57.132  1.00 103.38 ?  178  TYR B CZ  1 
ATOM   3624 O OH  . TYR B 1 52  ? 28.225  5.708   58.010  1.00 114.80 ?  178  TYR B OH  1 
ATOM   3625 N N   . ILE B 1 53  ? 33.758  10.180  53.003  1.00 66.92  ?  179  ILE B N   1 
ATOM   3626 C CA  . ILE B 1 53  ? 34.452  10.977  51.995  1.00 60.85  ?  179  ILE B CA  1 
ATOM   3627 C C   . ILE B 1 53  ? 35.411  10.096  51.198  1.00 62.42  ?  179  ILE B C   1 
ATOM   3628 O O   . ILE B 1 53  ? 35.510  10.202  49.961  1.00 47.09  ?  179  ILE B O   1 
ATOM   3629 C CB  . ILE B 1 53  ? 35.178  12.155  52.675  1.00 63.51  ?  179  ILE B CB  1 
ATOM   3630 C CG1 . ILE B 1 53  ? 34.165  13.064  53.374  1.00 58.78  ?  179  ILE B CG1 1 
ATOM   3631 C CG2 . ILE B 1 53  ? 36.016  12.936  51.673  1.00 64.66  ?  179  ILE B CG2 1 
ATOM   3632 C CD1 . ILE B 1 53  ? 34.780  14.161  54.207  1.00 68.06  ?  179  ILE B CD1 1 
ATOM   3633 N N   . HIS B 1 54  ? 36.113  9.194   51.894  1.00 50.58  ?  180  HIS B N   1 
ATOM   3634 C CA  . HIS B 1 54  ? 36.982  8.243   51.201  1.00 47.30  ?  180  HIS B CA  1 
ATOM   3635 C C   . HIS B 1 54  ? 36.198  7.389   50.212  1.00 55.53  ?  180  HIS B C   1 
ATOM   3636 O O   . HIS B 1 54  ? 36.687  7.085   49.120  1.00 56.37  ?  180  HIS B O   1 
ATOM   3637 C CB  . HIS B 1 54  ? 37.713  7.339   52.201  1.00 58.23  ?  180  HIS B CB  1 
ATOM   3638 C CG  . HIS B 1 54  ? 38.731  8.053   53.035  1.00 60.81  ?  180  HIS B CG  1 
ATOM   3639 N ND1 . HIS B 1 54  ? 38.776  9.426   53.132  1.00 61.72  ?  180  HIS B ND1 1 
ATOM   3640 C CD2 . HIS B 1 54  ? 39.741  7.588   53.809  1.00 52.10  ?  180  HIS B CD2 1 
ATOM   3641 C CE1 . HIS B 1 54  ? 39.770  9.778   53.928  1.00 65.55  ?  180  HIS B CE1 1 
ATOM   3642 N NE2 . HIS B 1 54  ? 40.372  8.682   54.352  1.00 59.23  ?  180  HIS B NE2 1 
ATOM   3643 N N   . LEU B 1 55  ? 35.001  6.949   50.597  1.00 54.60  ?  181  LEU B N   1 
ATOM   3644 C CA  . LEU B 1 55  ? 34.225  6.084   49.716  1.00 54.35  ?  181  LEU B CA  1 
ATOM   3645 C C   . LEU B 1 55  ? 33.836  6.817   48.443  1.00 61.06  ?  181  LEU B C   1 
ATOM   3646 O O   . LEU B 1 55  ? 33.856  6.239   47.348  1.00 47.35  ?  181  LEU B O   1 
ATOM   3647 C CB  . LEU B 1 55  ? 32.983  5.571   50.439  1.00 62.87  ?  181  LEU B CB  1 
ATOM   3648 C CG  . LEU B 1 55  ? 33.259  4.528   51.522  1.00 61.96  ?  181  LEU B CG  1 
ATOM   3649 C CD1 . LEU B 1 55  ? 32.061  4.390   52.435  1.00 57.24  ?  181  LEU B CD1 1 
ATOM   3650 C CD2 . LEU B 1 55  ? 33.629  3.177   50.919  1.00 49.07  ?  181  LEU B CD2 1 
ATOM   3651 N N   . ASN B 1 56  ? 33.496  8.100   48.562  1.00 61.00  ?  182  ASN B N   1 
ATOM   3652 C CA  . ASN B 1 56  ? 33.180  8.856   47.350  1.00 59.29  ?  182  ASN B CA  1 
ATOM   3653 C C   . ASN B 1 56  ? 34.408  8.999   46.449  1.00 53.84  ?  182  ASN B C   1 
ATOM   3654 O O   . ASN B 1 56  ? 34.311  8.823   45.221  1.00 56.45  ?  182  ASN B O   1 
ATOM   3655 C CB  . ASN B 1 56  ? 32.592  10.218  47.712  1.00 56.32  ?  182  ASN B CB  1 
ATOM   3656 C CG  . ASN B 1 56  ? 31.180  10.107  48.262  1.00 61.59  ?  182  ASN B CG  1 
ATOM   3657 O OD1 . ASN B 1 56  ? 30.203  10.451  47.596  1.00 55.39  ?  182  ASN B OD1 1 
ATOM   3658 N ND2 . ASN B 1 56  ? 31.069  9.612   49.484  1.00 67.46  ?  182  ASN B ND2 1 
ATOM   3659 N N   . LEU B 1 57  ? 35.580  9.263   47.040  1.00 46.36  ?  183  LEU B N   1 
ATOM   3660 C CA  . LEU B 1 57  ? 36.800  9.353   46.232  1.00 47.87  ?  183  LEU B CA  1 
ATOM   3661 C C   . LEU B 1 57  ? 37.106  8.024   45.537  1.00 51.92  ?  183  LEU B C   1 
ATOM   3662 O O   . LEU B 1 57  ? 37.432  7.986   44.333  1.00 53.57  ?  183  LEU B O   1 
ATOM   3663 C CB  . LEU B 1 57  ? 37.972  9.767   47.122  1.00 45.02  ?  183  LEU B CB  1 
ATOM   3664 C CG  . LEU B 1 57  ? 39.343  10.033  46.501  1.00 40.34  ?  183  LEU B CG  1 
ATOM   3665 C CD1 . LEU B 1 57  ? 39.342  11.340  45.727  1.00 39.90  ?  183  LEU B CD1 1 
ATOM   3666 C CD2 . LEU B 1 57  ? 40.419  10.051  47.574  1.00 37.79  ?  183  LEU B CD2 1 
ATOM   3667 N N   . PHE B 1 58  ? 36.975  6.923   46.283  1.00 56.31  ?  184  PHE B N   1 
ATOM   3668 C CA  . PHE B 1 58  ? 37.165  5.594   45.715  1.00 49.90  ?  184  PHE B CA  1 
ATOM   3669 C C   . PHE B 1 58  ? 36.228  5.368   44.544  1.00 53.27  ?  184  PHE B C   1 
ATOM   3670 O O   . PHE B 1 58  ? 36.620  4.772   43.537  1.00 63.29  ?  184  PHE B O   1 
ATOM   3671 C CB  . PHE B 1 58  ? 36.897  4.512   46.760  1.00 63.85  ?  184  PHE B CB  1 
ATOM   3672 C CG  . PHE B 1 58  ? 37.843  4.518   47.923  1.00 71.91  ?  184  PHE B CG  1 
ATOM   3673 C CD1 . PHE B 1 58  ? 39.078  5.142   47.849  1.00 74.13  ?  184  PHE B CD1 1 
ATOM   3674 C CD2 . PHE B 1 58  ? 37.493  3.872   49.097  1.00 67.21  ?  184  PHE B CD2 1 
ATOM   3675 C CE1 . PHE B 1 58  ? 39.936  5.127   48.934  1.00 72.34  ?  184  PHE B CE1 1 
ATOM   3676 C CE2 . PHE B 1 58  ? 38.344  3.855   50.178  1.00 72.19  ?  184  PHE B CE2 1 
ATOM   3677 C CZ  . PHE B 1 58  ? 39.566  4.483   50.099  1.00 80.55  ?  184  PHE B CZ  1 
ATOM   3678 N N   . ALA B 1 59  ? 34.972  5.794   44.685  1.00 61.08  ?  185  ALA B N   1 
ATOM   3679 C CA  . ALA B 1 59  ? 34.000  5.583   43.621  1.00 64.70  ?  185  ALA B CA  1 
ATOM   3680 C C   . ALA B 1 59  ? 34.396  6.336   42.363  1.00 67.22  ?  185  ALA B C   1 
ATOM   3681 O O   . ALA B 1 59  ? 34.238  5.822   41.248  1.00 72.06  ?  185  ALA B O   1 
ATOM   3682 C CB  . ALA B 1 59  ? 32.610  6.010   44.082  1.00 57.05  ?  185  ALA B CB  1 
ATOM   3683 N N   . SER B 1 60  ? 34.899  7.564   42.515  1.00 61.62  ?  186  SER B N   1 
ATOM   3684 C CA  . SER B 1 60  ? 35.344  8.266   41.315  1.00 63.23  ?  186  SER B CA  1 
ATOM   3685 C C   . SER B 1 60  ? 36.475  7.507   40.626  1.00 63.95  ?  186  SER B C   1 
ATOM   3686 O O   . SER B 1 60  ? 36.457  7.344   39.394  1.00 62.65  ?  186  SER B O   1 
ATOM   3687 C CB  . SER B 1 60  ? 35.754  9.708   41.637  1.00 65.62  ?  186  SER B CB  1 
ATOM   3688 O OG  . SER B 1 60  ? 36.858  9.789   42.518  1.00 81.05  ?  186  SER B OG  1 
ATOM   3689 N N   . PHE B 1 61  ? 37.420  6.963   41.401  1.00 61.59  ?  187  PHE B N   1 
ATOM   3690 C CA  . PHE B 1 61  ? 38.503  6.226   40.744  1.00 58.69  ?  187  PHE B CA  1 
ATOM   3691 C C   . PHE B 1 61  ? 38.017  4.908   40.134  1.00 59.96  ?  187  PHE B C   1 
ATOM   3692 O O   . PHE B 1 61  ? 38.478  4.518   39.049  1.00 68.73  ?  187  PHE B O   1 
ATOM   3693 C CB  . PHE B 1 61  ? 39.661  5.990   41.719  1.00 50.37  ?  187  PHE B CB  1 
ATOM   3694 C CG  . PHE B 1 61  ? 40.595  7.167   41.833  1.00 43.52  ?  187  PHE B CG  1 
ATOM   3695 C CD1 . PHE B 1 61  ? 41.612  7.359   40.908  1.00 51.19  ?  187  PHE B CD1 1 
ATOM   3696 C CD2 . PHE B 1 61  ? 40.444  8.093   42.852  1.00 45.28  ?  187  PHE B CD2 1 
ATOM   3697 C CE1 . PHE B 1 61  ? 42.467  8.450   41.005  1.00 45.34  ?  187  PHE B CE1 1 
ATOM   3698 C CE2 . PHE B 1 61  ? 41.293  9.184   42.954  1.00 43.22  ?  187  PHE B CE2 1 
ATOM   3699 C CZ  . PHE B 1 61  ? 42.305  9.363   42.030  1.00 38.29  ?  187  PHE B CZ  1 
ATOM   3700 N N   . ILE B 1 62  ? 37.064  4.238   40.785  1.00 49.44  ?  188  ILE B N   1 
ATOM   3701 C CA  . ILE B 1 62  ? 36.524  2.985   40.259  1.00 58.17  ?  188  ILE B CA  1 
ATOM   3702 C C   . ILE B 1 62  ? 35.794  3.230   38.945  1.00 63.40  ?  188  ILE B C   1 
ATOM   3703 O O   . ILE B 1 62  ? 35.916  2.451   37.993  1.00 60.33  ?  188  ILE B O   1 
ATOM   3704 C CB  . ILE B 1 62  ? 35.594  2.314   41.290  1.00 68.10  ?  188  ILE B CB  1 
ATOM   3705 C CG1 . ILE B 1 62  ? 36.379  1.839   42.509  1.00 59.48  ?  188  ILE B CG1 1 
ATOM   3706 C CG2 . ILE B 1 62  ? 34.829  1.150   40.658  1.00 57.20  ?  188  ILE B CG2 1 
ATOM   3707 C CD1 . ILE B 1 62  ? 35.508  1.222   43.582  1.00 67.31  ?  188  ILE B CD1 1 
ATOM   3708 N N   . LEU B 1 63  ? 34.992  4.296   38.886  1.00 65.24  ?  189  LEU B N   1 
ATOM   3709 C CA  . LEU B 1 63  ? 34.296  4.625   37.645  1.00 67.39  ?  189  LEU B CA  1 
ATOM   3710 C C   . LEU B 1 63  ? 35.279  4.976   36.535  1.00 65.41  ?  189  LEU B C   1 
ATOM   3711 O O   . LEU B 1 63  ? 35.069  4.618   35.368  1.00 83.92  ?  189  LEU B O   1 
ATOM   3712 C CB  . LEU B 1 63  ? 33.319  5.775   37.879  1.00 63.39  ?  189  LEU B CB  1 
ATOM   3713 C CG  . LEU B 1 63  ? 31.854  5.426   38.162  1.00 79.23  ?  189  LEU B CG  1 
ATOM   3714 C CD1 . LEU B 1 63  ? 31.670  4.644   39.463  1.00 78.67  ?  189  LEU B CD1 1 
ATOM   3715 C CD2 . LEU B 1 63  ? 31.004  6.689   38.167  1.00 77.92  ?  189  LEU B CD2 1 
ATOM   3716 N N   . ARG B 1 64  ? 36.350  5.698   36.874  1.00 59.25  ?  190  ARG B N   1 
ATOM   3717 C CA  . ARG B 1 64  ? 37.407  5.942   35.895  1.00 64.38  ?  190  ARG B CA  1 
ATOM   3718 C C   . ARG B 1 64  ? 37.942  4.629   35.325  1.00 64.95  ?  190  ARG B C   1 
ATOM   3719 O O   . ARG B 1 64  ? 38.066  4.467   34.099  1.00 64.77  ?  190  ARG B O   1 
ATOM   3720 C CB  . ARG B 1 64  ? 38.534  6.746   36.550  1.00 77.97  ?  190  ARG B CB  1 
ATOM   3721 C CG  . ARG B 1 64  ? 39.652  7.151   35.620  1.00 62.57  ?  190  ARG B CG  1 
ATOM   3722 C CD  . ARG B 1 64  ? 40.667  8.007   36.351  1.00 66.34  ?  190  ARG B CD  1 
ATOM   3723 N NE  . ARG B 1 64  ? 41.743  8.441   35.470  1.00 78.52  ?  190  ARG B NE  1 
ATOM   3724 C CZ  . ARG B 1 64  ? 42.655  9.348   35.797  1.00 78.56  ?  190  ARG B CZ  1 
ATOM   3725 N NH1 . ARG B 1 64  ? 42.626  9.929   36.992  1.00 77.79  ?  190  ARG B NH1 1 
ATOM   3726 N NH2 . ARG B 1 64  ? 43.595  9.674   34.923  1.00 74.70  ?  190  ARG B NH2 1 
ATOM   3727 N N   . ALA B 1 65  ? 38.230  3.666   36.203  1.00 60.50  ?  191  ALA B N   1 
ATOM   3728 C CA  . ALA B 1 65  ? 38.723  2.369   35.743  1.00 62.22  ?  191  ALA B CA  1 
ATOM   3729 C C   . ALA B 1 65  ? 37.692  1.653   34.875  1.00 63.10  ?  191  ALA B C   1 
ATOM   3730 O O   . ALA B 1 65  ? 38.046  0.996   33.887  1.00 72.96  ?  191  ALA B O   1 
ATOM   3731 C CB  . ALA B 1 65  ? 39.103  1.499   36.941  1.00 61.93  ?  191  ALA B CB  1 
ATOM   3732 N N   . LEU B 1 66  ? 36.414  1.745   35.246  1.00 59.69  ?  192  LEU B N   1 
ATOM   3733 C CA  . LEU B 1 66  ? 35.363  1.119   34.446  1.00 70.33  ?  192  LEU B CA  1 
ATOM   3734 C C   . LEU B 1 66  ? 35.327  1.700   33.038  1.00 82.36  ?  192  LEU B C   1 
ATOM   3735 O O   . LEU B 1 66  ? 35.153  0.966   32.056  1.00 79.50  ?  192  LEU B O   1 
ATOM   3736 C CB  . LEU B 1 66  ? 34.006  1.288   35.128  1.00 59.02  ?  192  LEU B CB  1 
ATOM   3737 N N   . CYS B 1 67  ? 35.488  3.020   32.921  1.00 64.42  ?  193  CYS B N   1 
ATOM   3738 C CA  . CYS B 1 67  ? 35.574  3.634   31.600  1.00 53.47  ?  193  CYS B CA  1 
ATOM   3739 C C   . CYS B 1 67  ? 36.762  3.090   30.821  1.00 56.58  ?  193  CYS B C   1 
ATOM   3740 O O   . CYS B 1 67  ? 36.658  2.820   29.619  1.00 64.18  ?  193  CYS B O   1 
ATOM   3741 C CB  . CYS B 1 67  ? 35.685  5.150   31.727  1.00 59.86  ?  193  CYS B CB  1 
ATOM   3742 S SG  . CYS B 1 67  ? 34.190  5.933   32.331  1.00 67.61  ?  193  CYS B SG  1 
ATOM   3743 N N   . VAL B 1 68  ? 37.900  2.911   31.495  1.00 63.54  ?  194  VAL B N   1 
ATOM   3744 C CA  . VAL B 1 68  ? 39.080  2.404   30.795  1.00 73.55  ?  194  VAL B CA  1 
ATOM   3745 C C   . VAL B 1 68  ? 38.817  1.000   30.259  1.00 78.98  ?  194  VAL B C   1 
ATOM   3746 O O   . VAL B 1 68  ? 39.090  0.704   29.085  1.00 80.87  ?  194  VAL B O   1 
ATOM   3747 C CB  . VAL B 1 68  ? 40.315  2.444   31.719  1.00 67.99  ?  194  VAL B CB  1 
ATOM   3748 C CG1 . VAL B 1 68  ? 41.496  1.744   31.069  1.00 64.21  ?  194  VAL B CG1 1 
ATOM   3749 C CG2 . VAL B 1 68  ? 40.672  3.885   32.049  1.00 83.39  ?  194  VAL B CG2 1 
ATOM   3750 N N   . PHE B 1 69  ? 38.239  0.131   31.093  1.00 76.10  ?  195  PHE B N   1 
ATOM   3751 C CA  . PHE B 1 69  ? 37.975  -1.238  30.662  1.00 82.26  ?  195  PHE B CA  1 
ATOM   3752 C C   . PHE B 1 69  ? 36.924  -1.283  29.563  1.00 79.19  ?  195  PHE B C   1 
ATOM   3753 O O   . PHE B 1 69  ? 36.998  -2.131  28.670  1.00 72.39  ?  195  PHE B O   1 
ATOM   3754 C CB  . PHE B 1 69  ? 37.528  -2.098  31.845  1.00 85.29  ?  195  PHE B CB  1 
ATOM   3755 C CG  . PHE B 1 69  ? 38.548  -2.201  32.946  1.00 85.61  ?  195  PHE B CG  1 
ATOM   3756 C CD1 . PHE B 1 69  ? 39.864  -2.526  32.664  1.00 84.61  ?  195  PHE B CD1 1 
ATOM   3757 C CD2 . PHE B 1 69  ? 38.188  -1.969  34.263  1.00 78.28  ?  195  PHE B CD2 1 
ATOM   3758 C CE1 . PHE B 1 69  ? 40.803  -2.617  33.677  1.00 81.42  ?  195  PHE B CE1 1 
ATOM   3759 C CE2 . PHE B 1 69  ? 39.122  -2.053  35.280  1.00 77.32  ?  195  PHE B CE2 1 
ATOM   3760 C CZ  . PHE B 1 69  ? 40.430  -2.379  34.987  1.00 78.92  ?  195  PHE B CZ  1 
ATOM   3761 N N   . PHE B 1 70  ? 35.954  -0.368  29.598  1.00 73.77  ?  196  PHE B N   1 
ATOM   3762 C CA  . PHE B 1 70  ? 34.920  -0.355  28.570  1.00 75.65  ?  196  PHE B CA  1 
ATOM   3763 C C   . PHE B 1 70  ? 35.495  0.088   27.233  1.00 81.44  ?  196  PHE B C   1 
ATOM   3764 O O   . PHE B 1 70  ? 35.198  -0.508  26.188  1.00 97.01  ?  196  PHE B O   1 
ATOM   3765 C CB  . PHE B 1 70  ? 33.779  0.567   29.005  1.00 69.66  ?  196  PHE B CB  1 
ATOM   3766 C CG  . PHE B 1 70  ? 32.504  0.384   28.223  1.00 94.49  ?  196  PHE B CG  1 
ATOM   3767 C CD1 . PHE B 1 70  ? 32.278  1.106   27.063  1.00 89.26  ?  196  PHE B CD1 1 
ATOM   3768 C CD2 . PHE B 1 70  ? 31.520  -0.488  28.664  1.00 109.02 ?  196  PHE B CD2 1 
ATOM   3769 C CE1 . PHE B 1 70  ? 31.101  0.951   26.345  1.00 85.85  ?  196  PHE B CE1 1 
ATOM   3770 C CE2 . PHE B 1 70  ? 30.339  -0.647  27.950  1.00 110.57 ?  196  PHE B CE2 1 
ATOM   3771 C CZ  . PHE B 1 70  ? 30.131  0.073   26.790  1.00 98.03  ?  196  PHE B CZ  1 
ATOM   3772 N N   . LYS B 1 71  ? 36.330  1.131   27.252  1.00 74.92  ?  197  LYS B N   1 
ATOM   3773 C CA  . LYS B 1 71  ? 36.996  1.569   26.031  1.00 72.70  ?  197  LYS B CA  1 
ATOM   3774 C C   . LYS B 1 71  ? 37.846  0.450   25.455  1.00 79.14  ?  197  LYS B C   1 
ATOM   3775 O O   . LYS B 1 71  ? 37.865  0.238   24.237  1.00 84.00  ?  197  LYS B O   1 
ATOM   3776 C CB  . LYS B 1 71  ? 37.857  2.802   26.313  1.00 70.11  ?  197  LYS B CB  1 
ATOM   3777 C CG  . LYS B 1 71  ? 38.661  3.332   25.130  1.00 69.38  ?  197  LYS B CG  1 
ATOM   3778 C CD  . LYS B 1 71  ? 39.618  4.431   25.589  1.00 74.63  ?  197  LYS B CD  1 
ATOM   3779 C CE  . LYS B 1 71  ? 40.209  5.212   24.425  1.00 73.20  ?  197  LYS B CE  1 
ATOM   3780 N NZ  . LYS B 1 71  ? 41.500  4.647   23.941  1.00 62.71  ?  197  LYS B NZ  1 
ATOM   3781 N N   . ASP B 1 72  ? 38.544  -0.291  26.316  1.00 77.87  ?  198  ASP B N   1 
ATOM   3782 C CA  . ASP B 1 72  ? 39.384  -1.370  25.806  1.00 73.69  ?  198  ASP B CA  1 
ATOM   3783 C C   . ASP B 1 72  ? 38.543  -2.519  25.256  1.00 86.45  ?  198  ASP B C   1 
ATOM   3784 O O   . ASP B 1 72  ? 38.879  -3.096  24.216  1.00 107.09 ?  198  ASP B O   1 
ATOM   3785 C CB  . ASP B 1 72  ? 40.328  -1.872  26.898  1.00 89.09  ?  198  ASP B CB  1 
ATOM   3786 C CG  . ASP B 1 72  ? 41.199  -3.032  26.433  1.00 96.63  ?  198  ASP B CG  1 
ATOM   3787 O OD1 . ASP B 1 72  ? 41.502  -3.117  25.227  1.00 92.38  ?  198  ASP B OD1 1 
ATOM   3788 O OD2 . ASP B 1 72  ? 41.568  -3.877  27.273  1.00 100.31 -1 198  ASP B OD2 1 
ATOM   3789 N N   . ALA B 1 73  ? 37.442  -2.863  25.931  1.00 90.86  ?  199  ALA B N   1 
ATOM   3790 C CA  . ALA B 1 73  ? 36.610  -3.974  25.484  1.00 85.84  ?  199  ALA B CA  1 
ATOM   3791 C C   . ALA B 1 73  ? 35.845  -3.657  24.206  1.00 92.18  ?  199  ALA B C   1 
ATOM   3792 O O   . ALA B 1 73  ? 35.502  -4.581  23.461  1.00 113.45 ?  199  ALA B O   1 
ATOM   3793 C CB  . ALA B 1 73  ? 35.631  -4.375  26.587  1.00 84.84  ?  199  ALA B CB  1 
ATOM   3794 N N   . ALA B 1 74  ? 35.564  -2.381  23.937  1.00 101.20 ?  200  ALA B N   1 
ATOM   3795 C CA  . ALA B 1 74  ? 34.899  -2.030  22.689  1.00 95.64  ?  200  ALA B CA  1 
ATOM   3796 C C   . ALA B 1 74  ? 35.831  -2.104  21.485  1.00 105.30 ?  200  ALA B C   1 
ATOM   3797 O O   . ALA B 1 74  ? 35.349  -2.074  20.346  1.00 120.32 ?  200  ALA B O   1 
ATOM   3798 C CB  . ALA B 1 74  ? 34.289  -0.631  22.792  1.00 100.22 ?  200  ALA B CB  1 
ATOM   3799 N N   . LEU B 1 75  ? 37.147  -2.198  21.706  1.00 111.48 ?  201  LEU B N   1 
ATOM   3800 C CA  . LEU B 1 75  ? 38.067  -2.354  20.586  1.00 128.68 ?  201  LEU B CA  1 
ATOM   3801 C C   . LEU B 1 75  ? 37.838  -3.672  19.860  1.00 140.37 ?  201  LEU B C   1 
ATOM   3802 O O   . LEU B 1 75  ? 38.023  -3.748  18.641  1.00 171.70 ?  201  LEU B O   1 
ATOM   3803 C CB  . LEU B 1 75  ? 39.515  -2.261  21.067  1.00 135.03 ?  201  LEU B CB  1 
ATOM   3804 C CG  . LEU B 1 75  ? 39.977  -0.947  21.701  1.00 142.00 ?  201  LEU B CG  1 
ATOM   3805 C CD1 . LEU B 1 75  ? 41.417  -1.074  22.174  1.00 152.15 ?  201  LEU B CD1 1 
ATOM   3806 C CD2 . LEU B 1 75  ? 39.827  0.214   20.730  1.00 124.39 ?  201  LEU B CD2 1 
ATOM   3807 N N   . LYS B 1 76  ? 37.438  -4.716  20.581  1.00 131.40 ?  202  LYS B N   1 
ATOM   3808 C CA  . LYS B 1 76  ? 37.102  -5.985  19.943  1.00 120.77 ?  202  LYS B CA  1 
ATOM   3809 C C   . LYS B 1 76  ? 35.716  -5.849  19.326  1.00 110.44 ?  202  LYS B C   1 
ATOM   3810 O O   . LYS B 1 76  ? 34.717  -5.725  20.038  1.00 90.91  ?  202  LYS B O   1 
ATOM   3811 C CB  . LYS B 1 76  ? 37.166  -7.140  20.935  1.00 125.61 ?  202  LYS B CB  1 
ATOM   3812 C CG  . LYS B 1 76  ? 37.181  -8.479  20.231  1.00 133.96 ?  202  LYS B CG  1 
ATOM   3813 C CD  . LYS B 1 76  ? 36.929  -9.664  21.141  1.00 128.34 ?  202  LYS B CD  1 
ATOM   3814 C CE  . LYS B 1 76  ? 37.036  -10.947 20.327  1.00 117.00 ?  202  LYS B CE  1 
ATOM   3815 N NZ  . LYS B 1 76  ? 36.968  -12.178 21.155  1.00 125.62 ?  202  LYS B NZ  1 
ATOM   3816 N N   . TRP B 1 77  ? 35.669  -5.858  17.993  1.00 117.75 ?  203  TRP B N   1 
ATOM   3817 C CA  . TRP B 1 77  ? 34.443  -5.681  17.214  1.00 104.84 ?  203  TRP B CA  1 
ATOM   3818 C C   . TRP B 1 77  ? 33.849  -4.294  17.447  1.00 87.36  ?  203  TRP B C   1 
ATOM   3819 O O   . TRP B 1 77  ? 34.391  -3.286  16.988  1.00 67.56  ?  203  TRP B O   1 
ATOM   3820 C CB  . TRP B 1 77  ? 33.409  -6.765  17.547  1.00 113.74 ?  203  TRP B CB  1 
ATOM   3821 N N   . GLY B 1 83  ? 35.217  -3.705  8.294   1.00 131.20 ?  216  GLY B N   1 
ATOM   3822 C CA  . GLY B 1 83  ? 34.013  -3.629  7.486   1.00 126.63 ?  216  GLY B CA  1 
ATOM   3823 C C   . GLY B 1 83  ? 33.113  -2.471  7.869   1.00 134.26 ?  216  GLY B C   1 
ATOM   3824 O O   . GLY B 1 83  ? 32.893  -1.561  7.069   1.00 140.17 ?  216  GLY B O   1 
ATOM   3825 N N   . LEU B 1 84  ? 32.594  -2.522  9.098   1.00 139.30 ?  217  LEU B N   1 
ATOM   3826 C CA  . LEU B 1 84  ? 31.667  -1.524  9.623   1.00 137.27 ?  217  LEU B CA  1 
ATOM   3827 C C   . LEU B 1 84  ? 32.394  -0.403  10.361  1.00 124.46 ?  217  LEU B C   1 
ATOM   3828 O O   . LEU B 1 84  ? 33.609  -0.237  10.210  1.00 111.56 ?  217  LEU B O   1 
ATOM   3829 C CB  . LEU B 1 84  ? 30.629  -2.185  10.535  1.00 120.27 ?  217  LEU B CB  1 
ATOM   3830 N N   . LEU B 1 85  ? 31.645  0.378   11.142  1.00 122.75 ?  218  LEU B N   1 
ATOM   3831 C CA  . LEU B 1 85  ? 32.140  1.635   11.696  1.00 137.38 ?  218  LEU B CA  1 
ATOM   3832 C C   . LEU B 1 85  ? 33.263  1.413   12.706  1.00 136.13 ?  218  LEU B C   1 
ATOM   3833 O O   . LEU B 1 85  ? 33.142  0.597   13.626  1.00 147.61 ?  218  LEU B O   1 
ATOM   3834 C CB  . LEU B 1 85  ? 30.990  2.402   12.351  1.00 117.72 ?  218  LEU B CB  1 
ATOM   3835 N N   . SER B 1 86  ? 34.359  2.149   12.519  1.00 132.01 ?  219  SER B N   1 
ATOM   3836 C CA  . SER B 1 86  ? 35.452  2.181   13.479  1.00 122.67 ?  219  SER B CA  1 
ATOM   3837 C C   . SER B 1 86  ? 34.988  2.797   14.795  1.00 125.68 ?  219  SER B C   1 
ATOM   3838 O O   . SER B 1 86  ? 34.032  3.576   14.848  1.00 112.72 ?  219  SER B O   1 
ATOM   3839 C CB  . SER B 1 86  ? 36.635  2.973   12.918  1.00 106.25 ?  219  SER B CB  1 
ATOM   3840 N N   . TYR B 1 87  ? 35.695  2.438   15.872  1.00 131.53 ?  220  TYR B N   1 
ATOM   3841 C CA  . TYR B 1 87  ? 35.296  2.876   17.206  1.00 108.25 ?  220  TYR B CA  1 
ATOM   3842 C C   . TYR B 1 87  ? 35.485  4.376   17.393  1.00 107.69 ?  220  TYR B C   1 
ATOM   3843 O O   . TYR B 1 87  ? 34.726  5.007   18.138  1.00 99.65  ?  220  TYR B O   1 
ATOM   3844 C CB  . TYR B 1 87  ? 36.080  2.103   18.270  1.00 99.45  ?  220  TYR B CB  1 
ATOM   3845 C CG  . TYR B 1 87  ? 35.758  2.510   19.691  1.00 106.87 ?  220  TYR B CG  1 
ATOM   3846 C CD1 . TYR B 1 87  ? 34.499  2.278   20.230  1.00 106.76 ?  220  TYR B CD1 1 
ATOM   3847 C CD2 . TYR B 1 87  ? 36.712  3.124   20.494  1.00 109.65 ?  220  TYR B CD2 1 
ATOM   3848 C CE1 . TYR B 1 87  ? 34.196  2.651   21.524  1.00 106.16 ?  220  TYR B CE1 1 
ATOM   3849 C CE2 . TYR B 1 87  ? 36.417  3.498   21.793  1.00 106.58 ?  220  TYR B CE2 1 
ATOM   3850 C CZ  . TYR B 1 87  ? 35.158  3.261   22.301  1.00 107.27 ?  220  TYR B CZ  1 
ATOM   3851 O OH  . TYR B 1 87  ? 34.861  3.633   23.590  1.00 95.98  ?  220  TYR B OH  1 
ATOM   3852 N N   . GLN B 1 88  ? 36.483  4.964   16.732  1.00 101.23 ?  221  GLN B N   1 
ATOM   3853 C CA  . GLN B 1 88  ? 36.710  6.396   16.874  1.00 99.53  ?  221  GLN B CA  1 
ATOM   3854 C C   . GLN B 1 88  ? 35.585  7.222   16.268  1.00 99.63  ?  221  GLN B C   1 
ATOM   3855 O O   . GLN B 1 88  ? 35.396  8.375   16.670  1.00 102.31 ?  221  GLN B O   1 
ATOM   3856 C CB  . GLN B 1 88  ? 38.047  6.788   16.241  1.00 105.45 ?  221  GLN B CB  1 
ATOM   3857 N N   . ASP B 1 89  ? 34.832  6.662   15.322  1.00 102.27 ?  222  ASP B N   1 
ATOM   3858 C CA  . ASP B 1 89  ? 33.759  7.394   14.663  1.00 103.65 ?  222  ASP B CA  1 
ATOM   3859 C C   . ASP B 1 89  ? 32.418  7.268   15.375  1.00 99.43  ?  222  ASP B C   1 
ATOM   3860 O O   . ASP B 1 89  ? 31.538  8.109   15.159  1.00 106.10 ?  222  ASP B O   1 
ATOM   3861 C CB  . ASP B 1 89  ? 33.609  6.916   13.214  1.00 103.31 ?  222  ASP B CB  1 
ATOM   3862 N N   . SER B 1 90  ? 32.240  6.250   16.211  1.00 115.03 ?  223  SER B N   1 
ATOM   3863 C CA  . SER B 1 90  ? 30.965  6.032   16.874  1.00 112.89 ?  223  SER B CA  1 
ATOM   3864 C C   . SER B 1 90  ? 30.687  7.119   17.909  1.00 106.35 ?  223  SER B C   1 
ATOM   3865 O O   . SER B 1 90  ? 31.569  7.888   18.304  1.00 101.30 ?  223  SER B O   1 
ATOM   3866 C CB  . SER B 1 90  ? 30.945  4.661   17.550  1.00 111.04 ?  223  SER B CB  1 
ATOM   3867 O OG  . SER B 1 90  ? 31.924  4.594   18.574  1.00 94.58  ?  223  SER B OG  1 
ATOM   3868 N N   . LEU B 1 91  ? 29.430  7.172   18.347  1.00 110.44 ?  224  LEU B N   1 
ATOM   3869 C CA  . LEU B 1 91  ? 29.025  8.073   19.417  1.00 126.13 ?  224  LEU B CA  1 
ATOM   3870 C C   . LEU B 1 91  ? 29.221  7.465   20.799  1.00 132.45 ?  224  LEU B C   1 
ATOM   3871 O O   . LEU B 1 91  ? 29.434  8.208   21.771  1.00 145.56 ?  224  LEU B O   1 
ATOM   3872 C CB  . LEU B 1 91  ? 27.557  8.477   19.232  1.00 130.72 ?  224  LEU B CB  1 
ATOM   3873 C CG  . LEU B 1 91  ? 26.963  9.496   20.208  1.00 131.08 ?  224  LEU B CG  1 
ATOM   3874 C CD1 . LEU B 1 91  ? 26.217  10.580  19.451  1.00 137.53 ?  224  LEU B CD1 1 
ATOM   3875 C CD2 . LEU B 1 91  ? 26.039  8.815   21.205  1.00 121.77 ?  224  LEU B CD2 1 
ATOM   3876 N N   . ALA B 1 92  ? 29.167  6.133   20.904  1.00 118.06 ?  225  ALA B N   1 
ATOM   3877 C CA  . ALA B 1 92  ? 29.438  5.472   22.175  1.00 104.03 ?  225  ALA B CA  1 
ATOM   3878 C C   . ALA B 1 92  ? 30.809  5.860   22.712  1.00 97.41  ?  225  ALA B C   1 
ATOM   3879 O O   . ALA B 1 92  ? 30.977  6.064   23.920  1.00 100.16 ?  225  ALA B O   1 
ATOM   3880 C CB  . ALA B 1 92  ? 29.342  3.956   22.009  1.00 126.17 ?  225  ALA B CB  1 
ATOM   3881 N N   . CYS B 1 93  ? 31.800  5.970   21.823  1.00 85.65  ?  226  CYS B N   1 
ATOM   3882 C CA  . CYS B 1 93  ? 33.141  6.376   22.235  1.00 90.63  ?  226  CYS B CA  1 
ATOM   3883 C C   . CYS B 1 93  ? 33.138  7.777   22.830  1.00 98.82  ?  226  CYS B C   1 
ATOM   3884 O O   . CYS B 1 93  ? 33.786  8.030   23.852  1.00 106.82 ?  226  CYS B O   1 
ATOM   3885 C CB  . CYS B 1 93  ? 34.094  6.314   21.041  1.00 85.82  ?  226  CYS B CB  1 
ATOM   3886 S SG  . CYS B 1 93  ? 35.773  6.927   21.351  1.00 86.84  ?  226  CYS B SG  1 
ATOM   3887 N N   . ARG B 1 94  ? 32.416  8.703   22.201  1.00 95.62  ?  227  ARG B N   1 
ATOM   3888 C CA  . ARG B 1 94  ? 32.365  10.062  22.722  1.00 93.76  ?  227  ARG B CA  1 
ATOM   3889 C C   . ARG B 1 94  ? 31.658  10.108  24.070  1.00 95.00  ?  227  ARG B C   1 
ATOM   3890 O O   . ARG B 1 94  ? 32.062  10.870  24.958  1.00 89.49  ?  227  ARG B O   1 
ATOM   3891 C CB  . ARG B 1 94  ? 31.685  10.968  21.699  1.00 98.06  ?  227  ARG B CB  1 
ATOM   3892 C CG  . ARG B 1 94  ? 32.266  10.774  20.306  1.00 97.25  ?  227  ARG B CG  1 
ATOM   3893 C CD  . ARG B 1 94  ? 31.532  11.567  19.242  1.00 90.94  ?  227  ARG B CD  1 
ATOM   3894 N NE  . ARG B 1 94  ? 31.905  11.118  17.903  1.00 99.02  ?  227  ARG B NE  1 
ATOM   3895 C CZ  . ARG B 1 94  ? 32.974  11.548  17.242  1.00 115.72 ?  227  ARG B CZ  1 
ATOM   3896 N NH1 . ARG B 1 94  ? 33.780  12.445  17.793  1.00 123.89 ?  227  ARG B NH1 1 
ATOM   3897 N NH2 . ARG B 1 94  ? 33.238  11.082  16.029  1.00 123.62 ?  227  ARG B NH2 1 
ATOM   3898 N N   . LEU B 1 95  ? 30.648  9.261   24.267  1.00 85.76  ?  228  LEU B N   1 
ATOM   3899 C CA  . LEU B 1 95  ? 30.007  9.198   25.577  1.00 85.50  ?  228  LEU B CA  1 
ATOM   3900 C C   . LEU B 1 95  ? 30.957  8.639   26.632  1.00 90.50  ?  228  LEU B C   1 
ATOM   3901 O O   . LEU B 1 95  ? 31.014  9.144   27.760  1.00 83.29  ?  228  LEU B O   1 
ATOM   3902 C CB  . LEU B 1 95  ? 28.737  8.355   25.503  1.00 89.61  ?  228  LEU B CB  1 
ATOM   3903 C CG  . LEU B 1 95  ? 27.579  8.964   24.717  1.00 88.80  ?  228  LEU B CG  1 
ATOM   3904 C CD1 . LEU B 1 95  ? 26.407  8.008   24.738  1.00 95.47  ?  228  LEU B CD1 1 
ATOM   3905 C CD2 . LEU B 1 95  ? 27.177  10.321  25.280  1.00 90.94  ?  228  LEU B CD2 1 
ATOM   3906 N N   . VAL B 1 96  ? 31.697  7.580   26.291  1.00 89.14  ?  229  VAL B N   1 
ATOM   3907 C CA  . VAL B 1 96  ? 32.622  6.987   27.256  1.00 84.09  ?  229  VAL B CA  1 
ATOM   3908 C C   . VAL B 1 96  ? 33.711  7.988   27.616  1.00 71.00  ?  229  VAL B C   1 
ATOM   3909 O O   . VAL B 1 96  ? 34.120  8.099   28.779  1.00 93.27  ?  229  VAL B O   1 
ATOM   3910 C CB  . VAL B 1 96  ? 33.202  5.666   26.711  1.00 88.39  ?  229  VAL B CB  1 
ATOM   3911 C CG1 . VAL B 1 96  ? 34.260  5.118   27.647  1.00 76.22  ?  229  VAL B CG1 1 
ATOM   3912 C CG2 . VAL B 1 96  ? 32.092  4.635   26.536  1.00 93.47  ?  229  VAL B CG2 1 
ATOM   3913 N N   . PHE B 1 97  ? 34.157  8.769   26.631  1.00 69.63  ?  230  PHE B N   1 
ATOM   3914 C CA  . PHE B 1 97  ? 35.179  9.781   26.871  1.00 73.64  ?  230  PHE B CA  1 
ATOM   3915 C C   . PHE B 1 97  ? 34.646  10.916  27.742  1.00 70.98  ?  230  PHE B C   1 
ATOM   3916 O O   . PHE B 1 97  ? 35.359  11.426  28.616  1.00 69.73  ?  230  PHE B O   1 
ATOM   3917 C CB  . PHE B 1 97  ? 35.693  10.304  25.529  1.00 69.05  ?  230  PHE B CB  1 
ATOM   3918 C CG  . PHE B 1 97  ? 36.791  11.313  25.646  1.00 66.73  ?  230  PHE B CG  1 
ATOM   3919 C CD1 . PHE B 1 97  ? 37.942  11.033  26.363  1.00 70.11  ?  230  PHE B CD1 1 
ATOM   3920 C CD2 . PHE B 1 97  ? 36.680  12.540  25.019  1.00 72.73  ?  230  PHE B CD2 1 
ATOM   3921 C CE1 . PHE B 1 97  ? 38.956  11.966  26.461  1.00 81.23  ?  230  PHE B CE1 1 
ATOM   3922 C CE2 . PHE B 1 97  ? 37.690  13.476  25.111  1.00 78.01  ?  230  PHE B CE2 1 
ATOM   3923 C CZ  . PHE B 1 97  ? 38.830  13.189  25.835  1.00 72.77  ?  230  PHE B CZ  1 
ATOM   3924 N N   . LEU B 1 98  ? 33.387  11.312  27.533  1.00 77.68  ?  231  LEU B N   1 
ATOM   3925 C CA  . LEU B 1 98  ? 32.790  12.341  28.380  1.00 71.59  ?  231  LEU B CA  1 
ATOM   3926 C C   . LEU B 1 98  ? 32.640  11.856  29.819  1.00 69.97  ?  231  LEU B C   1 
ATOM   3927 O O   . LEU B 1 98  ? 32.920  12.601  30.770  1.00 66.45  ?  231  LEU B O   1 
ATOM   3928 C CB  . LEU B 1 98  ? 31.434  12.760  27.810  1.00 69.26  ?  231  LEU B CB  1 
ATOM   3929 C CG  . LEU B 1 98  ? 30.741  13.926  28.511  1.00 63.97  ?  231  LEU B CG  1 
ATOM   3930 C CD1 . LEU B 1 98  ? 31.591  15.175  28.411  1.00 63.71  ?  231  LEU B CD1 1 
ATOM   3931 C CD2 . LEU B 1 98  ? 29.370  14.171  27.916  1.00 66.46  ?  231  LEU B CD2 1 
ATOM   3932 N N   . LEU B 1 99  ? 32.210  10.605  29.999  1.00 65.39  ?  232  LEU B N   1 
ATOM   3933 C CA  . LEU B 1 99  ? 32.105  10.049  31.345  1.00 69.08  ?  232  LEU B CA  1 
ATOM   3934 C C   . LEU B 1 99  ? 33.473  9.974   32.016  1.00 74.82  ?  232  LEU B C   1 
ATOM   3935 O O   . LEU B 1 99  ? 33.600  10.217  33.224  1.00 69.61  ?  232  LEU B O   1 
ATOM   3936 C CB  . LEU B 1 99  ? 31.454  8.668   31.288  1.00 72.10  ?  232  LEU B CB  1 
ATOM   3937 C CG  . LEU B 1 99  ? 31.257  7.954   32.628  1.00 72.87  ?  232  LEU B CG  1 
ATOM   3938 C CD1 . LEU B 1 99  ? 30.345  8.759   33.538  1.00 76.16  ?  232  LEU B CD1 1 
ATOM   3939 C CD2 . LEU B 1 99  ? 30.713  6.547   32.424  1.00 71.17  ?  232  LEU B CD2 1 
ATOM   3940 N N   . MET B 1 100 ? 34.508  9.634   31.247  1.00 68.70  ?  233  MET B N   1 
ATOM   3941 C CA  . MET B 1 100 ? 35.866  9.629   31.784  1.00 63.71  ?  233  MET B CA  1 
ATOM   3942 C C   . MET B 1 100 ? 36.285  11.022  32.241  1.00 68.71  ?  233  MET B C   1 
ATOM   3943 O O   . MET B 1 100 ? 36.863  11.189  33.322  1.00 78.97  ?  233  MET B O   1 
ATOM   3944 C CB  . MET B 1 100 ? 36.840  9.097   30.734  1.00 63.52  ?  233  MET B CB  1 
ATOM   3945 C CG  . MET B 1 100 ? 38.296  9.145   31.160  1.00 78.13  ?  233  MET B CG  1 
ATOM   3946 S SD  . MET B 1 100 ? 38.976  7.512   31.526  1.00 90.75  ?  233  MET B SD  1 
ATOM   3947 C CE  . MET B 1 100 ? 38.942  6.753   29.903  1.00 80.65  ?  233  MET B CE  1 
ATOM   3948 N N   . GLN B 1 101 ? 36.045  12.032  31.403  1.00 66.50  ?  234  GLN B N   1 
ATOM   3949 C CA  . GLN B 1 101 ? 36.352  13.402  31.803  1.00 71.99  ?  234  GLN B CA  1 
ATOM   3950 C C   . GLN B 1 101 ? 35.631  13.776  33.092  1.00 67.65  ?  234  GLN B C   1 
ATOM   3951 O O   . GLN B 1 101 ? 36.220  14.415  33.982  1.00 77.16  ?  234  GLN B O   1 
ATOM   3952 C CB  . GLN B 1 101 ? 35.978  14.368  30.678  1.00 78.44  ?  234  GLN B CB  1 
ATOM   3953 C CG  . GLN B 1 101 ? 36.950  14.373  29.513  1.00 69.87  ?  234  GLN B CG  1 
ATOM   3954 C CD  . GLN B 1 101 ? 38.270  15.035  29.858  1.00 72.92  ?  234  GLN B CD  1 
ATOM   3955 O OE1 . GLN B 1 101 ? 38.445  15.576  30.953  1.00 82.76  ?  234  GLN B OE1 1 
ATOM   3956 N NE2 . GLN B 1 101 ? 39.209  14.997  28.921  1.00 75.76  ?  234  GLN B NE2 1 
ATOM   3957 N N   . TYR B 1 102 ? 34.372  13.351  33.223  1.00 55.46  ?  235  TYR B N   1 
ATOM   3958 C CA  . TYR B 1 102 ? 33.628  13.613  34.449  1.00 60.50  ?  235  TYR B CA  1 
ATOM   3959 C C   . TYR B 1 102 ? 34.297  12.956  35.649  1.00 65.78  ?  235  TYR B C   1 
ATOM   3960 O O   . TYR B 1 102 ? 34.437  13.581  36.708  1.00 59.32  ?  235  TYR B O   1 
ATOM   3961 C CB  . TYR B 1 102 ? 32.187  13.118  34.311  1.00 55.76  ?  235  TYR B CB  1 
ATOM   3962 C CG  . TYR B 1 102 ? 31.373  13.325  35.566  1.00 56.05  ?  235  TYR B CG  1 
ATOM   3963 C CD1 . TYR B 1 102 ? 30.873  14.578  35.886  1.00 60.09  ?  235  TYR B CD1 1 
ATOM   3964 C CD2 . TYR B 1 102 ? 31.117  12.275  36.439  1.00 44.46  ?  235  TYR B CD2 1 
ATOM   3965 C CE1 . TYR B 1 102 ? 30.136  14.780  37.034  1.00 60.64  ?  235  TYR B CE1 1 
ATOM   3966 C CE2 . TYR B 1 102 ? 30.380  12.470  37.594  1.00 52.52  ?  235  TYR B CE2 1 
ATOM   3967 C CZ  . TYR B 1 102 ? 29.893  13.725  37.884  1.00 62.90  ?  235  TYR B CZ  1 
ATOM   3968 O OH  . TYR B 1 102 ? 29.159  13.933  39.026  1.00 67.04  ?  235  TYR B OH  1 
ATOM   3969 N N   . CYS B 1 103 ? 34.722  11.698  35.499  1.00 68.69  ?  236  CYS B N   1 
ATOM   3970 C CA  . CYS B 1 103 ? 35.389  11.005  36.600  1.00 62.35  ?  236  CYS B CA  1 
ATOM   3971 C C   . CYS B 1 103 ? 36.686  11.704  36.994  1.00 63.34  ?  236  CYS B C   1 
ATOM   3972 O O   . CYS B 1 103 ? 37.032  11.768  38.179  1.00 66.61  ?  236  CYS B O   1 
ATOM   3973 C CB  . CYS B 1 103 ? 35.667  9.551   36.221  1.00 57.22  ?  236  CYS B CB  1 
ATOM   3974 S SG  . CYS B 1 103 ? 34.207  8.518   36.051  1.00 83.59  ?  236  CYS B SG  1 
ATOM   3975 N N   . VAL B 1 104 ? 37.424  12.228  36.013  1.00 54.98  ?  237  VAL B N   1 
ATOM   3976 C CA  . VAL B 1 104 ? 38.690  12.901  36.314  1.00 51.62  ?  237  VAL B CA  1 
ATOM   3977 C C   . VAL B 1 104 ? 38.442  14.171  37.123  1.00 57.92  ?  237  VAL B C   1 
ATOM   3978 O O   . VAL B 1 104 ? 39.093  14.423  38.153  1.00 69.32  ?  237  VAL B O   1 
ATOM   3979 C CB  . VAL B 1 104 ? 39.461  13.197  35.017  1.00 50.26  ?  237  VAL B CB  1 
ATOM   3980 C CG1 . VAL B 1 104 ? 40.647  14.099  35.304  1.00 48.80  ?  237  VAL B CG1 1 
ATOM   3981 C CG2 . VAL B 1 104 ? 39.908  11.894  34.376  1.00 41.51  ?  237  VAL B CG2 1 
ATOM   3982 N N   . ALA B 1 105 ? 37.504  14.999  36.659  1.00 52.37  ?  238  ALA B N   1 
ATOM   3983 C CA  . ALA B 1 105 ? 37.155  16.189  37.430  1.00 39.17  ?  238  ALA B CA  1 
ATOM   3984 C C   . ALA B 1 105 ? 36.642  15.817  38.817  1.00 42.04  ?  238  ALA B C   1 
ATOM   3985 O O   . ALA B 1 105 ? 36.899  16.536  39.794  1.00 28.63  ?  238  ALA B O   1 
ATOM   3986 C CB  . ALA B 1 105 ? 36.114  17.023  36.684  1.00 35.85  ?  238  ALA B CB  1 
ATOM   3987 N N   . ALA B 1 106 ? 35.947  14.680  38.929  1.00 46.22  ?  239  ALA B N   1 
ATOM   3988 C CA  . ALA B 1 106 ? 35.490  14.214  40.234  1.00 43.17  ?  239  ALA B CA  1 
ATOM   3989 C C   . ALA B 1 106 ? 36.665  13.858  41.134  1.00 43.07  ?  239  ALA B C   1 
ATOM   3990 O O   . ALA B 1 106 ? 36.645  14.144  42.335  1.00 46.12  ?  239  ALA B O   1 
ATOM   3991 C CB  . ALA B 1 106 ? 34.568  13.009  40.065  1.00 41.47  ?  239  ALA B CB  1 
ATOM   3992 N N   . ASN B 1 107 ? 37.682  13.199  40.578  1.00 48.06  ?  240  ASN B N   1 
ATOM   3993 C CA  . ASN B 1 107 ? 38.883  12.912  41.355  1.00 46.96  ?  240  ASN B CA  1 
ATOM   3994 C C   . ASN B 1 107 ? 39.452  14.192  41.930  1.00 55.59  ?  240  ASN B C   1 
ATOM   3995 O O   . ASN B 1 107 ? 39.711  14.289  43.136  1.00 65.08  ?  240  ASN B O   1 
ATOM   3996 C CB  . ASN B 1 107 ? 39.937  12.219  40.491  1.00 53.45  ?  240  ASN B CB  1 
ATOM   3997 C CG  . ASN B 1 107 ? 39.439  10.927  39.900  1.00 52.58  ?  240  ASN B CG  1 
ATOM   3998 O OD1 . ASN B 1 107 ? 38.520  10.308  40.433  1.00 58.90  ?  240  ASN B OD1 1 
ATOM   3999 N ND2 . ASN B 1 107 ? 40.040  10.507  38.797  1.00 48.70  ?  240  ASN B ND2 1 
ATOM   4000 N N   . TYR B 1 108 ? 39.605  15.213  41.085  1.00 62.69  ?  241  TYR B N   1 
ATOM   4001 C CA  . TYR B 1 108 ? 40.253  16.424  41.587  1.00 50.43  ?  241  TYR B CA  1 
ATOM   4002 C C   . TYR B 1 108 ? 39.383  17.158  42.606  1.00 49.06  ?  241  TYR B C   1 
ATOM   4003 O O   . TYR B 1 108 ? 39.906  17.688  43.594  1.00 63.52  ?  241  TYR B O   1 
ATOM   4004 C CB  . TYR B 1 108 ? 40.656  17.349  40.434  1.00 62.91  ?  241  TYR B CB  1 
ATOM   4005 C CG  . TYR B 1 108 ? 41.849  16.817  39.662  1.00 74.91  ?  241  TYR B CG  1 
ATOM   4006 C CD1 . TYR B 1 108 ? 43.154  17.079  40.075  1.00 72.45  ?  241  TYR B CD1 1 
ATOM   4007 C CD2 . TYR B 1 108 ? 41.669  16.031  38.533  1.00 84.91  ?  241  TYR B CD2 1 
ATOM   4008 C CE1 . TYR B 1 108 ? 44.242  16.576  39.374  1.00 75.16  ?  241  TYR B CE1 1 
ATOM   4009 C CE2 . TYR B 1 108 ? 42.747  15.527  37.830  1.00 86.00  ?  241  TYR B CE2 1 
ATOM   4010 C CZ  . TYR B 1 108 ? 44.033  15.799  38.253  1.00 75.09  ?  241  TYR B CZ  1 
ATOM   4011 O OH  . TYR B 1 108 ? 45.109  15.299  37.555  1.00 88.89  ?  241  TYR B OH  1 
ATOM   4012 N N   . TYR B 1 109 ? 38.060  17.158  42.437  1.00 42.69  ?  242  TYR B N   1 
ATOM   4013 C CA  . TYR B 1 109 ? 37.260  17.949  43.373  1.00 39.96  ?  242  TYR B CA  1 
ATOM   4014 C C   . TYR B 1 109 ? 36.928  17.194  44.658  1.00 42.98  ?  242  TYR B C   1 
ATOM   4015 O O   . TYR B 1 109 ? 36.771  17.821  45.716  1.00 59.29  ?  242  TYR B O   1 
ATOM   4016 C CB  . TYR B 1 109 ? 35.999  18.475  42.687  1.00 41.72  ?  242  TYR B CB  1 
ATOM   4017 C CG  . TYR B 1 109 ? 36.286  19.755  41.932  1.00 35.44  ?  242  TYR B CG  1 
ATOM   4018 C CD1 . TYR B 1 109 ? 36.182  20.996  42.550  1.00 33.83  ?  242  TYR B CD1 1 
ATOM   4019 C CD2 . TYR B 1 109 ? 36.705  19.718  40.611  1.00 29.34  ?  242  TYR B CD2 1 
ATOM   4020 C CE1 . TYR B 1 109 ? 36.461  22.165  41.856  1.00 31.86  ?  242  TYR B CE1 1 
ATOM   4021 C CE2 . TYR B 1 109 ? 36.988  20.878  39.915  1.00 33.82  ?  242  TYR B CE2 1 
ATOM   4022 C CZ  . TYR B 1 109 ? 36.863  22.099  40.543  1.00 42.04  ?  242  TYR B CZ  1 
ATOM   4023 O OH  . TYR B 1 109 ? 37.136  23.270  39.873  1.00 29.68  ?  242  TYR B OH  1 
ATOM   4024 N N   . TRP B 1 110 ? 36.849  15.863  44.616  1.00 47.06  ?  243  TRP B N   1 
ATOM   4025 C CA  . TRP B 1 110 ? 36.791  15.123  45.870  1.00 54.97  ?  243  TRP B CA  1 
ATOM   4026 C C   . TRP B 1 110 ? 38.132  15.176  46.592  1.00 60.80  ?  243  TRP B C   1 
ATOM   4027 O O   . TRP B 1 110 ? 38.165  15.163  47.826  1.00 59.02  ?  243  TRP B O   1 
ATOM   4028 C CB  . TRP B 1 110 ? 36.343  13.672  45.635  1.00 55.95  ?  243  TRP B CB  1 
ATOM   4029 C CG  . TRP B 1 110 ? 34.834  13.521  45.570  1.00 59.44  ?  243  TRP B CG  1 
ATOM   4030 C CD1 . TRP B 1 110 ? 34.075  13.313  44.456  1.00 59.66  ?  243  TRP B CD1 1 
ATOM   4031 C CD2 . TRP B 1 110 ? 33.916  13.582  46.671  1.00 61.17  ?  243  TRP B CD2 1 
ATOM   4032 N NE1 . TRP B 1 110 ? 32.744  13.237  44.795  1.00 54.44  ?  243  TRP B NE1 1 
ATOM   4033 C CE2 . TRP B 1 110 ? 32.621  13.401  46.150  1.00 54.72  ?  243  TRP B CE2 1 
ATOM   4034 C CE3 . TRP B 1 110 ? 34.066  13.762  48.046  1.00 59.56  ?  243  TRP B CE3 1 
ATOM   4035 C CZ2 . TRP B 1 110 ? 31.484  13.403  46.956  1.00 55.82  ?  243  TRP B CZ2 1 
ATOM   4036 C CZ3 . TRP B 1 110 ? 32.942  13.771  48.845  1.00 51.14  ?  243  TRP B CZ3 1 
ATOM   4037 C CH2 . TRP B 1 110 ? 31.665  13.588  48.300  1.00 53.45  ?  243  TRP B CH2 1 
ATOM   4038 N N   . LEU B 1 111 ? 39.240  15.305  45.853  1.00 64.03  ?  244  LEU B N   1 
ATOM   4039 C CA  . LEU B 1 111 ? 40.508  15.603  46.509  1.00 61.95  ?  244  LEU B CA  1 
ATOM   4040 C C   . LEU B 1 111 ? 40.474  16.984  47.151  1.00 54.39  ?  244  LEU B C   1 
ATOM   4041 O O   . LEU B 1 111 ? 41.026  17.189  48.245  1.00 49.05  ?  244  LEU B O   1 
ATOM   4042 C CB  . LEU B 1 111 ? 41.645  15.516  45.489  1.00 70.62  ?  244  LEU B CB  1 
ATOM   4043 C CG  . LEU B 1 111 ? 43.093  15.752  45.916  1.00 68.72  ?  244  LEU B CG  1 
ATOM   4044 C CD1 . LEU B 1 111 ? 43.530  14.733  46.953  1.00 55.91  ?  244  LEU B CD1 1 
ATOM   4045 C CD2 . LEU B 1 111 ? 44.012  15.706  44.702  1.00 63.23  ?  244  LEU B CD2 1 
ATOM   4046 N N   . LEU B 1 112 ? 39.791  17.929  46.507  1.00 49.42  ?  245  LEU B N   1 
ATOM   4047 C CA  . LEU B 1 112 ? 39.649  19.255  47.093  1.00 43.62  ?  245  LEU B CA  1 
ATOM   4048 C C   . LEU B 1 112 ? 38.878  19.190  48.406  1.00 50.78  ?  245  LEU B C   1 
ATOM   4049 O O   . LEU B 1 112 ? 39.289  19.788  49.407  1.00 55.30  ?  245  LEU B O   1 
ATOM   4050 C CB  . LEU B 1 112 ? 38.955  20.198  46.113  1.00 40.99  ?  245  LEU B CB  1 
ATOM   4051 C CG  . LEU B 1 112 ? 38.706  21.601  46.676  1.00 38.46  ?  245  LEU B CG  1 
ATOM   4052 C CD1 . LEU B 1 112 ? 39.991  22.195  47.226  1.00 41.65  ?  245  LEU B CD1 1 
ATOM   4053 C CD2 . LEU B 1 112 ? 38.093  22.530  45.638  1.00 37.62  ?  245  LEU B CD2 1 
ATOM   4054 N N   . VAL B 1 113 ? 37.747  18.479  48.422  1.00 45.66  ?  246  VAL B N   1 
ATOM   4055 C CA  . VAL B 1 113 ? 36.995  18.402  49.674  1.00 50.31  ?  246  VAL B CA  1 
ATOM   4056 C C   . VAL B 1 113 ? 37.755  17.571  50.700  1.00 49.67  ?  246  VAL B C   1 
ATOM   4057 O O   . VAL B 1 113 ? 37.611  17.790  51.907  1.00 40.94  ?  246  VAL B O   1 
ATOM   4058 C CB  . VAL B 1 113 ? 35.568  17.859  49.464  1.00 51.56  ?  246  VAL B CB  1 
ATOM   4059 C CG1 . VAL B 1 113 ? 34.881  18.557  48.297  1.00 41.68  ?  246  VAL B CG1 1 
ATOM   4060 C CG2 . VAL B 1 113 ? 35.582  16.362  49.294  1.00 49.64  ?  246  VAL B CG2 1 
ATOM   4061 N N   . GLU B 1 114 ? 38.592  16.632  50.249  1.00 54.45  ?  247  GLU B N   1 
ATOM   4062 C CA  . GLU B 1 114 ? 39.453  15.909  51.177  1.00 52.60  ?  247  GLU B CA  1 
ATOM   4063 C C   . GLU B 1 114 ? 40.356  16.883  51.921  1.00 52.65  ?  247  GLU B C   1 
ATOM   4064 O O   . GLU B 1 114 ? 40.430  16.861  53.160  1.00 51.60  ?  247  GLU B O   1 
ATOM   4065 C CB  . GLU B 1 114 ? 40.269  14.866  50.403  1.00 56.81  ?  247  GLU B CB  1 
ATOM   4066 C CG  . GLU B 1 114 ? 40.939  13.781  51.241  1.00 69.90  ?  247  GLU B CG  1 
ATOM   4067 C CD  . GLU B 1 114 ? 39.957  12.828  51.916  1.00 77.59  ?  247  GLU B CD  1 
ATOM   4068 O OE1 . GLU B 1 114 ? 39.226  12.104  51.204  1.00 87.80  ?  247  GLU B OE1 1 
ATOM   4069 O OE2 . GLU B 1 114 ? 39.920  12.803  53.166  1.00 71.95  -1 247  GLU B OE2 1 
ATOM   4070 N N   . GLY B 1 115 ? 40.960  17.814  51.186  1.00 47.86  ?  248  GLY B N   1 
ATOM   4071 C CA  . GLY B 1 115 ? 41.814  18.814  51.802  1.00 41.27  ?  248  GLY B CA  1 
ATOM   4072 C C   . GLY B 1 115 ? 41.060  19.793  52.685  1.00 43.55  ?  248  GLY B C   1 
ATOM   4073 O O   . GLY B 1 115 ? 41.536  20.166  53.765  1.00 57.48  ?  248  GLY B O   1 
ATOM   4074 N N   . VAL B 1 116 ? 39.870  20.205  52.237  1.00 44.99  ?  249  VAL B N   1 
ATOM   4075 C CA  . VAL B 1 116 ? 39.060  21.151  53.009  1.00 39.60  ?  249  VAL B CA  1 
ATOM   4076 C C   . VAL B 1 116 ? 38.652  20.530  54.339  1.00 41.99  ?  249  VAL B C   1 
ATOM   4077 O O   . VAL B 1 116 ? 38.729  21.167  55.402  1.00 46.80  ?  249  VAL B O   1 
ATOM   4078 C CB  . VAL B 1 116 ? 37.830  21.599  52.195  1.00 46.45  ?  249  VAL B CB  1 
ATOM   4079 C CG1 . VAL B 1 116 ? 36.912  22.490  53.031  1.00 37.73  ?  249  VAL B CG1 1 
ATOM   4080 C CG2 . VAL B 1 116 ? 38.272  22.327  50.939  1.00 55.78  ?  249  VAL B CG2 1 
ATOM   4081 N N   . TYR B 1 117 ? 38.170  19.288  54.290  1.00 45.12  ?  250  TYR B N   1 
ATOM   4082 C CA  . TYR B 1 117 ? 37.822  18.558  55.500  1.00 44.08  ?  250  TYR B CA  1 
ATOM   4083 C C   . TYR B 1 117 ? 39.021  18.431  56.428  1.00 48.20  ?  250  TYR B C   1 
ATOM   4084 O O   . TYR B 1 117 ? 38.892  18.578  57.647  1.00 50.66  ?  250  TYR B O   1 
ATOM   4085 C CB  . TYR B 1 117 ? 37.277  17.180  55.124  1.00 43.09  ?  250  TYR B CB  1 
ATOM   4086 C CG  . TYR B 1 117 ? 37.043  16.260  56.294  1.00 49.33  ?  250  TYR B CG  1 
ATOM   4087 C CD1 . TYR B 1 117 ? 35.930  16.414  57.111  1.00 51.03  ?  250  TYR B CD1 1 
ATOM   4088 C CD2 . TYR B 1 117 ? 37.927  15.227  56.573  1.00 49.62  ?  250  TYR B CD2 1 
ATOM   4089 C CE1 . TYR B 1 117 ? 35.711  15.573  58.182  1.00 54.33  ?  250  TYR B CE1 1 
ATOM   4090 C CE2 . TYR B 1 117 ? 37.718  14.386  57.645  1.00 49.49  ?  250  TYR B CE2 1 
ATOM   4091 C CZ  . TYR B 1 117 ? 36.608  14.561  58.442  1.00 57.14  ?  250  TYR B CZ  1 
ATOM   4092 O OH  . TYR B 1 117 ? 36.398  13.719  59.505  1.00 58.45  ?  250  TYR B OH  1 
ATOM   4093 N N   . LEU B 1 118 ? 40.198  18.133  55.869  1.00 57.49  ?  251  LEU B N   1 
ATOM   4094 C CA  . LEU B 1 118 ? 41.400  18.062  56.697  1.00 56.66  ?  251  LEU B CA  1 
ATOM   4095 C C   . LEU B 1 118 ? 41.653  19.383  57.414  1.00 58.18  ?  251  LEU B C   1 
ATOM   4096 O O   . LEU B 1 118 ? 41.954  19.408  58.618  1.00 48.69  ?  251  LEU B O   1 
ATOM   4097 C CB  . LEU B 1 118 ? 42.607  17.689  55.836  1.00 45.65  ?  251  LEU B CB  1 
ATOM   4098 C CG  . LEU B 1 118 ? 43.969  17.621  56.522  1.00 40.68  ?  251  LEU B CG  1 
ATOM   4099 C CD1 . LEU B 1 118 ? 43.987  16.542  57.601  1.00 38.70  ?  251  LEU B CD1 1 
ATOM   4100 C CD2 . LEU B 1 118 ? 45.066  17.382  55.491  1.00 34.28  ?  251  LEU B CD2 1 
ATOM   4101 N N   . TYR B 1 119 ? 41.528  20.494  56.687  1.00 54.32  ?  252  TYR B N   1 
ATOM   4102 C CA  . TYR B 1 119 ? 41.789  21.802  57.281  1.00 50.95  ?  252  TYR B CA  1 
ATOM   4103 C C   . TYR B 1 119 ? 40.830  22.077  58.434  1.00 59.29  ?  252  TYR B C   1 
ATOM   4104 O O   . TYR B 1 119 ? 41.245  22.466  59.537  1.00 68.29  ?  252  TYR B O   1 
ATOM   4105 C CB  . TYR B 1 119 ? 41.674  22.890  56.211  1.00 59.32  ?  252  TYR B CB  1 
ATOM   4106 C CG  . TYR B 1 119 ? 42.052  24.270  56.696  1.00 62.77  ?  252  TYR B CG  1 
ATOM   4107 C CD1 . TYR B 1 119 ? 43.370  24.702  56.655  1.00 68.45  ?  252  TYR B CD1 1 
ATOM   4108 C CD2 . TYR B 1 119 ? 41.093  25.142  57.199  1.00 69.45  ?  252  TYR B CD2 1 
ATOM   4109 C CE1 . TYR B 1 119 ? 43.723  25.960  57.103  1.00 88.41  ?  252  TYR B CE1 1 
ATOM   4110 C CE2 . TYR B 1 119 ? 41.441  26.406  57.647  1.00 89.83  ?  252  TYR B CE2 1 
ATOM   4111 C CZ  . TYR B 1 119 ? 42.756  26.807  57.595  1.00 102.74 ?  252  TYR B CZ  1 
ATOM   4112 O OH  . TYR B 1 119 ? 43.105  28.057  58.038  1.00 124.34 ?  252  TYR B OH  1 
ATOM   4113 N N   . THR B 1 120 ? 39.534  21.874  58.198  1.00 64.92  ?  253  THR B N   1 
ATOM   4114 C CA  . THR B 1 120 ? 38.572  22.121  59.269  1.00 65.69  ?  253  THR B CA  1 
ATOM   4115 C C   . THR B 1 120 ? 38.762  21.147  60.427  1.00 59.16  ?  253  THR B C   1 
ATOM   4116 O O   . THR B 1 120 ? 38.473  21.489  61.580  1.00 47.81  ?  253  THR B O   1 
ATOM   4117 C CB  . THR B 1 120 ? 37.140  22.040  58.738  1.00 66.55  ?  253  THR B CB  1 
ATOM   4118 O OG1 . THR B 1 120 ? 36.904  20.742  58.180  1.00 68.49  ?  253  THR B OG1 1 
ATOM   4119 C CG2 . THR B 1 120 ? 36.906  23.096  57.667  1.00 73.97  ?  253  THR B CG2 1 
ATOM   4120 N N   . LEU B 1 121 ? 39.246  19.937  60.141  1.00 50.63  ?  254  LEU B N   1 
ATOM   4121 C CA  . LEU B 1 121 ? 39.559  18.991  61.203  1.00 43.18  ?  254  LEU B CA  1 
ATOM   4122 C C   . LEU B 1 121 ? 40.682  19.514  62.082  1.00 40.96  ?  254  LEU B C   1 
ATOM   4123 O O   . LEU B 1 121 ? 40.669  19.307  63.302  1.00 42.09  ?  254  LEU B O   1 
ATOM   4124 C CB  . LEU B 1 121 ? 39.943  17.642  60.596  1.00 47.46  ?  254  LEU B CB  1 
ATOM   4125 C CG  . LEU B 1 121 ? 39.937  16.432  61.529  1.00 53.50  ?  254  LEU B CG  1 
ATOM   4126 C CD1 . LEU B 1 121 ? 38.528  16.157  62.029  1.00 58.34  ?  254  LEU B CD1 1 
ATOM   4127 C CD2 . LEU B 1 121 ? 40.501  15.217  60.815  1.00 56.47  ?  254  LEU B CD2 1 
ATOM   4128 N N   . LEU B 1 122 ? 41.653  20.202  61.484  1.00 48.07  ?  255  LEU B N   1 
ATOM   4129 C CA  . LEU B 1 122 ? 42.684  20.850  62.286  1.00 42.64  ?  255  LEU B CA  1 
ATOM   4130 C C   . LEU B 1 122 ? 42.171  22.087  63.015  1.00 44.56  ?  255  LEU B C   1 
ATOM   4131 O O   . LEU B 1 122 ? 42.742  22.468  64.043  1.00 54.34  ?  255  LEU B O   1 
ATOM   4132 C CB  . LEU B 1 122 ? 43.875  21.235  61.411  1.00 31.79  ?  255  LEU B CB  1 
ATOM   4133 C CG  . LEU B 1 122 ? 44.538  20.114  60.613  1.00 31.50  ?  255  LEU B CG  1 
ATOM   4134 C CD1 . LEU B 1 122 ? 45.362  20.724  59.495  1.00 30.43  ?  255  LEU B CD1 1 
ATOM   4135 C CD2 . LEU B 1 122 ? 45.401  19.237  61.514  1.00 25.01  ?  255  LEU B CD2 1 
ATOM   4136 N N   . ALA B 1 123 ? 41.106  22.716  62.525  1.00 42.62  ?  256  ALA B N   1 
ATOM   4137 C CA  . ALA B 1 123 ? 40.614  23.926  63.176  1.00 50.38  ?  256  ALA B CA  1 
ATOM   4138 C C   . ALA B 1 123 ? 39.666  23.661  64.347  1.00 56.68  ?  256  ALA B C   1 
ATOM   4139 O O   . ALA B 1 123 ? 39.405  24.585  65.126  1.00 53.98  ?  256  ALA B O   1 
ATOM   4140 C CB  . ALA B 1 123 ? 39.922  24.829  62.151  1.00 60.68  ?  256  ALA B CB  1 
ATOM   4141 N N   . PHE B 1 124 ? 39.145  22.444  64.500  1.00 59.99  ?  257  PHE B N   1 
ATOM   4142 C CA  . PHE B 1 124 ? 38.240  22.139  65.601  1.00 50.12  ?  257  PHE B CA  1 
ATOM   4143 C C   . PHE B 1 124 ? 39.034  21.629  66.798  1.00 55.51  ?  257  PHE B C   1 
ATOM   4144 O O   . PHE B 1 124 ? 40.062  20.963  66.645  1.00 86.61  ?  257  PHE B O   1 
ATOM   4145 C CB  . PHE B 1 124 ? 37.194  21.104  65.176  1.00 56.24  ?  257  PHE B CB  1 
ATOM   4146 C CG  . PHE B 1 124 ? 35.922  21.149  65.987  1.00 65.07  ?  257  PHE B CG  1 
ATOM   4147 C CD1 . PHE B 1 124 ? 34.925  22.065  65.687  1.00 54.86  ?  257  PHE B CD1 1 
ATOM   4148 C CD2 . PHE B 1 124 ? 35.714  20.266  67.037  1.00 66.65  ?  257  PHE B CD2 1 
ATOM   4149 C CE1 . PHE B 1 124 ? 33.751  22.110  66.422  1.00 51.93  ?  257  PHE B CE1 1 
ATOM   4150 C CE2 . PHE B 1 124 ? 34.536  20.304  67.778  1.00 58.65  ?  257  PHE B CE2 1 
ATOM   4151 C CZ  . PHE B 1 124 ? 33.555  21.229  67.468  1.00 57.65  ?  257  PHE B CZ  1 
ATOM   4152 N N   . ASN B 1 125 ? 38.560  21.962  67.997  1.00 53.26  ?  1001 ASN B N   1 
ATOM   4153 C CA  . ASN B 1 125 ? 39.258  21.582  69.224  1.00 53.83  ?  1001 ASN B CA  1 
ATOM   4154 C C   . ASN B 1 125 ? 38.290  21.642  70.404  1.00 61.08  ?  1001 ASN B C   1 
ATOM   4155 O O   . ASN B 1 125 ? 37.078  21.811  70.231  1.00 57.51  ?  1001 ASN B O   1 
ATOM   4156 C CB  . ASN B 1 125 ? 40.484  22.474  69.451  1.00 52.05  ?  1001 ASN B CB  1 
ATOM   4157 C CG  . ASN B 1 125 ? 40.149  23.955  69.428  1.00 63.16  ?  1001 ASN B CG  1 
ATOM   4158 O OD1 . ASN B 1 125 ? 39.069  24.376  69.850  1.00 82.98  ?  1001 ASN B OD1 1 
ATOM   4159 N ND2 . ASN B 1 125 ? 41.083  24.757  68.934  1.00 63.84  ?  1001 ASN B ND2 1 
ATOM   4160 N N   . ILE B 1 126 ? 38.843  21.503  71.614  1.00 62.77  ?  1002 ILE B N   1 
ATOM   4161 C CA  . ILE B 1 126 ? 38.031  21.514  72.829  1.00 54.75  ?  1002 ILE B CA  1 
ATOM   4162 C C   . ILE B 1 126 ? 37.365  22.867  73.015  1.00 55.47  ?  1002 ILE B C   1 
ATOM   4163 O O   . ILE B 1 126 ? 36.236  22.956  73.511  1.00 54.50  ?  1002 ILE B O   1 
ATOM   4164 C CB  . ILE B 1 126 ? 38.889  21.134  74.054  1.00 58.45  ?  1002 ILE B CB  1 
ATOM   4165 C CG1 . ILE B 1 126 ? 38.066  21.208  75.346  1.00 41.41  ?  1002 ILE B CG1 1 
ATOM   4166 C CG2 . ILE B 1 126 ? 40.129  22.015  74.153  1.00 54.20  ?  1002 ILE B CG2 1 
ATOM   4167 C CD1 . ILE B 1 126 ? 36.961  20.183  75.419  1.00 41.24  ?  1002 ILE B CD1 1 
ATOM   4168 N N   . PHE B 1 127 ? 38.050  23.945  72.629  1.00 54.81  ?  1003 PHE B N   1 
ATOM   4169 C CA  . PHE B 1 127 ? 37.462  25.267  72.804  1.00 59.08  ?  1003 PHE B CA  1 
ATOM   4170 C C   . PHE B 1 127 ? 36.186  25.401  71.982  1.00 56.08  ?  1003 PHE B C   1 
ATOM   4171 O O   . PHE B 1 127 ? 35.170  25.899  72.478  1.00 59.73  ?  1003 PHE B O   1 
ATOM   4172 C CB  . PHE B 1 127 ? 38.484  26.346  72.444  1.00 61.96  ?  1003 PHE B CB  1 
ATOM   4173 C CG  . PHE B 1 127 ? 39.724  26.309  73.303  1.00 55.00  ?  1003 PHE B CG  1 
ATOM   4174 C CD1 . PHE B 1 127 ? 39.749  26.923  74.548  1.00 57.93  ?  1003 PHE B CD1 1 
ATOM   4175 C CD2 . PHE B 1 127 ? 40.859  25.644  72.871  1.00 47.78  ?  1003 PHE B CD2 1 
ATOM   4176 C CE1 . PHE B 1 127 ? 40.888  26.878  75.340  1.00 55.60  ?  1003 PHE B CE1 1 
ATOM   4177 C CE2 . PHE B 1 127 ? 41.999  25.592  73.657  1.00 41.29  ?  1003 PHE B CE2 1 
ATOM   4178 C CZ  . PHE B 1 127 ? 42.014  26.211  74.893  1.00 45.43  ?  1003 PHE B CZ  1 
ATOM   4179 N N   . GLU B 1 128 ? 36.188  24.870  70.758  1.00 58.44  ?  1004 GLU B N   1 
ATOM   4180 C CA  . GLU B 1 128 ? 34.991  24.946  69.929  1.00 62.80  ?  1004 GLU B CA  1 
ATOM   4181 C C   . GLU B 1 128 ? 33.925  23.950  70.375  1.00 59.79  ?  1004 GLU B C   1 
ATOM   4182 O O   . GLU B 1 128 ? 32.734  24.285  70.383  1.00 71.48  ?  1004 GLU B O   1 
ATOM   4183 C CB  . GLU B 1 128 ? 35.369  24.731  68.462  1.00 67.41  ?  1004 GLU B CB  1 
ATOM   4184 C CG  . GLU B 1 128 ? 36.514  25.629  68.003  1.00 86.33  ?  1004 GLU B CG  1 
ATOM   4185 C CD  . GLU B 1 128 ? 36.243  27.102  68.262  1.00 107.21 ?  1004 GLU B CD  1 
ATOM   4186 O OE1 . GLU B 1 128 ? 35.102  27.547  68.028  1.00 130.41 ?  1004 GLU B OE1 1 
ATOM   4187 O OE2 . GLU B 1 128 ? 37.165  27.816  68.707  1.00 140.79 -1 1004 GLU B OE2 1 
ATOM   4188 N N   . MET B 1 129 ? 34.335  22.744  70.778  1.00 60.20  ?  1005 MET B N   1 
ATOM   4189 C CA  . MET B 1 129 ? 33.409  21.783  71.377  1.00 50.75  ?  1005 MET B CA  1 
ATOM   4190 C C   . MET B 1 129 ? 32.646  22.417  72.539  1.00 55.04  ?  1005 MET B C   1 
ATOM   4191 O O   . MET B 1 129 ? 31.406  22.394  72.587  1.00 54.73  ?  1005 MET B O   1 
ATOM   4192 C CB  . MET B 1 129 ? 34.195  20.554  71.852  1.00 46.59  ?  1005 MET B CB  1 
ATOM   4193 C CG  . MET B 1 129 ? 33.369  19.382  72.371  1.00 49.50  ?  1005 MET B CG  1 
ATOM   4194 S SD  . MET B 1 129 ? 34.421  18.071  73.046  1.00 58.43  ?  1005 MET B SD  1 
ATOM   4195 C CE  . MET B 1 129 ? 33.236  16.750  73.265  1.00 54.89  ?  1005 MET B CE  1 
ATOM   4196 N N   . LEU B 1 130 ? 33.381  23.022  73.473  1.00 60.37  ?  1006 LEU B N   1 
ATOM   4197 C CA  . LEU B 1 130 ? 32.761  23.630  74.643  1.00 56.44  ?  1006 LEU B CA  1 
ATOM   4198 C C   . LEU B 1 130 ? 31.966  24.880  74.296  1.00 57.56  ?  1006 LEU B C   1 
ATOM   4199 O O   . LEU B 1 130 ? 30.952  25.153  74.940  1.00 69.92  ?  1006 LEU B O   1 
ATOM   4200 C CB  . LEU B 1 130 ? 33.821  23.962  75.689  1.00 57.38  ?  1006 LEU B CB  1 
ATOM   4201 C CG  . LEU B 1 130 ? 34.329  22.799  76.543  1.00 64.52  ?  1006 LEU B CG  1 
ATOM   4202 C CD1 . LEU B 1 130 ? 35.415  23.290  77.474  1.00 62.90  ?  1006 LEU B CD1 1 
ATOM   4203 C CD2 . LEU B 1 130 ? 33.197  22.159  77.335  1.00 63.90  ?  1006 LEU B CD2 1 
ATOM   4204 N N   . ARG B 1 131 ? 32.400  25.667  73.309  1.00 53.65  ?  1007 ARG B N   1 
ATOM   4205 C CA  . ARG B 1 131 ? 31.581  26.808  72.918  1.00 47.31  ?  1007 ARG B CA  1 
ATOM   4206 C C   . ARG B 1 131 ? 30.280  26.370  72.263  1.00 42.87  ?  1007 ARG B C   1 
ATOM   4207 O O   . ARG B 1 131 ? 29.295  27.113  72.299  1.00 42.32  ?  1007 ARG B O   1 
ATOM   4208 C CB  . ARG B 1 131 ? 32.361  27.728  71.979  1.00 46.06  ?  1007 ARG B CB  1 
ATOM   4209 N N   . ILE B 1 132 ? 30.247  25.177  71.678  1.00 53.72  ?  1008 ILE B N   1 
ATOM   4210 C CA  . ILE B 1 132 ? 28.973  24.652  71.201  1.00 55.07  ?  1008 ILE B CA  1 
ATOM   4211 C C   . ILE B 1 132 ? 28.111  24.210  72.377  1.00 57.72  ?  1008 ILE B C   1 
ATOM   4212 O O   . ILE B 1 132 ? 26.923  24.539  72.455  1.00 73.93  ?  1008 ILE B O   1 
ATOM   4213 C CB  . ILE B 1 132 ? 29.182  23.500  70.198  1.00 59.14  ?  1008 ILE B CB  1 
ATOM   4214 C CG1 . ILE B 1 132 ? 29.942  23.982  68.968  1.00 60.67  ?  1008 ILE B CG1 1 
ATOM   4215 C CG2 . ILE B 1 132 ? 27.839  22.944  69.766  1.00 61.57  ?  1008 ILE B CG2 1 
ATOM   4216 C CD1 . ILE B 1 132 ? 29.245  25.085  68.221  1.00 73.54  ?  1008 ILE B CD1 1 
ATOM   4217 N N   . ASP B 1 133 ? 28.696  23.465  73.315  1.00 50.85  ?  1009 ASP B N   1 
ATOM   4218 C CA  . ASP B 1 133 ? 27.886  22.848  74.367  1.00 52.85  ?  1009 ASP B CA  1 
ATOM   4219 C C   . ASP B 1 133 ? 27.423  23.863  75.413  1.00 53.09  ?  1009 ASP B C   1 
ATOM   4220 O O   . ASP B 1 133 ? 26.259  23.847  75.831  1.00 64.94  ?  1009 ASP B O   1 
ATOM   4221 C CB  . ASP B 1 133 ? 28.667  21.709  75.016  1.00 54.97  ?  1009 ASP B CB  1 
ATOM   4222 C CG  . ASP B 1 133 ? 28.765  20.500  74.115  1.00 69.90  ?  1009 ASP B CG  1 
ATOM   4223 O OD1 . ASP B 1 133 ? 27.939  20.377  73.185  1.00 71.54  ?  1009 ASP B OD1 1 
ATOM   4224 O OD2 . ASP B 1 133 ? 29.656  19.659  74.345  1.00 62.50  -1 1009 ASP B OD2 1 
ATOM   4225 N N   . GLU B 1 134 ? 28.321  24.745  75.855  1.00 54.96  ?  1010 GLU B N   1 
ATOM   4226 C CA  . GLU B 1 134 ? 28.075  25.640  76.982  1.00 50.33  ?  1010 GLU B CA  1 
ATOM   4227 C C   . GLU B 1 134 ? 27.453  26.977  76.593  1.00 56.99  ?  1010 GLU B C   1 
ATOM   4228 O O   . GLU B 1 134 ? 26.849  27.631  77.452  1.00 67.92  ?  1010 GLU B O   1 
ATOM   4229 C CB  . GLU B 1 134 ? 29.384  25.909  77.738  1.00 63.48  ?  1010 GLU B CB  1 
ATOM   4230 C CG  . GLU B 1 134 ? 30.002  24.687  78.393  1.00 77.74  ?  1010 GLU B CG  1 
ATOM   4231 C CD  . GLU B 1 134 ? 29.269  24.255  79.651  1.00 97.46  ?  1010 GLU B CD  1 
ATOM   4232 O OE1 . GLU B 1 134 ? 28.394  25.008  80.127  1.00 120.05 ?  1010 GLU B OE1 1 
ATOM   4233 O OE2 . GLU B 1 134 ? 29.568  23.157  80.166  1.00 115.22 -1 1010 GLU B OE2 1 
ATOM   4234 N N   . GLY B 1 135 ? 27.607  27.414  75.344  1.00 51.69  ?  1011 GLY B N   1 
ATOM   4235 C CA  . GLY B 1 135 ? 27.041  28.675  74.913  1.00 61.40  ?  1011 GLY B CA  1 
ATOM   4236 C C   . GLY B 1 135 ? 27.822  29.872  75.425  1.00 63.29  ?  1011 GLY B C   1 
ATOM   4237 O O   . GLY B 1 135 ? 28.830  29.758  76.124  1.00 60.32  ?  1011 GLY B O   1 
ATOM   4238 N N   . LEU B 1 136 ? 27.338  31.055  75.054  1.00 62.89  ?  1012 LEU B N   1 
ATOM   4239 C CA  . LEU B 1 136 ? 27.954  32.319  75.441  1.00 78.48  ?  1012 LEU B CA  1 
ATOM   4240 C C   . LEU B 1 136 ? 26.929  33.231  76.103  1.00 78.66  ?  1012 LEU B C   1 
ATOM   4241 O O   . LEU B 1 136 ? 25.834  33.442  75.568  1.00 77.78  ?  1012 LEU B O   1 
ATOM   4242 C CB  . LEU B 1 136 ? 28.577  33.021  74.231  1.00 84.97  ?  1012 LEU B CB  1 
ATOM   4243 C CG  . LEU B 1 136 ? 29.220  34.376  74.539  1.00 98.47  ?  1012 LEU B CG  1 
ATOM   4244 C CD1 . LEU B 1 136 ? 30.336  34.221  75.565  1.00 98.88  ?  1012 LEU B CD1 1 
ATOM   4245 C CD2 . LEU B 1 136 ? 29.738  35.034  73.267  1.00 86.83  ?  1012 LEU B CD2 1 
ATOM   4246 N N   . ARG B 1 137 ? 27.298  33.782  77.259  1.00 72.70  ?  1013 ARG B N   1 
ATOM   4247 C CA  . ARG B 1 137 ? 26.466  34.714  78.005  1.00 76.05  ?  1013 ARG B CA  1 
ATOM   4248 C C   . ARG B 1 137 ? 27.208  36.031  78.177  1.00 79.92  ?  1013 ARG B C   1 
ATOM   4249 O O   . ARG B 1 137 ? 28.400  36.045  78.505  1.00 77.68  ?  1013 ARG B O   1 
ATOM   4250 C CB  . ARG B 1 137 ? 26.091  34.164  79.387  1.00 81.84  ?  1013 ARG B CB  1 
ATOM   4251 C CG  . ARG B 1 137 ? 25.099  33.024  79.379  1.00 73.25  ?  1013 ARG B CG  1 
ATOM   4252 C CD  . ARG B 1 137 ? 24.679  32.699  80.798  1.00 79.96  ?  1013 ARG B CD  1 
ATOM   4253 N NE  . ARG B 1 137 ? 23.787  31.546  80.863  1.00 73.38  ?  1013 ARG B NE  1 
ATOM   4254 C CZ  . ARG B 1 137 ? 22.471  31.609  80.686  1.00 77.78  ?  1013 ARG B CZ  1 
ATOM   4255 N NH1 . ARG B 1 137 ? 21.892  32.772  80.424  1.00 75.63  ?  1013 ARG B NH1 1 
ATOM   4256 N NH2 . ARG B 1 137 ? 21.734  30.509  80.766  1.00 85.23  ?  1013 ARG B NH2 1 
ATOM   4257 N N   . LEU B 1 138 ? 26.495  37.137  77.967  1.00 87.23  ?  1014 LEU B N   1 
ATOM   4258 C CA  . LEU B 1 138 ? 27.080  38.467  78.097  1.00 98.29  ?  1014 LEU B CA  1 
ATOM   4259 C C   . LEU B 1 138 ? 26.893  39.045  79.497  1.00 102.19 ?  1014 LEU B C   1 
ATOM   4260 O O   . LEU B 1 138 ? 27.782  39.736  80.008  1.00 90.55  ?  1014 LEU B O   1 
ATOM   4261 C CB  . LEU B 1 138 ? 26.466  39.411  77.059  1.00 114.82 ?  1014 LEU B CB  1 
ATOM   4262 C CG  . LEU B 1 138 ? 27.273  40.646  76.654  1.00 128.37 ?  1014 LEU B CG  1 
ATOM   4263 C CD1 . LEU B 1 138 ? 28.447  40.243  75.778  1.00 119.19 ?  1014 LEU B CD1 1 
ATOM   4264 C CD2 . LEU B 1 138 ? 26.386  41.653  75.938  1.00 130.24 ?  1014 LEU B CD2 1 
ATOM   4265 N N   . LYS B 1 139 ? 25.752  38.778  80.126  1.00 111.36 ?  1015 LYS B N   1 
ATOM   4266 C CA  . LYS B 1 139 ? 25.436  39.283  81.452  1.00 99.66  ?  1015 LYS B CA  1 
ATOM   4267 C C   . LYS B 1 139 ? 25.357  38.133  82.449  1.00 106.63 ?  1015 LYS B C   1 
ATOM   4268 O O   . LYS B 1 139 ? 25.229  36.964  82.076  1.00 125.48 ?  1015 LYS B O   1 
ATOM   4269 C CB  . LYS B 1 139 ? 24.112  40.055  81.442  1.00 90.00  ?  1015 LYS B CB  1 
ATOM   4270 C CG  . LYS B 1 139 ? 24.009  41.124  80.363  1.00 93.90  ?  1015 LYS B CG  1 
ATOM   4271 C CD  . LYS B 1 139 ? 22.640  41.789  80.384  1.00 113.81 ?  1015 LYS B CD  1 
ATOM   4272 C CE  . LYS B 1 139 ? 22.603  43.017  79.490  1.00 126.89 ?  1015 LYS B CE  1 
ATOM   4273 N NZ  . LYS B 1 139 ? 21.342  43.787  79.665  1.00 134.64 ?  1015 LYS B NZ  1 
ATOM   4274 N N   . ILE B 1 140 ? 25.435  38.484  83.734  1.00 101.24 ?  1016 ILE B N   1 
ATOM   4275 C CA  . ILE B 1 140 ? 25.338  37.479  84.785  1.00 111.28 ?  1016 ILE B CA  1 
ATOM   4276 C C   . ILE B 1 140 ? 23.939  36.880  84.789  1.00 112.13 ?  1016 ILE B C   1 
ATOM   4277 O O   . ILE B 1 140 ? 22.936  37.588  84.633  1.00 123.47 ?  1016 ILE B O   1 
ATOM   4278 C CB  . ILE B 1 140 ? 25.687  38.089  86.154  1.00 112.09 ?  1016 ILE B CB  1 
ATOM   4279 C CG1 . ILE B 1 140 ? 27.096  38.685  86.135  1.00 114.66 ?  1016 ILE B CG1 1 
ATOM   4280 C CG2 . ILE B 1 140 ? 25.579  37.039  87.258  1.00 100.76 ?  1016 ILE B CG2 1 
ATOM   4281 C CD1 . ILE B 1 140 ? 27.520  39.280  87.464  1.00 137.44 ?  1016 ILE B CD1 1 
ATOM   4282 N N   . TYR B 1 141 ? 23.867  35.561  84.963  1.00 91.53  ?  1017 TYR B N   1 
ATOM   4283 C CA  . TYR B 1 141 ? 22.598  34.849  84.989  1.00 81.84  ?  1017 TYR B CA  1 
ATOM   4284 C C   . TYR B 1 141 ? 22.615  33.792  86.085  1.00 83.26  ?  1017 TYR B C   1 
ATOM   4285 O O   . TYR B 1 141 ? 23.619  33.100  86.276  1.00 77.77  ?  1017 TYR B O   1 
ATOM   4286 C CB  . TYR B 1 141 ? 22.302  34.192  83.636  1.00 68.41  ?  1017 TYR B CB  1 
ATOM   4287 C CG  . TYR B 1 141 ? 20.973  33.475  83.571  1.00 79.03  ?  1017 TYR B CG  1 
ATOM   4288 C CD1 . TYR B 1 141 ? 19.788  34.180  83.397  1.00 86.49  ?  1017 TYR B CD1 1 
ATOM   4289 C CD2 . TYR B 1 141 ? 20.903  32.091  83.669  1.00 84.64  ?  1017 TYR B CD2 1 
ATOM   4290 C CE1 . TYR B 1 141 ? 18.571  33.526  83.332  1.00 93.48  ?  1017 TYR B CE1 1 
ATOM   4291 C CE2 . TYR B 1 141 ? 19.689  31.430  83.606  1.00 88.38  ?  1017 TYR B CE2 1 
ATOM   4292 C CZ  . TYR B 1 141 ? 18.526  32.152  83.436  1.00 101.27 ?  1017 TYR B CZ  1 
ATOM   4293 O OH  . TYR B 1 141 ? 17.314  31.502  83.371  1.00 106.62 ?  1017 TYR B OH  1 
ATOM   4294 N N   . LYS B 1 142 ? 21.495  33.670  86.795  1.00 81.55  ?  1018 LYS B N   1 
ATOM   4295 C CA  . LYS B 1 142 ? 21.334  32.665  87.841  1.00 80.41  ?  1018 LYS B CA  1 
ATOM   4296 C C   . LYS B 1 142 ? 20.722  31.414  87.217  1.00 82.26  ?  1018 LYS B C   1 
ATOM   4297 O O   . LYS B 1 142 ? 19.560  31.426  86.800  1.00 82.40  ?  1018 LYS B O   1 
ATOM   4298 C CB  . LYS B 1 142 ? 20.466  33.204  88.977  1.00 99.80  ?  1018 LYS B CB  1 
ATOM   4299 N N   . ASP B 1 143 ? 21.499  30.336  87.163  1.00 87.56  ?  1019 ASP B N   1 
ATOM   4300 C CA  . ASP B 1 143 ? 21.084  29.114  86.493  1.00 97.19  ?  1019 ASP B CA  1 
ATOM   4301 C C   . ASP B 1 143 ? 20.166  28.278  87.391  1.00 95.77  ?  1019 ASP B C   1 
ATOM   4302 O O   . ASP B 1 143 ? 19.981  28.557  88.581  1.00 92.47  ?  1019 ASP B O   1 
ATOM   4303 C CB  . ASP B 1 143 ? 22.314  28.313  86.060  1.00 114.25 ?  1019 ASP B CB  1 
ATOM   4304 C CG  . ASP B 1 143 ? 22.035  27.402  84.883  1.00 128.61 ?  1019 ASP B CG  1 
ATOM   4305 O OD1 . ASP B 1 143 ? 20.856  27.276  84.494  1.00 139.63 ?  1019 ASP B OD1 1 
ATOM   4306 O OD2 . ASP B 1 143 ? 22.993  26.814  84.340  1.00 124.72 -1 1019 ASP B OD2 1 
ATOM   4307 N N   . THR B 1 144 ? 19.589  27.231  86.788  1.00 96.88  ?  1020 THR B N   1 
ATOM   4308 C CA  . THR B 1 144 ? 18.554  26.436  87.448  1.00 81.21  ?  1020 THR B CA  1 
ATOM   4309 C C   . THR B 1 144 ? 19.008  25.885  88.796  1.00 86.17  ?  1020 THR B C   1 
ATOM   4310 O O   . THR B 1 144 ? 18.202  25.749  89.725  1.00 103.86 ?  1020 THR B O   1 
ATOM   4311 C CB  . THR B 1 144 ? 18.112  25.294  86.528  1.00 60.51  ?  1020 THR B CB  1 
ATOM   4312 N N   . GLU B 1 145 ? 20.290  25.570  88.924  1.00 89.91  ?  1021 GLU B N   1 
ATOM   4313 C CA  . GLU B 1 145 ? 20.794  24.885  90.105  1.00 80.90  ?  1021 GLU B CA  1 
ATOM   4314 C C   . GLU B 1 145 ? 21.090  25.827  91.265  1.00 80.89  ?  1021 GLU B C   1 
ATOM   4315 O O   . GLU B 1 145 ? 21.317  25.355  92.386  1.00 82.01  ?  1021 GLU B O   1 
ATOM   4316 C CB  . GLU B 1 145 ? 22.061  24.093  89.755  1.00 92.01  ?  1021 GLU B CB  1 
ATOM   4317 C CG  . GLU B 1 145 ? 21.921  23.189  88.540  1.00 102.61 ?  1021 GLU B CG  1 
ATOM   4318 C CD  . GLU B 1 145 ? 22.076  23.938  87.230  1.00 108.54 ?  1021 GLU B CD  1 
ATOM   4319 O OE1 . GLU B 1 145 ? 22.791  24.963  87.213  1.00 117.13 ?  1021 GLU B OE1 1 
ATOM   4320 O OE2 . GLU B 1 145 ? 21.469  23.520  86.225  1.00 85.90  -1 1021 GLU B OE2 1 
ATOM   4321 N N   . GLY B 1 146 ? 21.081  27.135  91.030  1.00 84.31  ?  1022 GLY B N   1 
ATOM   4322 C CA  . GLY B 1 146 ? 21.392  28.118  92.046  1.00 73.34  ?  1022 GLY B CA  1 
ATOM   4323 C C   . GLY B 1 146 ? 22.719  28.810  91.845  1.00 84.30  ?  1022 GLY B C   1 
ATOM   4324 O O   . GLY B 1 146 ? 23.030  29.745  92.593  1.00 94.04  ?  1022 GLY B O   1 
ATOM   4325 N N   . TYR B 1 147 ? 23.512  28.380  90.866  1.00 105.01 ?  1023 TYR B N   1 
ATOM   4326 C CA  . TYR B 1 147 ? 24.820  28.966  90.608  1.00 107.63 ?  1023 TYR B CA  1 
ATOM   4327 C C   . TYR B 1 147 ? 24.706  30.111  89.608  1.00 90.57  ?  1023 TYR B C   1 
ATOM   4328 O O   . TYR B 1 147 ? 23.968  30.020  88.624  1.00 83.81  ?  1023 TYR B O   1 
ATOM   4329 C CB  . TYR B 1 147 ? 25.793  27.909  90.078  1.00 114.17 ?  1023 TYR B CB  1 
ATOM   4330 C CG  . TYR B 1 147 ? 26.005  26.712  90.984  1.00 113.45 ?  1023 TYR B CG  1 
ATOM   4331 C CD1 . TYR B 1 147 ? 25.169  25.603  90.916  1.00 123.06 ?  1023 TYR B CD1 1 
ATOM   4332 C CD2 . TYR B 1 147 ? 27.057  26.681  91.891  1.00 111.05 ?  1023 TYR B CD2 1 
ATOM   4333 C CE1 . TYR B 1 147 ? 25.366  24.503  91.738  1.00 124.73 ?  1023 TYR B CE1 1 
ATOM   4334 C CE2 . TYR B 1 147 ? 27.260  25.587  92.715  1.00 93.80  ?  1023 TYR B CE2 1 
ATOM   4335 C CZ  . TYR B 1 147 ? 26.414  24.501  92.635  1.00 113.78 ?  1023 TYR B CZ  1 
ATOM   4336 O OH  . TYR B 1 147 ? 26.619  23.414  93.454  1.00 124.65 ?  1023 TYR B OH  1 
ATOM   4337 N N   . TYR B 1 148 ? 25.438  31.193  89.873  1.00 80.79  ?  1024 TYR B N   1 
ATOM   4338 C CA  . TYR B 1 148 ? 25.515  32.328  88.959  1.00 81.44  ?  1024 TYR B CA  1 
ATOM   4339 C C   . TYR B 1 148 ? 26.601  32.073  87.919  1.00 86.06  ?  1024 TYR B C   1 
ATOM   4340 O O   . TYR B 1 148 ? 27.723  31.693  88.267  1.00 85.27  ?  1024 TYR B O   1 
ATOM   4341 C CB  . TYR B 1 148 ? 25.811  33.623  89.719  1.00 98.66  ?  1024 TYR B CB  1 
ATOM   4342 C CG  . TYR B 1 148 ? 24.632  34.212  90.469  1.00 127.72 ?  1024 TYR B CG  1 
ATOM   4343 C CD1 . TYR B 1 148 ? 24.411  33.911  91.809  1.00 148.61 ?  1024 TYR B CD1 1 
ATOM   4344 C CD2 . TYR B 1 148 ? 23.750  35.083  89.841  1.00 131.67 ?  1024 TYR B CD2 1 
ATOM   4345 C CE1 . TYR B 1 148 ? 23.338  34.455  92.499  1.00 149.93 ?  1024 TYR B CE1 1 
ATOM   4346 C CE2 . TYR B 1 148 ? 22.677  35.631  90.523  1.00 137.35 ?  1024 TYR B CE2 1 
ATOM   4347 C CZ  . TYR B 1 148 ? 22.474  35.314  91.851  1.00 144.87 ?  1024 TYR B CZ  1 
ATOM   4348 O OH  . TYR B 1 148 ? 21.406  35.858  92.528  1.00 153.31 ?  1024 TYR B OH  1 
ATOM   4349 N N   . THR B 1 149 ? 26.271  32.291  86.646  1.00 79.47  ?  1025 THR B N   1 
ATOM   4350 C CA  . THR B 1 149 ? 27.173  31.977  85.547  1.00 79.24  ?  1025 THR B CA  1 
ATOM   4351 C C   . THR B 1 149 ? 27.273  33.157  84.590  1.00 85.41  ?  1025 THR B C   1 
ATOM   4352 O O   . THR B 1 149 ? 26.418  34.046  84.571  1.00 93.74  ?  1025 THR B O   1 
ATOM   4353 C CB  . THR B 1 149 ? 26.714  30.729  84.781  1.00 82.02  ?  1025 THR B CB  1 
ATOM   4354 O OG1 . THR B 1 149 ? 27.646  30.448  83.729  1.00 91.84  ?  1025 THR B OG1 1 
ATOM   4355 C CG2 . THR B 1 149 ? 25.340  30.953  84.182  1.00 92.43  ?  1025 THR B CG2 1 
ATOM   4356 N N   . ILE B 1 150 ? 28.349  33.156  83.800  1.00 86.82  ?  1026 ILE B N   1 
ATOM   4357 C CA  . ILE B 1 150 ? 28.592  34.173  82.781  1.00 94.62  ?  1026 ILE B CA  1 
ATOM   4358 C C   . ILE B 1 150 ? 29.650  33.651  81.816  1.00 95.83  ?  1026 ILE B C   1 
ATOM   4359 O O   . ILE B 1 150 ? 30.386  32.712  82.138  1.00 103.19 ?  1026 ILE B O   1 
ATOM   4360 C CB  . ILE B 1 150 ? 29.019  35.512  83.410  1.00 98.86  ?  1026 ILE B CB  1 
ATOM   4361 C CG1 . ILE B 1 150 ? 28.812  36.662  82.418  1.00 100.34 ?  1026 ILE B CG1 1 
ATOM   4362 C CG2 . ILE B 1 150 ? 30.465  35.438  83.882  1.00 92.37  ?  1026 ILE B CG2 1 
ATOM   4363 C CD1 . ILE B 1 150 ? 29.047  38.027  83.010  1.00 123.56 ?  1026 ILE B CD1 1 
ATOM   4364 N N   . GLY B 1 151 ? 29.718  34.234  80.620  1.00 86.23  ?  1027 GLY B N   1 
ATOM   4365 C CA  . GLY B 1 151 ? 30.771  33.868  79.683  1.00 82.59  ?  1027 GLY B CA  1 
ATOM   4366 C C   . GLY B 1 151 ? 30.493  32.531  79.023  1.00 69.03  ?  1027 GLY B C   1 
ATOM   4367 O O   . GLY B 1 151 ? 29.367  32.238  78.605  1.00 79.07  ?  1027 GLY B O   1 
ATOM   4368 N N   . ILE B 1 152 ? 31.531  31.704  78.920  1.00 64.23  ?  1028 ILE B N   1 
ATOM   4369 C CA  . ILE B 1 152 ? 31.361  30.361  78.378  1.00 74.92  ?  1028 ILE B CA  1 
ATOM   4370 C C   . ILE B 1 152 ? 31.445  29.367  79.529  1.00 85.91  ?  1028 ILE B C   1 
ATOM   4371 O O   . ILE B 1 152 ? 32.526  28.875  79.871  1.00 72.85  ?  1028 ILE B O   1 
ATOM   4372 C CB  . ILE B 1 152 ? 32.402  30.045  77.285  1.00 83.33  ?  1028 ILE B CB  1 
ATOM   4373 C CG1 . ILE B 1 152 ? 32.382  31.107  76.180  1.00 94.87  ?  1028 ILE B CG1 1 
ATOM   4374 C CG2 . ILE B 1 152 ? 32.146  28.675  76.680  1.00 96.12  ?  1028 ILE B CG2 1 
ATOM   4375 C CD1 . ILE B 1 152 ? 33.398  32.219  76.373  1.00 92.96  ?  1028 ILE B CD1 1 
ATOM   4376 N N   . GLY B 1 153 ? 30.293  29.067  80.125  1.00 85.83  ?  1029 GLY B N   1 
ATOM   4377 C CA  . GLY B 1 153 ? 30.221  28.100  81.205  1.00 76.80  ?  1029 GLY B CA  1 
ATOM   4378 C C   . GLY B 1 153 ? 31.046  28.436  82.428  1.00 72.23  ?  1029 GLY B C   1 
ATOM   4379 O O   . GLY B 1 153 ? 31.527  27.522  83.105  1.00 91.61  ?  1029 GLY B O   1 
ATOM   4380 N N   . HIS B 1 154 ? 31.216  29.720  82.746  1.00 72.43  ?  1030 HIS B N   1 
ATOM   4381 C CA  . HIS B 1 154 ? 31.999  30.131  83.914  1.00 84.10  ?  1030 HIS B CA  1 
ATOM   4382 C C   . HIS B 1 154 ? 31.068  30.295  85.111  1.00 84.31  ?  1030 HIS B C   1 
ATOM   4383 O O   . HIS B 1 154 ? 30.409  31.324  85.263  1.00 91.29  ?  1030 HIS B O   1 
ATOM   4384 C CB  . HIS B 1 154 ? 32.775  31.417  83.641  1.00 83.99  ?  1030 HIS B CB  1 
ATOM   4385 C CG  . HIS B 1 154 ? 33.698  31.801  84.756  1.00 85.07  ?  1030 HIS B CG  1 
ATOM   4386 N ND1 . HIS B 1 154 ? 34.907  31.176  84.967  1.00 80.03  ?  1030 HIS B ND1 1 
ATOM   4387 C CD2 . HIS B 1 154 ? 33.577  32.725  85.739  1.00 85.21  ?  1030 HIS B CD2 1 
ATOM   4388 C CE1 . HIS B 1 154 ? 35.500  31.707  86.022  1.00 76.79  ?  1030 HIS B CE1 1 
ATOM   4389 N NE2 . HIS B 1 154 ? 34.713  32.648  86.509  1.00 80.77  ?  1030 HIS B NE2 1 
ATOM   4390 N N   . LEU B 1 155 ? 31.016  29.279  85.969  1.00 81.40  ?  1031 LEU B N   1 
ATOM   4391 C CA  . LEU B 1 155 ? 30.199  29.333  87.175  1.00 85.66  ?  1031 LEU B CA  1 
ATOM   4392 C C   . LEU B 1 155 ? 30.928  30.079  88.285  1.00 79.77  ?  1031 LEU B C   1 
ATOM   4393 O O   . LEU B 1 155 ? 32.126  29.874  88.499  1.00 84.12  ?  1031 LEU B O   1 
ATOM   4394 C CB  . LEU B 1 155 ? 29.852  27.919  87.644  1.00 74.55  ?  1031 LEU B CB  1 
ATOM   4395 C CG  . LEU B 1 155 ? 28.647  27.219  87.008  1.00 78.25  ?  1031 LEU B CG  1 
ATOM   4396 C CD1 . LEU B 1 155 ? 28.877  26.945  85.528  1.00 78.32  ?  1031 LEU B CD1 1 
ATOM   4397 C CD2 . LEU B 1 155 ? 28.352  25.933  87.756  1.00 76.54  ?  1031 LEU B CD2 1 
ATOM   4398 N N   . LEU B 1 156 ? 30.211  30.965  88.984  1.00 84.13  ?  1032 LEU B N   1 
ATOM   4399 C CA  . LEU B 1 156 ? 30.891  31.716  90.033  1.00 102.61 ?  1032 LEU B CA  1 
ATOM   4400 C C   . LEU B 1 156 ? 30.694  31.160  91.438  1.00 117.79 ?  1032 LEU B C   1 
ATOM   4401 O O   . LEU B 1 156 ? 31.598  30.522  91.990  1.00 140.27 ?  1032 LEU B O   1 
ATOM   4402 C CB  . LEU B 1 156 ? 30.417  33.171  90.013  1.00 99.62  ?  1032 LEU B CB  1 
ATOM   4403 C CG  . LEU B 1 156 ? 30.590  33.909  88.687  1.00 82.82  ?  1032 LEU B CG  1 
ATOM   4404 C CD1 . LEU B 1 156 ? 29.720  35.151  88.659  1.00 74.47  ?  1032 LEU B CD1 1 
ATOM   4405 C CD2 . LEU B 1 156 ? 32.046  34.269  88.486  1.00 78.72  ?  1032 LEU B CD2 1 
ATOM   4406 N N   . THR B 1 157 ? 29.497  31.346  91.994  1.00 137.04 ?  1033 THR B N   1 
ATOM   4407 C CA  . THR B 1 157 ? 29.209  30.986  93.376  1.00 173.20 ?  1033 THR B CA  1 
ATOM   4408 C C   . THR B 1 157 ? 27.726  30.688  93.519  1.00 188.63 ?  1033 THR B C   1 
ATOM   4409 O O   . THR B 1 157 ? 26.884  31.372  92.934  1.00 183.26 ?  1033 THR B O   1 
ATOM   4410 C CB  . THR B 1 157 ? 29.590  32.101  94.375  1.00 162.90 ?  1033 THR B CB  1 
ATOM   4411 O OG1 . THR B 1 157 ? 30.819  32.719  93.976  1.00 156.98 ?  1033 THR B OG1 1 
ATOM   4412 C CG2 . THR B 1 157 ? 29.751  31.528  95.778  1.00 136.44 ?  1033 THR B CG2 1 
ATOM   4413 N N   . LYS B 1 158 ? 27.411  29.680  94.331  1.00 182.01 ?  1034 LYS B N   1 
ATOM   4414 C CA  . LYS B 1 158 ? 26.020  29.340  94.593  1.00 154.81 ?  1034 LYS B CA  1 
ATOM   4415 C C   . LYS B 1 158 ? 25.347  30.319  95.547  1.00 174.18 ?  1034 LYS B C   1 
ATOM   4416 O O   . LYS B 1 158 ? 24.122  30.264  95.701  1.00 195.38 ?  1034 LYS B O   1 
ATOM   4417 C CB  . LYS B 1 158 ? 25.930  27.916  95.148  1.00 119.28 ?  1034 LYS B CB  1 
ATOM   4418 C CG  . LYS B 1 158 ? 24.543  27.300  95.087  1.00 87.92  ?  1034 LYS B CG  1 
ATOM   4419 C CD  . LYS B 1 158 ? 24.574  25.837  95.489  1.00 108.04 ?  1034 LYS B CD  1 
ATOM   4420 C CE  . LYS B 1 158 ? 23.215  25.175  95.317  1.00 119.79 ?  1034 LYS B CE  1 
ATOM   4421 N NZ  . LYS B 1 158 ? 22.248  25.541  96.393  1.00 138.71 ?  1034 LYS B NZ  1 
ATOM   4422 N N   . SER B 1 159 ? 26.111  31.210  96.176  1.00 180.70 ?  1035 SER B N   1 
ATOM   4423 C CA  . SER B 1 159 ? 25.577  32.185  97.114  1.00 161.95 ?  1035 SER B CA  1 
ATOM   4424 C C   . SER B 1 159 ? 24.452  32.988  96.462  1.00 155.47 ?  1035 SER B C   1 
ATOM   4425 O O   . SER B 1 159 ? 24.697  33.689  95.469  1.00 138.16 ?  1035 SER B O   1 
ATOM   4426 C CB  . SER B 1 159 ? 26.684  33.122  97.591  1.00 156.85 ?  1035 SER B CB  1 
ATOM   4427 O OG  . SER B 1 159 ? 27.723  32.400  98.225  1.00 154.12 ?  1035 SER B OG  1 
ATOM   4428 N N   . PRO B 1 160 ? 23.222  32.908  96.976  1.00 171.71 ?  1036 PRO B N   1 
ATOM   4429 C CA  . PRO B 1 160 ? 22.111  33.637  96.349  1.00 177.48 ?  1036 PRO B CA  1 
ATOM   4430 C C   . PRO B 1 160 ? 22.205  35.138  96.575  1.00 172.69 ?  1036 PRO B C   1 
ATOM   4431 O O   . PRO B 1 160 ? 21.420  35.702  97.345  1.00 166.88 ?  1036 PRO B O   1 
ATOM   4432 C CB  . PRO B 1 160 ? 20.875  33.038  97.033  1.00 189.87 ?  1036 PRO B CB  1 
ATOM   4433 C CG  . PRO B 1 160 ? 21.373  32.605  98.376  1.00 185.68 ?  1036 PRO B CG  1 
ATOM   4434 C CD  . PRO B 1 160 ? 22.788  32.135  98.153  1.00 175.81 ?  1036 PRO B CD  1 
ATOM   4435 N N   . SER B 1 161 ? 23.157  35.795  95.904  1.00 171.98 ?  1037 SER B N   1 
ATOM   4436 C CA  . SER B 1 161 ? 23.384  37.227  96.108  1.00 161.11 ?  1037 SER B CA  1 
ATOM   4437 C C   . SER B 1 161 ? 24.005  37.798  94.832  1.00 148.53 ?  1037 SER B C   1 
ATOM   4438 O O   . SER B 1 161 ? 25.188  37.571  94.563  1.00 144.10 ?  1037 SER B O   1 
ATOM   4439 C CB  . SER B 1 161 ? 24.269  37.469  97.319  1.00 165.23 ?  1037 SER B CB  1 
ATOM   4440 O OG  . SER B 1 161 ? 25.426  36.654  97.264  1.00 180.13 ?  1037 SER B OG  1 
ATOM   4441 N N   . LEU B 1 162 ? 23.195  38.531  94.062  1.00 142.70 ?  1038 LEU B N   1 
ATOM   4442 C CA  . LEU B 1 162 ? 23.676  39.119  92.816  1.00 130.93 ?  1038 LEU B CA  1 
ATOM   4443 C C   . LEU B 1 162 ? 24.772  40.141  93.075  1.00 138.24 ?  1038 LEU B C   1 
ATOM   4444 O O   . LEU B 1 162 ? 25.709  40.267  92.278  1.00 140.13 ?  1038 LEU B O   1 
ATOM   4445 C CB  . LEU B 1 162 ? 22.507  39.763  92.065  1.00 110.14 ?  1038 LEU B CB  1 
ATOM   4446 C CG  . LEU B 1 162 ? 22.722  40.327  90.659  1.00 105.76 ?  1038 LEU B CG  1 
ATOM   4447 C CD1 . LEU B 1 162 ? 23.266  39.272  89.711  1.00 112.43 ?  1038 LEU B CD1 1 
ATOM   4448 C CD2 . LEU B 1 162 ? 21.413  40.887  90.128  1.00 101.38 ?  1038 LEU B CD2 1 
ATOM   4449 N N   . ASN B 1 163 ? 24.684  40.856  94.199  1.00 147.75 ?  1039 ASN B N   1 
ATOM   4450 C CA  . ASN B 1 163 ? 25.711  41.829  94.561  1.00 151.23 ?  1039 ASN B CA  1 
ATOM   4451 C C   . ASN B 1 163 ? 27.050  41.141  94.797  1.00 137.76 ?  1039 ASN B C   1 
ATOM   4452 O O   . ASN B 1 163 ? 28.072  41.520  94.203  1.00 136.55 ?  1039 ASN B O   1 
ATOM   4453 C CB  . ASN B 1 163 ? 25.254  42.592  95.810  1.00 170.76 ?  1039 ASN B CB  1 
ATOM   4454 C CG  . ASN B 1 163 ? 26.050  43.863  96.067  1.00 175.14 ?  1039 ASN B CG  1 
ATOM   4455 O OD1 . ASN B 1 163 ? 26.746  44.369  95.188  1.00 159.74 ?  1039 ASN B OD1 1 
ATOM   4456 N ND2 . ASN B 1 163 ? 25.937  44.391  97.285  1.00 191.05 ?  1039 ASN B ND2 1 
ATOM   4457 N N   . ALA B 1 164 ? 27.050  40.094  95.624  1.00 132.08 ?  1040 ALA B N   1 
ATOM   4458 C CA  . ALA B 1 164 ? 28.275  39.353  95.887  1.00 135.75 ?  1040 ALA B CA  1 
ATOM   4459 C C   . ALA B 1 164 ? 28.751  38.596  94.657  1.00 142.31 ?  1040 ALA B C   1 
ATOM   4460 O O   . ALA B 1 164 ? 29.957  38.410  94.483  1.00 156.70 ?  1040 ALA B O   1 
ATOM   4461 C CB  . ALA B 1 164 ? 28.070  38.381  97.051  1.00 114.82 ?  1040 ALA B CB  1 
ATOM   4462 N N   . ALA B 1 165 ? 27.839  38.179  93.779  1.00 140.01 ?  1041 ALA B N   1 
ATOM   4463 C CA  . ALA B 1 165 ? 28.271  37.527  92.548  1.00 130.32 ?  1041 ALA B CA  1 
ATOM   4464 C C   . ALA B 1 165 ? 28.981  38.510  91.624  1.00 134.20 ?  1041 ALA B C   1 
ATOM   4465 O O   . ALA B 1 165 ? 30.020  38.183  91.037  1.00 158.91 ?  1041 ALA B O   1 
ATOM   4466 C CB  . ALA B 1 165 ? 27.076  36.886  91.844  1.00 115.85 ?  1041 ALA B CB  1 
ATOM   4467 N N   . LYS B 1 166 ? 28.450  39.728  91.502  1.00 107.25 ?  1042 LYS B N   1 
ATOM   4468 C CA  . LYS B 1 166 ? 29.132  40.735  90.700  1.00 115.62 ?  1042 LYS B CA  1 
ATOM   4469 C C   . LYS B 1 166 ? 30.479  41.106  91.305  1.00 136.92 ?  1042 LYS B C   1 
ATOM   4470 O O   . LYS B 1 166 ? 31.442  41.336  90.566  1.00 158.08 ?  1042 LYS B O   1 
ATOM   4471 C CB  . LYS B 1 166 ? 28.253  41.978  90.544  1.00 90.41  ?  1042 LYS B CB  1 
ATOM   4472 N N   . SER B 1 167 ? 30.589  41.127  92.636  1.00 132.15 ?  1043 SER B N   1 
ATOM   4473 C CA  . SER B 1 167 ? 31.901  41.418  93.214  1.00 124.27 ?  1043 SER B CA  1 
ATOM   4474 C C   . SER B 1 167 ? 32.883  40.272  92.979  1.00 116.07 ?  1043 SER B C   1 
ATOM   4475 O O   . SER B 1 167 ? 34.045  40.503  92.603  1.00 119.36 ?  1043 SER B O   1 
ATOM   4476 C CB  . SER B 1 167 ? 31.773  41.713  94.708  1.00 121.66 ?  1043 SER B CB  1 
ATOM   4477 O OG  . SER B 1 167 ? 33.027  42.054  95.269  1.00 130.97 ?  1043 SER B OG  1 
ATOM   4478 N N   . GLU B 1 168 ? 32.423  39.032  93.180  1.00 133.26 ?  1044 GLU B N   1 
ATOM   4479 C CA  . GLU B 1 168 ? 33.260  37.863  92.942  1.00 150.63 ?  1044 GLU B CA  1 
ATOM   4480 C C   . GLU B 1 168 ? 33.716  37.793  91.494  1.00 149.61 ?  1044 GLU B C   1 
ATOM   4481 O O   . GLU B 1 168 ? 34.800  37.273  91.206  1.00 163.44 ?  1044 GLU B O   1 
ATOM   4482 C CB  . GLU B 1 168 ? 32.495  36.593  93.318  1.00 147.90 ?  1044 GLU B CB  1 
ATOM   4483 N N   . LEU B 1 169 ? 32.902  38.304  90.572  1.00 130.39 ?  1045 LEU B N   1 
ATOM   4484 C CA  . LEU B 1 169 ? 33.332  38.398  89.185  1.00 133.94 ?  1045 LEU B CA  1 
ATOM   4485 C C   . LEU B 1 169 ? 34.285  39.565  88.971  1.00 133.65 ?  1045 LEU B C   1 
ATOM   4486 O O   . LEU B 1 169 ? 35.192  39.475  88.136  1.00 134.40 ?  1045 LEU B O   1 
ATOM   4487 C CB  . LEU B 1 169 ? 32.113  38.533  88.273  1.00 136.36 ?  1045 LEU B CB  1 
ATOM   4488 C CG  . LEU B 1 169 ? 32.357  38.522  86.763  1.00 143.08 ?  1045 LEU B CG  1 
ATOM   4489 C CD1 . LEU B 1 169 ? 32.996  37.218  86.322  1.00 152.41 ?  1045 LEU B CD1 1 
ATOM   4490 C CD2 . LEU B 1 169 ? 31.048  38.749  86.037  1.00 142.46 ?  1045 LEU B CD2 1 
ATOM   4491 N N   . ASP B 1 170 ? 34.099  40.659  89.715  1.00 137.65 ?  1046 ASP B N   1 
ATOM   4492 C CA  . ASP B 1 170 ? 34.967  41.820  89.559  1.00 136.06 ?  1046 ASP B CA  1 
ATOM   4493 C C   . ASP B 1 170 ? 36.405  41.488  89.930  1.00 132.54 ?  1046 ASP B C   1 
ATOM   4494 O O   . ASP B 1 170 ? 37.342  41.891  89.230  1.00 122.63 ?  1046 ASP B O   1 
ATOM   4495 C CB  . ASP B 1 170 ? 34.444  42.985  90.400  1.00 128.36 ?  1046 ASP B CB  1 
ATOM   4496 N N   . LYS B 1 171 ? 36.606  40.750  91.022  1.00 132.77 ?  1047 LYS B N   1 
ATOM   4497 C CA  . LYS B 1 171 ? 37.980  40.390  91.367  1.00 137.78 ?  1047 LYS B CA  1 
ATOM   4498 C C   . LYS B 1 171 ? 38.576  39.417  90.353  1.00 136.08 ?  1047 LYS B C   1 
ATOM   4499 O O   . LYS B 1 171 ? 39.789  39.434  90.114  1.00 121.73 ?  1047 LYS B O   1 
ATOM   4500 C CB  . LYS B 1 171 ? 38.045  39.810  92.782  1.00 135.35 ?  1047 LYS B CB  1 
ATOM   4501 C CG  . LYS B 1 171 ? 39.352  39.096  93.133  1.00 121.32 ?  1047 LYS B CG  1 
ATOM   4502 C CD  . LYS B 1 171 ? 40.572  40.014  93.127  1.00 127.98 ?  1047 LYS B CD  1 
ATOM   4503 C CE  . LYS B 1 171 ? 41.828  39.235  93.506  1.00 141.69 ?  1047 LYS B CE  1 
ATOM   4504 N NZ  . LYS B 1 171 ? 43.023  39.615  92.699  1.00 134.93 ?  1047 LYS B NZ  1 
ATOM   4505 N N   . ALA B 1 172 ? 37.749  38.581  89.733  1.00 124.21 ?  1048 ALA B N   1 
ATOM   4506 C CA  . ALA B 1 172 ? 38.217  37.581  88.784  1.00 115.10 ?  1048 ALA B CA  1 
ATOM   4507 C C   . ALA B 1 172 ? 38.274  38.087  87.344  1.00 103.08 ?  1048 ALA B C   1 
ATOM   4508 O O   . ALA B 1 172 ? 38.475  37.282  86.428  1.00 123.87 ?  1048 ALA B O   1 
ATOM   4509 C CB  . ALA B 1 172 ? 37.327  36.340  88.858  1.00 117.74 ?  1048 ALA B CB  1 
ATOM   4510 N N   . ILE B 1 173 ? 38.083  39.386  87.116  1.00 104.59 ?  1049 ILE B N   1 
ATOM   4511 C CA  . ILE B 1 173 ? 38.210  39.940  85.773  1.00 106.39 ?  1049 ILE B CA  1 
ATOM   4512 C C   . ILE B 1 173 ? 39.215  41.085  85.793  1.00 114.04 ?  1049 ILE B C   1 
ATOM   4513 O O   . ILE B 1 173 ? 39.887  41.358  84.793  1.00 107.83 ?  1049 ILE B O   1 
ATOM   4514 C CB  . ILE B 1 173 ? 36.841  40.406  85.241  1.00 110.63 ?  1049 ILE B CB  1 
ATOM   4515 C CG1 . ILE B 1 173 ? 36.927  40.734  83.752  1.00 116.96 ?  1049 ILE B CG1 1 
ATOM   4516 C CG2 . ILE B 1 173 ? 36.334  41.611  86.030  1.00 131.41 ?  1049 ILE B CG2 1 
ATOM   4517 C CD1 . ILE B 1 173 ? 37.097  39.513  82.886  1.00 126.14 ?  1049 ILE B CD1 1 
ATOM   4518 N N   . GLY B 1 174 ? 39.332  41.749  86.939  1.00 109.16 ?  1050 GLY B N   1 
ATOM   4519 C CA  . GLY B 1 174 ? 40.301  42.806  87.141  1.00 106.81 ?  1050 GLY B CA  1 
ATOM   4520 C C   . GLY B 1 174 ? 39.690  44.186  87.274  1.00 120.37 ?  1050 GLY B C   1 
ATOM   4521 O O   . GLY B 1 174 ? 40.058  44.951  88.171  1.00 129.22 ?  1050 GLY B O   1 
ATOM   4522 N N   . ARG B 1 175 ? 38.736  44.508  86.407  1.00 123.93 ?  1051 ARG B N   1 
ATOM   4523 C CA  . ARG B 1 175 ? 38.095  45.813  86.421  1.00 120.30 ?  1051 ARG B CA  1 
ATOM   4524 C C   . ARG B 1 175 ? 36.716  45.687  87.064  1.00 149.23 ?  1051 ARG B C   1 
ATOM   4525 O O   . ARG B 1 175 ? 36.339  44.627  87.572  1.00 164.49 ?  1051 ARG B O   1 
ATOM   4526 C CB  . ARG B 1 175 ? 38.030  46.382  85.005  1.00 99.43  ?  1051 ARG B CB  1 
ATOM   4527 N N   . ASN B 1 176 ? 35.949  46.773  87.060  1.00 165.63 ?  1052 ASN B N   1 
ATOM   4528 C CA  . ASN B 1 176 ? 34.584  46.721  87.558  1.00 174.99 ?  1052 ASN B CA  1 
ATOM   4529 C C   . ASN B 1 176 ? 33.684  46.074  86.517  1.00 181.37 ?  1052 ASN B C   1 
ATOM   4530 O O   . ASN B 1 176 ? 33.754  46.391  85.326  1.00 204.57 ?  1052 ASN B O   1 
ATOM   4531 C CB  . ASN B 1 176 ? 34.077  48.121  87.908  1.00 181.89 ?  1052 ASN B CB  1 
ATOM   4532 C CG  . ASN B 1 176 ? 32.737  48.094  88.612  1.00 194.87 ?  1052 ASN B CG  1 
ATOM   4533 O OD1 . ASN B 1 176 ? 32.274  47.039  89.045  1.00 202.86 ?  1052 ASN B OD1 1 
ATOM   4534 N ND2 . ASN B 1 176 ? 32.110  49.258  88.738  1.00 206.61 ?  1052 ASN B ND2 1 
ATOM   4535 N N   . THR B 1 177 ? 32.833  45.159  86.977  1.00 185.96 ?  1053 THR B N   1 
ATOM   4536 C CA  . THR B 1 177 ? 31.993  44.394  86.063  1.00 188.58 ?  1053 THR B CA  1 
ATOM   4537 C C   . THR B 1 177 ? 30.752  45.178  85.654  1.00 177.52 ?  1053 THR B C   1 
ATOM   4538 O O   . THR B 1 177 ? 30.493  45.377  84.461  1.00 165.64 ?  1053 THR B O   1 
ATOM   4539 C CB  . THR B 1 177 ? 31.583  43.069  86.713  1.00 203.21 ?  1053 THR B CB  1 
ATOM   4540 O OG1 . THR B 1 177 ? 31.050  43.319  88.021  1.00 213.56 ?  1053 THR B OG1 1 
ATOM   4541 C CG2 . THR B 1 177 ? 32.773  42.143  86.826  1.00 195.26 ?  1053 THR B CG2 1 
ATOM   4542 N N   . ASN B 1 178 ? 29.947  45.572  86.646  1.00 159.69 ?  1054 ASN B N   1 
ATOM   4543 C CA  . ASN B 1 178 ? 28.659  46.244  86.487  1.00 139.53 ?  1054 ASN B CA  1 
ATOM   4544 C C   . ASN B 1 178 ? 27.625  45.269  85.930  1.00 125.90 ?  1054 ASN B C   1 
ATOM   4545 O O   . ASN B 1 178 ? 26.419  45.498  86.048  1.00 134.34 ?  1054 ASN B O   1 
ATOM   4546 C CB  . ASN B 1 178 ? 28.793  47.481  85.583  1.00 119.97 ?  1054 ASN B CB  1 
ATOM   4547 C CG  . ASN B 1 178 ? 27.461  48.161  85.302  1.00 132.07 ?  1054 ASN B CG  1 
ATOM   4548 O OD1 . ASN B 1 178 ? 26.560  48.169  86.139  1.00 131.23 ?  1054 ASN B OD1 1 
ATOM   4549 N ND2 . ASN B 1 178 ? 27.334  48.736  84.109  1.00 132.16 ?  1054 ASN B ND2 1 
ATOM   4550 N N   . GLY B 1 179 ? 28.083  44.138  85.400  1.00 109.57 ?  1055 GLY B N   1 
ATOM   4551 C CA  . GLY B 1 179 ? 27.208  43.073  84.955  1.00 127.23 ?  1055 GLY B CA  1 
ATOM   4552 C C   . GLY B 1 179 ? 27.489  42.576  83.550  1.00 132.16 ?  1055 GLY B C   1 
ATOM   4553 O O   . GLY B 1 179 ? 27.392  41.373  83.290  1.00 148.67 ?  1055 GLY B O   1 
ATOM   4554 N N   . VAL B 1 180 ? 27.867  43.476  82.641  1.00 122.00 ?  1056 VAL B N   1 
ATOM   4555 C CA  . VAL B 1 180 ? 28.082  43.122  81.241  1.00 129.33 ?  1056 VAL B CA  1 
ATOM   4556 C C   . VAL B 1 180 ? 29.574  42.942  80.998  1.00 111.11 ?  1056 VAL B C   1 
ATOM   4557 O O   . VAL B 1 180 ? 30.389  43.770  81.423  1.00 98.55  ?  1056 VAL B O   1 
ATOM   4558 C CB  . VAL B 1 180 ? 27.488  44.184  80.298  1.00 151.66 ?  1056 VAL B CB  1 
ATOM   4559 C CG1 . VAL B 1 180 ? 27.671  43.761  78.840  1.00 157.89 ?  1056 VAL B CG1 1 
ATOM   4560 C CG2 . VAL B 1 180 ? 26.017  44.412  80.602  1.00 159.81 ?  1056 VAL B CG2 1 
ATOM   4561 N N   . ILE B 1 181 ? 29.933  41.859  80.310  1.00 108.46 ?  1057 ILE B N   1 
ATOM   4562 C CA  . ILE B 1 181 ? 31.322  41.497  80.054  1.00 118.05 ?  1057 ILE B CA  1 
ATOM   4563 C C   . ILE B 1 181 ? 31.498  41.295  78.554  1.00 122.87 ?  1057 ILE B C   1 
ATOM   4564 O O   . ILE B 1 181 ? 30.707  40.586  77.922  1.00 149.64 ?  1057 ILE B O   1 
ATOM   4565 C CB  . ILE B 1 181 ? 31.729  40.237  80.843  1.00 130.65 ?  1057 ILE B CB  1 
ATOM   4566 C CG1 . ILE B 1 181 ? 32.260  40.615  82.231  1.00 154.87 ?  1057 ILE B CG1 1 
ATOM   4567 C CG2 . ILE B 1 181 ? 32.756  39.414  80.080  1.00 118.30 ?  1057 ILE B CG2 1 
ATOM   4568 C CD1 . ILE B 1 181 ? 31.193  41.042  83.216  1.00 171.66 ?  1057 ILE B CD1 1 
ATOM   4569 N N   . THR B 1 182 ? 32.532  41.914  77.989  1.00 115.93 ?  1058 THR B N   1 
ATOM   4570 C CA  . THR B 1 182 ? 32.753  41.884  76.549  1.00 110.08 ?  1058 THR B CA  1 
ATOM   4571 C C   . THR B 1 182 ? 33.164  40.483  76.084  1.00 108.69 ?  1058 THR B C   1 
ATOM   4572 O O   . THR B 1 182 ? 33.432  39.580  76.883  1.00 111.50 ?  1058 THR B O   1 
ATOM   4573 C CB  . THR B 1 182 ? 33.812  42.914  76.154  1.00 104.29 ?  1058 THR B CB  1 
ATOM   4574 O OG1 . THR B 1 182 ? 35.057  42.591  76.785  1.00 99.45  ?  1058 THR B OG1 1 
ATOM   4575 C CG2 . THR B 1 182 ? 33.376  44.309  76.586  1.00 101.01 ?  1058 THR B CG2 1 
ATOM   4576 N N   . LYS B 1 183 ? 33.214  40.311  74.758  1.00 111.77 ?  1059 LYS B N   1 
ATOM   4577 C CA  . LYS B 1 183 ? 33.486  38.990  74.193  1.00 118.37 ?  1059 LYS B CA  1 
ATOM   4578 C C   . LYS B 1 183 ? 34.907  38.528  74.495  1.00 125.35 ?  1059 LYS B C   1 
ATOM   4579 O O   . LYS B 1 183 ? 35.136  37.347  74.787  1.00 140.54 ?  1059 LYS B O   1 
ATOM   4580 C CB  . LYS B 1 183 ? 33.238  38.997  72.682  1.00 116.53 ?  1059 LYS B CB  1 
ATOM   4581 C CG  . LYS B 1 183 ? 33.427  37.630  72.026  1.00 118.01 ?  1059 LYS B CG  1 
ATOM   4582 C CD  . LYS B 1 183 ? 32.831  37.575  70.625  1.00 111.24 ?  1059 LYS B CD  1 
ATOM   4583 C CE  . LYS B 1 183 ? 32.919  36.180  70.015  1.00 114.61 ?  1059 LYS B CE  1 
ATOM   4584 N NZ  . LYS B 1 183 ? 34.312  35.797  69.648  1.00 106.67 ?  1059 LYS B NZ  1 
ATOM   4585 N N   . ASP B 1 184 ? 35.873  39.445  74.443  1.00 126.07 ?  1060 ASP B N   1 
ATOM   4586 C CA  . ASP B 1 184 ? 37.268  39.072  74.667  1.00 108.18 ?  1060 ASP B CA  1 
ATOM   4587 C C   . ASP B 1 184 ? 37.546  38.770  76.139  1.00 105.69 ?  1060 ASP B C   1 
ATOM   4588 O O   . ASP B 1 184 ? 38.344  37.877  76.455  1.00 116.03 ?  1060 ASP B O   1 
ATOM   4589 C CB  . ASP B 1 184 ? 38.192  40.172  74.141  1.00 115.57 ?  1060 ASP B CB  1 
ATOM   4590 C CG  . ASP B 1 184 ? 38.669  39.905  72.716  1.00 135.31 ?  1060 ASP B CG  1 
ATOM   4591 O OD1 . ASP B 1 184 ? 37.815  39.690  71.834  1.00 151.71 ?  1060 ASP B OD1 1 
ATOM   4592 O OD2 . ASP B 1 184 ? 39.898  39.934  72.467  1.00 133.52 -1 1060 ASP B OD2 1 
ATOM   4593 N N   . GLU B 1 185 ? 36.908  39.501  77.054  1.00 111.01 ?  1061 GLU B N   1 
ATOM   4594 C CA  . GLU B 1 185 ? 37.006  39.143  78.467  1.00 112.48 ?  1061 GLU B CA  1 
ATOM   4595 C C   . GLU B 1 185 ? 36.476  37.732  78.705  1.00 104.41 ?  1061 GLU B C   1 
ATOM   4596 O O   . GLU B 1 185 ? 37.059  36.949  79.473  1.00 94.34  ?  1061 GLU B O   1 
ATOM   4597 C CB  . GLU B 1 185 ? 36.252  40.169  79.319  1.00 114.74 ?  1061 GLU B CB  1 
ATOM   4598 C CG  . GLU B 1 185 ? 36.826  41.584  79.226  1.00 122.41 ?  1061 GLU B CG  1 
ATOM   4599 C CD  . GLU B 1 185 ? 36.108  42.584  80.115  1.00 127.93 ?  1061 GLU B CD  1 
ATOM   4600 O OE1 . GLU B 1 185 ? 35.071  42.221  80.712  1.00 138.72 ?  1061 GLU B OE1 1 
ATOM   4601 O OE2 . GLU B 1 185 ? 36.588  43.733  80.222  1.00 124.72 -1 1061 GLU B OE2 1 
ATOM   4602 N N   . ALA B 1 186 ? 35.390  37.377  78.017  1.00 81.74  ?  1062 ALA B N   1 
ATOM   4603 C CA  . ALA B 1 186 ? 34.844  36.032  78.142  1.00 86.46  ?  1062 ALA B CA  1 
ATOM   4604 C C   . ALA B 1 186 ? 35.791  34.987  77.561  1.00 99.48  ?  1062 ALA B C   1 
ATOM   4605 O O   . ALA B 1 186 ? 35.943  33.902  78.130  1.00 104.29 ?  1062 ALA B O   1 
ATOM   4606 C CB  . ALA B 1 186 ? 33.474  35.956  77.470  1.00 81.21  ?  1062 ALA B CB  1 
ATOM   4607 N N   . GLU B 1 187 ? 36.444  35.285  76.435  1.00 108.43 ?  1063 GLU B N   1 
ATOM   4608 C CA  . GLU B 1 187 ? 37.393  34.312  75.892  1.00 95.41  ?  1063 GLU B CA  1 
ATOM   4609 C C   . GLU B 1 187 ? 38.598  34.138  76.819  1.00 87.82  ?  1063 GLU B C   1 
ATOM   4610 O O   . GLU B 1 187 ? 39.106  33.019  76.995  1.00 68.15  ?  1063 GLU B O   1 
ATOM   4611 C CB  . GLU B 1 187 ? 37.832  34.724  74.484  1.00 85.27  ?  1063 GLU B CB  1 
ATOM   4612 C CG  . GLU B 1 187 ? 36.747  34.544  73.416  1.00 90.26  ?  1063 GLU B CG  1 
ATOM   4613 C CD  . GLU B 1 187 ? 36.506  33.085  73.026  1.00 117.62 ?  1063 GLU B CD  1 
ATOM   4614 O OE1 . GLU B 1 187 ? 37.124  32.178  73.626  1.00 99.77  ?  1063 GLU B OE1 1 
ATOM   4615 O OE2 . GLU B 1 187 ? 35.699  32.840  72.108  1.00 124.45 -1 1063 GLU B OE2 1 
ATOM   4616 N N   . LYS B 1 188 ? 39.040  35.228  77.450  1.00 87.26  ?  1064 LYS B N   1 
ATOM   4617 C CA  . LYS B 1 188 ? 40.115  35.152  78.438  1.00 91.49  ?  1064 LYS B CA  1 
ATOM   4618 C C   . LYS B 1 188 ? 39.733  34.218  79.588  1.00 91.47  ?  1064 LYS B C   1 
ATOM   4619 O O   . LYS B 1 188 ? 40.470  33.271  79.923  1.00 90.95  ?  1064 LYS B O   1 
ATOM   4620 C CB  . LYS B 1 188 ? 40.418  36.569  78.946  1.00 104.25 ?  1064 LYS B CB  1 
ATOM   4621 C CG  . LYS B 1 188 ? 41.725  36.767  79.687  1.00 113.34 ?  1064 LYS B CG  1 
ATOM   4622 C CD  . LYS B 1 188 ? 41.946  38.246  80.014  1.00 106.89 ?  1064 LYS B CD  1 
ATOM   4623 C CE  . LYS B 1 188 ? 42.180  39.062  78.745  1.00 114.17 ?  1064 LYS B CE  1 
ATOM   4624 N NZ  . LYS B 1 188 ? 42.319  40.525  79.005  1.00 113.92 ?  1064 LYS B NZ  1 
ATOM   4625 N N   . LEU B 1 189 ? 38.555  34.447  80.177  1.00 83.30  ?  1065 LEU B N   1 
ATOM   4626 C CA  . LEU B 1 189 ? 38.096  33.587  81.267  1.00 81.25  ?  1065 LEU B CA  1 
ATOM   4627 C C   . LEU B 1 189 ? 37.903  32.146  80.805  1.00 74.11  ?  1065 LEU B C   1 
ATOM   4628 O O   . LEU B 1 189 ? 38.117  31.208  81.584  1.00 78.28  ?  1065 LEU B O   1 
ATOM   4629 C CB  . LEU B 1 189 ? 36.795  34.133  81.858  1.00 69.44  ?  1065 LEU B CB  1 
ATOM   4630 N N   . PHE B 1 190 ? 37.506  31.952  79.546  1.00 71.23  ?  1066 PHE B N   1 
ATOM   4631 C CA  . PHE B 1 190 ? 37.312  30.607  79.010  1.00 70.70  ?  1066 PHE B CA  1 
ATOM   4632 C C   . PHE B 1 190 ? 38.624  29.837  78.952  1.00 83.53  ?  1066 PHE B C   1 
ATOM   4633 O O   . PHE B 1 190 ? 38.682  28.651  79.317  1.00 73.69  ?  1066 PHE B O   1 
ATOM   4634 C CB  . PHE B 1 190 ? 36.674  30.709  77.624  1.00 68.42  ?  1066 PHE B CB  1 
ATOM   4635 C CG  . PHE B 1 190 ? 36.355  29.387  76.993  1.00 63.83  ?  1066 PHE B CG  1 
ATOM   4636 C CD1 . PHE B 1 190 ? 35.641  28.420  77.682  1.00 73.64  ?  1066 PHE B CD1 1 
ATOM   4637 C CD2 . PHE B 1 190 ? 36.751  29.122  75.694  1.00 67.51  ?  1066 PHE B CD2 1 
ATOM   4638 C CE1 . PHE B 1 190 ? 35.344  27.204  77.088  1.00 69.60  ?  1066 PHE B CE1 1 
ATOM   4639 C CE2 . PHE B 1 190 ? 36.458  27.914  75.097  1.00 70.18  ?  1066 PHE B CE2 1 
ATOM   4640 C CZ  . PHE B 1 190 ? 35.753  26.955  75.793  1.00 70.52  ?  1066 PHE B CZ  1 
ATOM   4641 N N   . ASN B 1 191 ? 39.683  30.496  78.474  1.00 89.28  ?  1067 ASN B N   1 
ATOM   4642 C CA  . ASN B 1 191 ? 41.010  29.888  78.518  1.00 89.37  ?  1067 ASN B CA  1 
ATOM   4643 C C   . ASN B 1 191 ? 41.395  29.525  79.946  1.00 95.18  ?  1067 ASN B C   1 
ATOM   4644 O O   . ASN B 1 191 ? 41.924  28.430  80.201  1.00 100.62 ?  1067 ASN B O   1 
ATOM   4645 C CB  . ASN B 1 191 ? 42.041  30.833  77.894  1.00 87.00  ?  1067 ASN B CB  1 
ATOM   4646 C CG  . ASN B 1 191 ? 42.078  30.733  76.369  1.00 98.28  ?  1067 ASN B CG  1 
ATOM   4647 O OD1 . ASN B 1 191 ? 41.072  30.967  75.697  1.00 103.61 ?  1067 ASN B OD1 1 
ATOM   4648 N ND2 . ASN B 1 191 ? 43.237  30.376  75.821  1.00 83.84  ?  1067 ASN B ND2 1 
ATOM   4649 N N   . GLN B 1 192 ? 41.109  30.421  80.895  1.00 89.08  ?  1068 GLN B N   1 
ATOM   4650 C CA  . GLN B 1 192 ? 41.411  30.114  82.292  1.00 96.17  ?  1068 GLN B CA  1 
ATOM   4651 C C   . GLN B 1 192 ? 40.698  28.843  82.745  1.00 87.75  ?  1068 GLN B C   1 
ATOM   4652 O O   . GLN B 1 192 ? 41.303  27.957  83.366  1.00 81.62  ?  1068 GLN B O   1 
ATOM   4653 C CB  . GLN B 1 192 ? 41.020  31.287  83.187  1.00 93.17  ?  1068 GLN B CB  1 
ATOM   4654 C CG  . GLN B 1 192 ? 41.811  32.553  82.924  1.00 93.92  ?  1068 GLN B CG  1 
ATOM   4655 C CD  . GLN B 1 192 ? 41.303  33.725  83.734  1.00 111.60 ?  1068 GLN B CD  1 
ATOM   4656 O OE1 . GLN B 1 192 ? 40.395  33.578  84.552  1.00 118.30 ?  1068 GLN B OE1 1 
ATOM   4657 N NE2 . GLN B 1 192 ? 41.883  34.899  83.510  1.00 104.80 ?  1068 GLN B NE2 1 
ATOM   4658 N N   . ASP B 1 193 ? 39.404  28.743  82.441  1.00 83.58  ?  1069 ASP B N   1 
ATOM   4659 C CA  . ASP B 1 193 ? 38.622  27.598  82.895  1.00 88.04  ?  1069 ASP B CA  1 
ATOM   4660 C C   . ASP B 1 193 ? 39.136  26.299  82.285  1.00 81.51  ?  1069 ASP B C   1 
ATOM   4661 O O   . ASP B 1 193 ? 39.216  25.269  82.968  1.00 67.10  ?  1069 ASP B O   1 
ATOM   4662 C CB  . ASP B 1 193 ? 37.148  27.805  82.555  1.00 93.37  ?  1069 ASP B CB  1 
ATOM   4663 C CG  . ASP B 1 193 ? 36.565  29.043  83.213  1.00 95.15  ?  1069 ASP B CG  1 
ATOM   4664 O OD1 . ASP B 1 193 ? 37.033  29.419  84.310  1.00 78.35  ?  1069 ASP B OD1 1 
ATOM   4665 O OD2 . ASP B 1 193 ? 35.627  29.636  82.643  1.00 84.82  -1 1069 ASP B OD2 1 
ATOM   4666 N N   . VAL B 1 194 ? 39.499  26.326  81.001  1.00 78.60  ?  1070 VAL B N   1 
ATOM   4667 C CA  . VAL B 1 194 ? 39.936  25.091  80.350  1.00 78.69  ?  1070 VAL B CA  1 
ATOM   4668 C C   . VAL B 1 194 ? 41.285  24.635  80.903  1.00 82.61  ?  1070 VAL B C   1 
ATOM   4669 O O   . VAL B 1 194 ? 41.511  23.430  81.131  1.00 95.42  ?  1070 VAL B O   1 
ATOM   4670 C CB  . VAL B 1 194 ? 39.971  25.275  78.821  1.00 80.27  ?  1070 VAL B CB  1 
ATOM   4671 C CG1 . VAL B 1 194 ? 40.557  24.047  78.136  1.00 69.30  ?  1070 VAL B CG1 1 
ATOM   4672 C CG2 . VAL B 1 194 ? 38.567  25.536  78.295  1.00 74.46  ?  1070 VAL B CG2 1 
ATOM   4673 N N   . ASP B 1 195 ? 42.199  25.583  81.141  1.00 72.20  ?  1071 ASP B N   1 
ATOM   4674 C CA  . ASP B 1 195 ? 43.469  25.210  81.758  1.00 81.04  ?  1071 ASP B CA  1 
ATOM   4675 C C   . ASP B 1 195 ? 43.260  24.644  83.157  1.00 92.61  ?  1071 ASP B C   1 
ATOM   4676 O O   . ASP B 1 195 ? 43.924  23.669  83.543  1.00 91.64  ?  1071 ASP B O   1 
ATOM   4677 C CB  . ASP B 1 195 ? 44.407  26.416  81.814  1.00 76.23  ?  1071 ASP B CB  1 
ATOM   4678 N N   . ALA B 1 196 ? 42.330  25.222  83.921  1.00 81.53  ?  1072 ALA B N   1 
ATOM   4679 C CA  . ALA B 1 196 ? 42.039  24.658  85.231  1.00 68.82  ?  1072 ALA B CA  1 
ATOM   4680 C C   . ALA B 1 196 ? 41.492  23.247  85.122  1.00 69.92  ?  1072 ALA B C   1 
ATOM   4681 O O   . ALA B 1 196 ? 41.837  22.398  85.949  1.00 76.46  ?  1072 ALA B O   1 
ATOM   4682 C CB  . ALA B 1 196 ? 41.039  25.534  85.985  1.00 57.90  ?  1072 ALA B CB  1 
ATOM   4683 N N   . ALA B 1 197 ? 40.690  22.970  84.093  1.00 61.76  ?  1073 ALA B N   1 
ATOM   4684 C CA  . ALA B 1 197 ? 40.148  21.627  83.936  1.00 60.89  ?  1073 ALA B CA  1 
ATOM   4685 C C   . ALA B 1 197 ? 41.253  20.613  83.685  1.00 70.85  ?  1073 ALA B C   1 
ATOM   4686 O O   . ALA B 1 197 ? 41.282  19.543  84.315  1.00 72.51  ?  1073 ALA B O   1 
ATOM   4687 C CB  . ALA B 1 197 ? 39.147  21.596  82.784  1.00 58.81  ?  1073 ALA B CB  1 
ATOM   4688 N N   . VAL B 1 198 ? 42.186  20.937  82.787  1.00 74.63  ?  1074 VAL B N   1 
ATOM   4689 C CA  . VAL B 1 198 ? 43.235  19.958  82.508  1.00 85.07  ?  1074 VAL B CA  1 
ATOM   4690 C C   . VAL B 1 198 ? 44.137  19.784  83.728  1.00 84.47  ?  1074 VAL B C   1 
ATOM   4691 O O   . VAL B 1 198 ? 44.581  18.668  84.034  1.00 73.46  ?  1074 VAL B O   1 
ATOM   4692 C CB  . VAL B 1 198 ? 44.040  20.321  81.241  1.00 80.95  ?  1074 VAL B CB  1 
ATOM   4693 C CG1 . VAL B 1 198 ? 43.140  20.307  80.011  1.00 97.02  ?  1074 VAL B CG1 1 
ATOM   4694 C CG2 . VAL B 1 198 ? 44.748  21.656  81.379  1.00 86.55  ?  1074 VAL B CG2 1 
ATOM   4695 N N   . ARG B 1 199 ? 44.403  20.870  84.462  1.00 87.09  ?  1075 ARG B N   1 
ATOM   4696 C CA  . ARG B 1 199 ? 45.217  20.738  85.668  1.00 94.29  ?  1075 ARG B CA  1 
ATOM   4697 C C   . ARG B 1 199 ? 44.515  19.878  86.706  1.00 95.44  ?  1075 ARG B C   1 
ATOM   4698 O O   . ARG B 1 199 ? 45.159  19.115  87.438  1.00 101.56 ?  1075 ARG B O   1 
ATOM   4699 C CB  . ARG B 1 199 ? 45.550  22.116  86.235  1.00 80.59  ?  1075 ARG B CB  1 
ATOM   4700 C CG  . ARG B 1 199 ? 46.720  22.784  85.534  1.00 77.05  ?  1075 ARG B CG  1 
ATOM   4701 C CD  . ARG B 1 199 ? 47.193  24.017  86.278  1.00 90.14  ?  1075 ARG B CD  1 
ATOM   4702 N NE  . ARG B 1 199 ? 46.174  25.057  86.299  1.00 91.05  ?  1075 ARG B NE  1 
ATOM   4703 C CZ  . ARG B 1 199 ? 46.078  26.019  85.390  1.00 99.50  ?  1075 ARG B CZ  1 
ATOM   4704 N NH1 . ARG B 1 199 ? 46.945  26.073  84.388  1.00 86.07  ?  1075 ARG B NH1 1 
ATOM   4705 N NH2 . ARG B 1 199 ? 45.117  26.927  85.484  1.00 99.82  ?  1075 ARG B NH2 1 
ATOM   4706 N N   . GLY B 1 200 ? 43.191  19.990  86.780  1.00 83.51  ?  1076 GLY B N   1 
ATOM   4707 C CA  . GLY B 1 200 ? 42.441  19.107  87.650  1.00 87.70  ?  1076 GLY B CA  1 
ATOM   4708 C C   . GLY B 1 200 ? 42.609  17.650  87.270  1.00 92.66  ?  1076 GLY B C   1 
ATOM   4709 O O   . GLY B 1 200 ? 42.869  16.799  88.123  1.00 73.91  ?  1076 GLY B O   1 
ATOM   4710 N N   . ILE B 1 201 ? 42.463  17.343  85.980  1.00 88.93  ?  1077 ILE B N   1 
ATOM   4711 C CA  . ILE B 1 201 ? 42.553  15.947  85.543  1.00 76.93  ?  1077 ILE B CA  1 
ATOM   4712 C C   . ILE B 1 201 ? 43.937  15.374  85.839  1.00 79.45  ?  1077 ILE B C   1 
ATOM   4713 O O   . ILE B 1 201 ? 44.069  14.248  86.333  1.00 74.89  ?  1077 ILE B O   1 
ATOM   4714 C CB  . ILE B 1 201 ? 42.199  15.820  84.052  1.00 70.19  ?  1077 ILE B CB  1 
ATOM   4715 C CG1 . ILE B 1 201 ? 40.741  16.208  83.823  1.00 64.24  ?  1077 ILE B CG1 1 
ATOM   4716 C CG2 . ILE B 1 201 ? 42.429  14.403  83.580  1.00 69.91  ?  1077 ILE B CG2 1 
ATOM   4717 C CD1 . ILE B 1 201 ? 40.377  16.364  82.364  1.00 64.36  ?  1077 ILE B CD1 1 
ATOM   4718 N N   . LEU B 1 202 ? 44.992  16.133  85.533  1.00 99.22  ?  1078 LEU B N   1 
ATOM   4719 C CA  . LEU B 1 202 ? 46.337  15.606  85.753  1.00 94.33  ?  1078 LEU B CA  1 
ATOM   4720 C C   . LEU B 1 202 ? 46.693  15.498  87.232  1.00 110.16 ?  1078 LEU B C   1 
ATOM   4721 O O   . LEU B 1 202 ? 47.655  14.804  87.576  1.00 121.22 ?  1078 LEU B O   1 
ATOM   4722 C CB  . LEU B 1 202 ? 47.367  16.471  85.034  1.00 92.39  ?  1078 LEU B CB  1 
ATOM   4723 C CG  . LEU B 1 202 ? 47.225  16.533  83.514  1.00 82.15  ?  1078 LEU B CG  1 
ATOM   4724 C CD1 . LEU B 1 202 ? 48.082  17.657  82.965  1.00 77.31  ?  1078 LEU B CD1 1 
ATOM   4725 C CD2 . LEU B 1 202 ? 47.600  15.204  82.872  1.00 97.13  ?  1078 LEU B CD2 1 
ATOM   4726 N N   . ARG B 1 203 ? 45.942  16.158  88.112  1.00 116.29 ?  1079 ARG B N   1 
ATOM   4727 C CA  . ARG B 1 203 ? 46.150  16.066  89.550  1.00 115.67 ?  1079 ARG B CA  1 
ATOM   4728 C C   . ARG B 1 203 ? 45.215  15.060  90.211  1.00 111.62 ?  1079 ARG B C   1 
ATOM   4729 O O   . ARG B 1 203 ? 45.116  15.033  91.441  1.00 137.95 ?  1079 ARG B O   1 
ATOM   4730 C CB  . ARG B 1 203 ? 45.976  17.443  90.190  1.00 110.90 ?  1079 ARG B CB  1 
ATOM   4731 N N   . ASN B 1 204 ? 44.525  14.244  89.422  1.00 91.28  ?  1080 ASN B N   1 
ATOM   4732 C CA  . ASN B 1 204 ? 43.582  13.257  89.927  1.00 73.94  ?  1080 ASN B CA  1 
ATOM   4733 C C   . ASN B 1 204 ? 44.146  11.863  89.692  1.00 78.67  ?  1080 ASN B C   1 
ATOM   4734 O O   . ASN B 1 204 ? 44.645  11.564  88.601  1.00 106.63 ?  1080 ASN B O   1 
ATOM   4735 C CB  . ASN B 1 204 ? 42.221  13.415  89.246  1.00 74.14  ?  1080 ASN B CB  1 
ATOM   4736 C CG  . ASN B 1 204 ? 41.146  12.551  89.875  1.00 88.47  ?  1080 ASN B CG  1 
ATOM   4737 O OD1 . ASN B 1 204 ? 41.277  11.329  89.955  1.00 85.02  ?  1080 ASN B OD1 1 
ATOM   4738 N ND2 . ASN B 1 204 ? 40.074  13.186  90.333  1.00 80.97  ?  1080 ASN B ND2 1 
ATOM   4739 N N   . ALA B 1 205 ? 44.057  11.012  90.714  1.00 80.73  ?  1081 ALA B N   1 
ATOM   4740 C CA  . ALA B 1 205 ? 44.680  9.696   90.628  1.00 85.38  ?  1081 ALA B CA  1 
ATOM   4741 C C   . ALA B 1 205 ? 43.892  8.747   89.732  1.00 95.16  ?  1081 ALA B C   1 
ATOM   4742 O O   . ALA B 1 205 ? 44.478  7.843   89.125  1.00 109.68 ?  1081 ALA B O   1 
ATOM   4743 C CB  . ALA B 1 205 ? 44.835  9.096   92.024  1.00 96.30  ?  1081 ALA B CB  1 
ATOM   4744 N N   . LYS B 1 206 ? 42.578  8.935   89.624  1.00 81.36  ?  1082 LYS B N   1 
ATOM   4745 C CA  . LYS B 1 206 ? 41.738  8.069   88.806  1.00 88.61  ?  1082 LYS B CA  1 
ATOM   4746 C C   . LYS B 1 206 ? 41.521  8.598   87.394  1.00 89.13  ?  1082 LYS B C   1 
ATOM   4747 O O   . LYS B 1 206 ? 40.881  7.917   86.586  1.00 91.19  ?  1082 LYS B O   1 
ATOM   4748 C CB  . LYS B 1 206 ? 40.375  7.861   89.480  1.00 87.08  ?  1082 LYS B CB  1 
ATOM   4749 N N   . LEU B 1 207 ? 42.025  9.788   87.074  1.00 79.23  ?  1083 LEU B N   1 
ATOM   4750 C CA  . LEU B 1 207 ? 41.819  10.382  85.762  1.00 71.46  ?  1083 LEU B CA  1 
ATOM   4751 C C   . LEU B 1 207 ? 43.095  10.563  84.955  1.00 88.21  ?  1083 LEU B C   1 
ATOM   4752 O O   . LEU B 1 207 ? 43.026  10.596  83.726  1.00 93.06  ?  1083 LEU B O   1 
ATOM   4753 C CB  . LEU B 1 207 ? 41.122  11.742  85.900  1.00 73.00  ?  1083 LEU B CB  1 
ATOM   4754 C CG  . LEU B 1 207 ? 39.704  11.727  86.483  1.00 70.10  ?  1083 LEU B CG  1 
ATOM   4755 C CD1 . LEU B 1 207 ? 39.158  13.144  86.594  1.00 58.45  ?  1083 LEU B CD1 1 
ATOM   4756 C CD2 . LEU B 1 207 ? 38.774  10.855  85.648  1.00 61.00  ?  1083 LEU B CD2 1 
ATOM   4757 N N   . LYS B 1 208 ? 44.252  10.706  85.605  1.00 87.76  ?  1084 LYS B N   1 
ATOM   4758 C CA  . LYS B 1 208 ? 45.492  10.868  84.846  1.00 87.95  ?  1084 LYS B CA  1 
ATOM   4759 C C   . LYS B 1 208 ? 45.856  9.635   84.033  1.00 83.03  ?  1084 LYS B C   1 
ATOM   4760 O O   . LYS B 1 208 ? 46.216  9.796   82.855  1.00 86.82  ?  1084 LYS B O   1 
ATOM   4761 C CB  . LYS B 1 208 ? 46.650  11.268  85.765  1.00 90.22  ?  1084 LYS B CB  1 
ATOM   4762 C CG  . LYS B 1 208 ? 47.934  11.549  84.987  1.00 99.76  ?  1084 LYS B CG  1 
ATOM   4763 C CD  . LYS B 1 208 ? 49.102  11.901  85.894  1.00 113.76 ?  1084 LYS B CD  1 
ATOM   4764 C CE  . LYS B 1 208 ? 49.668  10.665  86.581  1.00 108.94 ?  1084 LYS B CE  1 
ATOM   4765 N NZ  . LYS B 1 208 ? 50.077  9.620   85.599  1.00 117.21 ?  1084 LYS B NZ  1 
ATOM   4766 N N   . PRO B 1 209 ? 45.838  8.407   84.571  1.00 82.10  ?  1085 PRO B N   1 
ATOM   4767 C CA  . PRO B 1 209 ? 46.174  7.258   83.712  1.00 88.88  ?  1085 PRO B CA  1 
ATOM   4768 C C   . PRO B 1 209 ? 45.298  7.155   82.475  1.00 81.33  ?  1085 PRO B C   1 
ATOM   4769 O O   . PRO B 1 209 ? 45.819  6.993   81.359  1.00 72.26  ?  1085 PRO B O   1 
ATOM   4770 C CB  . PRO B 1 209 ? 45.989  6.047   84.643  1.00 75.54  ?  1085 PRO B CB  1 
ATOM   4771 C CG  . PRO B 1 209 ? 45.243  6.539   85.813  1.00 82.00  ?  1085 PRO B CG  1 
ATOM   4772 C CD  . PRO B 1 209 ? 45.599  7.981   85.962  1.00 81.20  ?  1085 PRO B CD  1 
ATOM   4773 N N   . VAL B 1 210 ? 43.984  7.314   82.630  1.00 74.77  ?  1086 VAL B N   1 
ATOM   4774 C CA  . VAL B 1 210 ? 43.084  7.160   81.493  1.00 76.27  ?  1086 VAL B CA  1 
ATOM   4775 C C   . VAL B 1 210 ? 43.231  8.334   80.533  1.00 82.04  ?  1086 VAL B C   1 
ATOM   4776 O O   . VAL B 1 210 ? 43.196  8.152   79.313  1.00 80.34  ?  1086 VAL B O   1 
ATOM   4777 C CB  . VAL B 1 210 ? 41.631  6.985   81.981  1.00 79.90  ?  1086 VAL B CB  1 
ATOM   4778 C CG1 . VAL B 1 210 ? 41.184  8.175   82.822  1.00 81.51  ?  1086 VAL B CG1 1 
ATOM   4779 C CG2 . VAL B 1 210 ? 40.676  6.764   80.812  1.00 91.48  ?  1086 VAL B CG2 1 
ATOM   4780 N N   . TYR B 1 211 ? 43.429  9.548   81.056  1.00 87.85  ?  1087 TYR B N   1 
ATOM   4781 C CA  . TYR B 1 211 ? 43.634  10.698  80.179  1.00 70.14  ?  1087 TYR B CA  1 
ATOM   4782 C C   . TYR B 1 211 ? 44.921  10.553  79.377  1.00 65.37  ?  1087 TYR B C   1 
ATOM   4783 O O   . TYR B 1 211 ? 44.957  10.872  78.182  1.00 73.84  ?  1087 TYR B O   1 
ATOM   4784 C CB  . TYR B 1 211 ? 43.651  11.994  80.997  1.00 64.46  ?  1087 TYR B CB  1 
ATOM   4785 C CG  . TYR B 1 211 ? 43.931  13.256  80.197  1.00 67.56  ?  1087 TYR B CG  1 
ATOM   4786 C CD1 . TYR B 1 211 ? 42.898  13.970  79.596  1.00 76.96  ?  1087 TYR B CD1 1 
ATOM   4787 C CD2 . TYR B 1 211 ? 45.228  13.740  80.054  1.00 58.06  ?  1087 TYR B CD2 1 
ATOM   4788 C CE1 . TYR B 1 211 ? 43.154  15.121  78.867  1.00 70.33  ?  1087 TYR B CE1 1 
ATOM   4789 C CE2 . TYR B 1 211 ? 45.489  14.885  79.327  1.00 59.74  ?  1087 TYR B CE2 1 
ATOM   4790 C CZ  . TYR B 1 211 ? 44.450  15.571  78.738  1.00 69.27  ?  1087 TYR B CZ  1 
ATOM   4791 O OH  . TYR B 1 211 ? 44.710  16.711  78.017  1.00 78.30  ?  1087 TYR B OH  1 
ATOM   4792 N N   . ASP B 1 212 ? 45.986  10.071  80.016  1.00 68.56  ?  1088 ASP B N   1 
ATOM   4793 C CA  . ASP B 1 212 ? 47.241  9.863   79.311  1.00 85.60  ?  1088 ASP B CA  1 
ATOM   4794 C C   . ASP B 1 212 ? 47.158  8.710   78.323  1.00 72.44  ?  1088 ASP B C   1 
ATOM   4795 O O   . ASP B 1 212 ? 47.959  8.660   77.383  1.00 66.18  ?  1088 ASP B O   1 
ATOM   4796 C CB  . ASP B 1 212 ? 48.376  9.630   80.312  1.00 89.54  ?  1088 ASP B CB  1 
ATOM   4797 C CG  . ASP B 1 212 ? 48.724  10.881  81.095  1.00 106.53 ?  1088 ASP B CG  1 
ATOM   4798 O OD1 . ASP B 1 212 ? 48.310  11.978  80.668  1.00 96.51  ?  1088 ASP B OD1 1 
ATOM   4799 O OD2 . ASP B 1 212 ? 49.421  10.775  82.128  1.00 135.17 -1 1088 ASP B OD2 1 
ATOM   4800 N N   . SER B 1 213 ? 46.215  7.786   78.503  1.00 65.05  ?  1089 SER B N   1 
ATOM   4801 C CA  . SER B 1 213 ? 46.033  6.755   77.490  1.00 65.65  ?  1089 SER B CA  1 
ATOM   4802 C C   . SER B 1 213 ? 45.099  7.179   76.356  1.00 72.22  ?  1089 SER B C   1 
ATOM   4803 O O   . SER B 1 213 ? 45.140  6.568   75.281  1.00 72.98  ?  1089 SER B O   1 
ATOM   4804 C CB  . SER B 1 213 ? 45.517  5.463   78.135  1.00 65.56  ?  1089 SER B CB  1 
ATOM   4805 O OG  . SER B 1 213 ? 44.252  5.641   78.747  1.00 57.92  ?  1089 SER B OG  1 
ATOM   4806 N N   . LEU B 1 214 ? 44.274  8.205   76.552  1.00 60.71  ?  1090 LEU B N   1 
ATOM   4807 C CA  . LEU B 1 214 ? 43.296  8.586   75.541  1.00 53.05  ?  1090 LEU B CA  1 
ATOM   4808 C C   . LEU B 1 214 ? 43.923  9.426   74.432  1.00 61.15  ?  1090 LEU B C   1 
ATOM   4809 O O   . LEU B 1 214 ? 44.895  10.156  74.646  1.00 76.51  ?  1090 LEU B O   1 
ATOM   4810 C CB  . LEU B 1 214 ? 42.139  9.356   76.180  1.00 49.82  ?  1090 LEU B CB  1 
ATOM   4811 C CG  . LEU B 1 214 ? 41.146  8.556   77.027  1.00 56.31  ?  1090 LEU B CG  1 
ATOM   4812 C CD1 . LEU B 1 214 ? 40.074  9.476   77.607  1.00 46.18  ?  1090 LEU B CD1 1 
ATOM   4813 C CD2 . LEU B 1 214 ? 40.525  7.426   76.219  1.00 60.89  ?  1090 LEU B CD2 1 
ATOM   4814 N N   . ASP B 1 215 ? 43.348  9.314   73.234  1.00 50.90  ?  1091 ASP B N   1 
ATOM   4815 C CA  . ASP B 1 215 ? 43.744  10.155  72.114  1.00 53.59  ?  1091 ASP B CA  1 
ATOM   4816 C C   . ASP B 1 215 ? 43.181  11.566  72.284  1.00 62.02  ?  1091 ASP B C   1 
ATOM   4817 O O   . ASP B 1 215 ? 42.313  11.824  73.124  1.00 84.91  ?  1091 ASP B O   1 
ATOM   4818 C CB  . ASP B 1 215 ? 43.281  9.547   70.789  1.00 51.13  ?  1091 ASP B CB  1 
ATOM   4819 C CG  . ASP B 1 215 ? 41.840  9.089   70.826  1.00 67.73  ?  1091 ASP B CG  1 
ATOM   4820 O OD1 . ASP B 1 215 ? 41.596  7.935   71.233  1.00 67.15  ?  1091 ASP B OD1 1 
ATOM   4821 O OD2 . ASP B 1 215 ? 40.953  9.885   70.457  1.00 77.52  -1 1091 ASP B OD2 1 
ATOM   4822 N N   . ALA B 1 216 ? 43.694  12.490  71.463  1.00 63.89  ?  1092 ALA B N   1 
ATOM   4823 C CA  . ALA B 1 216 ? 43.349  13.901  71.617  1.00 59.01  ?  1092 ALA B CA  1 
ATOM   4824 C C   . ALA B 1 216 ? 41.844  14.125  71.564  1.00 72.19  ?  1092 ALA B C   1 
ATOM   4825 O O   . ALA B 1 216 ? 41.306  14.922  72.342  1.00 75.60  ?  1092 ALA B O   1 
ATOM   4826 C CB  . ALA B 1 216 ? 44.038  14.733  70.536  1.00 52.02  ?  1092 ALA B CB  1 
ATOM   4827 N N   . VAL B 1 217 ? 41.146  13.395  70.694  1.00 68.17  ?  1093 VAL B N   1 
ATOM   4828 C CA  . VAL B 1 217 ? 39.700  13.560  70.561  1.00 61.61  ?  1093 VAL B CA  1 
ATOM   4829 C C   . VAL B 1 217 ? 38.994  13.057  71.816  1.00 57.55  ?  1093 VAL B C   1 
ATOM   4830 O O   . VAL B 1 217 ? 38.205  13.778  72.448  1.00 59.14  ?  1093 VAL B O   1 
ATOM   4831 C CB  . VAL B 1 217 ? 39.203  12.832  69.296  1.00 65.45  ?  1093 VAL B CB  1 
ATOM   4832 C CG1 . VAL B 1 217 ? 37.780  13.244  68.940  1.00 58.37  ?  1093 VAL B CG1 1 
ATOM   4833 C CG2 . VAL B 1 217 ? 40.149  13.090  68.133  1.00 61.24  ?  1093 VAL B CG2 1 
ATOM   4834 N N   . ARG B 1 218 ? 39.284  11.818  72.216  1.00 59.89  ?  1094 ARG B N   1 
ATOM   4835 C CA  . ARG B 1 218 ? 38.690  11.307  73.445  1.00 59.23  ?  1094 ARG B CA  1 
ATOM   4836 C C   . ARG B 1 218 ? 39.194  12.061  74.674  1.00 58.17  ?  1094 ARG B C   1 
ATOM   4837 O O   . ARG B 1 218 ? 38.466  12.167  75.672  1.00 75.24  ?  1094 ARG B O   1 
ATOM   4838 C CB  . ARG B 1 218 ? 38.947  9.797   73.555  1.00 65.57  ?  1094 ARG B CB  1 
ATOM   4839 C CG  . ARG B 1 218 ? 38.135  8.977   72.535  1.00 65.45  ?  1094 ARG B CG  1 
ATOM   4840 C CD  . ARG B 1 218 ? 38.310  7.470   72.688  1.00 66.12  ?  1094 ARG B CD  1 
ATOM   4841 N NE  . ARG B 1 218 ? 39.121  6.891   71.616  1.00 58.54  ?  1094 ARG B NE  1 
ATOM   4842 C CZ  . ARG B 1 218 ? 38.632  6.215   70.578  1.00 59.73  ?  1094 ARG B CZ  1 
ATOM   4843 N NH1 . ARG B 1 218 ? 37.326  6.020   70.461  1.00 46.90  ?  1094 ARG B NH1 1 
ATOM   4844 N NH2 . ARG B 1 218 ? 39.449  5.726   69.655  1.00 51.38  ?  1094 ARG B NH2 1 
ATOM   4845 N N   . ARG B 1 219 ? 40.395  12.639  74.600  1.00 62.69  ?  1095 ARG B N   1 
ATOM   4846 C CA  . ARG B 1 219 ? 40.857  13.532  75.659  1.00 62.70  ?  1095 ARG B CA  1 
ATOM   4847 C C   . ARG B 1 219 ? 39.939  14.738  75.796  1.00 60.44  ?  1095 ARG B C   1 
ATOM   4848 O O   . ARG B 1 219 ? 39.563  15.125  76.910  1.00 59.54  ?  1095 ARG B O   1 
ATOM   4849 C CB  . ARG B 1 219 ? 42.282  14.003  75.376  1.00 62.72  ?  1095 ARG B CB  1 
ATOM   4850 C CG  . ARG B 1 219 ? 43.371  13.052  75.816  1.00 66.65  ?  1095 ARG B CG  1 
ATOM   4851 C CD  . ARG B 1 219 ? 44.711  13.745  75.718  1.00 75.19  ?  1095 ARG B CD  1 
ATOM   4852 N NE  . ARG B 1 219 ? 45.830  12.852  75.986  1.00 80.98  ?  1095 ARG B NE  1 
ATOM   4853 C CZ  . ARG B 1 219 ? 47.098  13.246  76.002  1.00 90.17  ?  1095 ARG B CZ  1 
ATOM   4854 N NH1 . ARG B 1 219 ? 47.403  14.516  75.769  1.00 74.78  ?  1095 ARG B NH1 1 
ATOM   4855 N NH2 . ARG B 1 219 ? 48.060  12.372  76.249  1.00 94.25  ?  1095 ARG B NH2 1 
ATOM   4856 N N   . ALA B 1 220 ? 39.598  15.367  74.671  1.00 59.29  ?  1096 ALA B N   1 
ATOM   4857 C CA  . ALA B 1 220 ? 38.670  16.490  74.733  1.00 63.04  ?  1096 ALA B CA  1 
ATOM   4858 C C   . ALA B 1 220 ? 37.320  16.060  75.287  1.00 59.77  ?  1096 ALA B C   1 
ATOM   4859 O O   . ALA B 1 220 ? 36.676  16.827  76.010  1.00 44.79  ?  1096 ALA B O   1 
ATOM   4860 C CB  . ALA B 1 220 ? 38.500  17.123  73.355  1.00 64.29  ?  1096 ALA B CB  1 
ATOM   4861 N N   . ALA B 1 221 ? 36.891  14.832  74.995  1.00 53.56  ?  1097 ALA B N   1 
ATOM   4862 C CA  . ALA B 1 221 ? 35.643  14.354  75.598  1.00 50.86  ?  1097 ALA B CA  1 
ATOM   4863 C C   . ALA B 1 221 ? 35.743  14.296  77.125  1.00 44.84  ?  1097 ALA B C   1 
ATOM   4864 O O   . ALA B 1 221 ? 34.837  14.758  77.846  1.00 43.41  ?  1097 ALA B O   1 
ATOM   4865 C CB  . ALA B 1 221 ? 35.283  12.981  75.037  1.00 54.23  ?  1097 ALA B CB  1 
ATOM   4866 N N   . LEU B 1 222 ? 36.848  13.749  77.636  1.00 52.29  ?  1098 LEU B N   1 
ATOM   4867 C CA  . LEU B 1 222 ? 37.013  13.666  79.087  1.00 54.34  ?  1098 LEU B CA  1 
ATOM   4868 C C   . LEU B 1 222 ? 37.049  15.056  79.714  1.00 52.77  ?  1098 LEU B C   1 
ATOM   4869 O O   . LEU B 1 222 ? 36.405  15.302  80.749  1.00 57.36  ?  1098 LEU B O   1 
ATOM   4870 C CB  . LEU B 1 222 ? 38.286  12.891  79.434  1.00 64.59  ?  1098 LEU B CB  1 
ATOM   4871 C CG  . LEU B 1 222 ? 38.473  12.485  80.896  1.00 65.25  ?  1098 LEU B CG  1 
ATOM   4872 C CD1 . LEU B 1 222 ? 37.297  11.646  81.369  1.00 75.57  ?  1098 LEU B CD1 1 
ATOM   4873 C CD2 . LEU B 1 222 ? 39.774  11.722  81.095  1.00 79.11  ?  1098 LEU B CD2 1 
ATOM   4874 N N   . ILE B 1 223 ? 37.785  15.981  79.089  1.00 45.78  ?  1099 ILE B N   1 
ATOM   4875 C CA  . ILE B 1 223 ? 37.830  17.359  79.575  1.00 60.68  ?  1099 ILE B CA  1 
ATOM   4876 C C   . ILE B 1 223 ? 36.434  17.960  79.594  1.00 64.09  ?  1099 ILE B C   1 
ATOM   4877 O O   . ILE B 1 223 ? 36.092  18.740  80.487  1.00 64.76  ?  1099 ILE B O   1 
ATOM   4878 C CB  . ILE B 1 223 ? 38.776  18.217  78.715  1.00 66.96  ?  1099 ILE B CB  1 
ATOM   4879 C CG1 . ILE B 1 223 ? 40.173  17.612  78.652  1.00 60.18  ?  1099 ILE B CG1 1 
ATOM   4880 C CG2 . ILE B 1 223 ? 38.844  19.634  79.267  1.00 64.37  ?  1099 ILE B CG2 1 
ATOM   4881 C CD1 . ILE B 1 223 ? 41.069  18.319  77.658  1.00 52.63  ?  1099 ILE B CD1 1 
ATOM   4882 N N   . ASN B 1 224 ? 35.625  17.643  78.582  1.00 72.67  ?  1100 ASN B N   1 
ATOM   4883 C CA  . ASN B 1 224 ? 34.258  18.152  78.522  1.00 68.34  ?  1100 ASN B CA  1 
ATOM   4884 C C   . ASN B 1 224 ? 33.467  17.728  79.748  1.00 65.44  ?  1100 ASN B C   1 
ATOM   4885 O O   . ASN B 1 224 ? 32.807  18.548  80.406  1.00 68.43  ?  1100 ASN B O   1 
ATOM   4886 C CB  . ASN B 1 224 ? 33.576  17.648  77.249  1.00 62.50  ?  1100 ASN B CB  1 
ATOM   4887 C CG  . ASN B 1 224 ? 32.263  18.355  76.972  1.00 67.55  ?  1100 ASN B CG  1 
ATOM   4888 O OD1 . ASN B 1 224 ? 31.281  18.170  77.691  1.00 66.69  ?  1100 ASN B OD1 1 
ATOM   4889 N ND2 . ASN B 1 224 ? 32.240  19.172  75.923  1.00 69.87  ?  1100 ASN B ND2 1 
ATOM   4890 N N   . MET B 1 225 ? 33.519  16.436  80.067  1.00 65.10  ?  1101 MET B N   1 
ATOM   4891 C CA  . MET B 1 225 ? 32.851  15.972  81.280  1.00 75.06  ?  1101 MET B CA  1 
ATOM   4892 C C   . MET B 1 225 ? 33.334  16.754  82.498  1.00 85.67  ?  1101 MET B C   1 
ATOM   4893 O O   . MET B 1 225 ? 32.527  17.238  83.299  1.00 83.70  ?  1101 MET B O   1 
ATOM   4894 C CB  . MET B 1 225 ? 33.078  14.476  81.485  1.00 61.86  ?  1101 MET B CB  1 
ATOM   4895 C CG  . MET B 1 225 ? 32.285  13.602  80.543  1.00 79.53  ?  1101 MET B CG  1 
ATOM   4896 S SD  . MET B 1 225 ? 32.505  11.855  80.929  1.00 96.79  ?  1101 MET B SD  1 
ATOM   4897 C CE  . MET B 1 225 ? 31.581  11.753  82.456  1.00 73.93  ?  1101 MET B CE  1 
ATOM   4898 N N   . VAL B 1 226 ? 34.655  16.917  82.636  1.00 70.93  ?  1102 VAL B N   1 
ATOM   4899 C CA  . VAL B 1 226 ? 35.175  17.640  83.803  1.00 66.58  ?  1102 VAL B CA  1 
ATOM   4900 C C   . VAL B 1 226 ? 34.698  19.091  83.820  1.00 68.95  ?  1102 VAL B C   1 
ATOM   4901 O O   . VAL B 1 226 ? 34.436  19.658  84.889  1.00 76.03  ?  1102 VAL B O   1 
ATOM   4902 C CB  . VAL B 1 226 ? 36.713  17.548  83.862  1.00 70.56  ?  1102 VAL B CB  1 
ATOM   4903 C CG1 . VAL B 1 226 ? 37.266  18.487  84.921  1.00 53.63  ?  1102 VAL B CG1 1 
ATOM   4904 C CG2 . VAL B 1 226 ? 37.128  16.120  84.164  1.00 68.72  ?  1102 VAL B CG2 1 
ATOM   4905 N N   . PHE B 1 227 ? 34.569  19.710  82.649  1.00 73.11  ?  1103 PHE B N   1 
ATOM   4906 C CA  . PHE B 1 227 ? 34.119  21.097  82.578  1.00 69.93  ?  1103 PHE B CA  1 
ATOM   4907 C C   . PHE B 1 227 ? 32.665  21.225  83.009  1.00 75.81  ?  1103 PHE B C   1 
ATOM   4908 O O   . PHE B 1 227 ? 32.278  22.227  83.623  1.00 83.85  ?  1103 PHE B O   1 
ATOM   4909 C CB  . PHE B 1 227 ? 34.304  21.632  81.157  1.00 58.17  ?  1103 PHE B CB  1 
ATOM   4910 C CG  . PHE B 1 227 ? 34.321  23.136  81.062  1.00 58.80  ?  1103 PHE B CG  1 
ATOM   4911 C CD1 . PHE B 1 227 ? 33.140  23.859  81.000  1.00 64.72  ?  1103 PHE B CD1 1 
ATOM   4912 C CD2 . PHE B 1 227 ? 35.524  23.822  81.000  1.00 61.20  ?  1103 PHE B CD2 1 
ATOM   4913 C CE1 . PHE B 1 227 ? 33.159  25.237  80.901  1.00 66.20  ?  1103 PHE B CE1 1 
ATOM   4914 C CE2 . PHE B 1 227 ? 35.549  25.199  80.899  1.00 63.71  ?  1103 PHE B CE2 1 
ATOM   4915 C CZ  . PHE B 1 227 ? 34.365  25.907  80.853  1.00 58.72  ?  1103 PHE B CZ  1 
ATOM   4916 N N   . GLN B 1 228 ? 31.837  20.230  82.689  1.00 73.39  ?  1104 GLN B N   1 
ATOM   4917 C CA  . GLN B 1 228 ? 30.449  20.315  83.129  1.00 71.47  ?  1104 GLN B CA  1 
ATOM   4918 C C   . GLN B 1 228 ? 30.291  19.886  84.587  1.00 73.54  ?  1104 GLN B C   1 
ATOM   4919 O O   . GLN B 1 228 ? 29.757  20.643  85.405  1.00 63.88  ?  1104 GLN B O   1 
ATOM   4920 C CB  . GLN B 1 228 ? 29.546  19.479  82.223  1.00 78.21  ?  1104 GLN B CB  1 
ATOM   4921 C CG  . GLN B 1 228 ? 28.067  19.610  82.555  1.00 83.11  ?  1104 GLN B CG  1 
ATOM   4922 C CD  . GLN B 1 228 ? 27.221  18.583  81.834  1.00 89.98  ?  1104 GLN B CD  1 
ATOM   4923 O OE1 . GLN B 1 228 ? 27.743  17.614  81.286  1.00 66.22  ?  1104 GLN B OE1 1 
ATOM   4924 N NE2 . GLN B 1 228 ? 25.908  18.789  81.828  1.00 113.73 ?  1104 GLN B NE2 1 
ATOM   4925 N N   . MET B 1 229 ? 30.738  18.677  84.932  1.00 68.50  ?  1105 MET B N   1 
ATOM   4926 C CA  . MET B 1 229 ? 30.542  18.161  86.297  1.00 67.76  ?  1105 MET B CA  1 
ATOM   4927 C C   . MET B 1 229 ? 31.620  18.628  87.257  1.00 88.03  ?  1105 MET B C   1 
ATOM   4928 O O   . MET B 1 229 ? 31.332  19.365  88.221  1.00 99.39  ?  1105 MET B O   1 
ATOM   4929 C CB  . MET B 1 229 ? 30.468  16.632  86.254  1.00 70.55  ?  1105 MET B CB  1 
ATOM   4930 C CG  . MET B 1 229 ? 29.452  16.107  85.257  1.00 87.38  ?  1105 MET B CG  1 
ATOM   4931 S SD  . MET B 1 229 ? 29.461  14.308  85.143  1.00 98.45  ?  1105 MET B SD  1 
ATOM   4932 C CE  . MET B 1 229 ? 28.811  13.871  86.753  1.00 105.26 ?  1105 MET B CE  1 
ATOM   4933 N N   . GLY B 1 230 ? 32.860  18.232  87.036  1.00 91.56  ?  1106 GLY B N   1 
ATOM   4934 C CA  . GLY B 1 230 ? 33.934  18.547  87.957  1.00 72.46  ?  1106 GLY B CA  1 
ATOM   4935 C C   . GLY B 1 230 ? 34.942  17.421  88.037  1.00 89.84  ?  1106 GLY B C   1 
ATOM   4936 O O   . GLY B 1 230 ? 34.702  16.296  87.601  1.00 98.59  ?  1106 GLY B O   1 
ATOM   4937 N N   . GLU B 1 231 ? 36.094  17.747  88.629  1.00 84.08  ?  1107 GLU B N   1 
ATOM   4938 C CA  . GLU B 1 231 ? 37.213  16.809  88.666  1.00 94.00  ?  1107 GLU B CA  1 
ATOM   4939 C C   . GLU B 1 231 ? 36.893  15.587  89.519  1.00 86.85  ?  1107 GLU B C   1 
ATOM   4940 O O   . GLU B 1 231 ? 37.026  14.446  89.064  1.00 76.99  ?  1107 GLU B O   1 
ATOM   4941 C CB  . GLU B 1 231 ? 38.467  17.515  89.179  1.00 105.37 ?  1107 GLU B CB  1 
ATOM   4942 N N   . THR B 1 232 ? 36.475  15.802  90.765  1.00 96.33  ?  1108 THR B N   1 
ATOM   4943 C CA  . THR B 1 232 ? 36.108  14.681  91.621  1.00 114.10 ?  1108 THR B CA  1 
ATOM   4944 C C   . THR B 1 232 ? 34.767  14.070  91.232  1.00 110.29 ?  1108 THR B C   1 
ATOM   4945 O O   . THR B 1 232 ? 34.482  12.932  91.620  1.00 101.62 ?  1108 THR B O   1 
ATOM   4946 C CB  . THR B 1 232 ? 36.078  15.120  93.090  1.00 101.40 ?  1108 THR B CB  1 
ATOM   4947 O OG1 . THR B 1 232 ? 35.300  16.316  93.220  1.00 107.21 ?  1108 THR B OG1 1 
ATOM   4948 C CG2 . THR B 1 232 ? 37.489  15.378  93.603  1.00 103.03 ?  1108 THR B CG2 1 
ATOM   4949 N N   . GLY B 1 233 ? 33.939  14.801  90.490  1.00 91.59  ?  1109 GLY B N   1 
ATOM   4950 C CA  . GLY B 1 233 ? 32.655  14.300  90.043  1.00 90.37  ?  1109 GLY B CA  1 
ATOM   4951 C C   . GLY B 1 233 ? 32.750  13.146  89.066  1.00 94.07  ?  1109 GLY B C   1 
ATOM   4952 O O   . GLY B 1 233 ? 32.193  12.071  89.310  1.00 106.14 ?  1109 GLY B O   1 
ATOM   4953 N N   . VAL B 1 234 ? 33.459  13.351  87.951  1.00 82.36  ?  1110 VAL B N   1 
ATOM   4954 C CA  . VAL B 1 234 ? 33.560  12.305  86.940  1.00 83.09  ?  1110 VAL B CA  1 
ATOM   4955 C C   . VAL B 1 234 ? 34.459  11.165  87.396  1.00 83.55  ?  1110 VAL B C   1 
ATOM   4956 O O   . VAL B 1 234 ? 34.393  10.068  86.830  1.00 75.79  ?  1110 VAL B O   1 
ATOM   4957 C CB  . VAL B 1 234 ? 34.065  12.876  85.601  1.00 73.36  ?  1110 VAL B CB  1 
ATOM   4958 C CG1 . VAL B 1 234 ? 33.204  14.047  85.160  1.00 81.73  ?  1110 VAL B CG1 1 
ATOM   4959 C CG2 . VAL B 1 234 ? 35.513  13.291  85.714  1.00 78.22  ?  1110 VAL B CG2 1 
ATOM   4960 N N   . ALA B 1 235 ? 35.306  11.390  88.403  1.00 90.42  ?  1111 ALA B N   1 
ATOM   4961 C CA  . ALA B 1 235 ? 36.109  10.305  88.957  1.00 102.09 ?  1111 ALA B CA  1 
ATOM   4962 C C   . ALA B 1 235 ? 35.245  9.212   89.570  1.00 97.31  ?  1111 ALA B C   1 
ATOM   4963 O O   . ALA B 1 235 ? 35.740  8.108   89.818  1.00 88.42  ?  1111 ALA B O   1 
ATOM   4964 C CB  . ALA B 1 235 ? 37.089  10.846  90.002  1.00 96.64  ?  1111 ALA B CB  1 
ATOM   4965 N N   . GLY B 1 236 ? 33.968  9.501   89.830  1.00 94.55  ?  1112 GLY B N   1 
ATOM   4966 C CA  . GLY B 1 236 ? 33.045  8.503   90.338  1.00 92.80  ?  1112 GLY B CA  1 
ATOM   4967 C C   . GLY B 1 236 ? 32.662  7.438   89.334  1.00 109.56 ?  1112 GLY B C   1 
ATOM   4968 O O   . GLY B 1 236 ? 32.180  6.372   89.733  1.00 136.75 ?  1112 GLY B O   1 
ATOM   4969 N N   . PHE B 1 237 ? 32.870  7.694   88.041  1.00 120.23 ?  1113 PHE B N   1 
ATOM   4970 C CA  . PHE B 1 237 ? 32.521  6.718   87.017  1.00 105.58 ?  1113 PHE B CA  1 
ATOM   4971 C C   . PHE B 1 237 ? 33.548  5.594   86.988  1.00 101.69 ?  1113 PHE B C   1 
ATOM   4972 O O   . PHE B 1 237 ? 34.133  5.306   85.941  1.00 103.05 ?  1113 PHE B O   1 
ATOM   4973 C CB  . PHE B 1 237 ? 32.412  7.393   85.647  1.00 95.50  ?  1113 PHE B CB  1 
ATOM   4974 C CG  . PHE B 1 237 ? 31.234  8.316   85.520  1.00 87.52  ?  1113 PHE B CG  1 
ATOM   4975 C CD1 . PHE B 1 237 ? 31.338  9.651   85.876  1.00 81.99  ?  1113 PHE B CD1 1 
ATOM   4976 C CD2 . PHE B 1 237 ? 30.021  7.848   85.043  1.00 74.22  ?  1113 PHE B CD2 1 
ATOM   4977 C CE1 . PHE B 1 237 ? 30.253  10.502  85.759  1.00 76.72  ?  1113 PHE B CE1 1 
ATOM   4978 C CE2 . PHE B 1 237 ? 28.932  8.696   84.925  1.00 74.55  ?  1113 PHE B CE2 1 
ATOM   4979 C CZ  . PHE B 1 237 ? 29.049  10.024  85.284  1.00 80.93  ?  1113 PHE B CZ  1 
ATOM   4980 N N   . THR B 1 238 ? 33.766  4.963   88.147  1.00 105.32 ?  1114 THR B N   1 
ATOM   4981 C CA  . THR B 1 238 ? 34.736  3.878   88.268  1.00 100.85 ?  1114 THR B CA  1 
ATOM   4982 C C   . THR B 1 238 ? 34.522  2.818   87.197  1.00 109.90 ?  1114 THR B C   1 
ATOM   4983 O O   . THR B 1 238 ? 35.484  2.287   86.632  1.00 101.77 ?  1114 THR B O   1 
ATOM   4984 C CB  . THR B 1 238 ? 34.631  3.250   89.662  1.00 98.29  ?  1114 THR B CB  1 
ATOM   4985 O OG1 . THR B 1 238 ? 34.885  4.246   90.658  1.00 99.75  ?  1114 THR B OG1 1 
ATOM   4986 C CG2 . THR B 1 238 ? 35.629  2.113   89.828  1.00 94.30  ?  1114 THR B CG2 1 
ATOM   4987 N N   . ASN B 1 239 ? 33.257  2.509   86.898  1.00 112.78 ?  1115 ASN B N   1 
ATOM   4988 C CA  . ASN B 1 239 ? 32.947  1.413   85.985  1.00 123.48 ?  1115 ASN B CA  1 
ATOM   4989 C C   . ASN B 1 239 ? 33.340  1.752   84.551  1.00 122.78 ?  1115 ASN B C   1 
ATOM   4990 O O   . ASN B 1 239 ? 33.849  0.892   83.823  1.00 124.39 ?  1115 ASN B O   1 
ATOM   4991 C CB  . ASN B 1 239 ? 31.456  1.072   86.076  1.00 135.11 ?  1115 ASN B CB  1 
ATOM   4992 C CG  . ASN B 1 239 ? 31.145  -0.351  85.627  1.00 148.65 ?  1115 ASN B CG  1 
ATOM   4993 O OD1 . ASN B 1 239 ? 32.029  -1.206  85.580  1.00 144.54 ?  1115 ASN B OD1 1 
ATOM   4994 N ND2 . ASN B 1 239 ? 29.879  -0.609  85.303  1.00 163.09 ?  1115 ASN B ND2 1 
ATOM   4995 N N   . SER B 1 240 ? 33.108  2.995   84.126  1.00 121.01 ?  1116 SER B N   1 
ATOM   4996 C CA  . SER B 1 240 ? 33.353  3.364   82.735  1.00 110.22 ?  1116 SER B CA  1 
ATOM   4997 C C   . SER B 1 240 ? 34.817  3.700   82.477  1.00 93.01  ?  1116 SER B C   1 
ATOM   4998 O O   . SER B 1 240 ? 35.338  3.416   81.391  1.00 96.36  ?  1116 SER B O   1 
ATOM   4999 C CB  . SER B 1 240 ? 32.466  4.547   82.341  1.00 115.61 ?  1116 SER B CB  1 
ATOM   5000 O OG  . SER B 1 240 ? 31.090  4.209   82.422  1.00 112.70 ?  1116 SER B OG  1 
ATOM   5001 N N   . LEU B 1 241 ? 35.485  4.327   83.449  1.00 66.42  ?  1117 LEU B N   1 
ATOM   5002 C CA  . LEU B 1 241 ? 36.867  4.747   83.241  1.00 61.48  ?  1117 LEU B CA  1 
ATOM   5003 C C   . LEU B 1 241 ? 37.783  3.553   83.008  1.00 74.31  ?  1117 LEU B C   1 
ATOM   5004 O O   . LEU B 1 241 ? 38.703  3.625   82.182  1.00 72.80  ?  1117 LEU B O   1 
ATOM   5005 C CB  . LEU B 1 241 ? 37.352  5.567   84.441  1.00 61.89  ?  1117 LEU B CB  1 
ATOM   5006 C CG  . LEU B 1 241 ? 36.619  6.882   84.741  1.00 68.19  ?  1117 LEU B CG  1 
ATOM   5007 C CD1 . LEU B 1 241 ? 37.071  7.497   86.065  1.00 56.72  ?  1117 LEU B CD1 1 
ATOM   5008 C CD2 . LEU B 1 241 ? 36.788  7.877   83.604  1.00 73.41  ?  1117 LEU B CD2 1 
ATOM   5009 N N   . ARG B 1 242 ? 37.527  2.437   83.696  1.00 94.84  ?  1118 ARG B N   1 
ATOM   5010 C CA  . ARG B 1 242 ? 38.360  1.250   83.529  1.00 105.16 ?  1118 ARG B CA  1 
ATOM   5011 C C   . ARG B 1 242 ? 38.286  0.726   82.101  1.00 113.74 ?  1118 ARG B C   1 
ATOM   5012 O O   . ARG B 1 242 ? 39.316  0.439   81.481  1.00 106.12 ?  1118 ARG B O   1 
ATOM   5013 C CB  . ARG B 1 242 ? 37.933  0.170   84.526  1.00 132.68 ?  1118 ARG B CB  1 
ATOM   5014 C CG  . ARG B 1 242 ? 38.641  -1.164  84.355  1.00 150.66 ?  1118 ARG B CG  1 
ATOM   5015 C CD  . ARG B 1 242 ? 40.136  -1.024  84.586  1.00 179.99 ?  1118 ARG B CD  1 
ATOM   5016 N NE  . ARG B 1 242 ? 40.819  -2.310  84.501  1.00 185.83 ?  1118 ARG B NE  1 
ATOM   5017 C CZ  . ARG B 1 242 ? 42.137  -2.463  84.560  1.00 183.50 ?  1118 ARG B CZ  1 
ATOM   5018 N NH1 . ARG B 1 242 ? 42.928  -1.407  84.703  1.00 182.74 ?  1118 ARG B NH1 1 
ATOM   5019 N NH2 . ARG B 1 242 ? 42.666  -3.677  84.473  1.00 172.71 ?  1118 ARG B NH2 1 
ATOM   5020 N N   . MET B 1 243 ? 37.075  0.599   81.558  1.00 129.56 ?  1119 MET B N   1 
ATOM   5021 C CA  . MET B 1 243 ? 36.931  0.089   80.201  1.00 119.80 ?  1119 MET B CA  1 
ATOM   5022 C C   . MET B 1 243 ? 37.285  1.126   79.145  1.00 119.64 ?  1119 MET B C   1 
ATOM   5023 O O   . MET B 1 243 ? 37.513  0.758   77.987  1.00 117.74 ?  1119 MET B O   1 
ATOM   5024 C CB  . MET B 1 243 ? 35.509  -0.432  79.980  1.00 119.17 ?  1119 MET B CB  1 
ATOM   5025 C CG  . MET B 1 243 ? 34.414  0.418   80.594  1.00 124.24 ?  1119 MET B CG  1 
ATOM   5026 S SD  . MET B 1 243 ? 32.824  -0.438  80.614  1.00 136.53 ?  1119 MET B SD  1 
ATOM   5027 C CE  . MET B 1 243 ? 33.174  -1.779  81.750  1.00 129.55 ?  1119 MET B CE  1 
ATOM   5028 N N   . LEU B 1 244 ? 37.333  2.407   79.509  1.00 111.86 ?  1120 LEU B N   1 
ATOM   5029 C CA  . LEU B 1 244 ? 37.932  3.381   78.604  1.00 94.63  ?  1120 LEU B CA  1 
ATOM   5030 C C   . LEU B 1 244 ? 39.441  3.194   78.530  1.00 93.71  ?  1120 LEU B C   1 
ATOM   5031 O O   . LEU B 1 244 ? 40.030  3.263   77.446  1.00 76.29  ?  1120 LEU B O   1 
ATOM   5032 C CB  . LEU B 1 244 ? 37.586  4.803   79.042  1.00 83.53  ?  1120 LEU B CB  1 
ATOM   5033 C CG  . LEU B 1 244 ? 36.197  5.322   78.670  1.00 73.82  ?  1120 LEU B CG  1 
ATOM   5034 C CD1 . LEU B 1 244 ? 35.999  6.703   79.252  1.00 57.54  ?  1120 LEU B CD1 1 
ATOM   5035 C CD2 . LEU B 1 244 ? 35.998  5.354   77.162  1.00 70.04  ?  1120 LEU B CD2 1 
ATOM   5036 N N   . GLN B 1 245 ? 40.083  2.936   79.672  1.00 90.67  ?  1121 GLN B N   1 
ATOM   5037 C CA  . GLN B 1 245 ? 41.519  2.686   79.652  1.00 88.20  ?  1121 GLN B CA  1 
ATOM   5038 C C   . GLN B 1 245 ? 41.866  1.388   78.929  1.00 80.42  ?  1121 GLN B C   1 
ATOM   5039 O O   . GLN B 1 245 ? 43.000  1.236   78.463  1.00 86.26  ?  1121 GLN B O   1 
ATOM   5040 C CB  . GLN B 1 245 ? 42.067  2.666   81.080  1.00 97.08  ?  1121 GLN B CB  1 
ATOM   5041 C CG  . GLN B 1 245 ? 43.584  2.770   81.179  1.00 107.27 ?  1121 GLN B CG  1 
ATOM   5042 C CD  . GLN B 1 245 ? 44.046  2.982   82.607  1.00 98.65  ?  1121 GLN B CD  1 
ATOM   5043 O OE1 . GLN B 1 245 ? 43.242  3.304   83.480  1.00 97.45  ?  1121 GLN B OE1 1 
ATOM   5044 N NE2 . GLN B 1 245 ? 45.340  2.796   82.856  1.00 100.24 ?  1121 GLN B NE2 1 
ATOM   5045 N N   . GLN B 1 246 ? 40.916  0.462   78.806  1.00 86.34  ?  1122 GLN B N   1 
ATOM   5046 C CA  . GLN B 1 246 ? 41.151  -0.831  78.177  1.00 95.15  ?  1122 GLN B CA  1 
ATOM   5047 C C   . GLN B 1 246 ? 40.829  -0.846  76.686  1.00 86.25  ?  1122 GLN B C   1 
ATOM   5048 O O   . GLN B 1 246 ? 40.726  -1.931  76.104  1.00 85.14  ?  1122 GLN B O   1 
ATOM   5049 C CB  . GLN B 1 246 ? 40.329  -1.915  78.874  1.00 111.54 ?  1122 GLN B CB  1 
ATOM   5050 C CG  . GLN B 1 246 ? 40.707  -2.179  80.319  1.00 105.86 ?  1122 GLN B CG  1 
ATOM   5051 C CD  . GLN B 1 246 ? 39.882  -3.297  80.937  1.00 108.31 ?  1122 GLN B CD  1 
ATOM   5052 O OE1 . GLN B 1 246 ? 38.691  -3.438  80.654  1.00 103.46 ?  1122 GLN B OE1 1 
ATOM   5053 N NE2 . GLN B 1 246 ? 40.517  -4.103  81.781  1.00 120.50 ?  1122 GLN B NE2 1 
ATOM   5054 N N   . LYS B 1 247 ? 40.644  0.321   76.065  1.00 88.76  ?  1123 LYS B N   1 
ATOM   5055 C CA  . LYS B 1 247 ? 40.295  0.487   74.654  1.00 87.60  ?  1123 LYS B CA  1 
ATOM   5056 C C   . LYS B 1 247 ? 38.949  -0.130  74.293  1.00 89.14  ?  1123 LYS B C   1 
ATOM   5057 O O   . LYS B 1 247 ? 38.634  -0.245  73.103  1.00 80.51  ?  1123 LYS B O   1 
ATOM   5058 C CB  . LYS B 1 247 ? 41.372  -0.084  73.721  1.00 84.91  ?  1123 LYS B CB  1 
ATOM   5059 C CG  . LYS B 1 247 ? 42.783  0.398   74.005  1.00 75.86  ?  1123 LYS B CG  1 
ATOM   5060 C CD  . LYS B 1 247 ? 42.901  1.907   73.924  1.00 79.11  ?  1123 LYS B CD  1 
ATOM   5061 C CE  . LYS B 1 247 ? 44.360  2.321   73.927  1.00 88.48  ?  1123 LYS B CE  1 
ATOM   5062 N NZ  . LYS B 1 247 ? 44.551  3.730   74.355  1.00 97.60  ?  1123 LYS B NZ  1 
ATOM   5063 N N   . ARG B 1 248 ? 38.145  -0.538  75.277  1.00 88.37  ?  1124 ARG B N   1 
ATOM   5064 C CA  . ARG B 1 248 ? 36.835  -1.139  75.013  1.00 97.03  ?  1124 ARG B CA  1 
ATOM   5065 C C   . ARG B 1 248 ? 35.796  -0.027  74.992  1.00 95.07  ?  1124 ARG B C   1 
ATOM   5066 O O   . ARG B 1 248 ? 35.150  0.274   75.996  1.00 93.96  ?  1124 ARG B O   1 
ATOM   5067 C CB  . ARG B 1 248 ? 36.502  -2.207  76.047  1.00 97.62  ?  1124 ARG B CB  1 
ATOM   5068 C CG  . ARG B 1 248 ? 37.372  -3.445  75.949  1.00 97.32  ?  1124 ARG B CG  1 
ATOM   5069 C CD  . ARG B 1 248 ? 36.823  -4.586  76.792  1.00 111.06 ?  1124 ARG B CD  1 
ATOM   5070 N NE  . ARG B 1 248 ? 36.703  -4.241  78.206  1.00 123.35 ?  1124 ARG B NE  1 
ATOM   5071 C CZ  . ARG B 1 248 ? 36.310  -5.093  79.147  1.00 112.40 ?  1124 ARG B CZ  1 
ATOM   5072 N NH1 . ARG B 1 248 ? 36.001  -6.343  78.824  1.00 103.75 ?  1124 ARG B NH1 1 
ATOM   5073 N NH2 . ARG B 1 248 ? 36.228  -4.700  80.411  1.00 106.84 ?  1124 ARG B NH2 1 
ATOM   5074 N N   . TRP B 1 249 ? 35.627  0.583   73.816  1.00 103.15 ?  1125 TRP B N   1 
ATOM   5075 C CA  . TRP B 1 249 ? 34.830  1.802   73.719  1.00 92.76  ?  1125 TRP B CA  1 
ATOM   5076 C C   . TRP B 1 249 ? 33.336  1.511   73.790  1.00 98.31  ?  1125 TRP B C   1 
ATOM   5077 O O   . TRP B 1 249 ? 32.592  2.233   74.462  1.00 106.41 ?  1125 TRP B O   1 
ATOM   5078 C CB  . TRP B 1 249 ? 35.159  2.550   72.426  1.00 69.34  ?  1125 TRP B CB  1 
ATOM   5079 C CG  . TRP B 1 249 ? 36.633  2.658   72.137  1.00 63.20  ?  1125 TRP B CG  1 
ATOM   5080 C CD1 . TRP B 1 249 ? 37.299  2.130   71.068  1.00 59.75  ?  1125 TRP B CD1 1 
ATOM   5081 C CD2 . TRP B 1 249 ? 37.623  3.324   72.936  1.00 64.77  ?  1125 TRP B CD2 1 
ATOM   5082 N NE1 . TRP B 1 249 ? 38.638  2.430   71.148  1.00 69.27  ?  1125 TRP B NE1 1 
ATOM   5083 C CE2 . TRP B 1 249 ? 38.863  3.161   72.285  1.00 71.02  ?  1125 TRP B CE2 1 
ATOM   5084 C CE3 . TRP B 1 249 ? 37.580  4.044   74.135  1.00 68.45  ?  1125 TRP B CE3 1 
ATOM   5085 C CZ2 . TRP B 1 249 ? 40.048  3.689   72.791  1.00 70.49  ?  1125 TRP B CZ2 1 
ATOM   5086 C CZ3 . TRP B 1 249 ? 38.762  4.567   74.639  1.00 66.79  ?  1125 TRP B CZ3 1 
ATOM   5087 C CH2 . TRP B 1 249 ? 39.979  4.387   73.965  1.00 72.51  ?  1125 TRP B CH2 1 
ATOM   5088 N N   . ASP B 1 250 ? 32.876  0.473   73.089  1.00 92.87  ?  1126 ASP B N   1 
ATOM   5089 C CA  . ASP B 1 250 ? 31.440  0.242   72.961  1.00 100.10 ?  1126 ASP B CA  1 
ATOM   5090 C C   . ASP B 1 250 ? 30.815  -0.190  74.287  1.00 93.49  ?  1126 ASP B C   1 
ATOM   5091 O O   . ASP B 1 250 ? 29.714  0.274   74.646  1.00 98.89  ?  1126 ASP B O   1 
ATOM   5092 C CB  . ASP B 1 250 ? 31.192  -0.794  71.859  1.00 101.87 ?  1126 ASP B CB  1 
ATOM   5093 C CG  . ASP B 1 250 ? 31.826  -0.394  70.527  1.00 125.81 ?  1126 ASP B CG  1 
ATOM   5094 O OD1 . ASP B 1 250 ? 33.001  -0.749  70.294  1.00 134.81 ?  1126 ASP B OD1 1 
ATOM   5095 O OD2 . ASP B 1 250 ? 31.153  0.271   69.710  1.00 130.78 -1 1126 ASP B OD2 1 
ATOM   5096 N N   . GLU B 1 251 ? 31.522  -1.035  75.044  1.00 91.99  ?  1127 GLU B N   1 
ATOM   5097 C CA  . GLU B 1 251 ? 31.072  -1.402  76.382  1.00 104.80 ?  1127 GLU B CA  1 
ATOM   5098 C C   . GLU B 1 251 ? 30.929  -0.164  77.255  1.00 107.41 ?  1127 GLU B C   1 
ATOM   5099 O O   . GLU B 1 251 ? 29.916  0.011   77.944  1.00 102.18 ?  1127 GLU B O   1 
ATOM   5100 C CB  . GLU B 1 251 ? 32.063  -2.396  77.003  1.00 117.13 ?  1127 GLU B CB  1 
ATOM   5101 C CG  . GLU B 1 251 ? 31.581  -3.131  78.255  1.00 135.68 ?  1127 GLU B CG  1 
ATOM   5102 C CD  . GLU B 1 251 ? 32.535  -4.240  78.702  1.00 141.95 ?  1127 GLU B CD  1 
ATOM   5103 O OE1 . GLU B 1 251 ? 33.375  -4.667  77.884  1.00 131.60 ?  1127 GLU B OE1 1 
ATOM   5104 O OE2 . GLU B 1 251 ? 32.449  -4.682  79.868  1.00 135.18 -1 1127 GLU B OE2 1 
ATOM   5105 N N   . ALA B 1 252 ? 31.907  0.741   77.184  1.00 106.74 ?  1128 ALA B N   1 
ATOM   5106 C CA  . ALA B 1 252 ? 31.843  1.957   77.983  1.00 103.77 ?  1128 ALA B CA  1 
ATOM   5107 C C   . ALA B 1 252 ? 30.740  2.890   77.504  1.00 105.20 ?  1128 ALA B C   1 
ATOM   5108 O O   . ALA B 1 252 ? 30.165  3.622   78.309  1.00 99.31  ?  1128 ALA B O   1 
ATOM   5109 C CB  . ALA B 1 252 ? 33.187  2.682   77.962  1.00 92.77  ?  1128 ALA B CB  1 
ATOM   5110 N N   . ALA B 1 253 ? 30.419  2.880   76.211  1.00 93.49  ?  1129 ALA B N   1 
ATOM   5111 C CA  . ALA B 1 253 ? 29.315  3.708   75.738  1.00 89.26  ?  1129 ALA B CA  1 
ATOM   5112 C C   . ALA B 1 253 ? 28.005  3.260   76.368  1.00 91.47  ?  1129 ALA B C   1 
ATOM   5113 O O   . ALA B 1 253 ? 27.272  4.062   76.974  1.00 99.21  ?  1129 ALA B O   1 
ATOM   5114 C CB  . ALA B 1 253 ? 29.229  3.651   74.214  1.00 78.72  ?  1129 ALA B CB  1 
ATOM   5115 N N   . VAL B 1 254 ? 27.711  1.962   76.268  1.00 95.23  ?  1130 VAL B N   1 
ATOM   5116 C CA  . VAL B 1 254 ? 26.448  1.514   76.848  1.00 110.04 ?  1130 VAL B CA  1 
ATOM   5117 C C   . VAL B 1 254 ? 26.488  1.682   78.362  1.00 119.25 ?  1130 VAL B C   1 
ATOM   5118 O O   . VAL B 1 254 ? 25.452  1.926   78.992  1.00 115.67 ?  1130 VAL B O   1 
ATOM   5119 C CB  . VAL B 1 254 ? 26.100  0.065   76.440  1.00 102.79 ?  1130 VAL B CB  1 
ATOM   5120 C CG1 . VAL B 1 254 ? 27.072  -0.941  77.034  1.00 106.65 ?  1130 VAL B CG1 1 
ATOM   5121 C CG2 . VAL B 1 254 ? 24.675  -0.275  76.855  1.00 92.96  ?  1130 VAL B CG2 1 
ATOM   5122 N N   . ASN B 1 255 ? 27.679  1.614   78.969  1.00 121.73 ?  1131 ASN B N   1 
ATOM   5123 C CA  . ASN B 1 255 ? 27.756  1.766   80.419  1.00 103.96 ?  1131 ASN B CA  1 
ATOM   5124 C C   . ASN B 1 255 ? 27.531  3.214   80.837  1.00 103.45 ?  1131 ASN B C   1 
ATOM   5125 O O   . ASN B 1 255 ? 26.897  3.474   81.865  1.00 110.62 ?  1131 ASN B O   1 
ATOM   5126 C CB  . ASN B 1 255 ? 29.100  1.255   80.949  1.00 100.31 ?  1131 ASN B CB  1 
ATOM   5127 C CG  . ASN B 1 255 ? 29.107  1.116   82.471  1.00 109.71 ?  1131 ASN B CG  1 
ATOM   5128 O OD1 . ASN B 1 255 ? 28.490  0.203   83.026  1.00 113.56 ?  1131 ASN B OD1 1 
ATOM   5129 N ND2 . ASN B 1 255 ? 29.798  2.027   83.149  1.00 128.75 ?  1131 ASN B ND2 1 
ATOM   5130 N N   . LEU B 1 256 ? 28.046  4.168   80.061  1.00 97.76  ?  1132 LEU B N   1 
ATOM   5131 C CA  . LEU B 1 256 ? 27.838  5.580   80.353  1.00 106.18 ?  1132 LEU B CA  1 
ATOM   5132 C C   . LEU B 1 256 ? 26.400  6.003   80.123  1.00 109.66 ?  1132 LEU B C   1 
ATOM   5133 O O   . LEU B 1 256 ? 25.958  7.001   80.705  1.00 108.64 ?  1132 LEU B O   1 
ATOM   5134 C CB  . LEU B 1 256 ? 28.768  6.443   79.500  1.00 119.20 ?  1132 LEU B CB  1 
ATOM   5135 C CG  . LEU B 1 256 ? 30.218  6.598   79.965  1.00 102.13 ?  1132 LEU B CG  1 
ATOM   5136 C CD1 . LEU B 1 256 ? 31.063  7.170   78.845  1.00 116.19 ?  1132 LEU B CD1 1 
ATOM   5137 C CD2 . LEU B 1 256 ? 30.296  7.490   81.194  1.00 94.12  ?  1132 LEU B CD2 1 
ATOM   5138 N N   . ALA B 1 257 ? 25.660  5.278   79.285  1.00 107.65 ?  1133 ALA B N   1 
ATOM   5139 C CA  . ALA B 1 257 ? 24.242  5.604   79.172  1.00 110.41 ?  1133 ALA B CA  1 
ATOM   5140 C C   . ALA B 1 257 ? 23.481  5.298   80.463  1.00 110.79 ?  1133 ALA B C   1 
ATOM   5141 O O   . ALA B 1 257 ? 22.459  5.936   80.742  1.00 100.69 ?  1133 ALA B O   1 
ATOM   5142 C CB  . ALA B 1 257 ? 23.622  4.864   77.993  1.00 113.93 ?  1133 ALA B CB  1 
ATOM   5143 N N   . LYS B 1 258 ? 23.955  4.347   81.268  1.00 120.49 ?  1134 LYS B N   1 
ATOM   5144 C CA  . LYS B 1 258 ? 23.275  4.040   82.529  1.00 112.42 ?  1134 LYS B CA  1 
ATOM   5145 C C   . LYS B 1 258 ? 23.723  4.945   83.666  1.00 115.95 ?  1134 LYS B C   1 
ATOM   5146 O O   . LYS B 1 258 ? 24.041  4.456   84.754  1.00 137.25 ?  1134 LYS B O   1 
ATOM   5147 C CB  . LYS B 1 258 ? 23.506  2.583   82.910  1.00 112.82 ?  1134 LYS B CB  1 
ATOM   5148 C CG  . LYS B 1 258 ? 23.432  1.580   81.783  1.00 115.52 ?  1134 LYS B CG  1 
ATOM   5149 C CD  . LYS B 1 258 ? 23.939  0.229   82.273  1.00 96.88  ?  1134 LYS B CD  1 
ATOM   5150 C CE  . LYS B 1 258 ? 24.051  -0.779  81.145  1.00 85.55  ?  1134 LYS B CE  1 
ATOM   5151 N NZ  . LYS B 1 258 ? 22.733  -1.005  80.488  1.00 88.51  ?  1134 LYS B NZ  1 
ATOM   5152 N N   . SER B 1 259 ? 23.722  6.256   83.469  1.00 107.99 ?  1135 SER B N   1 
ATOM   5153 C CA  . SER B 1 259 ? 24.284  7.189   84.432  1.00 101.45 ?  1135 SER B CA  1 
ATOM   5154 C C   . SER B 1 259 ? 23.243  8.208   84.868  1.00 92.41  ?  1135 SER B C   1 
ATOM   5155 O O   . SER B 1 259 ? 22.188  8.372   84.249  1.00 80.39  ?  1135 SER B O   1 
ATOM   5156 C CB  . SER B 1 259 ? 25.504  7.905   83.840  1.00 102.52 ?  1135 SER B CB  1 
ATOM   5157 O OG  . SER B 1 259 ? 26.516  6.978   83.490  1.00 121.41 ?  1135 SER B OG  1 
ATOM   5158 N N   . ARG B 1 260 ? 23.567  8.902   85.958  1.00 97.58  ?  1136 ARG B N   1 
ATOM   5159 C CA  . ARG B 1 260 ? 22.818  10.100  86.312  1.00 105.38 ?  1136 ARG B CA  1 
ATOM   5160 C C   . ARG B 1 260 ? 23.074  11.203  85.293  1.00 102.28 ?  1136 ARG B C   1 
ATOM   5161 O O   . ARG B 1 260 ? 22.168  11.972  84.946  1.00 92.40  ?  1136 ARG B O   1 
ATOM   5162 C CB  . ARG B 1 260 ? 23.192  10.558  87.728  1.00 104.36 ?  1136 ARG B CB  1 
ATOM   5163 C CG  . ARG B 1 260 ? 24.617  11.115  87.916  1.00 113.08 ?  1136 ARG B CG  1 
ATOM   5164 C CD  . ARG B 1 260 ? 25.687  10.021  87.990  1.00 132.17 ?  1136 ARG B CD  1 
ATOM   5165 N NE  . ARG B 1 260 ? 26.990  10.556  88.381  1.00 130.86 ?  1136 ARG B NE  1 
ATOM   5166 C CZ  . ARG B 1 260 ? 28.065  9.815   88.637  1.00 126.49 ?  1136 ARG B CZ  1 
ATOM   5167 N NH1 . ARG B 1 260 ? 28.005  8.492   88.546  1.00 119.96 ?  1136 ARG B NH1 1 
ATOM   5168 N NH2 . ARG B 1 260 ? 29.203  10.398  88.991  1.00 134.82 ?  1136 ARG B NH2 1 
ATOM   5169 N N   . TRP B 1 261 ? 24.304  11.262  84.780  1.00 103.26 ?  1137 TRP B N   1 
ATOM   5170 C CA  . TRP B 1 261 ? 24.693  12.285  83.818  1.00 97.86  ?  1137 TRP B CA  1 
ATOM   5171 C C   . TRP B 1 261 ? 23.899  12.159  82.525  1.00 103.38 ?  1137 TRP B C   1 
ATOM   5172 O O   . TRP B 1 261 ? 23.514  13.168  81.920  1.00 87.09  ?  1137 TRP B O   1 
ATOM   5173 C CB  . TRP B 1 261 ? 26.198  12.172  83.563  1.00 84.98  ?  1137 TRP B CB  1 
ATOM   5174 C CG  . TRP B 1 261 ? 26.732  12.976  82.426  1.00 85.26  ?  1137 TRP B CG  1 
ATOM   5175 C CD1 . TRP B 1 261 ? 26.632  14.324  82.249  1.00 76.84  ?  1137 TRP B CD1 1 
ATOM   5176 C CD2 . TRP B 1 261 ? 27.492  12.481  81.321  1.00 71.13  ?  1137 TRP B CD2 1 
ATOM   5177 N NE1 . TRP B 1 261 ? 27.270  14.697  81.089  1.00 72.30  ?  1137 TRP B NE1 1 
ATOM   5178 C CE2 . TRP B 1 261 ? 27.805  13.582  80.500  1.00 70.32  ?  1137 TRP B CE2 1 
ATOM   5179 C CE3 . TRP B 1 261 ? 27.928  11.210  80.940  1.00 65.24  ?  1137 TRP B CE3 1 
ATOM   5180 C CZ2 . TRP B 1 261 ? 28.536  13.450  79.323  1.00 75.99  ?  1137 TRP B CZ2 1 
ATOM   5181 C CZ3 . TRP B 1 261 ? 28.651  11.080  79.777  1.00 69.88  ?  1137 TRP B CZ3 1 
ATOM   5182 C CH2 . TRP B 1 261 ? 28.948  12.192  78.980  1.00 76.30  ?  1137 TRP B CH2 1 
ATOM   5183 N N   . TYR B 1 262 ? 23.625  10.928  82.095  1.00 100.80 ?  1138 TYR B N   1 
ATOM   5184 C CA  . TYR B 1 262 ? 22.927  10.729  80.830  1.00 96.71  ?  1138 TYR B CA  1 
ATOM   5185 C C   . TYR B 1 262 ? 21.453  11.095  80.938  1.00 97.17  ?  1138 TYR B C   1 
ATOM   5186 O O   . TYR B 1 262 ? 20.864  11.607  79.979  1.00 108.53 ?  1138 TYR B O   1 
ATOM   5187 C CB  . TYR B 1 262 ? 23.082  9.280   80.368  1.00 99.54  ?  1138 TYR B CB  1 
ATOM   5188 C CG  . TYR B 1 262 ? 22.423  9.003   79.039  1.00 119.14 ?  1138 TYR B CG  1 
ATOM   5189 C CD1 . TYR B 1 262 ? 23.082  9.278   77.847  1.00 119.91 ?  1138 TYR B CD1 1 
ATOM   5190 C CD2 . TYR B 1 262 ? 21.139  8.476   78.972  1.00 124.71 ?  1138 TYR B CD2 1 
ATOM   5191 C CE1 . TYR B 1 262 ? 22.484  9.036   76.630  1.00 126.81 ?  1138 TYR B CE1 1 
ATOM   5192 C CE2 . TYR B 1 262 ? 20.533  8.231   77.756  1.00 129.76 ?  1138 TYR B CE2 1 
ATOM   5193 C CZ  . TYR B 1 262 ? 21.211  8.513   76.590  1.00 127.77 ?  1138 TYR B CZ  1 
ATOM   5194 O OH  . TYR B 1 262 ? 20.615  8.271   75.377  1.00 138.03 ?  1138 TYR B OH  1 
ATOM   5195 N N   . ASN B 1 263 ? 20.832  10.818  82.084  1.00 105.04 ?  1139 ASN B N   1 
ATOM   5196 C CA  . ASN B 1 263 ? 19.412  11.113  82.235  1.00 93.35  ?  1139 ASN B CA  1 
ATOM   5197 C C   . ASN B 1 263 ? 19.166  12.565  82.621  1.00 93.17  ?  1139 ASN B C   1 
ATOM   5198 O O   . ASN B 1 263 ? 18.070  13.086  82.384  1.00 99.28  ?  1139 ASN B O   1 
ATOM   5199 C CB  . ASN B 1 263 ? 18.779  10.168  83.263  1.00 97.89  ?  1139 ASN B CB  1 
ATOM   5200 C CG  . ASN B 1 263 ? 18.831  8.713   82.822  1.00 110.45 ?  1139 ASN B CG  1 
ATOM   5201 O OD1 . ASN B 1 263 ? 19.769  8.300   82.138  1.00 128.61 ?  1139 ASN B OD1 1 
ATOM   5202 N ND2 . ASN B 1 263 ? 17.818  7.935   83.197  1.00 99.73  ?  1139 ASN B ND2 1 
ATOM   5203 N N   . GLN B 1 264 ? 20.156  13.230  83.220  1.00 93.65  ?  1140 GLN B N   1 
ATOM   5204 C CA  . GLN B 1 264 ? 19.972  14.631  83.584  1.00 95.11  ?  1140 GLN B CA  1 
ATOM   5205 C C   . GLN B 1 264 ? 20.088  15.539  82.363  1.00 108.89 ?  1140 GLN B C   1 
ATOM   5206 O O   . GLN B 1 264 ? 19.204  16.364  82.107  1.00 143.81 ?  1140 GLN B O   1 
ATOM   5207 C CB  . GLN B 1 264 ? 20.989  15.033  84.654  1.00 107.52 ?  1140 GLN B CB  1 
ATOM   5208 C CG  . GLN B 1 264 ? 20.720  16.388  85.305  1.00 106.02 ?  1140 GLN B CG  1 
ATOM   5209 C CD  . GLN B 1 264 ? 19.611  16.337  86.344  1.00 103.86 ?  1140 GLN B CD  1 
ATOM   5210 O OE1 . GLN B 1 264 ? 18.426  16.420  86.016  1.00 118.25 ?  1140 GLN B OE1 1 
ATOM   5211 N NE2 . GLN B 1 264 ? 19.995  16.196  87.605  1.00 97.60  ?  1140 GLN B NE2 1 
ATOM   5212 N N   . THR B 1 265 ? 21.171  15.401  81.598  1.00 104.13 ?  1141 THR B N   1 
ATOM   5213 C CA  . THR B 1 265 ? 21.422  16.207  80.401  1.00 97.10  ?  1141 THR B CA  1 
ATOM   5214 C C   . THR B 1 265 ? 21.701  15.267  79.235  1.00 82.80  ?  1141 THR B C   1 
ATOM   5215 O O   . THR B 1 265 ? 22.862  14.963  78.927  1.00 77.18  ?  1141 THR B O   1 
ATOM   5216 C CB  . THR B 1 265 ? 22.586  17.177  80.615  1.00 97.70  ?  1141 THR B CB  1 
ATOM   5217 O OG1 . THR B 1 265 ? 23.733  16.455  81.078  1.00 101.22 ?  1141 THR B OG1 1 
ATOM   5218 C CG2 . THR B 1 265 ? 22.219  18.247  81.636  1.00 97.74  ?  1141 THR B CG2 1 
ATOM   5219 N N   . PRO B 1 266 ? 20.653  14.796  78.554  1.00 103.66 ?  1142 PRO B N   1 
ATOM   5220 C CA  . PRO B 1 266 ? 20.858  13.710  77.578  1.00 108.75 ?  1142 PRO B CA  1 
ATOM   5221 C C   . PRO B 1 266 ? 21.515  14.155  76.282  1.00 105.31 ?  1142 PRO B C   1 
ATOM   5222 O O   . PRO B 1 266 ? 22.358  13.424  75.743  1.00 90.33  ?  1142 PRO B O   1 
ATOM   5223 C CB  . PRO B 1 266 ? 19.434  13.187  77.349  1.00 89.61  ?  1142 PRO B CB  1 
ATOM   5224 C CG  . PRO B 1 266 ? 18.550  14.376  77.620  1.00 87.96  ?  1142 PRO B CG  1 
ATOM   5225 C CD  . PRO B 1 266 ? 19.236  15.184  78.686  1.00 91.93  ?  1142 PRO B CD  1 
ATOM   5226 N N   . ASN B 1 267 ? 21.159  15.336  75.767  1.00 98.55  ?  1143 ASN B N   1 
ATOM   5227 C CA  . ASN B 1 267 ? 21.663  15.759  74.462  1.00 92.86  ?  1143 ASN B CA  1 
ATOM   5228 C C   . ASN B 1 267 ? 23.165  16.020  74.487  1.00 93.81  ?  1143 ASN B C   1 
ATOM   5229 O O   . ASN B 1 267 ? 23.855  15.756  73.495  1.00 102.99 ?  1143 ASN B O   1 
ATOM   5230 C CB  . ASN B 1 267 ? 20.913  17.006  73.981  1.00 96.14  ?  1143 ASN B CB  1 
ATOM   5231 C CG  . ASN B 1 267 ? 19.432  16.744  73.740  1.00 95.05  ?  1143 ASN B CG  1 
ATOM   5232 O OD1 . ASN B 1 267 ? 19.003  15.594  73.638  1.00 103.27 ?  1143 ASN B OD1 1 
ATOM   5233 N ND2 . ASN B 1 267 ? 18.649  17.813  73.629  1.00 113.60 ?  1143 ASN B ND2 1 
ATOM   5234 N N   . ARG B 1 268 ? 23.688  16.539  75.599  1.00 82.65  ?  1144 ARG B N   1 
ATOM   5235 C CA  . ARG B 1 268 ? 25.129  16.743  75.723  1.00 66.76  ?  1144 ARG B CA  1 
ATOM   5236 C C   . ARG B 1 268 ? 25.843  15.420  75.972  1.00 64.98  ?  1144 ARG B C   1 
ATOM   5237 O O   . ARG B 1 268 ? 26.927  15.163  75.417  1.00 73.70  ?  1144 ARG B O   1 
ATOM   5238 C CB  . ARG B 1 268 ? 25.412  17.735  76.857  1.00 69.77  ?  1144 ARG B CB  1 
ATOM   5239 C CG  . ARG B 1 268 ? 26.865  18.144  77.015  1.00 59.75  ?  1144 ARG B CG  1 
ATOM   5240 C CD  . ARG B 1 268 ? 27.092  18.903  78.314  1.00 76.37  ?  1144 ARG B CD  1 
ATOM   5241 N NE  . ARG B 1 268 ? 28.504  19.206  78.512  1.00 86.72  ?  1144 ARG B NE  1 
ATOM   5242 C CZ  . ARG B 1 268 ? 29.006  20.434  78.563  1.00 81.43  ?  1144 ARG B CZ  1 
ATOM   5243 N NH1 . ARG B 1 268 ? 28.210  21.490  78.450  1.00 73.45  ?  1144 ARG B NH1 1 
ATOM   5244 N NH2 . ARG B 1 268 ? 30.307  20.603  78.742  1.00 69.98  ?  1144 ARG B NH2 1 
ATOM   5245 N N   . ALA B 1 269 ? 25.222  14.560  76.783  1.00 65.86  ?  1145 ALA B N   1 
ATOM   5246 C CA  . ALA B 1 269 ? 25.823  13.278  77.123  1.00 68.16  ?  1145 ALA B CA  1 
ATOM   5247 C C   . ALA B 1 269 ? 25.982  12.394  75.896  1.00 69.37  ?  1145 ALA B C   1 
ATOM   5248 O O   . ALA B 1 269 ? 27.003  11.719  75.751  1.00 65.16  ?  1145 ALA B O   1 
ATOM   5249 C CB  . ALA B 1 269 ? 24.989  12.569  78.189  1.00 73.90  ?  1145 ALA B CB  1 
ATOM   5250 N N   . LYS B 1 270 ? 24.991  12.380  75.001  1.00 69.91  ?  1146 LYS B N   1 
ATOM   5251 C CA  . LYS B 1 270 ? 25.110  11.538  73.814  1.00 68.87  ?  1146 LYS B CA  1 
ATOM   5252 C C   . LYS B 1 270 ? 26.225  12.017  72.893  1.00 67.52  ?  1146 LYS B C   1 
ATOM   5253 O O   . LYS B 1 270 ? 26.934  11.195  72.303  1.00 66.18  ?  1146 LYS B O   1 
ATOM   5254 C CB  . LYS B 1 270 ? 23.778  11.483  73.062  1.00 58.53  ?  1146 LYS B CB  1 
ATOM   5255 N N   . ARG B 1 271 ? 26.413  13.333  72.776  1.00 59.80  ?  1147 ARG B N   1 
ATOM   5256 C CA  . ARG B 1 271 ? 27.529  13.837  71.982  1.00 58.59  ?  1147 ARG B CA  1 
ATOM   5257 C C   . ARG B 1 271 ? 28.859  13.390  72.575  1.00 65.38  ?  1147 ARG B C   1 
ATOM   5258 O O   . ARG B 1 271 ? 29.726  12.869  71.856  1.00 60.01  ?  1147 ARG B O   1 
ATOM   5259 C CB  . ARG B 1 271 ? 27.475  15.365  71.890  1.00 60.47  ?  1147 ARG B CB  1 
ATOM   5260 C CG  . ARG B 1 271 ? 26.340  15.905  71.029  1.00 60.23  ?  1147 ARG B CG  1 
ATOM   5261 C CD  . ARG B 1 271 ? 26.443  17.417  70.832  1.00 61.92  ?  1147 ARG B CD  1 
ATOM   5262 N NE  . ARG B 1 271 ? 26.171  18.158  72.062  1.00 64.40  ?  1147 ARG B NE  1 
ATOM   5263 C CZ  . ARG B 1 271 ? 24.981  18.652  72.389  1.00 78.51  ?  1147 ARG B CZ  1 
ATOM   5264 N NH1 . ARG B 1 271 ? 23.948  18.488  71.573  1.00 78.08  ?  1147 ARG B NH1 1 
ATOM   5265 N NH2 . ARG B 1 271 ? 24.823  19.311  73.530  1.00 83.91  ?  1147 ARG B NH2 1 
ATOM   5266 N N   . VAL B 1 272 ? 29.025  13.548  73.893  1.00 50.66  ?  1148 VAL B N   1 
ATOM   5267 C CA  . VAL B 1 272 ? 30.294  13.163  74.515  1.00 47.04  ?  1148 VAL B CA  1 
ATOM   5268 C C   . VAL B 1 272 ? 30.514  11.654  74.407  1.00 51.93  ?  1148 VAL B C   1 
ATOM   5269 O O   . VAL B 1 272 ? 31.633  11.185  74.152  1.00 50.61  ?  1148 VAL B O   1 
ATOM   5270 C CB  . VAL B 1 272 ? 30.348  13.650  75.975  1.00 52.09  ?  1148 VAL B CB  1 
ATOM   5271 C CG1 . VAL B 1 272 ? 31.656  13.242  76.617  1.00 58.96  ?  1148 VAL B CG1 1 
ATOM   5272 C CG2 . VAL B 1 272 ? 30.189  15.162  76.027  1.00 53.48  ?  1148 VAL B CG2 1 
ATOM   5273 N N   . ILE B 1 273 ? 29.451  10.869  74.590  1.00 52.15  ?  1149 ILE B N   1 
ATOM   5274 C CA  . ILE B 1 273 ? 29.571  9.416   74.530  1.00 60.39  ?  1149 ILE B CA  1 
ATOM   5275 C C   . ILE B 1 273 ? 29.909  8.966   73.118  1.00 69.22  ?  1149 ILE B C   1 
ATOM   5276 O O   . ILE B 1 273 ? 30.678  8.019   72.927  1.00 77.03  ?  1149 ILE B O   1 
ATOM   5277 C CB  . ILE B 1 273 ? 28.279  8.748   75.039  1.00 67.43  ?  1149 ILE B CB  1 
ATOM   5278 C CG1 . ILE B 1 273 ? 28.078  9.021   76.526  1.00 72.87  ?  1149 ILE B CG1 1 
ATOM   5279 C CG2 . ILE B 1 273 ? 28.304  7.246   74.792  1.00 53.00  ?  1149 ILE B CG2 1 
ATOM   5280 C CD1 . ILE B 1 273 ? 26.738  8.537   77.047  1.00 78.79  ?  1149 ILE B CD1 1 
ATOM   5281 N N   . THR B 1 274 ? 29.331  9.621   72.108  1.00 70.39  ?  1150 THR B N   1 
ATOM   5282 C CA  . THR B 1 274 ? 29.696  9.310   70.733  1.00 70.18  ?  1150 THR B CA  1 
ATOM   5283 C C   . THR B 1 274 ? 31.161  9.622   70.489  1.00 72.72  ?  1150 THR B C   1 
ATOM   5284 O O   . THR B 1 274 ? 31.863  8.855   69.821  1.00 69.18  ?  1150 THR B O   1 
ATOM   5285 C CB  . THR B 1 274 ? 28.813  10.090  69.757  1.00 71.57  ?  1150 THR B CB  1 
ATOM   5286 O OG1 . THR B 1 274 ? 27.441  9.727   69.948  1.00 90.42  ?  1150 THR B OG1 1 
ATOM   5287 C CG2 . THR B 1 274 ? 29.206  9.795   68.316  1.00 63.28  ?  1150 THR B CG2 1 
ATOM   5288 N N   . THR B 1 275 ? 31.642  10.745  71.026  1.00 66.36  ?  1151 THR B N   1 
ATOM   5289 C CA  . THR B 1 275 ? 33.053  11.075  70.852  1.00 56.94  ?  1151 THR B CA  1 
ATOM   5290 C C   . THR B 1 275 ? 33.943  10.018  71.493  1.00 54.55  ?  1151 THR B C   1 
ATOM   5291 O O   . THR B 1 275 ? 35.004  9.684   70.954  1.00 51.03  ?  1151 THR B O   1 
ATOM   5292 C CB  . THR B 1 275 ? 33.357  12.454  71.433  1.00 54.18  ?  1151 THR B CB  1 
ATOM   5293 O OG1 . THR B 1 275 ? 32.472  13.419  70.856  1.00 65.16  ?  1151 THR B OG1 1 
ATOM   5294 C CG2 . THR B 1 275 ? 34.798  12.856  71.126  1.00 45.67  ?  1151 THR B CG2 1 
ATOM   5295 N N   . PHE B 1 276 ? 33.536  9.497   72.656  1.00 54.80  ?  1152 PHE B N   1 
ATOM   5296 C CA  . PHE B 1 276 ? 34.269  8.391   73.275  1.00 63.52  ?  1152 PHE B CA  1 
ATOM   5297 C C   . PHE B 1 276 ? 34.215  7.141   72.404  1.00 62.68  ?  1152 PHE B C   1 
ATOM   5298 O O   . PHE B 1 276 ? 35.226  6.455   72.211  1.00 59.81  ?  1152 PHE B O   1 
ATOM   5299 C CB  . PHE B 1 276 ? 33.709  8.080   74.667  1.00 64.45  ?  1152 PHE B CB  1 
ATOM   5300 C CG  . PHE B 1 276 ? 34.201  9.006   75.745  1.00 63.66  ?  1152 PHE B CG  1 
ATOM   5301 C CD1 . PHE B 1 276 ? 35.549  9.074   76.067  1.00 67.91  ?  1152 PHE B CD1 1 
ATOM   5302 C CD2 . PHE B 1 276 ? 33.310  9.795   76.453  1.00 62.48  ?  1152 PHE B CD2 1 
ATOM   5303 C CE1 . PHE B 1 276 ? 35.998  9.932   77.062  1.00 67.43  ?  1152 PHE B CE1 1 
ATOM   5304 C CE2 . PHE B 1 276 ? 33.752  10.648  77.446  1.00 60.67  ?  1152 PHE B CE2 1 
ATOM   5305 C CZ  . PHE B 1 276 ? 35.095  10.718  77.751  1.00 59.75  ?  1152 PHE B CZ  1 
ATOM   5306 N N   . ARG B 1 277 ? 33.027  6.823   71.888  1.00 56.17  ?  1153 ARG B N   1 
ATOM   5307 C CA  . ARG B 1 277 ? 32.819  5.570   71.169  1.00 64.76  ?  1153 ARG B CA  1 
ATOM   5308 C C   . ARG B 1 277 ? 33.614  5.538   69.868  1.00 69.05  ?  1153 ARG B C   1 
ATOM   5309 O O   . ARG B 1 277 ? 34.233  4.523   69.530  1.00 80.15  ?  1153 ARG B O   1 
ATOM   5310 C CB  . ARG B 1 277 ? 31.324  5.376   70.901  1.00 68.52  ?  1153 ARG B CB  1 
ATOM   5311 C CG  . ARG B 1 277 ? 30.941  4.038   70.299  1.00 84.44  ?  1153 ARG B CG  1 
ATOM   5312 C CD  . ARG B 1 277 ? 29.430  3.913   70.145  1.00 74.92  ?  1153 ARG B CD  1 
ATOM   5313 N NE  . ARG B 1 277 ? 28.888  4.901   69.217  1.00 82.94  ?  1153 ARG B NE  1 
ATOM   5314 C CZ  . ARG B 1 277 ? 28.943  4.785   67.894  1.00 100.63 ?  1153 ARG B CZ  1 
ATOM   5315 N NH1 . ARG B 1 277 ? 29.525  3.726   67.346  1.00 104.51 ?  1153 ARG B NH1 1 
ATOM   5316 N NH2 . ARG B 1 277 ? 28.424  5.728   67.120  1.00 98.11  ?  1153 ARG B NH2 1 
ATOM   5317 N N   . THR B 1 278 ? 33.613  6.645   69.129  1.00 79.04  ?  1154 THR B N   1 
ATOM   5318 C CA  . THR B 1 278 ? 34.196  6.698   67.794  1.00 73.52  ?  1154 THR B CA  1 
ATOM   5319 C C   . THR B 1 278 ? 35.557  7.379   67.742  1.00 71.86  ?  1154 THR B C   1 
ATOM   5320 O O   . THR B 1 278 ? 36.380  7.033   66.888  1.00 74.44  ?  1154 THR B O   1 
ATOM   5321 C CB  . THR B 1 278 ? 33.246  7.431   66.841  1.00 77.12  ?  1154 THR B CB  1 
ATOM   5322 O OG1 . THR B 1 278 ? 33.077  8.783   67.285  1.00 74.97  ?  1154 THR B OG1 1 
ATOM   5323 C CG2 . THR B 1 278 ? 31.882  6.749   66.813  1.00 92.22  ?  1154 THR B CG2 1 
ATOM   5324 N N   . GLY B 1 279 ? 35.813  8.339   68.625  1.00 63.57  ?  1155 GLY B N   1 
ATOM   5325 C CA  . GLY B 1 279 ? 37.038  9.106   68.550  1.00 57.38  ?  1155 GLY B CA  1 
ATOM   5326 C C   . GLY B 1 279 ? 37.038  10.168  67.480  1.00 61.93  ?  1155 GLY B C   1 
ATOM   5327 O O   . GLY B 1 279 ? 38.109  10.552  67.001  1.00 66.15  ?  1155 GLY B O   1 
ATOM   5328 N N   . THR B 1 280 ? 35.865  10.653  67.083  1.00 50.86  ?  1156 THR B N   1 
ATOM   5329 C CA  . THR B 1 280 ? 35.730  11.653  66.034  1.00 52.69  ?  1156 THR B CA  1 
ATOM   5330 C C   . THR B 1 280 ? 34.837  12.789  66.525  1.00 53.94  ?  1156 THR B C   1 
ATOM   5331 O O   . THR B 1 280 ? 34.268  12.739  67.619  1.00 63.22  ?  1156 THR B O   1 
ATOM   5332 C CB  . THR B 1 280 ? 35.152  11.038  64.753  1.00 58.90  ?  1156 THR B CB  1 
ATOM   5333 O OG1 . THR B 1 280 ? 33.837  10.537  65.027  1.00 58.13  ?  1156 THR B OG1 1 
ATOM   5334 C CG2 . THR B 1 280 ? 36.032  9.895   64.253  1.00 53.69  ?  1156 THR B CG2 1 
ATOM   5335 N N   . TRP B 1 281 ? 34.708  13.824  65.695  1.00 57.95  ?  1157 TRP B N   1 
ATOM   5336 C CA  . TRP B 1 281 ? 33.858  14.973  65.983  1.00 58.12  ?  1157 TRP B CA  1 
ATOM   5337 C C   . TRP B 1 281 ? 32.502  14.874  65.298  1.00 56.95  ?  1157 TRP B C   1 
ATOM   5338 O O   . TRP B 1 281 ? 31.811  15.889  65.153  1.00 48.75  ?  1157 TRP B O   1 
ATOM   5339 C CB  . TRP B 1 281 ? 34.548  16.273  65.562  1.00 56.88  ?  1157 TRP B CB  1 
ATOM   5340 C CG  . TRP B 1 281 ? 35.876  16.498  66.204  1.00 58.12  ?  1157 TRP B CG  1 
ATOM   5341 C CD1 . TRP B 1 281 ? 37.089  16.542  65.586  1.00 54.10  ?  1157 TRP B CD1 1 
ATOM   5342 C CD2 . TRP B 1 281 ? 36.125  16.707  67.595  1.00 55.38  ?  1157 TRP B CD2 1 
ATOM   5343 N NE1 . TRP B 1 281 ? 38.082  16.766  66.507  1.00 49.83  ?  1157 TRP B NE1 1 
ATOM   5344 C CE2 . TRP B 1 281 ? 37.516  16.871  67.750  1.00 49.98  ?  1157 TRP B CE2 1 
ATOM   5345 C CE3 . TRP B 1 281 ? 35.308  16.771  68.727  1.00 58.19  ?  1157 TRP B CE3 1 
ATOM   5346 C CZ2 . TRP B 1 281 ? 38.107  17.091  68.991  1.00 52.80  ?  1157 TRP B CZ2 1 
ATOM   5347 C CZ3 . TRP B 1 281 ? 35.894  16.994  69.955  1.00 56.70  ?  1157 TRP B CZ3 1 
ATOM   5348 C CH2 . TRP B 1 281 ? 37.279  17.150  70.079  1.00 56.53  ?  1157 TRP B CH2 1 
ATOM   5349 N N   . ASP B 1 282 ? 32.113  13.675  64.861  1.00 57.41  ?  1158 ASP B N   1 
ATOM   5350 C CA  . ASP B 1 282 ? 30.907  13.536  64.049  1.00 54.76  ?  1158 ASP B CA  1 
ATOM   5351 C C   . ASP B 1 282 ? 29.657  13.986  64.801  1.00 57.43  ?  1158 ASP B C   1 
ATOM   5352 O O   . ASP B 1 282 ? 28.695  14.462  64.187  1.00 70.82  ?  1158 ASP B O   1 
ATOM   5353 C CB  . ASP B 1 282 ? 30.761  12.093  63.568  1.00 65.77  ?  1158 ASP B CB  1 
ATOM   5354 C CG  . ASP B 1 282 ? 31.796  11.723  62.521  1.00 78.70  ?  1158 ASP B CG  1 
ATOM   5355 O OD1 . ASP B 1 282 ? 32.758  12.500  62.343  1.00 89.32  ?  1158 ASP B OD1 1 
ATOM   5356 O OD2 . ASP B 1 282 ? 31.640  10.667  61.865  1.00 89.07  -1 1158 ASP B OD2 1 
ATOM   5357 N N   . ALA B 1 283 ? 29.641  13.826  66.124  1.00 52.10  ?  1159 ALA B N   1 
ATOM   5358 C CA  . ALA B 1 283 ? 28.495  14.256  66.918  1.00 51.05  ?  1159 ALA B CA  1 
ATOM   5359 C C   . ALA B 1 283 ? 28.379  15.772  67.027  1.00 50.38  ?  1159 ALA B C   1 
ATOM   5360 O O   . ALA B 1 283 ? 27.370  16.263  67.546  1.00 51.41  ?  1159 ALA B O   1 
ATOM   5361 C CB  . ALA B 1 283 ? 28.566  13.643  68.316  1.00 47.06  ?  1159 ALA B CB  1 
ATOM   5362 N N   . TYR B 1 284 ? 29.372  16.520  66.552  1.00 42.71  ?  1160 TYR B N   1 
ATOM   5363 C CA  . TYR B 1 284 ? 29.307  17.973  66.512  1.00 49.64  ?  1160 TYR B CA  1 
ATOM   5364 C C   . TYR B 1 284 ? 29.326  18.513  65.089  1.00 57.06  ?  1160 TYR B C   1 
ATOM   5365 O O   . TYR B 1 284 ? 29.341  19.736  64.900  1.00 65.46  ?  1160 TYR B O   1 
ATOM   5366 C CB  . TYR B 1 284 ? 30.465  18.584  67.313  1.00 43.30  ?  1160 TYR B CB  1 
ATOM   5367 C CG  . TYR B 1 284 ? 30.378  18.345  68.808  1.00 48.95  ?  1160 TYR B CG  1 
ATOM   5368 C CD1 . TYR B 1 284 ? 30.690  17.106  69.351  1.00 51.02  ?  1160 TYR B CD1 1 
ATOM   5369 C CD2 . TYR B 1 284 ? 29.994  19.362  69.678  1.00 54.91  ?  1160 TYR B CD2 1 
ATOM   5370 C CE1 . TYR B 1 284 ? 30.617  16.884  70.712  1.00 49.59  ?  1160 TYR B CE1 1 
ATOM   5371 C CE2 . TYR B 1 284 ? 29.920  19.147  71.047  1.00 54.06  ?  1160 TYR B CE2 1 
ATOM   5372 C CZ  . TYR B 1 284 ? 30.233  17.907  71.556  1.00 62.82  ?  1160 TYR B CZ  1 
ATOM   5373 O OH  . TYR B 1 284 ? 30.158  17.695  72.912  1.00 61.69  ?  1160 TYR B OH  1 
ATOM   5374 N N   . SER B 1 285 ? 29.346  17.641  64.087  1.00 58.86  ?  261  SER B N   1 
ATOM   5375 C CA  . SER B 1 285 ? 29.294  18.065  62.699  1.00 72.86  ?  261  SER B CA  1 
ATOM   5376 C C   . SER B 1 285 ? 27.857  18.348  62.278  1.00 81.61  ?  261  SER B C   1 
ATOM   5377 O O   . SER B 1 285 ? 26.915  17.689  62.726  1.00 91.47  ?  261  SER B O   1 
ATOM   5378 C CB  . SER B 1 285 ? 29.905  16.994  61.794  1.00 79.46  ?  261  SER B CB  1 
ATOM   5379 O OG  . SER B 1 285 ? 29.885  17.397  60.436  1.00 108.54 ?  261  SER B OG  1 
ATOM   5380 N N   . GLU B 1 286 ? 27.696  19.347  61.413  1.00 82.90  ?  262  GLU B N   1 
ATOM   5381 C CA  . GLU B 1 286 ? 26.402  19.650  60.818  1.00 81.12  ?  262  GLU B CA  1 
ATOM   5382 C C   . GLU B 1 286 ? 26.221  18.842  59.538  1.00 73.56  ?  262  GLU B C   1 
ATOM   5383 O O   . GLU B 1 286 ? 27.162  18.677  58.754  1.00 83.52  ?  262  GLU B O   1 
ATOM   5384 C CB  . GLU B 1 286 ? 26.269  21.148  60.533  1.00 76.92  ?  262  GLU B CB  1 
ATOM   5385 C CG  . GLU B 1 286 ? 26.076  21.995  61.782  1.00 72.97  ?  262  GLU B CG  1 
ATOM   5386 C CD  . GLU B 1 286 ? 25.883  23.466  61.472  1.00 86.55  ?  262  GLU B CD  1 
ATOM   5387 O OE1 . GLU B 1 286 ? 26.848  24.113  61.012  1.00 82.30  ?  262  GLU B OE1 1 
ATOM   5388 O OE2 . GLU B 1 286 ? 24.763  23.974  61.684  1.00 102.79 -1 262  GLU B OE2 1 
ATOM   5389 N N   . GLN B 1 287 ? 25.000  18.340  59.335  1.00 86.36  ?  263  GLN B N   1 
ATOM   5390 C CA  . GLN B 1 287 ? 24.748  17.380  58.268  1.00 79.65  ?  263  GLN B CA  1 
ATOM   5391 C C   . GLN B 1 287 ? 24.623  18.024  56.894  1.00 69.73  ?  263  GLN B C   1 
ATOM   5392 O O   . GLN B 1 287 ? 24.725  17.316  55.886  1.00 69.32  ?  263  GLN B O   1 
ATOM   5393 C CB  . GLN B 1 287 ? 23.481  16.580  58.574  1.00 99.59  ?  263  GLN B CB  1 
ATOM   5394 N N   . TRP B 1 288 ? 24.404  19.340  56.823  1.00 65.34  ?  264  TRP B N   1 
ATOM   5395 C CA  . TRP B 1 288 ? 24.354  19.998  55.521  1.00 61.82  ?  264  TRP B CA  1 
ATOM   5396 C C   . TRP B 1 288 ? 25.745  20.175  54.918  1.00 70.20  ?  264  TRP B C   1 
ATOM   5397 O O   . TRP B 1 288 ? 25.873  20.328  53.694  1.00 80.00  ?  264  TRP B O   1 
ATOM   5398 C CB  . TRP B 1 288 ? 23.622  21.341  55.633  1.00 54.43  ?  264  TRP B CB  1 
ATOM   5399 C CG  . TRP B 1 288 ? 24.266  22.393  56.495  1.00 50.29  ?  264  TRP B CG  1 
ATOM   5400 C CD1 . TRP B 1 288 ? 24.036  22.625  57.821  1.00 63.08  ?  264  TRP B CD1 1 
ATOM   5401 C CD2 . TRP B 1 288 ? 25.216  23.381  56.075  1.00 56.74  ?  264  TRP B CD2 1 
ATOM   5402 N NE1 . TRP B 1 288 ? 24.796  23.685  58.255  1.00 61.15  ?  264  TRP B NE1 1 
ATOM   5403 C CE2 . TRP B 1 288 ? 25.530  24.166  57.202  1.00 64.19  ?  264  TRP B CE2 1 
ATOM   5404 C CE3 . TRP B 1 288 ? 25.838  23.670  54.858  1.00 62.63  ?  264  TRP B CE3 1 
ATOM   5405 C CZ2 . TRP B 1 288 ? 26.436  25.222  57.148  1.00 67.52  ?  264  TRP B CZ2 1 
ATOM   5406 C CZ3 . TRP B 1 288 ? 26.738  24.717  54.805  1.00 70.76  ?  264  TRP B CZ3 1 
ATOM   5407 C CH2 . TRP B 1 288 ? 27.028  25.482  55.942  1.00 68.39  ?  264  TRP B CH2 1 
ATOM   5408 N N   . ILE B 1 289 ? 26.790  20.116  55.746  1.00 67.59  ?  265  ILE B N   1 
ATOM   5409 C CA  . ILE B 1 289 ? 28.161  20.244  55.253  1.00 59.86  ?  265  ILE B CA  1 
ATOM   5410 C C   . ILE B 1 289 ? 28.518  19.076  54.338  1.00 56.74  ?  265  ILE B C   1 
ATOM   5411 O O   . ILE B 1 289 ? 29.206  19.244  53.321  1.00 51.22  ?  265  ILE B O   1 
ATOM   5412 C CB  . ILE B 1 289 ? 29.137  20.357  56.440  1.00 68.83  ?  265  ILE B CB  1 
ATOM   5413 C CG1 . ILE B 1 289 ? 28.826  21.605  57.262  1.00 66.39  ?  265  ILE B CG1 1 
ATOM   5414 C CG2 . ILE B 1 289 ? 30.579  20.388  55.959  1.00 74.79  ?  265  ILE B CG2 1 
ATOM   5415 C CD1 . ILE B 1 289 ? 29.157  22.881  56.541  1.00 53.99  ?  265  ILE B CD1 1 
ATOM   5416 N N   . PHE B 1 290 ? 28.081  17.868  54.699  1.00 52.93  ?  266  PHE B N   1 
ATOM   5417 C CA  . PHE B 1 290 ? 28.369  16.703  53.873  1.00 47.51  ?  266  PHE B CA  1 
ATOM   5418 C C   . PHE B 1 290 ? 27.659  16.802  52.531  1.00 60.18  ?  266  PHE B C   1 
ATOM   5419 O O   . PHE B 1 290 ? 28.212  16.403  51.492  1.00 60.99  ?  266  PHE B O   1 
ATOM   5420 C CB  . PHE B 1 290 ? 27.959  15.436  54.621  1.00 48.98  ?  266  PHE B CB  1 
ATOM   5421 C CG  . PHE B 1 290 ? 28.516  14.172  54.038  1.00 51.64  ?  266  PHE B CG  1 
ATOM   5422 C CD1 . PHE B 1 290 ? 29.757  13.695  54.433  1.00 48.26  ?  266  PHE B CD1 1 
ATOM   5423 C CD2 . PHE B 1 290 ? 27.789  13.445  53.112  1.00 50.15  ?  266  PHE B CD2 1 
ATOM   5424 C CE1 . PHE B 1 290 ? 30.264  12.518  53.906  1.00 56.98  ?  266  PHE B CE1 1 
ATOM   5425 C CE2 . PHE B 1 290 ? 28.288  12.268  52.584  1.00 42.88  ?  266  PHE B CE2 1 
ATOM   5426 C CZ  . PHE B 1 290 ? 29.527  11.806  52.980  1.00 50.32  ?  266  PHE B CZ  1 
ATOM   5427 N N   . ARG B 1 291 ? 26.462  17.386  52.522  1.00 65.87  ?  267  ARG B N   1 
ATOM   5428 C CA  . ARG B 1 291 ? 25.791  17.642  51.260  1.00 68.10  ?  267  ARG B CA  1 
ATOM   5429 C C   . ARG B 1 291 ? 26.501  18.712  50.448  1.00 68.47  ?  267  ARG B C   1 
ATOM   5430 O O   . ARG B 1 291 ? 26.513  18.635  49.214  1.00 87.16  ?  267  ARG B O   1 
ATOM   5431 C CB  . ARG B 1 291 ? 24.340  18.057  51.507  1.00 68.25  ?  267  ARG B CB  1 
ATOM   5432 C CG  . ARG B 1 291 ? 23.504  17.006  52.209  1.00 70.83  ?  267  ARG B CG  1 
ATOM   5433 C CD  . ARG B 1 291 ? 23.489  15.717  51.415  1.00 84.81  ?  267  ARG B CD  1 
ATOM   5434 N NE  . ARG B 1 291 ? 22.616  14.695  51.989  1.00 73.76  ?  267  ARG B NE  1 
ATOM   5435 C CZ  . ARG B 1 291 ? 21.307  14.622  51.767  1.00 74.82  ?  267  ARG B CZ  1 
ATOM   5436 N NH1 . ARG B 1 291 ? 20.716  15.527  51.000  1.00 65.76  ?  267  ARG B NH1 1 
ATOM   5437 N NH2 . ARG B 1 291 ? 20.586  13.652  52.315  1.00 68.55  ?  267  ARG B NH2 1 
ATOM   5438 N N   . LEU B 1 292 ? 27.159  19.661  51.105  1.00 48.91  ?  268  LEU B N   1 
ATOM   5439 C CA  . LEU B 1 292 ? 27.965  20.598  50.337  1.00 59.06  ?  268  LEU B CA  1 
ATOM   5440 C C   . LEU B 1 292 ? 29.180  19.918  49.723  1.00 62.22  ?  268  LEU B C   1 
ATOM   5441 O O   . LEU B 1 292 ? 29.541  20.210  48.573  1.00 69.95  ?  268  LEU B O   1 
ATOM   5442 C CB  . LEU B 1 292 ? 28.423  21.760  51.221  1.00 63.70  ?  268  LEU B CB  1 
ATOM   5443 C CG  . LEU B 1 292 ? 28.701  23.064  50.471  1.00 51.76  ?  268  LEU B CG  1 
ATOM   5444 C CD1 . LEU B 1 292 ? 27.565  23.347  49.508  1.00 59.86  ?  268  LEU B CD1 1 
ATOM   5445 C CD2 . LEU B 1 292 ? 28.879  24.229  51.437  1.00 62.95  ?  268  LEU B CD2 1 
ATOM   5446 N N   . TYR B 1 293 ? 29.793  18.982  50.451  1.00 56.30  ?  269  TYR B N   1 
ATOM   5447 C CA  . TYR B 1 293 ? 30.891  18.220  49.864  1.00 54.09  ?  269  TYR B CA  1 
ATOM   5448 C C   . TYR B 1 293 ? 30.422  17.447  48.643  1.00 57.37  ?  269  TYR B C   1 
ATOM   5449 O O   . TYR B 1 293 ? 31.127  17.389  47.628  1.00 49.16  ?  269  TYR B O   1 
ATOM   5450 C CB  . TYR B 1 293 ? 31.501  17.248  50.872  1.00 44.99  ?  269  TYR B CB  1 
ATOM   5451 C CG  . TYR B 1 293 ? 32.138  17.898  52.066  1.00 38.74  ?  269  TYR B CG  1 
ATOM   5452 C CD1 . TYR B 1 293 ? 32.643  19.187  51.993  1.00 38.85  ?  269  TYR B CD1 1 
ATOM   5453 C CD2 . TYR B 1 293 ? 32.228  17.222  53.274  1.00 39.70  ?  269  TYR B CD2 1 
ATOM   5454 C CE1 . TYR B 1 293 ? 33.219  19.785  53.089  1.00 37.90  ?  269  TYR B CE1 1 
ATOM   5455 C CE2 . TYR B 1 293 ? 32.803  17.814  54.375  1.00 41.45  ?  269  TYR B CE2 1 
ATOM   5456 C CZ  . TYR B 1 293 ? 33.296  19.091  54.277  1.00 50.44  ?  269  TYR B CZ  1 
ATOM   5457 O OH  . TYR B 1 293 ? 33.867  19.675  55.378  1.00 56.89  ?  269  TYR B OH  1 
ATOM   5458 N N   . VAL B 1 294 ? 29.244  16.821  48.728  1.00 53.72  ?  270  VAL B N   1 
ATOM   5459 C CA  . VAL B 1 294 ? 28.796  16.050  47.573  1.00 59.98  ?  270  VAL B CA  1 
ATOM   5460 C C   . VAL B 1 294 ? 28.374  16.974  46.438  1.00 51.11  ?  270  VAL B C   1 
ATOM   5461 O O   . VAL B 1 294 ? 28.388  16.565  45.270  1.00 51.76  ?  270  VAL B O   1 
ATOM   5462 C CB  . VAL B 1 294 ? 27.669  15.046  47.917  1.00 67.19  ?  270  VAL B CB  1 
ATOM   5463 C CG1 . VAL B 1 294 ? 28.119  14.041  48.974  1.00 68.25  ?  270  VAL B CG1 1 
ATOM   5464 C CG2 . VAL B 1 294 ? 26.397  15.736  48.347  1.00 94.73  ?  270  VAL B CG2 1 
ATOM   5465 N N   . ALA B 1 295 ? 28.008  18.217  46.740  1.00 50.42  ?  271  ALA B N   1 
ATOM   5466 C CA  . ALA B 1 295 ? 27.760  19.157  45.659  1.00 51.05  ?  271  ALA B CA  1 
ATOM   5467 C C   . ALA B 1 295 ? 29.052  19.657  45.029  1.00 59.42  ?  271  ALA B C   1 
ATOM   5468 O O   . ALA B 1 295 ? 29.033  20.111  43.879  1.00 52.81  ?  271  ALA B O   1 
ATOM   5469 C CB  . ALA B 1 295 ? 26.934  20.337  46.161  1.00 39.90  ?  271  ALA B CB  1 
ATOM   5470 N N   . ILE B 1 296 ? 30.169  19.581  45.746  1.00 49.74  ?  272  ILE B N   1 
ATOM   5471 C CA  . ILE B 1 296 ? 31.450  19.955  45.148  1.00 35.86  ?  272  ILE B CA  1 
ATOM   5472 C C   . ILE B 1 296 ? 32.042  18.807  44.337  1.00 41.48  ?  272  ILE B C   1 
ATOM   5473 O O   . ILE B 1 296 ? 32.420  18.988  43.178  1.00 45.23  ?  272  ILE B O   1 
ATOM   5474 C CB  . ILE B 1 296 ? 32.447  20.436  46.223  1.00 32.10  ?  272  ILE B CB  1 
ATOM   5475 C CG1 . ILE B 1 296 ? 31.928  21.679  46.947  1.00 30.91  ?  272  ILE B CG1 1 
ATOM   5476 C CG2 . ILE B 1 296 ? 33.783  20.743  45.575  1.00 27.81  ?  272  ILE B CG2 1 
ATOM   5477 C CD1 . ILE B 1 296 ? 32.842  22.138  48.065  1.00 39.38  ?  272  ILE B CD1 1 
ATOM   5478 N N   . GLY B 1 297 ? 32.130  17.612  44.932  1.00 39.34  ?  273  GLY B N   1 
ATOM   5479 C CA  . GLY B 1 297 ? 32.843  16.512  44.293  1.00 40.34  ?  273  GLY B CA  1 
ATOM   5480 C C   . GLY B 1 297 ? 32.153  15.973  43.053  1.00 45.01  ?  273  GLY B C   1 
ATOM   5481 O O   . GLY B 1 297 ? 32.809  15.664  42.052  1.00 59.04  ?  273  GLY B O   1 
ATOM   5482 N N   . TRP B 1 298 ? 30.824  15.840  43.099  1.00 54.36  ?  274  TRP B N   1 
ATOM   5483 C CA  . TRP B 1 298 ? 30.062  15.361  41.956  1.00 56.86  ?  274  TRP B CA  1 
ATOM   5484 C C   . TRP B 1 298 ? 29.330  16.461  41.202  1.00 54.60  ?  274  TRP B C   1 
ATOM   5485 O O   . TRP B 1 298 ? 29.030  16.278  40.018  1.00 43.31  ?  274  TRP B O   1 
ATOM   5486 C CB  . TRP B 1 298 ? 29.029  14.310  42.396  1.00 57.40  ?  274  TRP B CB  1 
ATOM   5487 C CG  . TRP B 1 298 ? 29.589  13.093  43.081  1.00 58.40  ?  274  TRP B CG  1 
ATOM   5488 C CD1 . TRP B 1 298 ? 29.459  12.763  44.400  1.00 59.00  ?  274  TRP B CD1 1 
ATOM   5489 C CD2 . TRP B 1 298 ? 30.340  12.035  42.475  1.00 54.25  ?  274  TRP B CD2 1 
ATOM   5490 N NE1 . TRP B 1 298 ? 30.091  11.569  44.653  1.00 52.11  ?  274  TRP B NE1 1 
ATOM   5491 C CE2 . TRP B 1 298 ? 30.643  11.103  43.488  1.00 48.89  ?  274  TRP B CE2 1 
ATOM   5492 C CE3 . TRP B 1 298 ? 30.792  11.788  41.176  1.00 55.45  ?  274  TRP B CE3 1 
ATOM   5493 C CZ2 . TRP B 1 298 ? 31.374  9.942   43.241  1.00 44.89  ?  274  TRP B CZ2 1 
ATOM   5494 C CZ3 . TRP B 1 298 ? 31.519  10.637  40.933  1.00 56.29  ?  274  TRP B CZ3 1 
ATOM   5495 C CH2 . TRP B 1 298 ? 31.803  9.729   41.959  1.00 50.54  ?  274  TRP B CH2 1 
ATOM   5496 N N   . GLY B 1 299 ? 29.033  17.585  41.846  1.00 49.35  ?  275  GLY B N   1 
ATOM   5497 C CA  . GLY B 1 299 ? 28.231  18.616  41.218  1.00 51.96  ?  275  GLY B CA  1 
ATOM   5498 C C   . GLY B 1 299 ? 29.010  19.572  40.335  1.00 55.13  ?  275  GLY B C   1 
ATOM   5499 O O   . GLY B 1 299 ? 28.630  19.812  39.186  1.00 51.06  ?  275  GLY B O   1 
ATOM   5500 N N   . VAL B 1 300 ? 30.100  20.123  40.859  1.00 49.36  ?  276  VAL B N   1 
ATOM   5501 C CA  . VAL B 1 300 ? 30.902  21.122  40.150  1.00 57.94  ?  276  VAL B CA  1 
ATOM   5502 C C   . VAL B 1 300 ? 31.546  20.546  38.888  1.00 63.40  ?  276  VAL B C   1 
ATOM   5503 O O   . VAL B 1 300 ? 31.600  21.252  37.871  1.00 62.69  ?  276  VAL B O   1 
ATOM   5504 C CB  . VAL B 1 300 ? 31.959  21.742  41.081  1.00 52.57  ?  276  VAL B CB  1 
ATOM   5505 C CG1 . VAL B 1 300 ? 32.893  22.653  40.304  1.00 45.21  ?  276  VAL B CG1 1 
ATOM   5506 C CG2 . VAL B 1 300 ? 31.277  22.523  42.205  1.00 47.94  ?  276  VAL B CG2 1 
ATOM   5507 N N   . PRO B 1 301 ? 32.062  19.305  38.881  1.00 58.54  ?  277  PRO B N   1 
ATOM   5508 C CA  . PRO B 1 301 ? 32.495  18.721  37.598  1.00 52.01  ?  277  PRO B CA  1 
ATOM   5509 C C   . PRO B 1 301 ? 31.423  18.781  36.525  1.00 56.68  ?  277  PRO B C   1 
ATOM   5510 O O   . PRO B 1 301 ? 31.716  19.108  35.369  1.00 43.99  ?  277  PRO B O   1 
ATOM   5511 C CB  . PRO B 1 301 ? 32.841  17.276  37.979  1.00 46.66  ?  277  PRO B CB  1 
ATOM   5512 C CG  . PRO B 1 301 ? 33.297  17.379  39.385  1.00 52.89  ?  277  PRO B CG  1 
ATOM   5513 C CD  . PRO B 1 301 ? 32.446  18.446  40.017  1.00 49.83  ?  277  PRO B CD  1 
ATOM   5514 N N   . LEU B 1 302 ? 30.178  18.477  36.891  1.00 59.52  ?  278  LEU B N   1 
ATOM   5515 C CA  . LEU B 1 302 ? 29.058  18.551  35.964  1.00 59.22  ?  278  LEU B CA  1 
ATOM   5516 C C   . LEU B 1 302 ? 28.890  19.946  35.377  1.00 60.76  ?  278  LEU B C   1 
ATOM   5517 O O   . LEU B 1 302 ? 28.285  20.094  34.309  1.00 57.88  ?  278  LEU B O   1 
ATOM   5518 C CB  . LEU B 1 302 ? 27.788  18.130  36.703  1.00 50.43  ?  278  LEU B CB  1 
ATOM   5519 C CG  . LEU B 1 302 ? 26.703  17.313  36.005  1.00 51.37  ?  278  LEU B CG  1 
ATOM   5520 C CD1 . LEU B 1 302 ? 27.307  16.314  35.046  1.00 47.57  ?  278  LEU B CD1 1 
ATOM   5521 C CD2 . LEU B 1 302 ? 25.884  16.597  37.064  1.00 47.74  ?  278  LEU B CD2 1 
ATOM   5522 N N   . LEU B 1 303 ? 29.437  20.965  36.039  1.00 61.04  ?  279  LEU B N   1 
ATOM   5523 C CA  . LEU B 1 303 ? 29.184  22.352  35.686  1.00 50.15  ?  279  LEU B CA  1 
ATOM   5524 C C   . LEU B 1 303 ? 30.114  22.877  34.601  1.00 42.09  ?  279  LEU B C   1 
ATOM   5525 O O   . LEU B 1 303 ? 29.781  23.874  33.951  1.00 60.65  ?  279  LEU B O   1 
ATOM   5526 C CB  . LEU B 1 303 ? 29.307  23.218  36.943  1.00 63.15  ?  279  LEU B CB  1 
ATOM   5527 C CG  . LEU B 1 303 ? 28.713  24.629  37.001  1.00 77.24  ?  279  LEU B CG  1 
ATOM   5528 C CD1 . LEU B 1 303 ? 28.061  24.852  38.358  1.00 62.75  ?  279  LEU B CD1 1 
ATOM   5529 C CD2 . LEU B 1 303 ? 29.780  25.681  36.754  1.00 103.67 ?  279  LEU B CD2 1 
ATOM   5530 N N   . PHE B 1 304 ? 31.270  22.247  34.393  1.00 52.38  ?  280  PHE B N   1 
ATOM   5531 C CA  . PHE B 1 304 ? 32.127  22.597  33.272  1.00 45.16  ?  280  PHE B CA  1 
ATOM   5532 C C   . PHE B 1 304 ? 32.382  21.440  32.321  1.00 48.86  ?  280  PHE B C   1 
ATOM   5533 O O   . PHE B 1 304 ? 32.904  21.673  31.225  1.00 51.56  ?  280  PHE B O   1 
ATOM   5534 C CB  . PHE B 1 304 ? 33.473  23.169  33.762  1.00 44.49  ?  280  PHE B CB  1 
ATOM   5535 C CG  . PHE B 1 304 ? 34.287  22.220  34.609  1.00 49.16  ?  280  PHE B CG  1 
ATOM   5536 C CD1 . PHE B 1 304 ? 35.223  21.370  34.033  1.00 49.20  ?  280  PHE B CD1 1 
ATOM   5537 C CD2 . PHE B 1 304 ? 34.146  22.212  35.986  1.00 56.06  ?  280  PHE B CD2 1 
ATOM   5538 C CE1 . PHE B 1 304 ? 35.980  20.510  34.819  1.00 43.10  ?  280  PHE B CE1 1 
ATOM   5539 C CE2 . PHE B 1 304 ? 34.898  21.361  36.774  1.00 47.39  ?  280  PHE B CE2 1 
ATOM   5540 C CZ  . PHE B 1 304 ? 35.815  20.509  36.192  1.00 42.15  ?  280  PHE B CZ  1 
ATOM   5541 N N   . VAL B 1 305 ? 32.027  20.208  32.695  1.00 56.29  ?  281  VAL B N   1 
ATOM   5542 C CA  . VAL B 1 305 ? 32.257  19.079  31.798  1.00 49.71  ?  281  VAL B CA  1 
ATOM   5543 C C   . VAL B 1 305 ? 31.215  19.051  30.686  1.00 60.38  ?  281  VAL B C   1 
ATOM   5544 O O   . VAL B 1 305 ? 31.548  18.814  29.518  1.00 80.76  ?  281  VAL B O   1 
ATOM   5545 C CB  . VAL B 1 305 ? 32.296  17.757  32.591  1.00 52.64  ?  281  VAL B CB  1 
ATOM   5546 C CG1 . VAL B 1 305 ? 32.164  16.554  31.666  1.00 54.09  ?  281  VAL B CG1 1 
ATOM   5547 C CG2 . VAL B 1 305 ? 33.594  17.658  33.373  1.00 61.26  ?  281  VAL B CG2 1 
ATOM   5548 N N   . VAL B 1 306 ? 29.950  19.304  31.014  1.00 54.34  ?  282  VAL B N   1 
ATOM   5549 C CA  . VAL B 1 306 ? 28.899  19.177  30.004  1.00 47.46  ?  282  VAL B CA  1 
ATOM   5550 C C   . VAL B 1 306 ? 28.935  20.318  28.985  1.00 46.02  ?  282  VAL B C   1 
ATOM   5551 O O   . VAL B 1 306 ? 28.652  20.059  27.806  1.00 54.16  ?  282  VAL B O   1 
ATOM   5552 C CB  . VAL B 1 306 ? 27.503  19.017  30.645  1.00 57.21  ?  282  VAL B CB  1 
ATOM   5553 C CG1 . VAL B 1 306 ? 27.532  17.942  31.722  1.00 53.08  ?  282  VAL B CG1 1 
ATOM   5554 C CG2 . VAL B 1 306 ? 26.946  20.311  31.219  1.00 62.32  ?  282  VAL B CG2 1 
ATOM   5555 N N   . PRO B 1 307 ? 29.276  21.571  29.328  1.00 40.07  ?  283  PRO B N   1 
ATOM   5556 C CA  . PRO B 1 307 ? 29.396  22.562  28.248  1.00 44.19  ?  283  PRO B CA  1 
ATOM   5557 C C   . PRO B 1 307 ? 30.558  22.266  27.316  1.00 61.78  ?  283  PRO B C   1 
ATOM   5558 O O   . PRO B 1 307 ? 30.471  22.543  26.110  1.00 79.09  ?  283  PRO B O   1 
ATOM   5559 C CB  . PRO B 1 307 ? 29.591  23.889  28.999  1.00 33.87  ?  283  PRO B CB  1 
ATOM   5560 C CG  . PRO B 1 307 ? 29.119  23.626  30.380  1.00 37.66  ?  283  PRO B CG  1 
ATOM   5561 C CD  . PRO B 1 307 ? 29.548  22.215  30.625  1.00 43.69  ?  283  PRO B CD  1 
ATOM   5562 N N   . TRP B 1 308 ? 31.641  21.692  27.843  1.00 65.28  ?  284  TRP B N   1 
ATOM   5563 C CA  . TRP B 1 308 ? 32.730  21.230  26.992  1.00 54.94  ?  284  TRP B CA  1 
ATOM   5564 C C   . TRP B 1 308 ? 32.242  20.151  26.040  1.00 63.72  ?  284  TRP B C   1 
ATOM   5565 O O   . TRP B 1 308 ? 32.557  20.172  24.845  1.00 64.83  ?  284  TRP B O   1 
ATOM   5566 C CB  . TRP B 1 308 ? 33.883  20.710  27.854  1.00 57.83  ?  284  TRP B CB  1 
ATOM   5567 C CG  . TRP B 1 308 ? 34.928  19.973  27.071  1.00 59.72  ?  284  TRP B CG  1 
ATOM   5568 C CD1 . TRP B 1 308 ? 35.966  20.518  26.371  1.00 50.34  ?  284  TRP B CD1 1 
ATOM   5569 C CD2 . TRP B 1 308 ? 35.029  18.554  26.896  1.00 55.59  ?  284  TRP B CD2 1 
ATOM   5570 N NE1 . TRP B 1 308 ? 36.709  19.526  25.776  1.00 45.46  ?  284  TRP B NE1 1 
ATOM   5571 C CE2 . TRP B 1 308 ? 36.154  18.311  26.082  1.00 48.77  ?  284  TRP B CE2 1 
ATOM   5572 C CE3 . TRP B 1 308 ? 34.282  17.465  27.354  1.00 52.14  ?  284  TRP B CE3 1 
ATOM   5573 C CZ2 . TRP B 1 308 ? 36.546  17.027  25.715  1.00 42.39  ?  284  TRP B CZ2 1 
ATOM   5574 C CZ3 . TRP B 1 308 ? 34.672  16.193  26.987  1.00 61.71  ?  284  TRP B CZ3 1 
ATOM   5575 C CH2 . TRP B 1 308 ? 35.792  15.984  26.178  1.00 57.15  ?  284  TRP B CH2 1 
ATOM   5576 N N   . GLY B 1 309 ? 31.465  19.200  26.557  1.00 72.60  ?  285  GLY B N   1 
ATOM   5577 C CA  . GLY B 1 309 ? 30.901  18.171  25.702  1.00 82.59  ?  285  GLY B CA  1 
ATOM   5578 C C   . GLY B 1 309 ? 29.969  18.729  24.643  1.00 84.75  ?  285  GLY B C   1 
ATOM   5579 O O   . GLY B 1 309 ? 29.867  18.185  23.542  1.00 102.09 ?  285  GLY B O   1 
ATOM   5580 N N   . ILE B 1 310 ? 29.269  19.817  24.963  1.00 64.03  ?  286  ILE B N   1 
ATOM   5581 C CA  . ILE B 1 310 ? 28.338  20.405  24.006  1.00 58.74  ?  286  ILE B CA  1 
ATOM   5582 C C   . ILE B 1 310 ? 29.088  21.123  22.890  1.00 63.04  ?  286  ILE B C   1 
ATOM   5583 O O   . ILE B 1 310 ? 28.777  20.951  21.700  1.00 53.98  ?  286  ILE B O   1 
ATOM   5584 C CB  . ILE B 1 310 ? 27.364  21.338  24.750  1.00 59.39  ?  286  ILE B CB  1 
ATOM   5585 C CG1 . ILE B 1 310 ? 26.373  20.504  25.567  1.00 63.66  ?  286  ILE B CG1 1 
ATOM   5586 C CG2 . ILE B 1 310 ? 26.633  22.247  23.785  1.00 56.90  ?  286  ILE B CG2 1 
ATOM   5587 C CD1 . ILE B 1 310 ? 25.556  21.299  26.571  1.00 58.29  ?  286  ILE B CD1 1 
ATOM   5588 N N   . VAL B 1 311 ? 30.103  21.913  23.248  1.00 56.45  ?  287  VAL B N   1 
ATOM   5589 C CA  . VAL B 1 311 ? 30.859  22.609  22.213  1.00 58.10  ?  287  VAL B CA  1 
ATOM   5590 C C   . VAL B 1 311 ? 31.731  21.638  21.419  1.00 60.63  ?  287  VAL B C   1 
ATOM   5591 O O   . VAL B 1 311 ? 31.975  21.859  20.229  1.00 58.35  ?  287  VAL B O   1 
ATOM   5592 C CB  . VAL B 1 311 ? 31.696  23.759  22.807  1.00 54.15  ?  287  VAL B CB  1 
ATOM   5593 C CG1 . VAL B 1 311 ? 30.792  24.824  23.415  1.00 46.91  ?  287  VAL B CG1 1 
ATOM   5594 C CG2 . VAL B 1 311 ? 32.686  23.244  23.827  1.00 63.77  ?  287  VAL B CG2 1 
ATOM   5595 N N   . LYS B 1 312 ? 32.189  20.544  22.030  1.00 67.24  ?  288  LYS B N   1 
ATOM   5596 C CA  . LYS B 1 312 ? 33.019  19.579  21.320  1.00 85.47  ?  288  LYS B CA  1 
ATOM   5597 C C   . LYS B 1 312 ? 32.135  18.567  20.609  1.00 88.99  ?  288  LYS B C   1 
ATOM   5598 O O   . LYS B 1 312 ? 32.581  17.474  20.250  1.00 118.56 ?  288  LYS B O   1 
ATOM   5599 C CB  . LYS B 1 312 ? 33.976  18.876  22.286  1.00 77.53  ?  288  LYS B CB  1 
ATOM   5600 C CG  . LYS B 1 312 ? 35.124  19.747  22.781  1.00 66.96  ?  288  LYS B CG  1 
ATOM   5601 C CD  . LYS B 1 312 ? 36.151  20.000  21.685  1.00 76.51  ?  288  LYS B CD  1 
ATOM   5602 C CE  . LYS B 1 312 ? 36.837  18.711  21.270  1.00 83.50  ?  288  LYS B CE  1 
ATOM   5603 N NZ  . LYS B 1 312 ? 37.846  18.925  20.198  1.00 90.17  ?  288  LYS B NZ  1 
ATOM   5604 N N   . TYR B 1 313 ? 30.891  18.925  20.415  1.00 93.37  ?  289  TYR B N   1 
ATOM   5605 C CA  . TYR B 1 313 ? 29.948  18.174  19.603  1.00 81.45  ?  289  TYR B CA  1 
ATOM   5606 C C   . TYR B 1 313 ? 29.338  19.039  18.515  1.00 63.91  ?  289  TYR B C   1 
ATOM   5607 O O   . TYR B 1 313 ? 29.149  18.566  17.392  1.00 63.12  ?  289  TYR B O   1 
ATOM   5608 C CB  . TYR B 1 313 ? 28.849  17.583  20.510  1.00 79.83  ?  289  TYR B CB  1 
ATOM   5609 C CG  . TYR B 1 313 ? 27.817  16.725  19.812  1.00 104.16 ?  289  TYR B CG  1 
ATOM   5610 C CD1 . TYR B 1 313 ? 28.095  15.408  19.464  1.00 96.55  ?  289  TYR B CD1 1 
ATOM   5611 C CD2 . TYR B 1 313 ? 26.554  17.226  19.526  1.00 106.56 ?  289  TYR B CD2 1 
ATOM   5612 C CE1 . TYR B 1 313 ? 27.147  14.623  18.834  1.00 94.39  ?  289  TYR B CE1 1 
ATOM   5613 C CE2 . TYR B 1 313 ? 25.604  16.448  18.901  1.00 92.22  ?  289  TYR B CE2 1 
ATOM   5614 C CZ  . TYR B 1 313 ? 25.904  15.150  18.556  1.00 99.92  ?  289  TYR B CZ  1 
ATOM   5615 O OH  . TYR B 1 313 ? 24.953  14.381  17.932  1.00 103.63 ?  289  TYR B OH  1 
ATOM   5616 N N   . LEU B 1 314 ? 29.066  20.312  18.802  1.00 50.58  ?  290  LEU B N   1 
ATOM   5617 C CA  . LEU B 1 314 ? 28.539  21.177  17.754  1.00 57.77  ?  290  LEU B CA  1 
ATOM   5618 C C   . LEU B 1 314 ? 29.637  21.812  16.909  1.00 61.28  ?  290  LEU B C   1 
ATOM   5619 O O   . LEU B 1 314 ? 29.408  22.102  15.730  1.00 68.81  ?  290  LEU B O   1 
ATOM   5620 C CB  . LEU B 1 314 ? 27.656  22.265  18.362  1.00 45.90  ?  290  LEU B CB  1 
ATOM   5621 C CG  . LEU B 1 314 ? 26.471  21.738  19.167  1.00 47.85  ?  290  LEU B CG  1 
ATOM   5622 C CD1 . LEU B 1 314 ? 25.730  22.882  19.845  1.00 46.71  ?  290  LEU B CD1 1 
ATOM   5623 C CD2 . LEU B 1 314 ? 25.534  20.930  18.281  1.00 36.40  ?  290  LEU B CD2 1 
ATOM   5624 N N   . TYR B 1 315 ? 30.821  22.047  17.479  1.00 68.36  ?  291  TYR B N   1 
ATOM   5625 C CA  . TYR B 1 315 ? 31.844  22.845  16.813  1.00 72.95  ?  291  TYR B CA  1 
ATOM   5626 C C   . TYR B 1 315 ? 33.208  22.173  16.686  1.00 71.26  ?  291  TYR B C   1 
ATOM   5627 O O   . TYR B 1 315 ? 34.060  22.704  15.962  1.00 80.92  ?  291  TYR B O   1 
ATOM   5628 C CB  . TYR B 1 315 ? 32.012  24.194  17.534  1.00 65.29  ?  291  TYR B CB  1 
ATOM   5629 C CG  . TYR B 1 315 ? 30.710  24.964  17.685  1.00 72.42  ?  291  TYR B CG  1 
ATOM   5630 C CD1 . TYR B 1 315 ? 30.234  25.778  16.660  1.00 61.51  ?  291  TYR B CD1 1 
ATOM   5631 C CD2 . TYR B 1 315 ? 29.952  24.868  18.847  1.00 84.49  ?  291  TYR B CD2 1 
ATOM   5632 C CE1 . TYR B 1 315 ? 29.045  26.475  16.789  1.00 67.46  ?  291  TYR B CE1 1 
ATOM   5633 C CE2 . TYR B 1 315 ? 28.760  25.561  18.981  1.00 81.15  ?  291  TYR B CE2 1 
ATOM   5634 C CZ  . TYR B 1 315 ? 28.315  26.362  17.951  1.00 81.26  ?  291  TYR B CZ  1 
ATOM   5635 O OH  . TYR B 1 315 ? 27.136  27.052  18.082  1.00 77.37  ?  291  TYR B OH  1 
ATOM   5636 N N   . GLU B 1 316 ? 33.452  21.043  17.358  1.00 81.06  ?  292  GLU B N   1 
ATOM   5637 C CA  . GLU B 1 316 ? 34.667  20.257  17.113  1.00 75.29  ?  292  GLU B CA  1 
ATOM   5638 C C   . GLU B 1 316 ? 34.319  18.782  17.332  1.00 87.97  ?  292  GLU B C   1 
ATOM   5639 O O   . GLU B 1 316 ? 34.397  18.280  18.454  1.00 91.48  ?  292  GLU B O   1 
ATOM   5640 C CB  . GLU B 1 316 ? 35.816  20.680  18.019  1.00 64.79  ?  292  GLU B CB  1 
ATOM   5641 C CG  . GLU B 1 316 ? 36.514  21.977  17.674  1.00 78.19  ?  292  GLU B CG  1 
ATOM   5642 C CD  . GLU B 1 316 ? 37.648  22.267  18.634  1.00 98.13  ?  292  GLU B CD  1 
ATOM   5643 O OE1 . GLU B 1 316 ? 38.202  21.304  19.203  1.00 95.65  ?  292  GLU B OE1 1 
ATOM   5644 O OE2 . GLU B 1 316 ? 37.982  23.453  18.829  1.00 103.91 -1 292  GLU B OE2 1 
ATOM   5645 N N   . ASP B 1 317 ? 33.975  18.088  16.246  1.00 73.93  ?  293  ASP B N   1 
ATOM   5646 C CA  . ASP B 1 317 ? 33.671  16.656  16.277  1.00 91.80  ?  293  ASP B CA  1 
ATOM   5647 C C   . ASP B 1 317 ? 34.628  15.930  15.332  1.00 110.48 ?  293  ASP B C   1 
ATOM   5648 O O   . ASP B 1 317 ? 34.422  15.914  14.114  1.00 140.52 ?  293  ASP B O   1 
ATOM   5649 C CB  . ASP B 1 317 ? 32.215  16.403  15.898  1.00 89.48  ?  293  ASP B CB  1 
ATOM   5650 C CG  . ASP B 1 317 ? 31.804  14.960  16.102  1.00 85.80  ?  293  ASP B CG  1 
ATOM   5651 O OD1 . ASP B 1 317 ? 31.903  14.465  17.246  1.00 82.30  ?  293  ASP B OD1 1 
ATOM   5652 O OD2 . ASP B 1 317 ? 31.369  14.319  15.124  1.00 108.74 -1 293  ASP B OD2 1 
ATOM   5653 N N   . GLU B 1 318 ? 35.674  15.318  15.897  1.00 92.36  ?  294  GLU B N   1 
ATOM   5654 C CA  . GLU B 1 318 ? 36.677  14.626  15.086  1.00 92.99  ?  294  GLU B CA  1 
ATOM   5655 C C   . GLU B 1 318 ? 37.367  13.574  15.959  1.00 100.08 ?  294  GLU B C   1 
ATOM   5656 O O   . GLU B 1 318 ? 38.250  13.913  16.751  1.00 87.52  ?  294  GLU B O   1 
ATOM   5657 C CB  . GLU B 1 318 ? 37.680  15.611  14.506  1.00 89.33  ?  294  GLU B CB  1 
ATOM   5658 N N   . GLY B 1 319 ? 36.973  12.311  15.787  1.00 117.50 ?  295  GLY B N   1 
ATOM   5659 C CA  . GLY B 1 319 ? 37.632  11.183  16.427  1.00 106.50 ?  295  GLY B CA  1 
ATOM   5660 C C   . GLY B 1 319 ? 37.517  11.144  17.937  1.00 111.13 ?  295  GLY B C   1 
ATOM   5661 O O   . GLY B 1 319 ? 38.523  11.240  18.647  1.00 131.83 ?  295  GLY B O   1 
ATOM   5662 N N   . CYS B 1 320 ? 36.288  10.987  18.433  1.00 100.14 ?  296  CYS B N   1 
ATOM   5663 C CA  . CYS B 1 320 ? 35.986  11.065  19.865  1.00 88.66  ?  296  CYS B CA  1 
ATOM   5664 C C   . CYS B 1 320 ? 36.608  12.310  20.486  1.00 85.22  ?  296  CYS B C   1 
ATOM   5665 O O   . CYS B 1 320 ? 36.983  12.315  21.662  1.00 100.31 ?  296  CYS B O   1 
ATOM   5666 C CB  . CYS B 1 320 ? 36.445  9.815   20.622  1.00 84.77  ?  296  CYS B CB  1 
ATOM   5667 S SG  . CYS B 1 320 ? 36.122  8.229   19.816  1.00 116.72 ?  296  CYS B SG  1 
ATOM   5668 N N   . TRP B 1 321 ? 36.751  13.364  19.676  1.00 84.91  ?  297  TRP B N   1 
ATOM   5669 C CA  . TRP B 1 321 ? 37.283  14.650  20.123  1.00 89.31  ?  297  TRP B CA  1 
ATOM   5670 C C   . TRP B 1 321 ? 38.740  14.528  20.571  1.00 95.12  ?  297  TRP B C   1 
ATOM   5671 O O   . TRP B 1 321 ? 39.175  15.206  21.500  1.00 87.95  ?  297  TRP B O   1 
ATOM   5672 C CB  . TRP B 1 321 ? 36.410  15.241  21.232  1.00 92.24  ?  297  TRP B CB  1 
ATOM   5673 C CG  . TRP B 1 321 ? 34.942  15.089  20.939  1.00 85.51  ?  297  TRP B CG  1 
ATOM   5674 C CD1 . TRP B 1 321 ? 34.340  15.162  19.715  1.00 87.44  ?  297  TRP B CD1 1 
ATOM   5675 C CD2 . TRP B 1 321 ? 33.899  14.798  21.880  1.00 77.67  ?  297  TRP B CD2 1 
ATOM   5676 N NE1 . TRP B 1 321 ? 32.987  14.956  19.838  1.00 83.37  ?  297  TRP B NE1 1 
ATOM   5677 C CE2 . TRP B 1 321 ? 32.691  14.724  21.156  1.00 80.93  ?  297  TRP B CE2 1 
ATOM   5678 C CE3 . TRP B 1 321 ? 33.868  14.600  23.263  1.00 82.60  ?  297  TRP B CE3 1 
ATOM   5679 C CZ2 . TRP B 1 321 ? 31.467  14.468  21.768  1.00 83.62  ?  297  TRP B CZ2 1 
ATOM   5680 C CZ3 . TRP B 1 321 ? 32.651  14.343  23.870  1.00 87.51  ?  297  TRP B CZ3 1 
ATOM   5681 C CH2 . TRP B 1 321 ? 31.467  14.278  23.122  1.00 72.02  ?  297  TRP B CH2 1 
ATOM   5682 N N   . THR B 1 322 ? 39.495  13.646  19.907  1.00 99.97  ?  298  THR B N   1 
ATOM   5683 C CA  . THR B 1 322 ? 40.922  13.529  20.192  1.00 111.67 ?  298  THR B CA  1 
ATOM   5684 C C   . THR B 1 322 ? 41.712  14.691  19.599  1.00 136.06 ?  298  THR B C   1 
ATOM   5685 O O   . THR B 1 322 ? 42.770  15.053  20.125  1.00 162.98 ?  298  THR B O   1 
ATOM   5686 C CB  . THR B 1 322 ? 41.462  12.197  19.666  1.00 101.48 ?  298  THR B CB  1 
ATOM   5687 N N   . ARG B 1 323 ? 41.224  15.280  18.506  1.00 162.26 ?  299  ARG B N   1 
ATOM   5688 C CA  . ARG B 1 323 ? 41.861  16.446  17.893  1.00 144.79 ?  299  ARG B CA  1 
ATOM   5689 C C   . ARG B 1 323 ? 41.448  17.723  18.630  1.00 131.63 ?  299  ARG B C   1 
ATOM   5690 O O   . ARG B 1 323 ? 40.783  18.606  18.091  1.00 132.02 ?  299  ARG B O   1 
ATOM   5691 C CB  . ARG B 1 323 ? 41.502  16.534  16.414  1.00 146.00 ?  299  ARG B CB  1 
ATOM   5692 C CG  . ARG B 1 323 ? 42.043  15.420  15.528  1.00 135.43 ?  299  ARG B CG  1 
ATOM   5693 C CD  . ARG B 1 323 ? 43.561  15.481  15.393  1.00 143.40 ?  299  ARG B CD  1 
ATOM   5694 N NE  . ARG B 1 323 ? 44.053  16.803  15.009  1.00 150.41 ?  299  ARG B NE  1 
ATOM   5695 C CZ  . ARG B 1 323 ? 44.294  17.188  13.758  1.00 147.72 ?  299  ARG B CZ  1 
ATOM   5696 N NH1 . ARG B 1 323 ? 44.083  16.355  12.748  1.00 152.79 ?  299  ARG B NH1 1 
ATOM   5697 N NH2 . ARG B 1 323 ? 44.747  18.412  13.519  1.00 143.72 ?  299  ARG B NH2 1 
ATOM   5698 N N   . ASN B 1 324 ? 41.850  17.805  19.896  1.00 122.77 ?  300  ASN B N   1 
ATOM   5699 C CA  . ASN B 1 324 ? 41.497  18.946  20.739  1.00 143.27 ?  300  ASN B CA  1 
ATOM   5700 C C   . ASN B 1 324 ? 42.565  20.040  20.652  1.00 151.92 ?  300  ASN B C   1 
ATOM   5701 O O   . ASN B 1 324 ? 43.099  20.513  21.653  1.00 169.23 ?  300  ASN B O   1 
ATOM   5702 C CB  . ASN B 1 324 ? 41.278  18.490  22.178  1.00 127.25 ?  300  ASN B CB  1 
ATOM   5703 N N   . SER B 1 325 ? 42.879  20.448  19.409  1.00 130.95 ?  301  SER B N   1 
ATOM   5704 C CA  . SER B 1 325 ? 43.745  21.611  19.185  1.00 118.40 ?  301  SER B CA  1 
ATOM   5705 C C   . SER B 1 325 ? 43.099  22.483  18.104  1.00 117.11 ?  301  SER B C   1 
ATOM   5706 O O   . SER B 1 325 ? 43.521  22.490  16.944  1.00 120.73 ?  301  SER B O   1 
ATOM   5707 C CB  . SER B 1 325 ? 45.150  21.167  18.779  1.00 117.12 ?  301  SER B CB  1 
ATOM   5708 O OG  . SER B 1 325 ? 45.086  20.300  17.659  1.00 125.41 ?  301  SER B OG  1 
ATOM   5709 N N   . ASN B 1 326 ? 42.065  23.235  18.488  1.00 106.49 ?  302  ASN B N   1 
ATOM   5710 C CA  . ASN B 1 326 ? 41.473  24.172  17.540  1.00 109.40 ?  302  ASN B CA  1 
ATOM   5711 C C   . ASN B 1 326 ? 41.249  25.574  18.107  1.00 104.12 ?  302  ASN B C   1 
ATOM   5712 O O   . ASN B 1 326 ? 41.719  26.563  17.535  1.00 101.36 ?  302  ASN B O   1 
ATOM   5713 C CB  . ASN B 1 326 ? 40.160  23.590  17.015  1.00 130.85 ?  302  ASN B CB  1 
ATOM   5714 C CG  . ASN B 1 326 ? 39.524  24.448  15.942  1.00 153.77 ?  302  ASN B CG  1 
ATOM   5715 O OD1 . ASN B 1 326 ? 40.209  25.187  15.245  1.00 179.87 ?  302  ASN B OD1 1 
ATOM   5716 N ND2 . ASN B 1 326 ? 38.198  24.359  15.810  1.00 131.28 ?  302  ASN B ND2 1 
ATOM   5717 N N   . MET B 1 327 ? 40.534  25.662  19.225  1.00 109.39 ?  303  MET B N   1 
ATOM   5718 C CA  . MET B 1 327 ? 40.002  26.933  19.728  1.00 112.94 ?  303  MET B CA  1 
ATOM   5719 C C   . MET B 1 327 ? 39.981  26.886  21.259  1.00 112.51 ?  303  MET B C   1 
ATOM   5720 O O   . MET B 1 327 ? 40.615  26.035  21.893  1.00 105.09 ?  303  MET B O   1 
ATOM   5721 C CB  . MET B 1 327 ? 38.622  27.224  19.099  1.00 118.20 ?  303  MET B CB  1 
ATOM   5722 C CG  . MET B 1 327 ? 38.173  28.702  19.142  1.00 120.58 ?  303  MET B CG  1 
ATOM   5723 S SD  . MET B 1 327 ? 36.545  29.032  18.422  1.00 147.78 ?  303  MET B SD  1 
ATOM   5724 C CE  . MET B 1 327 ? 36.223  30.681  19.046  1.00 104.08 ?  303  MET B CE  1 
ATOM   5725 N N   . ASN B 1 328 ? 39.243  27.830  21.859  1.00 125.96 ?  304  ASN B N   1 
ATOM   5726 C CA  . ASN B 1 328 ? 39.067  28.009  23.300  1.00 118.78 ?  304  ASN B CA  1 
ATOM   5727 C C   . ASN B 1 328 ? 38.510  26.776  24.008  1.00 106.40 ?  304  ASN B C   1 
ATOM   5728 O O   . ASN B 1 328 ? 38.524  26.737  25.244  1.00 84.22  ?  304  ASN B O   1 
ATOM   5729 C CB  . ASN B 1 328 ? 38.135  29.213  23.517  1.00 109.86 ?  304  ASN B CB  1 
ATOM   5730 C CG  . ASN B 1 328 ? 37.953  29.574  24.977  1.00 101.90 ?  304  ASN B CG  1 
ATOM   5731 O OD1 . ASN B 1 328 ? 36.956  29.206  25.601  1.00 104.13 ?  304  ASN B OD1 1 
ATOM   5732 N ND2 . ASN B 1 328 ? 38.911  30.306  25.528  1.00 124.01 ?  304  ASN B ND2 1 
ATOM   5733 N N   . TYR B 1 329 ? 38.049  25.763  23.266  1.00 113.30 ?  305  TYR B N   1 
ATOM   5734 C CA  . TYR B 1 329 ? 37.330  24.642  23.867  1.00 114.14 ?  305  TYR B CA  1 
ATOM   5735 C C   . TYR B 1 329 ? 38.224  23.757  24.725  1.00 102.11 ?  305  TYR B C   1 
ATOM   5736 O O   . TYR B 1 329 ? 37.716  23.037  25.592  1.00 121.52 ?  305  TYR B O   1 
ATOM   5737 C CB  . TYR B 1 329 ? 36.657  23.819  22.768  1.00 111.93 ?  305  TYR B CB  1 
ATOM   5738 C CG  . TYR B 1 329 ? 35.828  24.670  21.839  1.00 118.00 ?  305  TYR B CG  1 
ATOM   5739 C CD1 . TYR B 1 329 ? 34.957  25.630  22.340  1.00 115.36 ?  305  TYR B CD1 1 
ATOM   5740 C CD2 . TYR B 1 329 ? 35.936  24.540  20.462  1.00 125.10 ?  305  TYR B CD2 1 
ATOM   5741 C CE1 . TYR B 1 329 ? 34.206  26.422  21.498  1.00 109.01 ?  305  TYR B CE1 1 
ATOM   5742 C CE2 . TYR B 1 329 ? 35.190  25.329  19.614  1.00 114.54 ?  305  TYR B CE2 1 
ATOM   5743 C CZ  . TYR B 1 329 ? 34.328  26.268  20.135  1.00 106.46 ?  305  TYR B CZ  1 
ATOM   5744 O OH  . TYR B 1 329 ? 33.583  27.055  19.290  1.00 103.14 ?  305  TYR B OH  1 
ATOM   5745 N N   . TRP B 1 330 ? 39.538  23.789  24.502  1.00 78.25  ?  306  TRP B N   1 
ATOM   5746 C CA  . TRP B 1 330 ? 40.458  23.075  25.379  1.00 81.73  ?  306  TRP B CA  1 
ATOM   5747 C C   . TRP B 1 330 ? 40.577  23.765  26.732  1.00 76.92  ?  306  TRP B C   1 
ATOM   5748 O O   . TRP B 1 330 ? 40.869  23.112  27.740  1.00 77.47  ?  306  TRP B O   1 
ATOM   5749 C CB  . TRP B 1 330 ? 41.829  22.965  24.705  1.00 99.61  ?  306  TRP B CB  1 
ATOM   5750 C CG  . TRP B 1 330 ? 42.877  22.226  25.495  1.00 123.25 ?  306  TRP B CG  1 
ATOM   5751 C CD1 . TRP B 1 330 ? 43.021  20.873  25.605  1.00 126.19 ?  306  TRP B CD1 1 
ATOM   5752 C CD2 . TRP B 1 330 ? 43.943  22.805  26.260  1.00 148.91 ?  306  TRP B CD2 1 
ATOM   5753 N NE1 . TRP B 1 330 ? 44.102  20.574  26.402  1.00 120.05 ?  306  TRP B NE1 1 
ATOM   5754 C CE2 . TRP B 1 330 ? 44.686  21.743  26.816  1.00 151.97 ?  306  TRP B CE2 1 
ATOM   5755 C CE3 . TRP B 1 330 ? 44.337  24.118  26.533  1.00 150.60 ?  306  TRP B CE3 1 
ATOM   5756 C CZ2 . TRP B 1 330 ? 45.800  21.954  27.628  1.00 152.26 ?  306  TRP B CZ2 1 
ATOM   5757 C CZ3 . TRP B 1 330 ? 45.442  24.325  27.340  1.00 127.64 ?  306  TRP B CZ3 1 
ATOM   5758 C CH2 . TRP B 1 330 ? 46.160  23.250  27.877  1.00 139.51 ?  306  TRP B CH2 1 
ATOM   5759 N N   . LEU B 1 331 ? 40.331  25.075  26.770  1.00 71.06  ?  307  LEU B N   1 
ATOM   5760 C CA  . LEU B 1 331 ? 40.548  25.885  27.960  1.00 58.90  ?  307  LEU B CA  1 
ATOM   5761 C C   . LEU B 1 331 ? 39.447  25.724  29.000  1.00 67.50  ?  307  LEU B C   1 
ATOM   5762 O O   . LEU B 1 331 ? 39.700  25.944  30.190  1.00 71.44  ?  307  LEU B O   1 
ATOM   5763 C CB  . LEU B 1 331 ? 40.667  27.352  27.541  1.00 61.36  ?  307  LEU B CB  1 
ATOM   5764 C CG  . LEU B 1 331 ? 41.542  28.313  28.343  1.00 75.76  ?  307  LEU B CG  1 
ATOM   5765 C CD1 . LEU B 1 331 ? 42.949  27.763  28.508  1.00 85.06  ?  307  LEU B CD1 1 
ATOM   5766 C CD2 . LEU B 1 331 ? 41.572  29.677  27.664  1.00 58.85  ?  307  LEU B CD2 1 
ATOM   5767 N N   . ILE B 1 332 ? 38.234  25.343  28.586  1.00 76.44  ?  308  ILE B N   1 
ATOM   5768 C CA  . ILE B 1 332 ? 37.126  25.235  29.532  1.00 75.54  ?  308  ILE B CA  1 
ATOM   5769 C C   . ILE B 1 332 ? 37.130  23.917  30.289  1.00 73.29  ?  308  ILE B C   1 
ATOM   5770 O O   . ILE B 1 332 ? 36.287  23.717  31.172  1.00 64.88  ?  308  ILE B O   1 
ATOM   5771 C CB  . ILE B 1 332 ? 35.780  25.426  28.811  1.00 91.62  ?  308  ILE B CB  1 
ATOM   5772 C CG1 . ILE B 1 332 ? 35.591  24.338  27.758  1.00 80.71  ?  308  ILE B CG1 1 
ATOM   5773 C CG2 . ILE B 1 332 ? 35.713  26.810  28.172  1.00 105.88 ?  308  ILE B CG2 1 
ATOM   5774 C CD1 . ILE B 1 332 ? 34.332  24.501  26.944  1.00 69.73  ?  308  ILE B CD1 1 
ATOM   5775 N N   . ILE B 1 333 ? 38.054  23.013  29.973  1.00 71.00  ?  309  ILE B N   1 
ATOM   5776 C CA  . ILE B 1 333 ? 38.207  21.763  30.710  1.00 82.38  ?  309  ILE B CA  1 
ATOM   5777 C C   . ILE B 1 333 ? 39.516  21.707  31.483  1.00 81.52  ?  309  ILE B C   1 
ATOM   5778 O O   . ILE B 1 333 ? 39.668  20.836  32.356  1.00 60.55  ?  309  ILE B O   1 
ATOM   5779 C CB  . ILE B 1 333 ? 38.085  20.539  29.773  1.00 80.93  ?  309  ILE B CB  1 
ATOM   5780 C CG1 . ILE B 1 333 ? 37.802  19.254  30.557  1.00 70.27  ?  309  ILE B CG1 1 
ATOM   5781 C CG2 . ILE B 1 333 ? 39.336  20.383  28.928  1.00 104.27 ?  309  ILE B CG2 1 
ATOM   5782 C CD1 . ILE B 1 333 ? 36.363  19.101  30.982  1.00 71.50  ?  309  ILE B CD1 1 
ATOM   5783 N N   . ARG B 1 334 ? 40.458  22.609  31.211  1.00 83.64  ?  310  ARG B N   1 
ATOM   5784 C CA  . ARG B 1 334 ? 41.748  22.618  31.888  1.00 74.64  ?  310  ARG B CA  1 
ATOM   5785 C C   . ARG B 1 334 ? 41.912  23.761  32.877  1.00 71.28  ?  310  ARG B C   1 
ATOM   5786 O O   . ARG B 1 334 ? 42.765  23.673  33.763  1.00 86.74  ?  310  ARG B O   1 
ATOM   5787 C CB  . ARG B 1 334 ? 42.887  22.686  30.863  1.00 82.79  ?  310  ARG B CB  1 
ATOM   5788 C CG  . ARG B 1 334 ? 42.895  21.554  29.846  1.00 80.98  ?  310  ARG B CG  1 
ATOM   5789 C CD  . ARG B 1 334 ? 43.909  20.482  30.222  1.00 82.29  ?  310  ARG B CD  1 
ATOM   5790 N NE  . ARG B 1 334 ? 43.465  19.646  31.332  1.00 101.28 ?  310  ARG B NE  1 
ATOM   5791 C CZ  . ARG B 1 334 ? 42.853  18.477  31.183  1.00 115.24 ?  310  ARG B CZ  1 
ATOM   5792 N NH1 . ARG B 1 334 ? 42.486  17.781  32.250  1.00 105.21 ?  310  ARG B NH1 1 
ATOM   5793 N NH2 . ARG B 1 334 ? 42.607  18.005  29.967  1.00 133.16 ?  310  ARG B NH2 1 
ATOM   5794 N N   . LEU B 1 335 ? 41.138  24.835  32.737  1.00 60.17  ?  311  LEU B N   1 
ATOM   5795 C CA  . LEU B 1 335 ? 41.174  25.943  33.686  1.00 66.81  ?  311  LEU B CA  1 
ATOM   5796 C C   . LEU B 1 335 ? 40.466  25.612  34.998  1.00 61.51  ?  311  LEU B C   1 
ATOM   5797 O O   . LEU B 1 335 ? 40.954  26.021  36.059  1.00 59.33  ?  311  LEU B O   1 
ATOM   5798 C CB  . LEU B 1 335 ? 40.567  27.205  33.071  1.00 74.95  ?  311  LEU B CB  1 
ATOM   5799 C CG  . LEU B 1 335 ? 41.546  28.101  32.312  1.00 77.83  ?  311  LEU B CG  1 
ATOM   5800 C CD1 . LEU B 1 335 ? 40.811  29.282  31.710  1.00 75.99  ?  311  LEU B CD1 1 
ATOM   5801 C CD2 . LEU B 1 335 ? 42.664  28.577  33.224  1.00 72.98  ?  311  LEU B CD2 1 
ATOM   5802 N N   . PRO B 1 336 ? 39.315  24.922  34.995  1.00 62.19  ?  312  PRO B N   1 
ATOM   5803 C CA  . PRO B 1 336 ? 38.742  24.510  36.287  1.00 59.89  ?  312  PRO B CA  1 
ATOM   5804 C C   . PRO B 1 336 ? 39.663  23.591  37.065  1.00 56.99  ?  312  PRO B C   1 
ATOM   5805 O O   . PRO B 1 336 ? 39.908  23.833  38.258  1.00 67.05  ?  312  PRO B O   1 
ATOM   5806 C CB  . PRO B 1 336 ? 37.441  23.802  35.884  1.00 61.27  ?  312  PRO B CB  1 
ATOM   5807 C CG  . PRO B 1 336 ? 37.082  24.404  34.590  1.00 64.72  ?  312  PRO B CG  1 
ATOM   5808 C CD  . PRO B 1 336 ? 38.389  24.618  33.888  1.00 64.98  ?  312  PRO B CD  1 
ATOM   5809 N N   . ILE B 1 337 ? 40.249  22.590  36.397  1.00 43.57  ?  313  ILE B N   1 
ATOM   5810 C CA  . ILE B 1 337 ? 41.150  21.682  37.093  1.00 43.19  ?  313  ILE B CA  1 
ATOM   5811 C C   . ILE B 1 337 ? 42.342  22.448  37.642  1.00 47.40  ?  313  ILE B C   1 
ATOM   5812 O O   . ILE B 1 337 ? 42.688  22.289  38.821  1.00 45.96  ?  313  ILE B O   1 
ATOM   5813 C CB  . ILE B 1 337 ? 41.584  20.529  36.168  1.00 42.42  ?  313  ILE B CB  1 
ATOM   5814 C CG1 . ILE B 1 337 ? 40.373  19.673  35.795  1.00 43.32  ?  313  ILE B CG1 1 
ATOM   5815 C CG2 . ILE B 1 337 ? 42.667  19.680  36.841  1.00 37.01  ?  313  ILE B CG2 1 
ATOM   5816 C CD1 . ILE B 1 337 ? 40.698  18.518  34.893  1.00 40.32  ?  313  ILE B CD1 1 
ATOM   5817 N N   . LEU B 1 338 ? 42.930  23.351  36.839  1.00 52.20  ?  314  LEU B N   1 
ATOM   5818 C CA  . LEU B 1 338 ? 44.001  24.204  37.349  1.00 48.41  ?  314  LEU B CA  1 
ATOM   5819 C C   . LEU B 1 338 ? 43.557  24.918  38.616  1.00 50.03  ?  314  LEU B C   1 
ATOM   5820 O O   . LEU B 1 338 ? 44.259  24.871  39.635  1.00 49.39  ?  314  LEU B O   1 
ATOM   5821 C CB  . LEU B 1 338 ? 44.438  25.227  36.298  1.00 53.09  ?  314  LEU B CB  1 
ATOM   5822 C CG  . LEU B 1 338 ? 45.680  26.024  36.718  1.00 54.83  ?  314  LEU B CG  1 
ATOM   5823 C CD1 . LEU B 1 338 ? 46.886  25.100  36.809  1.00 58.43  ?  314  LEU B CD1 1 
ATOM   5824 C CD2 . LEU B 1 338 ? 45.952  27.167  35.759  1.00 43.05  ?  314  LEU B CD2 1 
ATOM   5825 N N   . PHE B 1 339 ? 42.350  25.501  38.596  1.00 47.00  ?  315  PHE B N   1 
ATOM   5826 C CA  . PHE B 1 339 ? 41.813  26.126  39.801  1.00 51.81  ?  315  PHE B CA  1 
ATOM   5827 C C   . PHE B 1 339 ? 41.850  25.152  40.974  1.00 60.68  ?  315  PHE B C   1 
ATOM   5828 O O   . PHE B 1 339 ? 42.493  25.431  41.996  1.00 66.84  ?  315  PHE B O   1 
ATOM   5829 C CB  . PHE B 1 339 ? 40.383  26.625  39.554  1.00 49.02  ?  315  PHE B CB  1 
ATOM   5830 C CG  . PHE B 1 339 ? 39.725  27.222  40.774  1.00 46.78  ?  315  PHE B CG  1 
ATOM   5831 C CD1 . PHE B 1 339 ? 39.999  28.525  41.154  1.00 52.70  ?  315  PHE B CD1 1 
ATOM   5832 C CD2 . PHE B 1 339 ? 38.836  26.480  41.541  1.00 50.49  ?  315  PHE B CD2 1 
ATOM   5833 C CE1 . PHE B 1 339 ? 39.405  29.079  42.275  1.00 47.27  ?  315  PHE B CE1 1 
ATOM   5834 C CE2 . PHE B 1 339 ? 38.237  27.032  42.665  1.00 49.08  ?  315  PHE B CE2 1 
ATOM   5835 C CZ  . PHE B 1 339 ? 38.524  28.332  43.030  1.00 57.17  ?  315  PHE B CZ  1 
ATOM   5836 N N   . ALA B 1 340 ? 41.263  23.958  40.800  1.00 49.99  ?  316  ALA B N   1 
ATOM   5837 C CA  . ALA B 1 340 ? 41.232  22.977  41.883  1.00 48.14  ?  316  ALA B CA  1 
ATOM   5838 C C   . ALA B 1 340 ? 42.634  22.587  42.337  1.00 52.89  ?  316  ALA B C   1 
ATOM   5839 O O   . ALA B 1 340 ? 42.829  22.265  43.514  1.00 40.28  ?  316  ALA B O   1 
ATOM   5840 C CB  . ALA B 1 340 ? 40.454  21.726  41.461  1.00 45.60  ?  316  ALA B CB  1 
ATOM   5841 N N   . CYS B 1 341 ? 43.625  22.625  41.443  1.00 52.70  ?  317  CYS B N   1 
ATOM   5842 C CA  . CYS B 1 341 ? 44.975  22.326  41.906  1.00 56.31  ?  317  CYS B CA  1 
ATOM   5843 C C   . CYS B 1 341 ? 45.583  23.514  42.644  1.00 66.86  ?  317  CYS B C   1 
ATOM   5844 O O   . CYS B 1 341 ? 46.204  23.330  43.699  1.00 62.76  ?  317  CYS B O   1 
ATOM   5845 C CB  . CYS B 1 341 ? 45.856  21.878  40.743  1.00 64.32  ?  317  CYS B CB  1 
ATOM   5846 S SG  . CYS B 1 341 ? 45.468  20.195  40.233  1.00 75.25  ?  317  CYS B SG  1 
ATOM   5847 N N   . ILE B 1 342 ? 45.362  24.739  42.150  1.00 63.23  ?  318  ILE B N   1 
ATOM   5848 C CA  . ILE B 1 342 ? 45.919  25.913  42.822  1.00 54.31  ?  318  ILE B CA  1 
ATOM   5849 C C   . ILE B 1 342 ? 45.469  25.944  44.275  1.00 63.47  ?  318  ILE B C   1 
ATOM   5850 O O   . ILE B 1 342 ? 46.292  25.952  45.201  1.00 70.88  ?  318  ILE B O   1 
ATOM   5851 C CB  . ILE B 1 342 ? 45.533  27.206  42.079  1.00 48.87  ?  318  ILE B CB  1 
ATOM   5852 C CG1 . ILE B 1 342 ? 46.356  27.309  40.796  1.00 45.17  ?  318  ILE B CG1 1 
ATOM   5853 C CG2 . ILE B 1 342 ? 45.735  28.431  42.975  1.00 48.50  ?  318  ILE B CG2 1 
ATOM   5854 C CD1 . ILE B 1 342 ? 45.969  28.427  39.870  1.00 48.79  ?  318  ILE B CD1 1 
ATOM   5855 N N   . VAL B 1 343 ? 44.155  25.867  44.496  1.00 56.46  ?  319  VAL B N   1 
ATOM   5856 C CA  . VAL B 1 343 ? 43.653  25.831  45.863  1.00 64.61  ?  319  VAL B CA  1 
ATOM   5857 C C   . VAL B 1 343 ? 44.232  24.635  46.611  1.00 64.13  ?  319  VAL B C   1 
ATOM   5858 O O   . VAL B 1 343 ? 44.676  24.769  47.757  1.00 67.02  ?  319  VAL B O   1 
ATOM   5859 C CB  . VAL B 1 343 ? 42.113  25.833  45.873  1.00 56.56  ?  319  VAL B CB  1 
ATOM   5860 C CG1 . VAL B 1 343 ? 41.595  27.112  45.249  1.00 53.75  ?  319  VAL B CG1 1 
ATOM   5861 C CG2 . VAL B 1 343 ? 41.564  24.650  45.117  1.00 76.86  ?  319  VAL B CG2 1 
ATOM   5862 N N   . ASN B 1 344 ? 44.301  23.466  45.959  1.00 64.49  ?  320  ASN B N   1 
ATOM   5863 C CA  . ASN B 1 344 ? 44.840  22.289  46.634  1.00 68.25  ?  320  ASN B CA  1 
ATOM   5864 C C   . ASN B 1 344 ? 46.278  22.501  47.067  1.00 60.65  ?  320  ASN B C   1 
ATOM   5865 O O   . ASN B 1 344 ? 46.700  21.953  48.093  1.00 51.01  ?  320  ASN B O   1 
ATOM   5866 C CB  . ASN B 1 344 ? 44.736  21.054  45.743  1.00 72.85  ?  320  ASN B CB  1 
ATOM   5867 C CG  . ASN B 1 344 ? 43.482  20.263  46.012  1.00 83.41  ?  320  ASN B CG  1 
ATOM   5868 O OD1 . ASN B 1 344 ? 42.972  20.262  47.131  1.00 103.64 ?  320  ASN B OD1 1 
ATOM   5869 N ND2 . ASN B 1 344 ? 42.969  19.594  44.989  1.00 88.40  ?  320  ASN B ND2 1 
ATOM   5870 N N   . PHE B 1 345 ? 47.044  23.297  46.315  1.00 57.81  ?  321  PHE B N   1 
ATOM   5871 C CA  . PHE B 1 345 ? 48.386  23.602  46.790  1.00 58.13  ?  321  PHE B CA  1 
ATOM   5872 C C   . PHE B 1 345 ? 48.354  24.626  47.914  1.00 54.56  ?  321  PHE B C   1 
ATOM   5873 O O   . PHE B 1 345 ? 49.076  24.469  48.906  1.00 53.70  ?  321  PHE B O   1 
ATOM   5874 C CB  . PHE B 1 345 ? 49.283  24.060  45.640  1.00 49.68  ?  321  PHE B CB  1 
ATOM   5875 C CG  . PHE B 1 345 ? 49.960  22.920  44.943  1.00 50.49  ?  321  PHE B CG  1 
ATOM   5876 C CD1 . PHE B 1 345 ? 50.948  22.200  45.591  1.00 52.40  ?  321  PHE B CD1 1 
ATOM   5877 C CD2 . PHE B 1 345 ? 49.588  22.542  43.664  1.00 47.63  ?  321  PHE B CD2 1 
ATOM   5878 C CE1 . PHE B 1 345 ? 51.567  21.138  44.978  1.00 55.15  ?  321  PHE B CE1 1 
ATOM   5879 C CE2 . PHE B 1 345 ? 50.208  21.472  43.039  1.00 60.60  ?  321  PHE B CE2 1 
ATOM   5880 C CZ  . PHE B 1 345 ? 51.201  20.771  43.699  1.00 71.53  ?  321  PHE B CZ  1 
ATOM   5881 N N   . LEU B 1 346 ? 47.485  25.639  47.821  1.00 49.58  ?  322  LEU B N   1 
ATOM   5882 C CA  . LEU B 1 346 ? 47.418  26.608  48.910  1.00 53.27  ?  322  LEU B CA  1 
ATOM   5883 C C   . LEU B 1 346 ? 47.013  25.931  50.212  1.00 46.40  ?  322  LEU B C   1 
ATOM   5884 O O   . LEU B 1 346 ? 47.707  26.084  51.228  1.00 53.51  ?  322  LEU B O   1 
ATOM   5885 C CB  . LEU B 1 346 ? 46.459  27.746  48.552  1.00 53.41  ?  322  LEU B CB  1 
ATOM   5886 C CG  . LEU B 1 346 ? 46.968  28.575  47.365  1.00 59.08  ?  322  LEU B CG  1 
ATOM   5887 C CD1 . LEU B 1 346 ? 45.974  29.643  46.908  1.00 51.07  ?  322  LEU B CD1 1 
ATOM   5888 C CD2 . LEU B 1 346 ? 48.323  29.196  47.689  1.00 47.24  ?  322  LEU B CD2 1 
ATOM   5889 N N   . ILE B 1 347 ? 45.962  25.103  50.174  1.00 48.80  ?  323  ILE B N   1 
ATOM   5890 C CA  . ILE B 1 347 ? 45.647  24.249  51.315  1.00 47.97  ?  323  ILE B CA  1 
ATOM   5891 C C   . ILE B 1 347 ? 46.892  23.482  51.739  1.00 49.41  ?  323  ILE B C   1 
ATOM   5892 O O   . ILE B 1 347 ? 47.329  23.567  52.895  1.00 54.27  ?  323  ILE B O   1 
ATOM   5893 C CB  . ILE B 1 347 ? 44.490  23.284  50.976  1.00 56.40  ?  323  ILE B CB  1 
ATOM   5894 C CG1 . ILE B 1 347 ? 43.256  24.043  50.493  1.00 65.17  ?  323  ILE B CG1 1 
ATOM   5895 C CG2 . ILE B 1 347 ? 44.152  22.404  52.179  1.00 49.26  ?  323  ILE B CG2 1 
ATOM   5896 C CD1 . ILE B 1 347 ? 42.826  25.139  51.424  1.00 62.36  ?  323  ILE B CD1 1 
ATOM   5897 N N   . PHE B 1 348 ? 47.523  22.794  50.777  1.00 53.46  ?  324  PHE B N   1 
ATOM   5898 C CA  . PHE B 1 348 ? 48.756  22.049  51.027  1.00 55.93  ?  324  PHE B CA  1 
ATOM   5899 C C   . PHE B 1 348 ? 49.740  22.866  51.856  1.00 59.64  ?  324  PHE B C   1 
ATOM   5900 O O   . PHE B 1 348 ? 50.290  22.374  52.845  1.00 62.13  ?  324  PHE B O   1 
ATOM   5901 C CB  . PHE B 1 348 ? 49.391  21.633  49.693  1.00 54.23  ?  324  PHE B CB  1 
ATOM   5902 C CG  . PHE B 1 348 ? 50.740  20.957  49.825  1.00 53.47  ?  324  PHE B CG  1 
ATOM   5903 C CD1 . PHE B 1 348 ? 50.832  19.577  49.919  1.00 50.83  ?  324  PHE B CD1 1 
ATOM   5904 C CD2 . PHE B 1 348 ? 51.915  21.699  49.822  1.00 47.49  ?  324  PHE B CD2 1 
ATOM   5905 C CE1 . PHE B 1 348 ? 52.067  18.951  50.031  1.00 55.34  ?  324  PHE B CE1 1 
ATOM   5906 C CE2 . PHE B 1 348 ? 53.152  21.076  49.936  1.00 47.52  ?  324  PHE B CE2 1 
ATOM   5907 C CZ  . PHE B 1 348 ? 53.227  19.702  50.037  1.00 54.61  ?  324  PHE B CZ  1 
ATOM   5908 N N   . VAL B 1 349 ? 49.959  24.129  51.483  1.00 65.33  ?  325  VAL B N   1 
ATOM   5909 C CA  . VAL B 1 349 ? 50.921  24.942  52.222  1.00 54.36  ?  325  VAL B CA  1 
ATOM   5910 C C   . VAL B 1 349 ? 50.367  25.302  53.596  1.00 52.04  ?  325  VAL B C   1 
ATOM   5911 O O   . VAL B 1 349 ? 51.033  25.102  54.621  1.00 55.19  ?  325  VAL B O   1 
ATOM   5912 C CB  . VAL B 1 349 ? 51.300  26.194  51.407  1.00 51.89  ?  325  VAL B CB  1 
ATOM   5913 C CG1 . VAL B 1 349 ? 52.097  27.177  52.255  1.00 47.62  ?  325  VAL B CG1 1 
ATOM   5914 C CG2 . VAL B 1 349 ? 52.091  25.788  50.176  1.00 43.58  ?  325  VAL B CG2 1 
ATOM   5915 N N   . ARG B 1 350 ? 49.126  25.799  53.644  1.00 52.61  ?  326  ARG B N   1 
ATOM   5916 C CA  . ARG B 1 350 ? 48.568  26.287  54.906  1.00 59.10  ?  326  ARG B CA  1 
ATOM   5917 C C   . ARG B 1 350 ? 48.504  25.173  55.948  1.00 58.34  ?  326  ARG B C   1 
ATOM   5918 O O   . ARG B 1 350 ? 48.967  25.348  57.085  1.00 52.21  ?  326  ARG B O   1 
ATOM   5919 C CB  . ARG B 1 350 ? 47.183  26.898  54.647  1.00 54.83  ?  326  ARG B CB  1 
ATOM   5920 C CG  . ARG B 1 350 ? 46.419  27.452  55.849  1.00 70.18  ?  326  ARG B CG  1 
ATOM   5921 C CD  . ARG B 1 350 ? 47.266  28.251  56.820  1.00 86.09  ?  326  ARG B CD  1 
ATOM   5922 N NE  . ARG B 1 350 ? 48.046  29.321  56.207  1.00 116.86 ?  326  ARG B NE  1 
ATOM   5923 C CZ  . ARG B 1 350 ? 48.864  30.105  56.900  1.00 138.12 ?  326  ARG B CZ  1 
ATOM   5924 N NH1 . ARG B 1 350 ? 48.985  29.922  58.209  1.00 124.00 ?  326  ARG B NH1 1 
ATOM   5925 N NH2 . ARG B 1 350 ? 49.559  31.061  56.299  1.00 145.58 ?  326  ARG B NH2 1 
ATOM   5926 N N   . VAL B 1 351 ? 47.981  24.007  55.553  1.00 56.35  ?  327  VAL B N   1 
ATOM   5927 C CA  . VAL B 1 351 ? 47.956  22.837  56.429  1.00 48.23  ?  327  VAL B CA  1 
ATOM   5928 C C   . VAL B 1 351 ? 49.327  22.596  57.038  1.00 45.76  ?  327  VAL B C   1 
ATOM   5929 O O   . VAL B 1 351 ? 49.451  22.377  58.250  1.00 58.50  ?  327  VAL B O   1 
ATOM   5930 C CB  . VAL B 1 351 ? 47.469  21.596  55.656  1.00 52.66  ?  327  VAL B CB  1 
ATOM   5931 C CG1 . VAL B 1 351 ? 47.808  20.332  56.418  1.00 61.07  ?  327  VAL B CG1 1 
ATOM   5932 C CG2 . VAL B 1 351 ? 45.968  21.685  55.408  1.00 43.85  ?  327  VAL B CG2 1 
ATOM   5933 N N   . ILE B 1 352 ? 50.382  22.669  56.218  1.00 51.64  ?  328  ILE B N   1 
ATOM   5934 C CA  . ILE B 1 352 ? 51.718  22.410  56.745  1.00 52.82  ?  328  ILE B CA  1 
ATOM   5935 C C   . ILE B 1 352 ? 52.029  23.378  57.881  1.00 58.33  ?  328  ILE B C   1 
ATOM   5936 O O   . ILE B 1 352 ? 52.371  22.954  58.994  1.00 62.34  ?  328  ILE B O   1 
ATOM   5937 C CB  . ILE B 1 352 ? 52.773  22.455  55.622  1.00 46.63  ?  328  ILE B CB  1 
ATOM   5938 C CG1 . ILE B 1 352 ? 52.535  21.288  54.664  1.00 47.13  ?  328  ILE B CG1 1 
ATOM   5939 C CG2 . ILE B 1 352 ? 54.159  22.373  56.220  1.00 47.98  ?  328  ILE B CG2 1 
ATOM   5940 C CD1 . ILE B 1 352 ? 53.510  21.201  53.533  1.00 47.93  ?  328  ILE B CD1 1 
ATOM   5941 N N   . CYS B 1 353 ? 51.803  24.680  57.658  1.00 62.32  ?  329  CYS B N   1 
ATOM   5942 C CA  . CYS B 1 353 ? 52.028  25.662  58.718  1.00 63.27  ?  329  CYS B CA  1 
ATOM   5943 C C   . CYS B 1 353 ? 51.299  25.272  59.995  1.00 64.15  ?  329  CYS B C   1 
ATOM   5944 O O   . CYS B 1 353 ? 51.838  25.413  61.099  1.00 66.35  ?  329  CYS B O   1 
ATOM   5945 C CB  . CYS B 1 353 ? 51.566  27.047  58.269  1.00 60.98  ?  329  CYS B CB  1 
ATOM   5946 S SG  . CYS B 1 353 ? 52.645  27.865  57.095  1.00 86.95  ?  329  CYS B SG  1 
ATOM   5947 N N   . ILE B 1 354 ? 50.087  24.736  59.861  1.00 67.17  ?  330  ILE B N   1 
ATOM   5948 C CA  . ILE B 1 354 ? 49.313  24.361  61.034  1.00 57.99  ?  330  ILE B CA  1 
ATOM   5949 C C   . ILE B 1 354 ? 49.906  23.126  61.696  1.00 59.05  ?  330  ILE B C   1 
ATOM   5950 O O   . ILE B 1 354 ? 50.130  23.112  62.912  1.00 65.47  ?  330  ILE B O   1 
ATOM   5951 C CB  . ILE B 1 354 ? 47.839  24.159  60.643  1.00 63.73  ?  330  ILE B CB  1 
ATOM   5952 C CG1 . ILE B 1 354 ? 47.331  25.411  59.933  1.00 60.49  ?  330  ILE B CG1 1 
ATOM   5953 C CG2 . ILE B 1 354 ? 47.005  23.837  61.872  1.00 56.18  ?  330  ILE B CG2 1 
ATOM   5954 C CD1 . ILE B 1 354 ? 47.605  26.674  60.710  1.00 69.38  ?  330  ILE B CD1 1 
ATOM   5955 N N   . VAL B 1 355 ? 50.228  22.095  60.907  1.00 47.88  ?  331  VAL B N   1 
ATOM   5956 C CA  . VAL B 1 355 ? 50.662  20.832  61.501  1.00 57.93  ?  331  VAL B CA  1 
ATOM   5957 C C   . VAL B 1 355 ? 51.922  21.048  62.329  1.00 64.50  ?  331  VAL B C   1 
ATOM   5958 O O   . VAL B 1 355 ? 51.953  20.766  63.536  1.00 52.31  ?  331  VAL B O   1 
ATOM   5959 C CB  . VAL B 1 355 ? 50.870  19.767  60.408  1.00 60.45  ?  331  VAL B CB  1 
ATOM   5960 C CG1 . VAL B 1 355 ? 51.487  18.514  60.994  1.00 63.64  ?  331  VAL B CG1 1 
ATOM   5961 C CG2 . VAL B 1 355 ? 49.548  19.435  59.751  1.00 57.24  ?  331  VAL B CG2 1 
ATOM   5962 N N   . VAL B 1 356 ? 52.948  21.642  61.715  1.00 61.56  ?  332  VAL B N   1 
ATOM   5963 C CA  . VAL B 1 356 ? 54.195  21.892  62.432  1.00 55.71  ?  332  VAL B CA  1 
ATOM   5964 C C   . VAL B 1 356 ? 53.991  22.859  63.589  1.00 53.46  ?  332  VAL B C   1 
ATOM   5965 O O   . VAL B 1 356 ? 54.782  22.866  64.541  1.00 60.59  ?  332  VAL B O   1 
ATOM   5966 C CB  . VAL B 1 356 ? 55.270  22.413  61.467  1.00 55.67  ?  332  VAL B CB  1 
ATOM   5967 C CG1 . VAL B 1 356 ? 55.342  21.527  60.247  1.00 51.08  ?  332  VAL B CG1 1 
ATOM   5968 C CG2 . VAL B 1 356 ? 54.974  23.849  61.069  1.00 52.59  ?  332  VAL B CG2 1 
ATOM   5969 N N   . SER B 1 357 ? 52.955  23.698  63.539  1.00 56.71  ?  333  SER B N   1 
ATOM   5970 C CA  . SER B 1 357 ? 52.621  24.474  64.727  1.00 59.71  ?  333  SER B CA  1 
ATOM   5971 C C   . SER B 1 357 ? 52.134  23.559  65.842  1.00 69.59  ?  333  SER B C   1 
ATOM   5972 O O   . SER B 1 357 ? 52.725  23.513  66.931  1.00 85.51  ?  333  SER B O   1 
ATOM   5973 C CB  . SER B 1 357 ? 51.570  25.533  64.393  1.00 57.19  ?  333  SER B CB  1 
ATOM   5974 O OG  . SER B 1 357 ? 52.160  26.607  63.690  1.00 82.15  ?  333  SER B OG  1 
ATOM   5975 N N   . LYS B 1 358 ? 51.096  22.767  65.563  1.00 71.47  ?  334  LYS B N   1 
ATOM   5976 C CA  . LYS B 1 358 ? 50.473  21.978  66.620  1.00 62.92  ?  334  LYS B CA  1 
ATOM   5977 C C   . LYS B 1 358 ? 51.415  20.909  67.163  1.00 58.42  ?  334  LYS B C   1 
ATOM   5978 O O   . LYS B 1 358 ? 51.290  20.512  68.327  1.00 55.22  ?  334  LYS B O   1 
ATOM   5979 C CB  . LYS B 1 358 ? 49.166  21.368  66.110  1.00 68.74  ?  334  LYS B CB  1 
ATOM   5980 C CG  . LYS B 1 358 ? 48.106  22.433  65.852  1.00 71.11  ?  334  LYS B CG  1 
ATOM   5981 C CD  . LYS B 1 358 ? 46.835  21.866  65.247  1.00 71.09  ?  334  LYS B CD  1 
ATOM   5982 C CE  . LYS B 1 358 ? 46.106  20.950  66.219  1.00 92.68  ?  334  LYS B CE  1 
ATOM   5983 N NZ  . LYS B 1 358 ? 45.571  21.658  67.415  1.00 113.49 ?  334  LYS B NZ  1 
ATOM   5984 N N   . LEU B 1 359 ? 52.368  20.447  66.351  1.00 57.56  ?  335  LEU B N   1 
ATOM   5985 C CA  . LEU B 1 359 ? 53.394  19.536  66.854  1.00 60.64  ?  335  LEU B CA  1 
ATOM   5986 C C   . LEU B 1 359 ? 54.394  20.266  67.747  1.00 58.15  ?  335  LEU B C   1 
ATOM   5987 O O   . LEU B 1 359 ? 54.792  19.751  68.800  1.00 52.95  ?  335  LEU B O   1 
ATOM   5988 C CB  . LEU B 1 359 ? 54.117  18.854  65.689  1.00 58.50  ?  335  LEU B CB  1 
ATOM   5989 C CG  . LEU B 1 359 ? 53.292  17.824  64.915  1.00 60.46  ?  335  LEU B CG  1 
ATOM   5990 C CD1 . LEU B 1 359 ? 53.982  17.448  63.613  1.00 53.82  ?  335  LEU B CD1 1 
ATOM   5991 C CD2 . LEU B 1 359 ? 53.047  16.593  65.775  1.00 55.34  ?  335  LEU B CD2 1 
ATOM   5992 N N   . LYS B 1 360 ? 54.816  21.469  67.340  1.00 57.92  ?  336  LYS B N   1 
ATOM   5993 C CA  . LYS B 1 360 ? 55.815  22.206  68.116  1.00 64.59  ?  336  LYS B CA  1 
ATOM   5994 C C   . LYS B 1 360 ? 55.264  22.644  69.468  1.00 69.68  ?  336  LYS B C   1 
ATOM   5995 O O   . LYS B 1 360 ? 55.978  22.601  70.475  1.00 95.43  ?  336  LYS B O   1 
ATOM   5996 C CB  . LYS B 1 360 ? 56.324  23.422  67.332  1.00 70.06  ?  336  LYS B CB  1 
ATOM   5997 C CG  . LYS B 1 360 ? 57.332  24.302  68.083  1.00 69.77  ?  336  LYS B CG  1 
ATOM   5998 C CD  . LYS B 1 360 ? 58.755  23.747  68.039  1.00 74.60  ?  336  LYS B CD  1 
ATOM   5999 C CE  . LYS B 1 360 ? 59.773  24.782  68.508  1.00 82.51  ?  336  LYS B CE  1 
ATOM   6000 N NZ  . LYS B 1 360 ? 60.003  25.858  67.497  1.00 79.28  ?  336  LYS B NZ  1 
ATOM   6001 N N   . ALA B 1 361 ? 53.999  23.073  69.511  1.00 58.63  ?  337  ALA B N   1 
ATOM   6002 C CA  . ALA B 1 361 ? 53.332  23.497  70.742  1.00 59.97  ?  337  ALA B CA  1 
ATOM   6003 C C   . ALA B 1 361 ? 52.772  22.328  71.553  1.00 63.91  ?  337  ALA B C   1 
ATOM   6004 O O   . ALA B 1 361 ? 51.942  22.556  72.443  1.00 60.23  ?  337  ALA B O   1 
ATOM   6005 C CB  . ALA B 1 361 ? 52.204  24.487  70.422  1.00 44.06  ?  337  ALA B CB  1 
ATOM   6006 N N   . ASN B 1 362 ? 53.200  21.100  71.243  1.00 68.20  ?  338  ASN B N   1 
ATOM   6007 C CA  . ASN B 1 362 ? 52.750  19.863  71.899  1.00 82.98  ?  338  ASN B CA  1 
ATOM   6008 C C   . ASN B 1 362 ? 51.226  19.774  72.002  1.00 80.53  ?  338  ASN B C   1 
ATOM   6009 O O   . ASN B 1 362 ? 50.687  19.171  72.934  1.00 83.55  ?  338  ASN B O   1 
ATOM   6010 C CB  . ASN B 1 362 ? 53.405  19.676  73.276  1.00 94.35  ?  338  ASN B CB  1 
ATOM   6011 C CG  . ASN B 1 362 ? 52.964  20.710  74.296  1.00 124.65 ?  338  ASN B CG  1 
ATOM   6012 O OD1 . ASN B 1 362 ? 53.651  21.708  74.523  1.00 132.62 ?  338  ASN B OD1 1 
ATOM   6013 N ND2 . ASN B 1 362 ? 51.818  20.473  74.923  1.00 140.17 ?  338  ASN B ND2 1 
ATOM   6014 N N   . LEU B 1 363 ? 50.518  20.369  71.038  1.00 74.84  ?  339  LEU B N   1 
ATOM   6015 C CA  . LEU B 1 363 ? 49.070  20.217  70.960  1.00 80.49  ?  339  LEU B CA  1 
ATOM   6016 C C   . LEU B 1 363 ? 48.653  18.938  70.248  1.00 83.72  ?  339  LEU B C   1 
ATOM   6017 O O   . LEU B 1 363 ? 47.482  18.553  70.328  1.00 71.37  ?  339  LEU B O   1 
ATOM   6018 C CB  . LEU B 1 363 ? 48.448  21.421  70.249  1.00 60.40  ?  339  LEU B CB  1 
ATOM   6019 C CG  . LEU B 1 363 ? 48.610  22.790  70.912  1.00 61.85  ?  339  LEU B CG  1 
ATOM   6020 C CD1 . LEU B 1 363 ? 47.949  23.859  70.057  1.00 56.84  ?  339  LEU B CD1 1 
ATOM   6021 C CD2 . LEU B 1 363 ? 48.023  22.775  72.314  1.00 54.58  ?  339  LEU B CD2 1 
ATOM   6022 N N   . MET B 1 364 ? 49.581  18.274  69.562  1.00 81.30  ?  340  MET B N   1 
ATOM   6023 C CA  . MET B 1 364 ? 49.253  17.124  68.734  1.00 81.17  ?  340  MET B CA  1 
ATOM   6024 C C   . MET B 1 364 ? 50.418  16.145  68.745  1.00 66.29  ?  340  MET B C   1 
ATOM   6025 O O   . MET B 1 364 ? 51.583  16.549  68.721  1.00 61.47  ?  340  MET B O   1 
ATOM   6026 C CB  . MET B 1 364 ? 48.937  17.560  67.297  1.00 76.68  ?  340  MET B CB  1 
ATOM   6027 C CG  . MET B 1 364 ? 48.520  16.436  66.369  1.00 82.18  ?  340  MET B CG  1 
ATOM   6028 S SD  . MET B 1 364 ? 48.544  16.909  64.625  1.00 98.30  ?  340  MET B SD  1 
ATOM   6029 C CE  . MET B 1 364 ? 47.199  18.086  64.561  1.00 84.81  ?  340  MET B CE  1 
ATOM   6030 N N   . CYS B 1 365 ? 50.092  14.860  68.784  1.00 57.44  ?  341  CYS B N   1 
ATOM   6031 C CA  . CYS B 1 365 ? 51.061  13.792  68.611  1.00 63.51  ?  341  CYS B CA  1 
ATOM   6032 C C   . CYS B 1 365 ? 50.923  13.203  67.214  1.00 67.89  ?  341  CYS B C   1 
ATOM   6033 O O   . CYS B 1 365 ? 49.876  13.319  66.570  1.00 80.56  ?  341  CYS B O   1 
ATOM   6034 C CB  . CYS B 1 365 ? 50.860  12.695  69.661  1.00 53.82  ?  341  CYS B CB  1 
ATOM   6035 S SG  . CYS B 1 365 ? 51.130  13.219  71.362  1.00 93.62  ?  341  CYS B SG  1 
ATOM   6036 N N   . LYS B 1 366 ? 51.992  12.555  66.746  1.00 63.27  ?  342  LYS B N   1 
ATOM   6037 C CA  . LYS B 1 366 ? 51.946  11.906  65.440  1.00 58.87  ?  342  LYS B CA  1 
ATOM   6038 C C   . LYS B 1 366 ? 51.081  10.650  65.437  1.00 64.00  ?  342  LYS B C   1 
ATOM   6039 O O   . LYS B 1 366 ? 51.013  9.960   64.410  1.00 77.47  ?  342  LYS B O   1 
ATOM   6040 C CB  . LYS B 1 366 ? 53.361  11.563  64.967  1.00 55.48  ?  342  LYS B CB  1 
ATOM   6041 C CG  . LYS B 1 366 ? 54.233  12.769  64.682  1.00 52.00  ?  342  LYS B CG  1 
ATOM   6042 C CD  . LYS B 1 366 ? 55.457  12.379  63.874  1.00 47.22  ?  342  LYS B CD  1 
ATOM   6043 C CE  . LYS B 1 366 ? 56.208  13.615  63.427  1.00 49.88  ?  342  LYS B CE  1 
ATOM   6044 N NZ  . LYS B 1 366 ? 57.188  13.332  62.349  1.00 62.88  ?  342  LYS B NZ  1 
ATOM   6045 N N   . THR B 1 367 ? 50.425  10.345  66.556  1.00 69.28  ?  343  THR B N   1 
ATOM   6046 C CA  . THR B 1 367 ? 49.561  9.182   66.679  1.00 71.08  ?  343  THR B CA  1 
ATOM   6047 C C   . THR B 1 367 ? 48.087  9.508   66.467  1.00 71.05  ?  343  THR B C   1 
ATOM   6048 O O   . THR B 1 367 ? 47.268  8.587   66.427  1.00 75.26  ?  343  THR B O   1 
ATOM   6049 C CB  . THR B 1 367 ? 49.751  8.528   68.058  1.00 71.07  ?  343  THR B CB  1 
ATOM   6050 O OG1 . THR B 1 367 ? 49.057  7.276   68.103  1.00 87.11  ?  343  THR B OG1 1 
ATOM   6051 C CG2 . THR B 1 367 ? 49.209  9.422   69.151  1.00 54.97  ?  343  THR B CG2 1 
ATOM   6052 N N   . ASP B 1 368 ? 47.733  10.787  66.351  1.00 58.51  ?  344  ASP B N   1 
ATOM   6053 C CA  . ASP B 1 368 ? 46.357  11.238  66.192  1.00 56.17  ?  344  ASP B CA  1 
ATOM   6054 C C   . ASP B 1 368 ? 45.910  11.165  64.735  1.00 58.61  ?  344  ASP B C   1 
ATOM   6055 O O   . ASP B 1 368 ? 46.722  11.130  63.807  1.00 67.51  ?  344  ASP B O   1 
ATOM   6056 C CB  . ASP B 1 368 ? 46.198  12.670  66.708  1.00 68.73  ?  344  ASP B CB  1 
ATOM   6057 C CG  . ASP B 1 368 ? 46.418  12.777  68.204  1.00 73.70  ?  344  ASP B CG  1 
ATOM   6058 O OD1 . ASP B 1 368 ? 46.052  11.836  68.939  1.00 77.28  ?  344  ASP B OD1 1 
ATOM   6059 O OD2 . ASP B 1 368 ? 46.944  13.816  68.653  1.00 76.22  -1 344  ASP B OD2 1 
ATOM   6060 N N   . ILE B 1 369 ? 44.585  11.157  64.546  1.00 67.19  ?  345  ILE B N   1 
ATOM   6061 C CA  . ILE B 1 369 ? 44.027  11.056  63.198  1.00 64.36  ?  345  ILE B CA  1 
ATOM   6062 C C   . ILE B 1 369 ? 44.367  12.285  62.374  1.00 63.45  ?  345  ILE B C   1 
ATOM   6063 O O   . ILE B 1 369 ? 44.624  12.180  61.171  1.00 69.35  ?  345  ILE B O   1 
ATOM   6064 C CB  . ILE B 1 369 ? 42.502  10.833  63.226  1.00 62.78  ?  345  ILE B CB  1 
ATOM   6065 C CG1 . ILE B 1 369 ? 41.861  11.521  64.430  1.00 78.43  ?  345  ILE B CG1 1 
ATOM   6066 C CG2 . ILE B 1 369 ? 42.166  9.356   63.124  1.00 49.99  ?  345  ILE B CG2 1 
ATOM   6067 C CD1 . ILE B 1 369 ? 40.428  11.936  64.174  1.00 67.24  ?  345  ILE B CD1 1 
ATOM   6068 N N   . ALA B 1 370 ? 44.303  13.476  62.977  1.00 59.57  ?  346  ALA B N   1 
ATOM   6069 C CA  . ALA B 1 370 ? 44.608  14.670  62.197  1.00 59.31  ?  346  ALA B CA  1 
ATOM   6070 C C   . ALA B 1 370 ? 45.966  14.547  61.522  1.00 56.21  ?  346  ALA B C   1 
ATOM   6071 O O   . ALA B 1 370 ? 46.090  14.802  60.317  1.00 66.11  ?  346  ALA B O   1 
ATOM   6072 C CB  . ALA B 1 370 ? 44.566  15.916  63.079  1.00 51.84  ?  346  ALA B CB  1 
ATOM   6073 N N   . PHE B 1 371 ? 46.966  14.047  62.251  1.00 50.45  ?  347  PHE B N   1 
ATOM   6074 C CA  . PHE B 1 371 ? 48.309  13.946  61.694  1.00 47.20  ?  347  PHE B CA  1 
ATOM   6075 C C   . PHE B 1 371 ? 48.413  12.826  60.665  1.00 53.68  ?  347  PHE B C   1 
ATOM   6076 O O   . PHE B 1 371 ? 49.023  13.011  59.612  1.00 55.27  ?  347  PHE B O   1 
ATOM   6077 C CB  . PHE B 1 371 ? 49.353  13.734  62.794  1.00 51.41  ?  347  PHE B CB  1 
ATOM   6078 C CG  . PHE B 1 371 ? 50.750  13.584  62.258  1.00 54.04  ?  347  PHE B CG  1 
ATOM   6079 C CD1 . PHE B 1 371 ? 51.489  14.701  61.911  1.00 52.05  ?  347  PHE B CD1 1 
ATOM   6080 C CD2 . PHE B 1 371 ? 51.310  12.329  62.064  1.00 51.30  ?  347  PHE B CD2 1 
ATOM   6081 C CE1 . PHE B 1 371 ? 52.764  14.576  61.401  1.00 51.13  ?  347  PHE B CE1 1 
ATOM   6082 C CE2 . PHE B 1 371 ? 52.591  12.197  61.554  1.00 59.63  ?  347  PHE B CE2 1 
ATOM   6083 C CZ  . PHE B 1 371 ? 53.316  13.325  61.224  1.00 54.41  ?  347  PHE B CZ  1 
ATOM   6084 N N   . ARG B 1 372 ? 47.854  11.648  60.954  1.00 60.80  ?  348  ARG B N   1 
ATOM   6085 C CA  . ARG B 1 372 ? 47.955  10.543  60.000  1.00 61.28  ?  348  ARG B CA  1 
ATOM   6086 C C   . ARG B 1 372 ? 47.217  10.873  58.701  1.00 57.61  ?  348  ARG B C   1 
ATOM   6087 O O   . ARG B 1 372 ? 47.717  10.625  57.589  1.00 58.91  ?  348  ARG B O   1 
ATOM   6088 C CB  . ARG B 1 372 ? 47.404  9.267   60.644  1.00 71.25  ?  348  ARG B CB  1 
ATOM   6089 C CG  . ARG B 1 372 ? 48.284  8.678   61.761  1.00 74.68  ?  348  ARG B CG  1 
ATOM   6090 C CD  . ARG B 1 372 ? 47.618  7.490   62.472  1.00 60.40  ?  348  ARG B CD  1 
ATOM   6091 N NE  . ARG B 1 372 ? 46.347  7.850   63.099  1.00 62.25  ?  348  ARG B NE  1 
ATOM   6092 C CZ  . ARG B 1 372 ? 45.661  7.053   63.911  1.00 73.68  ?  348  ARG B CZ  1 
ATOM   6093 N NH1 . ARG B 1 372 ? 46.125  5.846   64.208  1.00 102.75 ?  348  ARG B NH1 1 
ATOM   6094 N NH2 . ARG B 1 372 ? 44.514  7.464   64.431  1.00 77.64  ?  348  ARG B NH2 1 
ATOM   6095 N N   . LEU B 1 373 ? 46.038  11.474  58.831  1.00 61.50  ?  349  LEU B N   1 
ATOM   6096 C CA  . LEU B 1 373 ? 45.260  11.884  57.672  1.00 54.91  ?  349  LEU B CA  1 
ATOM   6097 C C   . LEU B 1 373 ? 45.981  12.963  56.879  1.00 53.71  ?  349  LEU B C   1 
ATOM   6098 O O   . LEU B 1 373 ? 45.953  12.951  55.641  1.00 62.42  ?  349  LEU B O   1 
ATOM   6099 C CB  . LEU B 1 373 ? 43.886  12.372  58.127  1.00 48.24  ?  349  LEU B CB  1 
ATOM   6100 C CG  . LEU B 1 373 ? 42.846  12.703  57.061  1.00 46.65  ?  349  LEU B CG  1 
ATOM   6101 C CD1 . LEU B 1 373 ? 42.619  11.499  56.168  1.00 47.19  ?  349  LEU B CD1 1 
ATOM   6102 C CD2 . LEU B 1 373 ? 41.544  13.142  57.721  1.00 42.75  ?  349  LEU B CD2 1 
ATOM   6103 N N   . ALA B 1 374 ? 46.625  13.912  57.565  1.00 44.68  ?  350  ALA B N   1 
ATOM   6104 C CA  . ALA B 1 374 ? 47.465  14.858  56.844  1.00 44.70  ?  350  ALA B CA  1 
ATOM   6105 C C   . ALA B 1 374 ? 48.624  14.144  56.166  1.00 44.03  ?  350  ALA B C   1 
ATOM   6106 O O   . ALA B 1 374 ? 48.990  14.486  55.038  1.00 40.37  ?  350  ALA B O   1 
ATOM   6107 C CB  . ALA B 1 374 ? 47.979  15.940  57.797  1.00 37.86  ?  350  ALA B CB  1 
ATOM   6108 N N   . LYS B 1 375 ? 49.159  13.109  56.811  1.00 49.23  ?  351  LYS B N   1 
ATOM   6109 C CA  . LYS B 1 375 ? 50.276  12.356  56.260  1.00 50.43  ?  351  LYS B CA  1 
ATOM   6110 C C   . LYS B 1 375 ? 49.901  11.678  54.951  1.00 57.06  ?  351  LYS B C   1 
ATOM   6111 O O   . LYS B 1 375 ? 50.769  11.444  54.104  1.00 57.50  ?  351  LYS B O   1 
ATOM   6112 C CB  . LYS B 1 375 ? 50.744  11.328  57.295  1.00 61.77  ?  351  LYS B CB  1 
ATOM   6113 C CG  . LYS B 1 375 ? 52.066  10.642  57.000  1.00 57.63  ?  351  LYS B CG  1 
ATOM   6114 C CD  . LYS B 1 375 ? 52.858  10.387  58.289  1.00 53.39  ?  351  LYS B CD  1 
ATOM   6115 C CE  . LYS B 1 375 ? 52.127  9.460   59.252  1.00 59.26  ?  351  LYS B CE  1 
ATOM   6116 N NZ  . LYS B 1 375 ? 52.074  8.051   58.770  1.00 59.84  ?  351  LYS B NZ  1 
ATOM   6117 N N   . SER B 1 376 ? 48.626  11.350  54.771  1.00 57.42  ?  352  SER B N   1 
ATOM   6118 C CA  . SER B 1 376 ? 48.204  10.791  53.486  1.00 57.09  ?  352  SER B CA  1 
ATOM   6119 C C   . SER B 1 376 ? 47.810  11.874  52.475  1.00 54.68  ?  352  SER B C   1 
ATOM   6120 O O   . SER B 1 376 ? 48.216  11.826  51.303  1.00 45.05  ?  352  SER B O   1 
ATOM   6121 C CB  . SER B 1 376 ? 47.049  9.803   53.699  1.00 46.54  ?  352  SER B CB  1 
ATOM   6122 O OG  . SER B 1 376 ? 47.477  8.657   54.423  1.00 52.04  ?  352  SER B OG  1 
ATOM   6123 N N   . THR B 1 377 ? 47.021  12.859  52.909  1.00 51.56  ?  353  THR B N   1 
ATOM   6124 C CA  . THR B 1 377 ? 46.481  13.840  51.969  1.00 61.29  ?  353  THR B CA  1 
ATOM   6125 C C   . THR B 1 377 ? 47.567  14.773  51.430  1.00 69.85  ?  353  THR B C   1 
ATOM   6126 O O   . THR B 1 377 ? 47.551  15.132  50.241  1.00 59.27  ?  353  THR B O   1 
ATOM   6127 C CB  . THR B 1 377 ? 45.362  14.638  52.637  1.00 57.70  ?  353  THR B CB  1 
ATOM   6128 O OG1 . THR B 1 377 ? 44.348  13.733  53.088  1.00 39.87  ?  353  THR B OG1 1 
ATOM   6129 C CG2 . THR B 1 377 ? 44.755  15.629  51.657  1.00 46.64  ?  353  THR B CG2 1 
ATOM   6130 N N   . LEU B 1 378 ? 48.502  15.198  52.291  1.00 59.70  ?  354  LEU B N   1 
ATOM   6131 C CA  . LEU B 1 378 ? 49.637  16.000  51.852  1.00 61.83  ?  354  LEU B CA  1 
ATOM   6132 C C   . LEU B 1 378 ? 50.551  15.232  50.914  1.00 61.18  ?  354  LEU B C   1 
ATOM   6133 O O   . LEU B 1 378 ? 51.368  15.849  50.224  1.00 62.96  ?  354  LEU B O   1 
ATOM   6134 C CB  . LEU B 1 378 ? 50.444  16.484  53.058  1.00 60.27  ?  354  LEU B CB  1 
ATOM   6135 C CG  . LEU B 1 378 ? 49.763  17.500  53.975  1.00 47.87  ?  354  LEU B CG  1 
ATOM   6136 C CD1 . LEU B 1 378 ? 50.610  17.772  55.202  1.00 59.26  ?  354  LEU B CD1 1 
ATOM   6137 C CD2 . LEU B 1 378 ? 49.490  18.789  53.226  1.00 59.38  ?  354  LEU B CD2 1 
ATOM   6138 N N   . THR B 1 379 ? 50.461  13.903  50.904  1.00 53.12  ?  355  THR B N   1 
ATOM   6139 C CA  . THR B 1 379 ? 51.158  13.127  49.888  1.00 49.31  ?  355  THR B CA  1 
ATOM   6140 C C   . THR B 1 379 ? 50.402  13.172  48.568  1.00 61.53  ?  355  THR B C   1 
ATOM   6141 O O   . THR B 1 379 ? 50.992  13.408  47.508  1.00 51.54  ?  355  THR B O   1 
ATOM   6142 C CB  . THR B 1 379 ? 51.330  11.678  50.348  1.00 58.52  ?  355  THR B CB  1 
ATOM   6143 O OG1 . THR B 1 379 ? 52.111  11.636  51.549  1.00 50.49  ?  355  THR B OG1 1 
ATOM   6144 C CG2 . THR B 1 379 ? 52.006  10.862  49.264  1.00 56.40  ?  355  THR B CG2 1 
ATOM   6145 N N   . LEU B 1 380 ? 49.087  12.958  48.623  1.00 69.05  ?  356  LEU B N   1 
ATOM   6146 C CA  . LEU B 1 380 ? 48.326  12.849  47.381  1.00 62.67  ?  356  LEU B CA  1 
ATOM   6147 C C   . LEU B 1 380 ? 48.255  14.170  46.622  1.00 66.28  ?  356  LEU B C   1 
ATOM   6148 O O   . LEU B 1 380 ? 48.200  14.161  45.386  1.00 61.41  ?  356  LEU B O   1 
ATOM   6149 C CB  . LEU B 1 380 ? 46.922  12.327  47.665  1.00 54.57  ?  356  LEU B CB  1 
ATOM   6150 C CG  . LEU B 1 380 ? 46.860  10.861  48.085  1.00 60.37  ?  356  LEU B CG  1 
ATOM   6151 C CD1 . LEU B 1 380 ? 45.511  10.600  48.681  1.00 57.81  ?  356  LEU B CD1 1 
ATOM   6152 C CD2 . LEU B 1 380 ? 47.107  9.934   46.903  1.00 63.83  ?  356  LEU B CD2 1 
ATOM   6153 N N   . ILE B 1 381 ? 48.260  15.304  47.321  1.00 55.57  ?  357  ILE B N   1 
ATOM   6154 C CA  . ILE B 1 381 ? 48.048  16.583  46.631  1.00 45.72  ?  357  ILE B CA  1 
ATOM   6155 C C   . ILE B 1 381 ? 49.163  16.879  45.624  1.00 60.00  ?  357  ILE B C   1 
ATOM   6156 O O   . ILE B 1 381 ? 48.857  17.100  44.439  1.00 74.41  ?  357  ILE B O   1 
ATOM   6157 C CB  . ILE B 1 381 ? 47.865  17.739  47.628  1.00 34.41  ?  357  ILE B CB  1 
ATOM   6158 C CG1 . ILE B 1 381 ? 46.501  17.627  48.306  1.00 27.73  ?  357  ILE B CG1 1 
ATOM   6159 C CG2 . ILE B 1 381 ? 47.999  19.081  46.919  1.00 34.02  ?  357  ILE B CG2 1 
ATOM   6160 C CD1 . ILE B 1 381 ? 46.284  18.629  49.413  1.00 25.14  ?  357  ILE B CD1 1 
ATOM   6161 N N   . PRO B 1 382 ? 50.448  16.897  46.008  1.00 64.78  ?  358  PRO B N   1 
ATOM   6162 C CA  . PRO B 1 382 ? 51.497  17.103  44.997  1.00 69.02  ?  358  PRO B CA  1 
ATOM   6163 C C   . PRO B 1 382 ? 51.694  15.901  44.092  1.00 73.65  ?  358  PRO B C   1 
ATOM   6164 O O   . PRO B 1 382 ? 52.390  16.014  43.074  1.00 88.06  ?  358  PRO B O   1 
ATOM   6165 C CB  . PRO B 1 382 ? 52.746  17.371  45.842  1.00 52.59  ?  358  PRO B CB  1 
ATOM   6166 C CG  . PRO B 1 382 ? 52.522  16.560  47.055  1.00 47.91  ?  358  PRO B CG  1 
ATOM   6167 C CD  . PRO B 1 382 ? 51.043  16.692  47.342  1.00 59.10  ?  358  PRO B CD  1 
ATOM   6168 N N   . LEU B 1 383 ? 51.103  14.758  44.438  1.00 69.18  ?  359  LEU B N   1 
ATOM   6169 C CA  . LEU B 1 383 ? 51.194  13.563  43.614  1.00 66.58  ?  359  LEU B CA  1 
ATOM   6170 C C   . LEU B 1 383 ? 50.223  13.619  42.444  1.00 64.61  ?  359  LEU B C   1 
ATOM   6171 O O   . LEU B 1 383 ? 50.537  13.120  41.358  1.00 66.62  ?  359  LEU B O   1 
ATOM   6172 C CB  . LEU B 1 383 ? 50.915  12.337  44.482  1.00 67.56  ?  359  LEU B CB  1 
ATOM   6173 C CG  . LEU B 1 383 ? 51.279  10.934  43.999  1.00 60.85  ?  359  LEU B CG  1 
ATOM   6174 C CD1 . LEU B 1 383 ? 52.782  10.736  43.987  1.00 70.14  ?  359  LEU B CD1 1 
ATOM   6175 C CD2 . LEU B 1 383 ? 50.611  9.893   44.883  1.00 61.39  ?  359  LEU B CD2 1 
ATOM   6176 N N   . LEU B 1 384 ? 49.049  14.229  42.644  1.00 62.66  ?  360  LEU B N   1 
ATOM   6177 C CA  . LEU B 1 384 ? 48.010  14.281  41.627  1.00 55.47  ?  360  LEU B CA  1 
ATOM   6178 C C   . LEU B 1 384 ? 47.869  15.638  40.949  1.00 63.16  ?  360  LEU B C   1 
ATOM   6179 O O   . LEU B 1 384 ? 47.278  15.700  39.866  1.00 77.26  ?  360  LEU B O   1 
ATOM   6180 C CB  . LEU B 1 384 ? 46.648  13.890  42.231  1.00 50.54  ?  360  LEU B CB  1 
ATOM   6181 C CG  . LEU B 1 384 ? 46.255  12.409  42.332  1.00 53.27  ?  360  LEU B CG  1 
ATOM   6182 C CD1 . LEU B 1 384 ? 47.186  11.646  43.255  1.00 72.09  ?  360  LEU B CD1 1 
ATOM   6183 C CD2 . LEU B 1 384 ? 44.815  12.283  42.807  1.00 60.50  ?  360  LEU B CD2 1 
ATOM   6184 N N   . CYS B 1 385 ? 48.395  16.718  41.541  1.00 60.91  ?  361  CYS B N   1 
ATOM   6185 C CA  . CYS B 1 385 ? 48.139  18.071  41.051  1.00 57.15  ?  361  CYS B CA  1 
ATOM   6186 C C   . CYS B 1 385 ? 49.378  18.809  40.565  1.00 62.68  ?  361  CYS B C   1 
ATOM   6187 O O   . CYS B 1 385 ? 49.254  19.937  40.068  1.00 58.77  ?  361  CYS B O   1 
ATOM   6188 C CB  . CYS B 1 385 ? 47.461  18.907  42.140  1.00 60.14  ?  361  CYS B CB  1 
ATOM   6189 S SG  . CYS B 1 385 ? 45.675  19.085  41.913  1.00 104.30 ?  361  CYS B SG  1 
ATOM   6190 N N   . THR B 1 386 ? 50.568  18.225  40.699  1.00 68.59  ?  362  THR B N   1 
ATOM   6191 C CA  . THR B 1 386 ? 51.761  18.955  40.287  1.00 61.28  ?  362  THR B CA  1 
ATOM   6192 C C   . THR B 1 386 ? 51.893  19.009  38.766  1.00 52.52  ?  362  THR B C   1 
ATOM   6193 O O   . THR B 1 386 ? 52.368  20.013  38.218  1.00 53.22  ?  362  THR B O   1 
ATOM   6194 C CB  . THR B 1 386 ? 53.010  18.347  40.938  1.00 65.42  ?  362  THR B CB  1 
ATOM   6195 O OG1 . THR B 1 386 ? 54.029  19.347  41.015  1.00 57.51  ?  362  THR B OG1 1 
ATOM   6196 C CG2 . THR B 1 386 ? 53.550  17.142  40.157  1.00 63.06  ?  362  THR B CG2 1 
ATOM   6197 N N   . HIS B 1 387 ? 51.481  17.943  38.073  1.00 58.98  ?  363  HIS B N   1 
ATOM   6198 C CA  . HIS B 1 387 ? 51.539  17.906  36.614  1.00 56.66  ?  363  HIS B CA  1 
ATOM   6199 C C   . HIS B 1 387 ? 50.714  19.032  36.003  1.00 57.61  ?  363  HIS B C   1 
ATOM   6200 O O   . HIS B 1 387 ? 51.171  19.734  35.094  1.00 48.32  ?  363  HIS B O   1 
ATOM   6201 C CB  . HIS B 1 387 ? 51.057  16.538  36.111  1.00 52.76  ?  363  HIS B CB  1 
ATOM   6202 C CG  . HIS B 1 387 ? 50.994  16.427  34.618  1.00 59.72  ?  363  HIS B CG  1 
ATOM   6203 N ND1 . HIS B 1 387 ? 52.081  16.066  33.850  1.00 61.70  ?  363  HIS B ND1 1 
ATOM   6204 C CD2 . HIS B 1 387 ? 49.972  16.620  33.751  1.00 61.50  ?  363  HIS B CD2 1 
ATOM   6205 C CE1 . HIS B 1 387 ? 51.733  16.045  32.576  1.00 50.27  ?  363  HIS B CE1 1 
ATOM   6206 N NE2 . HIS B 1 387 ? 50.458  16.378  32.489  1.00 66.56  ?  363  HIS B NE2 1 
ATOM   6207 N N   . GLU B 1 388 ? 49.488  19.218  36.496  1.00 63.16  ?  364  GLU B N   1 
ATOM   6208 C CA  . GLU B 1 388 ? 48.594  20.219  35.926  1.00 60.44  ?  364  GLU B CA  1 
ATOM   6209 C C   . GLU B 1 388 ? 49.140  21.631  36.094  1.00 71.50  ?  364  GLU B C   1 
ATOM   6210 O O   . GLU B 1 388 ? 48.940  22.482  35.219  1.00 64.51  ?  364  GLU B O   1 
ATOM   6211 C CB  . GLU B 1 388 ? 47.214  20.109  36.572  1.00 71.40  ?  364  GLU B CB  1 
ATOM   6212 C CG  . GLU B 1 388 ? 46.178  21.026  35.972  1.00 115.16 ?  364  GLU B CG  1 
ATOM   6213 C CD  . GLU B 1 388 ? 45.840  20.654  34.547  1.00 126.91 ?  364  GLU B CD  1 
ATOM   6214 O OE1 . GLU B 1 388 ? 45.819  19.449  34.227  1.00 116.03 ?  364  GLU B OE1 1 
ATOM   6215 O OE2 . GLU B 1 388 ? 45.608  21.570  33.736  1.00 122.67 -1 364  GLU B OE2 1 
ATOM   6216 N N   . VAL B 1 389 ? 49.835  21.900  37.200  1.00 67.65  ?  365  VAL B N   1 
ATOM   6217 C CA  . VAL B 1 389 ? 50.376  23.237  37.422  1.00 66.46  ?  365  VAL B CA  1 
ATOM   6218 C C   . VAL B 1 389 ? 51.641  23.447  36.604  1.00 65.33  ?  365  VAL B C   1 
ATOM   6219 O O   . VAL B 1 389 ? 51.854  24.526  36.041  1.00 74.03  ?  365  VAL B O   1 
ATOM   6220 C CB  . VAL B 1 389 ? 50.626  23.476  38.922  1.00 68.66  ?  365  VAL B CB  1 
ATOM   6221 C CG1 . VAL B 1 389 ? 51.393  24.777  39.138  1.00 62.35  ?  365  VAL B CG1 1 
ATOM   6222 C CG2 . VAL B 1 389 ? 49.308  23.499  39.677  1.00 61.30  ?  365  VAL B CG2 1 
ATOM   6223 N N   . ILE B 1 390 ? 52.493  22.422  36.512  1.00 55.35  ?  366  ILE B N   1 
ATOM   6224 C CA  . ILE B 1 390 ? 53.764  22.577  35.804  1.00 53.90  ?  366  ILE B CA  1 
ATOM   6225 C C   . ILE B 1 390 ? 53.526  22.946  34.341  1.00 54.89  ?  366  ILE B C   1 
ATOM   6226 O O   . ILE B 1 390 ? 54.093  23.921  33.832  1.00 67.85  ?  366  ILE B O   1 
ATOM   6227 C CB  . ILE B 1 390 ? 54.620  21.304  35.949  1.00 62.60  ?  366  ILE B CB  1 
ATOM   6228 C CG1 . ILE B 1 390 ? 55.213  21.232  37.356  1.00 64.45  ?  366  ILE B CG1 1 
ATOM   6229 C CG2 . ILE B 1 390 ? 55.725  21.267  34.900  1.00 61.22  ?  366  ILE B CG2 1 
ATOM   6230 C CD1 . ILE B 1 390 ? 55.919  19.931  37.678  1.00 72.48  ?  366  ILE B CD1 1 
ATOM   6231 N N   . PHE B 1 391 ? 52.711  22.164  33.641  1.00 44.17  ?  367  PHE B N   1 
ATOM   6232 C CA  . PHE B 1 391 ? 52.365  22.416  32.238  1.00 50.54  ?  367  PHE B CA  1 
ATOM   6233 C C   . PHE B 1 391 ? 51.049  23.179  32.097  1.00 62.82  ?  367  PHE B C   1 
ATOM   6234 O O   . PHE B 1 391 ? 50.153  22.745  31.378  1.00 67.62  ?  367  PHE B O   1 
ATOM   6235 C CB  . PHE B 1 391 ? 52.299  21.098  31.481  1.00 45.55  ?  367  PHE B CB  1 
ATOM   6236 C CG  . PHE B 1 391 ? 53.543  20.269  31.589  1.00 49.62  ?  367  PHE B CG  1 
ATOM   6237 C CD1 . PHE B 1 391 ? 54.635  20.521  30.777  1.00 44.48  ?  367  PHE B CD1 1 
ATOM   6238 C CD2 . PHE B 1 391 ? 53.612  19.225  32.495  1.00 54.20  ?  367  PHE B CD2 1 
ATOM   6239 C CE1 . PHE B 1 391 ? 55.778  19.748  30.872  1.00 46.15  ?  367  PHE B CE1 1 
ATOM   6240 C CE2 . PHE B 1 391 ? 54.750  18.452  32.595  1.00 45.37  ?  367  PHE B CE2 1 
ATOM   6241 C CZ  . PHE B 1 391 ? 55.833  18.712  31.784  1.00 51.15  ?  367  PHE B CZ  1 
ATOM   6242 N N   . ALA B 1 392 ? 50.924  24.339  32.747  1.00 68.49  ?  368  ALA B N   1 
ATOM   6243 C CA  . ALA B 1 392 ? 49.606  24.931  32.990  1.00 59.47  ?  368  ALA B CA  1 
ATOM   6244 C C   . ALA B 1 392 ? 48.870  25.282  31.698  1.00 73.22  ?  368  ALA B C   1 
ATOM   6245 O O   . ALA B 1 392 ? 47.687  24.953  31.541  1.00 97.69  ?  368  ALA B O   1 
ATOM   6246 C CB  . ALA B 1 392 ? 49.749  26.166  33.876  1.00 48.62  ?  368  ALA B CB  1 
ATOM   6247 N N   . PHE B 1 393 ? 49.542  25.965  30.773  1.00 63.58  ?  369  PHE B N   1 
ATOM   6248 C CA  . PHE B 1 393 ? 48.915  26.485  29.561  1.00 63.82  ?  369  PHE B CA  1 
ATOM   6249 C C   . PHE B 1 393 ? 49.580  25.938  28.303  1.00 69.79  ?  369  PHE B C   1 
ATOM   6250 O O   . PHE B 1 393 ? 49.737  26.645  27.305  1.00 67.91  ?  369  PHE B O   1 
ATOM   6251 C CB  . PHE B 1 393 ? 48.943  28.012  29.547  1.00 51.37  ?  369  PHE B CB  1 
ATOM   6252 C CG  . PHE B 1 393 ? 48.077  28.642  30.597  1.00 49.80  ?  369  PHE B CG  1 
ATOM   6253 C CD1 . PHE B 1 393 ? 48.586  28.942  31.851  1.00 58.46  ?  369  PHE B CD1 1 
ATOM   6254 C CD2 . PHE B 1 393 ? 46.751  28.931  30.330  1.00 59.01  ?  369  PHE B CD2 1 
ATOM   6255 C CE1 . PHE B 1 393 ? 47.784  29.523  32.819  1.00 63.91  ?  369  PHE B CE1 1 
ATOM   6256 C CE2 . PHE B 1 393 ? 45.943  29.511  31.295  1.00 63.22  ?  369  PHE B CE2 1 
ATOM   6257 C CZ  . PHE B 1 393 ? 46.460  29.807  32.541  1.00 68.39  ?  369  PHE B CZ  1 
ATOM   6258 N N   . VAL B 1 394 ? 49.975  24.670  28.334  1.00 65.23  ?  370  VAL B N   1 
ATOM   6259 C CA  . VAL B 1 394 ? 50.675  24.031  27.224  1.00 61.49  ?  370  VAL B CA  1 
ATOM   6260 C C   . VAL B 1 394 ? 49.754  22.971  26.640  1.00 68.65  ?  370  VAL B C   1 
ATOM   6261 O O   . VAL B 1 394 ? 49.356  22.029  27.337  1.00 78.30  ?  370  VAL B O   1 
ATOM   6262 C CB  . VAL B 1 394 ? 52.012  23.419  27.667  1.00 63.83  ?  370  VAL B CB  1 
ATOM   6263 C CG1 . VAL B 1 394 ? 52.708  22.771  26.480  1.00 73.84  ?  370  VAL B CG1 1 
ATOM   6264 C CG2 . VAL B 1 394 ? 52.901  24.483  28.297  1.00 54.02  ?  370  VAL B CG2 1 
ATOM   6265 N N   . MET B 1 395 ? 49.418  23.126  25.363  1.00 89.95  ?  371  MET B N   1 
ATOM   6266 C CA  . MET B 1 395 ? 48.448  22.262  24.701  1.00 83.45  ?  371  MET B CA  1 
ATOM   6267 C C   . MET B 1 395 ? 49.043  20.905  24.350  1.00 91.83  ?  371  MET B C   1 
ATOM   6268 O O   . MET B 1 395 ? 48.471  19.867  24.662  1.00 94.18  ?  371  MET B O   1 
ATOM   6269 C CB  . MET B 1 395 ? 47.914  22.932  23.433  1.00 71.04  ?  371  MET B CB  1 
ATOM   6270 N N   . ARG B 1 404 ? 62.093  11.849  23.101  1.00 141.61 ?  380  ARG B N   1 
ATOM   6271 C CA  . ARG B 1 404 ? 61.478  11.983  24.417  1.00 140.66 ?  380  ARG B CA  1 
ATOM   6272 C C   . ARG B 1 404 ? 60.079  11.388  24.442  1.00 152.74 ?  380  ARG B C   1 
ATOM   6273 O O   . ARG B 1 404 ? 59.377  11.500  25.443  1.00 156.83 ?  380  ARG B O   1 
ATOM   6274 C CB  . ARG B 1 404 ? 61.419  13.456  24.832  1.00 121.37 ?  380  ARG B CB  1 
ATOM   6275 N N   . PHE B 1 405 ? 59.671  10.761  23.335  1.00 164.16 ?  381  PHE B N   1 
ATOM   6276 C CA  . PHE B 1 405 ? 58.316  10.220  23.262  1.00 150.30 ?  381  PHE B CA  1 
ATOM   6277 C C   . PHE B 1 405 ? 58.109  9.105   24.279  1.00 147.82 ?  381  PHE B C   1 
ATOM   6278 O O   . PHE B 1 405 ? 57.115  9.105   25.022  1.00 132.30 ?  381  PHE B O   1 
ATOM   6279 C CB  . PHE B 1 405 ? 58.028  9.715   21.849  1.00 154.80 ?  381  PHE B CB  1 
ATOM   6280 N N   . ILE B 1 406 ? 59.069  8.182   24.375  1.00 172.29 ?  382  ILE B N   1 
ATOM   6281 C CA  . ILE B 1 406 ? 58.938  7.071   25.311  1.00 180.42 ?  382  ILE B CA  1 
ATOM   6282 C C   . ILE B 1 406 ? 58.907  7.587   26.740  1.00 168.84 ?  382  ILE B C   1 
ATOM   6283 O O   . ILE B 1 406 ? 58.133  7.100   27.571  1.00 184.70 ?  382  ILE B O   1 
ATOM   6284 C CB  . ILE B 1 406 ? 60.079  6.053   25.114  1.00 187.49 ?  382  ILE B CB  1 
ATOM   6285 C CG1 . ILE B 1 406 ? 60.310  5.758   23.634  1.00 177.40 ?  382  ILE B CG1 1 
ATOM   6286 C CG2 . ILE B 1 406 ? 59.780  4.755   25.870  1.00 189.35 ?  382  ILE B CG2 1 
ATOM   6287 C CD1 . ILE B 1 406 ? 61.452  4.787   23.394  1.00 129.98 ?  382  ILE B CD1 1 
ATOM   6288 N N   . LYS B 1 407 ? 59.730  8.594   27.040  1.00 136.92 ?  383  LYS B N   1 
ATOM   6289 C CA  . LYS B 1 407 ? 59.875  9.059   28.415  1.00 138.78 ?  383  LYS B CA  1 
ATOM   6290 C C   . LYS B 1 407 ? 58.611  9.745   28.918  1.00 121.59 ?  383  LYS B C   1 
ATOM   6291 O O   . LYS B 1 407 ? 58.226  9.572   30.080  1.00 129.34 ?  383  LYS B O   1 
ATOM   6292 C CB  . LYS B 1 407 ? 61.082  9.990   28.522  1.00 133.02 ?  383  LYS B CB  1 
ATOM   6293 N N   . LEU B 1 408 ? 57.957  10.536  28.071  1.00 93.10  ?  384  LEU B N   1 
ATOM   6294 C CA  . LEU B 1 408 ? 56.692  11.128  28.480  1.00 90.57  ?  384  LEU B CA  1 
ATOM   6295 C C   . LEU B 1 408 ? 55.542  10.136  28.400  1.00 86.41  ?  384  LEU B C   1 
ATOM   6296 O O   . LEU B 1 408 ? 54.501  10.362  29.031  1.00 70.60  ?  384  LEU B O   1 
ATOM   6297 C CB  . LEU B 1 408 ? 56.385  12.377  27.647  1.00 81.83  ?  384  LEU B CB  1 
ATOM   6298 C CG  . LEU B 1 408 ? 55.875  13.553  28.487  1.00 83.25  ?  384  LEU B CG  1 
ATOM   6299 C CD1 . LEU B 1 408 ? 56.268  14.875  27.860  1.00 80.45  ?  384  LEU B CD1 1 
ATOM   6300 C CD2 . LEU B 1 408 ? 54.367  13.488  28.682  1.00 90.24  ?  384  LEU B CD2 1 
ATOM   6301 N N   . PHE B 1 409 ? 55.707  9.035   27.666  1.00 94.43  ?  385  PHE B N   1 
ATOM   6302 C CA  . PHE B 1 409 ? 54.677  8.005   27.702  1.00 91.08  ?  385  PHE B CA  1 
ATOM   6303 C C   . PHE B 1 409 ? 54.590  7.328   29.071  1.00 93.81  ?  385  PHE B C   1 
ATOM   6304 O O   . PHE B 1 409 ? 53.752  6.443   29.268  1.00 88.98  ?  385  PHE B O   1 
ATOM   6305 C CB  . PHE B 1 409 ? 54.920  6.965   26.608  1.00 90.67  ?  385  PHE B CB  1 
ATOM   6306 N N   . THR B 1 410 ? 55.429  7.730   30.027  1.00 102.30 ?  386  THR B N   1 
ATOM   6307 C CA  . THR B 1 410 ? 55.388  7.153   31.366  1.00 89.69  ?  386  THR B CA  1 
ATOM   6308 C C   . THR B 1 410 ? 54.383  7.845   32.282  1.00 82.17  ?  386  THR B C   1 
ATOM   6309 O O   . THR B 1 410 ? 54.250  7.450   33.446  1.00 80.48  ?  386  THR B O   1 
ATOM   6310 C CB  . THR B 1 410 ? 56.777  7.187   32.017  1.00 109.14 ?  386  THR B CB  1 
ATOM   6311 O OG1 . THR B 1 410 ? 57.196  8.545   32.211  1.00 116.89 ?  386  THR B OG1 1 
ATOM   6312 C CG2 . THR B 1 410 ? 57.797  6.455   31.149  1.00 120.51 ?  386  THR B CG2 1 
ATOM   6313 N N   . GLU B 1 411 ? 53.693  8.879   31.791  1.00 92.67  ?  387  GLU B N   1 
ATOM   6314 C CA  . GLU B 1 411 ? 52.576  9.459   32.531  1.00 86.74  ?  387  GLU B CA  1 
ATOM   6315 C C   . GLU B 1 411 ? 51.439  8.457   32.668  1.00 80.20  ?  387  GLU B C   1 
ATOM   6316 O O   . GLU B 1 411 ? 50.696  8.476   33.663  1.00 99.66  ?  387  GLU B O   1 
ATOM   6317 C CB  . GLU B 1 411 ? 52.106  10.727  31.815  1.00 82.67  ?  387  GLU B CB  1 
ATOM   6318 C CG  . GLU B 1 411 ? 50.857  11.391  32.356  1.00 124.94 ?  387  GLU B CG  1 
ATOM   6319 C CD  . GLU B 1 411 ? 50.496  12.625  31.548  1.00 150.63 ?  387  GLU B CD  1 
ATOM   6320 O OE1 . GLU B 1 411 ? 51.061  12.781  30.446  1.00 146.34 ?  387  GLU B OE1 1 
ATOM   6321 O OE2 . GLU B 1 411 ? 49.667  13.440  32.005  1.00 165.55 -1 387  GLU B OE2 1 
ATOM   6322 N N   . LEU B 1 412 ? 51.314  7.562   31.686  1.00 71.77  ?  388  LEU B N   1 
ATOM   6323 C CA  . LEU B 1 412 ? 50.249  6.571   31.696  1.00 76.74  ?  388  LEU B CA  1 
ATOM   6324 C C   . LEU B 1 412 ? 50.418  5.581   32.842  1.00 76.10  ?  388  LEU B C   1 
ATOM   6325 O O   . LEU B 1 412 ? 49.427  5.194   33.473  1.00 80.07  ?  388  LEU B O   1 
ATOM   6326 C CB  . LEU B 1 412 ? 50.209  5.866   30.336  1.00 81.54  ?  388  LEU B CB  1 
ATOM   6327 C CG  . LEU B 1 412 ? 50.078  6.861   29.171  1.00 89.27  ?  388  LEU B CG  1 
ATOM   6328 C CD1 . LEU B 1 412 ? 50.378  6.241   27.803  1.00 91.09  ?  388  LEU B CD1 1 
ATOM   6329 C CD2 . LEU B 1 412 ? 48.693  7.498   29.182  1.00 77.62  ?  388  LEU B CD2 1 
ATOM   6330 N N   . SER B 1 413 ? 51.660  5.225   33.183  1.00 68.49  ?  389  SER B N   1 
ATOM   6331 C CA  . SER B 1 413 ? 51.879  4.292   34.285  1.00 79.69  ?  389  SER B CA  1 
ATOM   6332 C C   . SER B 1 413 ? 51.410  4.880   35.610  1.00 90.24  ?  389  SER B C   1 
ATOM   6333 O O   . SER B 1 413 ? 50.700  4.218   36.382  1.00 104.65 ?  389  SER B O   1 
ATOM   6334 C CB  . SER B 1 413 ? 53.360  3.920   34.367  1.00 80.42  ?  389  SER B CB  1 
ATOM   6335 O OG  . SER B 1 413 ? 54.158  5.062   34.632  1.00 105.22 ?  389  SER B OG  1 
ATOM   6336 N N   . PHE B 1 414 ? 51.776  6.132   35.879  1.00 89.38  ?  390  PHE B N   1 
ATOM   6337 C CA  . PHE B 1 414 ? 51.376  6.754   37.134  1.00 77.48  ?  390  PHE B CA  1 
ATOM   6338 C C   . PHE B 1 414 ? 49.870  6.970   37.183  1.00 76.12  ?  390  PHE B C   1 
ATOM   6339 O O   . PHE B 1 414 ? 49.234  6.708   38.214  1.00 91.40  ?  390  PHE B O   1 
ATOM   6340 C CB  . PHE B 1 414 ? 52.122  8.075   37.329  1.00 83.27  ?  390  PHE B CB  1 
ATOM   6341 C CG  . PHE B 1 414 ? 53.379  7.941   38.142  1.00 96.26  ?  390  PHE B CG  1 
ATOM   6342 C CD1 . PHE B 1 414 ? 54.496  7.306   37.623  1.00 101.43 ?  390  PHE B CD1 1 
ATOM   6343 C CD2 . PHE B 1 414 ? 53.440  8.442   39.432  1.00 101.36 ?  390  PHE B CD2 1 
ATOM   6344 C CE1 . PHE B 1 414 ? 55.652  7.176   38.376  1.00 104.06 ?  390  PHE B CE1 1 
ATOM   6345 C CE2 . PHE B 1 414 ? 54.592  8.316   40.189  1.00 106.77 ?  390  PHE B CE2 1 
ATOM   6346 C CZ  . PHE B 1 414 ? 55.698  7.682   39.660  1.00 107.32 ?  390  PHE B CZ  1 
ATOM   6347 N N   . THR B 1 415 ? 49.274  7.438   36.083  1.00 70.04  ?  391  THR B N   1 
ATOM   6348 C CA  . THR B 1 415 ? 47.830  7.633   36.109  1.00 73.72  ?  391  THR B CA  1 
ATOM   6349 C C   . THR B 1 415 ? 47.088  6.309   36.215  1.00 78.28  ?  391  THR B C   1 
ATOM   6350 O O   . THR B 1 415 ? 45.940  6.285   36.671  1.00 81.02  ?  391  THR B O   1 
ATOM   6351 C CB  . THR B 1 415 ? 47.357  8.416   34.876  1.00 60.95  ?  391  THR B CB  1 
ATOM   6352 O OG1 . THR B 1 415 ? 47.790  7.764   33.680  1.00 89.59  ?  391  THR B OG1 1 
ATOM   6353 C CG2 . THR B 1 415 ? 47.899  9.840   34.895  1.00 51.68  ?  391  THR B CG2 1 
ATOM   6354 N N   . SER B 1 416 ? 47.722  5.204   35.831  1.00 65.63  ?  392  SER B N   1 
ATOM   6355 C CA  . SER B 1 416 ? 47.077  3.916   36.035  1.00 68.36  ?  392  SER B CA  1 
ATOM   6356 C C   . SER B 1 416 ? 47.162  3.486   37.495  1.00 67.47  ?  392  SER B C   1 
ATOM   6357 O O   . SER B 1 416 ? 46.168  3.029   38.072  1.00 76.90  ?  392  SER B O   1 
ATOM   6358 C CB  . SER B 1 416 ? 47.694  2.860   35.110  1.00 72.00  ?  392  SER B CB  1 
ATOM   6359 O OG  . SER B 1 416 ? 49.081  2.684   35.342  1.00 64.21  ?  392  SER B OG  1 
ATOM   6360 N N   . PHE B 1 417 ? 48.339  3.627   38.112  1.00 65.67  ?  393  PHE B N   1 
ATOM   6361 C CA  . PHE B 1 417 ? 48.485  3.164   39.496  1.00 62.22  ?  393  PHE B CA  1 
ATOM   6362 C C   . PHE B 1 417 ? 47.933  4.151   40.536  1.00 61.57  ?  393  PHE B C   1 
ATOM   6363 O O   . PHE B 1 417 ? 48.015  3.862   41.752  1.00 62.42  ?  393  PHE B O   1 
ATOM   6364 C CB  . PHE B 1 417 ? 49.950  2.837   39.795  1.00 57.53  ?  393  PHE B CB  1 
ATOM   6365 C CG  . PHE B 1 417 ? 50.413  1.522   39.206  1.00 68.28  ?  393  PHE B CG  1 
ATOM   6366 C CD1 . PHE B 1 417 ? 50.341  0.340   39.935  1.00 68.92  ?  393  PHE B CD1 1 
ATOM   6367 C CD2 . PHE B 1 417 ? 50.925  1.473   37.923  1.00 72.91  ?  393  PHE B CD2 1 
ATOM   6368 C CE1 . PHE B 1 417 ? 50.776  -0.865  39.385  1.00 79.85  ?  393  PHE B CE1 1 
ATOM   6369 C CE2 . PHE B 1 417 ? 51.358  0.279   37.369  1.00 77.65  ?  393  PHE B CE2 1 
ATOM   6370 C CZ  . PHE B 1 417 ? 51.284  -0.891  38.099  1.00 81.46  ?  393  PHE B CZ  1 
ATOM   6371 N N   . GLN B 1 418 ? 47.399  5.294   40.081  1.00 62.74  ?  394  GLN B N   1 
ATOM   6372 C CA  . GLN B 1 418 ? 46.831  6.299   40.983  1.00 52.98  ?  394  GLN B CA  1 
ATOM   6373 C C   . GLN B 1 418 ? 45.843  5.699   41.986  1.00 57.98  ?  394  GLN B C   1 
ATOM   6374 O O   . GLN B 1 418 ? 45.980  5.883   43.202  1.00 60.76  ?  394  GLN B O   1 
ATOM   6375 C CB  . GLN B 1 418 ? 46.134  7.385   40.158  1.00 56.21  ?  394  GLN B CB  1 
ATOM   6376 C CG  . GLN B 1 418 ? 46.878  8.712   40.084  1.00 66.25  ?  394  GLN B CG  1 
ATOM   6377 C CD  . GLN B 1 418 ? 46.231  9.713   39.134  1.00 63.89  ?  394  GLN B CD  1 
ATOM   6378 O OE1 . GLN B 1 418 ? 45.424  9.347   38.278  1.00 89.53  ?  394  GLN B OE1 1 
ATOM   6379 N NE2 . GLN B 1 418 ? 46.591  10.984  39.279  1.00 69.04  ?  394  GLN B NE2 1 
ATOM   6380 N N   . GLY B 1 419 ? 44.828  4.986   41.493  1.00 59.10  ?  395  GLY B N   1 
ATOM   6381 C CA  . GLY B 1 419 ? 43.787  4.492   42.381  1.00 56.78  ?  395  GLY B CA  1 
ATOM   6382 C C   . GLY B 1 419 ? 44.293  3.466   43.373  1.00 62.62  ?  395  GLY B C   1 
ATOM   6383 O O   . GLY B 1 419 ? 43.841  3.431   44.524  1.00 63.99  ?  395  GLY B O   1 
ATOM   6384 N N   . LEU B 1 420 ? 45.237  2.625   42.951  1.00 67.30  ?  396  LEU B N   1 
ATOM   6385 C CA  . LEU B 1 420 ? 45.848  1.680   43.876  1.00 60.57  ?  396  LEU B CA  1 
ATOM   6386 C C   . LEU B 1 420 ? 46.509  2.409   45.034  1.00 66.51  ?  396  LEU B C   1 
ATOM   6387 O O   . LEU B 1 420 ? 46.310  2.051   46.203  1.00 78.22  ?  396  LEU B O   1 
ATOM   6388 C CB  . LEU B 1 420 ? 46.871  0.810   43.149  1.00 53.63  ?  396  LEU B CB  1 
ATOM   6389 C CG  . LEU B 1 420 ? 47.790  0.032   44.096  1.00 52.27  ?  396  LEU B CG  1 
ATOM   6390 C CD1 . LEU B 1 420 ? 47.041  -1.106  44.778  1.00 47.07  ?  396  LEU B CD1 1 
ATOM   6391 C CD2 . LEU B 1 420 ? 49.036  -0.476  43.383  1.00 58.38  ?  396  LEU B CD2 1 
ATOM   6392 N N   . MET B 1 421 ? 47.308  3.437   44.732  1.00 57.36  ?  397  MET B N   1 
ATOM   6393 C CA  . MET B 1 421 ? 47.946  4.135   45.846  1.00 58.44  ?  397  MET B CA  1 
ATOM   6394 C C   . MET B 1 421 ? 46.925  4.877   46.701  1.00 50.55  ?  397  MET B C   1 
ATOM   6395 O O   . MET B 1 421 ? 47.133  5.039   47.911  1.00 57.66  ?  397  MET B O   1 
ATOM   6396 C CB  . MET B 1 421 ? 49.023  5.099   45.364  1.00 66.66  ?  397  MET B CB  1 
ATOM   6397 C CG  . MET B 1 421 ? 49.815  5.712   46.518  1.00 87.91  ?  397  MET B CG  1 
ATOM   6398 S SD  . MET B 1 421 ? 51.603  5.522   46.361  1.00 92.32  ?  397  MET B SD  1 
ATOM   6399 C CE  . MET B 1 421 ? 51.908  4.165   47.490  1.00 106.32 ?  397  MET B CE  1 
ATOM   6400 N N   . VAL B 1 422 ? 45.820  5.334   46.104  1.00 50.13  ?  398  VAL B N   1 
ATOM   6401 C CA  . VAL B 1 422 ? 44.757  5.921   46.922  1.00 47.66  ?  398  VAL B CA  1 
ATOM   6402 C C   . VAL B 1 422 ? 44.234  4.896   47.922  1.00 56.24  ?  398  VAL B C   1 
ATOM   6403 O O   . VAL B 1 422 ? 44.057  5.199   49.111  1.00 48.65  ?  398  VAL B O   1 
ATOM   6404 C CB  . VAL B 1 422 ? 43.620  6.483   46.045  1.00 40.50  ?  398  VAL B CB  1 
ATOM   6405 C CG1 . VAL B 1 422 ? 42.481  6.976   46.927  1.00 42.89  ?  398  VAL B CG1 1 
ATOM   6406 C CG2 . VAL B 1 422 ? 44.131  7.615   45.171  1.00 31.58  ?  398  VAL B CG2 1 
ATOM   6407 N N   . ALA B 1 423 ? 43.989  3.666   47.459  1.00 56.89  ?  399  ALA B N   1 
ATOM   6408 C CA  . ALA B 1 423 ? 43.488  2.618   48.349  1.00 51.14  ?  399  ALA B CA  1 
ATOM   6409 C C   . ALA B 1 423 ? 44.500  2.273   49.437  1.00 51.02  ?  399  ALA B C   1 
ATOM   6410 O O   . ALA B 1 423 ? 44.120  1.988   50.580  1.00 38.44  ?  399  ALA B O   1 
ATOM   6411 C CB  . ALA B 1 423 ? 43.128  1.368   47.548  1.00 60.40  ?  399  ALA B CB  1 
ATOM   6412 N N   . ILE B 1 424 ? 45.789  2.275   49.100  1.00 52.55  ?  400  ILE B N   1 
ATOM   6413 C CA  . ILE B 1 424 ? 46.823  2.013   50.099  1.00 60.13  ?  400  ILE B CA  1 
ATOM   6414 C C   . ILE B 1 424 ? 46.788  3.095   51.170  1.00 65.11  ?  400  ILE B C   1 
ATOM   6415 O O   . ILE B 1 424 ? 46.560  2.808   52.350  1.00 55.12  ?  400  ILE B O   1 
ATOM   6416 C CB  . ILE B 1 424 ? 48.227  1.937   49.474  1.00 62.73  ?  400  ILE B CB  1 
ATOM   6417 C CG1 . ILE B 1 424 ? 48.260  0.902   48.355  1.00 55.63  ?  400  ILE B CG1 1 
ATOM   6418 C CG2 . ILE B 1 424 ? 49.257  1.599   50.540  1.00 54.54  ?  400  ILE B CG2 1 
ATOM   6419 C CD1 . ILE B 1 424 ? 48.105  -0.516  48.829  1.00 92.63  ?  400  ILE B CD1 1 
ATOM   6420 N N   . LEU B 1 425 ? 47.007  4.347   50.756  1.00 51.03  ?  401  LEU B N   1 
ATOM   6421 C CA  . LEU B 1 425 ? 47.188  5.434   51.715  1.00 49.77  ?  401  LEU B CA  1 
ATOM   6422 C C   . LEU B 1 425 ? 45.924  5.719   52.520  1.00 52.38  ?  401  LEU B C   1 
ATOM   6423 O O   . LEU B 1 425 ? 46.013  6.195   53.659  1.00 51.65  ?  401  LEU B O   1 
ATOM   6424 C CB  . LEU B 1 425 ? 47.645  6.701   50.992  1.00 55.51  ?  401  LEU B CB  1 
ATOM   6425 C CG  . LEU B 1 425 ? 48.993  6.665   50.264  1.00 64.61  ?  401  LEU B CG  1 
ATOM   6426 C CD1 . LEU B 1 425 ? 49.255  8.021   49.639  1.00 65.49  ?  401  LEU B CD1 1 
ATOM   6427 C CD2 . LEU B 1 425 ? 50.130  6.274   51.197  1.00 78.48  ?  401  LEU B CD2 1 
ATOM   6428 N N   . TYR B 1 426 ? 44.745  5.443   51.962  1.00 48.59  ?  402  TYR B N   1 
ATOM   6429 C CA  . TYR B 1 426 ? 43.504  5.761   52.655  1.00 54.25  ?  402  TYR B CA  1 
ATOM   6430 C C   . TYR B 1 426 ? 42.790  4.540   53.230  1.00 66.66  ?  402  TYR B C   1 
ATOM   6431 O O   . TYR B 1 426 ? 41.776  4.711   53.918  1.00 70.26  ?  402  TYR B O   1 
ATOM   6432 C CB  . TYR B 1 426 ? 42.557  6.519   51.720  1.00 57.58  ?  402  TYR B CB  1 
ATOM   6433 C CG  . TYR B 1 426 ? 42.813  8.008   51.630  1.00 58.53  ?  402  TYR B CG  1 
ATOM   6434 C CD1 . TYR B 1 426 ? 43.433  8.695   52.671  1.00 62.26  ?  402  TYR B CD1 1 
ATOM   6435 C CD2 . TYR B 1 426 ? 42.427  8.730   50.507  1.00 60.83  ?  402  TYR B CD2 1 
ATOM   6436 C CE1 . TYR B 1 426 ? 43.660  10.059  52.594  1.00 65.90  ?  402  TYR B CE1 1 
ATOM   6437 C CE2 . TYR B 1 426 ? 42.649  10.092  50.427  1.00 69.33  ?  402  TYR B CE2 1 
ATOM   6438 C CZ  . TYR B 1 426 ? 43.267  10.746  51.469  1.00 70.78  ?  402  TYR B CZ  1 
ATOM   6439 O OH  . TYR B 1 426 ? 43.488  12.094  51.375  1.00 48.22  ?  402  TYR B OH  1 
ATOM   6440 N N   . CYS B 1 427 ? 43.234  3.314   52.923  1.00 64.51  ?  403  CYS B N   1 
ATOM   6441 C CA  . CYS B 1 427 ? 42.666  2.167   53.629  1.00 66.64  ?  403  CYS B CA  1 
ATOM   6442 C C   . CYS B 1 427 ? 43.685  1.246   54.296  1.00 76.57  ?  403  CYS B C   1 
ATOM   6443 O O   . CYS B 1 427 ? 43.657  1.066   55.518  1.00 74.31  ?  403  CYS B O   1 
ATOM   6444 C CB  . CYS B 1 427 ? 41.797  1.335   52.683  1.00 67.26  ?  403  CYS B CB  1 
ATOM   6445 S SG  . CYS B 1 427 ? 40.871  0.033   53.531  1.00 85.25  ?  403  CYS B SG  1 
ATOM   6446 N N   . PHE B 1 428 ? 44.606  0.678   53.508  1.00 76.76  ?  404  PHE B N   1 
ATOM   6447 C CA  . PHE B 1 428 ? 45.287  -0.542  53.943  1.00 58.58  ?  404  PHE B CA  1 
ATOM   6448 C C   . PHE B 1 428 ? 46.347  -0.279  55.007  1.00 62.49  ?  404  PHE B C   1 
ATOM   6449 O O   . PHE B 1 428 ? 46.668  -1.180  55.792  1.00 73.39  ?  404  PHE B O   1 
ATOM   6450 C CB  . PHE B 1 428 ? 45.903  -1.264  52.744  1.00 58.84  ?  404  PHE B CB  1 
ATOM   6451 C CG  . PHE B 1 428 ? 44.892  -1.698  51.714  1.00 63.37  ?  404  PHE B CG  1 
ATOM   6452 C CD1 . PHE B 1 428 ? 43.853  -2.552  52.054  1.00 59.41  ?  404  PHE B CD1 1 
ATOM   6453 C CD2 . PHE B 1 428 ? 44.988  -1.259  50.403  1.00 66.57  ?  404  PHE B CD2 1 
ATOM   6454 C CE1 . PHE B 1 428 ? 42.920  -2.948  51.106  1.00 68.18  ?  404  PHE B CE1 1 
ATOM   6455 C CE2 . PHE B 1 428 ? 44.061  -1.654  49.452  1.00 69.00  ?  404  PHE B CE2 1 
ATOM   6456 C CZ  . PHE B 1 428 ? 43.026  -2.497  49.804  1.00 66.64  ?  404  PHE B CZ  1 
ATOM   6457 N N   . VAL B 1 429 ? 46.914  0.929   55.037  1.00 75.41  ?  405  VAL B N   1 
ATOM   6458 C CA  . VAL B 1 429 ? 47.864  1.308   56.076  1.00 69.78  ?  405  VAL B CA  1 
ATOM   6459 C C   . VAL B 1 429 ? 47.206  2.113   57.187  1.00 69.92  ?  405  VAL B C   1 
ATOM   6460 O O   . VAL B 1 429 ? 47.901  2.595   58.094  1.00 73.68  ?  405  VAL B O   1 
ATOM   6461 C CB  . VAL B 1 429 ? 49.058  2.082   55.480  1.00 64.83  ?  405  VAL B CB  1 
ATOM   6462 C CG1 . VAL B 1 429 ? 49.855  1.187   54.540  1.00 69.46  ?  405  VAL B CG1 1 
ATOM   6463 C CG2 . VAL B 1 429 ? 48.576  3.316   54.746  1.00 77.67  ?  405  VAL B CG2 1 
ATOM   6464 N N   . ASN B 1 430 ? 45.885  2.287   57.136  1.00 65.32  ?  406  ASN B N   1 
ATOM   6465 C CA  . ASN B 1 430 ? 45.169  2.930   58.228  1.00 72.53  ?  406  ASN B CA  1 
ATOM   6466 C C   . ASN B 1 430 ? 45.179  2.022   59.450  1.00 78.12  ?  406  ASN B C   1 
ATOM   6467 O O   . ASN B 1 430 ? 44.977  0.809   59.341  1.00 86.30  ?  406  ASN B O   1 
ATOM   6468 C CB  . ASN B 1 430 ? 43.735  3.259   57.805  1.00 76.78  ?  406  ASN B CB  1 
ATOM   6469 C CG  . ASN B 1 430 ? 42.922  3.880   58.923  1.00 73.30  ?  406  ASN B CG  1 
ATOM   6470 O OD1 . ASN B 1 430 ? 41.820  3.425   59.230  1.00 75.37  ?  406  ASN B OD1 1 
ATOM   6471 N ND2 . ASN B 1 430 ? 43.466  4.919   59.546  1.00 61.55  ?  406  ASN B ND2 1 
ATOM   6472 N N   . ASN B 1 431 ? 45.437  2.613   60.617  1.00 83.12  ?  407  ASN B N   1 
ATOM   6473 C CA  . ASN B 1 431 ? 45.577  1.814   61.831  1.00 76.14  ?  407  ASN B CA  1 
ATOM   6474 C C   . ASN B 1 431 ? 44.234  1.246   62.284  1.00 78.71  ?  407  ASN B C   1 
ATOM   6475 O O   . ASN B 1 431 ? 44.166  0.119   62.795  1.00 79.77  ?  407  ASN B O   1 
ATOM   6476 C CB  . ASN B 1 431 ? 46.218  2.660   62.934  1.00 79.17  ?  407  ASN B CB  1 
ATOM   6477 C CG  . ASN B 1 431 ? 47.566  3.233   62.520  1.00 91.56  ?  407  ASN B CG  1 
ATOM   6478 O OD1 . ASN B 1 431 ? 47.901  3.261   61.335  1.00 118.33 ?  407  ASN B OD1 1 
ATOM   6479 N ND2 . ASN B 1 431 ? 48.343  3.696   63.495  1.00 92.95  ?  407  ASN B ND2 1 
ATOM   6480 N N   . GLU B 1 432 ? 43.155  2.005   62.084  1.00 77.70  ?  408  GLU B N   1 
ATOM   6481 C CA  . GLU B 1 432 ? 41.842  1.598   62.576  1.00 81.85  ?  408  GLU B CA  1 
ATOM   6482 C C   . GLU B 1 432 ? 41.350  0.319   61.891  1.00 95.84  ?  408  GLU B C   1 
ATOM   6483 O O   . GLU B 1 432 ? 40.790  -0.579  62.542  1.00 96.68  ?  408  GLU B O   1 
ATOM   6484 C CB  . GLU B 1 432 ? 40.853  2.753   62.376  1.00 75.82  ?  408  GLU B CB  1 
ATOM   6485 C CG  . GLU B 1 432 ? 41.011  3.935   63.360  1.00 84.93  ?  408  GLU B CG  1 
ATOM   6486 C CD  . GLU B 1 432 ? 42.185  4.871   63.056  1.00 88.68  ?  408  GLU B CD  1 
ATOM   6487 O OE1 . GLU B 1 432 ? 42.761  4.796   61.952  1.00 83.21  ?  408  GLU B OE1 1 
ATOM   6488 O OE2 . GLU B 1 432 ? 42.534  5.690   63.933  1.00 66.33  -1 408  GLU B OE2 1 
ATOM   6489 N N   . VAL B 1 433 ? 41.571  0.202   60.580  1.00 86.87  ?  409  VAL B N   1 
ATOM   6490 C CA  . VAL B 1 433 ? 41.122  -0.999  59.880  1.00 90.43  ?  409  VAL B CA  1 
ATOM   6491 C C   . VAL B 1 433 ? 41.948  -2.208  60.303  1.00 89.92  ?  409  VAL B C   1 
ATOM   6492 O O   . VAL B 1 433 ? 41.427  -3.331  60.392  1.00 88.09  ?  409  VAL B O   1 
ATOM   6493 C CB  . VAL B 1 433 ? 41.162  -0.782  58.353  1.00 95.87  ?  409  VAL B CB  1 
ATOM   6494 C CG1 . VAL B 1 433 ? 40.552  0.559   57.998  1.00 86.77  ?  409  VAL B CG1 1 
ATOM   6495 C CG2 . VAL B 1 433 ? 42.581  -0.873  57.810  1.00 80.00  ?  409  VAL B CG2 1 
ATOM   6496 N N   . GLN B 1 434 ? 43.238  -2.008  60.583  1.00 86.06  ?  410  GLN B N   1 
ATOM   6497 C CA  . GLN B 1 434 ? 44.043  -3.108  61.096  1.00 95.61  ?  410  GLN B CA  1 
ATOM   6498 C C   . GLN B 1 434 ? 43.528  -3.559  62.455  1.00 92.41  ?  410  GLN B C   1 
ATOM   6499 O O   . GLN B 1 434 ? 43.516  -4.765  62.758  1.00 88.09  ?  410  GLN B O   1 
ATOM   6500 C CB  . GLN B 1 434 ? 45.516  -2.689  61.155  1.00 100.57 ?  410  GLN B CB  1 
ATOM   6501 C CG  . GLN B 1 434 ? 46.072  -2.283  59.785  1.00 106.67 ?  410  GLN B CG  1 
ATOM   6502 C CD  . GLN B 1 434 ? 47.546  -1.885  59.799  1.00 106.92 ?  410  GLN B CD  1 
ATOM   6503 O OE1 . GLN B 1 434 ? 48.162  -1.736  60.857  1.00 116.83 ?  410  GLN B OE1 1 
ATOM   6504 N NE2 . GLN B 1 434 ? 48.114  -1.706  58.610  1.00 95.30  ?  410  GLN B NE2 1 
ATOM   6505 N N   . LEU B 1 435 ? 43.049  -2.609  63.262  1.00 84.38  ?  411  LEU B N   1 
ATOM   6506 C CA  . LEU B 1 435 ? 42.357  -2.974  64.494  1.00 94.79  ?  411  LEU B CA  1 
ATOM   6507 C C   . LEU B 1 435 ? 41.153  -3.857  64.207  1.00 97.60  ?  411  LEU B C   1 
ATOM   6508 O O   . LEU B 1 435 ? 40.936  -4.868  64.886  1.00 92.11  ?  411  LEU B O   1 
ATOM   6509 C CB  . LEU B 1 435 ? 41.904  -1.721  65.242  1.00 108.57 ?  411  LEU B CB  1 
ATOM   6510 C CG  . LEU B 1 435 ? 42.933  -0.981  66.082  1.00 108.90 ?  411  LEU B CG  1 
ATOM   6511 C CD1 . LEU B 1 435 ? 42.325  0.309   66.584  1.00 111.78 ?  411  LEU B CD1 1 
ATOM   6512 C CD2 . LEU B 1 435 ? 43.390  -1.845  67.246  1.00 106.74 ?  411  LEU B CD2 1 
ATOM   6513 N N   . GLU B 1 436 ? 40.343  -3.481  63.218  1.00 95.53  ?  412  GLU B N   1 
ATOM   6514 C CA  . GLU B 1 436 ? 39.148  -4.276  62.941  1.00 96.11  ?  412  GLU B CA  1 
ATOM   6515 C C   . GLU B 1 436 ? 39.518  -5.702  62.537  1.00 98.19  ?  412  GLU B C   1 
ATOM   6516 O O   . GLU B 1 436 ? 38.886  -6.672  62.986  1.00 103.76 ?  412  GLU B O   1 
ATOM   6517 C CB  . GLU B 1 436 ? 38.297  -3.595  61.869  1.00 88.30  ?  412  GLU B CB  1 
ATOM   6518 C CG  . GLU B 1 436 ? 37.725  -2.251  62.320  1.00 101.80 ?  412  GLU B CG  1 
ATOM   6519 C CD  . GLU B 1 436 ? 37.022  -2.324  63.670  1.00 109.13 ?  412  GLU B CD  1 
ATOM   6520 O OE1 . GLU B 1 436 ? 36.185  -3.232  63.872  1.00 117.08 ?  412  GLU B OE1 1 
ATOM   6521 O OE2 . GLU B 1 436 ? 37.318  -1.477  64.538  1.00 124.20 -1 412  GLU B OE2 1 
ATOM   6522 N N   . PHE B 1 437 ? 40.575  -5.855  61.735  1.00 94.43  ?  413  PHE B N   1 
ATOM   6523 C CA  . PHE B 1 437 ? 40.970  -7.200  61.316  1.00 91.98  ?  413  PHE B CA  1 
ATOM   6524 C C   . PHE B 1 437 ? 41.460  -8.034  62.497  1.00 99.08  ?  413  PHE B C   1 
ATOM   6525 O O   . PHE B 1 437 ? 41.094  -9.211  62.626  1.00 87.96  ?  413  PHE B O   1 
ATOM   6526 C CB  . PHE B 1 437 ? 42.033  -7.136  60.218  1.00 100.60 ?  413  PHE B CB  1 
ATOM   6527 C CG  . PHE B 1 437 ? 41.473  -6.813  58.859  1.00 106.13 ?  413  PHE B CG  1 
ATOM   6528 C CD1 . PHE B 1 437 ? 40.878  -7.795  58.077  1.00 103.71 ?  413  PHE B CD1 1 
ATOM   6529 C CD2 . PHE B 1 437 ? 41.528  -5.522  58.369  1.00 109.62 ?  413  PHE B CD2 1 
ATOM   6530 C CE1 . PHE B 1 437 ? 40.354  -7.485  56.832  1.00 88.64  ?  413  PHE B CE1 1 
ATOM   6531 C CE2 . PHE B 1 437 ? 41.007  -5.208  57.132  1.00 116.08 ?  413  PHE B CE2 1 
ATOM   6532 C CZ  . PHE B 1 437 ? 40.421  -6.189  56.361  1.00 111.11 ?  413  PHE B CZ  1 
ATOM   6533 N N   . ARG B 1 438 ? 42.279  -7.450  63.376  1.00 91.64  ?  414  ARG B N   1 
ATOM   6534 C CA  . ARG B 1 438 ? 42.754  -8.232  64.518  1.00 96.32  ?  414  ARG B CA  1 
ATOM   6535 C C   . ARG B 1 438 ? 41.602  -8.601  65.451  1.00 87.78  ?  414  ARG B C   1 
ATOM   6536 O O   . ARG B 1 438 ? 41.530  -9.737  65.944  1.00 87.12  ?  414  ARG B O   1 
ATOM   6537 C CB  . ARG B 1 438 ? 43.854  -7.471  65.267  1.00 107.69 ?  414  ARG B CB  1 
ATOM   6538 C CG  . ARG B 1 438 ? 44.193  -7.999  66.670  1.00 150.77 ?  414  ARG B CG  1 
ATOM   6539 C CD  . ARG B 1 438 ? 44.531  -9.494  66.700  1.00 171.05 ?  414  ARG B CD  1 
ATOM   6540 N NE  . ARG B 1 438 ? 45.705  -9.847  65.909  1.00 196.30 ?  414  ARG B NE  1 
ATOM   6541 C CZ  . ARG B 1 438 ? 46.005  -11.094 65.561  1.00 205.79 ?  414  ARG B CZ  1 
ATOM   6542 N NH1 . ARG B 1 438 ? 45.207  -12.089 65.926  1.00 216.23 ?  414  ARG B NH1 1 
ATOM   6543 N NH2 . ARG B 1 438 ? 47.091  -11.346 64.842  1.00 197.73 ?  414  ARG B NH2 1 
ATOM   6544 N N   . LYS B 1 439 ? 40.679  -7.662  65.686  1.00 88.80  ?  415  LYS B N   1 
ATOM   6545 C CA  . LYS B 1 439 ? 39.537  -7.929  66.557  1.00 87.74  ?  415  LYS B CA  1 
ATOM   6546 C C   . LYS B 1 439 ? 38.692  -9.075  66.013  1.00 85.31  ?  415  LYS B C   1 
ATOM   6547 O O   . LYS B 1 439 ? 38.282  -9.974  66.765  1.00 102.05 ?  415  LYS B O   1 
ATOM   6548 C CB  . LYS B 1 439 ? 38.704  -6.649  66.698  1.00 99.66  ?  415  LYS B CB  1 
ATOM   6549 C CG  . LYS B 1 439 ? 37.644  -6.637  67.790  1.00 107.46 ?  415  LYS B CG  1 
ATOM   6550 C CD  . LYS B 1 439 ? 37.149  -5.209  68.074  1.00 105.73 ?  415  LYS B CD  1 
ATOM   6551 C CE  . LYS B 1 439 ? 36.398  -4.607  66.886  1.00 118.64 ?  415  LYS B CE  1 
ATOM   6552 N NZ  . LYS B 1 439 ? 35.972  -3.196  67.134  1.00 99.53  ?  415  LYS B NZ  1 
ATOM   6553 N N   . SER B 1 440 ? 38.475  -9.093  64.694  1.00 104.81 ?  416  SER B N   1 
ATOM   6554 C CA  . SER B 1 440 ? 37.655  -10.143 64.096  1.00 120.46 ?  416  SER B CA  1 
ATOM   6555 C C   . SER B 1 440 ? 38.357  -11.496 64.131  1.00 126.55 ?  416  SER B C   1 
ATOM   6556 O O   . SER B 1 440 ? 37.724  -12.517 64.431  1.00 117.01 ?  416  SER B O   1 
ATOM   6557 C CB  . SER B 1 440 ? 37.291  -9.768  62.657  1.00 114.62 ?  416  SER B CB  1 
ATOM   6558 O OG  . SER B 1 440 ? 36.197  -10.533 62.180  1.00 117.05 ?  416  SER B OG  1 
ATOM   6559 N N   . TRP B 1 441 ? 39.661  -11.533 63.838  1.00 118.16 ?  417  TRP B N   1 
ATOM   6560 C CA  . TRP B 1 441 ? 40.369  -12.808 63.925  1.00 104.83 ?  417  TRP B CA  1 
ATOM   6561 C C   . TRP B 1 441 ? 40.339  -13.355 65.344  1.00 111.18 ?  417  TRP B C   1 
ATOM   6562 O O   . TRP B 1 441 ? 40.172  -14.570 65.549  1.00 125.37 ?  417  TRP B O   1 
ATOM   6563 C CB  . TRP B 1 441 ? 41.814  -12.648 63.455  1.00 96.81  ?  417  TRP B CB  1 
ATOM   6564 N N   . GLU B 1 442 ? 40.453  -12.468 66.334  1.00 132.86 ?  418  GLU B N   1 
ATOM   6565 C CA  . GLU B 1 442 ? 40.366  -12.910 67.719  1.00 147.13 ?  418  GLU B CA  1 
ATOM   6566 C C   . GLU B 1 442 ? 38.986  -13.471 68.028  1.00 126.85 ?  418  GLU B C   1 
ATOM   6567 O O   . GLU B 1 442 ? 38.868  -14.472 68.745  1.00 110.94 ?  418  GLU B O   1 
ATOM   6568 C CB  . GLU B 1 442 ? 40.698  -11.761 68.669  1.00 164.95 ?  418  GLU B CB  1 
ATOM   6569 C CG  . GLU B 1 442 ? 41.101  -12.213 70.063  1.00 183.89 ?  418  GLU B CG  1 
ATOM   6570 C CD  . GLU B 1 442 ? 42.388  -13.012 70.057  1.00 189.63 ?  418  GLU B CD  1 
ATOM   6571 O OE1 . GLU B 1 442 ? 43.270  -12.707 69.229  1.00 185.23 ?  418  GLU B OE1 1 
ATOM   6572 O OE2 . GLU B 1 442 ? 42.512  -13.957 70.865  1.00 199.79 -1 418  GLU B OE2 1 
ATOM   6573 N N   . ARG B 1 443 ? 37.930  -12.841 67.507  1.00 121.02 ?  419  ARG B N   1 
ATOM   6574 C CA  . ARG B 1 443 ? 36.605  -13.440 67.654  1.00 132.84 ?  419  ARG B CA  1 
ATOM   6575 C C   . ARG B 1 443 ? 36.564  -14.826 67.026  1.00 144.64 ?  419  ARG B C   1 
ATOM   6576 O O   . ARG B 1 443 ? 35.898  -15.729 67.545  1.00 153.89 ?  419  ARG B O   1 
ATOM   6577 C CB  . ARG B 1 443 ? 35.531  -12.559 67.013  1.00 138.20 ?  419  ARG B CB  1 
ATOM   6578 C CG  . ARG B 1 443 ? 35.499  -11.127 67.508  1.00 144.73 ?  419  ARG B CG  1 
ATOM   6579 C CD  . ARG B 1 443 ? 34.885  -10.990 68.888  1.00 150.91 ?  419  ARG B CD  1 
ATOM   6580 N NE  . ARG B 1 443 ? 34.884  -9.588  69.288  1.00 176.43 ?  419  ARG B NE  1 
ATOM   6581 C CZ  . ARG B 1 443 ? 33.973  -8.702  68.901  1.00 199.69 ?  419  ARG B CZ  1 
ATOM   6582 N NH1 . ARG B 1 443 ? 32.974  -9.071  68.110  1.00 197.59 ?  419  ARG B NH1 1 
ATOM   6583 N NH2 . ARG B 1 443 ? 34.063  -7.445  69.308  1.00 214.92 ?  419  ARG B NH2 1 
ATOM   6584 N N   . TRP B 1 444 ? 37.278  -15.013 65.914  1.00 140.49 ?  420  TRP B N   1 
ATOM   6585 C CA  . TRP B 1 444 ? 37.266  -16.317 65.256  1.00 125.11 ?  420  TRP B CA  1 
ATOM   6586 C C   . TRP B 1 444 ? 37.911  -17.384 66.133  1.00 120.52 ?  420  TRP B C   1 
ATOM   6587 O O   . TRP B 1 444 ? 37.413  -18.512 66.212  1.00 113.17 ?  420  TRP B O   1 
ATOM   6588 C CB  . TRP B 1 444 ? 37.968  -16.251 63.896  1.00 133.27 ?  420  TRP B CB  1 
ATOM   6589 C CG  . TRP B 1 444 ? 37.915  -17.568 63.128  1.00 133.47 ?  420  TRP B CG  1 
ATOM   6590 C CD1 . TRP B 1 444 ? 38.769  -18.629 63.254  1.00 120.08 ?  420  TRP B CD1 1 
ATOM   6591 C CD2 . TRP B 1 444 ? 36.957  -17.948 62.126  1.00 121.31 ?  420  TRP B CD2 1 
ATOM   6592 N NE1 . TRP B 1 444 ? 38.399  -19.642 62.400  1.00 117.45 ?  420  TRP B NE1 1 
ATOM   6593 C CE2 . TRP B 1 444 ? 37.294  -19.248 61.694  1.00 120.09 ?  420  TRP B CE2 1 
ATOM   6594 C CE3 . TRP B 1 444 ? 35.848  -17.316 61.555  1.00 120.39 ?  420  TRP B CE3 1 
ATOM   6595 C CZ2 . TRP B 1 444 ? 36.564  -19.925 60.717  1.00 125.71 ?  420  TRP B CZ2 1 
ATOM   6596 C CZ3 . TRP B 1 444 ? 35.125  -17.991 60.586  1.00 120.17 ?  420  TRP B CZ3 1 
ATOM   6597 C CH2 . TRP B 1 444 ? 35.486  -19.281 60.179  1.00 133.56 ?  420  TRP B CH2 1 
ATOM   6598 N N   . ARG B 1 445 ? 39.012  -17.052 66.806  1.00 132.69 ?  421  ARG B N   1 
ATOM   6599 C CA  . ARG B 1 445 ? 39.657  -18.057 67.650  1.00 129.33 ?  421  ARG B CA  1 
ATOM   6600 C C   . ARG B 1 445 ? 38.833  -18.339 68.908  1.00 143.77 ?  421  ARG B C   1 
ATOM   6601 O O   . ARG B 1 445 ? 38.540  -19.499 69.222  1.00 159.22 ?  421  ARG B O   1 
ATOM   6602 C CB  . ARG B 1 445 ? 41.078  -17.614 68.005  1.00 123.56 ?  421  ARG B CB  1 
ATOM   6603 N N   . LEU B 1 446 ? 38.426  -17.295 69.622  1.00 146.28 ?  422  LEU B N   1 
ATOM   6604 C CA  . LEU B 1 446 ? 37.687  -17.462 70.871  1.00 128.42 ?  422  LEU B CA  1 
ATOM   6605 C C   . LEU B 1 446 ? 36.178  -17.501 70.639  1.00 121.09 ?  422  LEU B C   1 
ATOM   6606 O O   . LEU B 1 446 ? 35.658  -18.406 69.986  1.00 129.41 ?  422  LEU B O   1 
ATOM   6607 C CB  . LEU B 1 446 ? 38.035  -16.334 71.849  1.00 111.97 ?  422  LEU B CB  1 
HETATM 6608 C C13 . 97Y C 2 .   ? 22.388  32.792  30.032  1.00 57.25  ?  2001 97Y A C13 1 
HETATM 6609 C C15 . 97Y C 2 .   ? 23.390  32.829  32.296  1.00 61.95  ?  2001 97Y A C15 1 
HETATM 6610 C C17 . 97Y C 2 .   ? 21.333  33.457  29.131  1.00 61.78  ?  2001 97Y A C17 1 
HETATM 6611 C C20 . 97Y C 2 .   ? 22.343  30.431  29.022  1.00 50.95  ?  2001 97Y A C20 1 
HETATM 6612 C C21 . 97Y C 2 .   ? 22.460  24.162  24.706  1.00 75.88  ?  2001 97Y A C21 1 
HETATM 6613 C C22 . 97Y C 2 .   ? 22.428  26.307  26.153  1.00 54.36  ?  2001 97Y A C22 1 
HETATM 6614 C C24 . 97Y C 2 .   ? 23.172  29.853  26.839  1.00 50.16  ?  2001 97Y A C24 1 
HETATM 6615 C C26 . 97Y C 2 .   ? 19.982  33.320  29.413  1.00 66.28  ?  2001 97Y A C26 1 
HETATM 6616 C C28 . 97Y C 2 .   ? 22.994  30.793  27.844  1.00 53.00  ?  2001 97Y A C28 1 
HETATM 6617 F F01 . 97Y C 2 .   ? 22.066  24.036  23.411  1.00 92.36  ?  2001 97Y A F01 1 
HETATM 6618 F F02 . 97Y C 2 .   ? 23.569  23.406  24.927  1.00 71.45  ?  2001 97Y A F02 1 
HETATM 6619 F F03 . 97Y C 2 .   ? 21.457  23.737  25.526  1.00 81.12  ?  2001 97Y A F03 1 
HETATM 6620 O O04 . 97Y C 2 .   ? 18.767  35.884  25.611  1.00 116.13 ?  2001 97Y A O04 1 
HETATM 6621 O O05 . 97Y C 2 .   ? 13.446  34.611  26.475  1.00 192.27 ?  2001 97Y A O05 1 
HETATM 6622 O O06 . 97Y C 2 .   ? 13.171  34.712  24.304  1.00 158.24 ?  2001 97Y A O06 1 
HETATM 6623 N N07 . 97Y C 2 .   ? 22.857  27.544  26.022  1.00 48.41  ?  2001 97Y A N07 1 
HETATM 6624 N N08 . 97Y C 2 .   ? 22.118  31.352  30.125  1.00 53.18  ?  2001 97Y A N08 1 
HETATM 6625 N N09 . 97Y C 2 .   ? 23.396  26.498  24.220  1.00 56.41  ?  2001 97Y A N09 1 
HETATM 6626 N N10 . 97Y C 2 .   ? 22.091  28.250  28.150  1.00 43.16  ?  2001 97Y A N10 1 
HETATM 6627 N N11 . 97Y C 2 .   ? 17.018  35.242  26.933  1.00 123.10 ?  2001 97Y A N11 1 
HETATM 6628 C C12 . 97Y C 2 .   ? 22.277  33.307  31.402  1.00 57.92  ?  2001 97Y A C12 1 
HETATM 6629 C C14 . 97Y C 2 .   ? 23.475  34.238  32.820  1.00 59.15  ?  2001 97Y A C14 1 
HETATM 6630 C C16 . 97Y C 2 .   ? 22.800  34.705  31.553  1.00 54.67  ?  2001 97Y A C16 1 
HETATM 6631 C C18 . 97Y C 2 .   ? 22.768  25.630  24.996  1.00 61.28  ?  2001 97Y A C18 1 
HETATM 6632 C C19 . 97Y C 2 .   ? 22.699  28.567  27.025  1.00 45.01  ?  2001 97Y A C19 1 
HETATM 6633 C C23 . 97Y C 2 .   ? 23.447  27.653  24.848  1.00 53.57  ?  2001 97Y A C23 1 
HETATM 6634 C C25 . 97Y C 2 .   ? 21.745  34.192  28.029  1.00 66.32  ?  2001 97Y A C25 1 
HETATM 6635 C C27 . 97Y C 2 .   ? 21.909  29.122  29.112  1.00 48.08  ?  2001 97Y A C27 1 
HETATM 6636 C C29 . 97Y C 2 .   ? 22.600  34.430  34.054  1.00 55.98  ?  2001 97Y A C29 1 
HETATM 6637 C C30 . 97Y C 2 .   ? 24.903  34.759  32.968  1.00 60.96  ?  2001 97Y A C30 1 
HETATM 6638 C C31 . 97Y C 2 .   ? 19.458  34.657  27.493  1.00 88.79  ?  2001 97Y A C31 1 
HETATM 6639 C C32 . 97Y C 2 .   ? 20.808  34.794  27.211  1.00 74.86  ?  2001 97Y A C32 1 
HETATM 6640 C C33 . 97Y C 2 .   ? 19.042  33.923  28.596  1.00 78.02  ?  2001 97Y A C33 1 
HETATM 6641 C C34 . 97Y C 2 .   ? 18.417  35.318  26.594  1.00 106.41 ?  2001 97Y A C34 1 
HETATM 6642 C C35 . 97Y C 2 .   ? 16.052  35.875  26.054  1.00 125.22 ?  2001 97Y A C35 1 
HETATM 6643 C C36 . 97Y C 2 .   ? 15.432  34.839  25.130  1.00 145.67 ?  2001 97Y A C36 1 
HETATM 6644 C C37 . 97Y C 2 .   ? 13.925  34.714  25.315  1.00 162.25 ?  2001 97Y A C37 1 
HETATM 6645 C C18 . OLC D 3 .   ? 18.834  29.522  47.124  1.00 66.07  ?  2002 OLC A C18 1 
HETATM 6646 C C10 . OLC D 3 .   ? 23.771  26.357  39.737  1.00 78.04  ?  2002 OLC A C10 1 
HETATM 6647 C C9  . OLC D 3 .   ? 24.341  25.174  39.863  1.00 83.01  ?  2002 OLC A C9  1 
HETATM 6648 C C17 . OLC D 3 .   ? 20.173  28.796  47.272  1.00 85.89  ?  2002 OLC A C17 1 
HETATM 6649 C C11 . OLC D 3 .   ? 23.957  27.401  40.838  1.00 71.40  ?  2002 OLC A C11 1 
HETATM 6650 C C8  . OLC D 3 .   ? 24.164  24.122  38.771  1.00 98.99  ?  2002 OLC A C8  1 
HETATM 6651 C C24 . OLC D 3 .   ? 23.627  25.543  30.493  1.00 80.69  ?  2002 OLC A C24 1 
HETATM 6652 C C16 . OLC D 3 .   ? 21.151  29.167  46.157  1.00 100.87 ?  2002 OLC A C16 1 
HETATM 6653 C C12 . OLC D 3 .   ? 22.658  27.704  41.588  1.00 69.84  ?  2002 OLC A C12 1 
HETATM 6654 C C7  . OLC D 3 .   ? 24.351  22.697  39.295  1.00 86.08  ?  2002 OLC A C7  1 
HETATM 6655 C C15 . OLC D 3 .   ? 21.590  27.973  45.310  1.00 106.74 ?  2002 OLC A C15 1 
HETATM 6656 C C13 . OLC D 3 .   ? 22.853  27.728  43.105  1.00 63.69  ?  2002 OLC A C13 1 
HETATM 6657 C C6  . OLC D 3 .   ? 23.720  21.627  38.403  1.00 66.61  ?  2002 OLC A C6  1 
HETATM 6658 C C14 . OLC D 3 .   ? 21.647  28.335  43.824  1.00 78.97  ?  2002 OLC A C14 1 
HETATM 6659 C C5  . OLC D 3 .   ? 23.510  22.085  36.958  1.00 67.70  ?  2002 OLC A C5  1 
HETATM 6660 C C4  . OLC D 3 .   ? 23.850  20.983  35.956  1.00 76.75  ?  2002 OLC A C4  1 
HETATM 6661 C C3  . OLC D 3 .   ? 24.974  21.366  34.994  1.00 76.81  ?  2002 OLC A C3  1 
HETATM 6662 C C2  . OLC D 3 .   ? 24.483  21.486  33.551  1.00 60.93  ?  2002 OLC A C2  1 
HETATM 6663 C C21 . OLC D 3 .   ? 24.517  23.235  30.629  1.00 79.24  ?  2002 OLC A C21 1 
HETATM 6664 C C1  . OLC D 3 .   ? 24.908  22.790  32.887  1.00 94.86  ?  2002 OLC A C1  1 
HETATM 6665 C C22 . OLC D 3 .   ? 23.833  24.250  29.714  1.00 67.93  ?  2002 OLC A C22 1 
HETATM 6666 O O19 . OLC D 3 .   ? 25.931  23.308  33.175  1.00 78.74  ?  2002 OLC A O19 1 
HETATM 6667 O O25 . OLC D 3 .   ? 22.998  25.233  31.703  1.00 102.17 ?  2002 OLC A O25 1 
HETATM 6668 O O23 . OLC D 3 .   ? 24.650  24.502  28.599  1.00 59.36  ?  2002 OLC A O23 1 
HETATM 6669 O O20 . OLC D 3 .   ? 24.067  23.386  31.945  1.00 116.88 ?  2002 OLC A O20 1 
HETATM 6670 C C13 . 97Y E 2 .   ? 54.458  9.144   53.262  1.00 54.91  ?  2001 97Y B C13 1 
HETATM 6671 C C15 . 97Y E 2 .   ? 55.149  8.999   50.860  1.00 59.74  ?  2001 97Y B C15 1 
HETATM 6672 C C17 . 97Y E 2 .   ? 53.405  8.512   54.188  1.00 61.08  ?  2001 97Y B C17 1 
HETATM 6673 C C20 . 97Y E 2 .   ? 54.522  11.513  54.249  1.00 58.59  ?  2001 97Y B C20 1 
HETATM 6674 C C21 . 97Y E 2 .   ? 54.637  17.792  58.515  1.00 73.47  ?  2001 97Y B C21 1 
HETATM 6675 C C22 . 97Y E 2 .   ? 54.624  15.631  57.093  1.00 60.11  ?  2001 97Y B C22 1 
HETATM 6676 C C24 . 97Y E 2 .   ? 55.279  12.057  56.464  1.00 59.36  ?  2001 97Y B C24 1 
HETATM 6677 C C26 . 97Y E 2 .   ? 52.063  8.601   53.858  1.00 68.06  ?  2001 97Y B C26 1 
HETATM 6678 C C28 . 97Y E 2 .   ? 55.102  11.122  55.454  1.00 56.77  ?  2001 97Y B C28 1 
HETATM 6679 F F01 . 97Y E 2 .   ? 54.460  18.003  59.847  1.00 81.44  ?  2001 97Y B F01 1 
HETATM 6680 F F02 . 97Y E 2 .   ? 55.667  18.555  58.059  1.00 75.13  ?  2001 97Y B F02 1 
HETATM 6681 F F03 . 97Y E 2 .   ? 53.503  18.133  57.843  1.00 80.97  ?  2001 97Y B F03 1 
HETATM 6682 O O04 . 97Y E 2 .   ? 50.758  6.219   57.745  1.00 112.71 ?  2001 97Y B O04 1 
HETATM 6683 O O05 . 97Y E 2 .   ? 45.551  7.479   56.721  1.00 138.56 ?  2001 97Y B O05 1 
HETATM 6684 O O06 . 97Y E 2 .   ? 45.204  7.345   58.882  1.00 134.20 ?  2001 97Y B O06 1 
HETATM 6685 N N07 . 97Y E 2 .   ? 55.030  14.390  57.252  1.00 56.72  ?  2001 97Y B N07 1 
HETATM 6686 N N08 . 97Y E 2 .   ? 54.298  10.600  53.137  1.00 53.86  ?  2001 97Y B N08 1 
HETATM 6687 N N09 . 97Y E 2 .   ? 55.518  15.447  59.063  1.00 72.56  ?  2001 97Y B N09 1 
HETATM 6688 N N10 . 97Y E 2 .   ? 54.335  13.705  55.101  1.00 54.53  ?  2001 97Y B N10 1 
HETATM 6689 N N11 . 97Y E 2 .   ? 49.054  6.670   56.281  1.00 98.29  ?  2001 97Y B N11 1 
HETATM 6690 C C12 . 97Y E 2 .   ? 54.203  8.552   51.941  1.00 57.51  ?  2001 97Y B C12 1 
HETATM 6691 C C14 . 97Y E 2 .   ? 55.309  7.551   50.479  1.00 66.66  ?  2001 97Y B C14 1 
HETATM 6692 C C16 . 97Y E 2 .   ? 54.760  7.165   51.831  1.00 55.51  ?  2001 97Y B C16 1 
HETATM 6693 C C18 . 97Y E 2 .   ? 54.932  16.316  58.256  1.00 67.15  ?  2001 97Y B C18 1 
HETATM 6694 C C19 . 97Y E 2 .   ? 54.880  13.365  56.252  1.00 56.63  ?  2001 97Y B C19 1 
HETATM 6695 C C23 . 97Y E 2 .   ? 55.575  14.286  58.448  1.00 66.26  ?  2001 97Y B C23 1 
HETATM 6696 C C25 . 97Y E 2 .   ? 53.800  7.824   55.325  1.00 75.00  ?  2001 97Y B C25 1 
HETATM 6697 C C27 . 97Y E 2 .   ? 54.156  12.840  54.134  1.00 52.49  ?  2001 97Y B C27 1 
HETATM 6698 C C29 . 97Y E 2 .   ? 54.382  7.159   49.331  1.00 75.97  ?  2001 97Y B C29 1 
HETATM 6699 C C30 . 97Y E 2 .   ? 56.757  7.095   50.303  1.00 62.13  ?  2001 97Y B C30 1 
HETATM 6700 C C31 . 97Y E 2 .   ? 51.497  7.347   55.821  1.00 78.55  ?  2001 97Y B C31 1 
HETATM 6701 C C32 . 97Y E 2 .   ? 52.845  7.245   56.140  1.00 69.68  ?  2001 97Y B C32 1 
HETATM 6702 C C33 . 97Y E 2 .   ? 51.107  8.023   54.674  1.00 70.66  ?  2001 97Y B C33 1 
HETATM 6703 C C34 . 97Y E 2 .   ? 50.434  6.701   56.709  1.00 93.87  ?  2001 97Y B C34 1 
HETATM 6704 C C35 . 97Y E 2 .   ? 48.060  6.045   57.136  1.00 90.21  ?  2001 97Y B C35 1 
HETATM 6705 C C36 . 97Y E 2 .   ? 47.473  7.053   58.112  1.00 113.54 ?  2001 97Y B C36 1 
HETATM 6706 C C37 . 97Y E 2 .   ? 45.985  7.307   57.892  1.00 130.35 ?  2001 97Y B C37 1 
HETATM 6707 C C18 . OLC F 3 .   ? 50.605  12.581  36.293  1.00 58.36  ?  2002 OLC B C18 1 
HETATM 6708 C C10 . OLC F 3 .   ? 55.733  15.098  42.767  1.00 80.68  ?  2002 OLC B C10 1 
HETATM 6709 C C9  . OLC F 3 .   ? 56.816  15.825  42.981  1.00 97.40  ?  2002 OLC B C9  1 
HETATM 6710 C C17 . OLC F 3 .   ? 51.939  12.894  35.612  1.00 58.86  ?  2002 OLC B C17 1 
HETATM 6711 C C11 . OLC F 3 .   ? 55.725  14.015  41.682  1.00 80.52  ?  2002 OLC B C11 1 
HETATM 6712 C C8  . OLC F 3 .   ? 56.816  16.897  44.069  1.00 101.95 ?  2002 OLC B C8  1 
HETATM 6713 C C24 . OLC F 3 .   ? 55.179  16.435  52.342  1.00 70.30  ?  2002 OLC B C24 1 
HETATM 6714 C C16 . OLC F 3 .   ? 53.134  12.753  36.558  1.00 70.63  ?  2002 OLC B C16 1 
HETATM 6715 C C12 . OLC F 3 .   ? 54.354  13.825  41.026  1.00 86.19  ?  2002 OLC B C12 1 
HETATM 6716 C C7  . OLC F 3 .   ? 56.833  18.317  43.499  1.00 95.88  ?  2002 OLC B C7  1 
HETATM 6717 C C15 . OLC F 3 .   ? 53.099  13.772  37.698  1.00 92.13  ?  2002 OLC B C15 1 
HETATM 6718 C C13 . OLC F 3 .   ? 54.422  12.989  39.746  1.00 74.37  ?  2002 OLC B C13 1 
HETATM 6719 C C6  . OLC F 3 .   ? 57.232  19.358  44.544  1.00 107.80 ?  2002 OLC B C6  1 
HETATM 6720 C C14 . OLC F 3 .   ? 54.418  13.844  38.474  1.00 82.64  ?  2002 OLC B C14 1 
HETATM 6721 C C5  . OLC F 3 .   ? 56.124  20.377  44.804  1.00 78.57  ?  2002 OLC B C5  1 
HETATM 6722 C C4  . OLC F 3 .   ? 55.472  20.180  46.170  1.00 73.14  ?  2002 OLC B C4  1 
HETATM 6723 C C3  . OLC F 3 .   ? 56.467  20.321  47.323  1.00 88.21  ?  2002 OLC B C3  1 
HETATM 6724 C C2  . OLC F 3 .   ? 56.449  19.092  48.238  1.00 93.82  ?  2002 OLC B C2  1 
HETATM 6725 C C21 . OLC F 3 .   ? 56.985  17.971  51.555  1.00 98.25  ?  2002 OLC B C21 1 
HETATM 6726 C C1  . OLC F 3 .   ? 57.082  19.330  49.609  1.00 92.64  ?  2002 OLC B C1  1 
HETATM 6727 C C22 . OLC F 3 .   ? 56.024  17.655  52.703  1.00 76.11  ?  2002 OLC B C22 1 
HETATM 6728 O O19 . OLC F 3 .   ? 58.149  19.832  49.697  1.00 85.68  ?  2002 OLC B O19 1 
HETATM 6729 O O25 . OLC F 3 .   ? 54.995  16.408  50.955  1.00 74.01  ?  2002 OLC B O25 1 
HETATM 6730 O O23 . OLC F 3 .   ? 56.745  17.393  53.879  1.00 58.46  ?  2002 OLC B O23 1 
HETATM 6731 O O20 . OLC F 3 .   ? 56.392  18.967  50.772  1.00 107.19 ?  2002 OLC B O20 1 
HETATM 6732 O O   . HOH G 4 .   ? -8.300  29.719  30.775  1.00 53.38  ?  3001 HOH A O   1 
HETATM 6733 O O   . HOH G 4 .   ? 11.639  33.762  51.027  1.00 62.48  ?  3002 HOH A O   1 
HETATM 6734 O O   . HOH G 4 .   ? -6.614  14.939  2.640   1.00 66.58  ?  3003 HOH A O   1 
HETATM 6735 O O   . HOH G 4 .   ? 3.058   12.267  12.021  1.00 58.05  ?  3004 HOH A O   1 
HETATM 6736 O O   . HOH G 4 .   ? 2.958   15.792  18.638  1.00 54.57  ?  3005 HOH A O   1 
HETATM 6737 O O   . HOH G 4 .   ? 0.706   15.338  19.371  1.00 74.00  ?  3006 HOH A O   1 
HETATM 6738 O O   . HOH H 4 .   ? 17.211  18.287  84.965  1.00 55.17  ?  3001 HOH B O   1 
HETATM 6739 O O   . HOH H 4 .   ? 36.817  6.499   63.407  1.00 65.80  ?  3002 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 10  ? 1.4959 1.3026 1.2585 -0.0804 -0.0461 0.0233  136  SER A N   
2    C CA  . SER A 10  ? 1.6115 1.4141 1.3654 -0.0774 -0.0436 0.0183  136  SER A CA  
3    C C   . SER A 10  ? 1.9323 1.7406 1.6920 -0.0727 -0.0376 0.0180  136  SER A C   
4    O O   . SER A 10  ? 1.9350 1.7462 1.7034 -0.0707 -0.0355 0.0187  136  SER A O   
5    C CB  . SER A 10  ? 1.4823 1.2744 1.2290 -0.0765 -0.0448 0.0131  136  SER A CB  
6    N N   . PRO A 11  ? 2.2049 2.0149 1.9600 -0.0709 -0.0350 0.0170  137  PRO A N   
7    C CA  . PRO A 11  ? 2.0059 1.8217 1.7671 -0.0666 -0.0294 0.0169  137  PRO A CA  
8    C C   . PRO A 11  ? 1.7743 1.5850 1.5342 -0.0622 -0.0264 0.0123  137  PRO A C   
9    O O   . PRO A 11  ? 1.3633 1.1774 1.1318 -0.0597 -0.0234 0.0124  137  PRO A O   
10   C CB  . PRO A 11  ? 2.1258 1.9445 1.8816 -0.0661 -0.0280 0.0176  137  PRO A CB  
11   C CG  . PRO A 11  ? 2.1637 1.9747 1.9071 -0.0687 -0.0323 0.0153  137  PRO A CG  
12   C CD  . PRO A 11  ? 2.2673 2.0746 2.0118 -0.0728 -0.0372 0.0161  137  PRO A CD  
13   N N   . GLU A 12  ? 1.7412 1.5435 1.4900 -0.0616 -0.0273 0.0081  138  GLU A N   
14   C CA  . GLU A 12  ? 1.6994 1.4964 1.4457 -0.0574 -0.0243 0.0038  138  GLU A CA  
15   C C   . GLU A 12  ? 1.6319 1.4265 1.3836 -0.0575 -0.0253 0.0032  138  GLU A C   
16   O O   . GLU A 12  ? 1.6247 1.4200 1.3807 -0.0538 -0.0218 0.0016  138  GLU A O   
17   C CB  . GLU A 12  ? 1.8718 1.6595 1.6044 -0.0569 -0.0253 -0.0003 138  GLU A CB  
18   N N   . GLU A 13  ? 1.5158 1.3084 1.2678 -0.0615 -0.0299 0.0047  139  GLU A N   
19   C CA  . GLU A 13  ? 1.6032 1.3942 1.3609 -0.0615 -0.0309 0.0047  139  GLU A CA  
20   C C   . GLU A 13  ? 1.6365 1.4362 1.4065 -0.0597 -0.0282 0.0075  139  GLU A C   
21   O O   . GLU A 13  ? 1.6536 1.4530 1.4282 -0.0570 -0.0264 0.0061  139  GLU A O   
22   C CB  . GLU A 13  ? 1.6820 1.4699 1.4385 -0.0663 -0.0365 0.0066  139  GLU A CB  
23   N N   . GLN A 14  ? 1.8461 1.6535 1.6214 -0.0610 -0.0278 0.0113  140  GLN A N   
24   C CA  . GLN A 14  ? 1.7252 1.5406 1.5119 -0.0592 -0.0251 0.0137  140  GLN A CA  
25   C C   . GLN A 14  ? 1.7135 1.5302 1.5022 -0.0544 -0.0202 0.0107  140  GLN A C   
26   O O   . GLN A 14  ? 1.9660 1.7848 1.7614 -0.0520 -0.0185 0.0100  140  GLN A O   
27   C CB  . GLN A 14  ? 1.5604 1.3835 1.3520 -0.0614 -0.0251 0.0183  140  GLN A CB  
28   N N   . LEU A 15  ? 1.4861 1.3018 1.2690 -0.0528 -0.0179 0.0090  141  LEU A N   
29   C CA  . LEU A 15  ? 1.3383 1.1554 1.1237 -0.0482 -0.0133 0.0065  141  LEU A CA  
30   C C   . LEU A 15  ? 1.3916 1.2027 1.1745 -0.0459 -0.0128 0.0029  141  LEU A C   
31   O O   . LEU A 15  ? 1.5873 1.4015 1.3768 -0.0429 -0.0101 0.0021  141  LEU A O   
32   C CB  . LEU A 15  ? 1.2169 1.0334 0.9960 -0.0465 -0.0109 0.0055  141  LEU A CB  
33   N N   . LEU A 16  ? 1.4433 1.2460 1.2174 -0.0474 -0.0156 0.0009  142  LEU A N   
34   C CA  . LEU A 16  ? 1.3946 1.1914 1.1662 -0.0451 -0.0148 -0.0023 142  LEU A CA  
35   C C   . LEU A 16  ? 1.4122 1.2122 1.1928 -0.0449 -0.0154 -0.0012 142  LEU A C   
36   O O   . LEU A 16  ? 1.3318 1.1325 1.1159 -0.0414 -0.0127 -0.0029 142  LEU A O   
37   C CB  . LEU A 16  ? 1.5315 1.3186 1.2923 -0.0471 -0.0179 -0.0046 142  LEU A CB  
38   N N   . PHE A 17  ? 1.3485 1.1510 1.1332 -0.0483 -0.0190 0.0021  143  PHE A N   
39   C CA  . PHE A 17  ? 1.3154 1.1206 1.1082 -0.0479 -0.0198 0.0035  143  PHE A CA  
40   C C   . PHE A 17  ? 1.3909 1.2044 1.1933 -0.0450 -0.0164 0.0043  143  PHE A C   
41   O O   . PHE A 17  ? 1.3166 1.1316 1.1240 -0.0423 -0.0151 0.0033  143  PHE A O   
42   C CB  . PHE A 17  ? 1.4027 1.2088 1.1975 -0.0522 -0.0242 0.0074  143  PHE A CB  
43   C CG  . PHE A 17  ? 1.4707 1.2778 1.2720 -0.0518 -0.0256 0.0089  143  PHE A CG  
44   C CD1 . PHE A 17  ? 1.5157 1.3161 1.3136 -0.0515 -0.0271 0.0071  143  PHE A CD1 
45   C CD2 . PHE A 17  ? 1.3940 1.2087 1.2049 -0.0515 -0.0254 0.0123  143  PHE A CD2 
46   C CE1 . PHE A 17  ? 1.4226 1.2245 1.2270 -0.0508 -0.0282 0.0089  143  PHE A CE1 
47   C CE2 . PHE A 17  ? 1.5823 1.3981 1.3990 -0.0507 -0.0266 0.0139  143  PHE A CE2 
48   C CZ  . PHE A 17  ? 1.4680 1.2776 1.2816 -0.0502 -0.0280 0.0123  143  PHE A CZ  
49   N N   . LEU A 18  ? 1.4003 1.2194 1.2056 -0.0454 -0.0150 0.0060  144  LEU A N   
50   C CA  . LEU A 18  ? 1.3317 1.1582 1.1463 -0.0426 -0.0117 0.0062  144  LEU A CA  
51   C C   . LEU A 18  ? 1.3894 1.2146 1.2028 -0.0385 -0.0081 0.0025  144  LEU A C   
52   O O   . LEU A 18  ? 1.5040 1.3332 1.3243 -0.0358 -0.0062 0.0018  144  LEU A O   
53   C CB  . LEU A 18  ? 1.3707 1.2032 1.1890 -0.0439 -0.0106 0.0089  144  LEU A CB  
54   C CG  . LEU A 18  ? 1.5509 1.3868 1.3732 -0.0475 -0.0135 0.0133  144  LEU A CG  
55   C CD1 . LEU A 18  ? 1.5196 1.3598 1.3427 -0.0493 -0.0127 0.0160  144  LEU A CD1 
56   C CD2 . LEU A 18  ? 1.6063 1.4475 1.4384 -0.0463 -0.0132 0.0147  144  LEU A CD2 
57   N N   . TYR A 19  ? 1.3526 1.1719 1.1571 -0.0378 -0.0071 0.0003  145  TYR A N   
58   C CA  . TYR A 19  ? 1.3215 1.1389 1.1243 -0.0338 -0.0037 -0.0029 145  TYR A CA  
59   C C   . TYR A 19  ? 1.4024 1.2175 1.2065 -0.0322 -0.0040 -0.0044 145  TYR A C   
60   O O   . TYR A 19  ? 1.3174 1.1357 1.1264 -0.0289 -0.0012 -0.0057 145  TYR A O   
61   C CB  . TYR A 19  ? 1.3760 1.1863 1.1676 -0.0334 -0.0029 -0.0049 145  TYR A CB  
62   C CG  . TYR A 19  ? 1.4489 1.2556 1.2371 -0.0293 0.0005  -0.0079 145  TYR A CG  
63   C CD1 . TYR A 19  ? 1.4395 1.2502 1.2307 -0.0261 0.0045  -0.0082 145  TYR A CD1 
64   C CD2 . TYR A 19  ? 1.5363 1.3357 1.3185 -0.0286 0.0000  -0.0101 145  TYR A CD2 
65   C CE1 . TYR A 19  ? 1.6415 1.4491 1.4296 -0.0223 0.0078  -0.0105 145  TYR A CE1 
66   C CE2 . TYR A 19  ? 1.5677 1.3639 1.3467 -0.0248 0.0035  -0.0125 145  TYR A CE2 
67   C CZ  . TYR A 19  ? 1.6314 1.4318 1.4133 -0.0217 0.0074  -0.0126 145  TYR A CZ  
68   O OH  . TYR A 19  ? 1.5726 1.3700 1.3515 -0.0178 0.0109  -0.0145 145  TYR A OH  
69   N N   . ILE A 20  ? 1.3981 1.2084 1.1988 -0.0346 -0.0074 -0.0040 146  ILE A N   
70   C CA  . ILE A 20  ? 1.4311 1.2394 1.2335 -0.0329 -0.0075 -0.0051 146  ILE A CA  
71   C C   . ILE A 20  ? 1.5108 1.3272 1.3240 -0.0314 -0.0070 -0.0036 146  ILE A C   
72   O O   . ILE A 20  ? 1.4027 1.2209 1.2193 -0.0281 -0.0048 -0.0051 146  ILE A O   
73   C CB  . ILE A 20  ? 1.4634 1.2652 1.2610 -0.0359 -0.0115 -0.0045 146  ILE A CB  
74   C CG1 . ILE A 20  ? 1.4725 1.2654 1.2588 -0.0368 -0.0118 -0.0069 146  ILE A CG1 
75   C CG2 . ILE A 20  ? 1.3478 1.1491 1.1492 -0.0339 -0.0114 -0.0049 146  ILE A CG2 
76   C CD1 . ILE A 20  ? 1.4495 1.2391 1.2315 -0.0329 -0.0077 -0.0101 146  ILE A CD1 
77   N N   . ILE A 21  ? 1.5408 1.3621 1.3594 -0.0338 -0.0090 -0.0005 147  ILE A N   
78   C CA  . ILE A 21  ? 1.5196 1.3479 1.3479 -0.0322 -0.0087 0.0008  147  ILE A CA  
79   C C   . ILE A 21  ? 1.4784 1.3123 1.3117 -0.0290 -0.0049 -0.0009 147  ILE A C   
80   O O   . ILE A 21  ? 1.7718 1.6097 1.6108 -0.0262 -0.0036 -0.0018 147  ILE A O   
81   C CB  . ILE A 21  ? 1.4975 1.3298 1.3306 -0.0352 -0.0114 0.0048  147  ILE A CB  
82   C CG1 . ILE A 21  ? 1.9105 1.7451 1.7432 -0.0375 -0.0111 0.0063  147  ILE A CG1 
83   C CG2 . ILE A 21  ? 1.4095 1.2371 1.2397 -0.0378 -0.0152 0.0067  147  ILE A CG2 
84   C CD1 . ILE A 21  ? 1.9346 1.7769 1.7756 -0.0358 -0.0085 0.0066  147  ILE A CD1 
85   N N   . TYR A 22  ? 1.1593 0.9934 0.9903 -0.0291 -0.0030 -0.0016 148  TYR A N   
86   C CA  . TYR A 22  ? 1.0211 0.8602 0.8571 -0.0262 0.0005  -0.0031 148  TYR A CA  
87   C C   . TYR A 22  ? 0.9778 0.8149 0.8121 -0.0226 0.0029  -0.0060 148  TYR A C   
88   O O   . TYR A 22  ? 0.9872 0.8294 0.8281 -0.0199 0.0045  -0.0069 148  TYR A O   
89   C CB  . TYR A 22  ? 1.0575 0.8967 0.8910 -0.0269 0.0021  -0.0027 148  TYR A CB  
90   C CG  . TYR A 22  ? 1.0762 0.9211 0.9160 -0.0244 0.0056  -0.0035 148  TYR A CG  
91   C CD1 . TYR A 22  ? 1.1397 0.9918 0.9885 -0.0250 0.0059  -0.0019 148  TYR A CD1 
92   C CD2 . TYR A 22  ? 1.1354 0.9784 0.9723 -0.0214 0.0086  -0.0057 148  TYR A CD2 
93   C CE1 . TYR A 22  ? 1.2896 1.1468 1.1449 -0.0229 0.0090  -0.0027 148  TYR A CE1 
94   C CE2 . TYR A 22  ? 1.1457 0.9941 0.9890 -0.0191 0.0117  -0.0062 148  TYR A CE2 
95   C CZ  . TYR A 22  ? 1.2058 1.0613 1.0585 -0.0200 0.0117  -0.0047 148  TYR A CZ  
96   O OH  . TYR A 22  ? 1.1669 1.0275 1.0265 -0.0179 0.0146  -0.0052 148  TYR A OH  
97   N N   . THR A 23  ? 1.0264 0.8559 0.8516 -0.0224 0.0030  -0.0074 149  THR A N   
98   C CA  . THR A 23  ? 1.2273 1.0547 1.0505 -0.0189 0.0058  -0.0098 149  THR A CA  
99   C C   . THR A 23  ? 1.1951 1.0237 1.0219 -0.0175 0.0051  -0.0100 149  THR A C   
100  O O   . THR A 23  ? 1.1565 0.9879 0.9865 -0.0141 0.0076  -0.0114 149  THR A O   
101  C CB  . THR A 23  ? 1.2264 1.0449 1.0385 -0.0190 0.0064  -0.0112 149  THR A CB  
102  O OG1 . THR A 23  ? 1.5210 1.3338 1.3277 -0.0223 0.0028  -0.0105 149  THR A OG1 
103  C CG2 . THR A 23  ? 1.0953 0.9137 0.9044 -0.0188 0.0083  -0.0112 149  THR A CG2 
104  N N   . VAL A 24  ? 1.1625 0.9895 0.9894 -0.0198 0.0017  -0.0084 150  VAL A N   
105  C CA  . VAL A 24  ? 1.1812 1.0102 1.0124 -0.0180 0.0012  -0.0082 150  VAL A CA  
106  C C   . VAL A 24  ? 1.2729 1.1110 1.1139 -0.0166 0.0015  -0.0074 150  VAL A C   
107  O O   . VAL A 24  ? 1.4338 1.2757 1.2793 -0.0136 0.0025  -0.0080 150  VAL A O   
108  C CB  . VAL A 24  ? 0.9638 0.7880 0.7922 -0.0206 -0.0023 -0.0065 150  VAL A CB  
109  C CG1 . VAL A 24  ? 0.9374 0.7522 0.7558 -0.0221 -0.0027 -0.0078 150  VAL A CG1 
110  C CG2 . VAL A 24  ? 1.0023 0.8297 0.8344 -0.0238 -0.0054 -0.0035 150  VAL A CG2 
111  N N   . GLY A 25  ? 1.2517 1.0939 1.0965 -0.0184 0.0008  -0.0061 151  GLY A N   
112  C CA  . GLY A 25  ? 1.2414 1.0919 1.0953 -0.0169 0.0015  -0.0059 151  GLY A CA  
113  C C   . GLY A 25  ? 1.1077 0.9617 0.9643 -0.0134 0.0049  -0.0085 151  GLY A C   
114  O O   . GLY A 25  ? 1.0074 0.8665 0.8696 -0.0107 0.0055  -0.0093 151  GLY A O   
115  N N   . TYR A 26  ? 1.0941 0.9455 0.9467 -0.0132 0.0070  -0.0097 152  TYR A N   
116  C CA  . TYR A 26  ? 1.0382 0.8929 0.8935 -0.0099 0.0103  -0.0118 152  TYR A CA  
117  C C   . TYR A 26  ? 1.0796 0.9319 0.9320 -0.0070 0.0116  -0.0131 152  TYR A C   
118  O O   . TYR A 26  ? 1.0682 0.9254 0.9252 -0.0040 0.0135  -0.0144 152  TYR A O   
119  C CB  . TYR A 26  ? 0.9599 0.8128 0.8123 -0.0100 0.0125  -0.0122 152  TYR A CB  
120  C CG  . TYR A 26  ? 0.9971 0.8556 0.8562 -0.0112 0.0127  -0.0113 152  TYR A CG  
121  C CD1 . TYR A 26  ? 1.0170 0.8826 0.8845 -0.0092 0.0144  -0.0124 152  TYR A CD1 
122  C CD2 . TYR A 26  ? 1.0029 0.8600 0.8604 -0.0144 0.0112  -0.0094 152  TYR A CD2 
123  C CE1 . TYR A 26  ? 0.9386 0.8091 0.8128 -0.0103 0.0147  -0.0116 152  TYR A CE1 
124  C CE2 . TYR A 26  ? 0.9966 0.8590 0.8606 -0.0154 0.0117  -0.0083 152  TYR A CE2 
125  C CZ  . TYR A 26  ? 0.8719 0.7407 0.7443 -0.0134 0.0135  -0.0095 152  TYR A CZ  
126  O OH  . TYR A 26  ? 0.8533 0.7270 0.7327 -0.0144 0.0141  -0.0085 152  TYR A OH  
127  N N   . ALA A 27  ? 1.0957 0.9410 0.9411 -0.0079 0.0105  -0.0128 153  ALA A N   
128  C CA  . ALA A 27  ? 1.0429 0.8862 0.8863 -0.0052 0.0119  -0.0138 153  ALA A CA  
129  C C   . ALA A 27  ? 1.0159 0.8655 0.8666 -0.0034 0.0109  -0.0132 153  ALA A C   
130  O O   . ALA A 27  ? 1.0001 0.8540 0.8542 0.0000  0.0131  -0.0143 153  ALA A O   
131  C CB  . ALA A 27  ? 1.0370 0.8710 0.8718 -0.0068 0.0107  -0.0135 153  ALA A CB  
132  N N   . LEU A 28  ? 0.9740 0.8246 0.8271 -0.0055 0.0077  -0.0113 154  LEU A N   
133  C CA  . LEU A 28  ? 1.0106 0.8675 0.8706 -0.0036 0.0067  -0.0105 154  LEU A CA  
134  C C   . LEU A 28  ? 1.1311 0.9966 0.9985 -0.0015 0.0081  -0.0118 154  LEU A C   
135  O O   . LEU A 28  ? 1.0309 0.9016 0.9026 0.0018  0.0091  -0.0126 154  LEU A O   
136  C CB  . LEU A 28  ? 0.9244 0.7809 0.7859 -0.0063 0.0032  -0.0078 154  LEU A CB  
137  C CG  . LEU A 28  ? 0.8735 0.7246 0.7316 -0.0071 0.0013  -0.0061 154  LEU A CG  
138  C CD1 . LEU A 28  ? 0.8821 0.7243 0.7315 -0.0083 0.0021  -0.0072 154  LEU A CD1 
139  C CD2 . LEU A 28  ? 0.8195 0.6703 0.6791 -0.0102 -0.0023 -0.0029 154  LEU A CD2 
140  N N   . SER A 29  ? 1.2594 1.1264 1.1283 -0.0032 0.0084  -0.0122 155  SER A N   
141  C CA  . SER A 29  ? 1.0338 0.9087 0.9102 -0.0015 0.0095  -0.0136 155  SER A CA  
142  C C   . SER A 29  ? 0.8999 0.7767 0.7766 0.0018  0.0126  -0.0157 155  SER A C   
143  O O   . SER A 29  ? 0.7237 0.6072 0.6062 0.0044  0.0132  -0.0169 155  SER A O   
144  C CB  . SER A 29  ? 1.0097 0.8853 0.8879 -0.0041 0.0094  -0.0133 155  SER A CB  
145  O OG  . SER A 29  ? 1.0126 0.8878 0.8917 -0.0069 0.0067  -0.0110 155  SER A OG  
146  N N   . PHE A 30  ? 0.9064 0.7776 0.7769 0.0017  0.0146  -0.0162 156  PHE A N   
147  C CA  . PHE A 30  ? 0.9337 0.8063 0.8041 0.0048  0.0178  -0.0176 156  PHE A CA  
148  C C   . PHE A 30  ? 0.9242 0.7989 0.7954 0.0078  0.0184  -0.0178 156  PHE A C   
149  O O   . PHE A 30  ? 0.8329 0.7143 0.7093 0.0107  0.0198  -0.0189 156  PHE A O   
150  C CB  . PHE A 30  ? 0.9474 0.8125 0.8098 0.0043  0.0199  -0.0176 156  PHE A CB  
151  C CG  . PHE A 30  ? 0.9886 0.8548 0.8506 0.0076  0.0235  -0.0186 156  PHE A CG  
152  C CD1 . PHE A 30  ? 1.0893 0.9592 0.9551 0.0083  0.0253  -0.0191 156  PHE A CD1 
153  C CD2 . PHE A 30  ? 0.8652 0.7288 0.7235 0.0100  0.0253  -0.0187 156  PHE A CD2 
154  C CE1 . PHE A 30  ? 1.0744 0.9455 0.9401 0.0113  0.0287  -0.0195 156  PHE A CE1 
155  C CE2 . PHE A 30  ? 0.9733 0.8381 0.8313 0.0130  0.0288  -0.0192 156  PHE A CE2 
156  C CZ  . PHE A 30  ? 1.1385 1.0072 1.0002 0.0137  0.0305  -0.0195 156  PHE A CZ  
157  N N   . SER A 31  ? 1.0442 0.9135 0.9107 0.0072  0.0172  -0.0167 157  SER A N   
158  C CA  . SER A 31  ? 1.0670 0.9382 0.9345 0.0103  0.0181  -0.0165 157  SER A CA  
159  C C   . SER A 31  ? 1.0795 0.9597 0.9552 0.0120  0.0167  -0.0165 157  SER A C   
160  O O   . SER A 31  ? 1.0569 0.9429 0.9362 0.0155  0.0183  -0.0172 157  SER A O   
161  C CB  . SER A 31  ? 1.0347 0.8982 0.8963 0.0090  0.0169  -0.0151 157  SER A CB  
162  O OG  . SER A 31  ? 0.9944 0.8493 0.8479 0.0076  0.0183  -0.0156 157  SER A OG  
163  N N   . ALA A 32  ? 0.9845 0.8662 0.8630 0.0098  0.0137  -0.0155 158  ALA A N   
164  C CA  . ALA A 32  ? 0.9064 0.7961 0.7920 0.0116  0.0122  -0.0154 158  ALA A CA  
165  C C   . ALA A 32  ? 1.0801 0.9775 0.9715 0.0134  0.0135  -0.0177 158  ALA A C   
166  O O   . ALA A 32  ? 1.0598 0.9642 0.9561 0.0165  0.0137  -0.0185 158  ALA A O   
167  C CB  . ALA A 32  ? 0.7808 0.6698 0.6679 0.0088  0.0091  -0.0137 158  ALA A CB  
168  N N   . LEU A 33  ? 1.0476 0.9438 0.9388 0.0116  0.0144  -0.0188 159  LEU A N   
169  C CA  . LEU A 33  ? 0.9850 0.8884 0.8824 0.0130  0.0154  -0.0209 159  LEU A CA  
170  C C   . LEU A 33  ? 1.0330 0.9391 0.9305 0.0163  0.0182  -0.0220 159  LEU A C   
171  O O   . LEU A 33  ? 1.1101 1.0241 1.0135 0.0187  0.0184  -0.0235 159  LEU A O   
172  C CB  . LEU A 33  ? 0.9134 0.8149 0.8113 0.0102  0.0158  -0.0213 159  LEU A CB  
173  C CG  . LEU A 33  ? 0.8976 0.7987 0.7975 0.0071  0.0133  -0.0203 159  LEU A CG  
174  C CD1 . LEU A 33  ? 0.8339 0.7309 0.7319 0.0042  0.0140  -0.0198 159  LEU A CD1 
175  C CD2 . LEU A 33  ? 0.8139 0.7230 0.7220 0.0081  0.0121  -0.0217 159  LEU A CD2 
176  N N   . VAL A 34  ? 1.0189 0.9188 0.9099 0.0167  0.0203  -0.0212 160  VAL A N   
177  C CA  . VAL A 34  ? 1.0338 0.9364 0.9248 0.0201  0.0233  -0.0217 160  VAL A CA  
178  C C   . VAL A 34  ? 1.0219 0.9294 0.9154 0.0232  0.0230  -0.0214 160  VAL A C   
179  O O   . VAL A 34  ? 0.8387 0.7536 0.7365 0.0262  0.0243  -0.0223 160  VAL A O   
180  C CB  . VAL A 34  ? 1.0220 0.9162 0.9051 0.0199  0.0259  -0.0209 160  VAL A CB  
181  C CG1 . VAL A 34  ? 0.8224 0.7193 0.7055 0.0236  0.0293  -0.0209 160  VAL A CG1 
182  C CG2 . VAL A 34  ? 1.0002 0.8907 0.8814 0.0175  0.0265  -0.0211 160  VAL A CG2 
183  N N   . ILE A 35  ? 1.0542 0.9584 0.9454 0.0225  0.0212  -0.0198 161  ILE A N   
184  C CA  . ILE A 35  ? 1.0367 0.9459 0.9308 0.0257  0.0209  -0.0190 161  ILE A CA  
185  C C   . ILE A 35  ? 1.0550 0.9739 0.9566 0.0273  0.0192  -0.0203 161  ILE A C   
186  O O   . ILE A 35  ? 1.0473 0.9736 0.9527 0.0309  0.0202  -0.0209 161  ILE A O   
187  C CB  . ILE A 35  ? 0.9289 0.8324 0.8199 0.0244  0.0190  -0.0168 161  ILE A CB  
188  C CG1 . ILE A 35  ? 0.9050 0.7998 0.7890 0.0239  0.0210  -0.0158 161  ILE A CG1 
189  C CG2 . ILE A 35  ? 0.7673 0.6773 0.6630 0.0277  0.0180  -0.0156 161  ILE A CG2 
190  C CD1 . ILE A 35  ? 0.9909 0.8793 0.8718 0.0220  0.0188  -0.0136 161  ILE A CD1 
191  N N   . ALA A 36  ? 0.9464 0.8654 0.8502 0.0246  0.0167  -0.0209 162  ALA A N   
192  C CA  . ALA A 36  ? 1.0008 0.9282 0.9113 0.0258  0.0149  -0.0223 162  ALA A CA  
193  C C   . ALA A 36  ? 1.0653 0.9995 0.9801 0.0275  0.0163  -0.0249 162  ALA A C   
194  O O   . ALA A 36  ? 1.0836 1.0260 1.0033 0.0304  0.0159  -0.0262 162  ALA A O   
195  C CB  . ALA A 36  ? 1.0971 1.0221 1.0086 0.0223  0.0124  -0.0220 162  ALA A CB  
196  N N   . SER A 37  ? 0.9991 0.9301 0.9125 0.0256  0.0179  -0.0256 163  SER A N   
197  C CA  . SER A 37  ? 1.0168 0.9541 0.9346 0.0272  0.0194  -0.0277 163  SER A CA  
198  C C   . SER A 37  ? 1.1297 1.0710 1.0471 0.0311  0.0217  -0.0273 163  SER A C   
199  O O   . SER A 37  ? 1.2714 1.2212 1.1940 0.0335  0.0219  -0.0290 163  SER A O   
200  C CB  . SER A 37  ? 0.9976 0.9303 0.9139 0.0248  0.0210  -0.0278 163  SER A CB  
201  O OG  . SER A 37  ? 1.2582 1.1825 1.1670 0.0240  0.0228  -0.0259 163  SER A OG  
202  N N   . ALA A 38  ? 1.0151 0.9508 0.9268 0.0318  0.0234  -0.0252 164  ALA A N   
203  C CA  . ALA A 38  ? 1.0350 0.9745 0.9465 0.0357  0.0259  -0.0244 164  ALA A CA  
204  C C   . ALA A 38  ? 1.1053 1.0530 1.0213 0.0388  0.0244  -0.0246 164  ALA A C   
205  O O   . ALA A 38  ? 1.1753 1.1306 1.0943 0.0423  0.0259  -0.0250 164  ALA A O   
206  C CB  . ALA A 38  ? 0.9884 0.9192 0.8928 0.0356  0.0280  -0.0221 164  ALA A CB  
207  N N   . ILE A 39  ? 0.9954 0.9420 0.9119 0.0378  0.0215  -0.0241 165  ILE A N   
208  C CA  . ILE A 39  ? 0.9621 0.9165 0.8828 0.0410  0.0199  -0.0242 165  ILE A CA  
209  C C   . ILE A 39  ? 0.9557 0.9191 0.8824 0.0420  0.0187  -0.0272 165  ILE A C   
210  O O   . ILE A 39  ? 0.8635 0.8357 0.7938 0.0458  0.0191  -0.0280 165  ILE A O   
211  C CB  . ILE A 39  ? 0.9075 0.8583 0.8273 0.0397  0.0172  -0.0225 165  ILE A CB  
212  C CG1 . ILE A 39  ? 0.8490 0.7917 0.7635 0.0391  0.0182  -0.0195 165  ILE A CG1 
213  C CG2 . ILE A 39  ? 0.8398 0.7991 0.7642 0.0433  0.0155  -0.0226 165  ILE A CG2 
214  C CD1 . ILE A 39  ? 0.9629 0.9009 0.8762 0.0370  0.0155  -0.0175 165  ILE A CD1 
215  N N   . LEU A 40  ? 1.0224 0.9839 0.9506 0.0386  0.0171  -0.0290 166  LEU A N   
216  C CA  . LEU A 40  ? 1.0237 0.9930 0.9580 0.0390  0.0157  -0.0322 166  LEU A CA  
217  C C   . LEU A 40  ? 1.0489 1.0242 0.9856 0.0411  0.0178  -0.0335 166  LEU A C   
218  O O   . LEU A 40  ? 0.9243 0.9085 0.8659 0.0434  0.0168  -0.0357 166  LEU A O   
219  C CB  . LEU A 40  ? 1.0427 1.0079 0.9783 0.0348  0.0141  -0.0335 166  LEU A CB  
220  C CG  . LEU A 40  ? 0.8629 0.8240 0.7976 0.0327  0.0117  -0.0325 166  LEU A CG  
221  C CD1 . LEU A 40  ? 0.7480 0.7074 0.6856 0.0290  0.0106  -0.0341 166  LEU A CD1 
222  C CD2 . LEU A 40  ? 0.8961 0.8633 0.8332 0.0358  0.0097  -0.0327 166  LEU A CD2 
223  N N   . LEU A 41  ? 1.1359 1.1065 1.0691 0.0404  0.0207  -0.0320 167  LEU A N   
224  C CA  . LEU A 41  ? 1.1652 1.1413 1.1007 0.0424  0.0230  -0.0326 167  LEU A CA  
225  C C   . LEU A 41  ? 1.2098 1.1913 1.1448 0.0469  0.0249  -0.0312 167  LEU A C   
226  O O   . LEU A 41  ? 1.1354 1.1257 1.0744 0.0494  0.0256  -0.0322 167  LEU A O   
227  C CB  . LEU A 41  ? 0.9441 0.9131 0.8759 0.0403  0.0257  -0.0314 167  LEU A CB  
228  C CG  . LEU A 41  ? 0.9362 0.9018 0.8699 0.0365  0.0245  -0.0327 167  LEU A CG  
229  C CD1 . LEU A 41  ? 0.8430 0.8009 0.7719 0.0350  0.0274  -0.0308 167  LEU A CD1 
230  C CD2 . LEU A 41  ? 0.8843 0.8586 0.8257 0.0368  0.0233  -0.0354 167  LEU A CD2 
231  N N   . GLY A 42  ? 1.0881 1.0648 1.0186 0.0478  0.0258  -0.0287 168  GLY A N   
232  C CA  . GLY A 42  ? 0.9561 0.9370 0.8860 0.0520  0.0282  -0.0267 168  GLY A CA  
233  C C   . GLY A 42  ? 0.9936 0.9857 0.9287 0.0558  0.0267  -0.0277 168  GLY A C   
234  O O   . GLY A 42  ? 1.0797 1.0800 1.0174 0.0592  0.0285  -0.0277 168  GLY A O   
235  N N   . PHE A 43  ? 0.9363 0.9290 0.8726 0.0556  0.0235  -0.0284 169  PHE A N   
236  C CA  . PHE A 43  ? 0.8445 0.8475 0.7851 0.0595  0.0218  -0.0294 169  PHE A CA  
237  C C   . PHE A 43  ? 0.9003 0.9107 0.8458 0.0592  0.0200  -0.0333 169  PHE A C   
238  O O   . PHE A 43  ? 1.1001 1.1069 1.0465 0.0554  0.0180  -0.0354 169  PHE A O   
239  C CB  . PHE A 43  ? 0.8663 0.8669 0.8063 0.0596  0.0192  -0.0285 169  PHE A CB  
240  C CG  . PHE A 43  ? 0.9421 0.9358 0.8781 0.0598  0.0206  -0.0246 169  PHE A CG  
241  C CD1 . PHE A 43  ? 1.1226 1.1209 1.0592 0.0644  0.0226  -0.0221 169  PHE A CD1 
242  C CD2 . PHE A 43  ? 1.0156 0.9983 0.9476 0.0555  0.0198  -0.0235 169  PHE A CD2 
243  C CE1 . PHE A 43  ? 1.2035 1.1952 1.1371 0.0646  0.0238  -0.0186 169  PHE A CE1 
244  C CE2 . PHE A 43  ? 1.2035 1.1797 1.1320 0.0556  0.0208  -0.0201 169  PHE A CE2 
245  C CZ  . PHE A 43  ? 1.2366 1.2171 1.1661 0.0600  0.0228  -0.0177 169  PHE A CZ  
246  N N   . ARG A 44  ? 1.0248 1.0458 0.9737 0.0631  0.0207  -0.0342 170  ARG A N   
247  C CA  . ARG A 44  ? 0.9587 0.9872 0.9125 0.0628  0.0189  -0.0380 170  ARG A CA  
248  C C   . ARG A 44  ? 1.0193 1.0503 0.9757 0.0624  0.0148  -0.0409 170  ARG A C   
249  O O   . ARG A 44  ? 0.9702 1.0030 0.9300 0.0601  0.0128  -0.0444 170  ARG A O   
250  C CB  . ARG A 44  ? 0.8303 0.8700 0.7869 0.0672  0.0206  -0.0379 170  ARG A CB  
251  N N   . HIS A 45  ? 1.1095 1.1405 1.0645 0.0647  0.0138  -0.0396 171  HIS A N   
252  C CA  . HIS A 45  ? 1.1850 1.2187 1.1421 0.0650  0.0102  -0.0421 171  HIS A CA  
253  C C   . HIS A 45  ? 1.2450 1.2698 1.2014 0.0599  0.0084  -0.0432 171  HIS A C   
254  O O   . HIS A 45  ? 1.2382 1.2649 1.1969 0.0595  0.0056  -0.0458 171  HIS A O   
255  C CB  . HIS A 45  ? 1.2891 1.3252 1.2449 0.0692  0.0098  -0.0396 171  HIS A CB  
256  C CG  . HIS A 45  ? 1.5077 1.5546 1.4652 0.0750  0.0112  -0.0390 171  HIS A CG  
257  N ND1 . HIS A 45  ? 1.6183 1.6661 1.5747 0.0769  0.0147  -0.0359 171  HIS A ND1 
258  C CD2 . HIS A 45  ? 1.4046 1.4621 1.3650 0.0793  0.0095  -0.0410 171  HIS A CD2 
259  C CE1 . HIS A 45  ? 1.4362 1.4950 1.3950 0.0822  0.0154  -0.0358 171  HIS A CE1 
260  N NE2 . HIS A 45  ? 1.2810 1.3459 1.2420 0.0838  0.0122  -0.0389 171  HIS A NE2 
261  N N   . LEU A 46  ? 1.0787 1.0943 1.0321 0.0561  0.0100  -0.0412 172  LEU A N   
262  C CA  . LEU A 46  ? 0.8912 0.8985 0.8438 0.0513  0.0086  -0.0417 172  LEU A CA  
263  C C   . LEU A 46  ? 0.8546 0.8619 0.8106 0.0481  0.0085  -0.0446 172  LEU A C   
264  O O   . LEU A 46  ? 0.9529 0.9534 0.9086 0.0440  0.0080  -0.0447 172  LEU A O   
265  C CB  . LEU A 46  ? 0.8370 0.8341 0.7843 0.0491  0.0102  -0.0378 172  LEU A CB  
266  C CG  . LEU A 46  ? 0.8531 0.8494 0.7975 0.0519  0.0105  -0.0344 172  LEU A CG  
267  C CD1 . LEU A 46  ? 0.8978 0.8839 0.8370 0.0494  0.0120  -0.0310 172  LEU A CD1 
268  C CD2 . LEU A 46  ? 0.6561 0.6540 0.6019 0.0529  0.0076  -0.0346 172  LEU A CD2 
269  N N   . HIS A 47  ? 0.7138 0.7290 0.6733 0.0499  0.0091  -0.0466 173  HIS A N   
270  C CA  . HIS A 47  ? 0.7315 0.7473 0.6949 0.0471  0.0091  -0.0490 173  HIS A CA  
271  C C   . HIS A 47  ? 0.7064 0.7265 0.6752 0.0461  0.0058  -0.0532 173  HIS A C   
272  O O   . HIS A 47  ? 0.8917 0.9207 0.8646 0.0483  0.0045  -0.0562 173  HIS A O   
273  C CB  . HIS A 47  ? 0.8287 0.8511 0.7937 0.0494  0.0112  -0.0488 173  HIS A CB  
274  C CG  . HIS A 47  ? 0.8599 0.8769 0.8201 0.0495  0.0149  -0.0449 173  HIS A CG  
275  N ND1 . HIS A 47  ? 0.9379 0.9508 0.8928 0.0511  0.0163  -0.0417 173  HIS A ND1 
276  C CD2 . HIS A 47  ? 0.9169 0.9318 0.8769 0.0483  0.0175  -0.0437 173  HIS A CD2 
277  C CE1 . HIS A 47  ? 0.9354 0.9436 0.8868 0.0508  0.0196  -0.0390 173  HIS A CE1 
278  N NE2 . HIS A 47  ? 0.9390 0.9483 0.8931 0.0492  0.0205  -0.0401 173  HIS A NE2 
279  N N   . CYS A 48  ? 0.7075 0.7211 0.6763 0.0428  0.0046  -0.0535 174  CYS A N   
280  C CA  . CYS A 48  ? 0.6344 0.6505 0.6083 0.0413  0.0018  -0.0575 174  CYS A CA  
281  C C   . CYS A 48  ? 0.6068 0.6156 0.5823 0.0365  0.0021  -0.0573 174  CYS A C   
282  O O   . CYS A 48  ? 0.4928 0.4941 0.4644 0.0345  0.0041  -0.0540 174  CYS A O   
283  C CB  . CYS A 48  ? 0.6387 0.6561 0.6114 0.0434  -0.0004 -0.0581 174  CYS A CB  
284  S SG  . CYS A 48  ? 0.9277 0.9356 0.8941 0.0424  0.0004  -0.0533 174  CYS A SG  
285  N N   . THR A 49  ? 0.6416 0.6527 0.6231 0.0347  0.0002  -0.0610 175  THR A N   
286  C CA  . THR A 49  ? 0.6433 0.6487 0.6279 0.0303  0.0007  -0.0610 175  THR A CA  
287  C C   . THR A 49  ? 0.5698 0.5666 0.5499 0.0282  0.0013  -0.0578 175  THR A C   
288  O O   . THR A 49  ? 0.5839 0.5746 0.5633 0.0252  0.0030  -0.0556 175  THR A O   
289  C CB  . THR A 49  ? 0.7007 0.7102 0.6927 0.0291  -0.0017 -0.0656 175  THR A CB  
290  O OG1 . THR A 49  ? 1.1343 1.1443 1.1252 0.0304  -0.0038 -0.0670 175  THR A OG1 
291  C CG2 . THR A 49  ? 0.6230 0.6415 0.6196 0.0311  -0.0027 -0.0689 175  THR A CG2 
292  N N   . ARG A 50  ? 0.5130 0.5094 0.4901 0.0298  0.0000  -0.0572 176  ARG A N   
293  C CA  . ARG A 50  ? 0.5704 0.5591 0.5432 0.0279  0.0003  -0.0538 176  ARG A CA  
294  C C   . ARG A 50  ? 0.6902 0.6731 0.6573 0.0271  0.0027  -0.0498 176  ARG A C   
295  O O   . ARG A 50  ? 1.0545 1.0307 1.0201 0.0238  0.0037  -0.0477 176  ARG A O   
296  C CB  . ARG A 50  ? 0.5458 0.5360 0.5162 0.0307  -0.0013 -0.0533 176  ARG A CB  
297  C CG  . ARG A 50  ? 0.6101 0.5931 0.5759 0.0292  -0.0011 -0.0493 176  ARG A CG  
298  C CD  . ARG A 50  ? 0.6333 0.6184 0.5979 0.0321  -0.0029 -0.0488 176  ARG A CD  
299  N NE  . ARG A 50  ? 0.9264 0.9184 0.8901 0.0370  -0.0033 -0.0497 176  ARG A NE  
300  C CZ  . ARG A 50  ? 0.8987 0.8905 0.8582 0.0394  -0.0023 -0.0465 176  ARG A CZ  
301  N NH1 . ARG A 50  ? 0.8390 0.8236 0.7944 0.0372  -0.0010 -0.0426 176  ARG A NH1 
302  N NH2 . ARG A 50  ? 0.6705 0.6695 0.6301 0.0440  -0.0026 -0.0474 176  ARG A NH2 
303  N N   . ASN A 51  ? 0.5798 0.5654 0.5438 0.0302  0.0036  -0.0488 177  ASN A N   
304  C CA  . ASN A 51  ? 0.6327 0.6125 0.5909 0.0297  0.0058  -0.0452 177  ASN A CA  
305  C C   . ASN A 51  ? 0.6390 0.6167 0.5982 0.0277  0.0079  -0.0452 177  ASN A C   
306  O O   . ASN A 51  ? 0.5932 0.5641 0.5478 0.0260  0.0096  -0.0424 177  ASN A O   
307  C CB  . ASN A 51  ? 0.7255 0.7087 0.6804 0.0338  0.0065  -0.0439 177  ASN A CB  
308  C CG  . ASN A 51  ? 0.7363 0.7196 0.6891 0.0358  0.0050  -0.0425 177  ASN A CG  
309  O OD1 . ASN A 51  ? 0.7310 0.7097 0.6830 0.0336  0.0038  -0.0414 177  ASN A OD1 
310  N ND2 . ASN A 51  ? 0.7777 0.7666 0.7298 0.0401  0.0051  -0.0421 177  ASN A ND2 
311  N N   . TYR A 52  ? 0.7343 0.7177 0.6996 0.0278  0.0077  -0.0481 178  TYR A N   
312  C CA  . TYR A 52  ? 0.8060 0.7874 0.7731 0.0258  0.0096  -0.0478 178  TYR A CA  
313  C C   . TYR A 52  ? 0.7475 0.7224 0.7153 0.0218  0.0097  -0.0468 178  TYR A C   
314  O O   . TYR A 52  ? 0.5868 0.5561 0.5517 0.0202  0.0118  -0.0444 178  TYR A O   
315  C CB  . TYR A 52  ? 0.8724 0.8618 0.8467 0.0266  0.0090  -0.0510 178  TYR A CB  
316  C CG  . TYR A 52  ? 0.9489 0.9451 0.9226 0.0304  0.0095  -0.0514 178  TYR A CG  
317  C CD1 . TYR A 52  ? 0.8592 0.8531 0.8274 0.0321  0.0122  -0.0483 178  TYR A CD1 
318  C CD2 . TYR A 52  ? 1.0720 1.0771 1.0507 0.0325  0.0074  -0.0549 178  TYR A CD2 
319  C CE1 . TYR A 52  ? 1.0216 1.0221 0.9896 0.0357  0.0130  -0.0483 178  TYR A CE1 
320  C CE2 . TYR A 52  ? 1.1185 1.1305 1.0968 0.0361  0.0079  -0.0550 178  TYR A CE2 
321  C CZ  . TYR A 52  ? 1.1374 1.1473 1.1105 0.0377  0.0109  -0.0515 178  TYR A CZ  
322  O OH  . TYR A 52  ? 1.1928 1.2100 1.1659 0.0414  0.0118  -0.0513 178  TYR A OH  
323  N N   . ILE A 53  ? 0.6781 0.6537 0.6496 0.0205  0.0076  -0.0486 179  ILE A N   
324  C CA  . ILE A 53  ? 0.7594 0.7293 0.7316 0.0169  0.0078  -0.0472 179  ILE A CA  
325  C C   . ILE A 53  ? 0.6785 0.6409 0.6427 0.0161  0.0088  -0.0434 179  ILE A C   
326  O O   . ILE A 53  ? 0.6512 0.6080 0.6136 0.0136  0.0102  -0.0412 179  ILE A O   
327  C CB  . ILE A 53  ? 0.6734 0.6455 0.6505 0.0161  0.0056  -0.0496 179  ILE A CB  
328  C CG1 . ILE A 53  ? 0.5437 0.5227 0.5290 0.0166  0.0046  -0.0538 179  ILE A CG1 
329  C CG2 . ILE A 53  ? 0.6002 0.5665 0.5777 0.0126  0.0060  -0.0477 179  ILE A CG2 
330  C CD1 . ILE A 53  ? 0.4899 0.4716 0.4797 0.0164  0.0023  -0.0568 179  ILE A CD1 
331  N N   . HIS A 54  ? 0.6419 0.6042 0.6013 0.0182  0.0079  -0.0423 180  HIS A N   
332  C CA  . HIS A 54  ? 0.6520 0.6074 0.6039 0.0174  0.0086  -0.0387 180  HIS A CA  
333  C C   . HIS A 54  ? 0.6968 0.6483 0.6445 0.0172  0.0111  -0.0371 180  HIS A C   
334  O O   . HIS A 54  ? 0.7491 0.6937 0.6920 0.0151  0.0119  -0.0346 180  HIS A O   
335  C CB  . HIS A 54  ? 0.6859 0.6428 0.6344 0.0203  0.0075  -0.0378 180  HIS A CB  
336  C CG  . HIS A 54  ? 0.8641 0.8232 0.8149 0.0207  0.0052  -0.0383 180  HIS A CG  
337  N ND1 . HIS A 54  ? 1.0049 0.9660 0.9614 0.0191  0.0042  -0.0405 180  HIS A ND1 
338  C CD2 . HIS A 54  ? 0.7565 0.7160 0.7049 0.0226  0.0038  -0.0368 180  HIS A CD2 
339  C CE1 . HIS A 54  ? 0.9349 0.8973 0.8919 0.0200  0.0024  -0.0404 180  HIS A CE1 
340  N NE2 . HIS A 54  ? 0.9201 0.8817 0.8723 0.0223  0.0021  -0.0380 180  HIS A NE2 
341  N N   . LEU A 55  ? 0.6512 0.6071 0.6004 0.0196  0.0123  -0.0384 181  LEU A N   
342  C CA  . LEU A 55  ? 0.7539 0.7060 0.6987 0.0199  0.0150  -0.0366 181  LEU A CA  
343  C C   . LEU A 55  ? 0.8116 0.7600 0.7577 0.0171  0.0163  -0.0360 181  LEU A C   
344  O O   . LEU A 55  ? 0.7641 0.7060 0.7046 0.0162  0.0181  -0.0337 181  LEU A O   
345  C CB  . LEU A 55  ? 0.7512 0.7096 0.6980 0.0231  0.0162  -0.0378 181  LEU A CB  
346  C CG  . LEU A 55  ? 0.7809 0.7422 0.7248 0.0264  0.0158  -0.0374 181  LEU A CG  
347  C CD1 . LEU A 55  ? 0.9049 0.8745 0.8525 0.0295  0.0166  -0.0390 181  LEU A CD1 
348  C CD2 . LEU A 55  ? 0.6797 0.6338 0.6155 0.0266  0.0175  -0.0344 181  LEU A CD2 
349  N N   . ASN A 56  ? 0.8379 0.7903 0.7917 0.0159  0.0155  -0.0380 182  ASN A N   
350  C CA  . ASN A 56  ? 0.7917 0.7409 0.7476 0.0134  0.0169  -0.0370 182  ASN A CA  
351  C C   . ASN A 56  ? 0.8152 0.7575 0.7667 0.0107  0.0166  -0.0348 182  ASN A C   
352  O O   . ASN A 56  ? 0.9503 0.8873 0.8982 0.0095  0.0183  -0.0326 182  ASN A O   
353  C CB  . ASN A 56  ? 0.7752 0.7302 0.7410 0.0126  0.0161  -0.0396 182  ASN A CB  
354  C CG  . ASN A 56  ? 0.7663 0.7276 0.7366 0.0149  0.0167  -0.0413 182  ASN A CG  
355  O OD1 . ASN A 56  ? 0.5895 0.5511 0.5629 0.0146  0.0185  -0.0406 182  ASN A OD1 
356  N ND2 . ASN A 56  ? 0.7875 0.7542 0.7581 0.0172  0.0153  -0.0432 182  ASN A ND2 
357  N N   . LEU A 57  ? 0.7345 0.6770 0.6860 0.0100  0.0144  -0.0351 183  LEU A N   
358  C CA  . LEU A 57  ? 0.7063 0.6427 0.6536 0.0074  0.0139  -0.0325 183  LEU A CA  
359  C C   . LEU A 57  ? 0.7662 0.6961 0.7042 0.0076  0.0149  -0.0300 183  LEU A C   
360  O O   . LEU A 57  ? 0.8258 0.7500 0.7597 0.0055  0.0158  -0.0279 183  LEU A O   
361  C CB  . LEU A 57  ? 0.6673 0.6053 0.6161 0.0071  0.0115  -0.0329 183  LEU A CB  
362  C CG  . LEU A 57  ? 0.6739 0.6071 0.6200 0.0044  0.0107  -0.0302 183  LEU A CG  
363  C CD1 . LEU A 57  ? 0.5279 0.4612 0.4796 0.0017  0.0114  -0.0301 183  LEU A CD1 
364  C CD2 . LEU A 57  ? 0.5522 0.4870 0.4981 0.0053  0.0084  -0.0301 183  LEU A CD2 
365  N N   . PHE A 58  ? 0.8323 0.7631 0.7668 0.0102  0.0147  -0.0303 184  PHE A N   
366  C CA  . PHE A 58  ? 0.7656 0.6904 0.6917 0.0106  0.0157  -0.0282 184  PHE A CA  
367  C C   . PHE A 58  ? 0.9062 0.8273 0.8294 0.0103  0.0184  -0.0275 184  PHE A C   
368  O O   . PHE A 58  ? 1.0275 0.9415 0.9437 0.0090  0.0191  -0.0255 184  PHE A O   
369  C CB  . PHE A 58  ? 0.7831 0.7108 0.7076 0.0139  0.0158  -0.0287 184  PHE A CB  
370  C CG  . PHE A 58  ? 0.8630 0.7939 0.7892 0.0149  0.0134  -0.0289 184  PHE A CG  
371  C CD1 . PHE A 58  ? 0.8684 0.7972 0.7949 0.0126  0.0114  -0.0278 184  PHE A CD1 
372  C CD2 . PHE A 58  ? 0.8556 0.7918 0.7830 0.0184  0.0133  -0.0298 184  PHE A CD2 
373  C CE1 . PHE A 58  ? 0.8547 0.7864 0.7826 0.0139  0.0093  -0.0276 184  PHE A CE1 
374  C CE2 . PHE A 58  ? 0.8016 0.7409 0.7304 0.0198  0.0112  -0.0298 184  PHE A CE2 
375  C CZ  . PHE A 58  ? 0.8435 0.7805 0.7725 0.0176  0.0093  -0.0286 184  PHE A CZ  
376  N N   . ALA A 59  ? 0.9813 0.9069 0.9095 0.0117  0.0199  -0.0289 185  ALA A N   
377  C CA  . ALA A 59  ? 0.8441 0.7666 0.7698 0.0119  0.0227  -0.0278 185  ALA A CA  
378  C C   . ALA A 59  ? 0.8021 0.7204 0.7274 0.0091  0.0230  -0.0264 185  ALA A C   
379  O O   . ALA A 59  ? 0.9110 0.8235 0.8302 0.0089  0.0248  -0.0246 185  ALA A O   
380  C CB  . ALA A 59  ? 0.7320 0.6611 0.6644 0.0139  0.0240  -0.0293 185  ALA A CB  
381  N N   . SER A 60  ? 0.7466 0.6679 0.6784 0.0072  0.0215  -0.0270 186  SER A N   
382  C CA  . SER A 60  ? 0.8219 0.7396 0.7534 0.0046  0.0220  -0.0253 186  SER A CA  
383  C C   . SER A 60  ? 0.8289 0.7394 0.7512 0.0030  0.0213  -0.0232 186  SER A C   
384  O O   . SER A 60  ? 0.8632 0.7686 0.7806 0.0021  0.0226  -0.0214 186  SER A O   
385  C CB  . SER A 60  ? 0.7550 0.6771 0.6952 0.0028  0.0207  -0.0262 186  SER A CB  
386  O OG  . SER A 60  ? 0.7375 0.6607 0.6779 0.0021  0.0181  -0.0268 186  SER A OG  
387  N N   . PHE A 61  ? 0.7074 0.6173 0.6271 0.0029  0.0191  -0.0233 187  PHE A N   
388  C CA  . PHE A 61  ? 0.8417 0.7448 0.7532 0.0012  0.0181  -0.0213 187  PHE A CA  
389  C C   . PHE A 61  ? 0.8978 0.7952 0.8008 0.0025  0.0198  -0.0207 187  PHE A C   
390  O O   . PHE A 61  ? 1.1025 0.9935 0.9987 0.0009  0.0200  -0.0191 187  PHE A O   
391  C CB  . PHE A 61  ? 0.7843 0.6884 0.6958 0.0009  0.0155  -0.0211 187  PHE A CB  
392  C CG  . PHE A 61  ? 0.6627 0.5692 0.5794 -0.0014 0.0138  -0.0205 187  PHE A CG  
393  C CD1 . PHE A 61  ? 0.7133 0.6155 0.6268 -0.0044 0.0131  -0.0180 187  PHE A CD1 
394  C CD2 . PHE A 61  ? 0.6709 0.5839 0.5956 -0.0005 0.0131  -0.0223 187  PHE A CD2 
395  C CE1 . PHE A 61  ? 0.6684 0.5728 0.5868 -0.0064 0.0120  -0.0170 187  PHE A CE1 
396  C CE2 . PHE A 61  ? 0.7252 0.6400 0.6546 -0.0024 0.0120  -0.0217 187  PHE A CE2 
397  C CZ  . PHE A 61  ? 0.6733 0.5839 0.5996 -0.0054 0.0116  -0.0189 187  PHE A CZ  
398  N N   . ILE A 62  ? 0.8217 0.7213 0.7250 0.0055  0.0211  -0.0219 188  ILE A N   
399  C CA  . ILE A 62  ? 0.9039 0.7982 0.7995 0.0070  0.0231  -0.0214 188  ILE A CA  
400  C C   . ILE A 62  ? 0.8789 0.7698 0.7719 0.0068  0.0255  -0.0205 188  ILE A C   
401  O O   . ILE A 62  ? 0.7863 0.6700 0.6708 0.0064  0.0265  -0.0194 188  ILE A O   
402  C CB  . ILE A 62  ? 0.9327 0.8314 0.8303 0.0105  0.0244  -0.0226 188  ILE A CB  
403  C CG1 . ILE A 62  ? 0.9133 0.8144 0.8117 0.0112  0.0223  -0.0230 188  ILE A CG1 
404  C CG2 . ILE A 62  ? 0.7598 0.6534 0.6504 0.0123  0.0274  -0.0219 188  ILE A CG2 
405  C CD1 . ILE A 62  ? 0.7949 0.7014 0.6958 0.0148  0.0236  -0.0241 188  ILE A CD1 
406  N N   . LEU A 63  ? 0.9553 0.8513 0.8557 0.0072  0.0267  -0.0209 189  LEU A N   
407  C CA  . LEU A 63  ? 0.9979 0.8913 0.8969 0.0073  0.0291  -0.0196 189  LEU A CA  
408  C C   . LEU A 63  ? 0.9118 0.8004 0.8067 0.0045  0.0282  -0.0180 189  LEU A C   
409  O O   . LEU A 63  ? 0.8422 0.7254 0.7307 0.0046  0.0299  -0.0167 189  LEU A O   
410  C CB  . LEU A 63  ? 0.9109 0.8114 0.8201 0.0080  0.0301  -0.0201 189  LEU A CB  
411  C CG  . LEU A 63  ? 0.9616 0.8650 0.8731 0.0111  0.0327  -0.0203 189  LEU A CG  
412  C CD1 . LEU A 63  ? 1.0438 0.9499 0.9548 0.0131  0.0323  -0.0218 189  LEU A CD1 
413  C CD2 . LEU A 63  ? 0.9895 0.8995 0.9118 0.0112  0.0333  -0.0206 189  LEU A CD2 
414  N N   . ARG A 64  ? 0.8553 0.7460 0.7540 0.0020  0.0257  -0.0180 190  ARG A N   
415  C CA  . ARG A 64  ? 0.8624 0.7489 0.7571 -0.0008 0.0247  -0.0163 190  ARG A CA  
416  C C   . ARG A 64  ? 0.8573 0.7359 0.7407 -0.0013 0.0242  -0.0156 190  ARG A C   
417  O O   . ARG A 64  ? 0.8588 0.7323 0.7360 -0.0021 0.0249  -0.0143 190  ARG A O   
418  C CB  . ARG A 64  ? 1.0053 0.8954 0.9055 -0.0032 0.0221  -0.0162 190  ARG A CB  
419  C CG  . ARG A 64  ? 1.0573 0.9444 0.9548 -0.0062 0.0210  -0.0140 190  ARG A CG  
420  C CD  . ARG A 64  ? 0.9980 0.8895 0.9024 -0.0082 0.0190  -0.0136 190  ARG A CD  
421  N NE  . ARG A 64  ? 0.9662 0.8552 0.8682 -0.0112 0.0181  -0.0111 190  ARG A NE  
422  C CZ  . ARG A 64  ? 0.9609 0.8531 0.8682 -0.0132 0.0168  -0.0100 190  ARG A CZ  
423  N NH1 . ARG A 64  ? 0.9209 0.8183 0.8359 -0.0125 0.0162  -0.0114 190  ARG A NH1 
424  N NH2 . ARG A 64  ? 1.0099 0.8999 0.9146 -0.0158 0.0162  -0.0073 190  ARG A NH2 
425  N N   . ALA A 65  ? 0.8129 0.6903 0.6936 -0.0005 0.0229  -0.0165 191  ALA A N   
426  C CA  . ALA A 65  ? 0.8538 0.7234 0.7243 -0.0009 0.0224  -0.0161 191  ALA A CA  
427  C C   . ALA A 65  ? 0.8593 0.7241 0.7232 0.0012  0.0255  -0.0162 191  ALA A C   
428  O O   . ALA A 65  ? 0.9418 0.7993 0.7968 0.0003  0.0255  -0.0155 191  ALA A O   
429  C CB  . ALA A 65  ? 0.9585 0.8287 0.8289 0.0000  0.0209  -0.0169 191  ALA A CB  
430  N N   . LEU A 66  ? 0.9380 0.8067 0.8060 0.0042  0.0280  -0.0169 192  LEU A N   
431  C CA  . LEU A 66  ? 0.9486 0.8130 0.8108 0.0065  0.0313  -0.0165 192  LEU A CA  
432  C C   . LEU A 66  ? 1.0047 0.8661 0.8639 0.0056  0.0323  -0.0151 192  LEU A C   
433  O O   . LEU A 66  ? 1.0421 0.8965 0.8921 0.0063  0.0337  -0.0146 192  LEU A O   
434  C CB  . LEU A 66  ? 1.0725 0.9428 0.9410 0.0096  0.0338  -0.0170 192  LEU A CB  
435  C CG  . LEU A 66  ? 1.2567 1.1301 1.1273 0.0114  0.0336  -0.0182 192  LEU A CG  
436  C CD1 . LEU A 66  ? 1.1278 1.0090 1.0067 0.0139  0.0354  -0.0186 192  LEU A CD1 
437  C CD2 . LEU A 66  ? 1.1133 0.9796 0.9743 0.0129  0.0351  -0.0180 192  LEU A CD2 
438  N N   . CYS A 67  ? 0.8218 0.6885 0.6887 0.0043  0.0317  -0.0144 193  CYS A N   
439  C CA  . CYS A 67  ? 0.8094 0.6742 0.6743 0.0034  0.0327  -0.0127 193  CYS A CA  
440  C C   . CYS A 67  ? 0.9889 0.8468 0.8445 0.0009  0.0306  -0.0122 193  CYS A C   
441  O O   . CYS A 67  ? 1.0835 0.9362 0.9316 0.0013  0.0319  -0.0113 193  CYS A O   
442  C CB  . CYS A 67  ? 0.8814 0.7534 0.7572 0.0021  0.0323  -0.0120 193  CYS A CB  
443  S SG  . CYS A 67  ? 0.9142 0.7940 0.8013 0.0049  0.0348  -0.0124 193  CYS A SG  
444  N N   . VAL A 68  ? 1.0016 0.8597 0.8576 -0.0016 0.0274  -0.0127 194  VAL A N   
445  C CA  . VAL A 68  ? 1.1947 1.0468 1.0427 -0.0044 0.0251  -0.0120 194  VAL A CA  
446  C C   . VAL A 68  ? 1.2954 1.1389 1.1320 -0.0032 0.0258  -0.0128 194  VAL A C   
447  O O   . VAL A 68  ? 1.3847 1.2225 1.2131 -0.0041 0.0258  -0.0123 194  VAL A O   
448  C CB  . VAL A 68  ? 1.1100 0.9641 0.9613 -0.0071 0.0215  -0.0120 194  VAL A CB  
449  C CG1 . VAL A 68  ? 0.9025 0.7501 0.7454 -0.0099 0.0189  -0.0112 194  VAL A CG1 
450  C CG2 . VAL A 68  ? 1.3954 1.2570 1.2569 -0.0084 0.0210  -0.0110 194  VAL A CG2 
451  N N   . PHE A 69  ? 1.2474 1.0901 1.0835 -0.0011 0.0267  -0.0142 195  PHE A N   
452  C CA  . PHE A 69  ? 1.1876 1.0220 1.0133 0.0001  0.0277  -0.0150 195  PHE A CA  
453  C C   . PHE A 69  ? 1.2186 1.0497 1.0391 0.0027  0.0312  -0.0146 195  PHE A C   
454  O O   . PHE A 69  ? 1.1648 0.9878 0.9749 0.0028  0.0316  -0.0149 195  PHE A O   
455  C CB  . PHE A 69  ? 1.1579 0.9930 0.9851 0.0022  0.0284  -0.0161 195  PHE A CB  
456  C CG  . PHE A 69  ? 1.2960 1.1339 1.1275 0.0003  0.0251  -0.0163 195  PHE A CG  
457  C CD1 . PHE A 69  ? 1.2623 1.0958 1.0895 -0.0030 0.0218  -0.0159 195  PHE A CD1 
458  C CD2 . PHE A 69  ? 1.4191 1.2642 1.2591 0.0019  0.0253  -0.0168 195  PHE A CD2 
459  C CE1 . PHE A 69  ? 1.3924 1.2285 1.2238 -0.0044 0.0190  -0.0156 195  PHE A CE1 
460  C CE2 . PHE A 69  ? 1.3196 1.1674 1.1634 0.0006  0.0225  -0.0167 195  PHE A CE2 
461  C CZ  . PHE A 69  ? 1.3138 1.1571 1.1535 -0.0024 0.0194  -0.0159 195  PHE A CZ  
462  N N   . PHE A 70  ? 1.1286 0.9657 0.9562 0.0048  0.0337  -0.0138 196  PHE A N   
463  C CA  . PHE A 70  ? 1.1217 0.9562 0.9452 0.0076  0.0373  -0.0128 196  PHE A CA  
464  C C   . PHE A 70  ? 1.2276 1.0590 1.0459 0.0062  0.0367  -0.0117 196  PHE A C   
465  O O   . PHE A 70  ? 1.4842 1.3087 1.2927 0.0077  0.0383  -0.0115 196  PHE A O   
466  C CB  . PHE A 70  ? 1.1941 1.0366 1.0279 0.0100  0.0398  -0.0119 196  PHE A CB  
467  C CG  . PHE A 70  ? 1.4325 1.2727 1.2629 0.0138  0.0439  -0.0107 196  PHE A CG  
468  C CD1 . PHE A 70  ? 1.4135 1.2534 1.2430 0.0146  0.0455  -0.0088 196  PHE A CD1 
469  C CD2 . PHE A 70  ? 1.4547 1.2937 1.2834 0.0169  0.0465  -0.0109 196  PHE A CD2 
470  C CE1 . PHE A 70  ? 1.3416 1.1796 1.1681 0.0185  0.0495  -0.0072 196  PHE A CE1 
471  C CE2 . PHE A 70  ? 1.3763 1.2133 1.2020 0.0206  0.0505  -0.0093 196  PHE A CE2 
472  C CZ  . PHE A 70  ? 1.3450 1.1814 1.1695 0.0214  0.0520  -0.0074 196  PHE A CZ  
473  N N   . LYS A 71  ? 1.1898 1.0260 1.0143 0.0033  0.0344  -0.0108 197  LYS A N   
474  C CA  . LYS A 71  ? 1.2074 1.0416 1.0275 0.0018  0.0338  -0.0095 197  LYS A CA  
475  C C   . LYS A 71  ? 1.1257 0.9512 0.9338 -0.0002 0.0315  -0.0105 197  LYS A C   
476  O O   . LYS A 71  ? 1.1066 0.9270 0.9061 0.0003  0.0321  -0.0101 197  LYS A O   
477  C CB  . LYS A 71  ? 1.2075 1.0488 1.0370 -0.0011 0.0318  -0.0082 197  LYS A CB  
478  C CG  . LYS A 71  ? 1.2151 1.0556 1.0413 -0.0028 0.0313  -0.0064 197  LYS A CG  
479  C CD  . LYS A 71  ? 1.1777 1.0253 1.0136 -0.0057 0.0294  -0.0049 197  LYS A CD  
480  C CE  . LYS A 71  ? 1.0807 0.9279 0.9132 -0.0076 0.0288  -0.0028 197  LYS A CE  
481  N NZ  . LYS A 71  ? 1.2602 1.1019 1.0840 -0.0109 0.0251  -0.0033 197  LYS A NZ  
482  N N   . ASP A 72  ? 1.1580 0.9816 0.9653 -0.0022 0.0287  -0.0119 198  ASP A N   
483  C CA  . ASP A 72  ? 1.3265 1.1417 1.1230 -0.0043 0.0262  -0.0129 198  ASP A CA  
484  C C   . ASP A 72  ? 1.3869 1.1939 1.1732 -0.0014 0.0287  -0.0143 198  ASP A C   
485  O O   . ASP A 72  ? 1.6625 1.4620 1.4382 -0.0021 0.0280  -0.0149 198  ASP A O   
486  C CB  . ASP A 72  ? 1.4195 1.2350 1.2187 -0.0069 0.0228  -0.0136 198  ASP A CB  
487  C CG  . ASP A 72  ? 1.5709 1.3777 1.3599 -0.0093 0.0201  -0.0146 198  ASP A CG  
488  O OD1 . ASP A 72  ? 1.7592 1.5612 1.5401 -0.0103 0.0195  -0.0145 198  ASP A OD1 
489  O OD2 . ASP A 72  ? 1.7274 1.5323 1.5166 -0.0101 0.0184  -0.0155 198  ASP A OD2 
490  N N   . ALA A 73  ? 1.3034 1.1115 1.0924 0.0019  0.0317  -0.0148 199  ALA A N   
491  C CA  . ALA A 73  ? 1.3363 1.1367 1.1159 0.0048  0.0345  -0.0159 199  ALA A CA  
492  C C   . ALA A 73  ? 1.3878 1.1858 1.1621 0.0076  0.0376  -0.0148 199  ALA A C   
493  O O   . ALA A 73  ? 1.5750 1.3647 1.3386 0.0095  0.0394  -0.0157 199  ALA A O   
494  C CB  . ALA A 73  ? 1.3254 1.1288 1.1104 0.0076  0.0369  -0.0162 199  ALA A CB  
495  N N   . ALA A 74  ? 1.5277 1.3327 1.3091 0.0081  0.0386  -0.0128 200  ALA A N   
496  C CA  . ALA A 74  ? 1.5832 1.3865 1.3599 0.0109  0.0415  -0.0113 200  ALA A CA  
497  C C   . ALA A 74  ? 1.5421 1.3399 1.3092 0.0089  0.0394  -0.0116 200  ALA A C   
498  O O   . ALA A 74  ? 1.6919 1.4865 1.4523 0.0115  0.0417  -0.0106 200  ALA A O   
499  C CB  . ALA A 74  ? 1.4406 1.2534 1.2291 0.0122  0.0433  -0.0089 200  ALA A CB  
500  N N   . LEU A 75  ? 1.5031 1.3001 1.2694 0.0045  0.0350  -0.0126 201  LEU A N   
501  C CA  . LEU A 75  ? 1.7072 1.4989 1.4638 0.0023  0.0326  -0.0129 201  LEU A CA  
502  C C   . LEU A 75  ? 1.9077 1.6883 1.6503 0.0039  0.0334  -0.0151 201  LEU A C   
503  O O   . LEU A 75  ? 2.0332 1.8090 1.7662 0.0042  0.0332  -0.0152 201  LEU A O   
504  C CB  . LEU A 75  ? 1.8026 1.5959 1.5619 -0.0028 0.0277  -0.0132 201  LEU A CB  
505  C CG  . LEU A 75  ? 1.8771 1.6807 1.6495 -0.0047 0.0267  -0.0111 201  LEU A CG  
506  C CD1 . LEU A 75  ? 1.9391 1.7431 1.7129 -0.0096 0.0220  -0.0112 201  LEU A CD1 
507  C CD2 . LEU A 75  ? 1.6251 1.4336 1.4001 -0.0037 0.0285  -0.0086 201  LEU A CD2 
508  N N   . LYS A 76  ? 1.9221 1.6985 1.6631 0.0050  0.0344  -0.0167 202  LYS A N   
509  C CA  . LYS A 76  ? 1.8791 1.6448 1.6074 0.0070  0.0359  -0.0188 202  LYS A CA  
510  C C   . LYS A 76  ? 1.8523 1.6177 1.5784 0.0124  0.0411  -0.0174 202  LYS A C   
511  O O   . LYS A 76  ? 1.4054 1.1751 1.1386 0.0151  0.0442  -0.0162 202  LYS A O   
512  C CB  . LYS A 76  ? 2.0103 1.7725 1.7389 0.0063  0.0353  -0.0206 202  LYS A CB  
513  C CG  . LYS A 76  ? 2.1085 1.8590 1.8243 0.0078  0.0366  -0.0229 202  LYS A CG  
514  C CD  . LYS A 76  ? 1.8565 1.6035 1.5729 0.0060  0.0349  -0.0247 202  LYS A CD  
515  C CE  . LYS A 76  ? 1.7350 1.4699 1.4389 0.0075  0.0365  -0.0271 202  LYS A CE  
516  N NZ  . LYS A 76  ? 1.6127 1.3432 1.3163 0.0047  0.0338  -0.0289 202  LYS A NZ  
517  N N   . TRP A 77  ? 2.1821 1.9424 1.8983 0.0139  0.0420  -0.0173 203  TRP A N   
518  C CA  . TRP A 77  ? 2.1444 1.9041 1.8575 0.0193  0.0469  -0.0154 203  TRP A CA  
519  C C   . TRP A 77  ? 1.9415 1.7125 1.6677 0.0207  0.0487  -0.0120 203  TRP A C   
520  O O   . TRP A 77  ? 1.5805 1.3565 1.3100 0.0192  0.0472  -0.0105 203  TRP A O   
521  C CB  . TRP A 77  ? 2.1399 1.8940 1.8489 0.0229  0.0508  -0.0161 203  TRP A CB  
522  N N   . LEU A 85  ? 2.2374 2.0288 1.9618 0.0413  0.0640  0.0076  218  LEU A N   
523  C CA  . LEU A 85  ? 2.1961 1.9986 1.9369 0.0383  0.0628  0.0095  218  LEU A CA  
524  C C   . LEU A 85  ? 2.0506 1.8531 1.7947 0.0320  0.0581  0.0061  218  LEU A C   
525  O O   . LEU A 85  ? 1.9560 1.7544 1.6991 0.0311  0.0576  0.0037  218  LEU A O   
526  C CB  . LEU A 85  ? 2.2165 2.0257 1.9704 0.0416  0.0668  0.0127  218  LEU A CB  
527  C CG  . LEU A 85  ? 2.2424 2.0530 1.9958 0.0482  0.0718  0.0170  218  LEU A CG  
528  C CD1 . LEU A 85  ? 1.8977 1.7143 1.6643 0.0510  0.0752  0.0198  218  LEU A CD1 
529  C CD2 . LEU A 85  ? 2.2361 2.0529 1.9925 0.0486  0.0719  0.0199  218  LEU A CD2 
530  N N   . SER A 86  ? 2.0115 1.8190 1.7598 0.0278  0.0548  0.0064  219  SER A N   
531  C CA  . SER A 86  ? 2.0853 1.8936 1.8376 0.0220  0.0504  0.0038  219  SER A CA  
532  C C   . SER A 86  ? 2.2857 2.1008 2.0527 0.0214  0.0512  0.0044  219  SER A C   
533  O O   . SER A 86  ? 2.5062 2.3271 2.2825 0.0246  0.0547  0.0071  219  SER A O   
534  C CB  . SER A 86  ? 1.9888 1.8015 1.7428 0.0180  0.0472  0.0047  219  SER A CB  
535  O OG  . SER A 86  ? 1.9362 1.7495 1.6938 0.0125  0.0430  0.0027  219  SER A OG  
536  N N   . TYR A 87  ? 2.2270 2.0412 1.9961 0.0171  0.0478  0.0018  220  TYR A N   
537  C CA  . TYR A 87  ? 1.9957 1.8158 1.7777 0.0164  0.0481  0.0017  220  TYR A CA  
538  C C   . TYR A 87  ? 1.9977 1.8283 1.7940 0.0152  0.0483  0.0044  220  TYR A C   
539  O O   . TYR A 87  ? 2.1967 2.0333 2.0046 0.0163  0.0500  0.0053  220  TYR A O   
540  C CB  . TYR A 87  ? 2.0118 1.8286 1.7922 0.0124  0.0443  -0.0015 220  TYR A CB  
541  C CG  . TYR A 87  ? 2.0076 1.8306 1.8005 0.0115  0.0441  -0.0019 220  TYR A CG  
542  C CD1 . TYR A 87  ? 2.0154 1.8392 1.8120 0.0148  0.0471  -0.0019 220  TYR A CD1 
543  C CD2 . TYR A 87  ? 1.9371 1.7652 1.7379 0.0073  0.0408  -0.0022 220  TYR A CD2 
544  C CE1 . TYR A 87  ? 2.1036 1.9334 1.9113 0.0140  0.0467  -0.0024 220  TYR A CE1 
545  C CE2 . TYR A 87  ? 1.9556 1.7893 1.7673 0.0066  0.0405  -0.0028 220  TYR A CE2 
546  C CZ  . TYR A 87  ? 2.0255 1.8601 1.8406 0.0099  0.0434  -0.0030 220  TYR A CZ  
547  O OH  . TYR A 87  ? 1.9281 1.7685 1.7537 0.0093  0.0429  -0.0038 220  TYR A OH  
548  N N   . GLN A 88  ? 1.7757 1.6086 1.5714 0.0129  0.0466  0.0057  221  GLN A N   
549  C CA  . GLN A 88  ? 1.7387 1.5814 1.5480 0.0117  0.0471  0.0084  221  GLN A CA  
550  C C   . GLN A 88  ? 1.7474 1.5952 1.5636 0.0163  0.0517  0.0117  221  GLN A C   
551  O O   . GLN A 88  ? 1.5172 1.3732 1.3472 0.0159  0.0528  0.0136  221  GLN A O   
552  C CB  . GLN A 88  ? 1.8176 1.6616 1.6240 0.0083  0.0445  0.0094  221  GLN A CB  
553  N N   . ASP A 89  ? 1.9543 1.7972 1.7614 0.0207  0.0544  0.0125  222  ASP A N   
554  C CA  . ASP A 89  ? 1.8664 1.7139 1.6797 0.0255  0.0589  0.0162  222  ASP A CA  
555  C C   . ASP A 89  ? 1.8321 1.6803 1.6515 0.0285  0.0616  0.0163  222  ASP A C   
556  O O   . ASP A 89  ? 1.8788 1.7328 1.7079 0.0317  0.0650  0.0196  222  ASP A O   
557  C CB  . ASP A 89  ? 1.9038 1.7462 1.7045 0.0293  0.0609  0.0177  222  ASP A CB  
558  C CG  . ASP A 89  ? 2.0302 1.8722 1.8241 0.0266  0.0582  0.0176  222  ASP A CG  
559  O OD1 . ASP A 89  ? 2.1547 2.0027 1.9570 0.0225  0.0561  0.0182  222  ASP A OD1 
560  O OD2 . ASP A 89  ? 2.1984 2.0339 1.9785 0.0284  0.0583  0.0171  222  ASP A OD2 
561  N N   . SER A 90  ? 1.8843 1.7269 1.6985 0.0276  0.0602  0.0131  223  SER A N   
562  C CA  . SER A 90  ? 1.9136 1.7568 1.7327 0.0305  0.0627  0.0132  223  SER A CA  
563  C C   . SER A 90  ? 1.7165 1.5691 1.5527 0.0289  0.0625  0.0138  223  SER A C   
564  O O   . SER A 90  ? 1.5942 1.4517 1.4376 0.0250  0.0600  0.0134  223  SER A O   
565  C CB  . SER A 90  ? 1.9753 1.8108 1.7849 0.0297  0.0612  0.0096  223  SER A CB  
566  O OG  . SER A 90  ? 1.8820 1.7187 1.6948 0.0247  0.0572  0.0068  223  SER A OG  
567  N N   . LEU A 91  ? 1.6069 1.4619 1.4496 0.0319  0.0652  0.0150  224  LEU A N   
568  C CA  . LEU A 91  ? 1.5499 1.4131 1.4083 0.0306  0.0649  0.0151  224  LEU A CA  
569  C C   . LEU A 91  ? 1.6388 1.5012 1.4978 0.0278  0.0621  0.0113  224  LEU A C   
570  O O   . LEU A 91  ? 1.7429 1.6117 1.6133 0.0251  0.0603  0.0103  224  LEU A O   
571  C CB  . LEU A 91  ? 1.4808 1.3479 1.3470 0.0352  0.0690  0.0184  224  LEU A CB  
572  C CG  . LEU A 91  ? 1.6070 1.4833 1.4906 0.0343  0.0691  0.0190  224  LEU A CG  
573  C CD1 . LEU A 91  ? 1.5976 1.4796 1.4909 0.0375  0.0725  0.0236  224  LEU A CD1 
574  C CD2 . LEU A 91  ? 1.6373 1.5136 1.5230 0.0352  0.0694  0.0175  224  LEU A CD2 
575  N N   . ALA A 92  ? 1.5513 1.4060 1.3984 0.0284  0.0618  0.0092  225  ALA A N   
576  C CA  . ALA A 92  ? 1.4814 1.3353 1.3285 0.0260  0.0592  0.0059  225  ALA A CA  
577  C C   . ALA A 92  ? 1.3902 1.2459 1.2397 0.0210  0.0550  0.0038  225  ALA A C   
578  O O   . ALA A 92  ? 1.5174 1.3772 1.3743 0.0188  0.0530  0.0019  225  ALA A O   
579  C CB  . ALA A 92  ? 1.6955 1.5400 1.5284 0.0274  0.0597  0.0043  225  ALA A CB  
580  N N   . CYS A 93  ? 1.2909 1.1439 1.1343 0.0193  0.0537  0.0043  226  CYS A N   
581  C CA  . CYS A 93  ? 1.2455 1.1005 1.0914 0.0147  0.0499  0.0030  226  CYS A CA  
582  C C   . CYS A 93  ? 1.2364 1.1008 1.0977 0.0133  0.0498  0.0041  226  CYS A C   
583  O O   . CYS A 93  ? 1.0102 0.8776 0.8771 0.0102  0.0470  0.0023  226  CYS A O   
584  C CB  . CYS A 93  ? 1.1774 1.0286 1.0144 0.0135  0.0489  0.0040  226  CYS A CB  
585  S SG  . CYS A 93  ? 1.1357 0.9899 0.9760 0.0079  0.0447  0.0036  226  CYS A SG  
586  N N   . ARG A 94  ? 1.3474 1.2165 1.2159 0.0157  0.0528  0.0070  227  ARG A N   
587  C CA  . ARG A 94  ? 1.2577 1.1355 1.1415 0.0145  0.0529  0.0080  227  ARG A CA  
588  C C   . ARG A 94  ? 1.1407 1.0221 1.0329 0.0145  0.0524  0.0060  227  ARG A C   
589  O O   . ARG A 94  ? 1.1137 1.0005 1.0157 0.0119  0.0506  0.0048  227  ARG A O   
590  C CB  . ARG A 94  ? 1.3432 1.2249 1.2330 0.0175  0.0565  0.0118  227  ARG A CB  
591  C CG  . ARG A 94  ? 1.3597 1.2374 1.2393 0.0184  0.0574  0.0139  227  ARG A CG  
592  C CD  . ARG A 94  ? 1.5350 1.4166 1.4201 0.0221  0.0613  0.0181  227  ARG A CD  
593  N NE  . ARG A 94  ? 1.7023 1.5792 1.5755 0.0239  0.0623  0.0198  227  ARG A NE  
594  C CZ  . ARG A 94  ? 1.6848 1.5629 1.5560 0.0219  0.0612  0.0209  227  ARG A CZ  
595  N NH1 . ARG A 94  ? 1.8679 1.7514 1.7483 0.0180  0.0593  0.0207  227  ARG A NH1 
596  N NH2 . ARG A 94  ? 1.8548 1.7285 1.7145 0.0238  0.0621  0.0222  227  ARG A NH2 
597  N N   . LEU A 95  ? 1.0675 0.9460 0.9555 0.0174  0.0540  0.0054  228  LEU A N   
598  C CA  . LEU A 95  ? 1.0383 0.9206 0.9336 0.0175  0.0533  0.0034  228  LEU A CA  
599  C C   . LEU A 95  ? 1.0770 0.9577 0.9692 0.0142  0.0496  0.0001  228  LEU A C   
600  O O   . LEU A 95  ? 1.3529 1.2390 1.2542 0.0127  0.0479  -0.0016 228  LEU A O   
601  C CB  . LEU A 95  ? 1.1804 1.0600 1.0715 0.0214  0.0562  0.0042  228  LEU A CB  
602  C CG  . LEU A 95  ? 1.2880 1.1706 1.1850 0.0250  0.0600  0.0078  228  LEU A CG  
603  C CD1 . LEU A 95  ? 1.4147 1.2945 1.3071 0.0289  0.0626  0.0086  228  LEU A CD1 
604  C CD2 . LEU A 95  ? 1.1946 1.0863 1.1082 0.0241  0.0598  0.0084  228  LEU A CD2 
605  N N   . VAL A 96  ? 1.0014 0.8748 0.8810 0.0134  0.0483  -0.0009 229  VAL A N   
606  C CA  . VAL A 96  ? 0.9712 0.8431 0.8481 0.0105  0.0448  -0.0037 229  VAL A CA  
607  C C   . VAL A 96  ? 0.9396 0.8160 0.8236 0.0069  0.0422  -0.0038 229  VAL A C   
608  O O   . VAL A 96  ? 1.0549 0.9343 0.9437 0.0051  0.0398  -0.0057 229  VAL A O   
609  C CB  . VAL A 96  ? 1.0259 0.8887 0.8882 0.0103  0.0440  -0.0045 229  VAL A CB  
610  C CG1 . VAL A 96  ? 0.9990 0.8605 0.8593 0.0073  0.0403  -0.0068 229  VAL A CG1 
611  C CG2 . VAL A 96  ? 1.0179 0.8763 0.8736 0.0140  0.0468  -0.0045 229  VAL A CG2 
612  N N   . PHE A 97  ? 0.9309 0.8081 0.8159 0.0061  0.0429  -0.0016 230  PHE A N   
613  C CA  . PHE A 97  ? 0.9888 0.8704 0.8809 0.0028  0.0409  -0.0012 230  PHE A CA  
614  C C   . PHE A 97  ? 1.0520 0.9416 0.9586 0.0028  0.0414  -0.0015 230  PHE A C   
615  O O   . PHE A 97  ? 1.0170 0.9099 0.9294 0.0003  0.0392  -0.0028 230  PHE A O   
616  C CB  . PHE A 97  ? 0.9018 0.7828 0.7914 0.0024  0.0420  0.0017  230  PHE A CB  
617  C CG  . PHE A 97  ? 0.8469 0.7323 0.7431 -0.0010 0.0404  0.0027  230  PHE A CG  
618  C CD1 . PHE A 97  ? 0.8607 0.7448 0.7546 -0.0042 0.0370  0.0013  230  PHE A CD1 
619  C CD2 . PHE A 97  ? 0.8854 0.7760 0.7901 -0.0006 0.0426  0.0054  230  PHE A CD2 
620  C CE1 . PHE A 97  ? 0.9385 0.8265 0.8384 -0.0071 0.0358  0.0027  230  PHE A CE1 
621  C CE2 . PHE A 97  ? 0.9936 0.8882 0.9045 -0.0036 0.0415  0.0066  230  PHE A CE2 
622  C CZ  . PHE A 97  ? 0.9478 0.8410 0.8561 -0.0069 0.0382  0.0053  230  PHE A CZ  
623  N N   . LEU A 98  ? 1.0807 0.9733 0.9933 0.0058  0.0443  -0.0005 231  LEU A N   
624  C CA  . LEU A 98  ? 1.0423 0.9422 0.9687 0.0058  0.0446  -0.0011 231  LEU A CA  
625  C C   . LEU A 98  ? 0.9930 0.8941 0.9208 0.0053  0.0424  -0.0045 231  LEU A C   
626  O O   . LEU A 98  ? 0.8016 0.7077 0.7383 0.0036  0.0408  -0.0061 231  LEU A O   
627  C CB  . LEU A 98  ? 0.9757 0.8783 0.9078 0.0091  0.0481  0.0010  231  LEU A CB  
628  C CG  . LEU A 98  ? 1.0489 0.9593 0.9965 0.0091  0.0486  0.0007  231  LEU A CG  
629  C CD1 . LEU A 98  ? 0.9757 0.8901 0.9317 0.0066  0.0483  0.0017  231  LEU A CD1 
630  C CD2 . LEU A 98  ? 1.0013 0.9137 0.9537 0.0127  0.0520  0.0031  231  LEU A CD2 
631  N N   . LEU A 99  ? 0.8663 0.7630 0.7854 0.0070  0.0425  -0.0055 232  LEU A N   
632  C CA  . LEU A 99  ? 0.8531 0.7511 0.7729 0.0070  0.0406  -0.0084 232  LEU A CA  
633  C C   . LEU A 99  ? 0.8691 0.7666 0.7872 0.0039  0.0372  -0.0100 232  LEU A C   
634  O O   . LEU A 99  ? 0.7301 0.6318 0.6543 0.0031  0.0354  -0.0121 232  LEU A O   
635  C CB  . LEU A 99  ? 0.8836 0.7766 0.7938 0.0095  0.0419  -0.0087 232  LEU A CB  
636  C CG  . LEU A 99  ? 1.0008 0.8961 0.9124 0.0101  0.0406  -0.0112 232  LEU A CG  
637  C CD1 . LEU A 99  ? 0.9133 0.8164 0.8372 0.0111  0.0411  -0.0119 232  LEU A CD1 
638  C CD2 . LEU A 99  ? 0.9437 0.8333 0.8451 0.0126  0.0421  -0.0112 232  LEU A CD2 
639  N N   . MET A 100 ? 0.8151 0.7074 0.7250 0.0021  0.0363  -0.0089 233  MET A N   
640  C CA  . MET A 100 ? 0.8381 0.7298 0.7466 -0.0009 0.0331  -0.0097 233  MET A CA  
641  C C   . MET A 100 ? 0.8279 0.7259 0.7476 -0.0028 0.0323  -0.0096 233  MET A C   
642  O O   . MET A 100 ? 0.8427 0.7431 0.7658 -0.0042 0.0300  -0.0111 233  MET A O   
643  C CB  . MET A 100 ? 0.7801 0.6653 0.6781 -0.0025 0.0323  -0.0082 233  MET A CB  
644  C CG  . MET A 100 ? 0.8171 0.7023 0.7147 -0.0058 0.0291  -0.0082 233  MET A CG  
645  S SD  . MET A 100 ? 1.1882 1.0654 1.0727 -0.0069 0.0266  -0.0087 233  MET A SD  
646  C CE  . MET A 100 ? 1.0355 0.9153 0.9241 -0.0102 0.0232  -0.0083 233  MET A CE  
647  N N   . GLN A 101 ? 0.8437 0.7441 0.7688 -0.0028 0.0344  -0.0075 234  GLN A N   
648  C CA  . GLN A 101 ? 0.8462 0.7525 0.7828 -0.0045 0.0342  -0.0073 234  GLN A CA  
649  C C   . GLN A 101 ? 0.7712 0.6828 0.7169 -0.0037 0.0336  -0.0100 234  GLN A C   
650  O O   . GLN A 101 ? 0.7084 0.6232 0.6600 -0.0054 0.0317  -0.0114 234  GLN A O   
651  C CB  . GLN A 101 ? 1.0275 0.9359 0.9692 -0.0039 0.0371  -0.0044 234  GLN A CB  
652  C CG  . GLN A 101 ? 1.1927 1.1057 1.1439 -0.0062 0.0372  -0.0032 234  GLN A CG  
653  C CD  . GLN A 101 ? 1.2259 1.1370 1.1727 -0.0092 0.0347  -0.0029 234  GLN A CD  
654  O OE1 . GLN A 101 ? 1.2177 1.1301 1.1669 -0.0104 0.0324  -0.0049 234  GLN A OE1 
655  N NE2 . GLN A 101 ? 0.9016 0.8098 0.8420 -0.0103 0.0350  -0.0001 234  GLN A NE2 
656  N N   . TYR A 102 ? 0.5747 0.4871 0.5214 -0.0010 0.0350  -0.0109 235  TYR A N   
657  C CA  . TYR A 102 ? 0.5794 0.4969 0.5339 -0.0001 0.0342  -0.0136 235  TYR A CA  
658  C C   . TYR A 102 ? 0.7047 0.6216 0.6553 -0.0009 0.0312  -0.0161 235  TYR A C   
659  O O   . TYR A 102 ? 0.6946 0.6160 0.6524 -0.0016 0.0296  -0.0183 235  TYR A O   
660  C CB  . TYR A 102 ? 0.5894 0.5074 0.5439 0.0029  0.0363  -0.0136 235  TYR A CB  
661  C CG  . TYR A 102 ? 0.6599 0.5836 0.6223 0.0039  0.0353  -0.0163 235  TYR A CG  
662  C CD1 . TYR A 102 ? 0.7761 0.7058 0.7512 0.0034  0.0356  -0.0169 235  TYR A CD1 
663  C CD2 . TYR A 102 ? 0.5609 0.4842 0.5185 0.0052  0.0341  -0.0183 235  TYR A CD2 
664  C CE1 . TYR A 102 ? 0.7844 0.7196 0.7668 0.0041  0.0345  -0.0197 235  TYR A CE1 
665  C CE2 . TYR A 102 ? 0.6387 0.5679 0.6035 0.0061  0.0332  -0.0208 235  TYR A CE2 
666  C CZ  . TYR A 102 ? 0.7618 0.6969 0.7388 0.0055  0.0332  -0.0216 235  TYR A CZ  
667  O OH  . TYR A 102 ? 0.6791 0.6201 0.6633 0.0063  0.0320  -0.0243 235  TYR A OH  
668  N N   . CYS A 103 ? 0.7057 0.6170 0.6451 -0.0005 0.0306  -0.0158 236  CYS A N   
669  C CA  . CYS A 103 ? 0.7215 0.6323 0.6573 -0.0009 0.0279  -0.0177 236  CYS A CA  
670  C C   . CYS A 103 ? 0.7828 0.6948 0.7215 -0.0036 0.0257  -0.0177 236  CYS A C   
671  O O   . CYS A 103 ? 0.9399 0.8547 0.8814 -0.0036 0.0237  -0.0196 236  CYS A O   
672  C CB  . CYS A 103 ? 0.9587 0.8627 0.8823 -0.0003 0.0278  -0.0170 236  CYS A CB  
673  S SG  . CYS A 103 ? 1.0305 0.9331 0.9501 0.0033  0.0303  -0.0174 236  CYS A SG  
674  N N   . VAL A 104 ? 0.7235 0.6335 0.6614 -0.0056 0.0261  -0.0153 237  VAL A N   
675  C CA  . VAL A 104 ? 0.6536 0.5646 0.5941 -0.0082 0.0243  -0.0146 237  VAL A CA  
676  C C   . VAL A 104 ? 0.7136 0.6311 0.6660 -0.0084 0.0243  -0.0163 237  VAL A C   
677  O O   . VAL A 104 ? 0.8090 0.7286 0.7640 -0.0090 0.0222  -0.0177 237  VAL A O   
678  C CB  . VAL A 104 ? 0.6471 0.5554 0.5846 -0.0102 0.0252  -0.0113 237  VAL A CB  
679  C CG1 . VAL A 104 ? 0.6340 0.5444 0.5762 -0.0128 0.0239  -0.0102 237  VAL A CG1 
680  C CG2 . VAL A 104 ? 0.7170 0.6185 0.6422 -0.0105 0.0244  -0.0101 237  VAL A CG2 
681  N N   . ALA A 105 ? 0.6343 0.5549 0.5942 -0.0077 0.0265  -0.0162 238  ALA A N   
682  C CA  . ALA A 105 ? 0.5726 0.4991 0.5442 -0.0079 0.0264  -0.0182 238  ALA A CA  
683  C C   . ALA A 105 ? 0.5691 0.4985 0.5422 -0.0063 0.0246  -0.0218 238  ALA A C   
684  O O   . ALA A 105 ? 0.4086 0.3417 0.3881 -0.0068 0.0231  -0.0239 238  ALA A O   
685  C CB  . ALA A 105 ? 0.6240 0.5534 0.6037 -0.0072 0.0291  -0.0173 238  ALA A CB  
686  N N   . ALA A 106 ? 0.6047 0.5323 0.5715 -0.0042 0.0247  -0.0224 239  ALA A N   
687  C CA  . ALA A 106 ? 0.7290 0.6598 0.6966 -0.0024 0.0231  -0.0255 239  ALA A CA  
688  C C   . ALA A 106 ? 0.7264 0.6563 0.6901 -0.0030 0.0205  -0.0262 239  ALA A C   
689  O O   . ALA A 106 ? 0.8024 0.7365 0.7705 -0.0023 0.0188  -0.0289 239  ALA A O   
690  C CB  . ALA A 106 ? 0.8217 0.7504 0.7830 0.0000  0.0243  -0.0253 239  ALA A CB  
691  N N   . ASN A 107 ? 0.5945 0.5191 0.5499 -0.0041 0.0200  -0.0239 240  ASN A N   
692  C CA  . ASN A 107 ? 0.6012 0.5250 0.5535 -0.0048 0.0176  -0.0238 240  ASN A CA  
693  C C   . ASN A 107 ? 0.6564 0.5840 0.6168 -0.0061 0.0167  -0.0247 240  ASN A C   
694  O O   . ASN A 107 ? 0.6320 0.5626 0.5946 -0.0052 0.0149  -0.0267 240  ASN A O   
695  C CB  . ASN A 107 ? 0.7836 0.7011 0.7271 -0.0065 0.0172  -0.0207 240  ASN A CB  
696  C CG  . ASN A 107 ? 0.8023 0.7153 0.7372 -0.0053 0.0181  -0.0201 240  ASN A CG  
697  O OD1 . ASN A 107 ? 0.8610 0.7753 0.7953 -0.0029 0.0185  -0.0219 240  ASN A OD1 
698  N ND2 . ASN A 107 ? 0.6557 0.5632 0.5838 -0.0069 0.0184  -0.0176 240  ASN A ND2 
699  N N   . TYR A 108 ? 0.7798 0.7075 0.7449 -0.0081 0.0181  -0.0231 241  TYR A N   
700  C CA  . TYR A 108 ? 0.6848 0.6154 0.6571 -0.0095 0.0175  -0.0236 241  TYR A CA  
701  C C   . TYR A 108 ? 0.6261 0.5623 0.6074 -0.0082 0.0171  -0.0275 241  TYR A C   
702  O O   . TYR A 108 ? 0.6410 0.5796 0.6257 -0.0082 0.0156  -0.0292 241  TYR A O   
703  C CB  . TYR A 108 ? 0.7744 0.7041 0.7499 -0.0119 0.0194  -0.0206 241  TYR A CB  
704  C CG  . TYR A 108 ? 0.9507 0.8756 0.9179 -0.0136 0.0190  -0.0169 241  TYR A CG  
705  C CD1 . TYR A 108 ? 1.1473 1.0715 1.1137 -0.0151 0.0176  -0.0153 241  TYR A CD1 
706  C CD2 . TYR A 108 ? 1.1453 1.0661 1.1052 -0.0137 0.0199  -0.0149 241  TYR A CD2 
707  C CE1 . TYR A 108 ? 1.1150 1.0351 1.0741 -0.0168 0.0169  -0.0118 241  TYR A CE1 
708  C CE2 . TYR A 108 ? 1.2534 1.1698 1.2056 -0.0154 0.0192  -0.0118 241  TYR A CE2 
709  C CZ  . TYR A 108 ? 1.1652 1.0815 1.1173 -0.0171 0.0176  -0.0102 241  TYR A CZ  
710  O OH  . TYR A 108 ? 1.2294 1.1416 1.1741 -0.0190 0.0167  -0.0069 241  TYR A OH  
711  N N   . TYR A 109 ? 0.5254 0.4639 0.5103 -0.0069 0.0183  -0.0290 242  TYR A N   
712  C CA  . TYR A 109 ? 0.6031 0.5472 0.5970 -0.0060 0.0177  -0.0327 242  TYR A CA  
713  C C   . TYR A 109 ? 0.5875 0.5340 0.5788 -0.0036 0.0156  -0.0357 242  TYR A C   
714  O O   . TYR A 109 ? 0.6267 0.5776 0.6238 -0.0030 0.0141  -0.0390 242  TYR A O   
715  C CB  . TYR A 109 ? 0.6358 0.5820 0.6363 -0.0057 0.0198  -0.0328 242  TYR A CB  
716  C CG  . TYR A 109 ? 0.5516 0.4983 0.5600 -0.0078 0.0216  -0.0313 242  TYR A CG  
717  C CD1 . TYR A 109 ? 0.5286 0.4793 0.5475 -0.0086 0.0212  -0.0338 242  TYR A CD1 
718  C CD2 . TYR A 109 ? 0.4366 0.3796 0.4417 -0.0090 0.0236  -0.0272 242  TYR A CD2 
719  C CE1 . TYR A 109 ? 0.5139 0.4651 0.5405 -0.0105 0.0231  -0.0321 242  TYR A CE1 
720  C CE2 . TYR A 109 ? 0.5543 0.4983 0.5669 -0.0107 0.0255  -0.0254 242  TYR A CE2 
721  C CZ  . TYR A 109 ? 0.5311 0.4791 0.5546 -0.0115 0.0254  -0.0278 242  TYR A CZ  
722  O OH  . TYR A 109 ? 0.4232 0.3723 0.4549 -0.0131 0.0275  -0.0258 242  TYR A OH  
723  N N   . TRP A 110 ? 0.6222 0.5663 0.6049 -0.0021 0.0155  -0.0347 243  TRP A N   
724  C CA  . TRP A 110 ? 0.7228 0.6694 0.7027 0.0003  0.0135  -0.0370 243  TRP A CA  
725  C C   . TRP A 110 ? 0.8365 0.7823 0.8141 0.0000  0.0116  -0.0368 243  TRP A C   
726  O O   . TRP A 110 ? 0.8685 0.8181 0.8475 0.0018  0.0098  -0.0393 243  TRP A O   
727  C CB  . TRP A 110 ? 0.8150 0.7591 0.7869 0.0021  0.0143  -0.0358 243  TRP A CB  
728  C CG  . TRP A 110 ? 0.8697 0.8170 0.8449 0.0037  0.0157  -0.0371 243  TRP A CG  
729  C CD1 . TRP A 110 ? 0.7637 0.7086 0.7379 0.0036  0.0181  -0.0351 243  TRP A CD1 
730  C CD2 . TRP A 110 ? 0.8955 0.8492 0.8757 0.0058  0.0147  -0.0403 243  TRP A CD2 
731  N NE1 . TRP A 110 ? 0.8391 0.7884 0.8175 0.0054  0.0188  -0.0367 243  TRP A NE1 
732  C CE2 . TRP A 110 ? 0.8405 0.7953 0.8227 0.0066  0.0167  -0.0399 243  TRP A CE2 
733  C CE3 . TRP A 110 ? 0.9567 0.9154 0.9397 0.0071  0.0124  -0.0434 243  TRP A CE3 
734  C CZ2 . TRP A 110 ? 0.8665 0.8276 0.8538 0.0085  0.0163  -0.0424 243  TRP A CZ2 
735  C CZ3 . TRP A 110 ? 0.8762 0.8411 0.8639 0.0090  0.0120  -0.0462 243  TRP A CZ3 
736  C CH2 . TRP A 110 ? 0.7861 0.7523 0.7761 0.0095  0.0138  -0.0456 243  TRP A CH2 
737  N N   . LEU A 111 ? 0.8695 0.8109 0.8440 -0.0022 0.0119  -0.0336 244  LEU A N   
738  C CA  . LEU A 111 ? 0.7741 0.7152 0.7480 -0.0026 0.0102  -0.0330 244  LEU A CA  
739  C C   . LEU A 111 ? 0.7640 0.7092 0.7469 -0.0031 0.0098  -0.0356 244  LEU A C   
740  O O   . LEU A 111 ? 0.7277 0.6750 0.7114 -0.0019 0.0081  -0.0371 244  LEU A O   
741  C CB  . LEU A 111 ? 0.8708 0.8066 0.8400 -0.0051 0.0107  -0.0287 244  LEU A CB  
742  C CG  . LEU A 111 ? 0.8116 0.7463 0.7791 -0.0057 0.0092  -0.0269 244  LEU A CG  
743  C CD1 . LEU A 111 ? 0.7847 0.7196 0.7468 -0.0032 0.0073  -0.0271 244  LEU A CD1 
744  C CD2 . LEU A 111 ? 0.8943 0.8242 0.8579 -0.0086 0.0099  -0.0224 244  LEU A CD2 
745  N N   . LEU A 112 ? 0.7306 0.6770 0.7205 -0.0046 0.0114  -0.0363 245  LEU A N   
746  C CA  . LEU A 112 ? 0.5285 0.4786 0.5277 -0.0051 0.0112  -0.0391 245  LEU A CA  
747  C C   . LEU A 112 ? 0.5319 0.4871 0.5339 -0.0026 0.0093  -0.0438 245  LEU A C   
748  O O   . LEU A 112 ? 0.5408 0.4983 0.5458 -0.0019 0.0078  -0.0462 245  LEU A O   
749  C CB  . LEU A 112 ? 0.6399 0.5906 0.6467 -0.0069 0.0134  -0.0387 245  LEU A CB  
750  C CG  . LEU A 112 ? 0.5865 0.5409 0.6039 -0.0076 0.0133  -0.0420 245  LEU A CG  
751  C CD1 . LEU A 112 ? 0.5643 0.5177 0.5817 -0.0083 0.0125  -0.0416 245  LEU A CD1 
752  C CD2 . LEU A 112 ? 0.5507 0.5056 0.5763 -0.0095 0.0158  -0.0409 245  LEU A CD2 
753  N N   . VAL A 113 ? 0.5638 0.5209 0.5647 -0.0010 0.0094  -0.0450 246  VAL A N   
754  C CA  . VAL A 113 ? 0.6975 0.6601 0.7010 0.0015  0.0076  -0.0492 246  VAL A CA  
755  C C   . VAL A 113 ? 0.6714 0.6344 0.6682 0.0038  0.0057  -0.0494 246  VAL A C   
756  O O   . VAL A 113 ? 0.5469 0.5143 0.5460 0.0058  0.0038  -0.0528 246  VAL A O   
757  C CB  . VAL A 113 ? 0.6929 0.6580 0.6975 0.0027  0.0084  -0.0501 246  VAL A CB  
758  C CG1 . VAL A 113 ? 0.7521 0.7162 0.7625 0.0006  0.0106  -0.0488 246  VAL A CG1 
759  C CG2 . VAL A 113 ? 0.7020 0.6649 0.6973 0.0044  0.0088  -0.0478 246  VAL A CG2 
760  N N   . GLU A 114 ? 0.7433 0.7017 0.7320 0.0038  0.0061  -0.0456 247  GLU A N   
761  C CA  . GLU A 114 ? 0.7505 0.7089 0.7336 0.0060  0.0044  -0.0451 247  GLU A CA  
762  C C   . GLU A 114 ? 0.7666 0.7261 0.7530 0.0059  0.0031  -0.0462 247  GLU A C   
763  O O   . GLU A 114 ? 0.7591 0.7226 0.7458 0.0085  0.0014  -0.0487 247  GLU A O   
764  C CB  . GLU A 114 ? 0.8583 0.8109 0.8331 0.0053  0.0051  -0.0405 247  GLU A CB  
765  C CG  . GLU A 114 ? 1.1065 1.0591 1.0752 0.0079  0.0037  -0.0393 247  GLU A CG  
766  C CD  . GLU A 114 ? 1.1287 1.0852 1.0958 0.0111  0.0035  -0.0412 247  GLU A CD  
767  O OE1 . GLU A 114 ? 1.0385 0.9932 1.0029 0.0110  0.0050  -0.0404 247  GLU A OE1 
768  O OE2 . GLU A 114 ? 1.4214 1.3829 1.3899 0.0140  0.0020  -0.0435 247  GLU A OE2 
769  N N   . GLY A 115 ? 0.6733 0.6299 0.6627 0.0029  0.0042  -0.0445 248  GLY A N   
770  C CA  . GLY A 115 ? 0.6510 0.6081 0.6437 0.0026  0.0034  -0.0453 248  GLY A CA  
771  C C   . GLY A 115 ? 0.6671 0.6291 0.6673 0.0035  0.0025  -0.0506 248  GLY A C   
772  O O   . GLY A 115 ? 0.6735 0.6376 0.6743 0.0053  0.0009  -0.0526 248  GLY A O   
773  N N   . VAL A 116 ? 0.7044 0.6685 0.7106 0.0024  0.0033  -0.0528 249  VAL A N   
774  C CA  . VAL A 116 ? 0.6736 0.6425 0.6876 0.0029  0.0022  -0.0580 249  VAL A CA  
775  C C   . VAL A 116 ? 0.6356 0.6093 0.6470 0.0066  -0.0002 -0.0614 249  VAL A C   
776  O O   . VAL A 116 ? 0.7026 0.6796 0.7169 0.0080  -0.0020 -0.0652 249  VAL A O   
777  C CB  . VAL A 116 ? 0.6101 0.5803 0.6311 0.0011  0.0035  -0.0590 249  VAL A CB  
778  C CG1 . VAL A 116 ? 0.4602 0.4357 0.4896 0.0015  0.0020  -0.0646 249  VAL A CG1 
779  C CG2 . VAL A 116 ? 0.5850 0.5511 0.6093 -0.0022 0.0060  -0.0557 249  VAL A CG2 
780  N N   . TYR A 117 ? 0.5635 0.5380 0.5695 0.0083  -0.0001 -0.0600 250  TYR A N   
781  C CA  . TYR A 117 ? 0.6771 0.6566 0.6803 0.0120  -0.0020 -0.0624 250  TYR A CA  
782  C C   . TYR A 117 ? 0.7615 0.7408 0.7603 0.0143  -0.0034 -0.0619 250  TYR A C   
783  O O   . TYR A 117 ? 0.7965 0.7805 0.7961 0.0171  -0.0054 -0.0655 250  TYR A O   
784  C CB  . TYR A 117 ? 0.6117 0.5910 0.6093 0.0133  -0.0010 -0.0600 250  TYR A CB  
785  C CG  . TYR A 117 ? 0.7398 0.7241 0.7339 0.0174  -0.0025 -0.0615 250  TYR A CG  
786  C CD1 . TYR A 117 ? 0.6934 0.6845 0.6917 0.0191  -0.0037 -0.0657 250  TYR A CD1 
787  C CD2 . TYR A 117 ? 0.7350 0.7175 0.7218 0.0195  -0.0027 -0.0585 250  TYR A CD2 
788  C CE1 . TYR A 117 ? 0.7328 0.7292 0.7280 0.0231  -0.0049 -0.0668 250  TYR A CE1 
789  C CE2 . TYR A 117 ? 0.6653 0.6529 0.6494 0.0236  -0.0037 -0.0595 250  TYR A CE2 
790  C CZ  . TYR A 117 ? 0.7524 0.7471 0.7406 0.0254  -0.0048 -0.0637 250  TYR A CZ  
791  O OH  . TYR A 117 ? 0.9159 0.9164 0.9015 0.0296  -0.0057 -0.0645 250  TYR A OH  
792  N N   . LEU A 118 ? 0.8128 0.7866 0.8068 0.0132  -0.0025 -0.0574 251  LEU A N   
793  C CA  . LEU A 118 ? 0.7826 0.7559 0.7729 0.0154  -0.0037 -0.0562 251  LEU A CA  
794  C C   . LEU A 118 ? 0.7288 0.7038 0.7244 0.0154  -0.0047 -0.0597 251  LEU A C   
795  O O   . LEU A 118 ? 0.5677 0.5459 0.5620 0.0187  -0.0064 -0.0617 251  LEU A O   
796  C CB  . LEU A 118 ? 0.7174 0.6844 0.7028 0.0136  -0.0025 -0.0504 251  LEU A CB  
797  C CG  . LEU A 118 ? 0.6172 0.5830 0.5990 0.0154  -0.0035 -0.0480 251  LEU A CG  
798  C CD1 . LEU A 118 ? 0.4792 0.4486 0.4564 0.0200  -0.0049 -0.0480 251  LEU A CD1 
799  C CD2 . LEU A 118 ? 0.6578 0.6174 0.6361 0.0127  -0.0023 -0.0422 251  LEU A CD2 
800  N N   . TYR A 119 ? 0.6908 0.6636 0.6923 0.0119  -0.0035 -0.0604 252  TYR A N   
801  C CA  . TYR A 119 ? 0.7202 0.6940 0.7272 0.0117  -0.0041 -0.0637 252  TYR A CA  
802  C C   . TYR A 119 ? 0.8151 0.7951 0.8253 0.0142  -0.0063 -0.0699 252  TYR A C   
803  O O   . TYR A 119 ? 1.0057 0.9877 1.0153 0.0168  -0.0079 -0.0725 252  TYR A O   
804  C CB  . TYR A 119 ? 0.7173 0.6883 0.7313 0.0075  -0.0021 -0.0634 252  TYR A CB  
805  C CG  . TYR A 119 ? 0.7696 0.7406 0.7895 0.0068  -0.0023 -0.0666 252  TYR A CG  
806  C CD1 . TYR A 119 ? 0.8271 0.7943 0.8457 0.0062  -0.0013 -0.0635 252  TYR A CD1 
807  C CD2 . TYR A 119 ? 0.8304 0.8053 0.8574 0.0069  -0.0036 -0.0726 252  TYR A CD2 
808  C CE1 . TYR A 119 ? 1.0956 1.0625 1.1195 0.0058  -0.0012 -0.0664 252  TYR A CE1 
809  C CE2 . TYR A 119 ? 0.9761 0.9507 1.0086 0.0063  -0.0038 -0.0757 252  TYR A CE2 
810  C CZ  . TYR A 119 ? 1.2156 1.1860 1.2463 0.0058  -0.0024 -0.0726 252  TYR A CZ  
811  O OH  . TYR A 119 ? 1.4876 1.4572 1.5235 0.0053  -0.0023 -0.0757 252  TYR A OH  
812  N N   . THR A 120 ? 0.8590 0.8423 0.8724 0.0137  -0.0065 -0.0723 253  THR A N   
813  C CA  . THR A 120 ? 0.9152 0.9050 0.9322 0.0159  -0.0088 -0.0781 253  THR A CA  
814  C C   . THR A 120 ? 0.8800 0.8738 0.8904 0.0205  -0.0106 -0.0785 253  THR A C   
815  O O   . THR A 120 ? 0.8498 0.8486 0.8616 0.0231  -0.0128 -0.0832 253  THR A O   
816  C CB  . THR A 120 ? 0.9769 0.9696 0.9990 0.0143  -0.0085 -0.0798 253  THR A CB  
817  O OG1 . THR A 120 ? 1.2100 1.2019 1.2268 0.0148  -0.0072 -0.0759 253  THR A OG1 
818  C CG2 . THR A 120 ? 0.9702 0.9597 1.0001 0.0100  -0.0069 -0.0798 253  THR A CG2 
819  N N   . LEU A 121 ? 0.8382 0.8301 0.8417 0.0218  -0.0096 -0.0738 254  LEU A N   
820  C CA  . LEU A 121 ? 0.7132 0.7088 0.7109 0.0265  -0.0109 -0.0733 254  LEU A CA  
821  C C   . LEU A 121 ? 0.7474 0.7423 0.7432 0.0286  -0.0120 -0.0737 254  LEU A C   
822  O O   . LEU A 121 ? 0.7560 0.7559 0.7499 0.0329  -0.0138 -0.0761 254  LEU A O   
823  C CB  . LEU A 121 ? 0.7770 0.7696 0.7683 0.0269  -0.0094 -0.0678 254  LEU A CB  
824  C CG  . LEU A 121 ? 0.8146 0.8116 0.8007 0.0317  -0.0102 -0.0669 254  LEU A CG  
825  C CD1 . LEU A 121 ? 0.8838 0.8880 0.8724 0.0335  -0.0110 -0.0709 254  LEU A CD1 
826  C CD2 . LEU A 121 ? 0.7632 0.7558 0.7435 0.0314  -0.0086 -0.0611 254  LEU A CD2 
827  N N   . LEU A 122 ? 0.8563 0.8452 0.8526 0.0260  -0.0108 -0.0711 255  LEU A N   
828  C CA  . LEU A 122 ? 0.7283 0.7162 0.7234 0.0280  -0.0115 -0.0714 255  LEU A CA  
829  C C   . LEU A 122 ? 0.7337 0.7245 0.7345 0.0281  -0.0130 -0.0778 255  LEU A C   
830  O O   . LEU A 122 ? 0.8088 0.8006 0.8080 0.0311  -0.0141 -0.0795 255  LEU A O   
831  C CB  . LEU A 122 ? 0.6681 0.6490 0.6622 0.0251  -0.0096 -0.0662 255  LEU A CB  
832  C CG  . LEU A 122 ? 0.6475 0.6250 0.6356 0.0249  -0.0085 -0.0597 255  LEU A CG  
833  C CD1 . LEU A 122 ? 0.7294 0.7005 0.7182 0.0208  -0.0065 -0.0553 255  LEU A CD1 
834  C CD2 . LEU A 122 ? 0.4750 0.4541 0.4572 0.0296  -0.0095 -0.0573 255  LEU A CD2 
835  N N   . ALA A 123 ? 0.7073 0.6993 0.7148 0.0251  -0.0130 -0.0815 256  ALA A N   
836  C CA  . ALA A 123 ? 0.7767 0.7711 0.7901 0.0248  -0.0145 -0.0878 256  ALA A CA  
837  C C   . ALA A 123 ? 0.8653 0.8674 0.8789 0.0283  -0.0173 -0.0933 256  ALA A C   
838  O O   . ALA A 123 ? 0.7430 0.7474 0.7603 0.0289  -0.0191 -0.0989 256  ALA A O   
839  C CB  . ALA A 123 ? 0.9216 0.9139 0.9434 0.0199  -0.0132 -0.0891 256  ALA A CB  
840  N N   . PHE A 124 ? 0.7406 0.8931 0.7573 0.0516  -0.0511 -0.0045 257  PHE A N   
841  C CA  . PHE A 124 ? 0.6313 0.7871 0.6490 0.0579  -0.0535 -0.0032 257  PHE A CA  
842  C C   . PHE A 124 ? 0.7300 0.8915 0.7359 0.0623  -0.0526 -0.0066 257  PHE A C   
843  O O   . PHE A 124 ? 0.9138 1.0743 0.9086 0.0596  -0.0457 -0.0070 257  PHE A O   
844  C CB  . PHE A 124 ? 0.6440 0.7943 0.6624 0.0567  -0.0454 0.0043  257  PHE A CB  
845  C CG  . PHE A 124 ? 0.7804 0.9335 0.8054 0.0625  -0.0502 0.0058  257  PHE A CG  
846  C CD1 . PHE A 124 ? 0.7391 0.8928 0.7775 0.0624  -0.0574 0.0058  257  PHE A CD1 
847  C CD2 . PHE A 124 ? 0.7808 0.9362 0.7984 0.0678  -0.0474 0.0074  257  PHE A CD2 
848  C CE1 . PHE A 124 ? 0.6176 0.7744 0.6621 0.0677  -0.0616 0.0066  257  PHE A CE1 
849  C CE2 . PHE A 124 ? 0.7110 0.8697 0.7347 0.0734  -0.0518 0.0085  257  PHE A CE2 
850  C CZ  . PHE A 124 ? 0.8226 0.9822 0.8597 0.0734  -0.0587 0.0078  257  PHE A CZ  
854  O O   . ASN A 125 ? 0.6075 0.7884 0.6205 0.0820  -0.0679 -0.0093 1001 ASN A O   
855  C CB  . ASN A 125 ? 0.6511 0.8343 0.6475 0.0733  -0.0665 -0.0209 1001 ASN A CB  
856  C CG  . ASN A 125 ? 0.7683 0.9549 0.7787 0.0752  -0.0790 -0.0266 1001 ASN A CG  
857  O OD1 . ASN A 125 ? 1.1090 1.2978 1.1296 0.0791  -0.0849 -0.0261 1001 ASN A OD1 
858  N ND2 . ASN A 125 ? 0.9309 1.1179 0.9420 0.0725  -0.0831 -0.0322 1001 ASN A ND2 
859  N N   . ILE A 126 ? 0.6375 0.8310 0.6338 0.0854  -0.0684 -0.0161 1002 ILE A N   
860  C CA  . ILE A 126 ? 0.6423 0.8444 0.6420 0.0928  -0.0735 -0.0164 1002 ILE A CA  
861  C C   . ILE A 126 ? 0.6262 0.8336 0.6412 0.0962  -0.0853 -0.0221 1002 ILE A C   
862  O O   . ILE A 126 ? 0.6303 0.8407 0.6527 0.1008  -0.0887 -0.0207 1002 ILE A O   
863  C CB  . ILE A 126 ? 0.6388 0.8524 0.6275 0.0965  -0.0738 -0.0195 1002 ILE A CB  
864  C CG1 . ILE A 126 ? 0.6320 0.8563 0.6246 0.1044  -0.0792 -0.0200 1002 ILE A CG1 
865  C CG2 . ILE A 126 ? 0.6410 0.8624 0.6287 0.0957  -0.0802 -0.0288 1002 ILE A CG2 
866  C CD1 . ILE A 126 ? 0.5290 0.7466 0.5203 0.1060  -0.0726 -0.0110 1002 ILE A CD1 
867  N N   . PHE A 127 ? 0.6904 0.8990 0.7107 0.0940  -0.0920 -0.0286 1003 PHE A N   
868  C CA  . PHE A 127 ? 0.7698 0.9828 0.8054 0.0970  -0.1038 -0.0342 1003 PHE A CA  
869  C C   . PHE A 127 ? 0.8322 1.0362 0.8784 0.0946  -0.1031 -0.0286 1003 PHE A C   
870  O O   . PHE A 127 ? 0.9297 1.1380 0.9862 0.0990  -0.1093 -0.0297 1003 PHE A O   
871  C CB  . PHE A 127 ? 0.7952 1.0098 0.8341 0.0947  -0.1109 -0.0419 1003 PHE A CB  
872  C CG  . PHE A 127 ? 0.8517 1.0775 0.8813 0.0975  -0.1130 -0.0490 1003 PHE A CG  
873  C CD1 . PHE A 127 ? 0.8663 1.1065 0.9011 0.1043  -0.1229 -0.0570 1003 PHE A CD1 
874  C CD2 . PHE A 127 ? 0.6654 0.8882 0.6811 0.0931  -0.1049 -0.0479 1003 PHE A CD2 
875  C CE1 . PHE A 127 ? 0.8188 1.0711 0.8451 0.1066  -0.1250 -0.0638 1003 PHE A CE1 
876  C CE2 . PHE A 127 ? 0.6090 0.8431 0.6156 0.0952  -0.1067 -0.0545 1003 PHE A CE2 
877  C CZ  . PHE A 127 ? 0.6608 0.9100 0.6727 0.1019  -0.1169 -0.0625 1003 PHE A CZ  
878  N N   . GLU A 128 ? 0.8250 1.0175 0.8682 0.0879  -0.0949 -0.0224 1004 GLU A N   
879  C CA  . GLU A 128 ? 0.9455 1.1307 0.9983 0.0851  -0.0938 -0.0170 1004 GLU A CA  
880  C C   . GLU A 128 ? 0.9366 1.1217 0.9871 0.0886  -0.0884 -0.0113 1004 GLU A C   
881  O O   . GLU A 128 ? 0.8642 1.0498 0.9249 0.0905  -0.0921 -0.0101 1004 GLU A O   
882  C CB  . GLU A 128 ? 1.0185 1.1935 1.0692 0.0768  -0.0869 -0.0126 1004 GLU A CB  
883  C CG  . GLU A 128 ? 1.0549 1.2298 1.1052 0.0734  -0.0910 -0.0179 1004 GLU A CG  
884  C CD  . GLU A 128 ? 1.1573 1.3360 1.2211 0.0754  -0.1042 -0.0240 1004 GLU A CD  
885  O OE1 . GLU A 128 ? 1.2328 1.4098 1.3082 0.0753  -0.1083 -0.0219 1004 GLU A OE1 
886  O OE2 . GLU A 128 ? 1.2941 1.4776 1.3570 0.0770  -0.1106 -0.0313 1004 GLU A OE2 
887  N N   . MET A 129 ? 0.9244 1.1091 0.9618 0.0897  -0.0800 -0.0079 1005 MET A N   
888  C CA  . MET A 129 ? 0.7558 0.9412 0.7901 0.0941  -0.0755 -0.0029 1005 MET A CA  
889  C C   . MET A 129 ? 0.7825 0.9784 0.8246 0.1017  -0.0845 -0.0070 1005 MET A C   
890  O O   . MET A 129 ? 0.8704 1.0660 0.9197 0.1042  -0.0855 -0.0045 1005 MET A O   
891  C CB  . MET A 129 ? 0.6521 0.8373 0.6708 0.0946  -0.0674 -0.0001 1005 MET A CB  
892  C CG  . MET A 129 ? 0.5805 0.7643 0.5938 0.0984  -0.0612 0.0063  1005 MET A CG  
893  S SD  . MET A 129 ? 0.8203 1.0041 0.8155 0.0982  -0.0528 0.0093  1005 MET A SD  
894  C CE  . MET A 129 ? 0.8378 1.0157 0.8293 0.1014  -0.0454 0.0182  1005 MET A CE  
895  N N   . LEU A 130 ? 0.7748 0.9812 0.8162 0.1056  -0.0915 -0.0139 1006 LEU A N   
896  C CA  . LEU A 130 ? 0.7935 1.0120 0.8424 0.1133  -0.1001 -0.0187 1006 LEU A CA  
897  C C   . LEU A 130 ? 0.8136 1.0325 0.8791 0.1133  -0.1091 -0.0226 1006 LEU A C   
898  O O   . LEU A 130 ? 0.8627 1.0879 0.9361 0.1186  -0.1136 -0.0238 1006 LEU A O   
899  C CB  . LEU A 130 ? 0.7508 0.9821 0.7950 0.1172  -0.1051 -0.0258 1006 LEU A CB  
900  C CG  . LEU A 130 ? 0.7785 1.0144 0.8076 0.1195  -0.0983 -0.0226 1006 LEU A CG  
901  C CD1 . LEU A 130 ? 0.6055 0.8554 0.6312 0.1224  -0.1045 -0.0307 1006 LEU A CD1 
902  C CD2 . LEU A 130 ? 0.7001 0.9400 0.7288 0.1255  -0.0963 -0.0179 1006 LEU A CD2 
903  N N   . ARG A 131 ? 0.7544 0.9671 0.8255 0.1074  -0.1120 -0.0246 1007 ARG A N   
904  C CA  . ARG A 131 ? 0.6743 0.8861 0.7612 0.1066  -0.1202 -0.0271 1007 ARG A CA  
905  C C   . ARG A 131 ? 0.6804 0.8854 0.7715 0.1046  -0.1156 -0.0202 1007 ARG A C   
906  O O   . ARG A 131 ? 0.7002 0.9077 0.8038 0.1063  -0.1220 -0.0219 1007 ARG A O   
907  C CB  . ARG A 131 ? 0.6015 0.8073 0.6929 0.1004  -0.1242 -0.0297 1007 ARG A CB  
908  N N   . ILE A 132 ? 0.6968 0.8940 0.7782 0.1013  -0.1048 -0.0128 1008 ILE A N   
909  C CA  . ILE A 132 ? 0.6378 0.8304 0.7228 0.1004  -0.1004 -0.0070 1008 ILE A CA  
910  C C   . ILE A 132 ? 0.6719 0.8721 0.7559 0.1086  -0.1009 -0.0070 1008 ILE A C   
911  O O   . ILE A 132 ? 0.7346 0.9374 0.8279 0.1110  -0.1044 -0.0072 1008 ILE A O   
912  C CB  . ILE A 132 ? 0.6635 0.8459 0.7397 0.0944  -0.0891 0.0003  1008 ILE A CB  
913  C CG1 . ILE A 132 ? 0.7098 0.8858 0.7879 0.0862  -0.0887 0.0003  1008 ILE A CG1 
914  C CG2 . ILE A 132 ? 0.5688 0.7479 0.6493 0.0939  -0.0852 0.0054  1008 ILE A CG2 
915  C CD1 . ILE A 132 ? 0.8784 1.0533 0.9708 0.0826  -0.0958 -0.0007 1008 ILE A CD1 
916  N N   . ASP A 133 ? 0.7081 0.9127 0.7807 0.1130  -0.0973 -0.0067 1009 ASP A N   
917  C CA  . ASP A 133 ? 0.6977 0.9088 0.7678 0.1205  -0.0962 -0.0051 1009 ASP A CA  
918  C C   . ASP A 133 ? 0.7638 0.9881 0.8438 0.1275  -0.1065 -0.0122 1009 ASP A C   
919  O O   . ASP A 133 ? 1.1309 1.3592 1.2166 0.1321  -0.1081 -0.0118 1009 ASP A O   
920  C CB  . ASP A 133 ? 0.7741 0.9860 0.8289 0.1226  -0.0894 -0.0020 1009 ASP A CB  
921  C CG  . ASP A 133 ? 0.9476 1.1468 0.9933 0.1172  -0.0785 0.0057  1009 ASP A CG  
922  O OD1 . ASP A 133 ? 0.7777 0.9694 0.8290 0.1135  -0.0758 0.0090  1009 ASP A OD1 
923  O OD2 . ASP A 133 ? 1.0531 1.2507 1.0866 0.1165  -0.0726 0.0082  1009 ASP A OD2 
924  N N   . GLU A 134 ? 0.8304 1.0621 0.9130 0.1286  -0.1137 -0.0194 1010 GLU A N   
925  C CA  . GLU A 134 ? 0.7607 1.0071 0.8521 0.1358  -0.1234 -0.0271 1010 GLU A CA  
926  C C   . GLU A 134 ? 0.8708 1.1179 0.9792 0.1349  -0.1325 -0.0322 1010 GLU A C   
927  O O   . GLU A 134 ? 1.1432 1.4018 1.2609 0.1413  -0.1399 -0.0380 1010 GLU A O   
928  C CB  . GLU A 134 ? 0.8842 1.1400 0.9707 0.1378  -0.1274 -0.0333 1010 GLU A CB  
929  C CG  . GLU A 134 ? 1.1017 1.3604 1.1721 0.1397  -0.1199 -0.0293 1010 GLU A CG  
930  C CD  . GLU A 134 ? 1.1248 1.3955 1.1937 0.1482  -0.1202 -0.0287 1010 GLU A CD  
931  O OE1 . GLU A 134 ? 1.3160 1.5951 1.3970 0.1532  -0.1272 -0.0332 1010 GLU A OE1 
932  O OE2 . GLU A 134 ? 1.2887 1.5607 1.3445 0.1497  -0.1135 -0.0237 1010 GLU A OE2 
933  N N   . GLY A 135 ? 0.9191 1.1549 1.0321 0.1271  -0.1324 -0.0303 1011 GLY A N   
934  C CA  . GLY A 135 ? 0.6538 0.8891 0.7827 0.1253  -0.1410 -0.0342 1011 GLY A CA  
935  C C   . GLY A 135 ? 0.6846 0.9269 0.8214 0.1269  -0.1516 -0.0434 1011 GLY A C   
936  O O   . GLY A 135 ? 0.7208 0.9701 0.8509 0.1299  -0.1527 -0.0475 1011 GLY A O   
937  N N   . LEU A 136 ? 0.8399 1.0806 0.9916 0.1246  -0.1598 -0.0468 1012 LEU A N   
938  C CA  . LEU A 136 ? 0.9074 1.1541 1.0697 0.1263  -0.1713 -0.0560 1012 LEU A CA  
939  C C   . LEU A 136 ? 0.8942 1.1497 1.0724 0.1313  -0.1804 -0.0619 1012 LEU A C   
940  O O   . LEU A 136 ? 0.9099 1.1604 1.0957 0.1286  -0.1802 -0.0584 1012 LEU A O   
941  C CB  . LEU A 136 ? 0.9629 1.1978 1.1291 0.1179  -0.1739 -0.0549 1012 LEU A CB  
942  C CG  . LEU A 136 ? 1.0699 1.3092 1.2477 0.1193  -0.1865 -0.0645 1012 LEU A CG  
943  C CD1 . LEU A 136 ? 1.0570 1.3075 1.2274 0.1251  -0.1885 -0.0716 1012 LEU A CD1 
944  C CD2 . LEU A 136 ? 1.0554 1.2819 1.2370 0.1108  -0.1887 -0.0621 1012 LEU A CD2 
945  N N   . ARG A 137 ? 0.7702 1.0358 0.9510 0.1364  -0.1857 -0.0701 1013 ARG A N   
946  C CA  . ARG A 137 ? 0.8379 1.1052 1.0286 0.1372  -0.1888 -0.0747 1013 ARG A CA  
947  C C   . ARG A 137 ? 0.8793 1.1415 1.0760 0.1333  -0.1945 -0.0814 1013 ARG A C   
948  O O   . ARG A 137 ? 0.8886 1.1515 1.0783 0.1330  -0.1945 -0.0849 1013 ARG A O   
949  C CB  . ARG A 137 ? 0.9200 1.1987 1.1046 0.1441  -0.1850 -0.0770 1013 ARG A CB  
950  C CG  . ARG A 137 ? 0.9137 1.1971 1.0952 0.1487  -0.1801 -0.0710 1013 ARG A CG  
951  C CD  . ARG A 137 ? 0.7834 1.0774 0.9614 0.1549  -0.1775 -0.0740 1013 ARG A CD  
952  N NE  . ARG A 137 ? 0.6887 0.9876 0.8610 0.1601  -0.1720 -0.0679 1013 ARG A NE  
953  C CZ  . ARG A 137 ? 0.7040 1.0023 0.8831 0.1612  -0.1717 -0.0657 1013 ARG A CZ  
954  N NH1 . ARG A 137 ? 0.6853 0.9788 0.8773 0.1572  -0.1766 -0.0689 1013 ARG A NH1 
955  N NH2 . ARG A 137 ? 0.8808 1.1833 1.0534 0.1665  -0.1664 -0.0603 1013 ARG A NH2 
956  N N   . LEU A 138 ? 0.9511 1.2082 1.1605 0.1304  -0.1992 -0.0832 1014 LEU A N   
957  C CA  . LEU A 138 ? 1.1708 1.4225 1.3868 0.1273  -0.2048 -0.0895 1014 LEU A CA  
958  C C   . LEU A 138 ? 1.2694 1.5285 1.4874 0.1316  -0.2055 -0.0971 1014 LEU A C   
959  O O   . LEU A 138 ? 1.1223 1.3810 1.3399 0.1314  -0.2080 -0.1036 1014 LEU A O   
960  C CB  . LEU A 138 ? 1.3830 1.6245 1.6119 0.1213  -0.2101 -0.0873 1014 LEU A CB  
961  C CG  . LEU A 138 ? 1.6779 1.9098 1.9122 0.1165  -0.2160 -0.0910 1014 LEU A CG  
962  C CD1 . LEU A 138 ? 1.6480 1.8748 1.8745 0.1134  -0.2152 -0.0880 1014 LEU A CD1 
963  C CD2 . LEU A 138 ? 1.9164 2.1399 2.1646 0.1115  -0.2214 -0.0892 1014 LEU A CD2 
964  N N   . LYS A 139 ? 1.4943 1.7604 1.7146 0.1355  -0.2033 -0.0966 1015 LYS A N   
965  C CA  . LYS A 139 ? 1.4324 1.7062 1.6553 0.1396  -0.2038 -0.1035 1015 LYS A CA  
966  C C   . LYS A 139 ? 1.3551 1.6409 1.5674 0.1458  -0.1978 -0.1028 1015 LYS A C   
967  O O   . LYS A 139 ? 1.3676 1.6554 1.5723 0.1473  -0.1933 -0.0963 1015 LYS A O   
968  C CB  . LYS A 139 ? 1.1942 1.4665 1.4296 0.1390  -0.2066 -0.1045 1015 LYS A CB  
969  C CG  . LYS A 139 ? 1.2986 1.5593 1.5454 0.1328  -0.2130 -0.1052 1015 LYS A CG  
970  C CD  . LYS A 139 ? 1.4919 1.7517 1.7504 0.1319  -0.2154 -0.1052 1015 LYS A CD  
971  C CE  . LYS A 139 ? 1.4767 1.7247 1.7466 0.1255  -0.2222 -0.1056 1015 LYS A CE  
972  N NZ  . LYS A 139 ? 1.3917 1.6382 1.6726 0.1233  -0.2242 -0.1036 1015 LYS A NZ  
973  N N   . ILE A 140 ? 1.3200 1.6139 1.5319 0.1495  -0.1978 -0.1096 1016 ILE A N   
974  C CA  . ILE A 140 ? 1.2696 1.5755 1.4720 0.1553  -0.1925 -0.1092 1016 ILE A CA  
975  C C   . ILE A 140 ? 1.2855 1.5947 1.4899 0.1582  -0.1896 -0.1045 1016 ILE A C   
976  O O   . ILE A 140 ? 1.2164 1.5227 1.4314 0.1571  -0.1922 -0.1056 1016 ILE A O   
977  C CB  . ILE A 140 ? 1.1497 1.4639 1.3524 0.1582  -0.1935 -0.1180 1016 ILE A CB  
978  C CG1 . ILE A 140 ? 1.1229 1.4341 1.3234 0.1556  -0.1963 -0.1231 1016 ILE A CG1 
979  C CG2 . ILE A 140 ? 1.2895 1.6169 1.4826 0.1641  -0.1882 -0.1172 1016 ILE A CG2 
980  C CD1 . ILE A 140 ? 0.9129 1.2341 1.1106 0.1591  -0.1960 -0.1312 1016 ILE A CD1 
981  N N   . TYR A 141 ? 1.1751 1.4905 1.3691 0.1621  -0.1841 -0.0991 1017 TYR A N   
982  C CA  . TYR A 141 ? 1.0698 1.3885 1.2638 0.1657  -0.1806 -0.0943 1017 TYR A CA  
983  C C   . TYR A 141 ? 1.1049 1.4352 1.2877 0.1720  -0.1754 -0.0931 1017 TYR A C   
984  O O   . TYR A 141 ? 1.1405 1.4739 1.3129 0.1729  -0.1731 -0.0917 1017 TYR A O   
985  C CB  . TYR A 141 ? 1.0004 1.3113 1.1938 0.1634  -0.1793 -0.0863 1017 TYR A CB  
986  C CG  . TYR A 141 ? 0.9936 1.3073 1.1870 0.1671  -0.1757 -0.0813 1017 TYR A CG  
987  C CD1 . TYR A 141 ? 0.9934 1.3053 1.1979 0.1660  -0.1780 -0.0828 1017 TYR A CD1 
988  C CD2 . TYR A 141 ? 1.0811 1.3992 1.2632 0.1718  -0.1699 -0.0752 1017 TYR A CD2 
989  C CE1 . TYR A 141 ? 1.0081 1.3228 1.2123 0.1694  -0.1746 -0.0788 1017 TYR A CE1 
990  C CE2 . TYR A 141 ? 0.9855 1.3056 1.1672 0.1755  -0.1665 -0.0708 1017 TYR A CE2 
991  C CZ  . TYR A 141 ? 1.0390 1.3575 1.2316 0.1743  -0.1688 -0.0729 1017 TYR A CZ  
992  O OH  . TYR A 141 ? 1.0288 1.3496 1.2207 0.1781  -0.1653 -0.0691 1017 TYR A OH  
993  N N   . LYS A 142 ? 0.9937 1.3304 1.1784 0.1763  -0.1735 -0.0936 1018 LYS A N   
994  C CA  . LYS A 142 ? 0.8193 1.1672 0.9940 0.1825  -0.1685 -0.0918 1018 LYS A CA  
995  C C   . LYS A 142 ? 0.8133 1.1594 0.9814 0.1852  -0.1639 -0.0827 1018 LYS A C   
996  O O   . LYS A 142 ? 0.7300 1.0734 0.9037 0.1860  -0.1635 -0.0805 1018 LYS A O   
997  C CB  . LYS A 142 ? 0.9998 1.3559 1.1795 0.1860  -0.1689 -0.0975 1018 LYS A CB  
998  N N   . ASP A 143 ? 0.9882 1.3361 1.1444 0.1869  -0.1604 -0.0776 1019 ASP A N   
999  C CA  . ASP A 143 ? 1.2375 1.5827 1.3867 0.1894  -0.1559 -0.0685 1019 ASP A CA  
1000 C C   . ASP A 143 ? 1.2470 1.6004 1.3904 0.1964  -0.1514 -0.0654 1019 ASP A C   
1001 O O   . ASP A 143 ? 1.1010 1.4634 1.2447 0.1992  -0.1515 -0.0701 1019 ASP A O   
1002 C CB  . ASP A 143 ? 1.2549 1.5987 1.3932 0.1884  -0.1539 -0.0641 1019 ASP A CB  
1003 C CG  . ASP A 143 ? 1.3804 1.7167 1.5149 0.1885  -0.1509 -0.0556 1019 ASP A CG  
1004 O OD1 . ASP A 143 ? 1.4726 1.8059 1.6118 0.1901  -0.1498 -0.0527 1019 ASP A OD1 
1005 O OD2 . ASP A 143 ? 1.3788 1.7126 1.5055 0.1871  -0.1494 -0.0519 1019 ASP A OD2 
1006 N N   . THR A 144 ? 1.3695 1.7196 1.5075 0.1993  -0.1473 -0.0573 1020 THR A N   
1007 C CA  . THR A 144 ? 1.0359 1.3916 1.1691 0.2059  -0.1431 -0.0536 1020 THR A CA  
1008 C C   . THR A 144 ? 1.0426 1.4096 1.1657 0.2106  -0.1405 -0.0533 1020 THR A C   
1009 O O   . THR A 144 ? 1.1345 1.5087 1.2563 0.2155  -0.1387 -0.0538 1020 THR A O   
1010 C CB  . THR A 144 ? 0.8018 1.1511 0.9296 0.2082  -0.1389 -0.0444 1020 THR A CB  
1011 N N   . GLU A 145 ? 1.0624 1.4318 1.1780 0.2091  -0.1404 -0.0526 1021 GLU A N   
1012 C CA  . GLU A 145 ? 0.9805 1.3614 1.0854 0.2132  -0.1377 -0.0512 1021 GLU A CA  
1013 C C   . GLU A 145 ? 0.7733 1.1638 0.8826 0.2124  -0.1408 -0.0606 1021 GLU A C   
1014 O O   . GLU A 145 ? 0.9378 1.3397 1.0394 0.2159  -0.1388 -0.0603 1021 GLU A O   
1015 C CB  . GLU A 145 ? 1.0151 1.3953 1.1090 0.2120  -0.1358 -0.0458 1021 GLU A CB  
1016 C CG  . GLU A 145 ? 1.1597 1.5297 1.2490 0.2124  -0.1327 -0.0366 1021 GLU A CG  
1017 C CD  . GLU A 145 ? 1.3204 1.6792 1.4186 0.2062  -0.1360 -0.0392 1021 GLU A CD  
1018 O OE1 . GLU A 145 ? 1.4229 1.7815 1.5271 0.2012  -0.1405 -0.0468 1021 GLU A OE1 
1019 O OE2 . GLU A 145 ? 1.2379 1.5878 1.3372 0.2063  -0.1341 -0.0337 1021 GLU A OE2 
1020 N N   . GLY A 146 ? 0.7848 1.1712 0.9063 0.2080  -0.1455 -0.0687 1022 GLY A N   
1021 C CA  . GLY A 146 ? 0.7435 1.1377 0.8699 0.2071  -0.1486 -0.0780 1022 GLY A CA  
1022 C C   . GLY A 146 ? 0.9532 1.3452 1.0807 0.2018  -0.1520 -0.0832 1022 GLY A C   
1023 O O   . GLY A 146 ? 1.0977 1.4949 1.2300 0.2007  -0.1549 -0.0915 1022 GLY A O   
1024 N N   . TYR A 147 ? 1.0714 1.4559 1.1944 0.1987  -0.1517 -0.0787 1023 TYR A N   
1025 C CA  . TYR A 147 ? 1.0628 1.4446 1.1860 0.1936  -0.1548 -0.0834 1023 TYR A CA  
1026 C C   . TYR A 147 ? 0.9676 1.3374 1.1033 0.1882  -0.1597 -0.0874 1023 TYR A C   
1027 O O   . TYR A 147 ? 0.9605 1.3216 1.1011 0.1873  -0.1598 -0.0831 1023 TYR A O   
1028 C CB  . TYR A 147 ? 1.2117 1.5921 1.3230 0.1929  -0.1518 -0.0767 1023 TYR A CB  
1029 C CG  . TYR A 147 ? 1.3431 1.7353 1.4411 0.1977  -0.1471 -0.0716 1023 TYR A CG  
1030 C CD1 . TYR A 147 ? 1.3821 1.7847 1.4736 0.1973  -0.1470 -0.0756 1023 TYR A CD1 
1031 C CD2 . TYR A 147 ? 1.5146 1.9075 1.6062 0.2026  -0.1426 -0.0624 1023 TYR A CD2 
1032 C CE1 . TYR A 147 ? 1.3494 1.7634 1.4287 0.2013  -0.1428 -0.0703 1023 TYR A CE1 
1033 C CE2 . TYR A 147 ? 1.5432 1.9464 1.6224 0.2069  -0.1384 -0.0568 1023 TYR A CE2 
1034 C CZ  . TYR A 147 ? 1.5083 1.9225 1.5815 0.2061  -0.1386 -0.0606 1023 TYR A CZ  
1035 O OH  . TYR A 147 ? 1.6671 2.0923 1.7280 0.2100  -0.1345 -0.0544 1023 TYR A OH  
1036 N N   . TYR A 148 ? 0.8832 1.2526 1.0240 0.1848  -0.1637 -0.0955 1024 TYR A N   
1037 C CA  . TYR A 148 ? 1.0495 1.4073 1.2012 0.1794  -0.1687 -0.0991 1024 TYR A CA  
1038 C C   . TYR A 148 ? 1.0246 1.3747 1.1714 0.1751  -0.1692 -0.0962 1024 TYR A C   
1039 O O   . TYR A 148 ? 1.0517 1.4067 1.1894 0.1750  -0.1679 -0.0973 1024 TYR A O   
1040 C CB  . TYR A 148 ? 1.3046 1.6651 1.4638 0.1781  -0.1729 -0.1091 1024 TYR A CB  
1041 C CG  . TYR A 148 ? 1.5256 1.8908 1.6929 0.1811  -0.1737 -0.1130 1024 TYR A CG  
1042 C CD1 . TYR A 148 ? 1.5763 1.9334 1.7558 0.1788  -0.1771 -0.1142 1024 TYR A CD1 
1043 C CD2 . TYR A 148 ? 1.5443 1.9228 1.7072 0.1860  -0.1712 -0.1157 1024 TYR A CD2 
1044 C CE1 . TYR A 148 ? 1.3453 1.7070 1.5319 0.1814  -0.1777 -0.1181 1024 TYR A CE1 
1045 C CE2 . TYR A 148 ? 1.4117 1.7948 1.5816 0.1887  -0.1718 -0.1197 1024 TYR A CE2 
1046 C CZ  . TYR A 148 ? 1.3038 1.6784 1.4855 0.1864  -0.1750 -0.1210 1024 TYR A CZ  
1047 O OH  . TYR A 148 ? 1.1709 1.5505 1.3595 0.1891  -0.1755 -0.1252 1024 TYR A OH  
1048 N N   . THR A 149 ? 1.0324 1.3710 1.1851 0.1715  -0.1709 -0.0926 1025 THR A N   
1049 C CA  . THR A 149 ? 0.9704 1.3014 1.1183 0.1677  -0.1708 -0.0889 1025 THR A CA  
1050 C C   . THR A 149 ? 1.0740 1.3931 1.2329 0.1618  -0.1763 -0.0916 1025 THR A C   
1051 O O   . THR A 149 ? 1.2340 1.5497 1.4044 0.1608  -0.1795 -0.0941 1025 THR A O   
1052 C CB  . THR A 149 ? 1.0417 1.3710 1.1831 0.1698  -0.1663 -0.0793 1025 THR A CB  
1053 O OG1 . THR A 149 ? 1.2356 1.5581 1.3720 0.1660  -0.1661 -0.0762 1025 THR A OG1 
1054 C CG2 . THR A 149 ? 1.1849 1.5085 1.3361 0.1699  -0.1671 -0.0764 1025 THR A CG2 
1055 N N   . ILE A 150 ? 1.0447 1.3579 1.1997 0.1578  -0.1772 -0.0911 1026 ILE A N   
1056 C CA  . ILE A 150 ? 1.1018 1.4033 1.2658 0.1519  -0.1822 -0.0928 1026 ILE A CA  
1057 C C   . ILE A 150 ? 1.3832 1.6797 1.5393 0.1487  -0.1811 -0.0895 1026 ILE A C   
1058 O O   . ILE A 150 ? 1.6426 1.9455 1.7863 0.1508  -0.1771 -0.0880 1026 ILE A O   
1059 C CB  . ILE A 150 ? 1.1063 1.4073 1.2774 0.1503  -0.1870 -0.1019 1026 ILE A CB  
1060 C CG1 . ILE A 150 ? 1.0864 1.3751 1.2696 0.1450  -0.1927 -0.1028 1026 ILE A CG1 
1061 C CG2 . ILE A 150 ? 0.9131 1.2181 1.0751 0.1501  -0.1865 -0.1064 1026 ILE A CG2 
1062 C CD1 . ILE A 150 ? 1.1882 1.4759 1.3799 0.1442  -0.1975 -0.1113 1026 ILE A CD1 
1063 N N   . GLY A 151 ? 1.2803 1.5657 1.4431 0.1434  -0.1846 -0.0881 1027 GLY A N   
1064 C CA  . GLY A 151 ? 1.0473 1.3276 1.2032 0.1399  -0.1840 -0.0859 1027 GLY A CA  
1065 C C   . GLY A 151 ? 0.9309 1.2123 1.0792 0.1416  -0.1789 -0.0776 1027 GLY A C   
1066 O O   . GLY A 151 ? 1.1058 1.3855 1.2592 0.1427  -0.1780 -0.0725 1027 GLY A O   
1067 N N   . ILE A 152 ? 0.8808 1.1655 1.0164 0.1420  -0.1754 -0.0762 1028 ILE A N   
1068 C CA  . ILE A 152 ? 0.9696 1.2480 1.0925 0.1402  -0.1649 -0.0662 1028 ILE A CA  
1069 C C   . ILE A 152 ? 0.9868 1.2772 1.0986 0.1463  -0.1602 -0.0651 1028 ILE A C   
1070 O O   . ILE A 152 ? 0.8677 1.1630 0.9680 0.1464  -0.1576 -0.0662 1028 ILE A O   
1071 C CB  . ILE A 152 ? 1.1007 1.3663 1.2137 0.1323  -0.1592 -0.0625 1028 ILE A CB  
1072 C CG1 . ILE A 152 ? 1.2853 1.5400 1.4095 0.1263  -0.1645 -0.0635 1028 ILE A CG1 
1073 C CG2 . ILE A 152 ? 1.0487 1.3038 1.1482 0.1284  -0.1459 -0.0515 1028 ILE A CG2 
1074 C CD1 . ILE A 152 ? 1.4388 1.6987 1.5694 0.1268  -0.1749 -0.0733 1028 ILE A CD1 
1075 N N   . GLY A 153 ? 0.8234 1.1190 0.9385 0.1514  -0.1591 -0.0628 1029 GLY A N   
1076 C CA  . GLY A 153 ? 0.8535 1.1600 0.9584 0.1573  -0.1545 -0.0604 1029 GLY A CA  
1077 C C   . GLY A 153 ? 0.7808 1.1032 0.8839 0.1615  -0.1591 -0.0685 1029 GLY A C   
1078 O O   . GLY A 153 ? 0.6966 1.0280 0.7875 0.1645  -0.1550 -0.0661 1029 GLY A O   
1079 N N   . HIS A 154 ? 0.6840 1.0041 0.7965 0.1586  -0.1643 -0.0768 1030 HIS A N   
1080 C CA  . HIS A 154 ? 0.9372 1.2658 1.0464 0.1592  -0.1651 -0.0840 1030 HIS A CA  
1081 C C   . HIS A 154 ? 1.0371 1.3736 1.1510 0.1637  -0.1650 -0.0862 1030 HIS A C   
1082 O O   . HIS A 154 ? 1.0637 1.3968 1.1895 0.1629  -0.1690 -0.0908 1030 HIS A O   
1083 C CB  . HIS A 154 ? 0.9615 1.2835 1.0772 0.1542  -0.1703 -0.0919 1030 HIS A CB  
1084 C CG  . HIS A 154 ? 1.0513 1.3819 1.1624 0.1548  -0.1706 -0.0994 1030 HIS A CG  
1085 N ND1 . HIS A 154 ? 0.8864 1.2231 0.9845 0.1544  -0.1674 -0.0995 1030 HIS A ND1 
1086 C CD2 . HIS A 154 ? 0.9622 1.2970 1.0798 0.1559  -0.1733 -0.1070 1030 HIS A CD2 
1087 C CE1 . HIS A 154 ? 0.8533 1.1976 0.9505 0.1551  -0.1682 -0.1069 1030 HIS A CE1 
1088 N NE2 . HIS A 154 ? 0.9159 1.2592 1.0248 0.1562  -0.1718 -0.1116 1030 HIS A NE2 
1089 N N   . LEU A 155 ? 0.9797 1.3270 1.0839 0.1685  -0.1605 -0.0827 1031 LEU A N   
1090 C CA  . LEU A 155 ? 1.0139 1.3702 1.1209 0.1731  -0.1599 -0.0847 1031 LEU A CA  
1091 C C   . LEU A 155 ? 0.8856 1.2500 0.9929 0.1727  -0.1619 -0.0938 1031 LEU A C   
1092 O O   . LEU A 155 ? 0.8245 1.1934 0.9232 0.1713  -0.1609 -0.0957 1031 LEU A O   
1093 C CB  . LEU A 155 ? 1.0771 1.4419 1.1732 0.1785  -0.1542 -0.0767 1031 LEU A CB  
1094 C CG  . LEU A 155 ? 1.0292 1.3887 1.1262 0.1814  -0.1515 -0.0680 1031 LEU A CG  
1095 C CD1 . LEU A 155 ? 1.1207 1.4692 1.2168 0.1780  -0.1512 -0.0630 1031 LEU A CD1 
1096 C CD2 . LEU A 155 ? 1.0831 1.4522 1.1688 0.1874  -0.1461 -0.0609 1031 LEU A CD2 
1097 N N   . LEU A 156 ? 1.0436 1.4101 1.1608 0.1740  -0.1647 -0.0996 1032 LEU A N   
1098 C CA  . LEU A 156 ? 1.2542 1.6281 1.3722 0.1739  -0.1666 -0.1086 1032 LEU A CA  
1099 C C   . LEU A 156 ? 1.5411 1.9306 1.6531 0.1789  -0.1634 -0.1094 1032 LEU A C   
1100 O O   . LEU A 156 ? 1.6761 2.0747 1.7774 0.1796  -0.1607 -0.1090 1032 LEU A O   
1101 C CB  . LEU A 156 ? 1.2088 1.5763 1.3411 0.1720  -0.1719 -0.1158 1032 LEU A CB  
1102 C CG  . LEU A 156 ? 1.0636 1.4159 1.2031 0.1667  -0.1758 -0.1157 1032 LEU A CG  
1103 C CD1 . LEU A 156 ? 1.2262 1.5725 1.3801 0.1657  -0.1804 -0.1203 1032 LEU A CD1 
1104 C CD2 . LEU A 156 ? 0.9985 1.3486 1.1334 0.1633  -0.1772 -0.1201 1032 LEU A CD2 
1105 N N   . THR A 157 ? 1.9103 2.3034 2.0287 0.1824  -0.1635 -0.1100 1033 THR A N   
1106 C CA  . THR A 157 ? 2.1181 2.5261 2.2320 0.1874  -0.1608 -0.1110 1033 THR A CA  
1107 C C   . THR A 157 ? 2.0656 2.4740 2.1837 0.1913  -0.1594 -0.1069 1033 THR A C   
1108 O O   . THR A 157 ? 1.9183 2.3177 2.0471 0.1900  -0.1621 -0.1082 1033 THR A O   
1109 C CB  . THR A 157 ? 2.0349 2.4505 2.1536 0.1875  -0.1634 -0.1217 1033 THR A CB  
1110 O OG1 . THR A 157 ? 1.8107 2.2168 1.9427 0.1853  -0.1681 -0.1275 1033 THR A OG1 
1111 C CG2 . THR A 157 ? 1.9288 2.3481 2.0407 0.1849  -0.1634 -0.1257 1033 THR A CG2 
1112 N N   . LYS A 158 ? 1.8778 2.2974 1.9874 0.1962  -0.1551 -0.1021 1034 LYS A N   
1113 C CA  . LYS A 158 ? 1.4712 1.8926 1.5832 0.2006  -0.1532 -0.0983 1034 LYS A CA  
1114 C C   . LYS A 158 ? 1.6052 2.0329 1.7259 0.2025  -0.1553 -0.1065 1034 LYS A C   
1115 O O   . LYS A 158 ? 1.8296 2.2578 1.9542 0.2056  -0.1544 -0.1050 1034 LYS A O   
1116 C CB  . LYS A 158 ? 1.1283 1.5594 1.2276 0.2055  -0.1479 -0.0899 1034 LYS A CB  
1117 C CG  . LYS A 158 ? 0.8770 1.3068 0.9766 0.2101  -0.1452 -0.0833 1034 LYS A CG  
1118 C CD  . LYS A 158 ? 0.9589 1.3965 1.0449 0.2146  -0.1401 -0.0738 1034 LYS A CD  
1119 C CE  . LYS A 158 ? 1.2013 1.6359 1.2870 0.2195  -0.1372 -0.0666 1034 LYS A CE  
1120 N NZ  . LYS A 158 ? 1.2473 1.6915 1.3363 0.2239  -0.1368 -0.0704 1034 LYS A NZ  
1121 N N   . SER A 159 ? 1.7463 2.1787 1.8698 0.2007  -0.1580 -0.1154 1035 SER A N   
1122 C CA  . SER A 159 ? 1.6168 2.0554 1.7484 0.2024  -0.1601 -0.1239 1035 SER A CA  
1123 C C   . SER A 159 ? 1.6284 2.0564 1.7723 0.2012  -0.1629 -0.1254 1035 SER A C   
1124 O O   . SER A 159 ? 1.1774 1.5930 1.3282 0.1966  -0.1664 -0.1268 1035 SER A O   
1125 C CB  . SER A 159 ? 1.5365 1.9782 1.6703 0.1998  -0.1630 -0.1332 1035 SER A CB  
1126 O OG  . SER A 159 ? 1.5640 2.0167 1.6865 0.2007  -0.1602 -0.1323 1035 SER A OG  
1127 N N   . PRO A 160 ? 2.1016 2.5344 2.2483 0.2051  -0.1615 -0.1250 1036 PRO A N   
1128 C CA  . PRO A 160 ? 2.0887 2.5122 2.2469 0.2039  -0.1640 -0.1262 1036 PRO A CA  
1129 C C   . PRO A 160 ? 2.0049 2.4260 2.1742 0.2014  -0.1689 -0.1363 1036 PRO A C   
1130 O O   . PRO A 160 ? 1.9204 2.3477 2.0951 0.2039  -0.1694 -0.1417 1036 PRO A O   
1131 C CB  . PRO A 160 ? 2.1876 2.6193 2.3437 0.2095  -0.1605 -0.1236 1036 PRO A CB  
1132 C CG  . PRO A 160 ? 2.0287 2.4760 2.1762 0.2133  -0.1580 -0.1256 1036 PRO A CG  
1133 C CD  . PRO A 160 ? 2.1070 2.5544 2.2463 0.2109  -0.1575 -0.1232 1036 PRO A CD  
1134 N N   . SER A 161 ? 1.8779 2.2902 2.0507 0.1966  -0.1724 -0.1389 1037 SER A N   
1135 C CA  . SER A 161 ? 1.7517 2.1612 1.9345 0.1944  -0.1773 -0.1485 1037 SER A CA  
1136 C C   . SER A 161 ? 1.6127 2.0075 1.8005 0.1887  -0.1811 -0.1478 1037 SER A C   
1137 O O   . SER A 161 ? 1.8141 2.2070 1.9961 0.1865  -0.1812 -0.1471 1037 SER A O   
1138 C CB  . SER A 161 ? 1.8879 2.3091 2.0664 0.1963  -0.1771 -0.1557 1037 SER A CB  
1139 O OG  . SER A 161 ? 1.8529 2.2767 2.0206 0.1954  -0.1749 -0.1522 1037 SER A OG  
1140 N N   . LEU A 162 ? 1.4505 1.8355 1.6492 0.1863  -0.1843 -0.1479 1038 LEU A N   
1141 C CA  . LEU A 162 ? 1.4351 1.8060 1.6395 0.1808  -0.1883 -0.1470 1038 LEU A CA  
1142 C C   . LEU A 162 ? 1.5391 1.9084 1.7464 0.1789  -0.1923 -0.1553 1038 LEU A C   
1143 O O   . LEU A 162 ? 1.7141 2.0751 1.9199 0.1751  -0.1941 -0.1542 1038 LEU A O   
1144 C CB  . LEU A 162 ? 1.2830 1.6454 1.4990 0.1789  -0.1910 -0.1461 1038 LEU A CB  
1145 C CG  . LEU A 162 ? 1.3471 1.6948 1.5699 0.1731  -0.1952 -0.1437 1038 LEU A CG  
1146 C CD1 . LEU A 162 ? 1.2856 1.6282 1.5001 0.1711  -0.1925 -0.1348 1038 LEU A CD1 
1147 C CD2 . LEU A 162 ? 1.4664 1.8086 1.7008 0.1717  -0.1976 -0.1434 1038 LEU A CD2 
1148 N N   . ASN A 163 ? 1.7456 2.1230 1.9565 0.1817  -0.1934 -0.1638 1039 ASN A N   
1149 C CA  . ASN A 163 ? 1.7878 2.1649 2.0013 0.1807  -0.1969 -0.1725 1039 ASN A CA  
1150 C C   . ASN A 163 ? 1.6950 2.0765 1.8969 0.1806  -0.1946 -0.1717 1039 ASN A C   
1151 O O   . ASN A 163 ? 1.7494 2.1228 1.9512 0.1772  -0.1971 -0.1729 1039 ASN A O   
1152 C CB  . ASN A 163 ? 1.8813 2.2687 2.0995 0.1847  -0.1976 -0.1813 1039 ASN A CB  
1153 C CG  . ASN A 163 ? 1.8628 2.2488 2.0865 0.1841  -0.2020 -0.1915 1039 ASN A CG  
1154 O OD1 . ASN A 163 ? 2.0128 2.3877 2.2395 0.1805  -0.2056 -0.1923 1039 ASN A OD1 
1155 N ND2 . ASN A 163 ? 1.8827 2.2799 2.1076 0.1880  -0.2017 -0.1995 1039 ASN A ND2 
1156 N N   . ALA A 164 ? 1.5266 1.9208 1.7186 0.1841  -0.1897 -0.1691 1040 ALA A N   
1157 C CA  . ALA A 164 ? 1.5432 1.9431 1.7236 0.1841  -0.1870 -0.1682 1040 ALA A CA  
1158 C C   . ALA A 164 ? 1.5795 1.9700 1.7543 0.1805  -0.1860 -0.1598 1040 ALA A C   
1159 O O   . ALA A 164 ? 1.7378 2.1277 1.9062 0.1786  -0.1857 -0.1604 1040 ALA A O   
1160 C CB  . ALA A 164 ? 1.4773 1.8936 1.6486 0.1888  -0.1821 -0.1668 1040 ALA A CB  
1161 N N   . ALA A 165 ? 1.5304 1.9137 1.7077 0.1796  -0.1853 -0.1523 1041 ALA A N   
1162 C CA  . ALA A 165 ? 1.4482 1.8221 1.6206 0.1762  -0.1845 -0.1446 1041 ALA A CA  
1163 C C   . ALA A 165 ? 1.5404 1.9013 1.7191 0.1712  -0.1893 -0.1476 1041 ALA A C   
1164 O O   . ALA A 165 ? 1.7537 2.1105 1.9261 0.1685  -0.1889 -0.1456 1041 ALA A O   
1165 C CB  . ALA A 165 ? 1.6209 1.9906 1.7948 0.1768  -0.1825 -0.1362 1041 ALA A CB  
1166 N N   . LYS A 166 ? 1.2916 1.6463 1.4826 0.1700  -0.1939 -0.1526 1042 LYS A N   
1167 C CA  . LYS A 166 ? 1.2228 1.5654 1.4199 0.1657  -0.1988 -0.1558 1042 LYS A CA  
1168 C C   . LYS A 166 ? 1.3279 1.6744 1.5206 0.1659  -0.1997 -0.1631 1042 LYS A C   
1169 O O   . LYS A 166 ? 1.5969 1.9353 1.7878 0.1625  -0.2015 -0.1632 1042 LYS A O   
1170 C CB  . LYS A 166 ? 1.1488 1.4848 1.3601 0.1648  -0.2037 -0.1599 1042 LYS A CB  
1171 N N   . SER A 167 ? 1.3379 1.6971 1.5280 0.1699  -0.1981 -0.1691 1043 SER A N   
1172 C CA  . SER A 167 ? 1.5084 1.8722 1.6938 0.1702  -0.1985 -0.1760 1043 SER A CA  
1173 C C   . SER A 167 ? 1.4086 1.7756 1.5807 0.1692  -0.1944 -0.1710 1043 SER A C   
1174 O O   . SER A 167 ? 1.4652 1.8278 1.6341 0.1667  -0.1955 -0.1734 1043 SER A O   
1175 C CB  . SER A 167 ? 1.6463 2.0238 1.8322 0.1748  -0.1976 -0.1838 1043 SER A CB  
1176 O OG  . SER A 167 ? 1.5630 1.9452 1.7451 0.1752  -0.1981 -0.1909 1043 SER A OG  
1177 N N   . GLU A 168 ? 1.6567 2.0312 1.8210 0.1711  -0.1896 -0.1639 1044 GLU A N   
1178 C CA  . GLU A 168 ? 1.8701 2.2482 2.0215 0.1703  -0.1855 -0.1585 1044 GLU A CA  
1179 C C   . GLU A 168 ? 1.9041 2.2685 2.0547 0.1656  -0.1867 -0.1536 1044 GLU A C   
1180 O O   . GLU A 168 ? 2.0506 2.4154 2.1920 0.1638  -0.1848 -0.1523 1044 GLU A O   
1181 C CB  . GLU A 168 ? 2.0305 2.4181 2.1749 0.1736  -0.1806 -0.1512 1044 GLU A CB  
1182 N N   . LEU A 169 ? 1.7570 2.1096 1.9170 0.1634  -0.1898 -0.1508 1045 LEU A N   
1183 C CA  . LEU A 169 ? 1.5280 1.8672 1.6886 0.1587  -0.1917 -0.1468 1045 LEU A CA  
1184 C C   . LEU A 169 ? 1.4138 1.7457 1.5788 0.1560  -0.1961 -0.1541 1045 LEU A C   
1185 O O   . LEU A 169 ? 1.4429 1.7679 1.6035 0.1527  -0.1964 -0.1526 1045 LEU A O   
1186 C CB  . LEU A 169 ? 1.5337 1.8636 1.7030 0.1572  -0.1934 -0.1410 1045 LEU A CB  
1187 C CG  . LEU A 169 ? 1.3929 1.7093 1.5635 0.1523  -0.1951 -0.1358 1045 LEU A CG  
1188 C CD1 . LEU A 169 ? 1.2801 1.5984 1.4379 0.1517  -0.1906 -0.1294 1045 LEU A CD1 
1189 C CD2 . LEU A 169 ? 1.2872 1.5963 1.4677 0.1511  -0.1969 -0.1310 1045 LEU A CD2 
1190 N N   . ASP A 170 ? 1.4553 1.7889 1.6289 0.1578  -0.1995 -0.1622 1046 ASP A N   
1191 C CA  . ASP A 170 ? 1.3270 1.6537 1.5053 0.1560  -0.2040 -0.1696 1046 ASP A CA  
1192 C C   . ASP A 170 ? 1.2588 1.5914 1.4266 0.1562  -0.2016 -0.1731 1046 ASP A C   
1193 O O   . ASP A 170 ? 1.2603 1.5845 1.4270 0.1533  -0.2035 -0.1746 1046 ASP A O   
1194 C CB  . ASP A 170 ? 1.2263 1.5551 1.4152 0.1587  -0.2077 -0.1779 1046 ASP A CB  
1195 N N   . LYS A 171 ? 1.2908 1.6380 1.4506 0.1595  -0.1973 -0.1745 1047 LYS A N   
1196 C CA  . LYS A 171 ? 1.4868 1.8404 1.6364 0.1595  -0.1947 -0.1776 1047 LYS A CA  
1197 C C   . LYS A 171 ? 1.5276 1.8769 1.6674 0.1561  -0.1917 -0.1700 1047 LYS A C   
1198 O O   . LYS A 171 ? 1.6179 1.9661 1.7515 0.1543  -0.1910 -0.1724 1047 LYS A O   
1199 C CB  . LYS A 171 ? 1.6253 1.9965 1.7689 0.1636  -0.1908 -0.1805 1047 LYS A CB  
1200 C CG  . LYS A 171 ? 1.5184 1.8988 1.6490 0.1634  -0.1863 -0.1804 1047 LYS A CG  
1201 C CD  . LYS A 171 ? 1.4230 1.8011 1.5533 0.1622  -0.1881 -0.1882 1047 LYS A CD  
1202 C CE  . LYS A 171 ? 1.6418 2.0310 1.7593 0.1621  -0.1830 -0.1880 1047 LYS A CE  
1203 N NZ  . LYS A 171 ? 1.5317 1.9128 1.6452 0.1586  -0.1834 -0.1895 1047 LYS A NZ  
1204 N N   . ALA A 172 ? 1.2523 1.5991 1.3904 0.1555  -0.1898 -0.1612 1048 ALA A N   
1205 C CA  . ALA A 172 ? 1.1437 1.4869 1.2724 0.1527  -0.1867 -0.1538 1048 ALA A CA  
1206 C C   . ALA A 172 ? 1.1456 1.4728 1.2794 0.1482  -0.1901 -0.1510 1048 ALA A C   
1207 O O   . ALA A 172 ? 1.1991 1.5222 1.3264 0.1458  -0.1878 -0.1443 1048 ALA A O   
1208 C CB  . ALA A 172 ? 1.0897 1.4391 1.2133 0.1548  -0.1826 -0.1454 1048 ALA A CB  
1209 N N   . ILE A 173 ? 1.2798 1.5980 1.4250 0.1471  -0.1956 -0.1558 1049 ILE A N   
1210 C CA  . ILE A 173 ? 1.4177 1.7209 1.5677 0.1426  -0.1991 -0.1535 1049 ILE A CA  
1211 C C   . ILE A 173 ? 1.7166 2.0146 1.8698 0.1416  -0.2029 -0.1617 1049 ILE A C   
1212 O O   . ILE A 173 ? 1.6936 1.9818 1.8457 0.1381  -0.2045 -0.1608 1049 ILE A O   
1213 C CB  . ILE A 173 ? 1.3593 1.6545 1.5212 0.1418  -0.2025 -0.1496 1049 ILE A CB  
1214 C CG1 . ILE A 173 ? 1.2501 1.5309 1.4157 0.1368  -0.2054 -0.1453 1049 ILE A CG1 
1215 C CG2 . ILE A 173 ? 1.7528 2.0486 1.9261 0.1440  -0.2067 -0.1569 1049 ILE A CG2 
1216 C CD1 . ILE A 173 ? 1.3495 1.6295 1.5056 0.1347  -0.2013 -0.1372 1049 ILE A CD1 
1217 N N   . GLY A 174 ? 1.8810 2.1859 2.0381 0.1450  -0.2043 -0.1698 1050 GLY A N   
1218 C CA  . GLY A 174 ? 1.7818 2.0832 1.9421 0.1452  -0.2078 -0.1784 1050 GLY A CA  
1219 C C   . GLY A 174 ? 1.8176 2.1121 1.9921 0.1461  -0.2139 -0.1835 1050 GLY A C   
1220 O O   . GLY A 174 ? 2.1989 2.4975 2.3772 0.1491  -0.2159 -0.1923 1050 GLY A O   
1221 N N   . ARG A 175 ? 1.6328 1.9171 1.8155 0.1436  -0.2169 -0.1782 1051 ARG A N   
1222 C CA  . ARG A 175 ? 1.4996 1.7763 1.6961 0.1440  -0.2230 -0.1823 1051 ARG A CA  
1223 C C   . ARG A 175 ? 1.7269 2.0101 1.9293 0.1464  -0.2224 -0.1812 1051 ARG A C   
1224 O O   . ARG A 175 ? 1.8381 2.1318 2.0338 0.1483  -0.2174 -0.1776 1051 ARG A O   
1225 C CB  . ARG A 175 ? 1.0890 1.3498 1.2916 0.1393  -0.2272 -0.1776 1051 ARG A CB  
1226 N N   . ASN A 176 ? 1.8254 2.1024 2.0407 0.1466  -0.2276 -0.1846 1052 ASN A N   
1227 C CA  . ASN A 176 ? 1.9339 2.2158 2.1557 0.1486  -0.2273 -0.1835 1052 ASN A CA  
1228 C C   . ASN A 176 ? 2.0260 2.3022 2.2489 0.1453  -0.2262 -0.1731 1052 ASN A C   
1229 O O   . ASN A 176 ? 2.1166 2.3806 2.3429 0.1411  -0.2291 -0.1689 1052 ASN A O   
1230 C CB  . ASN A 176 ? 1.9542 2.2314 2.1895 0.1499  -0.2333 -0.1911 1052 ASN A CB  
1231 C CG  . ASN A 176 ? 2.2200 2.5041 2.4616 0.1525  -0.2327 -0.1915 1052 ASN A CG  
1232 O OD1 . ASN A 176 ? 2.3887 2.6828 2.6237 0.1542  -0.2274 -0.1873 1052 ASN A OD1 
1233 N ND2 . ASN A 176 ? 2.3725 2.6512 2.6268 0.1529  -0.2380 -0.1967 1052 ASN A ND2 
1234 N N   . THR A 177 ? 2.1687 2.4542 2.3887 0.1475  -0.2219 -0.1691 1053 THR A N   
1235 C CA  . THR A 177 ? 2.2481 2.5301 2.4676 0.1452  -0.2198 -0.1592 1053 THR A CA  
1236 C C   . THR A 177 ? 2.1232 2.3984 2.3560 0.1438  -0.2238 -0.1581 1053 THR A C   
1237 O O   . THR A 177 ? 1.8417 2.1060 2.0792 0.1395  -0.2263 -0.1526 1053 THR A O   
1238 C CB  . THR A 177 ? 2.3934 2.6881 2.6037 0.1485  -0.2135 -0.1552 1053 THR A CB  
1239 O OG1 . THR A 177 ? 2.5069 2.8120 2.7200 0.1531  -0.2129 -0.1612 1053 THR A OG1 
1240 C CG2 . THR A 177 ? 2.0950 2.3949 2.2917 0.1488  -0.2094 -0.1542 1053 THR A CG2 
1241 N N   . ASN A 178 ? 1.9490 2.2314 2.1876 0.1474  -0.2242 -0.1629 1054 ASN A N   
1242 C CA  . ASN A 178 ? 1.7955 2.0743 2.0462 0.1468  -0.2272 -0.1626 1054 ASN A CA  
1243 C C   . ASN A 178 ? 1.6576 1.9377 1.9064 0.1460  -0.2235 -0.1533 1054 ASN A C   
1244 O O   . ASN A 178 ? 1.6400 1.9213 1.8964 0.1468  -0.2240 -0.1527 1054 ASN A O   
1245 C CB  . ASN A 178 ? 1.7426 2.0069 2.0041 0.1426  -0.2341 -0.1642 1054 ASN A CB  
1246 C CG  . ASN A 178 ? 1.6837 1.9436 1.9579 0.1413  -0.2374 -0.1631 1054 ASN A CG  
1247 O OD1 . ASN A 178 ? 1.5485 1.8167 1.8258 0.1447  -0.2360 -0.1659 1054 ASN A OD1 
1248 N ND2 . ASN A 178 ? 1.6975 1.9445 1.9790 0.1363  -0.2418 -0.1591 1054 ASN A ND2 
1249 N N   . GLY A 179 ? 1.6877 1.9687 1.9260 0.1451  -0.2193 -0.1464 1055 GLY A N   
1250 C CA  . GLY A 179 ? 1.7908 2.0733 2.0265 0.1449  -0.2154 -0.1377 1055 GLY A CA  
1251 C C   . GLY A 179 ? 1.7340 2.0069 1.9673 0.1402  -0.2154 -0.1298 1055 GLY A C   
1252 O O   . GLY A 179 ? 1.6815 1.9577 1.9066 0.1409  -0.2107 -0.1232 1055 GLY A O   
1253 N N   . VAL A 180 ? 1.4398 1.7010 1.6801 0.1355  -0.2206 -0.1303 1056 VAL A N   
1254 C CA  . VAL A 180 ? 1.4218 1.6735 1.6607 0.1305  -0.2210 -0.1229 1056 VAL A CA  
1255 C C   . VAL A 180 ? 1.2829 1.5324 1.5126 0.1293  -0.2205 -0.1242 1056 VAL A C   
1256 O O   . VAL A 180 ? 1.1814 1.4294 1.4122 0.1297  -0.2235 -0.1314 1056 VAL A O   
1257 C CB  . VAL A 180 ? 1.7040 1.9439 1.9560 0.1255  -0.2271 -0.1217 1056 VAL A CB  
1258 C CG1 . VAL A 180 ? 1.8607 2.0920 2.1113 0.1201  -0.2271 -0.1132 1056 VAL A CG1 
1259 C CG2 . VAL A 180 ? 1.7594 2.0024 2.0209 0.1267  -0.2279 -0.1218 1056 VAL A CG2 
1260 N N   . ILE A 181 ? 1.1907 1.4403 1.4114 0.1281  -0.2165 -0.1175 1057 ILE A N   
1261 C CA  . ILE A 181 ? 1.1837 1.4322 1.3942 0.1270  -0.2151 -0.1182 1057 ILE A CA  
1262 C C   . ILE A 181 ? 1.4427 1.6811 1.6533 0.1217  -0.2160 -0.1112 1057 ILE A C   
1263 O O   . ILE A 181 ? 1.7741 2.0121 1.9852 0.1207  -0.2137 -0.1040 1057 ILE A O   
1264 C CB  . ILE A 181 ? 1.1527 1.4132 1.3501 0.1313  -0.2088 -0.1177 1057 ILE A CB  
1265 C CG1 . ILE A 181 ? 1.3264 1.5956 1.5213 0.1353  -0.2087 -0.1264 1057 ILE A CG1 
1266 C CG2 . ILE A 181 ? 1.0034 1.2619 1.1899 0.1291  -0.2060 -0.1139 1057 ILE A CG2 
1267 C CD1 . ILE A 181 ? 1.5397 1.8148 1.7424 0.1388  -0.2096 -0.1300 1057 ILE A CD1 
1268 N N   . THR A 182 ? 1.4762 1.7068 1.6862 0.1183  -0.2191 -0.1135 1058 THR A N   
1269 C CA  . THR A 182 ? 1.2842 1.5046 1.4950 0.1128  -0.2205 -0.1074 1058 THR A CA  
1270 C C   . THR A 182 ? 1.2263 1.4509 1.4251 0.1129  -0.2147 -0.1018 1058 THR A C   
1271 O O   . THR A 182 ? 1.1671 1.4017 1.3560 0.1172  -0.2099 -0.1032 1058 THR A O   
1272 C CB  . THR A 182 ? 1.2842 1.4957 1.4969 0.1099  -0.2252 -0.1120 1058 THR A CB  
1273 O OG1 . THR A 182 ? 1.3339 1.5512 1.5356 0.1125  -0.2226 -0.1174 1058 THR A OG1 
1274 C CG2 . THR A 182 ? 1.2819 1.4887 1.5070 0.1101  -0.2313 -0.1176 1058 THR A CG2 
1275 N N   . LYS A 183 ? 1.0654 1.2821 1.2652 0.1080  -0.2153 -0.0954 1059 LYS A N   
1276 C CA  . LYS A 183 ? 1.1638 1.3837 1.3531 0.1080  -0.2101 -0.0899 1059 LYS A CA  
1277 C C   . LYS A 183 ? 1.3291 1.5523 1.5058 0.1090  -0.2075 -0.0942 1059 LYS A C   
1278 O O   . LYS A 183 ? 1.3623 1.5934 1.5277 0.1118  -0.2021 -0.0926 1059 LYS A O   
1279 C CB  . LYS A 183 ? 1.1492 1.3599 1.3435 0.1021  -0.2116 -0.0825 1059 LYS A CB  
1280 C CG  . LYS A 183 ? 1.3977 1.6116 1.5825 0.1022  -0.2062 -0.0767 1059 LYS A CG  
1281 C CD  . LYS A 183 ? 1.4550 1.6579 1.6440 0.0948  -0.2044 -0.0676 1059 LYS A CD  
1282 C CE  . LYS A 183 ? 1.3730 1.5701 1.5448 0.0903  -0.1902 -0.0593 1059 LYS A CE  
1283 N NZ  . LYS A 183 ? 1.2794 1.4747 1.4416 0.0886  -0.1891 -0.0620 1059 LYS A NZ  
1284 N N   . ASP A 184 ? 1.2564 1.4739 1.4345 0.1070  -0.2114 -0.0997 1060 ASP A N   
1285 C CA  . ASP A 184 ? 1.1128 1.3334 1.2791 0.1077  -0.2091 -0.1045 1060 ASP A CA  
1286 C C   . ASP A 184 ? 1.0313 1.2643 1.1901 0.1132  -0.2054 -0.1095 1060 ASP A C   
1287 O O   . ASP A 184 ? 1.0890 1.3289 1.2352 0.1146  -0.2005 -0.1096 1060 ASP A O   
1288 C CB  . ASP A 184 ? 1.3038 1.5156 1.4744 0.1051  -0.2143 -0.1098 1060 ASP A CB  
1289 C CG  . ASP A 184 ? 1.5049 1.7055 1.6785 0.0992  -0.2169 -0.1048 1060 ASP A CG  
1290 O OD1 . ASP A 184 ? 1.6159 1.8119 1.7971 0.0964  -0.2181 -0.0979 1060 ASP A OD1 
1291 O OD2 . ASP A 184 ? 1.6283 1.8247 1.7970 0.0974  -0.2177 -0.1078 1060 ASP A OD2 
1292 N N   . GLU A 185 ? 1.0673 1.3035 1.2336 0.1162  -0.2077 -0.1137 1061 GLU A N   
1293 C CA  . GLU A 185 ? 1.1218 1.3702 1.2819 0.1213  -0.2044 -0.1184 1061 GLU A CA  
1294 C C   . GLU A 185 ? 0.9568 1.2141 1.1089 0.1240  -0.1986 -0.1125 1061 GLU A C   
1295 O O   . GLU A 185 ? 0.8087 1.0758 0.9497 0.1269  -0.1942 -0.1141 1061 GLU A O   
1296 C CB  . GLU A 185 ? 1.2759 1.5257 1.4468 0.1238  -0.2081 -0.1236 1061 GLU A CB  
1297 C CG  . GLU A 185 ? 1.5339 1.7747 1.7131 0.1217  -0.2142 -0.1296 1061 GLU A CG  
1298 C CD  . GLU A 185 ? 1.5560 1.7986 1.7456 0.1245  -0.2178 -0.1356 1061 GLU A CD  
1299 O OE1 . GLU A 185 ? 1.6158 1.8647 1.8085 0.1271  -0.2162 -0.1338 1061 GLU A OE1 
1300 O OE2 . GLU A 185 ? 1.4246 1.6624 1.6193 0.1244  -0.2222 -0.1423 1061 GLU A OE2 
1301 N N   . ALA A 186 ? 0.7702 1.0241 0.9276 0.1232  -0.1983 -0.1054 1062 ALA A N   
1302 C CA  . ALA A 186 ? 0.8258 1.0872 0.9760 0.1263  -0.1928 -0.0993 1062 ALA A CA  
1303 C C   . ALA A 186 ? 0.9572 1.2198 1.0944 0.1251  -0.1887 -0.0963 1062 ALA A C   
1304 O O   . ALA A 186 ? 0.8714 1.1434 0.9976 0.1286  -0.1835 -0.0945 1062 ALA A O   
1305 C CB  . ALA A 186 ? 0.8360 1.0928 0.9953 0.1256  -0.1936 -0.0927 1062 ALA A CB  
1306 N N   . GLU A 187 ? 1.0861 1.3396 1.2238 0.1202  -0.1907 -0.0955 1063 GLU A N   
1307 C CA  . GLU A 187 ? 0.9818 1.2370 1.1065 0.1190  -0.1865 -0.0933 1063 GLU A CA  
1308 C C   . GLU A 187 ? 0.9776 1.2406 1.0909 0.1205  -0.1840 -0.0996 1063 GLU A C   
1309 O O   . GLU A 187 ? 0.9400 1.2105 1.0402 0.1220  -0.1787 -0.0977 1063 GLU A O   
1310 C CB  . GLU A 187 ? 0.9359 1.1799 1.0641 0.1131  -0.1893 -0.0915 1063 GLU A CB  
1311 C CG  . GLU A 187 ? 1.0709 1.3064 1.2066 0.1100  -0.1886 -0.0831 1063 GLU A CG  
1312 C CD  . GLU A 187 ? 1.3581 1.5874 1.4790 0.1065  -0.1737 -0.0725 1063 GLU A CD  
1313 O OE1 . GLU A 187 ? 1.4367 1.6722 1.5438 0.1085  -0.1672 -0.0727 1063 GLU A OE1 
1314 O OE2 . GLU A 187 ? 1.3523 1.5708 1.4757 0.1015  -0.1685 -0.0642 1063 GLU A OE2 
1315 N N   . LYS A 188 ? 0.9875 1.2493 1.1056 0.1204  -0.1877 -0.1071 1064 LYS A N   
1316 C CA  . LYS A 188 ? 0.9744 1.2444 1.0831 0.1222  -0.1855 -0.1137 1064 LYS A CA  
1317 C C   . LYS A 188 ? 1.0730 1.3564 1.1747 0.1270  -0.1809 -0.1123 1064 LYS A C   
1318 O O   . LYS A 188 ? 0.9871 1.2786 1.0755 0.1278  -0.1760 -0.1118 1064 LYS A O   
1319 C CB  . LYS A 188 ? 1.1258 1.3925 1.2432 0.1221  -0.1906 -0.1217 1064 LYS A CB  
1320 C CG  . LYS A 188 ? 1.2000 1.4725 1.3095 0.1229  -0.1892 -0.1293 1064 LYS A CG  
1321 C CD  . LYS A 188 ? 1.1569 1.4294 1.2757 0.1250  -0.1936 -0.1372 1064 LYS A CD  
1322 C CE  . LYS A 188 ? 1.2855 1.5443 1.4160 0.1220  -0.1998 -0.1384 1064 LYS A CE  
1323 N NZ  . LYS A 188 ? 1.1402 1.3989 1.2820 0.1246  -0.2044 -0.1445 1064 LYS A NZ  
1324 N N   . LEU A 189 ? 0.9551 1.2410 1.0654 0.1302  -0.1823 -0.1114 1065 LEU A N   
1325 C CA  . LEU A 189 ? 0.9356 1.2341 1.0399 0.1351  -0.1781 -0.1096 1065 LEU A CA  
1326 C C   . LEU A 189 ? 0.8787 1.1806 0.9728 0.1361  -0.1728 -0.1012 1065 LEU A C   
1327 O O   . LEU A 189 ? 0.7719 1.0848 0.8553 0.1392  -0.1682 -0.0996 1065 LEU A O   
1328 C CB  . LEU A 189 ? 0.9265 1.2261 1.0423 0.1381  -0.1806 -0.1099 1065 LEU A CB  
1329 N N   . PHE A 190 ? 0.9283 1.2214 1.0255 0.1337  -0.1733 -0.0955 1066 PHE A N   
1330 C CA  . PHE A 190 ? 0.8670 1.1628 0.9549 0.1349  -0.1681 -0.0873 1066 PHE A CA  
1331 C C   . PHE A 190 ? 0.9759 1.2756 1.0477 0.1330  -0.1634 -0.0876 1066 PHE A C   
1332 O O   . PHE A 190 ? 1.1158 1.4172 1.1741 0.1330  -0.1541 -0.0814 1066 PHE A O   
1333 C CB  . PHE A 190 ? 0.8409 1.1202 0.9346 0.1296  -0.1663 -0.0806 1066 PHE A CB  
1334 C CG  . PHE A 190 ? 0.8691 1.1364 0.9502 0.1250  -0.1527 -0.0688 1066 PHE A CG  
1335 C CD1 . PHE A 190 ? 0.8526 1.1237 0.9276 0.1285  -0.1463 -0.0631 1066 PHE A CD1 
1336 C CD2 . PHE A 190 ? 1.0313 1.2835 1.1073 0.1171  -0.1464 -0.0635 1066 PHE A CD2 
1337 C CE1 . PHE A 190 ? 0.8201 1.0796 0.8843 0.1244  -0.1342 -0.0527 1066 PHE A CE1 
1338 C CE2 . PHE A 190 ? 1.0080 1.2497 1.0735 0.1129  -0.1341 -0.0534 1066 PHE A CE2 
1339 C CZ  . PHE A 190 ? 0.9907 1.2358 1.0506 0.1166  -0.1281 -0.0481 1066 PHE A CZ  
1340 N N   . ASN A 191 ? 1.0646 1.3596 1.1361 0.1288  -0.1661 -0.0932 1067 ASN A N   
1341 C CA  . ASN A 191 ? 1.0676 1.3674 1.1240 0.1269  -0.1620 -0.0951 1067 ASN A CA  
1342 C C   . ASN A 191 ? 1.0443 1.3568 1.0927 0.1300  -0.1592 -0.0983 1067 ASN A C   
1343 O O   . ASN A 191 ? 0.9494 1.2701 0.9833 0.1304  -0.1537 -0.0952 1067 ASN A O   
1344 C CB  . ASN A 191 ? 1.0552 1.3465 1.1136 0.1219  -0.1652 -0.1014 1067 ASN A CB  
1345 C CG  . ASN A 191 ? 1.1174 1.3960 1.1766 0.1169  -0.1639 -0.0964 1067 ASN A CG  
1346 O OD1 . ASN A 191 ? 1.3821 1.6497 1.4501 0.1150  -0.1631 -0.0902 1067 ASN A OD1 
1347 N ND2 . ASN A 191 ? 1.1605 1.4352 1.2087 0.1122  -0.1596 -0.0974 1067 ASN A ND2 
1348 N N   . GLN A 192 ? 0.9259 1.2406 0.9834 0.1321  -0.1627 -0.1039 1068 GLN A N   
1349 C CA  . GLN A 192 ? 1.0665 1.3943 1.1176 0.1352  -0.1602 -0.1070 1068 GLN A CA  
1350 C C   . GLN A 192 ? 1.0025 1.3395 1.0460 0.1392  -0.1555 -0.0990 1068 GLN A C   
1351 O O   . GLN A 192 ? 0.8464 1.1938 0.8769 0.1400  -0.1509 -0.0976 1068 GLN A O   
1352 C CB  . GLN A 192 ? 1.3179 1.6467 1.3811 0.1372  -0.1647 -0.1139 1068 GLN A CB  
1353 C CG  . GLN A 192 ? 1.3154 1.6360 1.3851 0.1340  -0.1690 -0.1219 1068 GLN A CG  
1354 C CD  . GLN A 192 ? 1.3858 1.7068 1.4678 0.1363  -0.1735 -0.1280 1068 GLN A CD  
1355 O OE1 . GLN A 192 ? 1.3964 1.7246 1.4815 0.1401  -0.1731 -0.1270 1068 GLN A OE1 
1356 N NE2 . GLN A 192 ? 1.4631 1.7763 1.5519 0.1341  -0.1778 -0.1345 1068 GLN A NE2 
1357 N N   . ASP A 193 ? 0.9092 1.2426 0.9606 0.1419  -0.1566 -0.0934 1069 ASP A N   
1358 C CA  . ASP A 193 ? 0.9646 1.3060 1.0098 0.1466  -0.1523 -0.0853 1069 ASP A CA  
1359 C C   . ASP A 193 ? 0.9731 1.3096 1.0019 0.1431  -0.1434 -0.0768 1069 ASP A C   
1360 O O   . ASP A 193 ? 0.9186 1.2612 0.9354 0.1443  -0.1370 -0.0715 1069 ASP A O   
1361 C CB  . ASP A 193 ? 1.1117 1.4473 1.1690 0.1493  -0.1543 -0.0810 1069 ASP A CB  
1362 C CG  . ASP A 193 ? 1.2197 1.5541 1.2909 0.1502  -0.1592 -0.0879 1069 ASP A CG  
1363 O OD1 . ASP A 193 ? 1.1668 1.5092 1.2368 0.1510  -0.1598 -0.0942 1069 ASP A OD1 
1364 O OD2 . ASP A 193 ? 1.1814 1.5075 1.2646 0.1499  -0.1624 -0.0868 1069 ASP A OD2 
1365 N N   . VAL A 194 ? 0.9679 1.2869 0.9948 0.1360  -0.1393 -0.0741 1070 VAL A N   
1366 C CA  . VAL A 194 ? 0.9246 1.2310 0.9358 0.1297  -0.1267 -0.0649 1070 VAL A CA  
1367 C C   . VAL A 194 ? 1.0007 1.3179 0.9979 0.1286  -0.1247 -0.0685 1070 VAL A C   
1368 O O   . VAL A 194 ? 0.9282 1.2440 0.9113 0.1266  -0.1153 -0.0612 1070 VAL A O   
1369 C CB  . VAL A 194 ? 0.7970 1.0837 0.8106 0.1226  -0.1230 -0.0616 1070 VAL A CB  
1370 C CG1 . VAL A 194 ? 0.8224 1.0972 0.8205 0.1161  -0.1101 -0.0533 1070 VAL A CG1 
1371 C CG2 . VAL A 194 ? 0.8708 1.1477 0.8970 0.1232  -0.1241 -0.0570 1070 VAL A CG2 
1372 N N   . ASP A 195 ? 0.9546 1.2831 0.9557 0.1297  -0.1337 -0.0799 1071 ASP A N   
1373 C CA  . ASP A 195 ? 0.9517 1.2933 0.9400 0.1290  -0.1327 -0.0845 1071 ASP A CA  
1374 C C   . ASP A 195 ? 1.0451 1.4046 1.0281 0.1344  -0.1326 -0.0834 1071 ASP A C   
1375 O O   . ASP A 195 ? 1.0206 1.3847 0.9883 0.1320  -0.1256 -0.0796 1071 ASP A O   
1376 C CB  . ASP A 195 ? 0.8966 1.2424 0.8915 0.1282  -0.1405 -0.0969 1071 ASP A CB  
1377 N N   . ALA A 196 ? 0.9808 1.3468 0.9762 0.1401  -0.1381 -0.0856 1072 ALA A N   
1378 C CA  . ALA A 196 ? 0.8707 1.2501 0.8616 0.1441  -0.1357 -0.0832 1072 ALA A CA  
1379 C C   . ALA A 196 ? 0.8010 1.1767 0.7798 0.1443  -0.1274 -0.0701 1072 ALA A C   
1380 O O   . ALA A 196 ? 0.7110 1.0969 0.6777 0.1448  -0.1230 -0.0664 1072 ALA A O   
1381 C CB  . ALA A 196 ? 0.6386 1.0195 0.6448 0.1485  -0.1402 -0.0869 1072 ALA A CB  
1382 N N   . ALA A 197 ? 0.7507 1.1050 0.7325 0.1412  -0.1216 -0.0622 1073 ALA A N   
1383 C CA  . ALA A 197 ? 0.7414 1.0834 0.7126 0.1390  -0.1102 -0.0491 1073 ALA A CA  
1384 C C   . ALA A 197 ? 0.7751 1.1124 0.7288 0.1325  -0.1011 -0.0449 1073 ALA A C   
1385 O O   . ALA A 197 ? 0.8841 1.2249 0.8263 0.1327  -0.0949 -0.0377 1073 ALA A O   
1386 C CB  . ALA A 197 ? 0.6281 0.9488 0.6064 0.1364  -0.1062 -0.0428 1073 ALA A CB  
1387 N N   . VAL A 198 ? 0.7642 1.0941 0.7159 0.1267  -0.1004 -0.0492 1074 VAL A N   
1388 C CA  . VAL A 198 ? 0.9775 1.3025 0.9126 0.1203  -0.0912 -0.0453 1074 VAL A CA  
1389 C C   . VAL A 198 ? 1.1535 1.5002 1.0792 0.1222  -0.0938 -0.0499 1074 VAL A C   
1390 O O   . VAL A 198 ? 1.2562 1.6027 1.1674 0.1190  -0.0856 -0.0430 1074 VAL A O   
1391 C CB  . VAL A 198 ? 0.7985 1.1112 0.7329 0.1136  -0.0892 -0.0489 1074 VAL A CB  
1392 C CG1 . VAL A 198 ? 0.7776 1.0694 0.7198 0.1109  -0.0851 -0.0427 1074 VAL A CG1 
1393 C CG2 . VAL A 198 ? 1.1268 1.4519 1.0690 0.1155  -0.1005 -0.0623 1074 VAL A CG2 
1394 N N   . ARG A 199 ? 1.1302 1.4964 1.0641 0.1272  -0.1052 -0.0613 1075 ARG A N   
1395 C CA  . ARG A 199 ? 0.9544 1.3437 0.8799 0.1291  -0.1081 -0.0661 1075 ARG A CA  
1396 C C   . ARG A 199 ? 1.1871 1.5849 1.1080 0.1331  -0.1051 -0.0577 1075 ARG A C   
1397 O O   . ARG A 199 ? 1.0975 1.5069 1.0055 0.1318  -0.1016 -0.0551 1075 ARG A O   
1398 C CB  . ARG A 199 ? 0.8289 1.2305 0.7677 0.1320  -0.1179 -0.0799 1075 ARG A CB  
1399 C CG  . ARG A 199 ? 0.9482 1.3417 0.8878 0.1264  -0.1184 -0.0880 1075 ARG A CG  
1400 C CD  . ARG A 199 ? 0.9795 1.3766 0.9319 0.1270  -0.1227 -0.0995 1075 ARG A CD  
1401 N NE  . ARG A 199 ? 1.0317 1.4247 1.0011 0.1315  -0.1294 -0.1028 1075 ARG A NE  
1402 C CZ  . ARG A 199 ? 1.2383 1.6186 1.2185 0.1305  -0.1340 -0.1069 1075 ARG A CZ  
1403 N NH1 . ARG A 199 ? 1.0362 1.4075 1.0119 0.1257  -0.1329 -0.1085 1075 ARG A NH1 
1404 N NH2 . ARG A 199 ? 1.3752 1.7517 1.3704 0.1340  -0.1396 -0.1093 1075 ARG A NH2 
1405 N N   . GLY A 200 ? 1.1854 1.5778 1.1166 0.1380  -0.1064 -0.0532 1076 GLY A N   
1406 C CA  . GLY A 200 ? 0.9324 1.3296 0.8589 0.1417  -0.1026 -0.0439 1076 GLY A CA  
1407 C C   . GLY A 200 ? 1.0619 1.4433 0.9727 0.1357  -0.0898 -0.0311 1076 GLY A C   
1408 O O   . GLY A 200 ? 0.8031 1.1942 0.7027 0.1358  -0.0863 -0.0255 1076 GLY A O   
1409 N N   . ILE A 201 ? 1.1680 1.5254 1.0783 0.1302  -0.0830 -0.0263 1077 ILE A N   
1410 C CA  . ILE A 201 ? 1.0429 1.3839 0.9399 0.1246  -0.0708 -0.0143 1077 ILE A CA  
1411 C C   . ILE A 201 ? 1.1359 1.4846 1.0174 0.1192  -0.0668 -0.0151 1077 ILE A C   
1412 O O   . ILE A 201 ? 0.9891 1.3377 0.8584 0.1174  -0.0601 -0.0062 1077 ILE A O   
1413 C CB  . ILE A 201 ? 0.9717 1.2876 0.8723 0.1196  -0.0648 -0.0107 1077 ILE A CB  
1414 C CG1 . ILE A 201 ? 0.9364 1.2453 0.8511 0.1247  -0.0680 -0.0087 1077 ILE A CG1 
1415 C CG2 . ILE A 201 ? 0.8774 1.1774 0.7649 0.1137  -0.0525 0.0004  1077 ILE A CG2 
1416 C CD1 . ILE A 201 ? 1.0304 1.3187 0.9515 0.1202  -0.0646 -0.0075 1077 ILE A CD1 
1417 N N   . LEU A 202 ? 1.3763 1.7317 1.2580 0.1163  -0.0709 -0.0256 1078 LEU A N   
1418 C CA  . LEU A 202 ? 1.3506 1.7137 1.2173 0.1108  -0.0670 -0.0271 1078 LEU A CA  
1419 C C   . LEU A 202 ? 1.4954 1.8843 1.3564 0.1144  -0.0715 -0.0289 1078 LEU A C   
1420 O O   . LEU A 202 ? 1.4181 1.8136 1.2648 0.1097  -0.0668 -0.0269 1078 LEU A O   
1421 C CB  . LEU A 202 ? 1.2014 1.5657 1.0698 0.1072  -0.0706 -0.0386 1078 LEU A CB  
1422 C CG  . LEU A 202 ? 0.9896 1.3301 0.8622 0.1025  -0.0656 -0.0371 1078 LEU A CG  
1423 C CD1 . LEU A 202 ? 0.9534 1.2985 0.8307 0.1012  -0.0723 -0.0498 1078 LEU A CD1 
1424 C CD2 . LEU A 202 ? 1.0058 1.3296 0.8649 0.0950  -0.0524 -0.0273 1078 LEU A CD2 
1425 N N   . ARG A 203 ? 1.6029 2.0073 1.4747 0.1225  -0.0804 -0.0327 1079 ARG A N   
1426 C CA  . ARG A 203 ? 1.4532 1.8840 1.3211 0.1267  -0.0851 -0.0342 1079 ARG A CA  
1427 C C   . ARG A 203 ? 1.3105 1.7396 1.1747 0.1298  -0.0804 -0.0212 1079 ARG A C   
1428 O O   . ARG A 203 ? 1.4325 1.8838 1.2967 0.1350  -0.0852 -0.0218 1079 ARG A O   
1429 C CB  . ARG A 203 ? 1.3623 1.8097 1.2473 0.1327  -0.0963 -0.0474 1079 ARG A CB  
1430 N N   . ASN A 204 ? 1.1796 1.5834 1.0412 0.1271  -0.0715 -0.0099 1080 ASN A N   
1431 C CA  . ASN A 204 ? 0.9320 1.3308 0.7896 0.1297  -0.0664 0.0031  1080 ASN A CA  
1432 C C   . ASN A 204 ? 0.8701 1.2558 0.7110 0.1221  -0.0552 0.0139  1080 ASN A C   
1433 O O   . ASN A 204 ? 1.0157 1.3829 0.8529 0.1153  -0.0488 0.0146  1080 ASN A O   
1434 C CB  . ASN A 204 ? 1.0068 1.3873 0.8763 0.1336  -0.0659 0.0070  1080 ASN A CB  
1435 C CG  . ASN A 204 ? 1.0638 1.4418 0.9311 0.1381  -0.0626 0.0188  1080 ASN A CG  
1436 O OD1 . ASN A 204 ? 0.8466 1.2159 0.7015 0.1344  -0.0544 0.0298  1080 ASN A OD1 
1437 N ND2 . ASN A 204 ? 0.9189 1.3045 0.7985 0.1463  -0.0691 0.0165  1080 ASN A ND2 
1438 N N   . ALA A 205 ? 0.9444 1.3400 0.7757 0.1230  -0.0529 0.0224  1081 ALA A N   
1439 C CA  . ALA A 205 ? 0.9853 1.3709 0.8004 0.1155  -0.0430 0.0325  1081 ALA A CA  
1440 C C   . ALA A 205 ? 1.0926 1.4490 0.9068 0.1134  -0.0339 0.0443  1081 ALA A C   
1441 O O   . ALA A 205 ? 1.3994 1.7407 1.2033 0.1058  -0.0251 0.0502  1081 ALA A O   
1442 C CB  . ALA A 205 ? 1.1360 1.5422 0.9413 0.1169  -0.0439 0.0384  1081 ALA A CB  
1443 N N   . LYS A 206 ? 1.1487 1.4975 0.9738 0.1199  -0.0360 0.0473  1082 LYS A N   
1444 C CA  . LYS A 206 ? 1.3556 1.6781 1.1811 0.1188  -0.0284 0.0576  1082 LYS A CA  
1445 C C   . LYS A 206 ? 1.3520 1.6565 1.1873 0.1166  -0.0271 0.0524  1082 LYS A C   
1446 O O   . LYS A 206 ? 1.3694 1.6523 1.2060 0.1151  -0.0207 0.0596  1082 LYS A O   
1447 C CB  . LYS A 206 ? 1.2847 1.6093 1.1157 0.1272  -0.0309 0.0645  1082 LYS A CB  
1448 N N   . LEU A 207 ? 1.2212 1.5342 1.0636 0.1163  -0.0332 0.0401  1083 LEU A N   
1449 C CA  . LEU A 207 ? 0.9939 1.2913 0.8459 0.1141  -0.0327 0.0351  1083 LEU A CA  
1450 C C   . LEU A 207 ? 1.0212 1.3147 0.8680 0.1063  -0.0296 0.0290  1083 LEU A C   
1451 O O   . LEU A 207 ? 0.8878 1.1639 0.7388 0.1024  -0.0255 0.0286  1083 LEU A O   
1452 C CB  . LEU A 207 ? 0.8169 1.1245 0.6847 0.1210  -0.0431 0.0260  1083 LEU A CB  
1453 C CG  . LEU A 207 ? 0.7964 1.1048 0.6723 0.1289  -0.0459 0.0309  1083 LEU A CG  
1454 C CD1 . LEU A 207 ? 0.6134 0.9334 0.5049 0.1351  -0.0565 0.0206  1083 LEU A CD1 
1455 C CD2 . LEU A 207 ? 0.8029 1.0871 0.6799 0.1274  -0.0383 0.0402  1083 LEU A CD2 
1456 N N   . LYS A 208 ? 0.9429 1.2529 0.7809 0.1038  -0.0315 0.0239  1084 LYS A N   
1457 C CA  . LYS A 208 ? 1.1394 1.4462 0.9719 0.0965  -0.0285 0.0176  1084 LYS A CA  
1458 C C   . LYS A 208 ? 1.2051 1.4918 1.0273 0.0888  -0.0163 0.0262  1084 LYS A C   
1459 O O   . LYS A 208 ? 1.5178 1.7916 1.3421 0.0841  -0.0126 0.0229  1084 LYS A O   
1460 C CB  . LYS A 208 ? 1.1580 1.4886 0.9830 0.0958  -0.0336 0.0095  1084 LYS A CB  
1461 C CG  . LYS A 208 ? 1.2684 1.5970 1.0885 0.0890  -0.0315 0.0012  1084 LYS A CG  
1462 C CD  . LYS A 208 ? 1.3690 1.7224 1.1825 0.0885  -0.0373 -0.0081 1084 LYS A CD  
1463 C CE  . LYS A 208 ? 1.5470 1.9062 1.3436 0.0836  -0.0305 -0.0009 1084 LYS A CE  
1464 N NZ  . LYS A 208 ? 1.4920 1.8297 1.2792 0.0753  -0.0185 0.0062  1084 LYS A NZ  
1465 N N   . PRO A 209 ? 1.1724 1.4559 0.9839 0.0870  -0.0099 0.0369  1085 PRO A N   
1466 C CA  . PRO A 209 ? 1.1514 1.4147 0.9547 0.0795  0.0016  0.0443  1085 PRO A CA  
1467 C C   . PRO A 209 ? 1.1370 1.3784 0.9502 0.0795  0.0056  0.0472  1085 PRO A C   
1468 O O   . PRO A 209 ? 1.2701 1.4988 1.0823 0.0733  0.0117  0.0454  1085 PRO A O   
1469 C CB  . PRO A 209 ? 1.0167 1.2805 0.8095 0.0795  0.0059  0.0562  1085 PRO A CB  
1470 C CG  . PRO A 209 ? 1.0244 1.3049 0.8223 0.0879  -0.0028 0.0564  1085 PRO A CG  
1471 C CD  . PRO A 209 ? 1.1618 1.4600 0.9676 0.0911  -0.0125 0.0427  1085 PRO A CD  
1472 N N   . VAL A 210 ? 1.1240 1.3621 0.9473 0.0862  0.0019  0.0507  1086 VAL A N   
1473 C CA  . VAL A 210 ? 1.1811 1.3996 1.0136 0.0862  0.0055  0.0537  1086 VAL A CA  
1474 C C   . VAL A 210 ? 1.2190 1.4369 1.0619 0.0852  0.0016  0.0436  1086 VAL A C   
1475 O O   . VAL A 210 ? 1.1016 1.3042 0.9478 0.0808  0.0072  0.0440  1086 VAL A O   
1476 C CB  . VAL A 210 ? 1.0159 1.2323 0.8557 0.0938  0.0026  0.0602  1086 VAL A CB  
1477 C CG1 . VAL A 210 ? 1.0625 1.2979 0.9104 0.1013  -0.0085 0.0534  1086 VAL A CG1 
1478 C CG2 . VAL A 210 ? 1.0017 1.1991 0.8510 0.0937  0.0062  0.0630  1086 VAL A CG2 
1479 N N   . TYR A 211 ? 1.0654 1.3001 0.9136 0.0889  -0.0081 0.0343  1087 TYR A N   
1480 C CA  . TYR A 211 ? 0.9101 1.1442 0.7678 0.0878  -0.0125 0.0248  1087 TYR A CA  
1481 C C   . TYR A 211 ? 0.8832 1.1130 0.7331 0.0799  -0.0068 0.0209  1087 TYR A C   
1482 O O   . TYR A 211 ? 1.1160 1.3352 0.9717 0.0764  -0.0046 0.0181  1087 TYR A O   
1483 C CB  . TYR A 211 ? 0.8435 1.0973 0.7085 0.0937  -0.0245 0.0153  1087 TYR A CB  
1484 C CG  . TYR A 211 ? 0.7771 1.0315 0.6519 0.0928  -0.0303 0.0051  1087 TYR A CG  
1485 C CD1 . TYR A 211 ? 0.7630 1.0101 0.6521 0.0956  -0.0343 0.0040  1087 TYR A CD1 
1486 C CD2 . TYR A 211 ? 0.8364 1.0989 0.7061 0.0890  -0.0321 -0.0034 1087 TYR A CD2 
1487 C CE1 . TYR A 211 ? 0.8777 1.1249 0.7759 0.0944  -0.0399 -0.0046 1087 TYR A CE1 
1488 C CE2 . TYR A 211 ? 0.7233 0.9857 0.6019 0.0884  -0.0377 -0.0124 1087 TYR A CE2 
1489 C CZ  . TYR A 211 ? 0.9085 1.1630 0.8014 0.0910  -0.0417 -0.0126 1087 TYR A CZ  
1490 O OH  . TYR A 211 ? 0.8659 1.1200 0.7678 0.0900  -0.0476 -0.0209 1087 TYR A OH  
1491 N N   . ASP A 212 ? 1.0108 1.2496 0.8475 0.0767  -0.0042 0.0206  1088 ASP A N   
1492 C CA  . ASP A 212 ? 1.0728 1.3083 0.9009 0.0691  0.0018  0.0169  1088 ASP A CA  
1493 C C   . ASP A 212 ? 1.0429 1.2579 0.8676 0.0633  0.0135  0.0248  1088 ASP A C   
1494 O O   . ASP A 212 ? 1.0029 1.2116 0.8250 0.0574  0.0187  0.0211  1088 ASP A O   
1495 C CB  . ASP A 212 ? 1.0611 1.3125 0.8755 0.0671  0.0016  0.0148  1088 ASP A CB  
1496 C CG  . ASP A 212 ? 1.2929 1.5664 1.1110 0.0720  -0.0100 0.0045  1088 ASP A CG  
1497 O OD1 . ASP A 212 ? 1.4237 1.6987 1.2550 0.0764  -0.0177 -0.0015 1088 ASP A OD1 
1498 O OD2 . ASP A 212 ? 1.6735 1.9635 1.4818 0.0713  -0.0117 0.0022  1088 ASP A OD2 
1499 N N   . SER A 213 ? 0.8562 1.0611 0.6812 0.0652  0.0177  0.0352  1089 SER A N   
1500 C CA  . SER A 213 ? 0.8861 1.0714 0.7102 0.0603  0.0281  0.0419  1089 SER A CA  
1501 C C   . SER A 213 ? 0.8858 1.0595 0.7238 0.0616  0.0276  0.0412  1089 SER A C   
1502 O O   . SER A 213 ? 0.8106 0.9702 0.6495 0.0568  0.0357  0.0438  1089 SER A O   
1503 C CB  . SER A 213 ? 0.8952 1.0737 0.7129 0.0611  0.0332  0.0535  1089 SER A CB  
1504 O OG  . SER A 213 ? 0.9155 1.0957 0.7409 0.0688  0.0274  0.0575  1089 SER A OG  
1505 N N   . LEU A 214 ? 0.7515 0.9316 0.6008 0.0676  0.0185  0.0375  1090 LEU A N   
1506 C CA  . LEU A 214 ? 0.6788 0.8489 0.5413 0.0688  0.0178  0.0375  1090 LEU A CA  
1507 C C   . LEU A 214 ? 0.8334 1.0024 0.7007 0.0644  0.0172  0.0295  1090 LEU A C   
1508 O O   . LEU A 214 ? 0.8749 1.0547 0.7388 0.0633  0.0130  0.0217  1090 LEU A O   
1509 C CB  . LEU A 214 ? 0.6451 0.8222 0.5180 0.0767  0.0083  0.0368  1090 LEU A CB  
1510 C CG  . LEU A 214 ? 0.6704 0.8457 0.5422 0.0820  0.0089  0.0455  1090 LEU A CG  
1511 C CD1 . LEU A 214 ? 0.6930 0.8766 0.5759 0.0897  -0.0008 0.0431  1090 LEU A CD1 
1512 C CD2 . LEU A 214 ? 0.6371 0.7944 0.5094 0.0794  0.0178  0.0536  1090 LEU A CD2 
1513 N N   . ASP A 215 ? 0.7822 0.9388 0.6575 0.0620  0.0213  0.0314  1091 ASP A N   
1514 C CA  . ASP A 215 ? 0.6612 0.8165 0.5431 0.0584  0.0202  0.0248  1091 ASP A CA  
1515 C C   . ASP A 215 ? 0.6952 0.8585 0.5889 0.0633  0.0088  0.0193  1091 ASP A C   
1516 O O   . ASP A 215 ? 0.8119 0.9801 0.7101 0.0694  0.0027  0.0209  1091 ASP A O   
1517 C CB  . ASP A 215 ? 0.6731 0.8143 0.5604 0.0542  0.0283  0.0289  1091 ASP A CB  
1518 C CG  . ASP A 215 ? 0.8436 0.9778 0.7383 0.0582  0.0284  0.0359  1091 ASP A CG  
1519 O OD1 . ASP A 215 ? 0.8294 0.9580 0.7180 0.0589  0.0339  0.0427  1091 ASP A OD1 
1520 O OD2 . ASP A 215 ? 0.8119 0.9463 0.7184 0.0608  0.0228  0.0345  1091 ASP A OD2 
1521 N N   . ALA A 216 ? 0.8009 0.9652 0.6996 0.0604  0.0060  0.0126  1092 ALA A N   
1522 C CA  . ALA A 216 ? 0.6053 0.7774 0.5148 0.0643  -0.0053 0.0065  1092 ALA A CA  
1523 C C   . ALA A 216 ? 0.6794 0.8478 0.6010 0.0686  -0.0091 0.0105  1092 ALA A C   
1524 O O   . ALA A 216 ? 0.6382 0.8151 0.5662 0.0743  -0.0183 0.0077  1092 ALA A O   
1525 C CB  . ALA A 216 ? 0.6216 0.7925 0.5353 0.0598  -0.0066 0.0003  1092 ALA A CB  
1526 N N   . VAL A 217 ? 0.5793 0.7359 0.5041 0.0660  -0.0019 0.0168  1093 VAL A N   
1527 C CA  . VAL A 217 ? 0.6508 0.8039 0.5868 0.0696  -0.0050 0.0204  1093 VAL A CA  
1528 C C   . VAL A 217 ? 0.7389 0.8959 0.6721 0.0761  -0.0069 0.0245  1093 VAL A C   
1529 O O   . VAL A 217 ? 0.7588 0.9224 0.6998 0.0818  -0.0151 0.0229  1093 VAL A O   
1530 C CB  . VAL A 217 ? 0.6847 0.8256 0.6244 0.0649  0.0035  0.0255  1093 VAL A CB  
1531 C CG1 . VAL A 217 ? 0.6968 0.8356 0.6498 0.0675  -0.0007 0.0274  1093 VAL A CG1 
1532 C CG2 . VAL A 217 ? 0.6610 0.7991 0.5999 0.0580  0.0074  0.0220  1093 VAL A CG2 
1533 N N   . ARG A 218 ? 0.8518 1.0052 0.7740 0.0754  0.0006  0.0299  1094 ARG A N   
1534 C CA  . ARG A 218 ? 0.8041 0.9617 0.7227 0.0815  -0.0012 0.0344  1094 ARG A CA  
1535 C C   . ARG A 218 ? 0.8898 1.0632 0.8057 0.0858  -0.0096 0.0289  1094 ARG A C   
1536 O O   . ARG A 218 ? 1.1723 1.3529 1.0905 0.0924  -0.0148 0.0302  1094 ARG A O   
1537 C CB  . ARG A 218 ? 0.7801 0.9293 0.6875 0.0792  0.0087  0.0419  1094 ARG A CB  
1538 C CG  . ARG A 218 ? 1.0612 1.1960 0.9733 0.0769  0.0159  0.0476  1094 ARG A CG  
1539 C CD  . ARG A 218 ? 1.0140 1.1397 0.9162 0.0750  0.0251  0.0551  1094 ARG A CD  
1540 N NE  . ARG A 218 ? 0.8960 1.0131 0.7950 0.0674  0.0338  0.0548  1094 ARG A NE  
1541 C CZ  . ARG A 218 ? 0.9180 1.0238 0.8221 0.0646  0.0402  0.0579  1094 ARG A CZ  
1542 N NH1 . ARG A 218 ? 0.9181 1.0195 0.8305 0.0687  0.0387  0.0615  1094 ARG A NH1 
1543 N NH2 . ARG A 218 ? 0.7900 0.8899 0.6912 0.0578  0.0481  0.0569  1094 ARG A NH2 
1544 N N   . ARG A 219 ? 0.7792 0.9589 0.6910 0.0825  -0.0114 0.0221  1095 ARG A N   
1545 C CA  . ARG A 219 ? 0.6754 0.8715 0.5870 0.0867  -0.0207 0.0150  1095 ARG A CA  
1546 C C   . ARG A 219 ? 0.8013 1.0030 0.7275 0.0920  -0.0309 0.0106  1095 ARG A C   
1547 O O   . ARG A 219 ? 0.9166 1.1303 0.8453 0.0983  -0.0379 0.0087  1095 ARG A O   
1548 C CB  . ARG A 219 ? 0.5922 0.7933 0.4984 0.0820  -0.0213 0.0076  1095 ARG A CB  
1549 C CG  . ARG A 219 ? 0.6231 0.8261 0.5136 0.0783  -0.0142 0.0095  1095 ARG A CG  
1550 C CD  . ARG A 219 ? 0.6240 0.8359 0.5101 0.0753  -0.0173 0.0001  1095 ARG A CD  
1551 N NE  . ARG A 219 ? 0.6947 0.9085 0.5656 0.0708  -0.0102 0.0012  1095 ARG A NE  
1552 C CZ  . ARG A 219 ? 0.8229 1.0454 0.6872 0.0678  -0.0116 -0.0066 1095 ARG A CZ  
1553 N NH1 . ARG A 219 ? 0.7442 0.9736 0.6161 0.0693  -0.0202 -0.0161 1095 ARG A NH1 
1554 N NH2 . ARG A 219 ? 0.7523 0.9764 0.6024 0.0633  -0.0046 -0.0052 1095 ARG A NH2 
1555 N N   . ALA A 220 ? 1.0062 1.1999 0.9423 0.0892  -0.0319 0.0089  1096 ALA A N   
1556 C CA  . ALA A 220 ? 0.8843 1.0821 0.8347 0.0935  -0.0412 0.0052  1096 ALA A CA  
1557 C C   . ALA A 220 ? 0.8291 1.0263 0.7836 0.0991  -0.0415 0.0109  1096 ALA A C   
1558 O O   . ALA A 220 ? 0.6769 0.8834 0.6398 0.1050  -0.0500 0.0075  1096 ALA A O   
1559 C CB  . ALA A 220 ? 0.7779 0.9665 0.7377 0.0886  -0.0413 0.0038  1096 ALA A CB  
1560 N N   . ALA A 221 ? 0.7025 0.8894 0.6513 0.0977  -0.0325 0.0193  1097 ALA A N   
1561 C CA  . ALA A 221 ? 0.7413 0.9281 0.6930 0.1036  -0.0329 0.0246  1097 ALA A CA  
1562 C C   . ALA A 221 ? 0.6900 0.8907 0.6366 0.1101  -0.0374 0.0239  1097 ALA A C   
1563 O O   . ALA A 221 ? 0.7678 0.9766 0.7218 0.1167  -0.0440 0.0225  1097 ALA A O   
1564 C CB  . ALA A 221 ? 0.6586 0.8316 0.6046 0.1009  -0.0225 0.0333  1097 ALA A CB  
1565 N N   . LEU A 222 ? 0.6389 0.8438 0.5730 0.1081  -0.0340 0.0245  1098 LEU A N   
1566 C CA  . LEU A 222 ? 0.6398 0.8598 0.5685 0.1137  -0.0382 0.0238  1098 LEU A CA  
1567 C C   . LEU A 222 ? 0.6700 0.9060 0.6080 0.1182  -0.0497 0.0141  1098 LEU A C   
1568 O O   . LEU A 222 ? 0.7006 0.9486 0.6425 0.1253  -0.0555 0.0132  1098 LEU A O   
1569 C CB  . LEU A 222 ? 0.7869 1.0092 0.7006 0.1095  -0.0327 0.0255  1098 LEU A CB  
1570 C CG  . LEU A 222 ? 0.8524 1.0898 0.7576 0.1139  -0.0350 0.0269  1098 LEU A CG  
1571 C CD1 . LEU A 222 ? 0.8084 1.0435 0.7139 0.1195  -0.0334 0.0354  1098 LEU A CD1 
1572 C CD2 . LEU A 222 ? 0.9086 1.1461 0.7988 0.1082  -0.0284 0.0292  1098 LEU A CD2 
1573 N N   . ILE A 223 ? 0.6928 0.9293 0.6352 0.1144  -0.0532 0.0065  1099 ILE A N   
1574 C CA  . ILE A 223 ? 0.7105 0.9609 0.6631 0.1184  -0.0647 -0.0034 1099 ILE A CA  
1575 C C   . ILE A 223 ? 0.8014 1.0517 0.7682 0.1235  -0.0702 -0.0037 1099 ILE A C   
1576 O O   . ILE A 223 ? 0.8112 1.0757 0.7856 0.1296  -0.0791 -0.0096 1099 ILE A O   
1577 C CB  . ILE A 223 ? 0.7916 1.0395 0.7468 0.1130  -0.0671 -0.0107 1099 ILE A CB  
1578 C CG1 . ILE A 223 ? 0.8383 1.0877 0.7792 0.1082  -0.0617 -0.0114 1099 ILE A CG1 
1579 C CG2 . ILE A 223 ? 0.7485 1.0100 0.7154 0.1174  -0.0796 -0.0211 1099 ILE A CG2 
1580 C CD1 . ILE A 223 ? 0.7965 1.0410 0.7388 0.1024  -0.0624 -0.0173 1099 ILE A CD1 
1581 N N   . ASN A 224 ? 0.8578 1.0928 0.8287 0.1208  -0.0653 0.0019  1100 ASN A N   
1582 C CA  . ASN A 224 ? 0.9573 1.1918 0.9412 0.1250  -0.0699 0.0020  1100 ASN A CA  
1583 C C   . ASN A 224 ? 0.8990 1.1433 0.8818 0.1329  -0.0716 0.0046  1100 ASN A C   
1584 O O   . ASN A 224 ? 1.0135 1.2691 1.0064 0.1388  -0.0798 -0.0004 1100 ASN A O   
1585 C CB  . ASN A 224 ? 0.8288 1.0461 0.8152 0.1203  -0.0630 0.0083  1100 ASN A CB  
1586 C CG  . ASN A 224 ? 0.7965 1.0131 0.7972 0.1231  -0.0683 0.0070  1100 ASN A CG  
1587 O OD1 . ASN A 224 ? 0.9589 1.1805 0.9625 0.1293  -0.0702 0.0088  1100 ASN A OD1 
1588 N ND2 . ASN A 224 ? 0.7964 1.0072 0.8060 0.1183  -0.0709 0.0040  1100 ASN A ND2 
1589 N N   . MET A 225 ? 0.7283 0.9686 0.6992 0.1330  -0.0638 0.0126  1101 MET A N   
1590 C CA  . MET A 225 ? 0.8986 1.1489 0.8672 0.1405  -0.0651 0.0158  1101 MET A CA  
1591 C C   . MET A 225 ? 1.0846 1.3560 1.0548 0.1455  -0.0737 0.0081  1101 MET A C   
1592 O O   . MET A 225 ? 1.0431 1.3266 1.0211 0.1527  -0.0800 0.0053  1101 MET A O   
1593 C CB  . MET A 225 ? 0.8290 1.0721 0.7835 0.1392  -0.0558 0.0256  1101 MET A CB  
1594 C CG  . MET A 225 ? 0.8220 1.0466 0.7765 0.1366  -0.0482 0.0332  1101 MET A CG  
1595 S SD  . MET A 225 ? 1.1318 1.3472 1.0700 0.1347  -0.0377 0.0443  1101 MET A SD  
1596 C CE  . MET A 225 ? 0.9995 1.2289 0.9361 0.1446  -0.0418 0.0476  1101 MET A CE  
1597 N N   . VAL A 226 ? 0.8748 1.1522 0.8384 0.1419  -0.0743 0.0038  1102 VAL A N   
1598 C CA  . VAL A 226 ? 0.7963 1.0955 0.7615 0.1466  -0.0828 -0.0043 1102 VAL A CA  
1599 C C   . VAL A 226 ? 0.8904 1.1977 0.8723 0.1503  -0.0934 -0.0141 1102 VAL A C   
1600 O O   . VAL A 226 ? 1.0707 1.3962 1.0586 0.1571  -0.1010 -0.0197 1102 VAL A O   
1601 C CB  . VAL A 226 ? 0.8065 1.1106 0.7611 0.1416  -0.0813 -0.0076 1102 VAL A CB  
1602 C CG1 . VAL A 226 ? 0.6849 1.0126 0.6430 0.1463  -0.0911 -0.0177 1102 VAL A CG1 
1603 C CG2 . VAL A 226 ? 0.6574 0.9565 0.5957 0.1388  -0.0717 0.0021  1102 VAL A CG2 
1604 N N   . PHE A 227 ? 0.8167 1.1112 0.8066 0.1458  -0.0942 -0.0164 1103 PHE A N   
1605 C CA  . PHE A 227 ? 0.7712 1.0714 0.7775 0.1486  -0.1043 -0.0251 1103 PHE A CA  
1606 C C   . PHE A 227 ? 0.8472 1.1512 0.8629 0.1552  -0.1070 -0.0235 1103 PHE A C   
1607 O O   . PHE A 227 ? 0.7451 1.0627 0.7726 0.1607  -0.1164 -0.0314 1103 PHE A O   
1608 C CB  . PHE A 227 ? 0.5863 0.8708 0.5983 0.1416  -0.1037 -0.0261 1103 PHE A CB  
1609 C CG  . PHE A 227 ? 0.4945 0.7850 0.5216 0.1429  -0.1147 -0.0361 1103 PHE A CG  
1610 C CD1 . PHE A 227 ? 0.6483 0.9389 0.6896 0.1463  -0.1200 -0.0376 1103 PHE A CD1 
1611 C CD2 . PHE A 227 ? 0.5071 0.8030 0.5344 0.1407  -0.1199 -0.0442 1103 PHE A CD2 
1612 C CE1 . PHE A 227 ? 0.6503 0.9456 0.7061 0.1472  -0.1304 -0.0465 1103 PHE A CE1 
1613 C CE2 . PHE A 227 ? 0.6642 0.9647 0.7061 0.1420  -0.1306 -0.0533 1103 PHE A CE2 
1614 C CZ  . PHE A 227 ? 0.5993 0.8992 0.6556 0.1451  -0.1358 -0.0543 1103 PHE A CZ  
1615 N N   . GLN A 228 ? 0.9256 1.2180 0.9366 0.1550  -0.0992 -0.0140 1104 GLN A N   
1616 C CA  . GLN A 228 ? 0.9854 1.2821 1.0047 0.1615  -0.1017 -0.0128 1104 GLN A CA  
1617 C C   . GLN A 228 ? 1.0375 1.3513 1.0518 0.1693  -0.1031 -0.0121 1104 GLN A C   
1618 O O   . GLN A 228 ? 0.8660 1.1956 0.8902 0.1760  -0.1109 -0.0185 1104 GLN A O   
1619 C CB  . GLN A 228 ? 0.9900 1.2687 1.0075 0.1589  -0.0938 -0.0038 1104 GLN A CB  
1620 C CG  . GLN A 228 ? 0.9417 1.2238 0.9680 0.1653  -0.0963 -0.0031 1104 GLN A CG  
1621 C CD  . GLN A 228 ? 1.0358 1.3015 1.0591 0.1631  -0.0883 0.0056  1104 GLN A CD  
1622 O OE1 . GLN A 228 ? 1.0185 1.2721 1.0312 0.1581  -0.0801 0.0122  1104 GLN A OE1 
1623 N NE2 . GLN A 228 ? 1.1955 1.4613 1.2284 0.1667  -0.0907 0.0051  1104 GLN A NE2 
1624 N N   . MET A 229 ? 0.9254 1.2371 0.9249 0.1683  -0.0956 -0.0043 1105 MET A N   
1625 C CA  . MET A 229 ? 0.7814 1.1088 0.7753 0.1754  -0.0962 -0.0018 1105 MET A CA  
1626 C C   . MET A 229 ? 0.8632 1.2110 0.8544 0.1770  -0.1017 -0.0089 1105 MET A C   
1627 O O   . MET A 229 ? 0.9170 1.2845 0.9164 0.1838  -0.1097 -0.0158 1105 MET A O   
1628 C CB  . MET A 229 ? 0.6536 0.9690 0.6333 0.1737  -0.0860 0.0104  1105 MET A CB  
1629 C CG  . MET A 229 ? 0.7991 1.0952 0.7815 0.1723  -0.0805 0.0169  1105 MET A CG  
1630 S SD  . MET A 229 ? 1.0874 1.3679 1.0539 0.1699  -0.0689 0.0306  1105 MET A SD  
1631 C CE  . MET A 229 ? 1.4484 1.7464 1.4111 0.1799  -0.0713 0.0343  1105 MET A CE  
1632 N N   . GLY A 230 ? 0.9270 1.2715 0.9071 0.1708  -0.0978 -0.0077 1106 GLY A N   
1633 C CA  . GLY A 230 ? 0.8864 1.2507 0.8625 0.1718  -0.1026 -0.0143 1106 GLY A CA  
1634 C C   . GLY A 230 ? 1.0882 1.4492 1.0467 0.1666  -0.0946 -0.0073 1106 GLY A C   
1635 O O   . GLY A 230 ? 1.1357 1.4802 1.0851 0.1634  -0.0856 0.0033  1106 GLY A O   
1636 N N   . GLU A 231 ? 1.0667 1.4442 1.0208 0.1658  -0.0985 -0.0139 1107 GLU A N   
1637 C CA  . GLU A 231 ? 1.2169 1.5929 1.1544 0.1599  -0.0917 -0.0088 1107 GLU A CA  
1638 C C   . GLU A 231 ? 1.2253 1.6046 1.1518 0.1624  -0.0860 0.0022  1107 GLU A C   
1639 O O   . GLU A 231 ? 1.3477 1.7107 1.2628 0.1575  -0.0767 0.0124  1107 GLU A O   
1640 C CB  . GLU A 231 ? 1.2554 1.6513 1.1915 0.1591  -0.0981 -0.0195 1107 GLU A CB  
1641 N N   . THR A 232 ? 1.1708 1.5716 1.1009 0.1701  -0.0918 0.0003  1108 THR A N   
1642 C CA  . THR A 232 ? 1.4077 1.8128 1.3281 0.1730  -0.0872 0.0111  1108 THR A CA  
1643 C C   . THR A 232 ? 1.3971 1.7838 1.3198 0.1756  -0.0822 0.0204  1108 THR A C   
1644 O O   . THR A 232 ? 1.5213 1.9034 1.4341 0.1763  -0.0762 0.0316  1108 THR A O   
1645 C CB  . THR A 232 ? 1.3055 1.7411 1.2295 0.1808  -0.0951 0.0059  1108 THR A CB  
1646 O OG1 . THR A 232 ? 1.4988 1.9427 1.4403 0.1873  -0.1036 -0.0036 1108 THR A OG1 
1647 C CG2 . THR A 232 ? 1.2546 1.7098 1.1727 0.1778  -0.0986 -0.0014 1108 THR A CG2 
1648 N N   . GLY A 233 ? 1.2346 1.6114 1.1705 0.1772  -0.0850 0.0160  1109 GLY A N   
1649 C CA  . GLY A 233 ? 1.0493 1.4094 0.9884 0.1795  -0.0808 0.0235  1109 GLY A CA  
1650 C C   . GLY A 233 ? 1.1728 1.5078 1.1017 0.1726  -0.0705 0.0338  1109 GLY A C   
1651 O O   . GLY A 233 ? 1.2020 1.5298 1.1237 0.1744  -0.0650 0.0441  1109 GLY A O   
1652 N N   . VAL A 234 ? 1.1062 1.4280 1.0347 0.1649  -0.0678 0.0309  1110 VAL A N   
1653 C CA  . VAL A 234 ? 1.0181 1.3165 0.9385 0.1582  -0.0580 0.0396  1110 VAL A CA  
1654 C C   . VAL A 234 ? 1.0760 1.3744 0.9802 0.1544  -0.0516 0.0471  1110 VAL A C   
1655 O O   . VAL A 234 ? 0.9919 1.2722 0.8885 0.1503  -0.0432 0.0561  1110 VAL A O   
1656 C CB  . VAL A 234 ? 0.7965 1.0821 0.7216 0.1511  -0.0569 0.0341  1110 VAL A CB  
1657 C CG1 . VAL A 234 ? 1.0555 1.3417 0.9969 0.1543  -0.0637 0.0268  1110 VAL A CG1 
1658 C CG2 . VAL A 234 ? 0.8612 1.1564 0.7809 0.1465  -0.0588 0.0274  1110 VAL A CG2 
1659 N N   . ALA A 235 ? 1.2060 1.5247 1.1048 0.1555  -0.0556 0.0436  1111 ALA A N   
1660 C CA  . ALA A 235 ? 1.2740 1.5949 1.1572 0.1520  -0.0500 0.0513  1111 ALA A CA  
1661 C C   . ALA A 235 ? 1.2807 1.5978 1.1585 0.1564  -0.0463 0.0633  1111 ALA A C   
1662 O O   . ALA A 235 ? 1.0216 1.3340 0.8865 0.1528  -0.0400 0.0723  1111 ALA A O   
1663 C CB  . ALA A 235 ? 1.2492 1.5959 1.1288 0.1528  -0.0560 0.0443  1111 ALA A CB  
1664 N N   . GLY A 236 ? 1.2502 1.5693 1.1378 0.1642  -0.0501 0.0634  1112 GLY A N   
1665 C CA  . GLY A 236 ? 1.2683 1.5826 1.1518 0.1691  -0.0469 0.0744  1112 GLY A CA  
1666 C C   . GLY A 236 ? 1.5122 1.7992 1.3918 0.1650  -0.0382 0.0835  1112 GLY A C   
1667 O O   . GLY A 236 ? 1.8726 2.1532 1.7454 0.1673  -0.0343 0.0940  1112 GLY A O   
1668 N N   . PHE A 237 ? 1.5541 1.8253 1.4381 0.1591  -0.0354 0.0795  1113 PHE A N   
1669 C CA  . PHE A 237 ? 1.3306 1.5771 1.2124 0.1551  -0.0273 0.0869  1113 PHE A CA  
1670 C C   . PHE A 237 ? 1.3189 1.5566 1.1864 0.1479  -0.0197 0.0943  1113 PHE A C   
1671 O O   . PHE A 237 ? 1.4707 1.6934 1.3365 0.1405  -0.0140 0.0940  1113 PHE A O   
1672 C CB  . PHE A 237 ? 1.1479 1.3825 1.0396 0.1510  -0.0270 0.0800  1113 PHE A CB  
1673 C CG  . PHE A 237 ? 1.0082 1.2472 0.9141 0.1571  -0.0334 0.0741  1113 PHE A CG  
1674 C CD1 . PHE A 237 ? 0.9013 1.1574 0.8157 0.1598  -0.0418 0.0638  1113 PHE A CD1 
1675 C CD2 . PHE A 237 ? 0.9654 1.1915 0.8767 0.1601  -0.0312 0.0783  1113 PHE A CD2 
1676 C CE1 . PHE A 237 ? 0.8265 1.0864 0.7544 0.1650  -0.0476 0.0583  1113 PHE A CE1 
1677 C CE2 . PHE A 237 ? 0.9841 1.2147 0.9083 0.1653  -0.0369 0.0727  1113 PHE A CE2 
1678 C CZ  . PHE A 237 ? 0.8234 1.0706 0.7559 0.1676  -0.0451 0.0628  1113 PHE A CZ  
1679 N N   . THR A 238 ? 1.3015 1.5493 1.1590 0.1499  -0.0195 0.1011  1114 THR A N   
1680 C CA  . THR A 238 ? 1.2331 1.4738 1.0766 0.1430  -0.0125 0.1089  1114 THR A CA  
1681 C C   . THR A 238 ? 1.3368 1.5508 1.1787 0.1382  -0.0040 0.1156  1114 THR A C   
1682 O O   . THR A 238 ? 1.1923 1.3960 1.0290 0.1299  0.0018  0.1152  1114 THR A O   
1683 C CB  . THR A 238 ? 1.1760 1.4289 1.0107 0.1473  -0.0136 0.1176  1114 THR A CB  
1684 O OG1 . THR A 238 ? 0.9887 1.2685 0.8257 0.1518  -0.0217 0.1104  1114 THR A OG1 
1685 C CG2 . THR A 238 ? 1.0150 1.2611 0.8347 0.1399  -0.0066 0.1265  1114 THR A CG2 
1686 N N   . ASN A 239 ? 1.6518 1.8550 1.4994 0.1437  -0.0036 0.1205  1115 ASN A N   
1687 C CA  . ASN A 239 ? 1.7390 1.9180 1.5857 0.1405  0.0039  0.1275  1115 ASN A CA  
1688 C C   . ASN A 239 ? 1.7607 1.9277 1.6134 0.1339  0.0073  0.1207  1115 ASN A C   
1689 O O   . ASN A 239 ? 1.7199 1.8708 1.5680 0.1273  0.0148  0.1246  1115 ASN A O   
1690 C CB  . ASN A 239 ? 1.9021 2.0754 1.7555 0.1489  0.0019  0.1318  1115 ASN A CB  
1691 C CG  . ASN A 239 ? 2.1530 2.3045 2.0025 0.1475  0.0088  0.1418  1115 ASN A CG  
1692 O OD1 . ASN A 239 ? 2.4050 2.5477 2.2448 0.1412  0.0147  0.1480  1115 ASN A OD1 
1693 N ND2 . ASN A 239 ? 2.2070 2.3500 2.0643 0.1533  0.0079  0.1432  1115 ASN A ND2 
1694 N N   . SER A 240 ? 1.6710 1.8458 1.5344 0.1354  0.0020  0.1106  1116 SER A N   
1695 C CA  . SER A 240 ? 1.4076 1.5720 1.2774 0.1293  0.0048  0.1044  1116 SER A CA  
1696 C C   . SER A 240 ? 1.3989 1.5678 1.2622 0.1217  0.0067  0.0996  1116 SER A C   
1697 O O   . SER A 240 ? 1.4084 1.5648 1.2709 0.1146  0.0128  0.0987  1116 SER A O   
1698 C CB  . SER A 240 ? 1.3538 1.5239 1.2376 0.1336  -0.0018 0.0961  1116 SER A CB  
1699 O OG  . SER A 240 ? 1.2232 1.3889 1.1131 0.1404  -0.0033 0.0999  1116 SER A OG  
1700 N N   . LEU A 241 ? 1.1908 1.3785 1.0498 0.1231  0.0015  0.0958  1117 LEU A N   
1701 C CA  . LEU A 241 ? 1.0050 1.1990 0.8579 0.1163  0.0026  0.0902  1117 LEU A CA  
1702 C C   . LEU A 241 ? 1.0528 1.2353 0.8931 0.1091  0.0116  0.0975  1117 LEU A C   
1703 O O   . LEU A 241 ? 1.1329 1.3095 0.9706 0.1017  0.0161  0.0938  1117 LEU A O   
1704 C CB  . LEU A 241 ? 0.9743 1.1923 0.8248 0.1198  -0.0051 0.0850  1117 LEU A CB  
1705 C CG  . LEU A 241 ? 1.0311 1.2629 0.8945 0.1264  -0.0148 0.0759  1117 LEU A CG  
1706 C CD1 . LEU A 241 ? 0.8813 1.1380 0.7420 0.1306  -0.0221 0.0718  1117 LEU A CD1 
1707 C CD2 . LEU A 241 ? 1.1162 1.3439 0.9883 0.1225  -0.0165 0.0663  1117 LEU A CD2 
1708 N N   . ARG A 242 ? 1.2247 1.4034 1.0576 0.1110  0.0145  0.1081  1118 ARG A N   
1709 C CA  . ARG A 242 ? 1.4751 1.6422 1.2963 0.1039  0.0231  0.1153  1118 ARG A CA  
1710 C C   . ARG A 242 ? 1.5710 1.7172 1.3963 0.0985  0.0304  0.1153  1118 ARG A C   
1711 O O   . ARG A 242 ? 1.4570 1.5979 1.2766 0.0906  0.0362  0.1136  1118 ARG A O   
1712 C CB  . ARG A 242 ? 1.7389 1.9032 1.5528 0.1072  0.0246  0.1275  1118 ARG A CB  
1713 C CG  . ARG A 242 ? 2.0739 2.2239 1.8767 0.0998  0.0336  0.1361  1118 ARG A CG  
1714 C CD  . ARG A 242 ? 2.3725 2.5332 2.1644 0.0924  0.0354  0.1328  1118 ARG A CD  
1715 N NE  . ARG A 242 ? 2.3257 2.4741 2.1066 0.0855  0.0436  0.1418  1118 ARG A NE  
1716 C CZ  . ARG A 242 ? 2.3722 2.5264 2.1421 0.0779  0.0470  0.1408  1118 ARG A CZ  
1717 N NH1 . ARG A 242 ? 2.2516 2.4243 2.0200 0.0764  0.0428  0.1309  1118 ARG A NH1 
1718 N NH2 . ARG A 242 ? 2.3068 2.4484 2.0675 0.0717  0.0546  0.1496  1118 ARG A NH2 
1719 N N   . MET A 243 ? 1.6380 1.7731 1.4734 0.1026  0.0302  0.1167  1119 MET A N   
1720 C CA  . MET A 243 ? 1.5723 1.6888 1.4124 0.0978  0.0370  0.1169  1119 MET A CA  
1721 C C   . MET A 243 ? 1.5095 1.6279 1.3571 0.0939  0.0363  0.1064  1119 MET A C   
1722 O O   . MET A 243 ? 1.5483 1.6540 1.3982 0.0883  0.0427  0.1055  1119 MET A O   
1723 C CB  . MET A 243 ? 1.5177 1.6227 1.3658 0.1036  0.0370  0.1219  1119 MET A CB  
1724 C CG  . MET A 243 ? 1.8230 1.9392 1.6796 0.1124  0.0283  0.1189  1119 MET A CG  
1725 S SD  . MET A 243 ? 2.0437 2.1480 1.9063 0.1198  0.0283  0.1263  1119 MET A SD  
1726 C CE  . MET A 243 ? 2.0516 2.1525 1.9004 0.1207  0.0314  0.1388  1119 MET A CE  
1727 N N   . LEU A 244 ? 1.4168 1.5508 1.2689 0.0968  0.0286  0.0985  1120 LEU A N   
1728 C CA  . LEU A 244 ? 1.4146 1.5513 1.2717 0.0922  0.0278  0.0889  1120 LEU A CA  
1729 C C   . LEU A 244 ? 1.4991 1.6380 1.3452 0.0847  0.0325  0.0869  1120 LEU A C   
1730 O O   . LEU A 244 ? 1.5774 1.7094 1.4247 0.0785  0.0372  0.0829  1120 LEU A O   
1731 C CB  . LEU A 244 ? 1.2093 1.3618 1.0744 0.0974  0.0178  0.0809  1120 LEU A CB  
1732 C CG  . LEU A 244 ? 1.1705 1.3207 1.0493 0.1029  0.0131  0.0793  1120 LEU A CG  
1733 C CD1 . LEU A 244 ? 0.8705 1.0379 0.7560 0.1078  0.0031  0.0714  1120 LEU A CD1 
1734 C CD2 . LEU A 244 ? 1.1000 1.2374 0.9867 0.0981  0.0173  0.0768  1120 LEU A CD2 
1735 N N   . GLN A 245 ? 1.5406 1.6900 1.3759 0.0851  0.0314  0.0897  1121 GLN A N   
1736 C CA  . GLN A 245 ? 1.4748 1.6271 1.2989 0.0776  0.0359  0.0877  1121 GLN A CA  
1737 C C   . GLN A 245 ? 1.3765 1.5109 1.1949 0.0711  0.0466  0.0942  1121 GLN A C   
1738 O O   . GLN A 245 ? 1.1957 1.3291 1.0074 0.0639  0.0517  0.0911  1121 GLN A O   
1739 C CB  . GLN A 245 ? 1.4737 1.6428 1.2875 0.0793  0.0321  0.0894  1121 GLN A CB  
1740 C CG  . GLN A 245 ? 1.5009 1.6788 1.3042 0.0724  0.0343  0.0843  1121 GLN A CG  
1741 C CD  . GLN A 245 ? 1.4486 1.6468 1.2433 0.0746  0.0290  0.0845  1121 GLN A CD  
1742 O OE1 . GLN A 245 ? 1.3644 1.5723 1.1629 0.0819  0.0226  0.0865  1121 GLN A OE1 
1743 N NE2 . GLN A 245 ? 1.6119 1.8178 1.3951 0.0683  0.0318  0.0820  1121 GLN A NE2 
1744 N N   . GLN A 246 ? 1.3170 1.4373 1.1385 0.0735  0.0499  0.1025  1122 GLN A N   
1745 C CA  . GLN A 246 ? 1.3049 1.4079 1.1222 0.0679  0.0596  0.1089  1122 GLN A CA  
1746 C C   . GLN A 246 ? 1.2646 1.3545 1.0920 0.0651  0.0641  0.1053  1122 GLN A C   
1747 O O   . GLN A 246 ? 1.0523 1.1270 0.8794 0.0619  0.0715  0.1104  1122 GLN A O   
1748 C CB  . GLN A 246 ? 1.4211 1.5157 1.2358 0.0721  0.0606  0.1203  1122 GLN A CB  
1749 C CG  . GLN A 246 ? 1.5405 1.6468 1.3439 0.0738  0.0576  0.1259  1122 GLN A CG  
1750 C CD  . GLN A 246 ? 1.5313 1.6280 1.3322 0.0778  0.0588  0.1379  1122 GLN A CD  
1751 O OE1 . GLN A 246 ? 1.4328 1.5209 1.2427 0.0834  0.0573  0.1403  1122 GLN A OE1 
1752 N NE2 . GLN A 246 ? 1.6344 1.7328 1.4229 0.0749  0.0613  0.1456  1122 GLN A NE2 
1753 N N   . LYS A 247 ? 1.2001 1.2962 1.0369 0.0662  0.0596  0.0966  1123 LYS A N   
1754 C CA  . LYS A 247 ? 1.1376 1.2245 0.9849 0.0637  0.0628  0.0925  1123 LYS A CA  
1755 C C   . LYS A 247 ? 1.2258 1.3009 1.0821 0.0678  0.0637  0.0978  1123 LYS A C   
1756 O O   . LYS A 247 ? 1.5008 1.5674 1.3654 0.0653  0.0676  0.0956  1123 LYS A O   
1757 C CB  . LYS A 247 ? 1.1352 1.2146 0.9779 0.0550  0.0719  0.0907  1123 LYS A CB  
1758 C CG  . LYS A 247 ? 1.0626 1.1529 0.8949 0.0503  0.0721  0.0855  1123 LYS A CG  
1759 C CD  . LYS A 247 ? 1.0902 1.1940 0.9277 0.0520  0.0644  0.0761  1123 LYS A CD  
1760 C CE  . LYS A 247 ? 1.0940 1.2081 0.9213 0.0471  0.0650  0.0701  1123 LYS A CE  
1761 N NZ  . LYS A 247 ? 1.3319 1.4600 1.1638 0.0496  0.0562  0.0609  1123 LYS A NZ  
1762 N N   . ARG A 248 ? 1.1636 1.2385 1.0184 0.0742  0.0603  0.1045  1124 ARG A N   
1763 C CA  . ARG A 248 ? 1.2341 1.2984 1.0971 0.0788  0.0606  0.1093  1124 ARG A CA  
1764 C C   . ARG A 248 ? 1.2411 1.3137 1.1151 0.0850  0.0525  0.1045  1124 ARG A C   
1765 O O   . ARG A 248 ? 1.1705 1.2508 1.0443 0.0919  0.0461  0.1066  1124 ARG A O   
1766 C CB  . ARG A 248 ? 1.4127 1.4717 1.2683 0.0825  0.0615  0.1194  1124 ARG A CB  
1767 C CG  . ARG A 248 ? 1.5513 1.5999 1.3971 0.0760  0.0699  0.1249  1124 ARG A CG  
1768 C CD  . ARG A 248 ? 1.5112 1.5515 1.3517 0.0797  0.0707  0.1358  1124 ARG A CD  
1769 N NE  . ARG A 248 ? 1.6314 1.6847 1.4655 0.0852  0.0641  0.1391  1124 ARG A NE  
1770 C CZ  . ARG A 248 ? 1.8894 1.9392 1.7180 0.0893  0.0633  0.1488  1124 ARG A CZ  
1771 N NH1 . ARG A 248 ? 2.0589 2.0913 1.8876 0.0886  0.0685  0.1561  1124 ARG A NH1 
1772 N NH2 . ARG A 248 ? 2.0602 2.1243 1.8835 0.0942  0.0571  0.1511  1124 ARG A NH2 
1773 N N   . TRP A 249 ? 1.2858 1.3571 1.1695 0.0824  0.0528  0.0981  1125 TRP A N   
1774 C CA  . TRP A 249 ? 1.2278 1.3082 1.1218 0.0866  0.0450  0.0925  1125 TRP A CA  
1775 C C   . TRP A 249 ? 1.3608 1.4370 1.2628 0.0933  0.0423  0.0959  1125 TRP A C   
1776 O O   . TRP A 249 ? 1.2766 1.3619 1.1824 0.0997  0.0348  0.0946  1125 TRP A O   
1777 C CB  . TRP A 249 ? 1.1196 1.2002 1.0211 0.0810  0.0462  0.0852  1125 TRP A CB  
1778 C CG  . TRP A 249 ? 0.9834 1.0660 0.8772 0.0739  0.0504  0.0817  1125 TRP A CG  
1779 C CD1 . TRP A 249 ? 0.9551 1.0297 0.8483 0.0668  0.0585  0.0807  1125 TRP A CD1 
1780 C CD2 . TRP A 249 ? 0.9537 1.0479 0.8396 0.0733  0.0467  0.0782  1125 TRP A CD2 
1781 N NE1 . TRP A 249 ? 0.9798 1.0598 0.8646 0.0619  0.0601  0.0769  1125 TRP A NE1 
1782 C CE2 . TRP A 249 ? 0.9825 1.0746 0.8627 0.0658  0.0528  0.0752  1125 TRP A CE2 
1783 C CE3 . TRP A 249 ? 0.9772 1.0844 0.8606 0.0786  0.0386  0.0767  1125 TRP A CE3 
1784 C CZ2 . TRP A 249 ? 0.9867 1.0889 0.8583 0.0633  0.0510  0.0707  1125 TRP A CZ2 
1785 C CZ3 . TRP A 249 ? 0.9418 1.0595 0.8173 0.0762  0.0367  0.0722  1125 TRP A CZ3 
1786 C CH2 . TRP A 249 ? 1.0230 1.1381 0.8926 0.0686  0.0428  0.0692  1125 TRP A CH2 
1787 N N   . ASP A 250 ? 1.2825 1.3457 1.1877 0.0920  0.0481  0.0996  1126 ASP A N   
1788 C CA  . ASP A 250 ? 1.3222 1.3816 1.2362 0.0978  0.0456  0.1014  1126 ASP A CA  
1789 C C   . ASP A 250 ? 1.3969 1.4578 1.3058 0.1057  0.0418  0.1077  1126 ASP A C   
1790 O O   . ASP A 250 ? 1.5438 1.6101 1.4590 0.1124  0.0358  0.1068  1126 ASP A O   
1791 C CB  . ASP A 250 ? 1.4133 1.4591 1.3318 0.0944  0.0528  0.1031  1126 ASP A CB  
1792 C CG  . ASP A 250 ? 1.5609 1.6064 1.4844 0.0865  0.0571  0.0970  1126 ASP A CG  
1793 O OD1 . ASP A 250 ? 1.7614 1.8045 1.6778 0.0804  0.0625  0.0969  1126 ASP A OD1 
1794 O OD2 . ASP A 250 ? 1.7742 1.8224 1.7087 0.0862  0.0550  0.0925  1126 ASP A OD2 
1795 N N   . GLU A 251 ? 1.3498 1.4072 1.2472 0.1049  0.0451  0.1140  1127 GLU A N   
1796 C CA  . GLU A 251 ? 1.4167 1.4772 1.3080 0.1119  0.0415  0.1205  1127 GLU A CA  
1797 C C   . GLU A 251 ? 1.5044 1.5824 1.3966 0.1168  0.0331  0.1162  1127 GLU A C   
1798 O O   . GLU A 251 ? 1.6788 1.7620 1.5742 0.1246  0.0277  0.1178  1127 GLU A O   
1799 C CB  . GLU A 251 ? 1.5870 1.6424 1.4652 0.1084  0.0465  0.1277  1127 GLU A CB  
1800 C CG  . GLU A 251 ? 1.7664 1.8217 1.6375 0.1148  0.0444  0.1367  1127 GLU A CG  
1801 C CD  . GLU A 251 ? 1.8058 1.8540 1.6645 0.1099  0.0502  0.1444  1127 GLU A CD  
1802 O OE1 . GLU A 251 ? 1.5208 1.5612 1.3776 0.1020  0.0567  0.1429  1127 GLU A OE1 
1803 O OE2 . GLU A 251 ? 1.7981 1.8492 1.6489 0.1139  0.0482  0.1520  1127 GLU A OE2 
1804 N N   . ALA A 252 ? 1.5216 1.6093 1.4122 0.1124  0.0316  0.1100  1128 ALA A N   
1805 C CA  . ALA A 252 ? 1.5166 1.6214 1.4091 0.1168  0.0233  0.1049  1128 ALA A CA  
1806 C C   . ALA A 252 ? 1.4585 1.5669 1.3643 0.1206  0.0178  0.0992  1128 ALA A C   
1807 O O   . ALA A 252 ? 1.4340 1.5544 1.3432 0.1271  0.0106  0.0969  1128 ALA A O   
1808 C CB  . ALA A 252 ? 1.4792 1.5929 1.3670 0.1110  0.0229  0.0991  1128 ALA A CB  
1809 N N   . ALA A 253 ? 1.3868 1.4861 1.3006 0.1168  0.0210  0.0966  1129 ALA A N   
1810 C CA  . ALA A 253 ? 1.3112 1.4140 1.2376 0.1200  0.0159  0.0918  1129 ALA A CA  
1811 C C   . ALA A 253 ? 1.2382 1.3402 1.1669 0.1284  0.0133  0.0960  1129 ALA A C   
1812 O O   . ALA A 253 ? 0.9674 1.0801 0.9015 0.1345  0.0062  0.0930  1129 ALA A O   
1813 C CB  . ALA A 253 ? 1.1320 1.2255 1.0660 0.1139  0.0204  0.0890  1129 ALA A CB  
1814 N N   . VAL A 254 ? 1.3825 1.4722 1.3073 0.1291  0.0187  0.1030  1130 VAL A N   
1815 C CA  . VAL A 254 ? 1.5557 1.6444 1.4826 0.1374  0.0160  0.1069  1130 VAL A CA  
1816 C C   . VAL A 254 ? 1.5879 1.6881 1.5080 0.1439  0.0111  0.1098  1130 VAL A C   
1817 O O   . VAL A 254 ? 1.6812 1.7879 1.6051 0.1517  0.0059  0.1098  1130 VAL A O   
1818 C CB  . VAL A 254 ? 1.4113 1.4838 1.3360 0.1373  0.0222  0.1137  1130 VAL A CB  
1819 C CG1 . VAL A 254 ? 1.1261 1.1923 1.0382 0.1349  0.0270  0.1212  1130 VAL A CG1 
1820 C CG2 . VAL A 254 ? 1.2823 1.3541 1.2112 0.1461  0.0187  0.1162  1130 VAL A CG2 
1821 N N   . ASN A 255 ? 1.4652 1.5697 1.3755 0.1407  0.0124  0.1116  1131 ASN A N   
1822 C CA  . ASN A 255 ? 1.3328 1.4505 1.2368 0.1465  0.0076  0.1141  1131 ASN A CA  
1823 C C   . ASN A 255 ? 1.3393 1.4742 1.2506 0.1501  -0.0005 0.1057  1131 ASN A C   
1824 O O   . ASN A 255 ? 1.5876 1.7338 1.4999 0.1579  -0.0059 0.1062  1131 ASN A O   
1825 C CB  . ASN A 255 ? 1.3745 1.4933 1.2658 0.1417  0.0111  0.1182  1131 ASN A CB  
1826 C CG  . ASN A 255 ? 1.4525 1.5840 1.3363 0.1478  0.0072  0.1230  1131 ASN A CG  
1827 O OD1 . ASN A 255 ? 1.6160 1.7421 1.4957 0.1525  0.0083  0.1312  1131 ASN A OD1 
1828 N ND2 . ASN A 255 ? 1.4328 1.5817 1.3151 0.1479  0.0023  0.1177  1131 ASN A ND2 
1829 N N   . LEU A 256 ? 1.3141 1.4517 1.2312 0.1447  -0.0016 0.0979  1132 LEU A N   
1830 C CA  . LEU A 256 ? 1.2789 1.4318 1.2042 0.1476  -0.0096 0.0895  1132 LEU A CA  
1831 C C   . LEU A 256 ? 1.2694 1.4231 1.2060 0.1531  -0.0136 0.0869  1132 LEU A C   
1832 O O   . LEU A 256 ? 1.2425 1.4100 1.1856 0.1581  -0.0209 0.0816  1132 LEU A O   
1833 C CB  . LEU A 256 ? 1.4995 1.6532 1.4280 0.1400  -0.0097 0.0824  1132 LEU A CB  
1834 C CG  . LEU A 256 ? 1.4246 1.5853 1.3439 0.1358  -0.0092 0.0810  1132 LEU A CG  
1835 C CD1 . LEU A 256 ? 1.4225 1.5791 1.3445 0.1277  -0.0073 0.0752  1132 LEU A CD1 
1836 C CD2 . LEU A 256 ? 1.4675 1.6478 1.3874 0.1415  -0.0173 0.0766  1132 LEU A CD2 
1837 N N   . ALA A 257 ? 1.3581 1.4982 1.2978 0.1524  -0.0093 0.0901  1133 ALA A N   
1838 C CA  . ALA A 257 ? 1.3869 1.5291 1.3366 0.1582  -0.0133 0.0879  1133 ALA A CA  
1839 C C   . ALA A 257 ? 1.3729 1.5229 1.3196 0.1679  -0.0168 0.0916  1133 ALA A C   
1840 O O   . ALA A 257 ? 1.4671 1.6257 1.4218 0.1739  -0.0223 0.0876  1133 ALA A O   
1841 C CB  . ALA A 257 ? 1.1575 1.2848 1.1112 0.1554  -0.0081 0.0899  1133 ALA A CB  
1842 N N   . LYS A 258 ? 1.3543 1.5023 1.2898 0.1696  -0.0139 0.0991  1134 LYS A N   
1843 C CA  . LYS A 258 ? 1.3143 1.4708 1.2465 0.1789  -0.0173 0.1032  1134 LYS A CA  
1844 C C   . LYS A 258 ? 1.3479 1.5245 1.2790 0.1823  -0.0234 0.0993  1134 LYS A C   
1845 O O   . LYS A 258 ? 1.3437 1.5269 1.2660 0.1857  -0.0237 0.1048  1134 LYS A O   
1846 C CB  . LYS A 258 ? 1.2616 1.4073 1.1825 0.1795  -0.0119 0.1138  1134 LYS A CB  
1847 C CG  . LYS A 258 ? 1.0469 1.1724 0.9673 0.1744  -0.0049 0.1178  1134 LYS A CG  
1848 C CD  . LYS A 258 ? 1.0039 1.1198 0.9123 0.1740  0.0001  0.1283  1134 LYS A CD  
1849 C CE  . LYS A 258 ? 0.8469 0.9430 0.7546 0.1678  0.0074  0.1316  1134 LYS A CE  
1850 N NZ  . LYS A 258 ? 1.0299 1.1171 0.9460 0.1718  0.0074  0.1309  1134 LYS A NZ  
1851 N N   . SER A 259 ? 1.3298 1.5168 1.2702 0.1815  -0.0287 0.0900  1135 SER A N   
1852 C CA  . SER A 259 ? 1.2317 1.4378 1.1723 0.1837  -0.0348 0.0848  1135 SER A CA  
1853 C C   . SER A 259 ? 1.0752 1.2951 1.0272 0.1909  -0.0423 0.0778  1135 SER A C   
1854 O O   . SER A 259 ? 0.8615 1.0759 0.8220 0.1924  -0.0430 0.0756  1135 SER A O   
1855 C CB  . SER A 259 ? 1.2445 1.4511 1.1855 0.1753  -0.0347 0.0790  1135 SER A CB  
1856 O OG  . SER A 259 ? 1.5519 1.7475 1.4820 0.1687  -0.0277 0.0849  1135 SER A OG  
1857 N N   . ARG A 260 ? 1.1682 1.4073 1.1204 0.1951  -0.0481 0.0739  1136 ARG A N   
1858 C CA  . ARG A 260 ? 1.2929 1.5471 1.2573 0.2007  -0.0558 0.0652  1136 ARG A CA  
1859 C C   . ARG A 260 ? 1.3311 1.5829 1.3057 0.1946  -0.0586 0.0566  1136 ARG A C   
1860 O O   . ARG A 260 ? 1.3892 1.6432 1.3753 0.1967  -0.0627 0.0509  1136 ARG A O   
1861 C CB  . ARG A 260 ? 1.3671 1.6437 1.3297 0.2066  -0.0613 0.0626  1136 ARG A CB  
1862 C CG  . ARG A 260 ? 1.7359 2.0213 1.6952 0.2013  -0.0632 0.0583  1136 ARG A CG  
1863 C CD  . ARG A 260 ? 1.8048 2.0822 1.7492 0.1960  -0.0565 0.0667  1136 ARG A CD  
1864 N NE  . ARG A 260 ? 1.7085 1.9982 1.6493 0.1923  -0.0590 0.0619  1136 ARG A NE  
1865 C CZ  . ARG A 260 ? 1.5465 1.8346 1.4746 0.1877  -0.0546 0.0674  1136 ARG A CZ  
1866 N NH1 . ARG A 260 ? 1.5907 1.8645 1.5087 0.1860  -0.0473 0.0783  1136 ARG A NH1 
1867 N NH2 . ARG A 260 ? 1.3877 1.6889 1.3135 0.1846  -0.0577 0.0616  1136 ARG A NH2 
1868 N N   . TRP A 261 ? 1.4070 1.6538 1.3770 0.1867  -0.0562 0.0559  1137 TRP A N   
1869 C CA  . TRP A 261 ? 1.1481 1.3922 1.1266 0.1804  -0.0587 0.0484  1137 TRP A CA  
1870 C C   . TRP A 261 ? 1.1472 1.3756 1.1320 0.1768  -0.0555 0.0494  1137 TRP A C   
1871 O O   . TRP A 261 ? 1.0167 1.2465 1.0130 0.1753  -0.0598 0.0429  1137 TRP A O   
1872 C CB  . TRP A 261 ? 1.1532 1.3943 1.1235 0.1730  -0.0557 0.0485  1137 TRP A CB  
1873 C CG  . TRP A 261 ? 1.1573 1.3916 1.1339 0.1653  -0.0563 0.0429  1137 TRP A CG  
1874 C CD1 . TRP A 261 ? 1.1211 1.3628 1.1096 0.1652  -0.0636 0.0340  1137 TRP A CD1 
1875 C CD2 . TRP A 261 ? 0.9522 1.1712 0.9233 0.1567  -0.0494 0.0459  1137 TRP A CD2 
1876 N NE1 . TRP A 261 ? 1.1226 1.3542 1.1132 0.1570  -0.0618 0.0318  1137 TRP A NE1 
1877 C CE2 . TRP A 261 ? 1.0355 1.2536 1.0155 0.1518  -0.0530 0.0388  1137 TRP A CE2 
1878 C CE3 . TRP A 261 ? 0.9532 1.1591 0.9133 0.1527  -0.0407 0.0538  1137 TRP A CE3 
1879 C CZ2 . TRP A 261 ? 1.0907 1.2965 1.0686 0.1432  -0.0478 0.0394  1137 TRP A CZ2 
1880 C CZ3 . TRP A 261 ? 1.0665 1.2603 1.0249 0.1442  -0.0355 0.0539  1137 TRP A CZ3 
1881 C CH2 . TRP A 261 ? 1.1649 1.3592 1.1320 0.1397  -0.0390 0.0467  1137 TRP A CH2 
1882 N N   . TYR A 262 ? 1.1981 1.4121 1.1760 0.1754  -0.0481 0.0574  1138 TYR A N   
1883 C CA  . TYR A 262 ? 1.1881 1.3882 1.1718 0.1715  -0.0447 0.0581  1138 TYR A CA  
1884 C C   . TYR A 262 ? 1.2369 1.4418 1.2303 0.1779  -0.0489 0.0555  1138 TYR A C   
1885 O O   . TYR A 262 ? 1.4061 1.6066 1.4088 0.1747  -0.0498 0.0520  1138 TYR A O   
1886 C CB  . TYR A 262 ? 1.2856 1.4698 1.2599 0.1687  -0.0361 0.0667  1138 TYR A CB  
1887 C CG  . TYR A 262 ? 1.3385 1.5096 1.3188 0.1646  -0.0324 0.0671  1138 TYR A CG  
1888 C CD1 . TYR A 262 ? 1.3535 1.5171 1.3365 0.1557  -0.0296 0.0648  1138 TYR A CD1 
1889 C CD2 . TYR A 262 ? 1.4868 1.6544 1.4705 0.1697  -0.0319 0.0694  1138 TYR A CD2 
1890 C CE1 . TYR A 262 ? 1.4807 1.6345 1.4698 0.1518  -0.0263 0.0649  1138 TYR A CE1 
1891 C CE2 . TYR A 262 ? 1.5618 1.7194 1.5515 0.1659  -0.0288 0.0691  1138 TYR A CE2 
1892 C CZ  . TYR A 262 ? 1.5258 1.6769 1.5182 0.1569  -0.0260 0.0669  1138 TYR A CZ  
1893 O OH  . TYR A 262 ? 1.5728 1.7158 1.5715 0.1529  -0.0230 0.0665  1138 TYR A OH  
1894 N N   . ASN A 263 ? 1.2482 1.4624 1.2394 0.1867  -0.0513 0.0573  1139 ASN A N   
1895 C CA  . ASN A 263 ? 1.0377 1.2569 1.0374 0.1932  -0.0549 0.0547  1139 ASN A CA  
1896 C C   . ASN A 263 ? 1.0088 1.2435 1.0199 0.1957  -0.0633 0.0454  1139 ASN A C   
1897 O O   . ASN A 263 ? 1.2189 1.4559 1.2398 0.1980  -0.0664 0.0413  1139 ASN A O   
1898 C CB  . ASN A 263 ? 1.0183 1.2406 1.0110 0.2021  -0.0538 0.0607  1139 ASN A CB  
1899 C CG  . ASN A 263 ? 1.0835 1.2888 1.0670 0.2002  -0.0461 0.0697  1139 ASN A CG  
1900 O OD1 . ASN A 263 ? 1.1652 1.3595 1.1434 0.1926  -0.0411 0.0727  1139 ASN A OD1 
1901 N ND2 . ASN A 263 ? 0.9341 1.1374 0.9162 0.2072  -0.0452 0.0738  1139 ASN A ND2 
1902 N N   . GLN A 264 ? 1.0275 1.2731 1.0379 0.1952  -0.0672 0.0415  1140 GLN A N   
1903 C CA  . GLN A 264 ? 1.0835 1.3437 1.1059 0.1975  -0.0756 0.0321  1140 GLN A CA  
1904 C C   . GLN A 264 ? 1.1970 1.4500 1.2288 0.1896  -0.0773 0.0270  1140 GLN A C   
1905 O O   . GLN A 264 ? 1.3496 1.6064 1.3931 0.1906  -0.0819 0.0216  1140 GLN A O   
1906 C CB  . GLN A 264 ? 1.1803 1.4560 1.1997 0.2001  -0.0798 0.0288  1140 GLN A CB  
1907 C CG  . GLN A 264 ? 1.1530 1.4453 1.1854 0.2035  -0.0891 0.0184  1140 GLN A CG  
1908 C CD  . GLN A 264 ? 1.1992 1.5062 1.2367 0.2136  -0.0931 0.0162  1140 GLN A CD  
1909 O OE1 . GLN A 264 ? 1.5061 1.8084 1.5475 0.2163  -0.0919 0.0174  1140 GLN A OE1 
1910 N NE2 . GLN A 264 ? 1.0569 1.3829 1.0945 0.2195  -0.0978 0.0124  1140 GLN A NE2 
1911 N N   . THR A 265 ? 1.1525 1.3956 1.1794 0.1814  -0.0736 0.0288  1141 THR A N   
1912 C CA  . THR A 265 ? 1.1126 1.3484 1.1473 0.1733  -0.0747 0.0249  1141 THR A CA  
1913 C C   . THR A 265 ? 1.0105 1.2289 1.0387 0.1661  -0.0661 0.0314  1141 THR A C   
1914 O O   . THR A 265 ? 0.8828 1.0954 0.9036 0.1606  -0.0624 0.0333  1141 THR A O   
1915 C CB  . THR A 265 ? 1.1749 1.4181 1.2117 0.1703  -0.0798 0.0188  1141 THR A CB  
1916 O OG1 . THR A 265 ? 1.3629 1.6064 1.3870 0.1695  -0.0759 0.0224  1141 THR A OG1 
1917 C CG2 . THR A 265 ? 1.1739 1.4346 1.2206 0.1770  -0.0892 0.0108  1141 THR A CG2 
1918 N N   . PRO A 266 ? 0.9970 1.2075 1.0282 0.1659  -0.0630 0.0342  1142 PRO A N   
1919 C CA  . PRO A 266 ? 1.0960 1.2911 1.1208 0.1603  -0.0545 0.0405  1142 PRO A CA  
1920 C C   . PRO A 266 ? 1.1046 1.2919 1.1332 0.1505  -0.0528 0.0388  1142 PRO A C   
1921 O O   . PRO A 266 ? 0.8311 1.0089 0.8522 0.1452  -0.0464 0.0428  1142 PRO A O   
1922 C CB  . PRO A 266 ? 0.9307 1.1228 0.9589 0.1644  -0.0531 0.0427  1142 PRO A CB  
1923 C CG  . PRO A 266 ? 0.8162 1.0198 0.8564 0.1679  -0.0610 0.0359  1142 PRO A CG  
1924 C CD  . PRO A 266 ? 0.8504 1.0666 0.8909 0.1712  -0.0670 0.0314  1142 PRO A CD  
1925 N N   . ASN A 267 ? 0.9561 1.1474 0.9964 0.1479  -0.0584 0.0332  1143 ASN A N   
1926 C CA  . ASN A 267 ? 0.9407 1.1249 0.9853 0.1386  -0.0569 0.0322  1143 ASN A CA  
1927 C C   . ASN A 267 ? 1.0402 1.2236 1.0791 0.1341  -0.0564 0.0311  1143 ASN A C   
1928 O O   . ASN A 267 ? 0.9239 1.0986 0.9604 0.1267  -0.0514 0.0329  1143 ASN A O   
1929 C CB  . ASN A 267 ? 0.8833 1.0725 0.9418 0.1369  -0.0638 0.0268  1143 ASN A CB  
1930 C CG  . ASN A 267 ? 0.8534 1.0434 0.9177 0.1401  -0.0638 0.0275  1143 ASN A CG  
1931 O OD1 . ASN A 267 ? 0.8048 0.9893 0.8633 0.1422  -0.0580 0.0322  1143 ASN A OD1 
1932 N ND2 . ASN A 267 ? 0.8192 1.0160 0.8952 0.1403  -0.0706 0.0226  1143 ASN A ND2 
1933 N N   . ARG A 268 ? 1.0246 1.2180 1.0616 0.1386  -0.0616 0.0276  1144 ARG A N   
1934 C CA  . ARG A 268 ? 0.8402 1.0343 0.8710 0.1350  -0.0615 0.0258  1144 ARG A CA  
1935 C C   . ARG A 268 ? 0.7965 0.9848 0.8130 0.1346  -0.0534 0.0319  1144 ARG A C   
1936 O O   . ARG A 268 ? 0.8536 1.0358 0.8640 0.1285  -0.0490 0.0329  1144 ARG A O   
1937 C CB  . ARG A 268 ? 0.7225 0.9312 0.7571 0.1403  -0.0704 0.0191  1144 ARG A CB  
1938 C CG  . ARG A 268 ? 0.5933 0.8053 0.6232 0.1372  -0.0721 0.0155  1144 ARG A CG  
1939 C CD  . ARG A 268 ? 0.8751 1.1035 0.9073 0.1439  -0.0802 0.0094  1144 ARG A CD  
1940 N NE  . ARG A 268 ? 0.8849 1.1179 0.9117 0.1414  -0.0818 0.0055  1144 ARG A NE  
1941 C CZ  . ARG A 268 ? 0.9099 1.1501 0.9447 0.1408  -0.0900 -0.0026 1144 ARG A CZ  
1942 N NH1 . ARG A 268 ? 0.8686 1.1120 0.9176 0.1423  -0.0973 -0.0074 1144 ARG A NH1 
1943 N NH2 . ARG A 268 ? 0.9697 1.2142 0.9986 0.1387  -0.0911 -0.0062 1144 ARG A NH2 
1944 N N   . ALA A 269 ? 0.7714 0.9612 0.7826 0.1411  -0.0514 0.0363  1145 ALA A N   
1945 C CA  . ALA A 269 ? 0.8718 1.0561 0.8697 0.1411  -0.0442 0.0427  1145 ALA A CA  
1946 C C   . ALA A 269 ? 0.7384 0.9074 0.7331 0.1344  -0.0356 0.0476  1145 ALA A C   
1947 O O   . ALA A 269 ? 0.7204 0.8835 0.7056 0.1302  -0.0298 0.0506  1145 ALA A O   
1948 C CB  . ALA A 269 ? 0.9318 1.1205 0.9260 0.1496  -0.0444 0.0468  1145 ALA A CB  
1949 N N   . LYS A 270 ? 0.7032 0.8665 0.7060 0.1331  -0.0347 0.0480  1146 LYS A N   
1950 C CA  . LYS A 270 ? 0.6307 0.7811 0.6316 0.1268  -0.0267 0.0519  1146 LYS A CA  
1951 C C   . LYS A 270 ? 0.6828 0.8301 0.6837 0.1183  -0.0249 0.0492  1146 LYS A C   
1952 O O   . LYS A 270 ? 0.8027 0.9414 0.7969 0.1134  -0.0175 0.0525  1146 LYS A O   
1953 C CB  . LYS A 270 ? 0.5118 0.6592 0.5222 0.1271  -0.0268 0.0519  1146 LYS A CB  
1954 N N   . ARG A 271 ? 0.7102 0.8646 0.7186 0.1167  -0.0316 0.0433  1147 ARG A N   
1955 C CA  . ARG A 271 ? 0.6961 0.8482 0.7043 0.1092  -0.0306 0.0406  1147 ARG A CA  
1956 C C   . ARG A 271 ? 0.7725 0.9250 0.7684 0.1084  -0.0275 0.0412  1147 ARG A C   
1957 O O   . ARG A 271 ? 0.8262 0.9716 0.8163 0.1023  -0.0209 0.0429  1147 ARG A O   
1958 C CB  . ARG A 271 ? 0.8162 0.9760 0.8348 0.1084  -0.0395 0.0340  1147 ARG A CB  
1959 C CG  . ARG A 271 ? 0.7451 0.9041 0.7761 0.1069  -0.0423 0.0332  1147 ARG A CG  
1960 C CD  . ARG A 271 ? 0.8019 0.9667 0.8431 0.1047  -0.0508 0.0272  1147 ARG A CD  
1961 N NE  . ARG A 271 ? 0.8577 1.0331 0.9026 0.1117  -0.0593 0.0227  1147 ARG A NE  
1962 C CZ  . ARG A 271 ? 1.0082 1.1890 1.0626 0.1158  -0.0649 0.0208  1147 ARG A CZ  
1963 N NH1 . ARG A 271 ? 0.8833 1.0600 0.9440 0.1134  -0.0630 0.0231  1147 ARG A NH1 
1964 N NH2 . ARG A 271 ? 1.1386 1.3301 1.1965 0.1222  -0.0725 0.0161  1147 ARG A NH2 
1965 N N   . VAL A 272 ? 0.6558 0.8176 0.6476 0.1145  -0.0320 0.0400  1148 VAL A N   
1966 C CA  . VAL A 272 ? 0.6780 0.8421 0.6580 0.1136  -0.0297 0.0403  1148 VAL A CA  
1967 C C   . VAL A 272 ? 0.6434 0.7974 0.6127 0.1119  -0.0200 0.0477  1148 VAL A C   
1968 O O   . VAL A 272 ? 0.6530 0.8031 0.6138 0.1069  -0.0146 0.0486  1148 VAL A O   
1969 C CB  . VAL A 272 ? 0.7327 0.9110 0.7112 0.1207  -0.0368 0.0372  1148 VAL A CB  
1970 C CG1 . VAL A 272 ? 0.5645 0.7468 0.5305 0.1194  -0.0344 0.0375  1148 VAL A CG1 
1971 C CG2 . VAL A 272 ? 0.5208 0.7087 0.5110 0.1221  -0.0466 0.0291  1148 VAL A CG2 
1972 N N   . ILE A 273 ? 0.6519 0.8014 0.6218 0.1161  -0.0176 0.0529  1149 ILE A N   
1973 C CA  . ILE A 273 ? 0.8509 0.9901 0.8116 0.1150  -0.0091 0.0601  1149 ILE A CA  
1974 C C   . ILE A 273 ? 0.8739 1.0016 0.8358 0.1073  -0.0018 0.0611  1149 ILE A C   
1975 O O   . ILE A 273 ? 0.8618 0.9821 0.8149 0.1035  0.0054  0.0647  1149 ILE A O   
1976 C CB  . ILE A 273 ? 0.7914 0.9288 0.7534 0.1220  -0.0093 0.0650  1149 ILE A CB  
1977 C CG1 . ILE A 273 ? 0.7051 0.8549 0.6645 0.1299  -0.0156 0.0646  1149 ILE A CG1 
1978 C CG2 . ILE A 273 ? 0.7843 0.9092 0.7385 0.1207  -0.0007 0.0724  1149 ILE A CG2 
1979 C CD1 . ILE A 273 ? 0.6829 0.8325 0.6444 0.1374  -0.0167 0.0686  1149 ILE A CD1 
1980 N N   . THR A 274 ? 0.9162 1.0428 0.8890 0.1046  -0.0036 0.0578  1150 THR A N   
1981 C CA  . THR A 274 ? 0.9035 1.0219 0.8783 0.0969  0.0028  0.0579  1150 THR A CA  
1982 C C   . THR A 274 ? 0.9316 1.0509 0.9001 0.0912  0.0047  0.0550  1150 THR A C   
1983 O O   . THR A 274 ? 0.7962 0.9081 0.7593 0.0859  0.0126  0.0570  1150 THR A O   
1984 C CB  . THR A 274 ? 0.8108 0.9306 0.7987 0.0949  -0.0006 0.0547  1150 THR A CB  
1985 O OG1 . THR A 274 ? 0.8776 0.9966 0.8709 0.1000  -0.0019 0.0570  1150 THR A OG1 
1986 C CG2 . THR A 274 ? 0.8031 0.9164 0.7935 0.0867  0.0058  0.0545  1150 THR A CG2 
1987 N N   . THR A 275 ? 0.8166 0.9456 0.7862 0.0923  -0.0025 0.0498  1151 THR A N   
1988 C CA  . THR A 275 ? 0.7025 0.8336 0.6660 0.0875  -0.0014 0.0463  1151 THR A CA  
1989 C C   . THR A 275 ? 0.6863 0.8149 0.6359 0.0871  0.0046  0.0499  1151 THR A C   
1990 O O   . THR A 275 ? 0.7099 0.8349 0.6533 0.0812  0.0103  0.0493  1151 THR A O   
1991 C CB  . THR A 275 ? 0.6065 0.7491 0.5738 0.0899  -0.0112 0.0396  1151 THR A CB  
1992 O OG1 . THR A 275 ? 0.6333 0.7774 0.6139 0.0899  -0.0169 0.0367  1151 THR A OG1 
1993 C CG2 . THR A 275 ? 0.6067 0.7516 0.5684 0.0849  -0.0106 0.0351  1151 THR A CG2 
1994 N N   . PHE A 276 ? 0.7786 0.9098 0.7233 0.0932  0.0034  0.0538  1152 PHE A N   
1995 C CA  . PHE A 276 ? 0.8644 0.9928 0.7960 0.0926  0.0092  0.0586  1152 PHE A CA  
1996 C C   . PHE A 276 ? 0.8152 0.9297 0.7442 0.0883  0.0191  0.0640  1152 PHE A C   
1997 O O   . PHE A 276 ? 0.8195 0.9296 0.7398 0.0833  0.0257  0.0653  1152 PHE A O   
1998 C CB  . PHE A 276 ? 0.9663 1.1007 0.8941 0.1003  0.0056  0.0624  1152 PHE A CB  
1999 C CG  . PHE A 276 ? 0.9161 1.0659 0.8418 0.1038  -0.0022 0.0575  1152 PHE A CG  
2000 C CD1 . PHE A 276 ? 1.1064 1.2615 1.0226 0.1003  -0.0011 0.0551  1152 PHE A CD1 
2001 C CD2 . PHE A 276 ? 0.8342 0.9939 0.7676 0.1108  -0.0106 0.0549  1152 PHE A CD2 
2002 C CE1 . PHE A 276 ? 1.0396 1.2105 0.9545 0.1037  -0.0087 0.0499  1152 PHE A CE1 
2003 C CE2 . PHE A 276 ? 1.0067 1.1817 0.9393 0.1143  -0.0180 0.0497  1152 PHE A CE2 
2004 C CZ  . PHE A 276 ? 0.9150 1.0959 0.8385 0.1108  -0.0172 0.0471  1152 PHE A CZ  
2005 N N   . ARG A 277 ? 0.7498 0.8579 0.6867 0.0903  0.0201  0.0667  1153 ARG A N   
2006 C CA  . ARG A 277 ? 0.7184 0.8138 0.6539 0.0876  0.0286  0.0719  1153 ARG A CA  
2007 C C   . ARG A 277 ? 0.8834 0.9740 0.8204 0.0793  0.0348  0.0690  1153 ARG A C   
2008 O O   . ARG A 277 ? 1.0967 1.1791 1.0275 0.0753  0.0428  0.0720  1153 ARG A O   
2009 C CB  . ARG A 277 ? 0.7372 0.8291 0.6821 0.0920  0.0271  0.0740  1153 ARG A CB  
2010 C CG  . ARG A 277 ? 0.8014 0.8809 0.7463 0.0905  0.0348  0.0789  1153 ARG A CG  
2011 C CD  . ARG A 277 ? 0.8790 0.9570 0.8331 0.0957  0.0321  0.0801  1153 ARG A CD  
2012 N NE  . ARG A 277 ? 0.8976 0.9809 0.8634 0.0937  0.0283  0.0746  1153 ARG A NE  
2013 C CZ  . ARG A 277 ? 1.1546 1.2344 1.1269 0.0878  0.0325  0.0726  1153 ARG A CZ  
2014 N NH1 . ARG A 277 ? 1.1168 1.1879 1.0857 0.0835  0.0408  0.0749  1153 ARG A NH1 
2015 N NH2 . ARG A 277 ? 1.2137 1.2994 1.1964 0.0860  0.0285  0.0682  1153 ARG A NH2 
2016 N N   . THR A 278 ? 0.8918 0.9873 0.8370 0.0766  0.0311  0.0633  1154 THR A N   
2017 C CA  . THR A 278 ? 0.8395 0.9315 0.7877 0.0691  0.0365  0.0606  1154 THR A CA  
2018 C C   . THR A 278 ? 0.7149 0.8125 0.6580 0.0649  0.0358  0.0556  1154 THR A C   
2019 O O   . THR A 278 ? 0.6447 0.7385 0.5851 0.0586  0.0425  0.0544  1154 THR A O   
2020 C CB  . THR A 278 ? 1.0042 1.0976 0.9660 0.0683  0.0335  0.0583  1154 THR A CB  
2021 O OG1 . THR A 278 ? 1.0045 1.1071 0.9713 0.0710  0.0240  0.0541  1154 THR A OG1 
2022 C CG2 . THR A 278 ? 1.0675 1.1563 1.0348 0.0725  0.0342  0.0624  1154 THR A CG2 
2023 N N   . GLY A 279 ? 0.6566 0.7634 0.5983 0.0682  0.0277  0.0521  1155 GLY A N   
2024 C CA  . GLY A 279 ? 0.5984 0.7112 0.5365 0.0646  0.0258  0.0464  1155 GLY A CA  
2025 C C   . GLY A 279 ? 0.7284 0.8433 0.6766 0.0611  0.0226  0.0416  1155 GLY A C   
2026 O O   . GLY A 279 ? 0.8092 0.9260 0.7547 0.0564  0.0238  0.0374  1155 GLY A O   
2027 N N   . THR A 280 ? 0.6343 0.7493 0.5941 0.0631  0.0184  0.0421  1156 THR A N   
2028 C CA  . THR A 280 ? 0.6814 0.7982 0.6516 0.0593  0.0152  0.0386  1156 THR A CA  
2029 C C   . THR A 280 ? 0.6274 0.7508 0.6068 0.0641  0.0046  0.0363  1156 THR A C   
2030 O O   . THR A 280 ? 0.5839 0.7107 0.5620 0.0705  0.0002  0.0373  1156 THR A O   
2031 C CB  . THR A 280 ? 0.6504 0.7608 0.6271 0.0553  0.0219  0.0417  1156 THR A CB  
2032 O OG1 . THR A 280 ? 0.6973 0.8055 0.6785 0.0599  0.0210  0.0456  1156 THR A OG1 
2033 C CG2 . THR A 280 ? 0.6881 0.7922 0.6567 0.0507  0.0326  0.0436  1156 THR A CG2 
2034 N N   . TRP A 281 ? 0.5803 0.7058 0.5694 0.0609  0.0003  0.0334  1157 TRP A N   
2035 C CA  . TRP A 281 ? 0.5795 0.7106 0.5789 0.0642  -0.0098 0.0309  1157 TRP A CA  
2036 C C   . TRP A 281 ? 0.6164 0.7453 0.6261 0.0639  -0.0096 0.0340  1157 TRP A C   
2037 O O   . TRP A 281 ? 0.4486 0.5815 0.4686 0.0644  -0.0170 0.0321  1157 TRP A O   
2038 C CB  . TRP A 281 ? 0.5459 0.6809 0.5499 0.0609  -0.0159 0.0256  1157 TRP A CB  
2039 C CG  . TRP A 281 ? 0.5973 0.7362 0.5923 0.0614  -0.0175 0.0213  1157 TRP A CG  
2040 C CD1 . TRP A 281 ? 0.5082 0.6460 0.4978 0.0563  -0.0140 0.0187  1157 TRP A CD1 
2041 C CD2 . TRP A 281 ? 0.5629 0.7087 0.5532 0.0676  -0.0233 0.0184  1157 TRP A CD2 
2042 N NE1 . TRP A 281 ? 0.5445 0.6879 0.5260 0.0588  -0.0172 0.0142  1157 TRP A NE1 
2043 C CE2 . TRP A 281 ? 0.5575 0.7064 0.5395 0.0656  -0.0230 0.0140  1157 TRP A CE2 
2044 C CE3 . TRP A 281 ? 0.5219 0.6727 0.5143 0.0746  -0.0285 0.0188  1157 TRP A CE3 
2045 C CZ2 . TRP A 281 ? 0.5353 0.6926 0.5113 0.0702  -0.0281 0.0099  1157 TRP A CZ2 
2046 C CZ3 . TRP A 281 ? 0.5238 0.6831 0.5105 0.0793  -0.0334 0.0151  1157 TRP A CZ3 
2047 C CH2 . TRP A 281 ? 0.5881 0.7509 0.5668 0.0770  -0.0332 0.0106  1157 TRP A CH2 
2048 N N   . ASP A 282 ? 0.6153 0.7383 0.6229 0.0629  -0.0014 0.0385  1158 ASP A N   
2049 C CA  . ASP A 282 ? 0.6524 0.7743 0.6700 0.0615  -0.0006 0.0407  1158 ASP A CA  
2050 C C   . ASP A 282 ? 0.7920 0.9180 0.8161 0.0677  -0.0080 0.0406  1158 ASP A C   
2051 O O   . ASP A 282 ? 0.9912 1.1193 1.0256 0.0662  -0.0109 0.0406  1158 ASP A O   
2052 C CB  . ASP A 282 ? 0.7671 0.8823 0.7811 0.0600  0.0093  0.0448  1158 ASP A CB  
2053 C CG  . ASP A 282 ? 0.9824 1.0945 0.9932 0.0529  0.0169  0.0444  1158 ASP A CG  
2054 O OD1 . ASP A 282 ? 1.1666 1.2813 1.1757 0.0497  0.0147  0.0412  1158 ASP A OD1 
2055 O OD2 . ASP A 282 ? 0.8884 0.9958 0.8987 0.0506  0.0248  0.0469  1158 ASP A OD2 
2056 N N   . ALA A 283 ? 0.7436 0.8718 0.7620 0.0745  -0.0111 0.0406  1159 ALA A N   
2057 C CA  . ALA A 283 ? 0.6032 0.7364 0.6274 0.0810  -0.0180 0.0400  1159 ALA A CA  
2058 C C   . ALA A 283 ? 0.6550 0.7955 0.6878 0.0813  -0.0280 0.0350  1159 ALA A C   
2059 O O   . ALA A 283 ? 0.5401 0.6857 0.5790 0.0864  -0.0343 0.0337  1159 ALA A O   
2060 C CB  . ALA A 283 ? 0.4721 0.6064 0.4874 0.0883  -0.0178 0.0417  1159 ALA A CB  
2061 N N   . TYR A 284 ? 0.5828 0.7238 0.6163 0.0762  -0.0296 0.0321  1160 TYR A N   
2062 C CA  . TYR A 284 ? 0.5461 0.6926 0.5888 0.0757  -0.0392 0.0275  1160 TYR A CA  
2063 C C   . TYR A 284 ? 0.6379 0.7822 0.6889 0.0680  -0.0391 0.0277  1160 TYR A C   
2064 O O   . TYR A 284 ? 0.7318 0.8793 0.7906 0.0663  -0.0468 0.0244  1160 TYR A O   
2065 C CB  . TYR A 284 ? 0.4200 0.5706 0.4574 0.0774  -0.0436 0.0228  1160 TYR A CB  
2066 C CG  . TYR A 284 ? 0.4842 0.6407 0.5162 0.0855  -0.0466 0.0215  1160 TYR A CG  
2067 C CD1 . TYR A 284 ? 0.5432 0.6973 0.5634 0.0878  -0.0396 0.0251  1160 TYR A CD1 
2068 C CD2 . TYR A 284 ? 0.5918 0.7567 0.6308 0.0907  -0.0565 0.0168  1160 TYR A CD2 
2069 C CE1 . TYR A 284 ? 0.6285 0.7890 0.6436 0.0949  -0.0423 0.0245  1160 TYR A CE1 
2070 C CE2 . TYR A 284 ? 0.5657 0.7378 0.6002 0.0981  -0.0592 0.0155  1160 TYR A CE2 
2071 C CZ  . TYR A 284 ? 0.7209 0.8910 0.7432 0.1002  -0.0521 0.0196  1160 TYR A CZ  
2072 O OH  . TYR A 284 ? 0.7394 0.9178 0.7571 0.1074  -0.0548 0.0188  1160 TYR A OH  
2073 N N   . SER A 285 ? 0.8952 1.0345 0.9450 0.0631  -0.0307 0.0316  261  SER A N   
2074 C CA  . SER A 285 ? 0.9967 1.1353 1.0539 0.0554  -0.0297 0.0323  261  SER A CA  
2075 C C   . SER A 285 ? 0.9470 1.0883 1.0155 0.0548  -0.0330 0.0337  261  SER A C   
2076 O O   . SER A 285 ? 1.1930 1.3347 1.2617 0.0591  -0.0317 0.0354  261  SER A O   
2077 C CB  . SER A 285 ? 0.9514 1.0851 1.0025 0.0504  -0.0189 0.0351  261  SER A CB  
2078 O OG  . SER A 285 ? 1.2470 1.3815 1.3052 0.0428  -0.0178 0.0358  261  SER A OG  
2079 N N   . GLU A 286 ? 0.8596 1.0031 0.9373 0.0492  -0.0375 0.0331  262  GLU A N   
2080 C CA  . GLU A 286 ? 0.8120 0.9588 0.9006 0.0465  -0.0398 0.0349  262  GLU A CA  
2081 C C   . GLU A 286 ? 0.7610 0.9068 0.8502 0.0404  -0.0311 0.0383  262  GLU A C   
2082 O O   . GLU A 286 ? 0.8780 1.0219 0.9639 0.0352  -0.0264 0.0389  262  GLU A O   
2083 C CB  . GLU A 286 ? 0.7832 0.9330 0.8820 0.0429  -0.0490 0.0331  262  GLU A CB  
2084 C CG  . GLU A 286 ? 0.8514 1.0038 0.9529 0.0492  -0.0587 0.0290  262  GLU A CG  
2085 C CD  . GLU A 286 ? 1.0900 1.2450 1.2035 0.0456  -0.0681 0.0277  262  GLU A CD  
2086 O OE1 . GLU A 286 ? 1.0832 1.2365 1.1979 0.0412  -0.0708 0.0268  262  GLU A OE1 
2087 O OE2 . GLU A 286 ? 1.2558 1.4145 1.3776 0.0470  -0.0729 0.0275  262  GLU A OE2 
2088 N N   . GLN A 287 ? 0.7741 0.9222 0.8677 0.0412  -0.0291 0.0401  263  GLN A N   
2089 C CA  . GLN A 287 ? 0.6367 0.7848 0.7305 0.0368  -0.0205 0.0426  263  GLN A CA  
2090 C C   . GLN A 287 ? 0.6275 0.7807 0.7305 0.0280  -0.0209 0.0439  263  GLN A C   
2091 O O   . GLN A 287 ? 0.6251 0.7796 0.7285 0.0233  -0.0136 0.0455  263  GLN A O   
2092 C CB  . GLN A 287 ? 0.7307 0.8799 0.8255 0.0416  -0.0186 0.0434  263  GLN A CB  
2093 N N   . TRP A 288 ? 0.5765 0.7331 0.6874 0.0254  -0.0294 0.0434  264  TRP A N   
2094 C CA  . TRP A 288 ? 0.6056 0.7672 0.7249 0.0165  -0.0301 0.0453  264  TRP A CA  
2095 C C   . TRP A 288 ? 0.7941 0.9532 0.9095 0.0117  -0.0273 0.0456  264  TRP A C   
2096 O O   . TRP A 288 ? 1.0021 1.1654 1.1223 0.0042  -0.0246 0.0478  264  TRP A O   
2097 C CB  . TRP A 288 ? 0.5341 0.6997 0.6637 0.0150  -0.0402 0.0451  264  TRP A CB  
2098 C CG  . TRP A 288 ? 0.5758 0.7378 0.7050 0.0180  -0.0487 0.0426  264  TRP A CG  
2099 C CD1 . TRP A 288 ? 0.7270 0.8874 0.8544 0.0259  -0.0540 0.0394  264  TRP A CD1 
2100 C CD2 . TRP A 288 ? 0.5489 0.7095 0.6806 0.0132  -0.0532 0.0426  264  TRP A CD2 
2101 N NE1 . TRP A 288 ? 0.6453 0.8038 0.7741 0.0263  -0.0616 0.0370  264  TRP A NE1 
2102 C CE2 . TRP A 288 ? 0.6605 0.8184 0.7919 0.0187  -0.0614 0.0389  264  TRP A CE2 
2103 C CE3 . TRP A 288 ? 0.6932 0.8551 0.8275 0.0050  -0.0512 0.0452  264  TRP A CE3 
2104 C CZ2 . TRP A 288 ? 0.6884 0.8441 0.8221 0.0164  -0.0679 0.0375  264  TRP A CZ2 
2105 C CZ3 . TRP A 288 ? 0.8760 1.0353 1.0121 0.0027  -0.0575 0.0444  264  TRP A CZ3 
2106 C CH2 . TRP A 288 ? 0.7900 0.9459 0.9259 0.0084  -0.0659 0.0404  264  TRP A CH2 
2107 N N   . ILE A 289 ? 0.6777 0.8310 0.7843 0.0160  -0.0277 0.0433  265  ILE A N   
2108 C CA  . ILE A 289 ? 0.7141 0.8651 0.8159 0.0121  -0.0248 0.0428  265  ILE A CA  
2109 C C   . ILE A 289 ? 0.6927 0.8442 0.7905 0.0084  -0.0136 0.0443  265  ILE A C   
2110 O O   . ILE A 289 ? 0.8055 0.9593 0.9047 0.0020  -0.0105 0.0453  265  ILE A O   
2111 C CB  . ILE A 289 ? 0.7515 0.8974 0.8441 0.0181  -0.0275 0.0392  265  ILE A CB  
2112 C CG1 . ILE A 289 ? 0.6690 0.8157 0.7673 0.0212  -0.0392 0.0369  265  ILE A CG1 
2113 C CG2 . ILE A 289 ? 0.5119 0.6556 0.5979 0.0146  -0.0234 0.0381  265  ILE A CG2 
2114 C CD1 . ILE A 289 ? 0.8144 0.9626 0.9207 0.0152  -0.0456 0.0372  265  ILE A CD1 
2115 N N   . PHE A 290 ? 0.6383 0.7879 0.7314 0.0126  -0.0075 0.0446  266  PHE A N   
2116 C CA  . PHE A 290 ? 0.4939 0.6438 0.5841 0.0095  0.0031  0.0455  266  PHE A CA  
2117 C C   . PHE A 290 ? 0.7308 0.8890 0.8314 0.0028  0.0049  0.0476  266  PHE A C   
2118 O O   . PHE A 290 ? 1.1470 1.3084 1.2480 -0.0026 0.0119  0.0480  266  PHE A O   
2119 C CB  . PHE A 290 ? 0.4709 0.6161 0.5546 0.0158  0.0081  0.0455  266  PHE A CB  
2120 C CG  . PHE A 290 ? 0.5276 0.6709 0.6066 0.0138  0.0188  0.0457  266  PHE A CG  
2121 C CD1 . PHE A 290 ? 0.5002 0.6378 0.5687 0.0147  0.0236  0.0446  266  PHE A CD1 
2122 C CD2 . PHE A 290 ? 0.6101 0.7580 0.6955 0.0111  0.0240  0.0467  266  PHE A CD2 
2123 C CE1 . PHE A 290 ? 0.6628 0.7986 0.7275 0.0127  0.0336  0.0446  266  PHE A CE1 
2124 C CE2 . PHE A 290 ? 0.6705 0.8170 0.7526 0.0094  0.0338  0.0464  266  PHE A CE2 
2125 C CZ  . PHE A 290 ? 0.6820 0.8219 0.7538 0.0102  0.0386  0.0455  266  PHE A CZ  
2126 N N   . ARG A 291 ? 0.6975 0.8605 0.8068 0.0027  -0.0014 0.0486  267  ARG A N   
2127 C CA  . ARG A 291 ? 0.6405 0.8130 0.7601 -0.0044 -0.0008 0.0505  267  ARG A CA  
2128 C C   . ARG A 291 ? 0.7000 0.8760 0.8237 -0.0117 -0.0036 0.0520  267  ARG A C   
2129 O O   . ARG A 291 ? 0.8590 1.0428 0.9879 -0.0185 0.0007  0.0537  267  ARG A O   
2130 C CB  . ARG A 291 ? 0.6259 0.8029 0.7534 -0.0030 -0.0074 0.0510  267  ARG A CB  
2131 C CG  . ARG A 291 ? 0.6068 0.7812 0.7311 0.0045  -0.0054 0.0496  267  ARG A CG  
2132 C CD  . ARG A 291 ? 0.6254 0.8022 0.7489 0.0033  0.0042  0.0495  267  ARG A CD  
2133 N NE  . ARG A 291 ? 0.6808 0.8572 0.8044 0.0094  0.0050  0.0485  267  ARG A NE  
2134 C CZ  . ARG A 291 ? 0.7100 0.8949 0.8421 0.0081  0.0026  0.0483  267  ARG A CZ  
2135 N NH1 . ARG A 291 ? 0.6160 0.8106 0.7572 0.0006  -0.0006 0.0495  267  ARG A NH1 
2136 N NH2 . ARG A 291 ? 0.6846 0.8687 0.8160 0.0143  0.0033  0.0469  267  ARG A NH2 
2137 N N   . LEU A 292 ? 0.7391 0.9099 0.8604 -0.0102 -0.0104 0.0512  268  LEU A N   
2138 C CA  . LEU A 292 ? 0.7346 0.9077 0.8588 -0.0168 -0.0127 0.0526  268  LEU A CA  
2139 C C   . LEU A 292 ? 0.7291 0.9013 0.8462 -0.0190 -0.0038 0.0517  268  LEU A C   
2140 O O   . LEU A 292 ? 0.7456 0.9237 0.8667 -0.0259 -0.0016 0.0535  268  LEU A O   
2141 C CB  . LEU A 292 ? 0.8767 1.0443 1.0006 -0.0143 -0.0228 0.0512  268  LEU A CB  
2142 C CG  . LEU A 292 ? 0.8970 1.0684 1.0298 -0.0212 -0.0296 0.0539  268  LEU A CG  
2143 C CD1 . LEU A 292 ? 0.8354 1.0163 0.9785 -0.0274 -0.0292 0.0578  268  LEU A CD1 
2144 C CD2 . LEU A 292 ? 0.8609 1.0274 0.9964 -0.0180 -0.0411 0.0524  268  LEU A CD2 
2145 N N   . TYR A 293 ? 0.6627 0.8283 0.7695 -0.0135 0.0015  0.0491  269  TYR A N   
2146 C CA  . TYR A 293 ? 0.6127 0.7779 0.7129 -0.0158 0.0109  0.0479  269  TYR A CA  
2147 C C   . TYR A 293 ? 0.6373 0.8109 0.7434 -0.0208 0.0188  0.0495  269  TYR A C   
2148 O O   . TYR A 293 ? 0.8041 0.9827 0.9110 -0.0264 0.0240  0.0497  269  TYR A O   
2149 C CB  . TYR A 293 ? 0.5985 0.7556 0.6871 -0.0093 0.0156  0.0453  269  TYR A CB  
2150 C CG  . TYR A 293 ? 0.4946 0.6450 0.5762 -0.0043 0.0090  0.0429  269  TYR A CG  
2151 C CD1 . TYR A 293 ? 0.3679 0.5189 0.4522 -0.0064 0.0011  0.0422  269  TYR A CD1 
2152 C CD2 . TYR A 293 ? 0.5240 0.6682 0.5967 0.0025  0.0102  0.0412  269  TYR A CD2 
2153 C CE1 . TYR A 293 ? 0.4765 0.6228 0.5553 -0.0016 -0.0054 0.0392  269  TYR A CE1 
2154 C CE2 . TYR A 293 ? 0.5563 0.6966 0.6231 0.0071  0.0040  0.0386  269  TYR A CE2 
2155 C CZ  . TYR A 293 ? 0.6069 0.7484 0.6769 0.0051  -0.0038 0.0372  269  TYR A CZ  
2156 O OH  . TYR A 293 ? 0.9028 1.0415 0.9676 0.0099  -0.0104 0.0337  269  TYR A OH  
2157 N N   . VAL A 294 ? 0.5323 0.7083 0.6426 -0.0188 0.0200  0.0501  270  VAL A N   
2158 C CA  . VAL A 294 ? 0.6361 0.8211 0.7524 -0.0232 0.0274  0.0506  270  VAL A CA  
2159 C C   . VAL A 294 ? 0.4989 0.6955 0.6260 -0.0310 0.0241  0.0534  270  VAL A C   
2160 O O   . VAL A 294 ? 0.6976 0.9039 0.8296 -0.0366 0.0303  0.0537  270  VAL A O   
2161 C CB  . VAL A 294 ? 0.7838 0.9686 0.9016 -0.0186 0.0296  0.0500  270  VAL A CB  
2162 C CG1 . VAL A 294 ? 0.6468 0.8201 0.7536 -0.0112 0.0334  0.0481  270  VAL A CG1 
2163 C CG2 . VAL A 294 ? 1.1088 1.2960 1.2332 -0.0169 0.0209  0.0512  270  VAL A CG2 
2164 N N   . ALA A 295 ? 0.5392 0.7356 0.6707 -0.0319 0.0143  0.0553  271  ALA A N   
2165 C CA  . ALA A 295 ? 0.5298 0.7363 0.6708 -0.0399 0.0106  0.0586  271  ALA A CA  
2166 C C   . ALA A 295 ? 0.5849 0.7918 0.7236 -0.0444 0.0120  0.0594  271  ALA A C   
2167 O O   . ALA A 295 ? 0.7398 0.9569 0.8858 -0.0519 0.0121  0.0623  271  ALA A O   
2168 C CB  . ALA A 295 ? 0.4101 0.6158 0.5571 -0.0397 -0.0005 0.0606  271  ALA A CB  
2169 N N   . ILE A 296 ? 0.5744 0.7713 0.7030 -0.0402 0.0129  0.0567  272  ILE A N   
2170 C CA  . ILE A 296 ? 0.3956 0.5930 0.5210 -0.0439 0.0150  0.0566  272  ILE A CA  
2171 C C   . ILE A 296 ? 0.4702 0.6730 0.5928 -0.0462 0.0269  0.0549  272  ILE A C   
2172 O O   . ILE A 296 ? 0.4150 0.6272 0.5419 -0.0526 0.0302  0.0564  272  ILE A O   
2173 C CB  . ILE A 296 ? 0.3377 0.5234 0.4537 -0.0387 0.0103  0.0538  272  ILE A CB  
2174 C CG1 . ILE A 296 ? 0.3284 0.5104 0.4492 -0.0375 -0.0022 0.0552  272  ILE A CG1 
2175 C CG2 . ILE A 296 ? 0.3670 0.5535 0.4785 -0.0419 0.0137  0.0527  272  ILE A CG2 
2176 C CD1 . ILE A 296 ? 0.3878 0.5599 0.5007 -0.0319 -0.0077 0.0516  272  ILE A CD1 
2177 N N   . GLY A 297 ? 0.5495 0.7467 0.6650 -0.0410 0.0335  0.0517  273  GLY A N   
2178 C CA  . GLY A 297 ? 0.4175 0.6181 0.5297 -0.0425 0.0449  0.0494  273  GLY A CA  
2179 C C   . GLY A 297 ? 0.4963 0.7108 0.6187 -0.0480 0.0503  0.0505  273  GLY A C   
2180 O O   . GLY A 297 ? 0.5589 0.7818 0.6830 -0.0527 0.0571  0.0498  273  GLY A O   
2181 N N   . TRP A 298 ? 0.5179 0.7363 0.6475 -0.0473 0.0474  0.0519  274  TRP A N   
2182 C CA  . TRP A 298 ? 0.3937 0.6269 0.5337 -0.0522 0.0517  0.0524  274  TRP A CA  
2183 C C   . TRP A 298 ? 0.4712 0.7157 0.6216 -0.0586 0.0449  0.0565  274  TRP A C   
2184 O O   . TRP A 298 ? 0.3390 0.5987 0.4979 -0.0647 0.0486  0.0573  274  TRP A O   
2185 C CB  . TRP A 298 ? 0.4220 0.6538 0.5636 -0.0474 0.0539  0.0504  274  TRP A CB  
2186 C CG  . TRP A 298 ? 0.4486 0.6700 0.5812 -0.0416 0.0611  0.0470  274  TRP A CG  
2187 C CD1 . TRP A 298 ? 0.4253 0.6332 0.5501 -0.0341 0.0590  0.0462  274  TRP A CD1 
2188 C CD2 . TRP A 298 ? 0.4136 0.6379 0.5447 -0.0430 0.0716  0.0439  274  TRP A CD2 
2189 N NE1 . TRP A 298 ? 0.4749 0.6766 0.5931 -0.0310 0.0673  0.0435  274  TRP A NE1 
2190 C CE2 . TRP A 298 ? 0.4508 0.6619 0.5728 -0.0364 0.0752  0.0418  274  TRP A CE2 
2191 C CE3 . TRP A 298 ? 0.3789 0.6162 0.5157 -0.0493 0.0783  0.0428  274  TRP A CE3 
2192 C CZ2 . TRP A 298 ? 0.4125 0.6221 0.5311 -0.0362 0.0851  0.0386  274  TRP A CZ2 
2193 C CZ3 . TRP A 298 ? 0.6345 0.8710 0.7682 -0.0486 0.0883  0.0390  274  TRP A CZ3 
2194 C CH2 . TRP A 298 ? 0.5680 0.7903 0.6926 -0.0423 0.0916  0.0370  274  TRP A CH2 
2195 N N   . GLY A 299 ? 0.5317 0.7701 0.6822 -0.0575 0.0348  0.0591  275  GLY A N   
2196 C CA  . GLY A 299 ? 0.4273 0.6757 0.5880 -0.0636 0.0278  0.0634  275  GLY A CA  
2197 C C   . GLY A 299 ? 0.5118 0.7656 0.6751 -0.0704 0.0256  0.0669  275  GLY A C   
2198 O O   . GLY A 299 ? 0.6259 0.8945 0.7982 -0.0778 0.0260  0.0700  275  GLY A O   
2199 N N   . VAL A 300 ? 0.5895 0.8322 0.7450 -0.0681 0.0230  0.0663  276  VAL A N   
2200 C CA  . VAL A 300 ? 0.6815 0.9273 0.8388 -0.0737 0.0197  0.0696  276  VAL A CA  
2201 C C   . VAL A 300 ? 0.6281 0.8865 0.7871 -0.0791 0.0290  0.0694  276  VAL A C   
2202 O O   . VAL A 300 ? 0.7047 0.9735 0.8703 -0.0862 0.0269  0.0737  276  VAL A O   
2203 C CB  . VAL A 300 ? 0.6181 0.8489 0.7662 -0.0690 0.0147  0.0678  276  VAL A CB  
2204 C CG1 . VAL A 300 ? 0.5078 0.7416 0.6568 -0.0742 0.0125  0.0703  276  VAL A CG1 
2205 C CG2 . VAL A 300 ? 0.5445 0.7659 0.6937 -0.0649 0.0039  0.0685  276  VAL A CG2 
2206 N N   . PRO A 301 ? 0.7766 0.7610 0.7066 0.0353  0.0098  -0.0367 277  PRO A N   
2207 C CA  . PRO A 301 ? 0.7774 0.7689 0.6979 0.0305  0.0059  -0.0340 277  PRO A CA  
2208 C C   . PRO A 301 ? 0.8783 0.8672 0.7956 0.0394  0.0040  -0.0326 277  PRO A C   
2209 O O   . PRO A 301 ? 0.6300 0.6364 0.5551 0.0407  0.0028  -0.0271 277  PRO A O   
2210 C CB  . PRO A 301 ? 0.6505 0.6238 0.5444 0.0196  0.0023  -0.0398 277  PRO A CB  
2211 C CG  . PRO A 301 ? 0.7858 0.7557 0.6838 0.0157  0.0052  -0.0422 277  PRO A CG  
2212 C CD  . PRO A 301 ? 0.7390 0.7085 0.6538 0.0268  0.0095  -0.0424 277  PRO A CD  
2213 N N   . LEU A 302 ? 0.8197 0.7877 0.7255 0.0457  0.0037  -0.0372 278  LEU A N   
2214 C CA  . LEU A 302 ? 0.7627 0.7274 0.6652 0.0551  0.0020  -0.0357 278  LEU A CA  
2215 C C   . LEU A 302 ? 0.8545 0.8420 0.7853 0.0646  0.0045  -0.0278 278  LEU A C   
2216 O O   . LEU A 302 ? 1.0305 1.0241 0.9622 0.0713  0.0027  -0.0241 278  LEU A O   
2217 C CB  . LEU A 302 ? 0.6951 0.6336 0.5831 0.0603  0.0021  -0.0418 278  LEU A CB  
2218 C CG  . LEU A 302 ? 0.6458 0.5697 0.5158 0.0664  -0.0011 -0.0436 278  LEU A CG  
2219 C CD1 . LEU A 302 ? 0.6960 0.6171 0.5450 0.0589  -0.0062 -0.0456 278  LEU A CD1 
2220 C CD2 . LEU A 302 ? 0.5848 0.4818 0.4399 0.0689  -0.0003 -0.0503 278  LEU A CD2 
2221 N N   . LEU A 303 ? 0.8711 0.8723 0.8253 0.0654  0.0084  -0.0249 279  LEU A N   
2222 C CA  . LEU A 303 ? 0.6862 0.7074 0.6692 0.0749  0.0108  -0.0176 279  LEU A CA  
2223 C C   . LEU A 303 ? 0.5114 0.5602 0.5096 0.0725  0.0105  -0.0101 279  LEU A C   
2224 O O   . LEU A 303 ? 0.5897 0.6557 0.6089 0.0808  0.0114  -0.0033 279  LEU A O   
2225 C CB  . LEU A 303 ? 1.0056 1.0286 1.0072 0.0773  0.0148  -0.0184 279  LEU A CB  
2226 C CG  . LEU A 303 ? 1.0278 1.0648 1.0592 0.0884  0.0173  -0.0128 279  LEU A CG  
2227 C CD1 . LEU A 303 ? 0.8554 0.8767 0.8897 0.0930  0.0195  -0.0179 279  LEU A CD1 
2228 C CD2 . LEU A 303 ? 1.3089 1.3739 1.3661 0.0862  0.0192  -0.0064 279  LEU A CD2 
2229 N N   . PHE A 304 ? 0.6327 0.6868 0.6217 0.0613  0.0093  -0.0108 280  PHE A N   
2230 C CA  . PHE A 304 ? 0.6464 0.7256 0.6471 0.0585  0.0088  -0.0039 280  PHE A CA  
2231 C C   . PHE A 304 ? 0.7320 0.8073 0.7096 0.0521  0.0044  -0.0056 280  PHE A C   
2232 O O   . PHE A 304 ? 0.7651 0.8607 0.7508 0.0510  0.0036  0.0001  280  PHE A O   
2233 C CB  . PHE A 304 ? 0.5854 0.6820 0.6030 0.0516  0.0118  -0.0011 280  PHE A CB  
2234 C CG  . PHE A 304 ? 0.7333 0.8171 0.7331 0.0401  0.0112  -0.0068 280  PHE A CG  
2235 C CD1 . PHE A 304 ? 0.8520 0.9393 0.8380 0.0295  0.0085  -0.0067 280  PHE A CD1 
2236 C CD2 . PHE A 304 ? 0.8313 0.9010 0.8298 0.0401  0.0133  -0.0119 280  PHE A CD2 
2237 C CE1 . PHE A 304 ? 0.6864 0.7628 0.6574 0.0190  0.0076  -0.0111 280  PHE A CE1 
2238 C CE2 . PHE A 304 ? 0.7210 0.7806 0.7045 0.0299  0.0127  -0.0164 280  PHE A CE2 
2239 C CZ  . PHE A 304 ? 0.6133 0.6763 0.5833 0.0192  0.0098  -0.0157 280  PHE A CZ  
2240 N N   . VAL A 305 ? 0.7417 0.7919 0.6914 0.0478  0.0013  -0.0132 281  VAL A N   
2241 C CA  . VAL A 305 ? 0.6886 0.7339 0.6161 0.0421  -0.0036 -0.0153 281  VAL A CA  
2242 C C   . VAL A 305 ? 0.8765 0.9232 0.8005 0.0518  -0.0060 -0.0133 281  VAL A C   
2243 O O   . VAL A 305 ? 1.2156 1.2755 1.1376 0.0507  -0.0087 -0.0101 281  VAL A O   
2244 C CB  . VAL A 305 ? 0.7369 0.7552 0.6366 0.0339  -0.0065 -0.0240 281  VAL A CB  
2245 C CG1 . VAL A 305 ? 0.6699 0.6789 0.5451 0.0305  -0.0125 -0.0272 281  VAL A CG1 
2246 C CG2 . VAL A 305 ? 0.5686 0.5906 0.4708 0.0228  -0.0052 -0.0245 281  VAL A CG2 
2247 N N   . VAL A 306 ? 0.7104 0.7444 0.6341 0.0616  -0.0052 -0.0147 282  VAL A N   
2248 C CA  . VAL A 306 ? 0.5975 0.6302 0.5144 0.0708  -0.0079 -0.0133 282  VAL A CA  
2249 C C   . VAL A 306 ? 0.5662 0.6280 0.5087 0.0784  -0.0065 -0.0036 282  VAL A C   
2250 O O   . VAL A 306 ? 0.8471 0.9163 0.7834 0.0820  -0.0097 -0.0012 282  VAL A O   
2251 C CB  . VAL A 306 ? 0.6243 0.6335 0.5313 0.0787  -0.0077 -0.0176 282  VAL A CB  
2252 C CG1 . VAL A 306 ? 0.6065 0.5885 0.4908 0.0707  -0.0085 -0.0268 282  VAL A CG1 
2253 C CG2 . VAL A 306 ? 0.6486 0.6650 0.5811 0.0880  -0.0033 -0.0130 282  VAL A CG2 
2254 N N   . PRO A 307 ? 0.4957 0.5756 0.4672 0.0812  -0.0022 0.0024  283  PRO A N   
2255 C CA  . PRO A 307 ? 0.6247 0.7337 0.6200 0.0873  -0.0014 0.0121  283  PRO A CA  
2256 C C   . PRO A 307 ? 0.8551 0.9820 0.8489 0.0792  -0.0030 0.0146  283  PRO A C   
2257 O O   . PRO A 307 ? 0.8760 1.0223 0.8778 0.0839  -0.0042 0.0208  283  PRO A O   
2258 C CB  . PRO A 307 ? 0.4223 0.5440 0.4479 0.0907  0.0033  0.0168  283  PRO A CB  
2259 C CG  . PRO A 307 ? 0.4864 0.5829 0.5026 0.0904  0.0046  0.0096  283  PRO A CG  
2260 C CD  . PRO A 307 ? 0.5309 0.6079 0.5168 0.0799  0.0019  0.0014  283  PRO A CD  
2261 N N   . TRP A 308 ? 0.8230 0.9444 0.8065 0.0672  -0.0031 0.0103  284  TRP A N   
2262 C CA  . TRP A 308 ? 0.7054 0.8405 0.6837 0.0586  -0.0052 0.0119  284  TRP A CA  
2263 C C   . TRP A 308 ? 0.7441 0.8703 0.6980 0.0596  -0.0106 0.0085  284  TRP A C   
2264 O O   . TRP A 308 ? 0.5929 0.7379 0.5502 0.0603  -0.0124 0.0130  284  TRP A O   
2265 C CB  . TRP A 308 ? 0.7522 0.8795 0.7217 0.0455  -0.0048 0.0076  284  TRP A CB  
2266 C CG  . TRP A 308 ? 0.7986 0.9341 0.7570 0.0356  -0.0079 0.0078  284  TRP A CG  
2267 C CD1 . TRP A 308 ? 0.7155 0.8773 0.6903 0.0314  -0.0064 0.0145  284  TRP A CD1 
2268 C CD2 . TRP A 308 ? 0.7624 0.8792 0.6910 0.0286  -0.0134 0.0009  284  TRP A CD2 
2269 N NE1 . TRP A 308 ? 0.8201 0.9807 0.7769 0.0223  -0.0105 0.0123  284  TRP A NE1 
2270 C CE2 . TRP A 308 ? 0.7502 0.8835 0.6788 0.0205  -0.0151 0.0039  284  TRP A CE2 
2271 C CE3 . TRP A 308 ? 0.8453 0.9333 0.7476 0.0285  -0.0172 -0.0075 284  TRP A CE3 
2272 C CZ2 . TRP A 308 ? 0.6667 0.7881 0.5703 0.0124  -0.0208 -0.0013 284  TRP A CZ2 
2273 C CZ3 . TRP A 308 ? 1.0105 1.0870 0.8882 0.0204  -0.0228 -0.0126 284  TRP A CZ3 
2274 C CH2 . TRP A 308 ? 0.8350 0.9280 0.7136 0.0125  -0.0248 -0.0096 284  TRP A CH2 
2275 N N   . GLY A 309 ? 0.7913 0.8890 0.7203 0.0597  -0.0135 0.0005  285  GLY A N   
2276 C CA  . GLY A 309 ? 0.8462 0.9340 0.7518 0.0619  -0.0189 -0.0033 285  GLY A CA  
2277 C C   . GLY A 309 ? 0.8640 0.9671 0.7804 0.0746  -0.0193 0.0030  285  GLY A C   
2278 O O   . GLY A 309 ? 0.9870 1.0997 0.8957 0.0760  -0.0229 0.0042  285  GLY A O   
2279 N N   . ILE A 310 ? 0.7667 0.8739 0.7023 0.0841  -0.0156 0.0074  286  ILE A N   
2280 C CA  . ILE A 310 ? 0.6480 0.7700 0.5953 0.0968  -0.0160 0.0142  286  ILE A CA  
2281 C C   . ILE A 310 ? 0.6885 0.8441 0.6565 0.0969  -0.0152 0.0229  286  ILE A C   
2282 O O   . ILE A 310 ? 0.6389 0.8067 0.6035 0.1024  -0.0182 0.0260  286  ILE A O   
2283 C CB  . ILE A 310 ? 0.6167 0.7356 0.5821 0.1062  -0.0123 0.0175  286  ILE A CB  
2284 C CG1 . ILE A 310 ? 0.6374 0.7236 0.5796 0.1083  -0.0137 0.0093  286  ILE A CG1 
2285 C CG2 . ILE A 310 ? 0.5250 0.6664 0.5110 0.1186  -0.0120 0.0272  286  ILE A CG2 
2286 C CD1 . ILE A 310 ? 0.6323 0.7112 0.5897 0.1154  -0.0100 0.0109  286  ILE A CD1 
2287 N N   . VAL A 311 ? 0.6846 0.8562 0.6739 0.0911  -0.0113 0.0270  287  VAL A N   
2288 C CA  . VAL A 311 ? 0.6802 0.8845 0.6906 0.0912  -0.0102 0.0358  287  VAL A CA  
2289 C C   . VAL A 311 ? 0.7450 0.9533 0.7375 0.0827  -0.0139 0.0330  287  VAL A C   
2290 O O   . VAL A 311 ? 0.6409 0.8727 0.6418 0.0854  -0.0148 0.0389  287  VAL A O   
2291 C CB  . VAL A 311 ? 0.6624 0.8838 0.7019 0.0879  -0.0049 0.0413  287  VAL A CB  
2292 C CG1 . VAL A 311 ? 0.6116 0.8327 0.6720 0.0979  -0.0019 0.0450  287  VAL A CG1 
2293 C CG2 . VAL A 311 ? 0.8032 1.0112 0.8324 0.0751  -0.0039 0.0350  287  VAL A CG2 
2294 N N   . LYS A 312 ? 0.8120 0.9982 0.7800 0.0724  -0.0162 0.0243  288  LYS A N   
2295 C CA  . LYS A 312 ? 0.9531 1.1415 0.9032 0.0646  -0.0206 0.0213  288  LYS A CA  
2296 C C   . LYS A 312 ? 1.0417 1.2221 0.9710 0.0716  -0.0261 0.0180  288  LYS A C   
2297 O O   . LYS A 312 ? 1.4515 1.6427 1.3728 0.0695  -0.0296 0.0182  288  LYS A O   
2298 C CB  . LYS A 312 ? 1.0510 1.2185 0.9822 0.0514  -0.0220 0.0136  288  LYS A CB  
2299 C CG  . LYS A 312 ? 0.9495 1.1283 0.8993 0.0430  -0.0173 0.0171  288  LYS A CG  
2300 C CD  . LYS A 312 ? 1.0242 1.2323 0.9885 0.0384  -0.0164 0.0241  288  LYS A CD  
2301 C CE  . LYS A 312 ? 1.0113 1.2132 0.9526 0.0281  -0.0216 0.0193  288  LYS A CE  
2302 N NZ  . LYS A 312 ? 1.2213 1.4514 1.1754 0.0236  -0.0209 0.0260  288  LYS A NZ  
2303 N N   . TYR A 313 ? 0.9590 1.1210 0.8795 0.0801  -0.0268 0.0149  289  TYR A N   
2304 C CA  . TYR A 313 ? 0.8965 1.0524 0.7981 0.0878  -0.0319 0.0123  289  TYR A CA  
2305 C C   . TYR A 313 ? 0.9025 1.0871 0.8241 0.0993  -0.0311 0.0220  289  TYR A C   
2306 O O   . TYR A 313 ? 0.9013 1.0957 0.8136 0.1026  -0.0352 0.0223  289  TYR A O   
2307 C CB  . TYR A 313 ? 0.9289 1.0543 0.8124 0.0925  -0.0332 0.0057  289  TYR A CB  
2308 C CG  . TYR A 313 ? 0.9522 1.0680 0.8141 0.1007  -0.0385 0.0022  289  TYR A CG  
2309 C CD1 . TYR A 313 ? 0.8936 0.9974 0.7283 0.0951  -0.0446 -0.0054 289  TYR A CD1 
2310 C CD2 . TYR A 313 ? 0.8392 0.9576 0.7077 0.1142  -0.0377 0.0066  289  TYR A CD2 
2311 C CE1 . TYR A 313 ? 0.7976 0.8926 0.6122 0.1031  -0.0497 -0.0089 289  TYR A CE1 
2312 C CE2 . TYR A 313 ? 0.9706 1.0807 0.8191 0.1222  -0.0426 0.0037  289  TYR A CE2 
2313 C CZ  . TYR A 313 ? 0.9836 1.0820 0.8050 0.1168  -0.0486 -0.0043 289  TYR A CZ  
2314 O OH  . TYR A 313 ? 0.9993 1.0897 0.8006 0.1253  -0.0536 -0.0075 289  TYR A OH  
2315 N N   . LEU A 314 ? 0.7251 0.9246 0.6753 0.1056  -0.0260 0.0301  290  LEU A N   
2316 C CA  . LEU A 314 ? 0.7653 0.9920 0.7359 0.1172  -0.0254 0.0401  290  LEU A CA  
2317 C C   . LEU A 314 ? 0.8658 1.1259 0.8573 0.1136  -0.0237 0.0478  290  LEU A C   
2318 O O   . LEU A 314 ? 0.9691 1.2519 0.9687 0.1212  -0.0250 0.0541  290  LEU A O   
2319 C CB  . LEU A 314 ? 0.6733 0.9018 0.6663 0.1263  -0.0214 0.0460  290  LEU A CB  
2320 C CG  . LEU A 314 ? 0.6820 0.8808 0.6577 0.1322  -0.0227 0.0401  290  LEU A CG  
2321 C CD1 . LEU A 314 ? 0.5288 0.7321 0.5299 0.1406  -0.0188 0.0468  290  LEU A CD1 
2322 C CD2 . LEU A 314 ? 0.8259 1.0194 0.7804 0.1403  -0.0279 0.0382  290  LEU A CD2 
2323 N N   . TYR A 315 ? 1.0057 1.2703 1.0064 0.1025  -0.0206 0.0477  291  TYR A N   
2324 C CA  . TYR A 315 ? 0.9908 1.2881 1.0156 0.0996  -0.0178 0.0562  291  TYR A CA  
2325 C C   . TYR A 315 ? 0.9466 1.2457 0.9607 0.0859  -0.0189 0.0525  291  TYR A C   
2326 O O   . TYR A 315 ? 1.0308 1.3577 1.0616 0.0836  -0.0172 0.0594  291  TYR A O   
2327 C CB  . TYR A 315 ? 0.9513 1.2619 1.0088 0.1013  -0.0119 0.0635  291  TYR A CB  
2328 C CG  . TYR A 315 ? 0.9003 1.2130 0.9735 0.1149  -0.0108 0.0689  291  TYR A CG  
2329 C CD1 . TYR A 315 ? 0.8496 1.1912 0.9451 0.1248  -0.0103 0.0794  291  TYR A CD1 
2330 C CD2 . TYR A 315 ? 1.0934 1.3800 1.1597 0.1178  -0.0103 0.0639  291  TYR A CD2 
2331 C CE1 . TYR A 315 ? 0.8584 1.2023 0.9689 0.1372  -0.0098 0.0850  291  TYR A CE1 
2332 C CE2 . TYR A 315 ? 1.0178 1.3060 1.0984 0.1301  -0.0096 0.0691  291  TYR A CE2 
2333 C CZ  . TYR A 315 ? 0.9901 1.3069 1.0928 0.1397  -0.0094 0.0797  291  TYR A CZ  
2334 O OH  . TYR A 315 ? 0.9393 1.2580 1.0569 0.1519  -0.0091 0.0855  291  TYR A OH  
2335 N N   . GLU A 316 ? 1.0692 1.3405 1.0572 0.0766  -0.0215 0.0426  292  GLU A N   
2336 C CA  . GLU A 316 ? 1.0415 1.3140 1.0166 0.0642  -0.0238 0.0392  292  GLU A CA  
2337 C C   . GLU A 316 ? 1.0590 1.3008 0.9985 0.0599  -0.0300 0.0279  292  GLU A C   
2338 O O   . GLU A 316 ? 1.2060 1.4250 1.1323 0.0514  -0.0304 0.0214  292  GLU A O   
2339 C CB  . GLU A 316 ? 1.0773 1.3529 1.0651 0.0533  -0.0195 0.0406  292  GLU A CB  
2340 C CG  . GLU A 316 ? 1.2463 1.5536 1.2681 0.0547  -0.0138 0.0513  292  GLU A CG  
2341 C CD  . GLU A 316 ? 1.2496 1.5571 1.2799 0.0435  -0.0101 0.0516  292  GLU A CD  
2342 O OE1 . GLU A 316 ? 1.0967 1.3861 1.1057 0.0331  -0.0127 0.0447  292  GLU A OE1 
2343 O OE2 . GLU A 316 ? 1.1773 1.5033 1.2357 0.0453  -0.0048 0.0588  292  GLU A OE2 
2344 N N   . ASP A 317 ? 1.0786 1.3212 1.0024 0.0653  -0.0352 0.0257  293  ASP A N   
2345 C CA  . ASP A 317 ? 1.3874 1.6014 1.2776 0.0628  -0.0418 0.0151  293  ASP A CA  
2346 C C   . ASP A 317 ? 1.6684 1.8908 1.5453 0.0568  -0.0470 0.0128  293  ASP A C   
2347 O O   . ASP A 317 ? 1.9023 2.1388 1.7770 0.0645  -0.0501 0.0145  293  ASP A O   
2348 C CB  . ASP A 317 ? 1.2906 1.4936 1.1711 0.0759  -0.0440 0.0131  293  ASP A CB  
2349 C CG  . ASP A 317 ? 1.3255 1.4959 1.1720 0.0735  -0.0503 0.0018  293  ASP A CG  
2350 O OD1 . ASP A 317 ? 1.2595 1.4064 1.0952 0.0648  -0.0501 -0.0043 293  ASP A OD1 
2351 O OD2 . ASP A 317 ? 1.4267 1.5954 1.2575 0.0803  -0.0555 -0.0011 293  ASP A OD2 
2352 N N   . GLU A 318 ? 1.5501 1.7639 1.4181 0.0432  -0.0483 0.0089  294  GLU A N   
2353 C CA  . GLU A 318 ? 1.4369 1.6576 1.2926 0.0362  -0.0536 0.0066  294  GLU A CA  
2354 C C   . GLU A 318 ? 1.4576 1.6540 1.2940 0.0223  -0.0569 -0.0009 294  GLU A C   
2355 O O   . GLU A 318 ? 1.2656 1.4662 1.1134 0.0129  -0.0530 0.0021  294  GLU A O   
2356 C CB  . GLU A 318 ? 1.1133 1.3691 0.9936 0.0346  -0.0496 0.0162  294  GLU A CB  
2357 N N   . GLY A 319 ? 1.5187 1.6906 1.3266 0.0212  -0.0642 -0.0104 295  GLY A N   
2358 C CA  . GLY A 319 ? 1.4974 1.6462 1.2858 0.0083  -0.0687 -0.0176 295  GLY A CA  
2359 C C   . GLY A 319 ? 1.4996 1.6276 1.2880 0.0035  -0.0652 -0.0198 295  GLY A C   
2360 O O   . GLY A 319 ? 1.6960 1.8262 1.4923 -0.0068 -0.0625 -0.0175 295  GLY A O   
2361 N N   . CYS A 320 ? 1.4010 1.5093 1.1804 0.0113  -0.0653 -0.0242 296  CYS A N   
2362 C CA  . CYS A 320 ? 1.3135 1.4013 1.0923 0.0086  -0.0619 -0.0267 296  CYS A CA  
2363 C C   . CYS A 320 ? 1.2083 1.3139 1.0151 0.0068  -0.0536 -0.0186 296  CYS A C   
2364 O O   . CYS A 320 ? 1.3018 1.3956 1.1100 0.0001  -0.0510 -0.0200 296  CYS A O   
2365 C CB  . CYS A 320 ? 1.1717 1.2339 0.9285 -0.0036 -0.0671 -0.0345 296  CYS A CB  
2366 S SG  . CYS A 320 ? 1.6276 1.6702 1.3516 -0.0050 -0.0781 -0.0443 296  CYS A SG  
2367 N N   . TRP A 321 ? 1.1522 1.2871 0.9817 0.0128  -0.0497 -0.0102 297  TRP A N   
2368 C CA  . TRP A 321 ? 1.3917 1.5462 1.2498 0.0122  -0.0420 -0.0020 297  TRP A CA  
2369 C C   . TRP A 321 ? 1.5571 1.7154 1.4180 -0.0017 -0.0412 -0.0008 297  TRP A C   
2370 O O   . TRP A 321 ? 1.6600 1.8219 1.5366 -0.0048 -0.0357 0.0025  297  TRP A O   
2371 C CB  . TRP A 321 ? 1.5543 1.6967 1.4205 0.0186  -0.0374 -0.0023 297  TRP A CB  
2372 C CG  . TRP A 321 ? 1.5112 1.6442 1.3702 0.0314  -0.0390 -0.0045 297  TRP A CG  
2373 C CD1 . TRP A 321 ? 1.5913 1.7395 1.4535 0.0412  -0.0406 -0.0011 297  TRP A CD1 
2374 C CD2 . TRP A 321 ? 1.4630 1.5694 1.3098 0.0356  -0.0391 -0.0104 297  TRP A CD2 
2375 N NE1 . TRP A 321 ? 1.5983 1.7310 1.4509 0.0515  -0.0418 -0.0042 297  TRP A NE1 
2376 C CE2 . TRP A 321 ? 1.4604 1.5669 1.3034 0.0481  -0.0408 -0.0100 297  TRP A CE2 
2377 C CE3 . TRP A 321 ? 1.3586 1.4418 1.1976 0.0302  -0.0379 -0.0156 297  TRP A CE3 
2378 C CZ2 . TRP A 321 ? 1.3505 1.4342 1.1819 0.0551  -0.0413 -0.0146 297  TRP A CZ2 
2379 C CZ3 . TRP A 321 ? 1.3766 1.4374 1.2044 0.0371  -0.0382 -0.0205 297  TRP A CZ3 
2380 C CH2 . TRP A 321 ? 1.2888 1.3496 1.1127 0.0493  -0.0398 -0.0199 297  TRP A CH2 
2381 N N   . THR A 322 ? 1.6409 1.7986 1.4868 -0.0101 -0.0467 -0.0034 298  THR A N   
2382 C CA  . THR A 322 ? 1.5652 1.7279 1.4134 -0.0235 -0.0464 -0.0015 298  THR A CA  
2383 C C   . THR A 322 ? 1.6530 1.8487 1.5277 -0.0242 -0.0410 0.0084  298  THR A C   
2384 O O   . THR A 322 ? 1.6950 1.8979 1.5800 -0.0329 -0.0377 0.0122  298  THR A O   
2385 C CB  . THR A 322 ? 1.3100 1.4606 1.1336 -0.0322 -0.0547 -0.0073 298  THR A CB  
2386 N N   . ARG A 323 ? 1.8712 2.0880 1.7573 -0.0151 -0.0400 0.0131  299  ARG A N   
2387 C CA  . ARG A 323 ? 1.8309 2.0806 1.7438 -0.0147 -0.0346 0.0230  299  ARG A CA  
2388 C C   . ARG A 323 ? 1.8146 2.0734 1.7528 -0.0072 -0.0273 0.0285  299  ARG A C   
2389 O O   . ARG A 323 ? 1.7058 1.9826 1.6615 0.0033  -0.0245 0.0340  299  ARG A O   
2390 C CB  . ARG A 323 ? 1.4960 1.7655 1.4105 -0.0083 -0.0371 0.0258  299  ARG A CB  
2391 N N   . ASN A 324 ? 1.8195 2.0656 1.7596 -0.0126 -0.0245 0.0270  300  ASN A N   
2392 C CA  . ASN A 324 ? 1.9447 2.1965 1.9076 -0.0064 -0.0180 0.0311  300  ASN A CA  
2393 C C   . ASN A 324 ? 2.0712 2.3510 2.0609 -0.0104 -0.0123 0.0400  300  ASN A C   
2394 O O   . ASN A 324 ? 2.3305 2.6094 2.3301 -0.0149 -0.0085 0.0413  300  ASN A O   
2395 C CB  . ASN A 324 ? 1.8378 2.0621 1.7893 -0.0093 -0.0179 0.0245  300  ASN A CB  
2396 N N   . SER A 325 ? 1.8199 2.1259 1.8217 -0.0083 -0.0118 0.0465  301  SER A N   
2397 C CA  . SER A 325 ? 1.6949 2.0301 1.7249 -0.0103 -0.0060 0.0559  301  SER A CA  
2398 C C   . SER A 325 ? 1.6214 1.9815 1.6725 0.0011  -0.0038 0.0631  301  SER A C   
2399 O O   . SER A 325 ? 1.7832 2.1635 1.8377 0.0006  -0.0048 0.0674  301  SER A O   
2400 C CB  . SER A 325 ? 1.5090 1.8542 1.5335 -0.0230 -0.0071 0.0578  301  SER A CB  
2401 N N   . ASN A 326 ? 1.4676 1.8268 1.5334 0.0116  -0.0011 0.0647  302  ASN A N   
2402 C CA  . ASN A 326 ? 1.6573 2.0424 1.7475 0.0222  0.0014  0.0731  302  ASN A CA  
2403 C C   . ASN A 326 ? 1.7135 2.1108 1.8344 0.0280  0.0072  0.0793  302  ASN A C   
2404 O O   . ASN A 326 ? 1.7809 2.2068 1.9281 0.0288  0.0110  0.0882  302  ASN A O   
2405 C CB  . ASN A 326 ? 1.8954 2.2706 1.9720 0.0327  -0.0029 0.0698  302  ASN A CB  
2406 C CG  . ASN A 326 ? 2.1443 2.5471 2.2445 0.0440  -0.0012 0.0788  302  ASN A CG  
2407 O OD1 . ASN A 326 ? 2.4647 2.8962 2.5870 0.0426  0.0021  0.0871  302  ASN A OD1 
2408 N ND2 . ASN A 326 ? 1.9274 2.3220 2.0232 0.0555  -0.0034 0.0776  302  ASN A ND2 
2409 N N   . MET A 327 ? 1.6427 2.0185 1.7608 0.0320  0.0076  0.0747  303  MET A N   
2410 C CA  . MET A 327 ? 1.4898 1.8743 1.6356 0.0407  0.0118  0.0797  303  MET A CA  
2411 C C   . MET A 327 ? 1.4016 1.7629 1.5423 0.0378  0.0132  0.0735  303  MET A C   
2412 O O   . MET A 327 ? 1.2358 1.5807 1.3568 0.0278  0.0120  0.0674  303  MET A O   
2413 C CB  . MET A 327 ? 1.4417 1.8284 1.5928 0.0544  0.0102  0.0821  303  MET A CB  
2414 C CG  . MET A 327 ? 1.4062 1.8163 1.5936 0.0636  0.0141  0.0917  303  MET A CG  
2415 S SD  . MET A 327 ? 1.5393 1.9485 1.7335 0.0800  0.0121  0.0947  303  MET A SD  
2416 C CE  . MET A 327 ? 1.2007 1.6250 1.4227 0.0815  0.0153  0.1037  303  MET A CE  
2417 N N   . ASN A 328 ? 1.4230 1.7839 1.5826 0.0467  0.0157  0.0755  304  ASN A N   
2418 C CA  . ASN A 328 ? 1.3014 1.6426 1.4599 0.0460  0.0173  0.0701  304  ASN A CA  
2419 C C   . ASN A 328 ? 1.2054 1.5129 1.3316 0.0440  0.0136  0.0597  304  ASN A C   
2420 O O   . ASN A 328 ? 1.1148 1.4044 1.2366 0.0425  0.0147  0.0545  304  ASN A O   
2421 C CB  . ASN A 328 ? 1.2895 1.6358 1.4734 0.0578  0.0196  0.0740  304  ASN A CB  
2422 C CG  . ASN A 328 ? 1.2205 1.6002 1.4375 0.0624  0.0224  0.0850  304  ASN A CG  
2423 O OD1 . ASN A 328 ? 1.3669 1.7662 1.5863 0.0589  0.0222  0.0899  304  ASN A OD1 
2424 N ND2 . ASN A 328 ? 0.9990 1.3856 1.2422 0.0704  0.0247  0.0889  304  ASN A ND2 
2425 N N   . TYR A 329 ? 1.1664 1.4656 1.2705 0.0444  0.0092  0.0567  305  TYR A N   
2426 C CA  . TYR A 329 ? 1.1514 1.4188 1.2257 0.0438  0.0054  0.0471  305  TYR A CA  
2427 C C   . TYR A 329 ? 1.1217 1.3723 1.1771 0.0313  0.0046  0.0406  305  TYR A C   
2428 O O   . TYR A 329 ? 1.0201 1.2438 1.0557 0.0303  0.0027  0.0328  305  TYR A O   
2429 C CB  . TYR A 329 ? 0.9225 1.1873 0.9786 0.0472  0.0006  0.0458  305  TYR A CB  
2430 C CG  . TYR A 329 ? 1.0023 1.2867 1.0778 0.0596  0.0013  0.0533  305  TYR A CG  
2431 C CD1 . TYR A 329 ? 1.1678 1.4535 1.2633 0.0695  0.0040  0.0566  305  TYR A CD1 
2432 C CD2 . TYR A 329 ? 1.0039 1.3068 1.0792 0.0615  -0.0009 0.0576  305  TYR A CD2 
2433 C CE1 . TYR A 329 ? 1.0970 1.4014 1.2114 0.0807  0.0044  0.0644  305  TYR A CE1 
2434 C CE2 . TYR A 329 ? 0.8761 1.1985 0.9701 0.0729  -0.0003 0.0653  305  TYR A CE2 
2435 C CZ  . TYR A 329 ? 1.0645 1.3877 1.1783 0.0824  0.0022  0.0689  305  TYR A CZ  
2436 O OH  . TYR A 329 ? 1.0560 1.3993 1.1892 0.0938  0.0024  0.0772  305  TYR A OH  
2437 N N   . TRP A 330 ? 0.9930 1.2593 1.0545 0.0218  0.0060  0.0440  306  TRP A N   
2438 C CA  . TRP A 330 ? 0.9143 1.1674 0.9613 0.0100  0.0055  0.0393  306  TRP A CA  
2439 C C   . TRP A 330 ? 0.7652 1.0136 0.8252 0.0106  0.0096  0.0385  306  TRP A C   
2440 O O   . TRP A 330 ? 0.6809 0.9104 0.7257 0.0042  0.0088  0.0326  306  TRP A O   
2441 C CB  . TRP A 330 ? 1.1030 1.3757 1.1531 0.0000  0.0057  0.0440  306  TRP A CB  
2442 C CG  . TRP A 330 ? 1.3736 1.6357 1.4092 -0.0128 0.0047  0.0405  306  TRP A CG  
2443 C CD1 . TRP A 330 ? 1.4575 1.6993 1.4646 -0.0206 -0.0005 0.0340  306  TRP A CD1 
2444 C CD2 . TRP A 330 ? 1.6265 1.8988 1.6759 -0.0193 0.0087  0.0438  306  TRP A CD2 
2445 N NE1 . TRP A 330 ? 1.4691 1.7080 1.4719 -0.0315 -0.0001 0.0335  306  TRP A NE1 
2446 C CE2 . TRP A 330 ? 1.6408 1.8984 1.6688 -0.0308 0.0057  0.0395  306  TRP A CE2 
2447 C CE3 . TRP A 330 ? 1.4856 1.7782 1.5635 -0.0162 0.0142  0.0501  306  TRP A CE3 
2448 C CZ2 . TRP A 330 ? 1.6094 1.8726 1.6434 -0.0391 0.0082  0.0416  306  TRP A CZ2 
2449 C CZ3 . TRP A 330 ? 1.4783 1.7758 1.5617 -0.0244 0.0168  0.0516  306  TRP A CZ3 
2450 C CH2 . TRP A 330 ? 1.5537 1.8368 1.6149 -0.0356 0.0139  0.0476  306  TRP A CH2 
2451 N N   . LEU A 331 ? 0.8216 1.0872 0.9101 0.0186  0.0138  0.0444  307  LEU A N   
2452 C CA  . LEU A 331 ? 0.6841 0.9479 0.7872 0.0196  0.0176  0.0438  307  LEU A CA  
2453 C C   . LEU A 331 ? 0.8017 1.0396 0.8948 0.0260  0.0168  0.0368  307  LEU A C   
2454 O O   . LEU A 331 ? 0.9493 1.1747 1.0383 0.0225  0.0181  0.0323  307  LEU A O   
2455 C CB  . LEU A 331 ? 0.7240 1.0148 0.8618 0.0263  0.0217  0.0523  307  LEU A CB  
2456 C CG  . LEU A 331 ? 0.8439 1.1602 0.9957 0.0184  0.0242  0.0590  307  LEU A CG  
2457 C CD1 . LEU A 331 ? 0.7338 1.0788 0.9184 0.0255  0.0273  0.0684  307  LEU A CD1 
2458 C CD2 . LEU A 331 ? 0.8700 1.1822 1.0220 0.0108  0.0264  0.0567  307  LEU A CD2 
2459 N N   . ILE A 332 ? 0.7878 1.0173 0.8757 0.0350  0.0147  0.0356  308  ILE A N   
2460 C CA  . ILE A 332 ? 0.8033 1.0091 0.8833 0.0418  0.0143  0.0296  308  ILE A CA  
2461 C C   . ILE A 332 ? 0.8465 1.0247 0.8962 0.0342  0.0116  0.0206  308  ILE A C   
2462 O O   . ILE A 332 ? 0.7681 0.9257 0.8103 0.0381  0.0118  0.0150  308  ILE A O   
2463 C CB  . ILE A 332 ? 0.9397 1.1431 1.0199 0.0531  0.0124  0.0311  308  ILE A CB  
2464 C CG1 . ILE A 332 ? 0.9334 1.1323 0.9904 0.0502  0.0079  0.0294  308  ILE A CG1 
2465 C CG2 . ILE A 332 ? 1.1862 1.4164 1.2989 0.0617  0.0150  0.0405  308  ILE A CG2 
2466 C CD1 . ILE A 332 ? 0.8200 1.0204 0.8777 0.0614  0.0060  0.0319  308  ILE A CD1 
2467 N N   . ILE A 333 ? 0.8977 1.0751 0.9305 0.0235  0.0091  0.0192  309  ILE A N   
2468 C CA  . ILE A 333 ? 0.9450 1.0984 0.9513 0.0150  0.0064  0.0114  309  ILE A CA  
2469 C C   . ILE A 333 ? 1.0775 1.2366 1.0872 0.0047  0.0083  0.0121  309  ILE A C   
2470 O O   . ILE A 333 ? 0.9907 1.1311 0.9830 -0.0017 0.0069  0.0062  309  ILE A O   
2471 C CB  . ILE A 333 ? 0.8310 0.9744 0.8116 0.0104  0.0008  0.0083  309  ILE A CB  
2472 C CG1 . ILE A 333 ? 0.8377 0.9518 0.7908 0.0045  -0.0025 -0.0005 309  ILE A CG1 
2473 C CG2 . ILE A 333 ? 1.0807 1.2433 1.0634 0.0015  -0.0002 0.0130  309  ILE A CG2 
2474 C CD1 . ILE A 333 ? 0.9776 1.0701 0.9207 0.0134  -0.0032 -0.0059 309  ILE A CD1 
2475 N N   . ARG A 334 ? 0.9851 1.1701 1.0171 0.0029  0.0115  0.0193  310  ARG A N   
2476 C CA  . ARG A 334 ? 0.9700 1.1627 1.0054 -0.0069 0.0132  0.0208  310  ARG A CA  
2477 C C   . ARG A 334 ? 1.0065 1.2083 1.0649 -0.0029 0.0181  0.0227  310  ARG A C   
2478 O O   . ARG A 334 ? 1.1236 1.3251 1.1807 -0.0100 0.0193  0.0218  310  ARG A O   
2479 C CB  . ARG A 334 ? 1.0280 1.2433 1.0690 -0.0139 0.0129  0.0274  310  ARG A CB  
2480 C CG  . ARG A 334 ? 1.0160 1.2225 1.0328 -0.0199 0.0075  0.0250  310  ARG A CG  
2481 C CD  . ARG A 334 ? 1.0586 1.2591 1.0594 -0.0333 0.0052  0.0234  310  ARG A CD  
2482 N NE  . ARG A 334 ? 1.3517 1.5259 1.3335 -0.0361 0.0031  0.0159  310  ARG A NE  
2483 C CZ  . ARG A 334 ? 1.5079 1.6601 1.4641 -0.0387 -0.0022 0.0097  310  ARG A CZ  
2484 N NH1 . ARG A 334 ? 1.2128 1.3658 1.1589 -0.0385 -0.0061 0.0096  310  ARG A NH1 
2485 N NH2 . ARG A 334 ? 1.4187 1.5484 1.3597 -0.0414 -0.0036 0.0034  310  ARG A NH2 
2486 N N   . LEU A 335 ? 0.8988 1.1088 0.9782 0.0083  0.0206  0.0253  311  LEU A N   
2487 C CA  . LEU A 335 ? 0.9229 1.1399 1.0245 0.0133  0.0247  0.0263  311  LEU A CA  
2488 C C   . LEU A 335 ? 0.8037 0.9963 0.8938 0.0158  0.0246  0.0184  311  LEU A C   
2489 O O   . LEU A 335 ? 0.9676 1.1620 1.0656 0.0142  0.0271  0.0172  311  LEU A O   
2490 C CB  . LEU A 335 ? 0.8958 1.1292 1.0243 0.0247  0.0268  0.0319  311  LEU A CB  
2491 C CG  . LEU A 335 ? 0.9428 1.2065 1.0932 0.0228  0.0288  0.0409  311  LEU A CG  
2492 C CD1 . LEU A 335 ? 1.0069 1.2854 1.1826 0.0343  0.0301  0.0465  311  LEU A CD1 
2493 C CD2 . LEU A 335 ? 0.9154 1.1912 1.0784 0.0171  0.0320  0.0427  311  LEU A CD2 
2494 N N   . PRO A 336 ? 0.6065 0.7771 0.6791 0.0200  0.0220  0.0129  312  PRO A N   
2495 C CA  . PRO A 336 ? 0.6631 0.8105 0.7232 0.0209  0.0221  0.0053  312  PRO A CA  
2496 C C   . PRO A 336 ? 0.6490 0.7880 0.6914 0.0092  0.0210  0.0018  312  PRO A C   
2497 O O   . PRO A 336 ? 0.8409 0.9766 0.8873 0.0087  0.0232  -0.0008 312  PRO A O   
2498 C CB  . PRO A 336 ? 0.7210 0.8479 0.7632 0.0262  0.0190  0.0011  312  PRO A CB  
2499 C CG  . PRO A 336 ? 0.5902 0.7332 0.6470 0.0332  0.0189  0.0073  312  PRO A CG  
2500 C CD  . PRO A 336 ? 0.6728 0.8394 0.7388 0.0258  0.0194  0.0136  312  PRO A CD  
2501 N N   . ILE A 337 ? 0.6279 0.7650 0.6523 0.0000  0.0176  0.0022  313  ILE A N   
2502 C CA  . ILE A 337 ? 0.5670 0.6967 0.5753 -0.0114 0.0161  -0.0003 313  ILE A CA  
2503 C C   . ILE A 337 ? 0.5976 0.7473 0.6240 -0.0153 0.0196  0.0044  313  ILE A C   
2504 O O   . ILE A 337 ? 0.6528 0.7964 0.6761 -0.0185 0.0206  0.0015  313  ILE A O   
2505 C CB  . ILE A 337 ? 0.4571 0.5830 0.4449 -0.0204 0.0113  0.0000  313  ILE A CB  
2506 C CG1 . ILE A 337 ? 0.5155 0.6187 0.4828 -0.0167 0.0075  -0.0059 313  ILE A CG1 
2507 C CG2 . ILE A 337 ? 0.4292 0.5514 0.4040 -0.0328 0.0096  -0.0008 313  ILE A CG2 
2508 C CD1 . ILE A 337 ? 0.5941 0.6913 0.5402 -0.0246 0.0021  -0.0067 313  ILE A CD1 
2509 N N   . LEU A 338 ? 0.6665 0.8408 0.7132 -0.0141 0.0217  0.0116  314  LEU A N   
2510 C CA  . LEU A 338 ? 0.5684 0.7625 0.6342 -0.0165 0.0253  0.0161  314  LEU A CA  
2511 C C   . LEU A 338 ? 0.5788 0.7684 0.6564 -0.0091 0.0284  0.0126  314  LEU A C   
2512 O O   . LEU A 338 ? 0.5796 0.7700 0.6568 -0.0135 0.0296  0.0115  314  LEU A O   
2513 C CB  . LEU A 338 ? 0.5783 0.7990 0.6671 -0.0140 0.0276  0.0242  314  LEU A CB  
2514 C CG  . LEU A 338 ? 0.5312 0.7735 0.6382 -0.0180 0.0310  0.0294  314  LEU A CG  
2515 C CD1 . LEU A 338 ? 0.5926 0.8345 0.6824 -0.0313 0.0291  0.0304  314  LEU A CD1 
2516 C CD2 . LEU A 338 ? 0.3451 0.6137 0.4774 -0.0143 0.0336  0.0373  314  LEU A CD2 
2517 N N   . PHE A 339 ? 0.6318 0.8151 0.7182 0.0022  0.0291  0.0105  315  PHE A N   
2518 C CA  . PHE A 339 ? 0.5996 0.7764 0.6960 0.0098  0.0315  0.0063  315  PHE A CA  
2519 C C   . PHE A 339 ? 0.6732 0.8303 0.7487 0.0045  0.0304  -0.0003 315  PHE A C   
2520 O O   . PHE A 339 ? 0.8404 1.0027 0.9222 0.0028  0.0324  -0.0010 315  PHE A O   
2521 C CB  . PHE A 339 ? 0.5465 0.7145 0.6496 0.0218  0.0314  0.0045  315  PHE A CB  
2522 C CG  . PHE A 339 ? 0.5583 0.7188 0.6720 0.0304  0.0335  0.0000  315  PHE A CG  
2523 C CD1 . PHE A 339 ? 0.6315 0.8098 0.7730 0.0364  0.0364  0.0032  315  PHE A CD1 
2524 C CD2 . PHE A 339 ? 0.6753 0.8108 0.7714 0.0326  0.0325  -0.0074 315  PHE A CD2 
2525 C CE1 . PHE A 339 ? 0.5931 0.7645 0.7445 0.0446  0.0379  -0.0013 315  PHE A CE1 
2526 C CE2 . PHE A 339 ? 0.6011 0.7299 0.7069 0.0406  0.0344  -0.0116 315  PHE A CE2 
2527 C CZ  . PHE A 339 ? 0.6150 0.7617 0.7484 0.0467  0.0370  -0.0087 315  PHE A CZ  
2528 N N   . ALA A 340 ? 0.6179 0.7539 0.6683 0.0011  0.0270  -0.0048 316  ALA A N   
2529 C CA  . ALA A 340 ? 0.6576 0.7744 0.6880 -0.0042 0.0257  -0.0109 316  ALA A CA  
2530 C C   . ALA A 340 ? 0.6944 0.8207 0.7210 -0.0151 0.0256  -0.0084 316  ALA A C   
2531 O O   . ALA A 340 ? 0.6082 0.7269 0.6288 -0.0175 0.0261  -0.0119 316  ALA A O   
2532 C CB  . ALA A 340 ? 0.7606 0.8546 0.7648 -0.0069 0.0216  -0.0153 316  ALA A CB  
2533 N N   . CYS A 341 ? 0.5771 0.7206 0.6077 -0.0217 0.0250  -0.0020 317  CYS A N   
2534 C CA  . CYS A 341 ? 0.5431 0.6966 0.5714 -0.0318 0.0250  0.0011  317  CYS A CA  
2535 C C   . CYS A 341 ? 0.6319 0.8046 0.6838 -0.0279 0.0294  0.0041  317  CYS A C   
2536 O O   . CYS A 341 ? 0.5887 0.7622 0.6383 -0.0318 0.0301  0.0032  317  CYS A O   
2537 C CB  . CYS A 341 ? 0.6153 0.7794 0.6379 -0.0411 0.0225  0.0068  317  CYS A CB  
2538 S SG  . CYS A 341 ? 0.7638 0.9036 0.7542 -0.0490 0.0162  0.0023  317  CYS A SG  
2539 N N   . ILE A 342 ? 0.4958 0.6834 0.5707 -0.0195 0.0322  0.0073  318  ILE A N   
2540 C CA  . ILE A 342 ? 0.3558 0.5616 0.4542 -0.0150 0.0360  0.0097  318  ILE A CA  
2541 C C   . ILE A 342 ? 0.3888 0.5827 0.4855 -0.0104 0.0371  0.0033  318  ILE A C   
2542 O O   . ILE A 342 ? 0.4401 0.6404 0.5375 -0.0143 0.0382  0.0036  318  ILE A O   
2543 C CB  . ILE A 342 ? 0.4181 0.6388 0.5418 -0.0055 0.0382  0.0134  318  ILE A CB  
2544 C CG1 . ILE A 342 ? 0.4341 0.6738 0.5635 -0.0114 0.0381  0.0212  318  ILE A CG1 
2545 C CG2 . ILE A 342 ? 0.4174 0.6505 0.5648 0.0021  0.0417  0.0134  318  ILE A CG2 
2546 C CD1 . ILE A 342 ? 0.5206 0.7760 0.6738 -0.0032 0.0398  0.0259  318  ILE A CD1 
2547 N N   . VAL A 343 ? 0.4409 0.6166 0.5334 -0.0024 0.0366  -0.0026 319  VAL A N   
2548 C CA  . VAL A 343 ? 0.6755 0.8388 0.7653 0.0022  0.0376  -0.0092 319  VAL A CA  
2549 C C   . VAL A 343 ? 0.6957 0.8493 0.7638 -0.0078 0.0359  -0.0114 319  VAL A C   
2550 O O   . VAL A 343 ? 0.7460 0.9033 0.8172 -0.0078 0.0374  -0.0130 319  VAL A O   
2551 C CB  . VAL A 343 ? 0.7783 0.9220 0.8644 0.0115  0.0371  -0.0148 319  VAL A CB  
2552 C CG1 . VAL A 343 ? 0.7442 0.8995 0.8550 0.0221  0.0388  -0.0121 319  VAL A CG1 
2553 C CG2 . VAL A 343 ? 0.9019 1.0286 0.9650 0.0067  0.0337  -0.0161 319  VAL A CG2 
2554 N N   . ASN A 344 ? 0.7936 0.9363 0.8404 -0.0165 0.0324  -0.0110 320  ASN A N   
2555 C CA  . ASN A 344 ? 0.8253 0.9581 0.8517 -0.0263 0.0301  -0.0126 320  ASN A CA  
2556 C C   . ASN A 344 ? 0.7773 0.9296 0.8109 -0.0329 0.0312  -0.0074 320  ASN A C   
2557 O O   . ASN A 344 ? 0.8320 0.9804 0.8570 -0.0372 0.0308  -0.0090 320  ASN A O   
2558 C CB  . ASN A 344 ? 0.8995 1.0191 0.9038 -0.0346 0.0256  -0.0125 320  ASN A CB  
2559 C CG  . ASN A 344 ? 1.0304 1.1236 1.0169 -0.0318 0.0235  -0.0198 320  ASN A CG  
2560 O OD1 . ASN A 344 ? 1.0851 1.1683 1.0704 -0.0275 0.0250  -0.0248 320  ASN A OD1 
2561 N ND2 . ASN A 344 ? 0.8847 0.9667 0.8572 -0.0341 0.0201  -0.0205 320  ASN A ND2 
2562 N N   . PHE A 345 ? 0.6264 0.8004 0.6762 -0.0337 0.0328  -0.0007 321  PHE A N   
2563 C CA  . PHE A 345 ? 0.5620 0.7551 0.6194 -0.0392 0.0342  0.0044  321  PHE A CA  
2564 C C   . PHE A 345 ? 0.6480 0.8506 0.7238 -0.0303 0.0379  0.0024  321  PHE A C   
2565 O O   . PHE A 345 ? 0.7300 0.9384 0.8043 -0.0336 0.0385  0.0030  321  PHE A O   
2566 C CB  . PHE A 345 ? 0.4555 0.6686 0.5223 -0.0443 0.0345  0.0125  321  PHE A CB  
2567 C CG  . PHE A 345 ? 0.4299 0.6385 0.4771 -0.0567 0.0305  0.0157  321  PHE A CG  
2568 C CD1 . PHE A 345 ? 0.5565 0.7642 0.5910 -0.0661 0.0286  0.0173  321  PHE A CD1 
2569 C CD2 . PHE A 345 ? 0.4135 0.6187 0.4548 -0.0587 0.0283  0.0171  321  PHE A CD2 
2570 C CE1 . PHE A 345 ? 0.4849 0.6880 0.5019 -0.0776 0.0244  0.0202  321  PHE A CE1 
2571 C CE2 . PHE A 345 ? 0.5529 0.7534 0.5760 -0.0699 0.0241  0.0195  321  PHE A CE2 
2572 C CZ  . PHE A 345 ? 0.5799 0.7789 0.5910 -0.0795 0.0220  0.0210  321  PHE A CZ  
2573 N N   . LEU A 346 ? 0.6148 0.8184 0.7075 -0.0188 0.0401  -0.0001 322  LEU A N   
2574 C CA  . LEU A 346 ? 0.5798 0.7909 0.6896 -0.0098 0.0431  -0.0029 322  LEU A CA  
2575 C C   . LEU A 346 ? 0.5631 0.7580 0.6592 -0.0090 0.0425  -0.0096 322  LEU A C   
2576 O O   . LEU A 346 ? 0.4886 0.6927 0.5886 -0.0093 0.0438  -0.0097 322  LEU A O   
2577 C CB  . LEU A 346 ? 0.6424 0.8550 0.7720 0.0024  0.0447  -0.0046 322  LEU A CB  
2578 C CG  . LEU A 346 ? 0.7908 1.0222 0.9369 0.0021  0.0455  0.0026  322  LEU A CG  
2579 C CD1 . LEU A 346 ? 0.5657 0.7978 0.7310 0.0139  0.0465  0.0016  322  LEU A CD1 
2580 C CD2 . LEU A 346 ? 0.7146 0.9704 0.8751 -0.0012 0.0476  0.0083  322  LEU A CD2 
2581 N N   . ILE A 347 ? 0.6019 0.7735 0.6808 -0.0087 0.0405  -0.0148 323  ILE A N   
2582 C CA  . ILE A 347 ? 0.5514 0.7072 0.6143 -0.0101 0.0397  -0.0205 323  ILE A CA  
2583 C C   . ILE A 347 ? 0.6678 0.8310 0.7199 -0.0214 0.0383  -0.0165 323  ILE A C   
2584 O O   . ILE A 347 ? 0.7312 0.8998 0.7853 -0.0206 0.0395  -0.0177 323  ILE A O   
2585 C CB  . ILE A 347 ? 0.5246 0.6545 0.5682 -0.0105 0.0373  -0.0254 323  ILE A CB  
2586 C CG1 . ILE A 347 ? 0.7083 0.8315 0.7630 0.0010  0.0385  -0.0286 323  ILE A CG1 
2587 C CG2 . ILE A 347 ? 0.6027 0.7167 0.6301 -0.0125 0.0365  -0.0309 323  ILE A CG2 
2588 C CD1 . ILE A 347 ? 0.8306 0.9599 0.9046 0.0123  0.0416  -0.0321 323  ILE A CD1 
2589 N N   . PHE A 348 ? 0.6842 0.8496 0.7260 -0.0318 0.0357  -0.0111 324  PHE A N   
2590 C CA  . PHE A 348 ? 0.8149 0.9883 0.8471 -0.0432 0.0339  -0.0060 324  PHE A CA  
2591 C C   . PHE A 348 ? 0.7774 0.9726 0.8255 -0.0412 0.0368  -0.0028 324  PHE A C   
2592 O O   . PHE A 348 ? 0.7708 0.9680 0.8122 -0.0451 0.0362  -0.0024 324  PHE A O   
2593 C CB  . PHE A 348 ? 0.7686 0.9474 0.7950 -0.0526 0.0313  0.0004  324  PHE A CB  
2594 C CG  . PHE A 348 ? 0.7597 0.9485 0.7780 -0.0646 0.0292  0.0068  324  PHE A CG  
2595 C CD1 . PHE A 348 ? 0.6658 0.8790 0.6988 -0.0664 0.0315  0.0135  324  PHE A CD1 
2596 C CD2 . PHE A 348 ? 0.9047 1.0787 0.9009 -0.0743 0.0248  0.0064  324  PHE A CD2 
2597 C CE1 . PHE A 348 ? 0.9601 1.1827 0.9855 -0.0774 0.0295  0.0201  324  PHE A CE1 
2598 C CE2 . PHE A 348 ? 0.9741 1.1574 0.9635 -0.0854 0.0224  0.0129  324  PHE A CE2 
2599 C CZ  . PHE A 348 ? 1.0227 1.2303 1.0264 -0.0870 0.0248  0.0199  324  PHE A CZ  
2600 N N   . VAL A 349 ? 0.7122 0.9245 0.7820 -0.0345 0.0398  -0.0004 325  VAL A N   
2601 C CA  . VAL A 349 ? 0.6415 0.8754 0.7271 -0.0321 0.0424  0.0027  325  VAL A CA  
2602 C C   . VAL A 349 ? 0.6359 0.8652 0.7260 -0.0228 0.0441  -0.0042 325  VAL A C   
2603 O O   . VAL A 349 ? 0.8006 1.0367 0.8879 -0.0248 0.0443  -0.0036 325  VAL A O   
2604 C CB  . VAL A 349 ? 0.7215 0.9749 0.8297 -0.0276 0.0450  0.0072  325  VAL A CB  
2605 C CG1 . VAL A 349 ? 0.7315 1.0059 0.8573 -0.0230 0.0478  0.0090  325  VAL A CG1 
2606 C CG2 . VAL A 349 ? 0.5463 0.8072 0.6495 -0.0380 0.0434  0.0148  325  VAL A CG2 
2607 N N   . ARG A 350 ? 0.6703 0.8875 0.7665 -0.0125 0.0451  -0.0108 326  ARG A N   
2608 C CA  . ARG A 350 ? 0.7383 0.9520 0.8411 -0.0025 0.0469  -0.0176 326  ARG A CA  
2609 C C   . ARG A 350 ? 0.6878 0.8897 0.7714 -0.0073 0.0455  -0.0207 326  ARG A C   
2610 O O   . ARG A 350 ? 0.5376 0.7491 0.6250 -0.0051 0.0466  -0.0216 326  ARG A O   
2611 C CB  . ARG A 350 ? 0.8136 1.0135 0.9238 0.0082  0.0476  -0.0237 326  ARG A CB  
2612 C CG  . ARG A 350 ? 0.9004 1.0965 1.0200 0.0200  0.0494  -0.0312 326  ARG A CG  
2613 C CD  . ARG A 350 ? 1.1116 1.3294 1.2478 0.0243  0.0513  -0.0301 326  ARG A CD  
2614 N NE  . ARG A 350 ? 1.4672 1.7063 1.6220 0.0245  0.0523  -0.0238 326  ARG A NE  
2615 C CZ  . ARG A 350 ? 1.6676 1.9276 1.8376 0.0276  0.0538  -0.0218 326  ARG A CZ  
2616 N NH1 . ARG A 350 ? 1.8220 2.0844 1.9902 0.0310  0.0544  -0.0258 326  ARG A NH1 
2617 N NH2 . ARG A 350 ? 1.4183 1.6973 1.6051 0.0275  0.0548  -0.0159 326  ARG A NH2 
2618 N N   . VAL A 351 ? 0.6819 0.8641 0.7448 -0.0142 0.0428  -0.0219 327  VAL A N   
2619 C CA  . VAL A 351 ? 0.6737 0.8441 0.7179 -0.0199 0.0410  -0.0242 327  VAL A CA  
2620 C C   . VAL A 351 ? 0.6508 0.8393 0.6947 -0.0269 0.0406  -0.0182 327  VAL A C   
2621 O O   . VAL A 351 ? 0.7521 0.9423 0.7937 -0.0252 0.0412  -0.0205 327  VAL A O   
2622 C CB  . VAL A 351 ? 0.6538 0.8037 0.6765 -0.0284 0.0374  -0.0244 327  VAL A CB  
2623 C CG1 . VAL A 351 ? 0.5665 0.7088 0.5709 -0.0372 0.0348  -0.0242 327  VAL A CG1 
2624 C CG2 . VAL A 351 ? 0.7015 0.8310 0.7217 -0.0205 0.0378  -0.0315 327  VAL A CG2 
2625 N N   . ILE A 352 ? 0.5773 0.7809 0.6243 -0.0343 0.0398  -0.0103 328  ILE A N   
2626 C CA  . ILE A 352 ? 0.5907 0.8116 0.6365 -0.0415 0.0392  -0.0037 328  ILE A CA  
2627 C C   . ILE A 352 ? 0.6169 0.8543 0.6789 -0.0322 0.0425  -0.0053 328  ILE A C   
2628 O O   . ILE A 352 ? 0.5523 0.7929 0.6091 -0.0331 0.0422  -0.0057 328  ILE A O   
2629 C CB  . ILE A 352 ? 0.5324 0.7674 0.5807 -0.0502 0.0382  0.0052  328  ILE A CB  
2630 C CG1 . ILE A 352 ? 0.6537 0.8718 0.6835 -0.0599 0.0343  0.0064  328  ILE A CG1 
2631 C CG2 . ILE A 352 ? 0.5359 0.7902 0.5846 -0.0567 0.0379  0.0125  328  ILE A CG2 
2632 C CD1 . ILE A 352 ? 0.5956 0.8258 0.6249 -0.0696 0.0327  0.0150  328  ILE A CD1 
2633 N N   . CYS A 353 ? 0.5547 0.8016 0.6367 -0.0223 0.0454  -0.0071 329  CYS A N   
2634 C CA  . CYS A 353 ? 0.5805 0.8427 0.6790 -0.0124 0.0481  -0.0095 329  CYS A CA  
2635 C C   . CYS A 353 ? 0.7272 0.9776 0.8190 -0.0066 0.0483  -0.0172 329  CYS A C   
2636 O O   . CYS A 353 ? 0.8563 1.1192 0.9522 -0.0034 0.0493  -0.0175 329  CYS A O   
2637 C CB  . CYS A 353 ? 0.7418 1.0106 0.8622 -0.0017 0.0505  -0.0119 329  CYS A CB  
2638 S SG  . CYS A 353 ? 1.0687 1.3579 1.2027 -0.0064 0.0512  -0.0027 329  CYS A SG  
2639 N N   . ILE A 354 ? 0.6366 0.8633 0.7176 -0.0053 0.0474  -0.0231 330  ILE A N   
2640 C CA  . ILE A 354 ? 0.5399 0.7543 0.6145 0.0003  0.0478  -0.0306 330  ILE A CA  
2641 C C   . ILE A 354 ? 0.5508 0.7649 0.6085 -0.0092 0.0458  -0.0275 330  ILE A C   
2642 O O   . ILE A 354 ? 0.4857 0.7079 0.5453 -0.0054 0.0468  -0.0293 330  ILE A O   
2643 C CB  . ILE A 354 ? 0.5805 0.7697 0.6482 0.0041  0.0475  -0.0373 330  ILE A CB  
2644 C CG1 . ILE A 354 ? 0.5840 0.7756 0.6702 0.0137  0.0492  -0.0393 330  ILE A CG1 
2645 C CG2 . ILE A 354 ? 0.5630 0.7395 0.6241 0.0098  0.0483  -0.0450 330  ILE A CG2 
2646 C CD1 . ILE A 354 ? 0.5918 0.8010 0.6996 0.0247  0.0517  -0.0415 330  ILE A CD1 
2647 N N   . VAL A 355 ? 0.4737 0.6801 0.5156 -0.0215 0.0428  -0.0224 331  VAL A N   
2648 C CA  . VAL A 355 ? 0.5121 0.7146 0.5373 -0.0306 0.0402  -0.0199 331  VAL A CA  
2649 C C   . VAL A 355 ? 0.6363 0.8634 0.6680 -0.0325 0.0406  -0.0137 331  VAL A C   
2650 O O   . VAL A 355 ? 0.6341 0.8646 0.6631 -0.0305 0.0409  -0.0153 331  VAL A O   
2651 C CB  . VAL A 355 ? 0.5714 0.7609 0.5795 -0.0434 0.0362  -0.0156 331  VAL A CB  
2652 C CG1 . VAL A 355 ? 0.6663 0.8560 0.6597 -0.0539 0.0329  -0.0110 331  VAL A CG1 
2653 C CG2 . VAL A 355 ? 0.5658 0.7294 0.5646 -0.0409 0.0355  -0.0226 331  VAL A CG2 
2654 N N   . VAL A 356 ? 0.7246 0.9703 0.7660 -0.0353 0.0410  -0.0067 332  VAL A N   
2655 C CA  . VAL A 356 ? 0.7550 1.0253 0.8031 -0.0366 0.0415  -0.0003 332  VAL A CA  
2656 C C   . VAL A 356 ? 0.6809 0.9622 0.7432 -0.0234 0.0447  -0.0059 332  VAL A C   
2657 O O   . VAL A 356 ? 0.7415 1.0393 0.8056 -0.0231 0.0449  -0.0028 332  VAL A O   
2658 C CB  . VAL A 356 ? 0.8341 1.1219 0.8910 -0.0414 0.0417  0.0079  332  VAL A CB  
2659 C CG1 . VAL A 356 ? 0.6863 0.9623 0.7297 -0.0535 0.0384  0.0125  332  VAL A CG1 
2660 C CG2 . VAL A 356 ? 0.8099 1.1047 0.8867 -0.0305 0.0451  0.0043  332  VAL A CG2 
2661 N N   . SER A 357 ? 0.7305 1.0038 0.8034 -0.0121 0.0470  -0.0141 333  SER A N   
2662 C CA  . SER A 357 ? 0.7582 1.0387 0.8427 0.0006  0.0495  -0.0207 333  SER A CA  
2663 C C   . SER A 357 ? 0.7527 1.0225 0.8239 0.0003  0.0487  -0.0247 333  SER A C   
2664 O O   . SER A 357 ? 0.6822 0.9667 0.7543 0.0017  0.0489  -0.0231 333  SER A O   
2665 C CB  . SER A 357 ? 0.6523 0.9248 0.7508 0.0124  0.0516  -0.0284 333  SER A CB  
2666 O OG  . SER A 357 ? 0.8738 1.1617 0.9888 0.0146  0.0526  -0.0246 333  SER A OG  
2667 N N   . LYS A 358 ? 0.7677 1.0125 0.8257 -0.0023 0.0476  -0.0293 334  LYS A N   
2668 C CA  . LYS A 358 ? 0.9159 1.1491 0.9627 -0.0012 0.0474  -0.0342 334  LYS A CA  
2669 C C   . LYS A 358 ? 0.8084 1.0497 0.8430 -0.0118 0.0449  -0.0270 334  LYS A C   
2670 O O   . LYS A 358 ? 0.9469 1.1898 0.9778 -0.0094 0.0452  -0.0293 334  LYS A O   
2671 C CB  . LYS A 358 ? 1.0963 1.3008 1.1314 -0.0022 0.0467  -0.0401 334  LYS A CB  
2672 C CG  . LYS A 358 ? 1.1020 1.2984 1.1498 0.0100  0.0492  -0.0478 334  LYS A CG  
2673 C CD  . LYS A 358 ? 1.1640 1.3327 1.1999 0.0092  0.0485  -0.0529 334  LYS A CD  
2674 C CE  . LYS A 358 ? 1.4562 1.6103 1.4787 0.0091  0.0484  -0.0580 334  LYS A CE  
2675 N NZ  . LYS A 358 ? 1.6147 1.7734 1.6481 0.0218  0.0514  -0.0652 334  LYS A NZ  
2676 N N   . LEU A 359 ? 0.7893 1.0365 0.8183 -0.0234 0.0423  -0.0179 335  LEU A N   
2677 C CA  . LEU A 359 ? 0.8022 1.0596 0.8216 -0.0334 0.0395  -0.0098 335  LEU A CA  
2678 C C   . LEU A 359 ? 0.7563 1.0419 0.7880 -0.0282 0.0411  -0.0060 335  LEU A C   
2679 O O   . LEU A 359 ? 0.8220 1.1157 0.8490 -0.0298 0.0402  -0.0035 335  LEU A O   
2680 C CB  . LEU A 359 ? 0.7731 1.0287 0.7835 -0.0470 0.0360  -0.0012 335  LEU A CB  
2681 C CG  . LEU A 359 ? 0.7163 0.9448 0.7103 -0.0546 0.0330  -0.0036 335  LEU A CG  
2682 C CD1 . LEU A 359 ? 0.7491 0.9777 0.7373 -0.0661 0.0298  0.0040  335  LEU A CD1 
2683 C CD2 . LEU A 359 ? 0.7812 0.9995 0.7610 -0.0597 0.0305  -0.0042 335  LEU A CD2 
2684 N N   . LYS A 360 ? 0.6690 0.9703 0.7167 -0.0220 0.0434  -0.0051 336  LYS A N   
2685 C CA  . LYS A 360 ? 0.7520 1.0809 0.8113 -0.0170 0.0448  -0.0013 336  LYS A CA  
2686 C C   . LYS A 360 ? 0.8508 1.1833 0.9165 -0.0043 0.0471  -0.0094 336  LYS A C   
2687 O O   . LYS A 360 ? 1.0649 1.4150 1.1316 -0.0028 0.0469  -0.0062 336  LYS A O   
2688 C CB  . LYS A 360 ? 0.7366 1.0813 0.8119 -0.0132 0.0466  0.0014  336  LYS A CB  
2689 C CG  . LYS A 360 ? 0.7297 1.1032 0.8163 -0.0080 0.0479  0.0055  336  LYS A CG  
2690 C CD  . LYS A 360 ? 0.8218 1.2134 0.9195 -0.0099 0.0486  0.0125  336  LYS A CD  
2691 C CE  . LYS A 360 ? 0.7485 1.1682 0.8517 -0.0086 0.0488  0.0193  336  LYS A CE  
2692 N NZ  . LYS A 360 ? 0.8304 1.2697 0.9473 -0.0077 0.0503  0.0248  336  LYS A NZ  
2693 N N   . ALA A 361 ? 0.8145 1.1018 0.9056 0.0647  0.0511  -0.1008 337  ALA A N   
2694 C CA  . ALA A 361 ? 0.7008 0.9875 0.7831 0.0714  0.0496  -0.1025 337  ALA A CA  
2695 C C   . ALA A 361 ? 0.7785 1.0485 0.8370 0.0646  0.0535  -0.0934 337  ALA A C   
2696 O O   . ALA A 361 ? 0.8081 1.0728 0.8570 0.0700  0.0515  -0.0934 337  ALA A O   
2697 C CB  . ALA A 361 ? 0.6095 0.8857 0.7013 0.0845  0.0403  -0.1046 337  ALA A CB  
2698 N N   . ASN A 362 ? 0.8234 1.0846 0.8724 0.0531  0.0585  -0.0858 338  ASN A N   
2699 C CA  . ASN A 362 ? 0.8978 1.1414 0.9240 0.0456  0.0616  -0.0765 338  ASN A CA  
2700 C C   . ASN A 362 ? 0.9217 1.1416 0.9408 0.0534  0.0547  -0.0723 338  ASN A C   
2701 O O   . ASN A 362 ? 0.9132 1.1222 0.9143 0.0517  0.0552  -0.0680 338  ASN A O   
2702 C CB  . ASN A 362 ? 1.1334 1.3910 1.1461 0.0396  0.0686  -0.0782 338  ASN A CB  
2703 C CG  . ASN A 362 ? 1.4914 1.7572 1.4986 0.0255  0.0772  -0.0751 338  ASN A CG  
2704 O OD1 . ASN A 362 ? 1.6365 1.8890 1.6411 0.0186  0.0778  -0.0680 338  ASN A OD1 
2705 N ND2 . ASN A 362 ? 1.8025 2.0904 1.8079 0.0210  0.0841  -0.0806 338  ASN A ND2 
2706 N N   . LEU A 363 ? 1.0042 1.2160 1.0375 0.0619  0.0479  -0.0738 339  LEU A N   
2707 C CA  . LEU A 363 ? 0.9124 1.0996 0.9409 0.0678  0.0417  -0.0689 339  LEU A CA  
2708 C C   . LEU A 363 ? 0.9587 1.1248 0.9782 0.0594  0.0428  -0.0595 339  LEU A C   
2709 O O   . LEU A 363 ? 1.0241 1.1683 1.0359 0.0619  0.0386  -0.0545 339  LEU A O   
2710 C CB  . LEU A 363 ? 0.7286 0.9155 0.7761 0.0798  0.0345  -0.0744 339  LEU A CB  
2711 C CG  . LEU A 363 ? 0.7243 0.9309 0.7828 0.0896  0.0319  -0.0842 339  LEU A CG  
2712 C CD1 . LEU A 363 ? 0.7357 0.9395 0.8126 0.1005  0.0243  -0.0885 339  LEU A CD1 
2713 C CD2 . LEU A 363 ? 0.7958 0.9997 0.8403 0.0932  0.0312  -0.0843 339  LEU A CD2 
2714 N N   . MET A 364 ? 0.8561 1.0284 0.8771 0.0496  0.0479  -0.0573 340  MET A N   
2715 C CA  . MET A 364 ? 0.9448 1.0987 0.9594 0.0417  0.0487  -0.0489 340  MET A CA  
2716 C C   . MET A 364 ? 0.7962 0.9596 0.8036 0.0287  0.0563  -0.0459 340  MET A C   
2717 O O   . MET A 364 ? 0.7667 0.9522 0.7831 0.0266  0.0602  -0.0515 340  MET A O   
2718 C CB  . MET A 364 ? 0.9324 1.0801 0.9632 0.0459  0.0446  -0.0499 340  MET A CB  
2719 C CG  . MET A 364 ? 1.0530 1.1816 1.0784 0.0385  0.0452  -0.0419 340  MET A CG  
2720 S SD  . MET A 364 ? 1.0642 1.1890 1.1079 0.0417  0.0418  -0.0437 340  MET A SD  
2721 C CE  . MET A 364 ? 1.0617 1.1778 1.1144 0.0562  0.0342  -0.0480 340  MET A CE  
2722 N N   . CYS A 365 ? 0.7358 0.8826 0.7274 0.0200  0.0582  -0.0372 341  CYS A N   
2723 C CA  . CYS A 365 ? 0.8898 1.0417 0.8747 0.0070  0.0648  -0.0329 341  CYS A CA  
2724 C C   . CYS A 365 ? 0.9211 1.0597 0.9111 0.0029  0.0635  -0.0280 341  CYS A C   
2725 O O   . CYS A 365 ? 1.1542 1.2751 1.1474 0.0085  0.0580  -0.0259 341  CYS A O   
2726 C CB  . CYS A 365 ? 0.8156 0.9585 0.7776 -0.0011 0.0680  -0.0263 341  CYS A CB  
2727 S SG  . CYS A 365 ? 1.3808 1.5443 1.3340 -0.0017 0.0731  -0.0316 341  CYS A SG  
2728 N N   . LYS A 366 ? 0.8160 0.9633 0.8068 -0.0071 0.0689  -0.0262 342  LYS A N   
2729 C CA  . LYS A 366 ? 0.8455 0.9809 0.8404 -0.0117 0.0680  -0.0215 342  LYS A CA  
2730 C C   . LYS A 366 ? 0.7952 0.9057 0.7743 -0.0170 0.0664  -0.0120 342  LYS A C   
2731 O O   . LYS A 366 ? 0.7263 0.8254 0.7070 -0.0215 0.0657  -0.0075 342  LYS A O   
2732 C CB  . LYS A 366 ? 0.7638 0.9155 0.7640 -0.0210 0.0739  -0.0224 342  LYS A CB  
2733 C CG  . LYS A 366 ? 0.7889 0.9630 0.8083 -0.0158 0.0740  -0.0320 342  LYS A CG  
2734 C CD  . LYS A 366 ? 0.6474 0.8319 0.6742 -0.0243 0.0780  -0.0322 342  LYS A CD  
2735 C CE  . LYS A 366 ? 0.7114 0.9153 0.7583 -0.0184 0.0765  -0.0419 342  LYS A CE  
2736 N NZ  . LYS A 366 ? 0.8723 1.0817 0.9286 -0.0249 0.0781  -0.0422 342  LYS A NZ  
2737 N N   . THR A 367 ? 0.8608 0.9622 0.8246 -0.0165 0.0655  -0.0091 343  THR A N   
2738 C CA  . THR A 367 ? 0.8901 0.9671 0.8386 -0.0209 0.0629  -0.0007 343  THR A CA  
2739 C C   . THR A 367 ? 0.8927 0.9506 0.8436 -0.0110 0.0554  -0.0007 343  THR A C   
2740 O O   . THR A 367 ? 0.8658 0.9021 0.8064 -0.0136 0.0522  0.0055  343  THR A O   
2741 C CB  . THR A 367 ? 0.9238 1.0003 0.8521 -0.0278 0.0660  0.0031  343  THR A CB  
2742 O OG1 . THR A 367 ? 1.1385 1.1919 1.0517 -0.0344 0.0638  0.0120  343  THR A OG1 
2743 C CG2 . THR A 367 ? 0.7127 0.7908 0.6369 -0.0187 0.0632  -0.0012 343  THR A CG2 
2744 N N   . ASP A 368 ? 0.7581 0.8233 0.7225 0.0003  0.0523  -0.0079 344  ASP A N   
2745 C CA  . ASP A 368 ? 0.7201 0.7689 0.6886 0.0103  0.0455  -0.0089 344  ASP A CA  
2746 C C   . ASP A 368 ? 0.8260 0.8639 0.8061 0.0117  0.0430  -0.0080 344  ASP A C   
2747 O O   . ASP A 368 ? 1.0043 1.0507 0.9926 0.0074  0.0460  -0.0085 344  ASP A O   
2748 C CB  . ASP A 368 ? 0.8543 0.9160 0.8328 0.0217  0.0432  -0.0169 344  ASP A CB  
2749 C CG  . ASP A 368 ? 0.9709 1.0409 0.9371 0.0217  0.0448  -0.0182 344  ASP A CG  
2750 O OD1 . ASP A 368 ? 0.9887 1.0462 0.9369 0.0157  0.0451  -0.0122 344  ASP A OD1 
2751 O OD2 . ASP A 368 ? 0.8919 0.9804 0.8661 0.0277  0.0455  -0.0252 344  ASP A OD2 
2752 N N   . ILE A 369 ? 0.9141 0.9327 0.8949 0.0179  0.0375  -0.0070 345  ILE A N   
2753 C CA  . ILE A 369 ? 0.9504 0.9565 0.9409 0.0191  0.0353  -0.0061 345  ILE A CA  
2754 C C   . ILE A 369 ? 0.9777 0.9968 0.9861 0.0255  0.0351  -0.0126 345  ILE A C   
2755 O O   . ILE A 369 ? 0.8355 0.8527 0.8513 0.0228  0.0360  -0.0120 345  ILE A O   
2756 C CB  . ILE A 369 ? 0.8742 0.8575 0.8624 0.0246  0.0295  -0.0045 345  ILE A CB  
2757 C CG1 . ILE A 369 ? 0.9056 0.8901 0.8918 0.0335  0.0259  -0.0083 345  ILE A CG1 
2758 C CG2 . ILE A 369 ? 0.8766 0.8416 0.8511 0.0161  0.0291  0.0031  345  ILE A CG2 
2759 C CD1 . ILE A 369 ? 0.9551 0.9240 0.9494 0.0431  0.0200  -0.0107 345  ILE A CD1 
2760 N N   . ALA A 370 ? 0.9916 1.0226 1.0071 0.0343  0.0334  -0.0189 346  ALA A N   
2761 C CA  . ALA A 370 ? 0.8121 0.8541 0.8447 0.0406  0.0323  -0.0251 346  ALA A CA  
2762 C C   . ALA A 370 ? 0.7969 0.8539 0.8342 0.0336  0.0366  -0.0258 346  ALA A C   
2763 O O   . ALA A 370 ? 0.8598 0.9155 0.9073 0.0340  0.0359  -0.0270 346  ALA A O   
2764 C CB  . ALA A 370 ? 0.7381 0.7932 0.7772 0.0505  0.0298  -0.0320 346  ALA A CB  
2765 N N   . PHE A 371 ? 0.8384 0.9079 0.8675 0.0264  0.0412  -0.0245 347  PHE A N   
2766 C CA  . PHE A 371 ? 0.8296 0.9144 0.8639 0.0196  0.0454  -0.0256 347  PHE A CA  
2767 C C   . PHE A 371 ? 0.8590 0.9309 0.8898 0.0110  0.0469  -0.0193 347  PHE A C   
2768 O O   . PHE A 371 ? 0.8541 0.9307 0.8945 0.0093  0.0473  -0.0209 347  PHE A O   
2769 C CB  . PHE A 371 ? 0.7392 0.8417 0.7661 0.0139  0.0505  -0.0264 347  PHE A CB  
2770 C CG  . PHE A 371 ? 0.6915 0.8095 0.7241 0.0063  0.0550  -0.0277 347  PHE A CG  
2771 C CD1 . PHE A 371 ? 0.5850 0.7212 0.6333 0.0107  0.0544  -0.0354 347  PHE A CD1 
2772 C CD2 . PHE A 371 ? 0.6728 0.7865 0.6957 -0.0051 0.0592  -0.0213 347  PHE A CD2 
2773 C CE1 . PHE A 371 ? 0.6763 0.8264 0.7309 0.0040  0.0579  -0.0371 347  PHE A CE1 
2774 C CE2 . PHE A 371 ? 0.7994 0.9273 0.8286 -0.0119 0.0632  -0.0227 347  PHE A CE2 
2775 C CZ  . PHE A 371 ? 0.6974 0.8433 0.7426 -0.0073 0.0625  -0.0308 347  PHE A CZ  
2776 N N   . ARG A 372 ? 0.8281 0.8834 0.8450 0.0055  0.0473  -0.0122 348  ARG A N   
2777 C CA  . ARG A 372 ? 0.8248 0.8678 0.8384 -0.0026 0.0484  -0.0063 348  ARG A CA  
2778 C C   . ARG A 372 ? 0.8199 0.8500 0.8434 0.0024  0.0447  -0.0073 348  ARG A C   
2779 O O   . ARG A 372 ? 0.7608 0.7895 0.7892 -0.0018 0.0457  -0.0063 348  ARG A O   
2780 C CB  . ARG A 372 ? 0.9298 0.9568 0.9266 -0.0089 0.0486  0.0011  348  ARG A CB  
2781 C CG  . ARG A 372 ? 1.0213 1.0594 1.0059 -0.0167 0.0532  0.0034  348  ARG A CG  
2782 C CD  . ARG A 372 ? 0.8873 0.9077 0.8541 -0.0222 0.0521  0.0107  348  ARG A CD  
2783 N NE  . ARG A 372 ? 0.9677 0.9759 0.9306 -0.0139 0.0471  0.0098  348  ARG A NE  
2784 C CZ  . ARG A 372 ? 1.1204 1.1140 1.0678 -0.0165 0.0450  0.0147  348  ARG A CZ  
2785 N NH1 . ARG A 372 ? 1.4267 1.4162 1.3604 -0.0275 0.0476  0.0212  348  ARG A NH1 
2786 N NH2 . ARG A 372 ? 1.0601 1.0428 1.0058 -0.0082 0.0399  0.0131  348  ARG A NH2 
2787 N N   . LEU A 373 ? 0.8489 0.8697 0.8756 0.0114  0.0406  -0.0097 349  LEU A N   
2788 C CA  . LEU A 373 ? 0.7322 0.7413 0.7685 0.0166  0.0374  -0.0112 349  LEU A CA  
2789 C C   . LEU A 373 ? 0.7374 0.7603 0.7875 0.0197  0.0373  -0.0168 349  LEU A C   
2790 O O   . LEU A 373 ? 0.7651 0.7809 0.8207 0.0185  0.0368  -0.0164 349  LEU A O   
2791 C CB  . LEU A 373 ? 0.7032 0.7016 0.7409 0.0258  0.0331  -0.0132 349  LEU A CB  
2792 C CG  . LEU A 373 ? 0.6090 0.5924 0.6552 0.0307  0.0302  -0.0144 349  LEU A CG  
2793 C CD1 . LEU A 373 ? 0.5842 0.5506 0.6242 0.0232  0.0312  -0.0085 349  LEU A CD1 
2794 C CD2 . LEU A 373 ? 0.5186 0.4934 0.5672 0.0400  0.0260  -0.0170 349  LEU A CD2 
2795 N N   . ALA A 374 ? 0.6558 0.6980 0.7115 0.0238  0.0375  -0.0223 350  ALA A N   
2796 C CA  . ALA A 374 ? 0.6504 0.7065 0.7188 0.0258  0.0370  -0.0277 350  ALA A CA  
2797 C C   . ALA A 374 ? 0.6776 0.7389 0.7449 0.0162  0.0405  -0.0252 350  ALA A C   
2798 O O   . ALA A 374 ? 0.5851 0.6468 0.6607 0.0159  0.0393  -0.0271 350  ALA A O   
2799 C CB  . ALA A 374 ? 0.4657 0.5423 0.5404 0.0318  0.0364  -0.0344 350  ALA A CB  
2800 N N   . LYS A 375 ? 0.6294 0.6930 0.6859 0.0080  0.0445  -0.0207 351  LYS A N   
2801 C CA  . LYS A 375 ? 0.6188 0.6874 0.6739 -0.0017 0.0480  -0.0181 351  LYS A CA  
2802 C C   . LYS A 375 ? 0.6070 0.6576 0.6613 -0.0052 0.0469  -0.0137 351  LYS A C   
2803 O O   . LYS A 375 ? 0.7025 0.7568 0.7606 -0.0104 0.0481  -0.0135 351  LYS A O   
2804 C CB  . LYS A 375 ? 0.6154 0.6878 0.6577 -0.0098 0.0525  -0.0136 351  LYS A CB  
2805 C CG  . LYS A 375 ? 0.6722 0.7528 0.7132 -0.0201 0.0567  -0.0112 351  LYS A CG  
2806 C CD  . LYS A 375 ? 0.7571 0.8527 0.7906 -0.0258 0.0616  -0.0109 351  LYS A CD  
2807 C CE  . LYS A 375 ? 0.8292 0.9114 0.8460 -0.0288 0.0622  -0.0045 351  LYS A CE  
2808 N NZ  . LYS A 375 ? 0.7561 0.8210 0.7636 -0.0372 0.0627  0.0036  351  LYS A NZ  
2809 N N   . SER A 376 ? 0.6330 0.6642 0.6829 -0.0025 0.0446  -0.0105 352  SER A N   
2810 C CA  . SER A 376 ? 0.7381 0.7522 0.7879 -0.0052 0.0436  -0.0072 352  SER A CA  
2811 C C   . SER A 376 ? 0.7755 0.7864 0.8366 0.0020  0.0404  -0.0119 352  SER A C   
2812 O O   . SER A 376 ? 1.0732 1.0805 1.1381 -0.0008 0.0401  -0.0118 352  SER A O   
2813 C CB  . SER A 376 ? 0.6447 0.6388 0.6844 -0.0067 0.0429  -0.0016 352  SER A CB  
2814 O OG  . SER A 376 ? 0.6704 0.6649 0.6985 -0.0148 0.0456  0.0037  352  SER A OG  
2815 N N   . THR A 377 ? 0.6244 0.6362 0.6906 0.0111  0.0376  -0.0161 353  THR A N   
2816 C CA  . THR A 377 ? 0.7052 0.7117 0.7811 0.0177  0.0344  -0.0201 353  THR A CA  
2817 C C   . THR A 377 ? 0.6472 0.6688 0.7330 0.0186  0.0333  -0.0251 353  THR A C   
2818 O O   . THR A 377 ? 0.5693 0.5841 0.6600 0.0192  0.0315  -0.0263 353  THR A O   
2819 C CB  . THR A 377 ? 0.6516 0.6556 0.7309 0.0272  0.0315  -0.0233 353  THR A CB  
2820 O OG1 . THR A 377 ? 0.5763 0.5646 0.6471 0.0263  0.0318  -0.0189 353  THR A OG1 
2821 C CG2 . THR A 377 ? 0.5004 0.4987 0.5896 0.0337  0.0283  -0.0273 353  THR A CG2 
2822 N N   . LEU A 378 ? 0.5691 0.6107 0.6577 0.0189  0.0342  -0.0285 354  LEU A N   
2823 C CA  . LEU A 378 ? 0.6308 0.6878 0.7293 0.0193  0.0329  -0.0338 354  LEU A CA  
2824 C C   . LEU A 378 ? 0.6472 0.7020 0.7440 0.0107  0.0346  -0.0309 354  LEU A C   
2825 O O   . LEU A 378 ? 0.7871 0.8495 0.8923 0.0109  0.0324  -0.0349 354  LEU A O   
2826 C CB  . LEU A 378 ? 0.6397 0.7191 0.7413 0.0205  0.0341  -0.0382 354  LEU A CB  
2827 C CG  . LEU A 378 ? 0.6118 0.6989 0.7181 0.0301  0.0315  -0.0432 354  LEU A CG  
2828 C CD1 . LEU A 378 ? 0.6472 0.7577 0.7566 0.0300  0.0333  -0.0479 354  LEU A CD1 
2829 C CD2 . LEU A 378 ? 0.7187 0.8031 0.8361 0.0381  0.0261  -0.0481 354  LEU A CD2 
2830 N N   . THR A 379 ? 0.5705 0.6154 0.6570 0.0031  0.0380  -0.0242 355  THR A N   
2831 C CA  . THR A 379 ? 0.5558 0.5954 0.6405 -0.0046 0.0391  -0.0211 355  THR A CA  
2832 C C   . THR A 379 ? 0.6603 0.6808 0.7453 -0.0031 0.0366  -0.0197 355  THR A C   
2833 O O   . THR A 379 ? 0.6877 0.7073 0.7772 -0.0046 0.0349  -0.0212 355  THR A O   
2834 C CB  . THR A 379 ? 0.6131 0.6489 0.6867 -0.0134 0.0432  -0.0144 355  THR A CB  
2835 O OG1 . THR A 379 ? 0.5667 0.6202 0.6390 -0.0154 0.0461  -0.0157 355  THR A OG1 
2836 C CG2 . THR A 379 ? 0.4707 0.5011 0.5430 -0.0212 0.0441  -0.0112 355  THR A CG2 
2837 N N   . LEU A 380 ? 0.7794 0.7845 0.8597 -0.0001 0.0363  -0.0171 356  LEU A N   
2838 C CA  . LEU A 380 ? 0.7146 0.7008 0.7941 0.0001  0.0350  -0.0156 356  LEU A CA  
2839 C C   . LEU A 380 ? 0.6790 0.6658 0.7677 0.0065  0.0313  -0.0210 356  LEU A C   
2840 O O   . LEU A 380 ? 0.7226 0.6983 0.8114 0.0047  0.0303  -0.0205 356  LEU A O   
2841 C CB  . LEU A 380 ? 0.6579 0.6281 0.7315 0.0019  0.0356  -0.0123 356  LEU A CB  
2842 C CG  . LEU A 380 ? 0.6223 0.5865 0.6855 -0.0053 0.0384  -0.0061 356  LEU A CG  
2843 C CD1 . LEU A 380 ? 0.6063 0.5579 0.6654 -0.0017 0.0378  -0.0046 356  LEU A CD1 
2844 C CD2 . LEU A 380 ? 0.7265 0.6796 0.7853 -0.0128 0.0395  -0.0020 356  LEU A CD2 
2845 N N   . ILE A 381 ? 0.5314 0.5304 0.6274 0.0138  0.0290  -0.0262 357  ILE A N   
2846 C CA  . ILE A 381 ? 0.4389 0.4368 0.5433 0.0201  0.0249  -0.0312 357  ILE A CA  
2847 C C   . ILE A 381 ? 0.5442 0.5461 0.6526 0.0169  0.0228  -0.0332 357  ILE A C   
2848 O O   . ILE A 381 ? 0.7221 0.7105 0.8301 0.0166  0.0211  -0.0329 357  ILE A O   
2849 C CB  . ILE A 381 ? 0.4144 0.4257 0.5266 0.0287  0.0223  -0.0366 357  ILE A CB  
2850 C CG1 . ILE A 381 ? 0.3578 0.3612 0.4665 0.0329  0.0233  -0.0350 357  ILE A CG1 
2851 C CG2 . ILE A 381 ? 0.3484 0.3598 0.4696 0.0345  0.0174  -0.0418 357  ILE A CG2 
2852 C CD1 . ILE A 381 ? 0.3284 0.3448 0.4438 0.0413  0.0208  -0.0400 357  ILE A CD1 
2853 N N   . PRO A 382 ? 0.5217 0.5410 0.6338 0.0143  0.0227  -0.0355 358  PRO A N   
2854 C CA  . PRO A 382 ? 0.5752 0.5969 0.6912 0.0112  0.0201  -0.0376 358  PRO A CA  
2855 C C   . PRO A 382 ? 0.8161 0.8249 0.9241 0.0028  0.0226  -0.0319 358  PRO A C   
2856 O O   . PRO A 382 ? 1.0191 1.0251 1.1288 0.0002  0.0200  -0.0330 358  PRO A O   
2857 C CB  . PRO A 382 ? 0.4104 0.4555 0.5334 0.0108  0.0200  -0.0420 358  PRO A CB  
2858 C CG  . PRO A 382 ? 0.3739 0.4244 0.4909 0.0086  0.0250  -0.0387 358  PRO A CG  
2859 C CD  . PRO A 382 ? 0.4673 0.5046 0.5799 0.0136  0.0252  -0.0365 358  PRO A CD  
2860 N N   . LEU A 383 ? 0.7010 0.7013 0.8001 -0.0012 0.0269  -0.0261 359  LEU A N   
2861 C CA  . LEU A 383 ? 0.6338 0.6207 0.7252 -0.0088 0.0289  -0.0207 359  LEU A CA  
2862 C C   . LEU A 383 ? 0.6726 0.6387 0.7606 -0.0076 0.0277  -0.0193 359  LEU A C   
2863 O O   . LEU A 383 ? 0.9983 0.9540 1.0825 -0.0127 0.0276  -0.0169 359  LEU A O   
2864 C CB  . LEU A 383 ? 0.8366 0.8219 0.9198 -0.0136 0.0333  -0.0152 359  LEU A CB  
2865 C CG  . LEU A 383 ? 0.8206 0.7971 0.8961 -0.0225 0.0358  -0.0093 359  LEU A CG  
2866 C CD1 . LEU A 383 ? 0.7460 0.7384 0.8242 -0.0280 0.0367  -0.0098 359  LEU A CD1 
2867 C CD2 . LEU A 383 ? 0.8448 0.8117 0.9116 -0.0248 0.0387  -0.0039 359  LEU A CD2 
2868 N N   . LEU A 384 ? 0.5640 0.5239 0.6536 -0.0011 0.0270  -0.0209 360  LEU A N   
2869 C CA  . LEU A 384 ? 0.5315 0.4717 0.6179 -0.0002 0.0268  -0.0198 360  LEU A CA  
2870 C C   . LEU A 384 ? 0.6287 0.5669 0.7211 0.0053  0.0227  -0.0246 360  LEU A C   
2871 O O   . LEU A 384 ? 0.7840 0.7060 0.8730 0.0043  0.0226  -0.0237 360  LEU A O   
2872 C CB  . LEU A 384 ? 0.6289 0.5601 0.7123 0.0025  0.0292  -0.0177 360  LEU A CB  
2873 C CG  . LEU A 384 ? 0.7110 0.6315 0.7858 -0.0033 0.0327  -0.0120 360  LEU A CG  
2874 C CD1 . LEU A 384 ? 0.7379 0.6711 0.8098 -0.0075 0.0344  -0.0094 360  LEU A CD1 
2875 C CD2 . LEU A 384 ? 0.7939 0.7022 0.8676 0.0006  0.0338  -0.0115 360  LEU A CD2 
2876 N N   . CYS A 385 ? 0.6169 0.5705 0.7176 0.0107  0.0194  -0.0296 361  CYS A N   
2877 C CA  . CYS A 385 ? 0.6836 0.6349 0.7902 0.0164  0.0149  -0.0342 361  CYS A CA  
2878 C C   . CYS A 385 ? 0.8339 0.7931 0.9452 0.0156  0.0101  -0.0378 361  CYS A C   
2879 O O   . CYS A 385 ? 0.9858 0.9397 1.1001 0.0190  0.0057  -0.0410 361  CYS A O   
2880 C CB  . CYS A 385 ? 0.6821 0.6431 0.7958 0.0246  0.0135  -0.0378 361  CYS A CB  
2881 S SG  . CYS A 385 ? 1.0033 0.9472 1.1149 0.0287  0.0155  -0.0364 361  CYS A SG  
2882 N N   . THR A 386 ? 0.9082 0.8793 1.0202 0.0111  0.0105  -0.0376 362  THR A N   
2883 C CA  . THR A 386 ? 0.7784 0.7591 0.8968 0.0110  0.0054  -0.0421 362  THR A CA  
2884 C C   . THR A 386 ? 0.6438 0.6079 0.7573 0.0074  0.0026  -0.0410 362  THR A C   
2885 O O   . THR A 386 ? 0.6039 0.5689 0.7222 0.0100  -0.0034 -0.0454 362  THR A O   
2886 C CB  . THR A 386 ? 0.8757 0.8737 0.9969 0.0067  0.0071  -0.0424 362  THR A CB  
2887 O OG1 . THR A 386 ? 0.9857 0.9983 1.1170 0.0091  0.0017  -0.0489 362  THR A OG1 
2888 C CG2 . THR A 386 ? 0.7412 0.7302 0.8546 -0.0019 0.0099  -0.0373 362  THR A CG2 
2889 N N   . HIS A 387 ? 0.7145 0.6627 0.8181 0.0017  0.0065  -0.0354 363  HIS A N   
2890 C CA  . HIS A 387 ? 0.6970 0.6281 0.7947 -0.0016 0.0041  -0.0344 363  HIS A CA  
2891 C C   . HIS A 387 ? 0.7606 0.6799 0.8580 0.0032  0.0014  -0.0365 363  HIS A C   
2892 O O   . HIS A 387 ? 0.8432 0.7565 0.9407 0.0036  -0.0039 -0.0390 363  HIS A O   
2893 C CB  . HIS A 387 ? 0.8982 0.8145 0.9854 -0.0084 0.0090  -0.0282 363  HIS A CB  
2894 C CG  . HIS A 387 ? 0.9702 0.8677 1.0501 -0.0118 0.0071  -0.0270 363  HIS A CG  
2895 N ND1 . HIS A 387 ? 1.0473 0.9279 1.1221 -0.0101 0.0077  -0.0266 363  HIS A ND1 
2896 C CD2 . HIS A 387 ? 0.9000 0.7927 0.9764 -0.0167 0.0044  -0.0264 363  HIS A CD2 
2897 C CE1 . HIS A 387 ? 0.9671 0.8330 1.0347 -0.0141 0.0057  -0.0257 363  HIS A CE1 
2898 N NE2 . HIS A 387 ? 0.7720 0.6447 0.8404 -0.0180 0.0034  -0.0255 363  HIS A NE2 
2899 N N   . GLU A 388 ? 0.7708 0.6863 0.8680 0.0069  0.0048  -0.0355 364  GLU A N   
2900 C CA  . GLU A 388 ? 0.6852 0.5897 0.7826 0.0113  0.0028  -0.0375 364  GLU A CA  
2901 C C   . GLU A 388 ? 0.6816 0.5973 0.7882 0.0172  -0.0041 -0.0433 364  GLU A C   
2902 O O   . GLU A 388 ? 0.6985 0.6040 0.8041 0.0187  -0.0082 -0.0451 364  GLU A O   
2903 C CB  . GLU A 388 ? 0.5718 0.4724 0.6694 0.0148  0.0074  -0.0361 364  GLU A CB  
2904 C CG  . GLU A 388 ? 0.9726 0.8587 1.0693 0.0179  0.0069  -0.0373 364  GLU A CG  
2905 C CD  . GLU A 388 ? 1.0475 0.9128 1.1339 0.0120  0.0094  -0.0342 364  GLU A CD  
2906 O OE1 . GLU A 388 ? 0.9474 0.8073 1.0274 0.0064  0.0135  -0.0303 364  GLU A OE1 
2907 O OE2 . GLU A 388 ? 0.7536 0.6075 0.8380 0.0127  0.0072  -0.0357 364  GLU A OE2 
2908 N N   . VAL A 389 ? 0.5951 0.5314 0.7105 0.0204  -0.0057 -0.0464 365  VAL A N   
2909 C CA  . VAL A 389 ? 0.6442 0.5912 0.7691 0.0262  -0.0129 -0.0525 365  VAL A CA  
2910 C C   . VAL A 389 ? 0.8023 0.7494 0.9277 0.0230  -0.0188 -0.0548 365  VAL A C   
2911 O O   . VAL A 389 ? 0.9234 0.8660 1.0512 0.0258  -0.0255 -0.0583 365  VAL A O   
2912 C CB  . VAL A 389 ? 0.5606 0.5299 0.6953 0.0314  -0.0129 -0.0560 365  VAL A CB  
2913 C CG1 . VAL A 389 ? 0.6139 0.5949 0.7592 0.0372  -0.0209 -0.0629 365  VAL A CG1 
2914 C CG2 . VAL A 389 ? 0.6035 0.5705 0.7378 0.0356  -0.0086 -0.0544 365  VAL A CG2 
2915 N N   . ILE A 390 ? 0.6655 0.6167 0.7885 0.0171  -0.0169 -0.0529 366  ILE A N   
2916 C CA  . ILE A 390 ? 0.6332 0.5864 0.7584 0.0144  -0.0230 -0.0558 366  ILE A CA  
2917 C C   . ILE A 390 ? 0.5863 0.5178 0.7033 0.0125  -0.0270 -0.0548 366  ILE A C   
2918 O O   . ILE A 390 ? 0.7202 0.6511 0.8411 0.0150  -0.0350 -0.0593 366  ILE A O   
2919 C CB  . ILE A 390 ? 0.7944 0.7537 0.9177 0.0077  -0.0194 -0.0532 366  ILE A CB  
2920 C CG1 . ILE A 390 ? 0.8536 0.8370 0.9864 0.0095  -0.0171 -0.0559 366  ILE A CG1 
2921 C CG2 . ILE A 390 ? 0.8977 0.8530 1.0210 0.0041  -0.0255 -0.0552 366  ILE A CG2 
2922 C CD1 . ILE A 390 ? 0.8145 0.8042 0.9450 0.0026  -0.0122 -0.0526 366  ILE A CD1 
2923 N N   . PHE A 391 ? 0.6031 0.5161 0.7085 0.0079  -0.0218 -0.0492 367  PHE A N   
2924 C CA  . PHE A 391 ? 0.7186 0.6094 0.8141 0.0053  -0.0243 -0.0476 367  PHE A CA  
2925 C C   . PHE A 391 ? 0.9330 0.8126 1.0260 0.0092  -0.0230 -0.0474 367  PHE A C   
2926 O O   . PHE A 391 ? 0.9650 0.8265 1.0480 0.0059  -0.0185 -0.0435 367  PHE A O   
2927 C CB  . PHE A 391 ? 0.6740 0.5510 0.7583 -0.0022 -0.0194 -0.0421 367  PHE A CB  
2928 C CG  . PHE A 391 ? 0.7276 0.6151 0.8144 -0.0064 -0.0201 -0.0419 367  PHE A CG  
2929 C CD1 . PHE A 391 ? 0.6763 0.5616 0.7634 -0.0084 -0.0272 -0.0445 367  PHE A CD1 
2930 C CD2 . PHE A 391 ? 0.7581 0.6570 0.8470 -0.0084 -0.0140 -0.0393 367  PHE A CD2 
2931 C CE1 . PHE A 391 ? 0.6299 0.5250 0.7203 -0.0123 -0.0278 -0.0446 367  PHE A CE1 
2932 C CE2 . PHE A 391 ? 0.7345 0.6431 0.8260 -0.0126 -0.0144 -0.0391 367  PHE A CE2 
2933 C CZ  . PHE A 391 ? 0.7156 0.6227 0.8084 -0.0145 -0.0211 -0.0419 367  PHE A CZ  
2934 N N   . ALA A 392 ? 1.1071 0.9971 1.2096 0.0160  -0.0270 -0.0518 368  ALA A N   
2935 C CA  . ALA A 392 ? 1.0543 0.9378 1.1570 0.0203  -0.0245 -0.0516 368  ALA A CA  
2936 C C   . ALA A 392 ? 1.1145 0.9750 1.2072 0.0179  -0.0254 -0.0500 368  ALA A C   
2937 O O   . ALA A 392 ? 1.5317 1.3796 1.6186 0.0168  -0.0192 -0.0470 368  ALA A O   
2938 C CB  . ALA A 392 ? 0.9732 0.8729 1.0885 0.0283  -0.0298 -0.0570 368  ALA A CB  
2939 N N   . PHE A 393 ? 0.7325 0.5867 0.8229 0.0170  -0.0332 -0.0523 369  PHE A N   
2940 C CA  . PHE A 393 ? 0.7674 0.5995 0.8475 0.0145  -0.0350 -0.0513 369  PHE A CA  
2941 C C   . PHE A 393 ? 0.7550 0.5738 0.8242 0.0076  -0.0375 -0.0494 369  PHE A C   
2942 O O   . PHE A 393 ? 0.9266 0.7322 0.9895 0.0063  -0.0439 -0.0505 369  PHE A O   
2943 C CB  . PHE A 393 ? 0.6474 0.4808 0.7334 0.0200  -0.0433 -0.0557 369  PHE A CB  
2944 C CG  . PHE A 393 ? 0.6081 0.4502 0.7033 0.0267  -0.0410 -0.0573 369  PHE A CG  
2945 C CD1 . PHE A 393 ? 0.6644 0.5291 0.7732 0.0328  -0.0434 -0.0610 369  PHE A CD1 
2946 C CD2 . PHE A 393 ? 0.5820 0.4097 0.6723 0.0268  -0.0364 -0.0554 369  PHE A CD2 
2947 C CE1 . PHE A 393 ? 0.6797 0.5520 0.7968 0.0392  -0.0417 -0.0626 369  PHE A CE1 
2948 C CE2 . PHE A 393 ? 0.5726 0.4081 0.6721 0.0332  -0.0347 -0.0571 369  PHE A CE2 
2949 C CZ  . PHE A 393 ? 0.5939 0.4514 0.7066 0.0396  -0.0376 -0.0606 369  PHE A CZ  
2950 N N   . VAL A 394 ? 0.7722 0.5933 0.8383 0.0031  -0.0327 -0.0464 370  VAL A N   
2951 C CA  . VAL A 394 ? 0.9067 0.7159 0.9629 -0.0034 -0.0347 -0.0444 370  VAL A CA  
2952 C C   . VAL A 394 ? 1.0098 0.8009 1.0532 -0.0088 -0.0263 -0.0392 370  VAL A C   
2953 O O   . VAL A 394 ? 0.8950 0.6909 0.9399 -0.0094 -0.0186 -0.0366 370  VAL A O   
2954 C CB  . VAL A 394 ? 0.6791 0.5049 0.7421 -0.0047 -0.0361 -0.0452 370  VAL A CB  
2955 N N   . MET A 395 ? 1.2712 1.0409 1.3018 -0.0129 -0.0282 -0.0380 371  MET A N   
2956 C CA  . MET A 395 ? 1.3058 1.0574 1.3239 -0.0182 -0.0203 -0.0338 371  MET A CA  
2957 C C   . MET A 395 ? 1.2806 1.0308 1.2936 -0.0237 -0.0177 -0.0306 371  MET A C   
2958 O O   . MET A 395 ? 1.3387 1.0901 1.3513 -0.0255 -0.0099 -0.0277 371  MET A O   
2959 C CB  . MET A 395 ? 1.3711 1.1000 1.3762 -0.0211 -0.0228 -0.0337 371  MET A CB  
2960 N N   . ASP A 396 ? 1.1533 0.9007 1.1629 -0.0263 -0.0246 -0.0314 372  ASP A N   
2961 C CA  . ASP A 396 ? 1.1111 0.8563 1.1160 -0.0316 -0.0237 -0.0287 372  ASP A CA  
2962 C C   . ASP A 396 ? 1.0504 0.7881 1.0505 -0.0336 -0.0333 -0.0306 372  ASP A C   
2963 O O   . ASP A 396 ? 0.8165 0.5335 0.8036 -0.0365 -0.0356 -0.0300 372  ASP A O   
2964 C CB  . ASP A 396 ? 0.9333 0.6614 0.9259 -0.0368 -0.0156 -0.0243 372  ASP A CB  
2965 N N   . ARG A 404 ? 1.8609 1.6750 1.9039 -0.0629 -0.0431 -0.0254 380  ARG A N   
2966 C CA  . ARG A 404 ? 1.5902 1.4209 1.6401 -0.0598 -0.0364 -0.0252 380  ARG A CA  
2967 C C   . ARG A 404 ? 1.6579 1.4782 1.6973 -0.0613 -0.0279 -0.0192 380  ARG A C   
2968 O O   . ARG A 404 ? 1.5735 1.4045 1.6168 -0.0589 -0.0222 -0.0184 380  ARG A O   
2969 C CB  . ARG A 404 ? 1.2159 1.0522 1.2714 -0.0535 -0.0407 -0.0306 380  ARG A CB  
2970 N N   . PHE A 405 ? 1.8328 1.6322 1.8591 -0.0652 -0.0273 -0.0152 381  PHE A N   
2971 C CA  . PHE A 405 ? 1.8181 1.6059 1.8345 -0.0664 -0.0198 -0.0104 381  PHE A CA  
2972 C C   . PHE A 405 ? 1.8232 1.6237 1.8442 -0.0686 -0.0127 -0.0066 381  PHE A C   
2973 O O   . PHE A 405 ? 1.4085 1.2129 1.4300 -0.0664 -0.0070 -0.0053 381  PHE A O   
2974 C CB  . PHE A 405 ? 1.8523 1.6159 1.8540 -0.0705 -0.0207 -0.0075 381  PHE A CB  
2975 N N   . ILE A 406 ? 1.9798 1.7872 2.0048 -0.0727 -0.0134 -0.0051 382  ILE A N   
2976 C CA  . ILE A 406 ? 1.7649 1.5831 1.7931 -0.0756 -0.0071 -0.0011 382  ILE A CA  
2977 C C   . ILE A 406 ? 1.6050 1.4446 1.6441 -0.0719 -0.0044 -0.0034 382  ILE A C   
2978 O O   . ILE A 406 ? 1.7696 1.6137 1.8082 -0.0719 0.0016  -0.0003 382  ILE A O   
2979 C CB  . ILE A 406 ? 1.5968 1.4188 1.6280 -0.0809 -0.0089 0.0007  382  ILE A CB  
2980 C CG1 . ILE A 406 ? 1.5744 1.3756 1.5956 -0.0838 -0.0133 0.0017  382  ILE A CG1 
2981 C CG2 . ILE A 406 ? 1.2745 1.1025 1.3056 -0.0849 -0.0024 0.0060  382  ILE A CG2 
2982 C CD1 . ILE A 406 ? 1.1361 0.9405 1.1611 -0.0886 -0.0162 0.0029  382  ILE A CD1 
2983 N N   . LYS A 407 ? 1.4807 1.3332 1.5295 -0.0685 -0.0093 -0.0090 383  LYS A N   
2984 C CA  . LYS A 407 ? 1.5544 1.4291 1.6144 -0.0653 -0.0071 -0.0118 383  LYS A CA  
2985 C C   . LYS A 407 ? 1.3461 1.2193 1.4039 -0.0602 -0.0039 -0.0120 383  LYS A C   
2986 O O   . LYS A 407 ? 1.3772 1.2630 1.4390 -0.0589 0.0010  -0.0111 383  LYS A O   
2987 C CB  . LYS A 407 ? 1.3795 1.2679 1.4511 -0.0628 -0.0137 -0.0186 383  LYS A CB  
2988 N N   . LEU A 408 ? 0.8822 0.7400 0.9337 -0.0572 -0.0066 -0.0133 384  LEU A N   
2989 C CA  . LEU A 408 ? 1.0926 0.9477 1.1420 -0.0527 -0.0032 -0.0133 384  LEU A CA  
2990 C C   . LEU A 408 ? 1.0779 0.9202 1.1180 -0.0553 0.0033  -0.0078 384  LEU A C   
2991 O O   . LEU A 408 ? 0.9653 0.8085 1.0055 -0.0521 0.0072  -0.0073 384  LEU A O   
2992 C CB  . LEU A 408 ? 1.0069 0.8511 1.0536 -0.0487 -0.0083 -0.0170 384  LEU A CB  
2993 C CG  . LEU A 408 ? 0.8796 0.7351 0.9340 -0.0420 -0.0087 -0.0209 384  LEU A CG  
2994 C CD1 . LEU A 408 ? 0.9366 0.7865 0.9917 -0.0385 -0.0162 -0.0257 384  LEU A CD1 
2995 C CD2 . LEU A 408 ? 0.9103 0.7594 0.9601 -0.0401 -0.0023 -0.0181 384  LEU A CD2 
2996 N N   . PHE A 409 ? 1.2622 1.0929 1.2949 -0.0609 0.0042  -0.0038 385  PHE A N   
2997 C CA  . PHE A 409 ? 1.1571 0.9786 1.1829 -0.0633 0.0102  0.0010  385  PHE A CA  
2998 C C   . PHE A 409 ? 1.2527 1.0896 1.2840 -0.0639 0.0146  0.0033  385  PHE A C   
2999 O O   . PHE A 409 ? 1.3876 1.2176 1.4139 -0.0662 0.0190  0.0074  385  PHE A O   
3000 C CB  . PHE A 409 ? 1.0892 0.8947 1.1059 -0.0691 0.0100  0.0046  385  PHE A CB  
3001 N N   . THR A 410 ? 1.2153 1.0723 1.2566 -0.0622 0.0135  0.0007  386  THR A N   
3002 C CA  . THR A 410 ? 1.1703 1.0418 1.2157 -0.0627 0.0177  0.0026  386  THR A CA  
3003 C C   . THR A 410 ? 1.2624 1.1377 1.3098 -0.0569 0.0202  0.0011  386  THR A C   
3004 O O   . THR A 410 ? 1.0492 0.9355 1.0991 -0.0568 0.0235  0.0026  386  THR A O   
3005 C CB  . THR A 410 ? 1.2659 1.1580 1.3209 -0.0640 0.0161  0.0002  386  THR A CB  
3006 O OG1 . THR A 410 ? 1.2327 1.1347 1.2957 -0.0585 0.0121  -0.0060 386  THR A OG1 
3007 C CG2 . THR A 410 ? 1.4899 1.3785 1.5440 -0.0699 0.0136  0.0017  386  THR A CG2 
3008 N N   . GLU A 411 ? 1.2934 1.1597 1.3396 -0.0522 0.0183  -0.0018 387  GLU A N   
3009 C CA  . GLU A 411 ? 1.0856 0.9523 1.1330 -0.0468 0.0208  -0.0029 387  GLU A CA  
3010 C C   . GLU A 411 ? 1.0071 0.8622 1.0478 -0.0489 0.0256  0.0016  387  GLU A C   
3011 O O   . GLU A 411 ? 1.4650 1.3245 1.5076 -0.0459 0.0284  0.0019  387  GLU A O   
3012 C CB  . GLU A 411 ? 1.3099 1.1679 1.3571 -0.0422 0.0176  -0.0069 387  GLU A CB  
3013 C CG  . GLU A 411 ? 1.7348 1.5906 1.7833 -0.0365 0.0198  -0.0082 387  GLU A CG  
3014 C CD  . GLU A 411 ? 1.8206 1.6668 1.8682 -0.0329 0.0165  -0.0118 387  GLU A CD  
3015 O OE1 . GLU A 411 ? 1.8034 1.6419 1.8474 -0.0353 0.0128  -0.0125 387  GLU A OE1 
3016 O OE2 . GLU A 411 ? 1.9835 1.8295 2.0339 -0.0277 0.0174  -0.0138 387  GLU A OE2 
3017 N N   . LEU A 412 ? 0.8714 0.7115 0.9043 -0.0540 0.0263  0.0048  388  LEU A N   
3018 C CA  . LEU A 412 ? 1.0101 0.8381 1.0370 -0.0561 0.0303  0.0086  388  LEU A CA  
3019 C C   . LEU A 412 ? 1.0548 0.8928 1.0830 -0.0587 0.0327  0.0122  388  LEU A C   
3020 O O   . LEU A 412 ? 1.2748 1.1096 1.3018 -0.0574 0.0355  0.0136  388  LEU A O   
3021 C CB  . LEU A 412 ? 1.0286 0.8392 1.0471 -0.0611 0.0300  0.0108  388  LEU A CB  
3022 C CG  . LEU A 412 ? 1.0608 0.8603 1.0762 -0.0593 0.0274  0.0076  388  LEU A CG  
3023 C CD1 . LEU A 412 ? 1.0034 0.7883 1.0106 -0.0645 0.0260  0.0094  388  LEU A CD1 
3024 C CD2 . LEU A 412 ? 1.0254 0.8153 1.0394 -0.0551 0.0300  0.0056  388  LEU A CD2 
3025 N N   . SER A 413 ? 0.9555 0.8062 0.9866 -0.0622 0.0314  0.0132  389  SER A N   
3026 C CA  . SER A 413 ? 1.0211 0.8814 1.0526 -0.0654 0.0338  0.0168  389  SER A CA  
3027 C C   . SER A 413 ? 1.1695 1.0411 1.2053 -0.0604 0.0354  0.0151  389  SER A C   
3028 O O   . SER A 413 ? 1.2603 1.1298 1.2931 -0.0610 0.0378  0.0180  389  SER A O   
3029 C CB  . SER A 413 ? 1.2286 1.1015 1.2634 -0.0701 0.0325  0.0175  389  SER A CB  
3030 O OG  . SER A 413 ? 1.6586 1.5464 1.7015 -0.0664 0.0302  0.0124  389  SER A OG  
3031 N N   . PHE A 414 ? 1.1894 1.0725 1.2321 -0.0553 0.0336  0.0101  390  PHE A N   
3032 C CA  . PHE A 414 ? 1.1634 1.0581 1.2105 -0.0502 0.0347  0.0081  390  PHE A CA  
3033 C C   . PHE A 414 ? 1.3788 1.2612 1.4235 -0.0456 0.0359  0.0078  390  PHE A C   
3034 O O   . PHE A 414 ? 1.6917 1.5765 1.7359 -0.0439 0.0378  0.0091  390  PHE A O   
3035 C CB  . PHE A 414 ? 1.2194 1.1295 1.2752 -0.0457 0.0319  0.0024  390  PHE A CB  
3036 C CG  . PHE A 414 ? 1.3307 1.2604 1.3913 -0.0484 0.0324  0.0019  390  PHE A CG  
3037 C CD1 . PHE A 414 ? 1.2958 1.2287 1.3566 -0.0545 0.0318  0.0033  390  PHE A CD1 
3038 C CD2 . PHE A 414 ? 1.2619 1.2067 1.3267 -0.0449 0.0338  -0.0001 390  PHE A CD2 
3039 C CE1 . PHE A 414 ? 1.1987 1.1501 1.2646 -0.0574 0.0328  0.0024  390  PHE A CE1 
3040 C CE2 . PHE A 414 ? 1.1464 1.1097 1.2154 -0.0478 0.0350  -0.0009 390  PHE A CE2 
3041 C CZ  . PHE A 414 ? 1.1775 1.1442 1.2473 -0.0542 0.0347  0.0003  390  PHE A CZ  
3042 N N   . THR A 415 ? 1.3188 1.1874 1.3620 -0.0437 0.0349  0.0061  391  THR A N   
3043 C CA  . THR A 415 ? 1.2616 1.1184 1.3034 -0.0398 0.0365  0.0055  391  THR A CA  
3044 C C   . THR A 415 ? 1.2292 1.0750 1.2650 -0.0436 0.0392  0.0099  391  THR A C   
3045 O O   . THR A 415 ? 1.4273 1.2674 1.4632 -0.0404 0.0406  0.0096  391  THR A O   
3046 C CB  . THR A 415 ? 1.1067 0.9505 1.1473 -0.0378 0.0354  0.0027  391  THR A CB  
3047 O OG1 . THR A 415 ? 1.2769 1.1098 1.3113 -0.0436 0.0351  0.0050  391  THR A OG1 
3048 C CG2 . THR A 415 ? 0.9326 0.7863 0.9795 -0.0330 0.0320  -0.0020 391  THR A CG2 
3049 N N   . SER A 416 ? 0.9434 0.7862 0.9744 -0.0503 0.0394  0.0139  392  SER A N   
3050 C CA  . SER A 416 ? 1.1167 0.9497 1.1423 -0.0541 0.0411  0.0181  392  SER A CA  
3051 C C   . SER A 416 ? 1.1946 1.0386 1.2208 -0.0544 0.0418  0.0203  392  SER A C   
3052 O O   . SER A 416 ? 1.5451 1.3825 1.5694 -0.0532 0.0426  0.0216  392  SER A O   
3053 C CB  . SER A 416 ? 1.1912 1.0164 1.2114 -0.0611 0.0407  0.0216  392  SER A CB  
3054 O OG  . SER A 416 ? 0.9462 0.7846 0.9679 -0.0649 0.0396  0.0230  392  SER A OG  
3055 N N   . PHE A 417 ? 1.0872 0.9476 1.1158 -0.0560 0.0413  0.0206  393  PHE A N   
3056 C CA  . PHE A 417 ? 0.9272 0.7976 0.9547 -0.0574 0.0423  0.0231  393  PHE A CA  
3057 C C   . PHE A 417 ? 0.8613 0.7404 0.8931 -0.0503 0.0424  0.0196  393  PHE A C   
3058 O O   . PHE A 417 ? 0.7974 0.6850 0.8276 -0.0509 0.0432  0.0213  393  PHE A O   
3059 C CB  . PHE A 417 ? 0.9748 0.8597 1.0031 -0.0628 0.0425  0.0248  393  PHE A CB  
3060 C CG  . PHE A 417 ? 1.0257 0.9027 1.0485 -0.0707 0.0426  0.0297  393  PHE A CG  
3061 C CD1 . PHE A 417 ? 1.1596 1.0343 1.1765 -0.0758 0.0435  0.0349  393  PHE A CD1 
3062 C CD2 . PHE A 417 ? 1.0324 0.9038 1.0557 -0.0730 0.0412  0.0292  393  PHE A CD2 
3063 C CE1 . PHE A 417 ? 1.1815 1.0490 1.1938 -0.0830 0.0431  0.0395  393  PHE A CE1 
3064 C CE2 . PHE A 417 ? 0.9772 0.8414 0.9959 -0.0799 0.0409  0.0336  393  PHE A CE2 
3065 C CZ  . PHE A 417 ? 1.0514 0.9139 1.0649 -0.0849 0.0419  0.0388  393  PHE A CZ  
3066 N N   . GLN A 418 ? 0.8857 0.7627 0.9225 -0.0438 0.0415  0.0149  394  GLN A N   
3067 C CA  . GLN A 418 ? 0.7455 0.6300 0.7871 -0.0366 0.0411  0.0113  394  GLN A CA  
3068 C C   . GLN A 418 ? 0.8947 0.7739 0.9326 -0.0356 0.0419  0.0137  394  GLN A C   
3069 O O   . GLN A 418 ? 0.9128 0.8030 0.9512 -0.0336 0.0419  0.0134  394  GLN A O   
3070 C CB  . GLN A 418 ? 0.9177 0.7954 0.9640 -0.0305 0.0400  0.0068  394  GLN A CB  
3071 C CG  . GLN A 418 ? 0.8684 0.7557 0.9202 -0.0287 0.0379  0.0029  394  GLN A CG  
3072 C CD  . GLN A 418 ? 0.9359 0.8136 0.9906 -0.0239 0.0367  -0.0009 394  GLN A CD  
3073 O OE1 . GLN A 418 ? 1.0656 0.9285 1.1179 -0.0228 0.0380  -0.0005 394  GLN A OE1 
3074 N NE2 . GLN A 418 ? 1.2058 1.0916 1.2656 -0.0211 0.0340  -0.0047 394  GLN A NE2 
3075 N N   . GLY A 419 ? 0.8691 0.7311 0.9033 -0.0369 0.0422  0.0156  395  GLY A N   
3076 C CA  . GLY A 419 ? 0.8327 0.6879 0.8643 -0.0352 0.0419  0.0170  395  GLY A CA  
3077 C C   . GLY A 419 ? 0.8666 0.7268 0.8917 -0.0406 0.0420  0.0218  395  GLY A C   
3078 O O   . GLY A 419 ? 0.8656 0.7280 0.8890 -0.0382 0.0413  0.0222  395  GLY A O   
3079 N N   . LEU A 420 ? 0.9275 0.7890 0.9485 -0.0480 0.0426  0.0255  396  LEU A N   
3080 C CA  . LEU A 420 ? 0.9181 0.7860 0.9329 -0.0539 0.0430  0.0302  396  LEU A CA  
3081 C C   . LEU A 420 ? 0.9556 0.8422 0.9726 -0.0515 0.0438  0.0283  396  LEU A C   
3082 O O   . LEU A 420 ? 1.1438 1.0334 1.1558 -0.0524 0.0439  0.0305  396  LEU A O   
3083 C CB  . LEU A 420 ? 0.8549 0.7229 0.8668 -0.0619 0.0436  0.0339  396  LEU A CB  
3084 C CG  . LEU A 420 ? 0.7672 0.6459 0.7741 -0.0685 0.0447  0.0382  396  LEU A CG  
3085 C CD1 . LEU A 420 ? 0.7961 0.6639 0.7945 -0.0719 0.0435  0.0431  396  LEU A CD1 
3086 C CD2 . LEU A 420 ? 0.8497 0.7330 0.8569 -0.0752 0.0454  0.0402  396  LEU A CD2 
3087 N N   . MET A 421 ? 0.7784 0.6773 0.8026 -0.0485 0.0442  0.0240  397  MET A N   
3088 C CA  . MET A 421 ? 0.8391 0.7566 0.8663 -0.0459 0.0450  0.0214  397  MET A CA  
3089 C C   . MET A 421 ? 0.9091 0.8257 0.9373 -0.0384 0.0440  0.0189  397  MET A C   
3090 O O   . MET A 421 ? 0.9050 0.8324 0.9312 -0.0377 0.0446  0.0188  397  MET A O   
3091 C CB  . MET A 421 ? 0.9825 0.9131 1.0183 -0.0437 0.0448  0.0166  397  MET A CB  
3092 C CG  . MET A 421 ? 1.2472 1.1982 1.2871 -0.0412 0.0456  0.0133  397  MET A CG  
3093 S SD  . MET A 421 ? 1.8782 1.8470 1.9250 -0.0451 0.0462  0.0105  397  MET A SD  
3094 C CE  . MET A 421 ? 1.2398 1.2165 1.2789 -0.0546 0.0497  0.0159  397  MET A CE  
3095 N N   . VAL A 422 ? 0.9132 0.8171 0.9445 -0.0329 0.0425  0.0166  398  VAL A N   
3096 C CA  . VAL A 422 ? 0.7622 0.6638 0.7950 -0.0257 0.0411  0.0142  398  VAL A CA  
3097 C C   . VAL A 422 ? 0.7952 0.6900 0.8191 -0.0287 0.0406  0.0186  398  VAL A C   
3098 O O   . VAL A 422 ? 0.6705 0.5715 0.6925 -0.0255 0.0400  0.0179  398  VAL A O   
3099 C CB  . VAL A 422 ? 0.7248 0.6129 0.7629 -0.0200 0.0399  0.0110  398  VAL A CB  
3100 C CG1 . VAL A 422 ? 0.7599 0.6448 0.8001 -0.0127 0.0382  0.0085  398  VAL A CG1 
3101 C CG2 . VAL A 422 ? 0.5349 0.4296 0.5808 -0.0169 0.0398  0.0066  398  VAL A CG2 
3102 N N   . ALA A 423 ? 0.9223 0.8038 0.9400 -0.0349 0.0405  0.0232  399  ALA A N   
3103 C CA  . ALA A 423 ? 0.7584 0.6318 0.7671 -0.0384 0.0392  0.0277  399  ALA A CA  
3104 C C   . ALA A 423 ? 0.7296 0.6167 0.7317 -0.0433 0.0407  0.0308  399  ALA A C   
3105 O O   . ALA A 423 ? 0.6799 0.5658 0.6754 -0.0431 0.0395  0.0325  399  ALA A O   
3106 C CB  . ALA A 423 ? 0.7979 0.6549 0.8021 -0.0443 0.0385  0.0318  399  ALA A CB  
3107 N N   . ILE A 424 ? 0.7418 0.6418 0.7455 -0.0480 0.0432  0.0312  400  ILE A N   
3108 C CA  . ILE A 424 ? 0.9093 0.8241 0.9079 -0.0530 0.0454  0.0334  400  ILE A CA  
3109 C C   . ILE A 424 ? 0.9470 0.8750 0.9483 -0.0465 0.0458  0.0291  400  ILE A C   
3110 O O   . ILE A 424 ? 0.9580 0.8869 0.9515 -0.0471 0.0456  0.0310  400  ILE A O   
3111 C CB  . ILE A 424 ? 1.1040 1.0304 1.1061 -0.0588 0.0480  0.0337  400  ILE A CB  
3112 C CG1 . ILE A 424 ? 1.2166 1.1294 1.2156 -0.0653 0.0474  0.0381  400  ILE A CG1 
3113 C CG2 . ILE A 424 ? 1.1517 1.0946 1.1496 -0.0641 0.0509  0.0352  400  ILE A CG2 
3114 C CD1 . ILE A 424 ? 1.2384 1.1427 1.2262 -0.0727 0.0470  0.0448  400  ILE A CD1 
3115 N N   . LEU A 425 ? 0.8025 0.7404 0.8143 -0.0402 0.0459  0.0231  401  LEU A N   
3116 C CA  . LEU A 425 ? 0.7745 0.7278 0.7901 -0.0342 0.0462  0.0185  401  LEU A CA  
3117 C C   . LEU A 425 ? 0.7903 0.7350 0.8035 -0.0273 0.0436  0.0174  401  LEU A C   
3118 O O   . LEU A 425 ? 0.8782 0.8333 0.8898 -0.0242 0.0438  0.0155  401  LEU A O   
3119 C CB  . LEU A 425 ? 0.8214 0.7856 0.8493 -0.0289 0.0459  0.0123  401  LEU A CB  
3120 C CG  . LEU A 425 ? 0.8915 0.8667 0.9237 -0.0344 0.0478  0.0118  401  LEU A CG  
3121 C CD1 . LEU A 425 ? 0.9308 0.9152 0.9751 -0.0279 0.0462  0.0051  401  LEU A CD1 
3122 C CD2 . LEU A 425 ? 1.1735 1.1644 1.2016 -0.0407 0.0511  0.0133  401  LEU A CD2 
3123 N N   . TYR A 426 ? 0.8848 0.8110 0.8980 -0.0248 0.0411  0.0183  402  TYR A N   
3124 C CA  . TYR A 426 ? 0.8995 0.8170 0.9118 -0.0179 0.0381  0.0167  402  TYR A CA  
3125 C C   . TYR A 426 ? 0.8230 0.7252 0.8241 -0.0221 0.0363  0.0221  402  TYR A C   
3126 O O   . TYR A 426 ? 0.8136 0.7079 0.8128 -0.0168 0.0333  0.0210  402  TYR A O   
3127 C CB  . TYR A 426 ? 0.7536 0.6616 0.7758 -0.0106 0.0362  0.0125  402  TYR A CB  
3128 C CG  . TYR A 426 ? 0.6369 0.5583 0.6699 -0.0032 0.0362  0.0063  402  TYR A CG  
3129 C CD1 . TYR A 426 ? 0.6266 0.5652 0.6604 -0.0003 0.0366  0.0037  402  TYR A CD1 
3130 C CD2 . TYR A 426 ? 0.7346 0.6510 0.7767 0.0008  0.0356  0.0028  402  TYR A CD2 
3131 C CE1 . TYR A 426 ? 0.6884 0.6391 0.7326 0.0067  0.0358  -0.0023 402  TYR A CE1 
3132 C CE2 . TYR A 426 ? 0.4907 0.4183 0.5422 0.0075  0.0348  -0.0027 402  TYR A CE2 
3133 C CZ  . TYR A 426 ? 0.6179 0.5627 0.6709 0.0105  0.0347  -0.0053 402  TYR A CZ  
3134 O OH  . TYR A 426 ? 0.7135 0.6692 0.7765 0.0172  0.0333  -0.0110 402  TYR A OH  
3135 N N   . CYS A 427 ? 0.8604 0.7569 0.8543 -0.0311 0.0373  0.0275  403  CYS A N   
3136 C CA  . CYS A 427 ? 0.9406 0.8237 0.9227 -0.0355 0.0349  0.0327  403  CYS A CA  
3137 C C   . CYS A 427 ? 0.9282 0.8179 0.8992 -0.0452 0.0371  0.0383  403  CYS A C   
3138 O O   . CYS A 427 ? 0.8589 0.7504 0.8206 -0.0464 0.0365  0.0403  403  CYS A O   
3139 C CB  . CYS A 427 ? 0.9317 0.7949 0.9143 -0.0370 0.0324  0.0345  403  CYS A CB  
3140 S SG  . CYS A 427 ? 1.0540 0.8981 1.0240 -0.0405 0.0276  0.0396  403  CYS A SG  
3141 N N   . PHE A 428 ? 0.8301 0.7233 0.8019 -0.0524 0.0396  0.0409  404  PHE A N   
3142 C CA  . PHE A 428 ? 0.8579 0.7503 0.8184 -0.0627 0.0407  0.0475  404  PHE A CA  
3143 C C   . PHE A 428 ? 0.9709 0.8818 0.9266 -0.0661 0.0444  0.0478  404  PHE A C   
3144 O O   . PHE A 428 ? 1.2399 1.1493 1.1837 -0.0737 0.0449  0.0531  404  PHE A O   
3145 C CB  . PHE A 428 ? 0.9256 0.8154 0.8888 -0.0692 0.0420  0.0500  404  PHE A CB  
3146 C CG  . PHE A 428 ? 0.9385 0.8090 0.9043 -0.0675 0.0386  0.0504  404  PHE A CG  
3147 C CD1 . PHE A 428 ? 1.0222 0.8749 0.9801 -0.0691 0.0345  0.0540  404  PHE A CD1 
3148 C CD2 . PHE A 428 ? 0.9813 0.8511 0.9572 -0.0646 0.0394  0.0470  404  PHE A CD2 
3149 C CE1 . PHE A 428 ? 1.1417 0.9773 1.1029 -0.0676 0.0316  0.0535  404  PHE A CE1 
3150 C CE2 . PHE A 428 ? 1.0747 0.9271 1.0527 -0.0634 0.0369  0.0469  404  PHE A CE2 
3151 C CZ  . PHE A 428 ? 1.1397 0.9755 1.1109 -0.0648 0.0332  0.0499  404  PHE A CZ  
3152 N N   . VAL A 429 ? 1.0370 0.9655 1.0018 -0.0610 0.0470  0.0421  405  VAL A N   
3153 C CA  . VAL A 429 ? 0.9358 0.8832 0.8975 -0.0633 0.0508  0.0410  405  VAL A CA  
3154 C C   . VAL A 429 ? 0.9353 0.8852 0.8946 -0.0558 0.0493  0.0378  405  VAL A C   
3155 O O   . VAL A 429 ? 1.0495 1.0155 1.0066 -0.0564 0.0523  0.0359  405  VAL A O   
3156 C CB  . VAL A 429 ? 0.9524 0.9195 0.9259 -0.0631 0.0544  0.0364  405  VAL A CB  
3157 C CG1 . VAL A 429 ? 1.0490 1.0147 1.0232 -0.0717 0.0561  0.0401  405  VAL A CG1 
3158 C CG2 . VAL A 429 ? 1.0347 1.0028 1.0214 -0.0530 0.0523  0.0299  405  VAL A CG2 
3159 N N   . ASN A 430 ? 0.9220 0.8565 0.8822 -0.0487 0.0446  0.0367  406  ASN A N   
3160 C CA  . ASN A 430 ? 1.0478 0.9823 1.0053 -0.0414 0.0424  0.0338  406  ASN A CA  
3161 C C   . ASN A 430 ? 1.1317 1.0610 1.0723 -0.0474 0.0420  0.0391  406  ASN A C   
3162 O O   . ASN A 430 ? 1.3821 1.2966 1.3133 -0.0542 0.0401  0.0451  406  ASN A O   
3163 C CB  . ASN A 430 ? 0.9936 0.9117 0.9571 -0.0328 0.0374  0.0313  406  ASN A CB  
3164 C CG  . ASN A 430 ? 1.0577 0.9742 1.0188 -0.0249 0.0343  0.0284  406  ASN A CG  
3165 O OD1 . ASN A 430 ? 1.0245 0.9235 0.9808 -0.0224 0.0297  0.0298  406  ASN A OD1 
3166 N ND2 . ASN A 430 ? 0.9045 0.8392 0.8693 -0.0208 0.0366  0.0240  406  ASN A ND2 
3167 N N   . ASN A 431 ? 1.1367 1.0781 1.0731 -0.0451 0.0435  0.0368  407  ASN A N   
3168 C CA  . ASN A 431 ? 0.9552 0.8930 0.8741 -0.0514 0.0436  0.0417  407  ASN A CA  
3169 C C   . ASN A 431 ? 0.9942 0.9090 0.9040 -0.0485 0.0370  0.0444  407  ASN A C   
3170 O O   . ASN A 431 ? 1.2130 1.1160 1.1077 -0.0560 0.0354  0.0507  407  ASN A O   
3171 C CB  . ASN A 431 ? 0.9502 0.9075 0.8671 -0.0493 0.0473  0.0378  407  ASN A CB  
3172 C CG  . ASN A 431 ? 1.2472 1.2279 1.1745 -0.0518 0.0534  0.0341  407  ASN A CG  
3173 O OD1 . ASN A 431 ? 1.5812 1.5639 1.5202 -0.0520 0.0540  0.0330  407  ASN A OD1 
3174 N ND2 . ASN A 431 ? 1.0584 1.0569 0.9816 -0.0538 0.0578  0.0320  407  ASN A ND2 
3175 N N   . GLU A 432 ? 0.9654 0.8730 0.8845 -0.0379 0.0327  0.0397  408  GLU A N   
3176 C CA  . GLU A 432 ? 1.0118 0.8983 0.9242 -0.0341 0.0260  0.0411  408  GLU A CA  
3177 C C   . GLU A 432 ? 1.1079 0.9744 1.0158 -0.0402 0.0226  0.0465  408  GLU A C   
3178 O O   . GLU A 432 ? 1.3546 1.2050 1.2492 -0.0435 0.0181  0.0509  408  GLU A O   
3179 C CB  . GLU A 432 ? 1.0994 0.9839 1.0254 -0.0215 0.0227  0.0342  408  GLU A CB  
3180 C CG  . GLU A 432 ? 1.0847 0.9836 1.0123 -0.0140 0.0234  0.0291  408  GLU A CG  
3181 C CD  . GLU A 432 ? 0.9716 0.8955 0.9077 -0.0142 0.0297  0.0253  408  GLU A CD  
3182 O OE1 . GLU A 432 ? 0.8071 0.7370 0.7520 -0.0175 0.0328  0.0252  408  GLU A OE1 
3183 O OE2 . GLU A 432 ? 0.7616 0.6992 0.6957 -0.0110 0.0312  0.0222  408  GLU A OE2 
3184 N N   . VAL A 433 ? 1.0273 0.8943 0.9458 -0.0419 0.0245  0.0462  409  VAL A N   
3185 C CA  . VAL A 433 ? 1.0901 0.9388 1.0054 -0.0473 0.0213  0.0508  409  VAL A CA  
3186 C C   . VAL A 433 ? 1.1254 0.9732 1.0257 -0.0594 0.0227  0.0582  409  VAL A C   
3187 O O   . VAL A 433 ? 1.1219 0.9516 1.0128 -0.0641 0.0181  0.0630  409  VAL A O   
3188 C CB  . VAL A 433 ? 1.1245 0.9740 1.0543 -0.0459 0.0231  0.0482  409  VAL A CB  
3189 C CG1 . VAL A 433 ? 1.1110 0.9652 1.0552 -0.0347 0.0229  0.0408  409  VAL A CG1 
3190 C CG2 . VAL A 433 ? 1.1533 1.0187 1.0849 -0.0532 0.0292  0.0500  409  VAL A CG2 
3191 N N   . GLN A 434 ? 1.0778 0.9447 0.9758 -0.0647 0.0289  0.0590  410  GLN A N   
3192 C CA  . GLN A 434 ? 1.2121 1.0791 1.0956 -0.0764 0.0308  0.0659  410  GLN A CA  
3193 C C   . GLN A 434 ? 1.2680 1.1243 1.1343 -0.0780 0.0269  0.0693  410  GLN A C   
3194 O O   . GLN A 434 ? 1.1231 0.9662 0.9757 -0.0864 0.0243  0.0759  410  GLN A O   
3195 C CB  . GLN A 434 ? 1.2883 1.1795 1.1747 -0.0811 0.0387  0.0649  410  GLN A CB  
3196 C CG  . GLN A 434 ? 1.3260 1.2263 1.2284 -0.0804 0.0417  0.0620  410  GLN A CG  
3197 C CD  . GLN A 434 ? 1.4026 1.3270 1.3098 -0.0844 0.0489  0.0601  410  GLN A CD  
3198 O OE1 . GLN A 434 ? 1.3184 1.2558 1.2196 -0.0859 0.0522  0.0592  410  GLN A OE1 
3199 N NE2 . GLN A 434 ? 1.2007 1.1308 1.1190 -0.0861 0.0510  0.0590  410  GLN A NE2 
3200 N N   . LEU A 435 ? 1.1846 1.0447 1.0512 -0.0696 0.0258  0.0647  411  LEU A N   
3201 C CA  . LEU A 435 ? 1.2399 1.0865 1.0907 -0.0693 0.0207  0.0671  411  LEU A CA  
3202 C C   . LEU A 435 ? 1.2779 1.0984 1.1257 -0.0685 0.0123  0.0697  411  LEU A C   
3203 O O   . LEU A 435 ? 1.2081 1.0137 1.0395 -0.0747 0.0079  0.0754  411  LEU A O   
3204 C CB  . LEU A 435 ? 1.3475 1.2013 1.2022 -0.0586 0.0200  0.0607  411  LEU A CB  
3205 C CG  . LEU A 435 ? 1.4708 1.3470 1.3222 -0.0593 0.0265  0.0584  411  LEU A CG  
3206 C CD1 . LEU A 435 ? 1.4737 1.3546 1.3320 -0.0471 0.0244  0.0515  411  LEU A CD1 
3207 C CD2 . LEU A 435 ? 1.4658 1.3392 1.2953 -0.0693 0.0275  0.0646  411  LEU A CD2 
3208 N N   . GLU A 436 ? 1.2256 1.0397 1.0889 -0.0610 0.0097  0.0654  412  GLU A N   
3209 C CA  . GLU A 436 ? 1.2635 1.0532 1.1256 -0.0597 0.0016  0.0668  412  GLU A CA  
3210 C C   . GLU A 436 ? 1.4055 1.1849 1.2590 -0.0709 0.0003  0.0739  412  GLU A C   
3211 O O   . GLU A 436 ? 1.5622 1.3220 1.4041 -0.0741 -0.0066 0.0779  412  GLU A O   
3212 C CB  . GLU A 436 ? 1.2852 1.0718 1.1666 -0.0502 0.0003  0.0603  412  GLU A CB  
3213 C CG  . GLU A 436 ? 1.3520 1.1449 1.2417 -0.0386 -0.0003 0.0534  412  GLU A CG  
3214 C CD  . GLU A 436 ? 1.5492 1.3306 1.4266 -0.0355 -0.0065 0.0539  412  GLU A CD  
3215 O OE1 . GLU A 436 ? 1.5831 1.3432 1.4540 -0.0368 -0.0138 0.0563  412  GLU A OE1 
3216 O OE2 . GLU A 436 ? 1.7007 1.4939 1.5748 -0.0318 -0.0045 0.0517  412  GLU A OE2 
3217 N N   . PHE A 437 ? 1.3803 1.1723 1.2386 -0.0771 0.0066  0.0757  413  PHE A N   
3218 C CA  . PHE A 437 ? 1.4443 1.2270 1.2950 -0.0877 0.0053  0.0824  413  PHE A CA  
3219 C C   . PHE A 437 ? 1.5439 1.3229 1.3738 -0.0970 0.0044  0.0893  413  PHE A C   
3220 O O   . PHE A 437 ? 1.8049 1.5652 1.6240 -0.1027 -0.0019 0.0947  413  PHE A O   
3221 C CB  . PHE A 437 ? 1.5719 1.3695 1.4326 -0.0920 0.0121  0.0826  413  PHE A CB  
3222 C CG  . PHE A 437 ? 1.5277 1.3222 1.4056 -0.0856 0.0116  0.0778  413  PHE A CG  
3223 C CD1 . PHE A 437 ? 1.3733 1.1505 1.2528 -0.0880 0.0069  0.0798  413  PHE A CD1 
3224 C CD2 . PHE A 437 ? 1.6235 1.4319 1.5156 -0.0774 0.0156  0.0711  413  PHE A CD2 
3225 C CE1 . PHE A 437 ? 1.3651 1.1392 1.2596 -0.0824 0.0069  0.0752  413  PHE A CE1 
3226 C CE2 . PHE A 437 ? 1.5605 1.3653 1.4671 -0.0720 0.0153  0.0668  413  PHE A CE2 
3227 C CZ  . PHE A 437 ? 1.5432 1.3309 1.4508 -0.0746 0.0113  0.0688  413  PHE A CZ  
3228 N N   . ARG A 438 ? 1.3456 1.1418 1.1693 -0.0989 0.0102  0.0892  414  ARG A N   
3229 C CA  . ARG A 438 ? 1.3519 1.1446 1.1547 -0.1086 0.0100  0.0959  414  ARG A CA  
3230 C C   . ARG A 438 ? 1.3440 1.1160 1.1336 -0.1054 0.0013  0.0970  414  ARG A C   
3231 O O   . ARG A 438 ? 1.3669 1.1238 1.1395 -0.1135 -0.0033 0.1036  414  ARG A O   
3232 C CB  . ARG A 438 ? 1.3987 1.2156 1.1985 -0.1114 0.0190  0.0947  414  ARG A CB  
3233 C CG  . ARG A 438 ? 1.6619 1.4772 1.4392 -0.1200 0.0198  0.1002  414  ARG A CG  
3234 C CD  . ARG A 438 ? 2.1961 1.9944 1.9575 -0.1320 0.0160  0.1092  414  ARG A CD  
3235 N NE  . ARG A 438 ? 2.5998 2.4061 2.3669 -0.1406 0.0207  0.1125  414  ARG A NE  
3236 C CZ  . ARG A 438 ? 2.6227 2.4163 2.3787 -0.1512 0.0178  0.1202  414  ARG A CZ  
3237 N NH1 . ARG A 438 ? 2.4479 2.2200 2.1861 -0.1547 0.0101  0.1253  414  ARG A NH1 
3238 N NH2 . ARG A 438 ? 2.6941 2.4959 2.4566 -0.1584 0.0222  0.1227  414  ARG A NH2 
3239 N N   . LYS A 439 ? 1.5185 1.2887 1.3159 -0.0936 -0.0017 0.0906  415  LYS A N   
3240 C CA  . LYS A 439 ? 1.3939 1.1438 1.1806 -0.0895 -0.0108 0.0908  415  LYS A CA  
3241 C C   . LYS A 439 ? 1.3213 1.0464 1.1067 -0.0915 -0.0197 0.0938  415  LYS A C   
3242 O O   . LYS A 439 ? 1.3608 1.0671 1.1297 -0.0953 -0.0272 0.0981  415  LYS A O   
3243 C CB  . LYS A 439 ? 1.6268 1.3806 1.4260 -0.0757 -0.0120 0.0825  415  LYS A CB  
3244 C CG  . LYS A 439 ? 1.8657 1.6030 1.6539 -0.0703 -0.0202 0.0817  415  LYS A CG  
3245 C CD  . LYS A 439 ? 1.9827 1.7290 1.7838 -0.0571 -0.0197 0.0734  415  LYS A CD  
3246 C CE  . LYS A 439 ? 2.0544 1.7957 1.8772 -0.0480 -0.0223 0.0675  415  LYS A CE  
3247 N NZ  . LYS A 439 ? 1.7968 1.5463 1.6322 -0.0354 -0.0220 0.0596  415  LYS A NZ  
3248 N N   . SER A 440 ? 1.3250 1.0496 1.1269 -0.0895 -0.0193 0.0915  416  SER A N   
3249 C CA  . SER A 440 ? 1.5328 1.2351 1.3351 -0.0913 -0.0276 0.0936  416  SER A CA  
3250 C C   . SER A 440 ? 1.6496 1.3445 1.4362 -0.1046 -0.0289 0.1024  416  SER A C   
3251 O O   . SER A 440 ? 1.5310 1.2041 1.3065 -0.1079 -0.0379 0.1061  416  SER A O   
3252 C CB  . SER A 440 ? 1.4187 1.1238 1.2423 -0.0862 -0.0257 0.0886  416  SER A CB  
3253 O OG  . SER A 440 ? 1.6391 1.3230 1.4651 -0.0865 -0.0338 0.0891  416  SER A OG  
3254 N N   . TRP A 441 ? 1.6050 1.3174 1.3907 -0.1124 -0.0203 0.1057  417  TRP A N   
3255 C CA  . TRP A 441 ? 1.6529 1.3591 1.4233 -0.1255 -0.0212 0.1143  417  TRP A CA  
3256 C C   . TRP A 441 ? 1.7203 1.4164 1.4678 -0.1305 -0.0253 0.1192  417  TRP A C   
3257 O O   . TRP A 441 ? 1.7666 1.4442 1.4998 -0.1382 -0.0322 0.1256  417  TRP A O   
3258 C CB  . TRP A 441 ? 1.7517 1.4801 1.5256 -0.1328 -0.0108 0.1164  417  TRP A CB  
3259 N N   . GLU A 442 ? 1.8758 1.5827 1.6194 -0.1258 -0.0217 0.1160  418  GLU A N   
3260 C CA  . GLU A 442 ? 1.9382 1.6354 1.6593 -0.1297 -0.0254 0.1201  418  GLU A CA  
3261 C C   . GLU A 442 ? 1.9723 1.6413 1.6871 -0.1255 -0.0384 0.1202  418  GLU A C   
3262 O O   . GLU A 442 ? 1.8601 1.5119 1.5545 -0.1330 -0.0448 0.1265  418  GLU A O   
3263 C CB  . GLU A 442 ? 1.9072 1.6219 1.6276 -0.1238 -0.0192 0.1154  418  GLU A CB  
3264 C CG  . GLU A 442 ? 2.2145 1.9248 1.9102 -0.1301 -0.0198 0.1200  418  GLU A CG  
3265 C CD  . GLU A 442 ? 2.4258 2.1468 2.1089 -0.1443 -0.0123 0.1269  418  GLU A CD  
3266 O OE1 . GLU A 442 ? 2.4211 2.1615 2.1175 -0.1469 -0.0038 0.1258  418  GLU A OE1 
3267 O OE2 . GLU A 442 ? 2.6371 2.3465 2.2970 -0.1531 -0.0151 0.1333  418  GLU A OE2 
3268 N N   . ARG A 443 ? 2.0504 1.7139 1.7824 -0.1138 -0.0427 0.1131  419  ARG A N   
3269 C CA  . ARG A 443 ? 1.9898 1.6265 1.7188 -0.1096 -0.0554 0.1124  419  ARG A CA  
3270 C C   . ARG A 443 ? 2.1389 1.7579 1.8623 -0.1184 -0.0620 0.1183  419  ARG A C   
3271 O O   . ARG A 443 ? 2.4401 2.0361 2.1496 -0.1210 -0.0726 0.1217  419  ARG A O   
3272 C CB  . ARG A 443 ? 1.8960 1.5318 1.6473 -0.0960 -0.0576 0.1032  419  ARG A CB  
3273 C CG  . ARG A 443 ? 2.1524 1.8039 1.9108 -0.0861 -0.0526 0.0968  419  ARG A CG  
3274 C CD  . ARG A 443 ? 2.2465 1.8862 1.9891 -0.0830 -0.0591 0.0969  419  ARG A CD  
3275 N NE  . ARG A 443 ? 2.3635 2.0208 2.1123 -0.0744 -0.0533 0.0912  419  ARG A NE  
3276 C CZ  . ARG A 443 ? 2.3248 1.9839 2.0915 -0.0619 -0.0547 0.0831  419  ARG A CZ  
3277 N NH1 . ARG A 443 ? 2.3643 2.0088 2.1447 -0.0567 -0.0612 0.0795  419  ARG A NH1 
3278 N NH2 . ARG A 443 ? 2.2697 1.9454 2.0412 -0.0548 -0.0495 0.0784  419  ARG A NH2 
3279 N N   . TRP A 444 ? 2.0935 1.7227 1.8273 -0.1232 -0.0563 0.1198  420  TRP A N   
3280 C CA  . TRP A 444 ? 2.0158 1.6287 1.7449 -0.1316 -0.0627 0.1254  420  TRP A CA  
3281 C C   . TRP A 444 ? 2.0471 1.6531 1.7511 -0.1444 -0.0643 0.1348  420  TRP A C   
3282 O O   . TRP A 444 ? 2.0061 1.5899 1.6991 -0.1499 -0.0744 0.1395  420  TRP A O   
3283 C CB  . TRP A 444 ? 2.0912 1.7165 1.8366 -0.1338 -0.0562 0.1248  420  TRP A CB  
3284 C CG  . TRP A 444 ? 2.1827 1.7914 1.9248 -0.1419 -0.0632 0.1301  420  TRP A CG  
3285 C CD1 . TRP A 444 ? 2.0339 1.6427 1.7632 -0.1547 -0.0618 0.1385  420  TRP A CD1 
3286 C CD2 . TRP A 444 ? 2.2558 1.8456 2.0079 -0.1377 -0.0725 0.1270  420  TRP A CD2 
3287 N NE1 . TRP A 444 ? 2.0541 1.6452 1.7847 -0.1584 -0.0702 0.1410  420  TRP A NE1 
3288 C CE2 . TRP A 444 ? 2.1701 1.7496 1.9148 -0.1481 -0.0768 0.1339  420  TRP A CE2 
3289 C CE3 . TRP A 444 ? 2.3469 1.9281 2.1143 -0.1262 -0.0775 0.1188  420  TRP A CE3 
3290 C CZ2 . TRP A 444 ? 2.0728 1.6369 1.8262 -0.1462 -0.0856 0.1316  420  TRP A CZ2 
3291 C CZ3 . TRP A 444 ? 2.1738 1.7371 1.9486 -0.1255 -0.0863 0.1173  420  TRP A CZ3 
3292 C CH2 . TRP A 444 ? 1.9038 1.4622 1.6732 -0.1343 -0.0897 0.1226  420  TRP A CH2 
3293 N N   . ARG A 445 ? 1.9649 1.5895 1.6597 -0.1498 -0.0547 0.1376  421  ARG A N   
3294 C CA  . ARG A 445 ? 1.8868 1.5050 1.5570 -0.1627 -0.0556 0.1465  421  ARG A CA  
3295 C C   . ARG A 445 ? 2.1582 1.7557 1.8090 -0.1614 -0.0652 0.1480  421  ARG A C   
3296 O O   . ARG A 445 ? 2.5314 2.1070 2.1657 -0.1689 -0.0745 0.1543  421  ARG A O   
3297 C CB  . ARG A 445 ? 1.5457 1.1902 1.2121 -0.1688 -0.0421 0.1483  421  ARG A CB  
3298 N N   . LEU A 446 ? 2.2747 1.8776 1.9274 -0.1518 -0.0640 0.1422  422  LEU A N   
3299 C CA  . LEU A 446 ? 1.9441 1.5283 1.5781 -0.1500 -0.0728 0.1431  422  LEU A CA  
3300 C C   . LEU A 446 ? 1.6588 1.2207 1.3020 -0.1397 -0.0856 0.1380  422  LEU A C   
3301 O O   . LEU A 446 ? 1.6627 1.2064 1.3074 -0.1424 -0.0944 0.1401  422  LEU A O   
3302 C CB  . LEU A 446 ? 1.8807 1.4818 1.5107 -0.1449 -0.0653 0.1394  422  LEU A CB  
3303 N N   . SER B 10  ? 1.7741 1.5053 1.5481 -0.0154 -0.0732 -0.0540 136  SER B N   
3304 C CA  . SER B 10  ? 1.7549 1.4869 1.5262 -0.0204 -0.0767 -0.0551 136  SER B CA  
3305 C C   . SER B 10  ? 1.8789 1.6078 1.6490 -0.0216 -0.0785 -0.0518 136  SER B C   
3306 O O   . SER B 10  ? 1.9241 1.6533 1.6996 -0.0206 -0.0761 -0.0496 136  SER B O   
3307 C CB  . SER B 10  ? 1.7288 1.4584 1.4986 -0.0243 -0.0787 -0.0566 136  SER B CB  
3308 N N   . PRO B 11  ? 2.0555 1.7820 1.8187 -0.0240 -0.0828 -0.0514 137  PRO B N   
3309 C CA  . PRO B 11  ? 2.0303 1.7538 1.7925 -0.0255 -0.0852 -0.0483 137  PRO B CA  
3310 C C   . PRO B 11  ? 2.0746 1.7953 1.8364 -0.0307 -0.0878 -0.0471 137  PRO B C   
3311 O O   . PRO B 11  ? 1.7852 1.5049 1.5510 -0.0305 -0.0870 -0.0447 137  PRO B O   
3312 C CB  . PRO B 11  ? 1.8413 1.5644 1.5961 -0.0271 -0.0895 -0.0485 137  PRO B CB  
3313 C CG  . PRO B 11  ? 1.7680 1.4929 1.5186 -0.0292 -0.0908 -0.0521 137  PRO B CG  
3314 C CD  . PRO B 11  ? 1.9515 1.6787 1.7079 -0.0257 -0.0859 -0.0541 137  PRO B CD  
3315 N N   . GLU B 12  ? 2.2389 1.9588 1.9962 -0.0353 -0.0910 -0.0488 138  GLU B N   
3316 C CA  . GLU B 12  ? 2.0959 1.8132 1.8525 -0.0407 -0.0939 -0.0474 138  GLU B CA  
3317 C C   . GLU B 12  ? 1.9685 1.6860 1.7313 -0.0395 -0.0899 -0.0472 138  GLU B C   
3318 O O   . GLU B 12  ? 1.9609 1.6766 1.7253 -0.0424 -0.0909 -0.0452 138  GLU B O   
3319 C CB  . GLU B 12  ? 2.0605 1.7775 1.8109 -0.0459 -0.0984 -0.0492 138  GLU B CB  
3320 N N   . GLU B 13  ? 1.8665 1.5866 1.6330 -0.0353 -0.0857 -0.0491 139  GLU B N   
3321 C CA  . GLU B 13  ? 1.6958 1.4171 1.4683 -0.0342 -0.0822 -0.0489 139  GLU B CA  
3322 C C   . GLU B 13  ? 1.6087 1.3314 1.3873 -0.0317 -0.0790 -0.0463 139  GLU B C   
3323 O O   . GLU B 13  ? 1.4050 1.1276 1.1870 -0.0330 -0.0778 -0.0453 139  GLU B O   
3324 C CB  . GLU B 13  ? 1.6382 1.3633 1.4143 -0.0304 -0.0787 -0.0513 139  GLU B CB  
3325 N N   . GLN B 14  ? 1.7222 1.4463 1.5022 -0.0281 -0.0778 -0.0453 140  GLN B N   
3326 C CA  . GLN B 14  ? 1.5584 1.2844 1.3449 -0.0253 -0.0748 -0.0431 140  GLN B CA  
3327 C C   . GLN B 14  ? 1.5153 1.2375 1.3005 -0.0297 -0.0779 -0.0413 140  GLN B C   
3328 O O   . GLN B 14  ? 1.3676 1.0910 1.1582 -0.0297 -0.0756 -0.0403 140  GLN B O   
3329 C CB  . GLN B 14  ? 1.5133 1.2409 1.3010 -0.0208 -0.0736 -0.0423 140  GLN B CB  
3330 N N   . LEU B 15  ? 1.3526 1.0710 1.1313 -0.0338 -0.0833 -0.0408 141  LEU B N   
3331 C CA  . LEU B 15  ? 1.2608 0.9765 1.0388 -0.0389 -0.0869 -0.0389 141  LEU B CA  
3332 C C   . LEU B 15  ? 1.4669 1.1816 1.2445 -0.0434 -0.0875 -0.0391 141  LEU B C   
3333 O O   . LEU B 15  ? 1.5332 1.2474 1.3143 -0.0455 -0.0873 -0.0376 141  LEU B O   
3334 C CB  . LEU B 15  ? 1.1262 0.8396 0.8975 -0.0434 -0.0933 -0.0381 141  LEU B CB  
3335 N N   . LEU B 16  ? 1.7003 1.4149 1.4745 -0.0446 -0.0879 -0.0411 142  LEU B N   
3336 C CA  . LEU B 16  ? 1.6550 1.3682 1.4288 -0.0488 -0.0888 -0.0411 142  LEU B CA  
3337 C C   . LEU B 16  ? 1.6097 1.3252 1.3904 -0.0457 -0.0836 -0.0409 142  LEU B C   
3338 O O   . LEU B 16  ? 1.3981 1.1124 1.1800 -0.0491 -0.0841 -0.0397 142  LEU B O   
3339 C CB  . LEU B 16  ? 1.7871 1.4996 1.5563 -0.0503 -0.0905 -0.0434 142  LEU B CB  
3340 N N   . PHE B 17  ? 1.5919 1.3113 1.3775 -0.0394 -0.0788 -0.0419 143  PHE B N   
3341 C CA  . PHE B 17  ? 1.5597 1.2827 1.3526 -0.0365 -0.0739 -0.0417 143  PHE B CA  
3342 C C   . PHE B 17  ? 1.5877 1.3113 1.3851 -0.0361 -0.0724 -0.0398 143  PHE B C   
3343 O O   . PHE B 17  ? 1.5729 1.2971 1.3737 -0.0374 -0.0708 -0.0392 143  PHE B O   
3344 C CB  . PHE B 17  ? 1.5306 1.2590 1.3283 -0.0305 -0.0694 -0.0429 143  PHE B CB  
3345 C CG  . PHE B 17  ? 1.5702 1.2973 1.3690 -0.0280 -0.0667 -0.0419 143  PHE B CG  
3346 C CD1 . PHE B 17  ? 1.6315 1.3532 1.4245 -0.0299 -0.0684 -0.0421 143  PHE B CD1 
3347 C CD2 . PHE B 17  ? 1.4884 1.2187 1.2925 -0.0237 -0.0631 -0.0406 143  PHE B CD2 
3348 C CE1 . PHE B 17  ? 1.5717 1.2913 1.3642 -0.0278 -0.0665 -0.0410 143  PHE B CE1 
3349 C CE2 . PHE B 17  ? 1.4571 1.1856 1.2606 -0.0216 -0.0611 -0.0397 143  PHE B CE2 
3350 C CZ  . PHE B 17  ? 1.5106 1.2339 1.3083 -0.0237 -0.0628 -0.0399 143  PHE B CZ  
3351 N N   . LEU B 18  ? 1.4050 1.1286 1.2029 -0.0343 -0.0731 -0.0388 144  LEU B N   
3352 C CA  . LEU B 18  ? 1.4385 1.1623 1.2413 -0.0341 -0.0722 -0.0372 144  LEU B CA  
3353 C C   . LEU B 18  ? 1.4536 1.1730 1.2530 -0.0410 -0.0764 -0.0361 144  LEU B C   
3354 O O   . LEU B 18  ? 1.5009 1.2209 1.3049 -0.0418 -0.0748 -0.0353 144  LEU B O   
3355 C CB  . LEU B 18  ? 1.2573 0.9810 1.0611 -0.0310 -0.0730 -0.0363 144  LEU B CB  
3356 C CG  . LEU B 18  ? 1.3043 1.0337 1.1139 -0.0240 -0.0680 -0.0367 144  LEU B CG  
3357 C CD1 . LEU B 18  ? 1.2670 0.9952 1.0747 -0.0216 -0.0699 -0.0360 144  LEU B CD1 
3358 C CD2 . LEU B 18  ? 1.2003 0.9349 1.0199 -0.0204 -0.0628 -0.0361 144  LEU B CD2 
3359 N N   . TYR B 19  ? 1.4850 1.2009 1.2769 -0.0464 -0.0817 -0.0361 145  TYR B N   
3360 C CA  . TYR B 19  ? 1.4123 1.1253 1.2013 -0.0539 -0.0860 -0.0348 145  TYR B CA  
3361 C C   . TYR B 19  ? 1.4123 1.1257 1.2030 -0.0553 -0.0838 -0.0351 145  TYR B C   
3362 O O   . TYR B 19  ? 1.3550 1.0677 1.1476 -0.0592 -0.0845 -0.0337 145  TYR B O   
3363 C CB  . TYR B 19  ? 1.5041 1.2149 1.2853 -0.0591 -0.0918 -0.0349 145  TYR B CB  
3364 C CG  . TYR B 19  ? 1.5174 1.2267 1.2957 -0.0676 -0.0966 -0.0334 145  TYR B CG  
3365 C CD1 . TYR B 19  ? 1.5345 1.2441 1.3136 -0.0728 -0.1008 -0.0310 145  TYR B CD1 
3366 C CD2 . TYR B 19  ? 1.5033 1.2114 1.2786 -0.0706 -0.0973 -0.0340 145  TYR B CD2 
3367 C CE1 . TYR B 19  ? 1.5648 1.2746 1.3422 -0.0811 -0.1053 -0.0291 145  TYR B CE1 
3368 C CE2 . TYR B 19  ? 1.4443 1.1515 1.2173 -0.0785 -0.1017 -0.0322 145  TYR B CE2 
3369 C CZ  . TYR B 19  ? 1.5477 1.2561 1.3217 -0.0839 -0.1056 -0.0297 145  TYR B CZ  
3370 O OH  . TYR B 19  ? 1.3911 1.1002 1.1636 -0.0922 -0.1101 -0.0276 145  TYR B OH  
3371 N N   . ILE B 20  ? 1.3286 1.0432 1.1190 -0.0524 -0.0812 -0.0368 146  ILE B N   
3372 C CA  . ILE B 20  ? 1.4064 1.1212 1.1983 -0.0539 -0.0795 -0.0369 146  ILE B CA  
3373 C C   . ILE B 20  ? 1.4846 1.2022 1.2836 -0.0511 -0.0750 -0.0363 146  ILE B C   
3374 O O   . ILE B 20  ? 1.5240 1.2404 1.3236 -0.0549 -0.0754 -0.0353 146  ILE B O   
3375 C CB  . ILE B 20  ? 1.4614 1.1775 1.2529 -0.0509 -0.0777 -0.0388 146  ILE B CB  
3376 C CG1 . ILE B 20  ? 1.3724 1.0853 1.1568 -0.0544 -0.0823 -0.0397 146  ILE B CG1 
3377 C CG2 . ILE B 20  ? 1.3029 1.0194 1.0967 -0.0520 -0.0758 -0.0388 146  ILE B CG2 
3378 C CD1 . ILE B 20  ? 1.3090 1.0180 1.0883 -0.0622 -0.0876 -0.0383 146  ILE B CD1 
3379 N N   . ILE B 21  ? 1.5010 1.2229 1.3059 -0.0444 -0.0706 -0.0369 147  ILE B N   
3380 C CA  . ILE B 21  ? 1.5412 1.2666 1.3537 -0.0415 -0.0660 -0.0365 147  ILE B CA  
3381 C C   . ILE B 21  ? 1.5253 1.2484 1.3389 -0.0447 -0.0678 -0.0351 147  ILE B C   
3382 O O   . ILE B 21  ? 1.8676 1.5911 1.6845 -0.0460 -0.0661 -0.0346 147  ILE B O   
3383 C CB  . ILE B 21  ? 1.5478 1.2796 1.3676 -0.0339 -0.0608 -0.0372 147  ILE B CB  
3384 C CG1 . ILE B 21  ? 1.8456 1.5773 1.6650 -0.0314 -0.0619 -0.0369 147  ILE B CG1 
3385 C CG2 . ILE B 21  ? 1.4805 1.2156 1.3010 -0.0316 -0.0587 -0.0385 147  ILE B CG2 
3386 C CD1 . ILE B 21  ? 2.1809 1.9134 2.0059 -0.0296 -0.0608 -0.0357 147  ILE B CD1 
3387 N N   . TYR B 22  ? 1.3227 1.0430 1.1332 -0.0468 -0.0718 -0.0342 148  TYR B N   
3388 C CA  . TYR B 22  ? 1.1807 0.8991 0.9933 -0.0503 -0.0741 -0.0325 148  TYR B CA  
3389 C C   . TYR B 22  ? 1.1795 0.8953 0.9886 -0.0584 -0.0773 -0.0315 148  TYR B C   
3390 O O   . TYR B 22  ? 1.1615 0.8775 0.9746 -0.0602 -0.0761 -0.0307 148  TYR B O   
3391 C CB  . TYR B 22  ? 1.1538 0.8702 0.9639 -0.0516 -0.0786 -0.0316 148  TYR B CB  
3392 C CG  . TYR B 22  ? 1.2172 0.9325 1.0313 -0.0546 -0.0814 -0.0295 148  TYR B CG  
3393 C CD1 . TYR B 22  ? 1.3012 1.0182 1.1235 -0.0487 -0.0784 -0.0291 148  TYR B CD1 
3394 C CD2 . TYR B 22  ? 1.1489 0.8625 0.9599 -0.0634 -0.0873 -0.0277 148  TYR B CD2 
3395 C CE1 . TYR B 22  ? 1.2864 1.0023 1.1139 -0.0512 -0.0813 -0.0270 148  TYR B CE1 
3396 C CE2 . TYR B 22  ? 1.1258 0.8395 0.9423 -0.0668 -0.0903 -0.0254 148  TYR B CE2 
3397 C CZ  . TYR B 22  ? 1.1963 0.9106 1.0211 -0.0605 -0.0874 -0.0251 148  TYR B CZ  
3398 O OH  . TYR B 22  ? 1.2700 0.9923 1.1055 -0.0618 -0.0887 -0.0213 148  TYR B OH  
3399 N N   . THR B 23  ? 1.1401 0.8538 0.9421 -0.0633 -0.0813 -0.0314 149  THR B N   
3400 C CA  . THR B 23  ? 1.1101 0.8220 0.9089 -0.0716 -0.0850 -0.0300 149  THR B CA  
3401 C C   . THR B 23  ? 1.1622 0.8744 0.9625 -0.0714 -0.0816 -0.0304 149  THR B C   
3402 O O   . THR B 23  ? 1.0769 0.7886 0.8777 -0.0770 -0.0828 -0.0289 149  THR B O   
3403 C CB  . THR B 23  ? 1.1590 0.8689 0.9503 -0.0766 -0.0903 -0.0297 149  THR B CB  
3404 O OG1 . THR B 23  ? 1.3780 1.0876 1.1668 -0.0717 -0.0883 -0.0318 149  THR B OG1 
3405 C CG2 . THR B 23  ? 1.1701 0.8801 0.9599 -0.0794 -0.0950 -0.0285 149  THR B CG2 
3406 N N   . VAL B 24  ? 1.1738 0.8876 0.9755 -0.0653 -0.0774 -0.0322 150  VAL B N   
3407 C CA  . VAL B 24  ? 1.2417 0.9561 1.0451 -0.0654 -0.0745 -0.0324 150  VAL B CA  
3408 C C   . VAL B 24  ? 1.3884 1.1055 1.1990 -0.0623 -0.0702 -0.0324 150  VAL B C   
3409 O O   . VAL B 24  ? 1.5184 1.2352 1.3300 -0.0648 -0.0690 -0.0319 150  VAL B O   
3410 C CB  . VAL B 24  ? 1.1443 0.8604 0.9478 -0.0607 -0.0720 -0.0341 150  VAL B CB  
3411 C CG1 . VAL B 24  ? 1.2578 0.9710 1.0545 -0.0636 -0.0764 -0.0344 150  VAL B CG1 
3412 C CG2 . VAL B 24  ? 1.2455 0.9665 1.0552 -0.0525 -0.0671 -0.0354 150  VAL B CG2 
3413 N N   . GLY B 25  ? 1.3218 1.0412 1.1374 -0.0569 -0.0678 -0.0328 151  GLY B N   
3414 C CA  . GLY B 25  ? 1.1460 0.8675 0.9688 -0.0542 -0.0642 -0.0327 151  GLY B CA  
3415 C C   . GLY B 25  ? 1.0950 0.8136 0.9170 -0.0614 -0.0674 -0.0311 151  GLY B C   
3416 O O   . GLY B 25  ? 0.8705 0.5893 0.6951 -0.0628 -0.0653 -0.0309 151  GLY B O   
3417 N N   . TYR B 26  ? 1.0611 0.7774 0.8795 -0.0667 -0.0729 -0.0296 152  TYR B N   
3418 C CA  . TYR B 26  ? 1.0366 0.7519 0.8556 -0.0748 -0.0764 -0.0275 152  TYR B CA  
3419 C C   . TYR B 26  ? 0.9691 0.6835 0.7833 -0.0823 -0.0784 -0.0265 152  TYR B C   
3420 O O   . TYR B 26  ? 0.7958 0.5108 0.6121 -0.0879 -0.0790 -0.0250 152  TYR B O   
3421 C CB  . TYR B 26  ? 1.0449 0.7598 0.8628 -0.0792 -0.0821 -0.0257 152  TYR B CB  
3422 C CG  . TYR B 26  ? 1.0815 0.7972 0.9067 -0.0744 -0.0812 -0.0255 152  TYR B CG  
3423 C CD1 . TYR B 26  ? 1.0318 0.7484 0.8642 -0.0767 -0.0814 -0.0240 152  TYR B CD1 
3424 C CD2 . TYR B 26  ? 1.1005 0.8161 0.9259 -0.0674 -0.0802 -0.0265 152  TYR B CD2 
3425 C CE1 . TYR B 26  ? 0.8402 0.5643 0.6837 -0.0696 -0.0790 -0.0225 152  TYR B CE1 
3426 C CE2 . TYR B 26  ? 0.8889 0.6050 0.7214 -0.0627 -0.0797 -0.0259 152  TYR B CE2 
3427 C CZ  . TYR B 26  ? 0.7886 0.5071 0.6297 -0.0639 -0.0795 -0.0241 152  TYR B CZ  
3428 O OH  . TYR B 26  ? 1.0203 0.7485 0.8738 -0.0563 -0.0770 -0.0220 152  TYR B OH  
3429 N N   . ALA B 27  ? 0.9832 0.6963 0.7915 -0.0825 -0.0793 -0.0271 153  ALA B N   
3430 C CA  . ALA B 27  ? 0.9820 0.6939 0.7861 -0.0890 -0.0811 -0.0259 153  ALA B CA  
3431 C C   . ALA B 27  ? 1.0315 0.7441 0.8389 -0.0866 -0.0763 -0.0266 153  ALA B C   
3432 O O   . ALA B 27  ? 0.8477 0.5603 0.6549 -0.0931 -0.0772 -0.0250 153  ALA B O   
3433 C CB  . ALA B 27  ? 0.8194 0.5294 0.6174 -0.0888 -0.0832 -0.0266 153  ALA B CB  
3434 N N   . LEU B 28  ? 1.0382 0.7522 0.8488 -0.0779 -0.0712 -0.0289 154  LEU B N   
3435 C CA  . LEU B 28  ? 1.0091 0.7245 0.8234 -0.0751 -0.0666 -0.0296 154  LEU B CA  
3436 C C   . LEU B 28  ? 1.0906 0.8068 0.9098 -0.0766 -0.0651 -0.0291 154  LEU B C   
3437 O O   . LEU B 28  ? 1.2012 0.9170 1.0205 -0.0803 -0.0640 -0.0285 154  LEU B O   
3438 C CB  . LEU B 28  ? 0.8770 0.5960 0.6960 -0.0655 -0.0616 -0.0318 154  LEU B CB  
3439 C CG  . LEU B 28  ? 0.9933 0.7128 0.8098 -0.0639 -0.0611 -0.0324 154  LEU B CG  
3440 C CD1 . LEU B 28  ? 1.0876 0.8033 0.8966 -0.0689 -0.0664 -0.0316 154  LEU B CD1 
3441 C CD2 . LEU B 28  ? 0.9763 0.7012 0.7988 -0.0551 -0.0567 -0.0342 154  LEU B CD2 
3442 N N   . SER B 29  ? 1.0273 0.7442 0.8504 -0.0743 -0.0653 -0.0292 155  SER B N   
3443 C CA  . SER B 29  ? 0.9911 0.7085 0.8198 -0.0752 -0.0640 -0.0287 155  SER B CA  
3444 C C   . SER B 29  ? 0.9302 0.6468 0.7565 -0.0865 -0.0684 -0.0262 155  SER B C   
3445 O O   . SER B 29  ? 0.7401 0.4573 0.5689 -0.0896 -0.0667 -0.0258 155  SER B O   
3446 C CB  . SER B 29  ? 0.9443 0.6624 0.7781 -0.0704 -0.0642 -0.0290 155  SER B CB  
3447 O OG  . SER B 29  ? 0.9709 0.6915 0.8084 -0.0603 -0.0597 -0.0310 155  SER B OG  
3448 N N   . PHE B 30  ? 1.0025 0.7191 0.8245 -0.0933 -0.0741 -0.0242 156  PHE B N   
3449 C CA  . PHE B 30  ? 1.0196 0.7383 0.8407 -0.1049 -0.0787 -0.0210 156  PHE B CA  
3450 C C   . PHE B 30  ? 0.9655 0.6839 0.7831 -0.1093 -0.0775 -0.0204 156  PHE B C   
3451 O O   . PHE B 30  ? 0.8511 0.5723 0.6714 -0.1157 -0.0773 -0.0188 156  PHE B O   
3452 C CB  . PHE B 30  ? 1.1081 0.8278 0.9251 -0.1106 -0.0849 -0.0190 156  PHE B CB  
3453 C CG  . PHE B 30  ? 1.1153 0.8401 0.9329 -0.1230 -0.0899 -0.0151 156  PHE B CG  
3454 C CD1 . PHE B 30  ? 1.0626 0.8045 0.8927 -0.1231 -0.0894 -0.0111 156  PHE B CD1 
3455 C CD2 . PHE B 30  ? 1.0220 0.7468 0.8341 -0.1291 -0.0917 -0.0136 156  PHE B CD2 
3456 C CE1 . PHE B 30  ? 1.0724 0.8276 0.9076 -0.1311 -0.0917 -0.0063 156  PHE B CE1 
3457 C CE2 . PHE B 30  ? 1.0526 0.7840 0.8662 -0.1405 -0.0962 -0.0095 156  PHE B CE2 
3458 C CZ  . PHE B 30  ? 1.0437 0.7925 0.8698 -0.1405 -0.0954 -0.0056 156  PHE B CZ  
3459 N N   . SER B 31  ? 1.0045 0.7203 0.8165 -0.1064 -0.0770 -0.0215 157  SER B N   
3460 C CA  . SER B 31  ? 1.0811 0.7961 0.8895 -0.1106 -0.0767 -0.0206 157  SER B CA  
3461 C C   . SER B 31  ? 1.1390 0.8544 0.9513 -0.1075 -0.0713 -0.0219 157  SER B C   
3462 O O   . SER B 31  ? 1.2223 0.9391 1.0342 -0.1145 -0.0714 -0.0201 157  SER B O   
3463 C CB  . SER B 31  ? 0.9918 0.7038 0.7948 -0.1070 -0.0771 -0.0216 157  SER B CB  
3464 O OG  . SER B 31  ? 1.0639 0.7751 0.8629 -0.1100 -0.0822 -0.0206 157  SER B OG  
3465 N N   . ALA B 32  ? 0.9795 0.6947 0.7962 -0.0971 -0.0664 -0.0248 158  ALA B N   
3466 C CA  . ALA B 32  ? 1.0098 0.7255 0.8304 -0.0931 -0.0611 -0.0263 158  ALA B CA  
3467 C C   . ALA B 32  ? 1.0479 0.7649 0.8726 -0.0982 -0.0608 -0.0254 158  ALA B C   
3468 O O   . ALA B 32  ? 1.1616 0.8791 0.9866 -0.1014 -0.0586 -0.0253 158  ALA B O   
3469 C CB  . ALA B 32  ? 1.0642 0.7813 0.8900 -0.0811 -0.0562 -0.0292 158  ALA B CB  
3470 N N   . LEU B 33  ? 1.0376 0.7558 0.8658 -0.0995 -0.0632 -0.0247 159  LEU B N   
3471 C CA  . LEU B 33  ? 1.0654 0.7946 0.9036 -0.1011 -0.0613 -0.0227 159  LEU B CA  
3472 C C   . LEU B 33  ? 1.0776 0.8189 0.9179 -0.1111 -0.0632 -0.0182 159  LEU B C   
3473 O O   . LEU B 33  ? 0.9788 0.7336 0.8277 -0.1111 -0.0590 -0.0165 159  LEU B O   
3474 C CB  . LEU B 33  ? 1.0168 0.7565 0.8654 -0.0952 -0.0612 -0.0213 159  LEU B CB  
3475 C CG  . LEU B 33  ? 1.0432 0.7745 0.8927 -0.0844 -0.0584 -0.0251 159  LEU B CG  
3476 C CD1 . LEU B 33  ? 1.0640 0.8007 0.9190 -0.0808 -0.0606 -0.0237 159  LEU B CD1 
3477 C CD2 . LEU B 33  ? 1.0267 0.7655 0.8864 -0.0770 -0.0519 -0.0263 159  LEU B CD2 
3478 N N   . VAL B 34  ? 1.0929 0.8292 0.9250 -0.1197 -0.0693 -0.0164 160  VAL B N   
3479 C CA  . VAL B 34  ? 1.1462 0.8931 0.9796 -0.1297 -0.0715 -0.0120 160  VAL B CA  
3480 C C   . VAL B 34  ? 1.1303 0.8705 0.9572 -0.1339 -0.0699 -0.0128 160  VAL B C   
3481 O O   . VAL B 34  ? 1.0213 0.7756 0.8547 -0.1376 -0.0674 -0.0097 160  VAL B O   
3482 C CB  . VAL B 34  ? 1.1726 0.9150 0.9987 -0.1379 -0.0790 -0.0099 160  VAL B CB  
3483 C CG1 . VAL B 34  ? 1.0860 0.8379 0.9126 -0.1488 -0.0816 -0.0052 160  VAL B CG1 
3484 C CG2 . VAL B 34  ? 1.1438 0.8954 0.9775 -0.1342 -0.0803 -0.0085 160  VAL B CG2 
3485 N N   . ILE B 35  ? 1.1307 0.8549 0.9476 -0.1306 -0.0700 -0.0164 161  ILE B N   
3486 C CA  . ILE B 35  ? 1.0605 0.7830 0.8738 -0.1313 -0.0673 -0.0166 161  ILE B CA  
3487 C C   . ILE B 35  ? 1.0714 0.7951 0.8894 -0.1298 -0.0621 -0.0183 161  ILE B C   
3488 O O   . ILE B 35  ? 0.9419 0.6729 0.7614 -0.1348 -0.0602 -0.0163 161  ILE B O   
3489 C CB  . ILE B 35  ? 1.1499 0.8670 0.9591 -0.1221 -0.0659 -0.0189 161  ILE B CB  
3490 C CG1 . ILE B 35  ? 1.1750 0.8907 0.9783 -0.1260 -0.0713 -0.0169 161  ILE B CG1 
3491 C CG2 . ILE B 35  ? 1.0979 0.8135 0.9056 -0.1203 -0.0621 -0.0198 161  ILE B CG2 
3492 C CD1 . ILE B 35  ? 1.0960 0.8078 0.8965 -0.1174 -0.0702 -0.0191 161  ILE B CD1 
3493 N N   . ALA B 36  ? 1.0552 0.7788 0.8791 -0.1194 -0.0582 -0.0214 162  ALA B N   
3494 C CA  . ALA B 36  ? 0.9572 0.6897 0.7902 -0.1122 -0.0512 -0.0227 162  ALA B CA  
3495 C C   . ALA B 36  ? 0.9056 0.6629 0.7526 -0.1138 -0.0484 -0.0186 162  ALA B C   
3496 O O   . ALA B 36  ? 0.8476 0.6139 0.6991 -0.1138 -0.0440 -0.0182 162  ALA B O   
3497 C CB  . ALA B 36  ? 1.0939 0.8214 0.9309 -0.1005 -0.0483 -0.0265 162  ALA B CB  
3498 N N   . SER B 37  ? 0.9118 0.6810 0.7663 -0.1149 -0.0508 -0.0155 163  SER B N   
3499 C CA  . SER B 37  ? 0.9332 0.7261 0.8010 -0.1170 -0.0486 -0.0114 163  SER B CA  
3500 C C   . SER B 37  ? 1.0156 0.8134 0.8792 -0.1282 -0.0503 -0.0079 163  SER B C   
3501 O O   . SER B 37  ? 1.0888 0.9035 0.9612 -0.1292 -0.0465 -0.0060 163  SER B O   
3502 C CB  . SER B 37  ? 0.9358 0.7390 0.8114 -0.1167 -0.0516 -0.0087 163  SER B CB  
3503 O OG  . SER B 37  ? 1.1376 0.9286 1.0024 -0.1231 -0.0582 -0.0077 163  SER B OG  
3504 N N   . ALA B 38  ? 1.0308 0.8141 0.8812 -0.1365 -0.0562 -0.0072 164  ALA B N   
3505 C CA  . ALA B 38  ? 1.1362 0.9221 0.9815 -0.1475 -0.0584 -0.0037 164  ALA B CA  
3506 C C   . ALA B 38  ? 1.0996 0.8829 0.9422 -0.1468 -0.0538 -0.0055 164  ALA B C   
3507 O O   . ALA B 38  ? 1.0275 0.8230 0.8729 -0.1531 -0.0525 -0.0023 164  ALA B O   
3508 C CB  . ALA B 38  ? 1.0502 0.8187 0.8814 -0.1558 -0.0660 -0.0032 164  ALA B CB  
3509 N N   . ILE B 39  ? 0.9154 0.6831 0.7525 -0.1394 -0.0515 -0.0106 165  ILE B N   
3510 C CA  . ILE B 39  ? 0.9125 0.6776 0.7472 -0.1380 -0.0470 -0.0125 165  ILE B CA  
3511 C C   . ILE B 39  ? 0.9808 0.7676 0.8303 -0.1323 -0.0401 -0.0121 165  ILE B C   
3512 O O   . ILE B 39  ? 1.0060 0.8032 0.8576 -0.1363 -0.0373 -0.0104 165  ILE B O   
3513 C CB  . ILE B 39  ? 0.8879 0.6311 0.7137 -0.1310 -0.0462 -0.0181 165  ILE B CB  
3514 C CG1 . ILE B 39  ? 1.0054 0.7287 0.8168 -0.1365 -0.0528 -0.0186 165  ILE B CG1 
3515 C CG2 . ILE B 39  ? 0.8896 0.6318 0.7147 -0.1282 -0.0409 -0.0202 165  ILE B CG2 
3516 C CD1 . ILE B 39  ? 1.0158 0.7334 0.8273 -0.1225 -0.0501 -0.0223 165  ILE B CD1 
3517 N N   . LEU B 40  ? 0.8878 0.6820 0.7479 -0.1228 -0.0375 -0.0138 166  LEU B N   
3518 C CA  . LEU B 40  ? 0.9349 0.7493 0.8097 -0.1163 -0.0312 -0.0140 166  LEU B CA  
3519 C C   . LEU B 40  ? 1.0525 0.8894 0.9358 -0.1237 -0.0311 -0.0090 166  LEU B C   
3520 O O   . LEU B 40  ? 1.3087 1.1611 1.2000 -0.1224 -0.0261 -0.0088 166  LEU B O   
3521 C CB  . LEU B 40  ? 0.9345 0.7524 0.8195 -0.1056 -0.0296 -0.0161 166  LEU B CB  
3522 C CG  . LEU B 40  ? 0.7937 0.5933 0.6737 -0.0963 -0.0284 -0.0213 166  LEU B CG  
3523 C CD1 . LEU B 40  ? 0.7906 0.5988 0.6836 -0.0860 -0.0263 -0.0225 166  LEU B CD1 
3524 C CD2 . LEU B 40  ? 0.7899 0.5821 0.6653 -0.0934 -0.0240 -0.0247 166  LEU B CD2 
3525 N N   . LEU B 41  ? 1.1742 1.0133 1.0557 -0.1316 -0.0365 -0.0049 167  LEU B N   
3526 C CA  . LEU B 41  ? 1.2011 1.0616 1.0907 -0.1390 -0.0367 0.0002  167  LEU B CA  
3527 C C   . LEU B 41  ? 1.1667 1.0259 1.0476 -0.1497 -0.0380 0.0029  167  LEU B C   
3528 O O   . LEU B 41  ? 0.9839 0.8620 0.8719 -0.1536 -0.0353 0.0058  167  LEU B O   
3529 C CB  . LEU B 41  ? 1.0998 0.9643 0.9918 -0.1430 -0.0422 0.0037  167  LEU B CB  
3530 C CG  . LEU B 41  ? 1.0482 0.9208 0.9522 -0.1338 -0.0410 0.0026  167  LEU B CG  
3531 C CD1 . LEU B 41  ? 0.9787 0.8516 0.8821 -0.1389 -0.0471 0.0060  167  LEU B CD1 
3532 C CD2 . LEU B 41  ? 1.0358 0.9327 0.9566 -0.1289 -0.0353 0.0031  167  LEU B CD2 
3533 N N   . GLY B 42  ? 1.1051 0.9426 0.9707 -0.1546 -0.0423 0.0021  168  GLY B N   
3534 C CA  . GLY B 42  ? 0.9740 0.8079 0.8303 -0.1657 -0.0448 0.0051  168  GLY B CA  
3535 C C   . GLY B 42  ? 1.0107 0.8513 0.8681 -0.1651 -0.0391 0.0043  168  GLY B C   
3536 O O   . GLY B 42  ? 1.0123 0.8682 0.8728 -0.1726 -0.0383 0.0084  168  GLY B O   
3537 N N   . PHE B 43  ? 1.1028 0.9324 0.9577 -0.1564 -0.0352 -0.0009 169  PHE B N   
3538 C CA  . PHE B 43  ? 0.9703 0.8053 0.8258 -0.1550 -0.0297 -0.0023 169  PHE B CA  
3539 C C   . PHE B 43  ? 1.1980 1.0583 1.0700 -0.1486 -0.0232 -0.0025 169  PHE B C   
3540 O O   . PHE B 43  ? 1.3105 1.1748 1.1917 -0.1389 -0.0209 -0.0052 169  PHE B O   
3541 C CB  . PHE B 43  ? 0.9054 0.7195 0.7527 -0.1477 -0.0280 -0.0079 169  PHE B CB  
3542 C CG  . PHE B 43  ? 1.0381 0.8269 0.8695 -0.1532 -0.0342 -0.0083 169  PHE B CG  
3543 C CD1 . PHE B 43  ? 1.0120 0.7938 0.8330 -0.1631 -0.0369 -0.0059 169  PHE B CD1 
3544 C CD2 . PHE B 43  ? 1.2045 0.9766 1.0313 -0.1485 -0.0375 -0.0113 169  PHE B CD2 
3545 C CE1 . PHE B 43  ? 1.0427 0.8010 0.8496 -0.1680 -0.0430 -0.0066 169  PHE B CE1 
3546 C CE2 . PHE B 43  ? 1.3562 1.1054 1.1686 -0.1531 -0.0433 -0.0122 169  PHE B CE2 
3547 C CZ  . PHE B 43  ? 1.1504 0.8924 0.9530 -0.1628 -0.0462 -0.0100 169  PHE B CZ  
3548 N N   . ARG B 44  ? 1.2264 1.1037 1.1021 -0.1542 -0.0203 0.0004  170  ARG B N   
3549 C CA  . ARG B 44  ? 1.2077 1.1108 1.0992 -0.1491 -0.0145 0.0003  170  ARG B CA  
3550 C C   . ARG B 44  ? 1.1287 1.0314 1.0252 -0.1368 -0.0081 -0.0057 170  ARG B C   
3551 O O   . ARG B 44  ? 0.9645 0.8832 0.8751 -0.1286 -0.0041 -0.0075 170  ARG B O   
3552 C CB  . ARG B 44  ? 1.0682 0.9896 0.9614 -0.1588 -0.0132 0.0049  170  ARG B CB  
3553 N N   . HIS B 45  ? 1.0629 0.9473 0.9485 -0.1352 -0.0073 -0.0089 171  HIS B N   
3554 C CA  . HIS B 45  ? 1.1288 1.0122 1.0186 -0.1239 -0.0014 -0.0146 171  HIS B CA  
3555 C C   . HIS B 45  ? 1.0188 0.8945 0.9141 -0.1125 -0.0012 -0.0185 171  HIS B C   
3556 O O   . HIS B 45  ? 1.0093 0.8879 0.9115 -0.1021 0.0038  -0.0230 171  HIS B O   
3557 C CB  . HIS B 45  ? 1.3373 1.2020 1.2133 -0.1257 -0.0010 -0.0167 171  HIS B CB  
3558 C CG  . HIS B 45  ? 1.4997 1.3733 1.3713 -0.1355 -0.0001 -0.0133 171  HIS B CG  
3559 N ND1 . HIS B 45  ? 1.5948 1.4661 1.4584 -0.1484 -0.0055 -0.0078 171  HIS B ND1 
3560 C CD2 . HIS B 45  ? 1.5425 1.4275 1.4166 -0.1345 0.0053  -0.0144 171  HIS B CD2 
3561 C CE1 . HIS B 45  ? 1.5851 1.4661 1.4465 -0.1551 -0.0034 -0.0054 171  HIS B CE1 
3562 N NE2 . HIS B 45  ? 1.6543 1.5441 1.5219 -0.1469 0.0033  -0.0094 171  HIS B NE2 
3563 N N   . LEU B 46  ? 0.8271 0.6933 0.7196 -0.1141 -0.0065 -0.0170 172  LEU B N   
3564 C CA  . LEU B 46  ? 0.7919 0.6507 0.6890 -0.1041 -0.0069 -0.0201 172  LEU B CA  
3565 C C   . LEU B 46  ? 0.8200 0.6996 0.7334 -0.1000 -0.0059 -0.0187 172  LEU B C   
3566 O O   . LEU B 46  ? 1.0280 0.9031 0.9460 -0.0930 -0.0071 -0.0203 172  LEU B O   
3567 C CB  . LEU B 46  ? 0.7715 0.6082 0.6564 -0.1077 -0.0132 -0.0196 172  LEU B CB  
3568 C CG  . LEU B 46  ? 0.9008 0.7147 0.7691 -0.1119 -0.0153 -0.0212 172  LEU B CG  
3569 C CD1 . LEU B 46  ? 0.9996 0.7941 0.8570 -0.1156 -0.0220 -0.0207 172  LEU B CD1 
3570 C CD2 . LEU B 46  ? 0.8314 0.6358 0.6987 -0.1022 -0.0106 -0.0266 172  LEU B CD2 
3571 N N   . HIS B 47  ? 0.7668 0.6693 0.6894 -0.1042 -0.0038 -0.0158 173  HIS B N   
3572 C CA  . HIS B 47  ? 0.7701 0.6935 0.7084 -0.1012 -0.0032 -0.0140 173  HIS B CA  
3573 C C   . HIS B 47  ? 0.7710 0.7063 0.7228 -0.0893 0.0029  -0.0185 173  HIS B C   
3574 O O   . HIS B 47  ? 1.0104 0.9644 0.9703 -0.0888 0.0073  -0.0188 173  HIS B O   
3575 C CB  . HIS B 47  ? 0.8295 0.7721 0.7714 -0.1115 -0.0040 -0.0088 173  HIS B CB  
3576 C CG  . HIS B 47  ? 0.9186 0.8525 0.8506 -0.1226 -0.0107 -0.0040 173  HIS B CG  
3577 N ND1 . HIS B 47  ? 1.0897 1.0286 1.0157 -0.1345 -0.0125 0.0004  173  HIS B ND1 
3578 C CD2 . HIS B 47  ? 1.1978 1.1190 1.1252 -0.1237 -0.0162 -0.0029 173  HIS B CD2 
3579 C CE1 . HIS B 47  ? 1.1216 1.0506 1.0398 -0.1423 -0.0190 0.0039  173  HIS B CE1 
3580 N NE2 . HIS B 47  ? 1.1190 1.0372 1.0377 -0.1359 -0.0212 0.0018  173  HIS B NE2 
3581 N N   . CYS B 48  ? 0.7654 0.6897 0.7194 -0.0794 0.0028  -0.0220 174  CYS B N   
3582 C CA  . CYS B 48  ? 0.6894 0.6229 0.6565 -0.0674 0.0076  -0.0263 174  CYS B CA  
3583 C C   . CYS B 48  ? 0.6892 0.6210 0.6646 -0.0601 0.0052  -0.0267 174  CYS B C   
3584 O O   . CYS B 48  ? 0.5629 0.4825 0.5314 -0.0636 0.0002  -0.0245 174  CYS B O   
3585 C CB  . CYS B 48  ? 0.7429 0.6623 0.7031 -0.0614 0.0112  -0.0314 174  CYS B CB  
3586 S SG  . CYS B 48  ? 1.1480 1.0347 1.0912 -0.0609 0.0073  -0.0330 174  CYS B SG  
3587 N N   . THR B 49  ? 0.7369 0.6815 0.7273 -0.0501 0.0086  -0.0295 175  THR B N   
3588 C CA  . THR B 49  ? 0.8739 0.8210 0.8749 -0.0433 0.0063  -0.0292 175  THR B CA  
3589 C C   . THR B 49  ? 0.7788 0.7020 0.7702 -0.0399 0.0032  -0.0306 175  THR B C   
3590 O O   . THR B 49  ? 0.7684 0.6883 0.7611 -0.0400 -0.0010 -0.0283 175  THR B O   
3591 C CB  . THR B 49  ? 1.0107 0.9736 1.0288 -0.0325 0.0106  -0.0328 175  THR B CB  
3592 O OG1 . THR B 49  ? 1.7195 1.6713 1.7341 -0.0250 0.0142  -0.0379 175  THR B OG1 
3593 C CG2 . THR B 49  ? 0.7386 0.7264 0.7666 -0.0357 0.0137  -0.0317 175  THR B CG2 
3594 N N   . ARG B 50  ? 0.7787 0.6853 0.7605 -0.0366 0.0053  -0.0343 176  ARG B N   
3595 C CA  . ARG B 50  ? 0.7761 0.6597 0.7479 -0.0336 0.0026  -0.0358 176  ARG B CA  
3596 C C   . ARG B 50  ? 0.8188 0.6917 0.7788 -0.0431 -0.0030 -0.0321 176  ARG B C   
3597 O O   . ARG B 50  ? 0.9262 0.7918 0.8857 -0.0413 -0.0067 -0.0311 176  ARG B O   
3598 C CB  . ARG B 50  ? 0.6419 0.5100 0.6039 -0.0306 0.0056  -0.0401 176  ARG B CB  
3599 C CG  . ARG B 50  ? 0.7084 0.5514 0.6570 -0.0296 0.0027  -0.0415 176  ARG B CG  
3600 C CD  . ARG B 50  ? 0.6274 0.4558 0.5675 -0.0260 0.0059  -0.0459 176  ARG B CD  
3601 N NE  . ARG B 50  ? 0.8134 0.6489 0.7506 -0.0311 0.0091  -0.0461 176  ARG B NE  
3602 C CZ  . ARG B 50  ? 0.7810 0.6077 0.7046 -0.0407 0.0075  -0.0445 176  ARG B CZ  
3603 N NH1 . ARG B 50  ? 0.7365 0.5466 0.6482 -0.0462 0.0025  -0.0429 176  ARG B NH1 
3604 N NH2 . ARG B 50  ? 0.6748 0.5095 0.5968 -0.0451 0.0105  -0.0444 176  ARG B NH2 
3605 N N   . ASN B 51  ? 0.9258 0.7985 0.8765 -0.0534 -0.0040 -0.0298 177  ASN B N   
3606 C CA  . ASN B 51  ? 0.9020 0.7637 0.8409 -0.0626 -0.0096 -0.0265 177  ASN B CA  
3607 C C   . ASN B 51  ? 0.8355 0.7112 0.7828 -0.0663 -0.0130 -0.0221 177  ASN B C   
3608 O O   . ASN B 51  ? 0.8320 0.6980 0.7723 -0.0704 -0.0181 -0.0201 177  ASN B O   
3609 C CB  . ASN B 51  ? 0.8349 0.6919 0.7617 -0.0728 -0.0100 -0.0252 177  ASN B CB  
3610 C CG  . ASN B 51  ? 0.8771 0.7149 0.7923 -0.0703 -0.0082 -0.0293 177  ASN B CG  
3611 O OD1 . ASN B 51  ? 0.8161 0.6406 0.7297 -0.0622 -0.0077 -0.0328 177  ASN B OD1 
3612 N ND2 . ASN B 51  ? 0.7977 0.6338 0.7048 -0.0774 -0.0073 -0.0286 177  ASN B ND2 
3613 N N   . TYR B 52  ? 0.8758 0.7743 0.8381 -0.0645 -0.0105 -0.0208 178  TYR B N   
3614 C CA  . TYR B 52  ? 0.9744 0.8864 0.9460 -0.0669 -0.0137 -0.0168 178  TYR B CA  
3615 C C   . TYR B 52  ? 1.0227 0.9284 0.9990 -0.0590 -0.0159 -0.0177 178  TYR B C   
3616 O O   . TYR B 52  ? 0.9920 0.8950 0.9662 -0.0627 -0.0207 -0.0147 178  TYR B O   
3617 C CB  . TYR B 52  ? 0.9608 0.8989 0.9484 -0.0658 -0.0103 -0.0157 178  TYR B CB  
3618 C CG  . TYR B 52  ? 1.1592 1.1073 1.1435 -0.0749 -0.0087 -0.0136 178  TYR B CG  
3619 C CD1 . TYR B 52  ? 1.1763 1.1188 1.1492 -0.0867 -0.0129 -0.0096 178  TYR B CD1 
3620 C CD2 . TYR B 52  ? 1.3185 1.2822 1.3114 -0.0719 -0.0032 -0.0156 178  TYR B CD2 
3621 C CE1 . TYR B 52  ? 1.1895 1.1415 1.1596 -0.0954 -0.0117 -0.0073 178  TYR B CE1 
3622 C CE2 . TYR B 52  ? 1.3286 1.3025 1.3186 -0.0804 -0.0017 -0.0134 178  TYR B CE2 
3623 C CZ  . TYR B 52  ? 1.3271 1.2950 1.3057 -0.0923 -0.0060 -0.0090 178  TYR B CZ  
3624 O OH  . TYR B 52  ? 1.4694 1.4475 1.4452 -0.1012 -0.0048 -0.0064 178  TYR B OH  
3625 N N   . ILE B 53  ? 0.8857 0.7888 0.8681 -0.0482 -0.0125 -0.0217 179  ILE B N   
3626 C CA  . ILE B 53  ? 0.8103 0.7056 0.7961 -0.0406 -0.0145 -0.0226 179  ILE B CA  
3627 C C   . ILE B 53  ? 0.8431 0.7160 0.8125 -0.0444 -0.0186 -0.0225 179  ILE B C   
3628 O O   . ILE B 53  ? 0.6502 0.5194 0.6194 -0.0443 -0.0227 -0.0206 179  ILE B O   
3629 C CB  . ILE B 53  ? 0.8416 0.7360 0.8353 -0.0288 -0.0102 -0.0272 179  ILE B CB  
3630 C CG1 . ILE B 53  ? 0.7682 0.6859 0.7792 -0.0248 -0.0066 -0.0275 179  ILE B CG1 
3631 C CG2 . ILE B 53  ? 0.8588 0.7434 0.8547 -0.0212 -0.0124 -0.0280 179  ILE B CG2 
3632 C CD1 . ILE B 53  ? 0.8829 0.8011 0.9018 -0.0137 -0.0022 -0.0324 179  ILE B CD1 
3633 N N   . HIS B 54  ? 0.7028 0.5609 0.6581 -0.0480 -0.0178 -0.0246 180  HIS B N   
3634 C CA  . HIS B 54  ? 0.6736 0.5107 0.6129 -0.0522 -0.0219 -0.0248 180  HIS B CA  
3635 C C   . HIS B 54  ? 0.7782 0.6180 0.7135 -0.0618 -0.0272 -0.0204 180  HIS B C   
3636 O O   . HIS B 54  ? 0.7952 0.6234 0.7233 -0.0628 -0.0314 -0.0199 180  HIS B O   
3637 C CB  . HIS B 54  ? 0.8215 0.6438 0.7470 -0.0555 -0.0203 -0.0275 180  HIS B CB  
3638 C CG  . HIS B 54  ? 0.8564 0.6711 0.7828 -0.0462 -0.0158 -0.0322 180  HIS B CG  
3639 N ND1 . HIS B 54  ? 0.8603 0.6843 0.8006 -0.0361 -0.0127 -0.0338 180  HIS B ND1 
3640 C CD2 . HIS B 54  ? 0.7552 0.5537 0.6705 -0.0456 -0.0142 -0.0356 180  HIS B CD2 
3641 C CE1 . HIS B 54  ? 0.9130 0.7269 0.8506 -0.0295 -0.0093 -0.0381 180  HIS B CE1 
3642 N NE2 . HIS B 54  ? 0.8432 0.6416 0.7657 -0.0351 -0.0100 -0.0392 180  HIS B NE2 
3643 N N   . LEU B 55  ? 0.7602 0.6150 0.6993 -0.0692 -0.0272 -0.0172 181  LEU B N   
3644 C CA  . LEU B 55  ? 0.7575 0.6149 0.6925 -0.0788 -0.0325 -0.0128 181  LEU B CA  
3645 C C   . LEU B 55  ? 0.8369 0.7021 0.7812 -0.0756 -0.0353 -0.0106 181  LEU B C   
3646 O O   . LEU B 55  ? 0.6678 0.5259 0.6053 -0.0803 -0.0404 -0.0086 181  LEU B O   
3647 C CB  . LEU B 55  ? 0.8589 0.7324 0.7976 -0.0868 -0.0316 -0.0096 181  LEU B CB  
3648 C CG  . LEU B 55  ? 0.8542 0.7190 0.7810 -0.0931 -0.0305 -0.0105 181  LEU B CG  
3649 C CD1 . LEU B 55  ? 0.7853 0.6699 0.7195 -0.0984 -0.0280 -0.0078 181  LEU B CD1 
3650 C CD2 . LEU B 55  ? 0.7023 0.5494 0.6129 -0.1018 -0.0363 -0.0093 181  LEU B CD2 
3651 N N   . ASN B 56  ? 0.8260 0.7058 0.7861 -0.0676 -0.0322 -0.0109 182  ASN B N   
3652 C CA  . ASN B 56  ? 0.7989 0.6857 0.7683 -0.0643 -0.0350 -0.0087 182  ASN B CA  
3653 C C   . ASN B 56  ? 0.7384 0.6071 0.7001 -0.0597 -0.0374 -0.0106 182  ASN B C   
3654 O O   . ASN B 56  ? 0.7731 0.6394 0.7324 -0.0623 -0.0420 -0.0082 182  ASN B O   
3655 C CB  . ASN B 56  ? 0.7486 0.6543 0.7370 -0.0563 -0.0315 -0.0089 182  ASN B CB  
3656 C CG  . ASN B 56  ? 0.8052 0.7320 0.8029 -0.0616 -0.0302 -0.0061 182  ASN B CG  
3657 O OD1 . ASN B 56  ? 0.7183 0.6598 0.7264 -0.0631 -0.0324 -0.0026 182  ASN B OD1 
3658 N ND2 . ASN B 56  ? 0.8802 0.8087 0.8742 -0.0646 -0.0267 -0.0075 182  ASN B ND2 
3659 N N   . LEU B 57  ? 0.6498 0.5052 0.6066 -0.0531 -0.0344 -0.0150 183  LEU B N   
3660 C CA  . LEU B 57  ? 0.6774 0.5153 0.6262 -0.0489 -0.0365 -0.0169 183  LEU B CA  
3661 C C   . LEU B 57  ? 0.7392 0.5623 0.6714 -0.0574 -0.0412 -0.0162 183  LEU B C   
3662 O O   . LEU B 57  ? 0.7633 0.5802 0.6918 -0.0574 -0.0452 -0.0153 183  LEU B O   
3663 C CB  . LEU B 57  ? 0.6460 0.4723 0.5920 -0.0411 -0.0323 -0.0217 183  LEU B CB  
3664 C CG  . LEU B 57  ? 0.5949 0.4037 0.5341 -0.0351 -0.0333 -0.0244 183  LEU B CG  
3665 C CD1 . LEU B 57  ? 0.5822 0.3992 0.5345 -0.0272 -0.0338 -0.0231 183  LEU B CD1 
3666 C CD2 . LEU B 57  ? 0.5690 0.3648 0.5022 -0.0302 -0.0294 -0.0290 183  LEU B CD2 
3667 N N   . PHE B 58  ? 0.7998 0.6177 0.7222 -0.0647 -0.0411 -0.0166 184  PHE B N   
3668 C CA  . PHE B 58  ? 0.7280 0.5326 0.6352 -0.0734 -0.0460 -0.0160 184  PHE B CA  
3669 C C   . PHE B 58  ? 0.7667 0.5805 0.6767 -0.0791 -0.0509 -0.0117 184  PHE B C   
3670 O O   . PHE B 58  ? 0.9006 0.7033 0.8010 -0.0822 -0.0555 -0.0116 184  PHE B O   
3671 C CB  . PHE B 58  ? 0.9084 0.7101 0.8076 -0.0811 -0.0454 -0.0161 184  PHE B CB  
3672 C CG  . PHE B 58  ? 1.0159 0.8065 0.9098 -0.0770 -0.0412 -0.0203 184  PHE B CG  
3673 C CD1 . PHE B 58  ? 1.0487 0.8271 0.9407 -0.0680 -0.0394 -0.0242 184  PHE B CD1 
3674 C CD2 . PHE B 58  ? 0.9568 0.7495 0.8475 -0.0823 -0.0393 -0.0201 184  PHE B CD2 
3675 C CE1 . PHE B 58  ? 1.0310 0.7993 0.9182 -0.0644 -0.0356 -0.0281 184  PHE B CE1 
3676 C CE2 . PHE B 58  ? 1.0248 0.8075 0.9105 -0.0788 -0.0355 -0.0239 184  PHE B CE2 
3677 C CZ  . PHE B 58  ? 1.1354 0.9057 1.0193 -0.0698 -0.0337 -0.0279 184  PHE B CZ  
3678 N N   . ALA B 59  ? 0.8545 0.6887 0.7774 -0.0809 -0.0500 -0.0081 185  ALA B N   
3679 C CA  . ALA B 59  ? 0.8960 0.7399 0.8223 -0.0867 -0.0547 -0.0037 185  ALA B CA  
3680 C C   . ALA B 59  ? 0.9272 0.7696 0.8570 -0.0811 -0.0570 -0.0034 185  ALA B C   
3681 O O   . ALA B 59  ? 0.9915 0.8307 0.9158 -0.0860 -0.0621 -0.0013 185  ALA B O   
3682 C CB  . ALA B 59  ? 0.7866 0.6535 0.7274 -0.0888 -0.0528 -0.0002 185  ALA B CB  
3683 N N   . SER B 60  ? 0.8523 0.6974 0.7916 -0.0710 -0.0535 -0.0052 186  SER B N   
3684 C CA  . SER B 60  ? 0.8725 0.7154 0.8145 -0.0659 -0.0560 -0.0046 186  SER B CA  
3685 C C   . SER B 60  ? 0.8940 0.7163 0.8196 -0.0673 -0.0591 -0.0070 186  SER B C   
3686 O O   . SER B 60  ? 0.8792 0.6997 0.8015 -0.0696 -0.0636 -0.0052 186  SER B O   
3687 C CB  . SER B 60  ? 0.8967 0.7450 0.8515 -0.0548 -0.0521 -0.0061 186  SER B CB  
3688 O OG  . SER B 60  ? 1.0983 0.9338 1.0476 -0.0494 -0.0483 -0.0107 186  SER B OG  
3689 N N   . PHE B 61  ? 0.8728 0.6796 0.7875 -0.0666 -0.0570 -0.0111 187  PHE B N   
3690 C CA  . PHE B 61  ? 0.8478 0.6350 0.7470 -0.0678 -0.0601 -0.0137 187  PHE B CA  
3691 C C   . PHE B 61  ? 0.8690 0.6520 0.7573 -0.0783 -0.0654 -0.0120 187  PHE B C   
3692 O O   . PHE B 61  ? 0.9859 0.7599 0.8658 -0.0798 -0.0696 -0.0125 187  PHE B O   
3693 C CB  . PHE B 61  ? 0.7506 0.5221 0.6413 -0.0641 -0.0567 -0.0186 187  PHE B CB  
3694 C CG  . PHE B 61  ? 0.6628 0.4314 0.5595 -0.0532 -0.0532 -0.0210 187  PHE B CG  
3695 C CD1 . PHE B 61  ? 0.7655 0.5230 0.6566 -0.0491 -0.0551 -0.0226 187  PHE B CD1 
3696 C CD2 . PHE B 61  ? 0.6781 0.4558 0.5864 -0.0471 -0.0482 -0.0216 187  PHE B CD2 
3697 C CE1 . PHE B 61  ? 0.6903 0.4454 0.5872 -0.0393 -0.0521 -0.0245 187  PHE B CE1 
3698 C CE2 . PHE B 61  ? 0.6510 0.4259 0.5652 -0.0371 -0.0453 -0.0238 187  PHE B CE2 
3699 C CZ  . PHE B 61  ? 0.5943 0.3578 0.5029 -0.0333 -0.0474 -0.0250 187  PHE B CZ  
3700 N N   . ILE B 62  ? 0.7332 0.5234 0.6220 -0.0857 -0.0656 -0.0100 188  ILE B N   
3701 C CA  . ILE B 62  ? 0.8480 0.6350 0.7273 -0.0961 -0.0710 -0.0081 188  ILE B CA  
3702 C C   . ILE B 62  ? 0.9090 0.7062 0.7936 -0.0983 -0.0752 -0.0043 188  ILE B C   
3703 O O   . ILE B 62  ? 0.8763 0.6652 0.7509 -0.1032 -0.0804 -0.0042 188  ILE B O   
3704 C CB  . ILE B 62  ? 0.9710 0.7654 0.8512 -0.1035 -0.0702 -0.0061 188  ILE B CB  
3705 C CG1 . ILE B 62  ? 0.8688 0.6505 0.7408 -0.1029 -0.0671 -0.0098 188  ILE B CG1 
3706 C CG2 . ILE B 62  ? 0.8353 0.6296 0.7085 -0.1144 -0.0762 -0.0031 188  ILE B CG2 
3707 C CD1 . ILE B 62  ? 0.9650 0.7545 0.8380 -0.1101 -0.0659 -0.0077 188  ILE B CD1 
3708 N N   . LEU B 63  ? 0.9209 0.7364 0.8214 -0.0947 -0.0733 -0.0011 189  LEU B N   
3709 C CA  . LEU B 63  ? 0.9427 0.7686 0.8493 -0.0963 -0.0772 0.0027  189  LEU B CA  
3710 C C   . LEU B 63  ? 0.9226 0.7385 0.8242 -0.0913 -0.0793 0.0010  189  LEU B C   
3711 O O   . LEU B 63  ? 1.1586 0.9740 1.0560 -0.0954 -0.0842 0.0029  189  LEU B O   
3712 C CB  . LEU B 63  ? 0.8787 0.7258 0.8040 -0.0927 -0.0744 0.0060  189  LEU B CB  
3713 C CG  . LEU B 63  ? 1.0715 0.9350 1.0039 -0.1002 -0.0754 0.0102  189  LEU B CG  
3714 C CD1 . LEU B 63  ? 1.0667 0.9282 0.9944 -0.1049 -0.0728 0.0091  189  LEU B CD1 
3715 C CD2 . LEU B 63  ? 1.0418 0.9257 0.9932 -0.0953 -0.0732 0.0131  189  LEU B CD2 
3716 N N   . ARG B 64  ? 0.8469 0.6554 0.7492 -0.0826 -0.0756 -0.0023 190  ARG B N   
3717 C CA  . ARG B 64  ? 0.9175 0.7151 0.8136 -0.0780 -0.0774 -0.0042 190  ARG B CA  
3718 C C   . ARG B 64  ? 0.9360 0.7174 0.8144 -0.0842 -0.0818 -0.0065 190  ARG B C   
3719 O O   . ARG B 64  ? 0.9359 0.7152 0.8097 -0.0858 -0.0861 -0.0058 190  ARG B O   
3720 C CB  . ARG B 64  ? 1.0914 0.8817 0.9895 -0.0684 -0.0726 -0.0079 190  ARG B CB  
3721 C CG  . ARG B 64  ? 0.9011 0.6818 0.7945 -0.0628 -0.0738 -0.0096 190  ARG B CG  
3722 C CD  . ARG B 64  ? 0.9497 0.7245 0.8465 -0.0534 -0.0690 -0.0127 190  ARG B CD  
3723 N NE  . ARG B 64  ? 1.1080 0.8744 1.0009 -0.0480 -0.0701 -0.0141 190  ARG B NE  
3724 C CZ  . ARG B 64  ? 1.1085 0.8709 1.0056 -0.0392 -0.0668 -0.0160 190  ARG B CZ  
3725 N NH1 . ARG B 64  ? 1.0948 0.8607 1.0002 -0.0345 -0.0621 -0.0171 190  ARG B NH1 
3726 N NH2 . ARG B 64  ? 1.0632 0.8186 0.9563 -0.0351 -0.0681 -0.0168 190  ARG B NH2 
3727 N N   . ALA B 65  ? 0.8866 0.6570 0.7552 -0.0880 -0.0811 -0.0094 191  ALA B N   
3728 C CA  . ALA B 65  ? 0.9192 0.6736 0.7711 -0.0940 -0.0856 -0.0119 191  ALA B CA  
3729 C C   . ALA B 65  ? 0.9288 0.6898 0.7789 -0.1029 -0.0913 -0.0084 191  ALA B C   
3730 O O   . ALA B 65  ? 1.0602 0.8122 0.8999 -0.1059 -0.0960 -0.0097 191  ALA B O   
3731 C CB  . ALA B 65  ? 0.9224 0.6650 0.7656 -0.0968 -0.0839 -0.0151 191  ALA B CB  
3732 N N   . LEU B 66  ? 0.8771 0.6537 0.7370 -0.1073 -0.0910 -0.0041 192  LEU B N   
3733 C CA  . LEU B 66  ? 1.0097 0.7936 0.8689 -0.1158 -0.0964 -0.0003 192  LEU B CA  
3734 C C   . LEU B 66  ? 1.1593 0.9485 1.0216 -0.1135 -0.0994 0.0015  192  LEU B C   
3735 O O   . LEU B 66  ? 1.1268 0.9124 0.9813 -0.1192 -0.1049 0.0021  192  LEU B O   
3736 C CB  . LEU B 66  ? 0.8566 0.6583 0.7277 -0.1198 -0.0949 0.0042  192  LEU B CB  
3737 N N   . CYS B 67  ? 0.9252 0.7232 0.7993 -0.1053 -0.0960 0.0025  193  CYS B N   
3738 C CA  . CYS B 67  ? 0.7842 0.5865 0.6610 -0.1027 -0.0988 0.0043  193  CYS B CA  
3739 C C   . CYS B 67  ? 0.8342 0.6194 0.6962 -0.1017 -0.1014 0.0002  193  CYS B C   
3740 O O   . CYS B 67  ? 0.9320 0.7172 0.7893 -0.1048 -0.1062 0.0013  193  CYS B O   
3741 C CB  . CYS B 67  ? 0.8567 0.6695 0.7483 -0.0935 -0.0946 0.0057  193  CYS B CB  
3742 S SG  . CYS B 67  ? 0.9407 0.7764 0.8517 -0.0940 -0.0924 0.0108  193  CYS B SG  
3743 N N   . VAL B 68  ? 0.9298 0.7005 0.7841 -0.0976 -0.0985 -0.0047 194  VAL B N   
3744 C CA  . VAL B 68  ? 1.0666 0.8210 0.9069 -0.0963 -0.1008 -0.0090 194  VAL B CA  
3745 C C   . VAL B 68  ? 1.1423 0.8888 0.9696 -0.1053 -0.1067 -0.0100 194  VAL B C   
3746 O O   . VAL B 68  ? 1.1699 0.9127 0.9900 -0.1067 -0.1109 -0.0108 194  VAL B O   
3747 C CB  . VAL B 68  ? 1.0027 0.7430 0.8376 -0.0903 -0.0965 -0.0141 194  VAL B CB  
3748 C CG1 . VAL B 68  ? 0.9658 0.6887 0.7853 -0.0898 -0.0991 -0.0190 194  VAL B CG1 
3749 C CG2 . VAL B 68  ? 1.1912 0.9387 1.0386 -0.0808 -0.0914 -0.0132 194  VAL B CG2 
3750 N N   . PHE B 69  ? 1.1074 0.8521 0.9319 -0.1118 -0.1073 -0.0098 195  PHE B N   
3751 C CA  . PHE B 69  ? 1.1922 0.9288 1.0046 -0.1207 -0.1132 -0.0108 195  PHE B CA  
3752 C C   . PHE B 69  ? 1.1479 0.8966 0.9641 -0.1260 -0.1180 -0.0063 195  PHE B C   
3753 O O   . PHE B 69  ? 1.0677 0.8093 0.8734 -0.1308 -0.1236 -0.0077 195  PHE B O   
3754 C CB  . PHE B 69  ? 1.2326 0.9657 1.0424 -0.1267 -0.1129 -0.0108 195  PHE B CB  
3755 C CG  . PHE B 69  ? 1.2404 0.9650 1.0476 -0.1202 -0.1071 -0.0145 195  PHE B CG  
3756 C CD1 . PHE B 69  ? 1.2313 0.9503 1.0332 -0.1116 -0.1038 -0.0178 195  PHE B CD1 
3757 C CD2 . PHE B 69  ? 1.1454 0.8714 0.9574 -0.1218 -0.1040 -0.0139 195  PHE B CD2 
3758 C CE1 . PHE B 69  ? 1.1917 0.9076 0.9941 -0.1046 -0.0977 -0.0203 195  PHE B CE1 
3759 C CE2 . PHE B 69  ? 1.1349 0.8565 0.9462 -0.1146 -0.0978 -0.0167 195  PHE B CE2 
3760 C CZ  . PHE B 69  ? 1.1583 0.8753 0.9651 -0.1060 -0.0948 -0.0198 195  PHE B CZ  
3761 N N   . PHE B 70  ? 1.0684 0.8353 0.8994 -0.1251 -0.1161 -0.0011 196  PHE B N   
3762 C CA  . PHE B 70  ? 1.0866 0.8658 0.9221 -0.1301 -0.1206 0.0034  196  PHE B CA  
3763 C C   . PHE B 70  ? 1.1612 0.9392 0.9940 -0.1263 -0.1230 0.0028  196  PHE B C   
3764 O O   . PHE B 70  ? 1.3607 1.1381 1.1871 -0.1316 -0.1286 0.0035  196  PHE B O   
3765 C CB  . PHE B 70  ? 0.9983 0.7974 0.8512 -0.1294 -0.1178 0.0089  196  PHE B CB  
3766 C CG  . PHE B 70  ? 1.3067 1.1189 1.1647 -0.1363 -0.1224 0.0140  196  PHE B CG  
3767 C CD1 . PHE B 70  ? 1.2355 1.0567 1.0992 -0.1343 -0.1246 0.0168  196  PHE B CD1 
3768 C CD2 . PHE B 70  ? 1.4897 1.3056 1.3470 -0.1450 -0.1248 0.0163  196  PHE B CD2 
3769 C CE1 . PHE B 70  ? 1.1867 1.0201 1.0552 -0.1406 -0.1290 0.0216  196  PHE B CE1 
3770 C CE2 . PHE B 70  ? 1.5037 1.3317 1.3658 -0.1514 -0.1291 0.0211  196  PHE B CE2 
3771 C CZ  . PHE B 70  ? 1.3400 1.1767 1.2078 -0.1491 -0.1312 0.0237  196  PHE B CZ  
3772 N N   . LYS B 71  ? 1.0771 0.8548 0.9145 -0.1174 -0.1189 0.0015  197  LYS B N   
3773 C CA  . LYS B 71  ? 1.0506 0.8267 0.8849 -0.1135 -0.1208 0.0008  197  LYS B CA  
3774 C C   . LYS B 71  ? 1.1438 0.9030 0.9603 -0.1163 -0.1246 -0.0043 197  LYS B C   
3775 O O   . LYS B 71  ? 1.2069 0.9665 1.0181 -0.1184 -0.1291 -0.0041 197  LYS B O   
3776 C CB  . LYS B 71  ? 1.0151 0.7919 0.8566 -0.1034 -0.1155 0.0000  197  LYS B CB  
3777 C CG  . LYS B 71  ? 1.0075 0.7826 0.8460 -0.0989 -0.1170 -0.0006 197  LYS B CG  
3778 C CD  . LYS B 71  ? 1.0726 0.8460 0.9171 -0.0891 -0.1117 -0.0019 197  LYS B CD  
3779 C CE  . LYS B 71  ? 1.0531 0.8294 0.8986 -0.0845 -0.1129 -0.0007 197  LYS B CE  
3780 N NZ  . LYS B 71  ? 0.9305 0.6914 0.7610 -0.0828 -0.1139 -0.0061 197  LYS B NZ  
3781 N N   . ASP B 72  ? 1.1356 0.8801 0.9429 -0.1163 -0.1232 -0.0091 198  ASP B N   
3782 C CA  . ASP B 72  ? 1.0934 0.8220 0.8846 -0.1183 -0.1268 -0.0144 198  ASP B CA  
3783 C C   . ASP B 72  ? 1.2556 0.9871 1.0422 -0.1260 -0.1316 -0.0126 198  ASP B C   
3784 O O   . ASP B 72  ? 1.5196 1.2498 1.2995 -0.1254 -0.1336 -0.0138 198  ASP B O   
3785 C CB  . ASP B 72  ? 1.2914 1.0133 1.0805 -0.1117 -0.1199 -0.0175 198  ASP B CB  
3786 C CG  . ASP B 72  ? 1.3910 1.1084 1.1719 -0.1082 -0.1187 -0.0203 198  ASP B CG  
3787 O OD1 . ASP B 72  ? 1.3387 1.0561 1.1152 -0.1075 -0.1213 -0.0210 198  ASP B OD1 
3788 O OD2 . ASP B 72  ? 1.4393 1.1536 1.2186 -0.1064 -0.1153 -0.0217 198  ASP B OD2 
3789 N N   . ALA B 73  ? 1.3085 1.0446 1.0990 -0.1334 -0.1333 -0.0097 199  ALA B N   
3790 C CA  . ALA B 73  ? 1.2454 0.9842 1.0320 -0.1407 -0.1377 -0.0077 199  ALA B CA  
3791 C C   . ALA B 73  ? 1.3224 1.0695 1.1104 -0.1460 -0.1441 -0.0047 199  ALA B C   
3792 O O   . ALA B 73  ? 1.5933 1.3410 1.3761 -0.1496 -0.1476 -0.0041 199  ALA B O   
3793 C CB  . ALA B 73  ? 1.2300 0.9725 1.0211 -0.1473 -0.1378 -0.0049 199  ALA B CB  
3794 N N   . ALA B 74  ? 1.4280 1.1889 1.2284 -0.1414 -0.1414 -0.0008 200  ALA B N   
3795 C CA  . ALA B 74  ? 1.3523 1.1249 1.1567 -0.1435 -0.1452 0.0031  200  ALA B CA  
3796 C C   . ALA B 74  ? 1.4805 1.2456 1.2748 -0.1409 -0.1480 -0.0004 200  ALA B C   
3797 O O   . ALA B 74  ? 1.6683 1.4407 1.4626 -0.1438 -0.1523 0.0021  200  ALA B O   
3798 C CB  . ALA B 74  ? 1.3984 1.1889 1.2205 -0.1390 -0.1413 0.0087  200  ALA B CB  
3799 N N   . LEU B 75  ? 1.5663 1.3175 1.3519 -0.1354 -0.1456 -0.0061 201  LEU B N   
3800 C CA  . LEU B 75  ? 1.7896 1.5344 1.5654 -0.1326 -0.1477 -0.0097 201  LEU B CA  
3801 C C   . LEU B 75  ? 1.9404 1.6841 1.7089 -0.1358 -0.1501 -0.0103 201  LEU B C   
3802 O O   . LEU B 75  ? 2.3380 2.0837 2.1022 -0.1355 -0.1529 -0.0108 201  LEU B O   
3803 C CB  . LEU B 75  ? 1.8741 1.6095 1.6467 -0.1230 -0.1411 -0.0143 201  LEU B CB  
3804 C CG  . LEU B 75  ? 1.9601 1.6956 1.7398 -0.1175 -0.1375 -0.0142 201  LEU B CG  
3805 C CD1 . LEU B 75  ? 2.0931 1.8191 1.8687 -0.1085 -0.1312 -0.0187 201  LEU B CD1 
3806 C CD2 . LEU B 75  ? 1.7295 1.4787 1.5181 -0.1138 -0.1373 -0.0098 201  LEU B CD2 
3807 N N   . LYS B 76  ? 1.8281 1.5689 1.5955 -0.1388 -0.1493 -0.0103 202  LYS B N   
3808 C CA  . LYS B 76  ? 1.6958 1.4356 1.4574 -0.1424 -0.1523 -0.0105 202  LYS B CA  
3809 C C   . LYS B 76  ? 1.5604 1.3104 1.3256 -0.1511 -0.1586 -0.0056 202  LYS B C   
3810 O O   . LYS B 76  ? 1.3090 1.0646 1.0806 -0.1569 -0.1599 -0.0020 202  LYS B O   
3811 C CB  . LYS B 76  ? 1.7600 1.4933 1.5194 -0.1427 -0.1497 -0.0118 202  LYS B CB  
3812 C CG  . LYS B 76  ? 1.8691 1.5990 1.6219 -0.1441 -0.1522 -0.0133 202  LYS B CG  
3813 C CD  . LYS B 76  ? 1.7998 1.5252 1.5513 -0.1465 -0.1515 -0.0132 202  LYS B CD  
3814 C CE  . LYS B 76  ? 1.6595 1.3812 1.4049 -0.1472 -0.1543 -0.0150 202  LYS B CE  
3815 N NZ  . LYS B 76  ? 1.7711 1.4873 1.5147 -0.1487 -0.1539 -0.0153 202  LYS B NZ  
3816 N N   . TRP B 77  ? 1.6528 1.4064 1.4147 -0.1519 -0.1622 -0.0054 203  TRP B N   
3817 C CA  . TRP B 77  ? 1.4844 1.2490 1.2500 -0.1594 -0.1683 -0.0006 203  TRP B CA  
3818 C C   . TRP B 77  ? 1.2560 1.0312 1.0319 -0.1616 -0.1699 0.0037  203  TRP B C   
3819 O O   . TRP B 77  ? 1.0033 0.7819 0.7817 -0.1566 -0.1687 0.0038  203  TRP B O   
3820 C CB  . TRP B 77  ? 1.5967 1.3624 1.3626 -0.1664 -0.1707 0.0017  203  TRP B CB  
3821 N N   . GLY B 83  ? 1.8115 1.6141 1.5595 -0.1566 -0.1870 0.0028  216  GLY B N   
3822 C CA  . GLY B 83  ? 1.7483 1.5627 1.5003 -0.1632 -0.1924 0.0083  216  GLY B CA  
3823 C C   . GLY B 83  ? 1.8370 1.6635 1.6009 -0.1666 -0.1951 0.0155  216  GLY B C   
3824 O O   . GLY B 83  ? 1.9066 1.7444 1.6749 -0.1671 -0.1980 0.0199  216  GLY B O   
3825 N N   . LEU B 84  ? 1.8994 1.7241 1.6691 -0.1690 -0.1943 0.0167  217  LEU B N   
3826 C CA  . LEU B 84  ? 1.8635 1.7021 1.6499 -0.1692 -0.1925 0.0239  217  LEU B CA  
3827 C C   . LEU B 84  ? 1.6980 1.5377 1.4932 -0.1605 -0.1854 0.0244  217  LEU B C   
3828 O O   . LEU B 84  ? 1.5396 1.3714 1.3276 -0.1549 -0.1831 0.0201  217  LEU B O   
3829 C CB  . LEU B 84  ? 1.6467 1.4854 1.4374 -0.1753 -0.1934 0.0257  217  LEU B CB  
3830 N N   . LEU B 85  ? 1.6676 1.5178 1.4785 -0.1593 -0.1821 0.0297  218  LEU B N   
3831 C CA  . LEU B 85  ? 1.8477 1.7025 1.6698 -0.1511 -0.1760 0.0315  218  LEU B CA  
3832 C C   . LEU B 85  ? 1.8387 1.6791 1.6547 -0.1459 -0.1710 0.0254  218  LEU B C   
3833 O O   . LEU B 85  ? 1.9882 1.8201 1.8003 -0.1486 -0.1703 0.0225  218  LEU B O   
3834 C CB  . LEU B 85  ? 1.5878 1.4569 1.4280 -0.1515 -0.1740 0.0380  218  LEU B CB  
3835 N N   . SER B 86  ? 1.7876 1.6254 1.6028 -0.1386 -0.1678 0.0238  219  SER B N   
3836 C CA  . SER B 86  ? 1.6745 1.5002 1.4862 -0.1325 -0.1626 0.0188  219  SER B CA  
3837 C C   . SER B 86  ? 1.7064 1.5369 1.5319 -0.1298 -0.1576 0.0214  219  SER B C   
3838 O O   . SER B 86  ? 1.5326 1.3776 1.3727 -0.1302 -0.1573 0.0275  219  SER B O   
3839 C CB  . SER B 86  ? 1.4677 1.2920 1.2775 -0.1253 -0.1605 0.0175  219  SER B CB  
3840 N N   . TYR B 87  ? 1.7861 1.6045 1.6071 -0.1270 -0.1536 0.0165  220  TYR B N   
3841 C CA  . TYR B 87  ? 1.4863 1.3080 1.3188 -0.1247 -0.1488 0.0182  220  TYR B CA  
3842 C C   . TYR B 87  ? 1.4711 1.3025 1.3180 -0.1169 -0.1446 0.0217  220  TYR B C   
3843 O O   . TYR B 87  ? 1.3613 1.2027 1.2222 -0.1159 -0.1420 0.0254  220  TYR B O   
3844 C CB  . TYR B 87  ? 1.3834 1.1889 1.2065 -0.1236 -0.1459 0.0119  220  TYR B CB  
3845 C CG  . TYR B 87  ? 1.4729 1.2812 1.3066 -0.1212 -0.1408 0.0130  220  TYR B CG  
3846 C CD1 . TYR B 87  ? 1.4659 1.2831 1.3073 -0.1267 -0.1415 0.0167  220  TYR B CD1 
3847 C CD2 . TYR B 87  ? 1.5093 1.3117 1.3453 -0.1134 -0.1352 0.0104  220  TYR B CD2 
3848 C CE1 . TYR B 87  ? 1.4540 1.2746 1.3050 -0.1245 -0.1367 0.0175  220  TYR B CE1 
3849 C CE2 . TYR B 87  ? 1.4663 1.2715 1.3117 -0.1111 -0.1305 0.0112  220  TYR B CE2 
3850 C CZ  . TYR B 87  ? 1.4695 1.2841 1.3224 -0.1166 -0.1312 0.0147  220  TYR B CZ  
3851 O OH  . TYR B 87  ? 1.3221 1.1404 1.1843 -0.1143 -0.1264 0.0153  220  TYR B OH  
3852 N N   . GLN B 88  ? 1.3910 1.2201 1.2351 -0.1114 -0.1439 0.0206  221  GLN B N   
3853 C CA  . GLN B 88  ? 1.3621 1.1998 1.2199 -0.1040 -0.1404 0.0241  221  GLN B CA  
3854 C C   . GLN B 88  ? 1.3527 1.2083 1.2246 -0.1057 -0.1429 0.0315  221  GLN B C   
3855 O O   . GLN B 88  ? 1.3786 1.2434 1.2653 -0.1006 -0.1401 0.0350  221  GLN B O   
3856 C CB  . GLN B 88  ? 1.4415 1.2726 1.2924 -0.0983 -0.1396 0.0216  221  GLN B CB  
3857 N N   . ASP B 89  ? 1.3857 1.2464 1.2537 -0.1128 -0.1483 0.0337  222  ASP B N   
3858 C CA  . ASP B 89  ? 1.3933 1.2709 1.2741 -0.1148 -0.1512 0.0407  222  ASP B CA  
3859 C C   . ASP B 89  ? 1.3333 1.2200 1.2246 -0.1191 -0.1512 0.0439  222  ASP B C   
3860 O O   . ASP B 89  ? 1.4080 1.3095 1.3138 -0.1190 -0.1522 0.0497  222  ASP B O   
3861 C CB  . ASP B 89  ? 1.3914 1.2709 1.2631 -0.1202 -0.1573 0.0418  222  ASP B CB  
3862 N N   . SER B 90  ? 1.5358 1.4143 1.4204 -0.1229 -0.1503 0.0403  223  SER B N   
3863 C CA  . SER B 90  ? 1.5028 1.3902 1.3964 -0.1277 -0.1505 0.0433  223  SER B CA  
3864 C C   . SER B 90  ? 1.4114 1.3077 1.3218 -0.1218 -0.1453 0.0455  223  SER B C   
3865 O O   . SER B 90  ? 1.3475 1.2403 1.2611 -0.1141 -0.1412 0.0438  223  SER B O   
3866 C CB  . SER B 90  ? 1.4873 1.3629 1.3689 -0.1332 -0.1508 0.0389  223  SER B CB  
3867 O OG  . SER B 90  ? 1.2842 1.1479 1.1615 -0.1281 -0.1458 0.0339  223  SER B OG  
3868 N N   . LEU B 91  ? 1.4555 1.3637 1.3769 -0.1255 -0.1456 0.0493  224  LEU B N   
3869 C CA  . LEU B 91  ? 1.6458 1.5632 1.5832 -0.1206 -0.1409 0.0510  224  LEU B CA  
3870 C C   . LEU B 91  ? 1.7299 1.6391 1.6635 -0.1206 -0.1365 0.0467  224  LEU B C   
3871 O O   . LEU B 91  ? 1.8921 1.8036 1.8350 -0.1143 -0.1314 0.0459  224  LEU B O   
3872 C CB  . LEU B 91  ? 1.6930 1.6286 1.6451 -0.1243 -0.1432 0.0571  224  LEU B CB  
3873 C CG  . LEU B 91  ? 1.6871 1.6354 1.6579 -0.1194 -0.1390 0.0593  224  LEU B CG  
3874 C CD1 . LEU B 91  ? 1.7582 1.7228 1.7445 -0.1179 -0.1416 0.0652  224  LEU B CD1 
3875 C CD2 . LEU B 91  ? 1.5671 1.5195 1.5403 -0.1246 -0.1375 0.0592  224  LEU B CD2 
3876 N N   . ALA B 92  ? 1.5554 1.4549 1.4755 -0.1275 -0.1386 0.0440  225  ALA B N   
3877 C CA  . ALA B 92  ? 1.3825 1.2728 1.2974 -0.1280 -0.1349 0.0400  225  ALA B CA  
3878 C C   . ALA B 92  ? 1.3040 1.1825 1.2146 -0.1199 -0.1303 0.0352  225  ALA B C   
3879 O O   . ALA B 92  ? 1.3379 1.2149 1.2528 -0.1164 -0.1253 0.0333  225  ALA B O   
3880 C CB  . ALA B 92  ? 1.6716 1.5513 1.5710 -0.1365 -0.1389 0.0377  225  ALA B CB  
3881 N N   . CYS B 93  ? 1.1607 1.0309 1.0629 -0.1168 -0.1318 0.0333  226  CYS B N   
3882 C CA  . CYS B 93  ? 1.2287 1.0878 1.1270 -0.1090 -0.1276 0.0290  226  CYS B CA  
3883 C C   . CYS B 93  ? 1.3238 1.1925 1.2385 -0.1010 -0.1231 0.0311  226  CYS B C   
3884 O O   . CYS B 93  ? 1.4269 1.2894 1.3425 -0.0957 -0.1182 0.0279  226  CYS B O   
3885 C CB  . CYS B 93  ? 1.1740 1.0252 1.0616 -0.1076 -0.1305 0.0272  226  CYS B CB  
3886 S SG  . CYS B 93  ? 1.1924 1.0313 1.0758 -0.0977 -0.1259 0.0226  226  CYS B SG  
3887 N N   . ARG B 94  ? 1.2737 1.1576 1.2016 -0.1000 -0.1249 0.0365  227  ARG B N   
3888 C CA  . ARG B 94  ? 1.2415 1.1350 1.1860 -0.0923 -0.1212 0.0386  227  ARG B CA  
3889 C C   . ARG B 94  ? 1.2521 1.1516 1.2058 -0.0922 -0.1172 0.0383  227  ARG B C   
3890 O O   . ARG B 94  ? 1.1796 1.0794 1.1411 -0.0852 -0.1126 0.0368  227  ARG B O   
3891 C CB  . ARG B 94  ? 1.2871 1.1954 1.2435 -0.0921 -0.1247 0.0445  227  ARG B CB  
3892 C CG  . ARG B 94  ? 1.2819 1.1852 1.2279 -0.0937 -0.1291 0.0451  227  ARG B CG  
3893 C CD  . ARG B 94  ? 1.1935 1.1115 1.1504 -0.0945 -0.1332 0.0513  227  ARG B CD  
3894 N NE  . ARG B 94  ? 1.3011 1.2150 1.2462 -0.0981 -0.1380 0.0518  227  ARG B NE  
3895 C CZ  . ARG B 94  ? 1.5161 1.4244 1.4562 -0.0938 -0.1382 0.0510  227  ARG B CZ  
3896 N NH1 . ARG B 94  ? 1.6184 1.5242 1.5645 -0.0856 -0.1342 0.0499  227  ARG B NH1 
3897 N NH2 . ARG B 94  ? 1.6208 1.5263 1.5498 -0.0976 -0.1426 0.0513  227  ARG B NH2 
3898 N N   . LEU B 95  ? 1.1340 1.0381 1.0864 -0.1000 -0.1190 0.0396  228  LEU B N   
3899 C CA  . LEU B 95  ? 1.1264 1.0360 1.0861 -0.1005 -0.1152 0.0391  228  LEU B CA  
3900 C C   . LEU B 95  ? 1.1982 1.0928 1.1477 -0.0984 -0.1110 0.0334  228  LEU B C   
3901 O O   . LEU B 95  ? 1.1034 1.0005 1.0606 -0.0936 -0.1061 0.0320  228  LEU B O   
3902 C CB  . LEU B 95  ? 1.1758 1.0934 1.1355 -0.1099 -0.1184 0.0420  228  LEU B CB  
3903 C CG  . LEU B 95  ? 1.1553 1.0904 1.1282 -0.1120 -0.1219 0.0480  228  LEU B CG  
3904 C CD1 . LEU B 95  ? 1.2382 1.1795 1.2096 -0.1217 -0.1249 0.0504  228  LEU B CD1 
3905 C CD2 . LEU B 95  ? 1.1711 1.1205 1.1635 -0.1049 -0.1184 0.0501  228  LEU B CD2 
3906 N N   . VAL B 96  ? 1.1921 1.0709 1.1240 -0.1020 -0.1131 0.0300  229  VAL B N   
3907 C CA  . VAL B 96  ? 1.1366 1.0002 1.0582 -0.1004 -0.1096 0.0245  229  VAL B CA  
3908 C C   . VAL B 96  ? 0.9711 0.8300 0.8965 -0.0904 -0.1053 0.0220  229  VAL B C   
3909 O O   . VAL B 96  ? 1.2543 1.1086 1.1807 -0.0866 -0.1006 0.0191  229  VAL B O   
3910 C CB  . VAL B 96  ? 1.2028 1.0505 1.1052 -0.1062 -0.1134 0.0212  229  VAL B CB  
3911 C CG1 . VAL B 96  ? 1.0577 0.8889 0.9495 -0.1039 -0.1101 0.0155  229  VAL B CG1 
3912 C CG2 . VAL B 96  ? 1.2668 1.1187 1.1659 -0.1163 -0.1177 0.0236  229  VAL B CG2 
3913 N N   . PHE B 97  ? 0.9522 0.8129 0.8804 -0.0860 -0.1069 0.0236  230  PHE B N   
3914 C CA  . PHE B 97  ? 1.0029 0.8598 0.9354 -0.0765 -0.1033 0.0218  230  PHE B CA  
3915 C C   . PHE B 97  ? 0.9588 0.8285 0.9094 -0.0709 -0.0994 0.0237  230  PHE B C   
3916 O O   . PHE B 97  ? 0.9439 0.8086 0.8970 -0.0642 -0.0949 0.0208  230  PHE B O   
3917 C CB  . PHE B 97  ? 0.9452 0.8022 0.8764 -0.0742 -0.1066 0.0237  230  PHE B CB  
3918 C CG  . PHE B 97  ? 0.9160 0.7686 0.8509 -0.0650 -0.1036 0.0223  230  PHE B CG  
3919 C CD1 . PHE B 97  ? 0.9668 0.8045 0.8927 -0.0611 -0.1000 0.0170  230  PHE B CD1 
3920 C CD2 . PHE B 97  ? 0.9842 0.8475 0.9317 -0.0603 -0.1046 0.0265  230  PHE B CD2 
3921 C CE1 . PHE B 97  ? 1.1077 0.9415 1.0371 -0.0526 -0.0974 0.0158  230  PHE B CE1 
3922 C CE2 . PHE B 97  ? 1.0511 0.9105 1.0023 -0.0519 -0.1022 0.0255  230  PHE B CE2 
3923 C CZ  . PHE B 97  ? 0.9927 0.8374 0.9348 -0.0481 -0.0986 0.0202  230  PHE B CZ  
3924 N N   . LEU B 98  ? 1.0339 0.9203 0.9972 -0.0735 -0.1012 0.0285  231  LEU B N   
3925 C CA  . LEU B 98  ? 0.9465 0.8460 0.9275 -0.0684 -0.0977 0.0300  231  LEU B CA  
3926 C C   . LEU B 98  ? 0.9272 0.8243 0.9070 -0.0692 -0.0932 0.0267  231  LEU B C   
3927 O O   . LEU B 98  ? 0.8792 0.7780 0.8674 -0.0623 -0.0887 0.0248  231  LEU B O   
3928 C CB  . LEU B 98  ? 0.9065 0.8243 0.9006 -0.0718 -0.1010 0.0356  231  LEU B CB  
3929 C CG  . LEU B 98  ? 0.8277 0.7610 0.8418 -0.0662 -0.0982 0.0375  231  LEU B CG  
3930 C CD1 . LEU B 98  ? 0.8224 0.7543 0.8442 -0.0565 -0.0968 0.0371  231  LEU B CD1 
3931 C CD2 . LEU B 98  ? 0.8496 0.8003 0.8754 -0.0705 -0.1018 0.0429  231  LEU B CD2 
3932 N N   . LEU B 99  ? 0.8738 0.7671 0.8434 -0.0775 -0.0946 0.0261  232  LEU B N   
3933 C CA  . LEU B 99  ? 0.9224 0.8128 0.8895 -0.0790 -0.0906 0.0232  232  LEU B CA  
3934 C C   . LEU B 99  ? 1.0036 0.8775 0.9616 -0.0736 -0.0870 0.0179  232  LEU B C   
3935 O O   . LEU B 99  ? 0.9362 0.8103 0.8983 -0.0699 -0.0822 0.0155  232  LEU B O   
3936 C CB  . LEU B 99  ? 0.9649 0.8530 0.9217 -0.0896 -0.0937 0.0239  232  LEU B CB  
3937 C CG  . LEU B 99  ? 0.9766 0.8622 0.9299 -0.0927 -0.0903 0.0216  232  LEU B CG  
3938 C CD1 . LEU B 99  ? 1.0069 0.9098 0.9771 -0.0900 -0.0865 0.0234  232  LEU B CD1 
3939 C CD2 . LEU B 99  ? 0.9602 0.8417 0.9021 -0.1035 -0.0943 0.0225  232  LEU B CD2 
3940 N N   . MET B 100 ? 0.9351 0.7948 0.8805 -0.0730 -0.0891 0.0158  233  MET B N   
3941 C CA  . MET B 100 ? 0.8798 0.7238 0.8169 -0.0674 -0.0859 0.0108  233  MET B CA  
3942 C C   . MET B 100 ? 0.9373 0.7862 0.8874 -0.0573 -0.0819 0.0106  233  MET B C   
3943 O O   . MET B 100 ? 1.0691 0.9120 1.0192 -0.0527 -0.0774 0.0071  233  MET B O   
3944 C CB  . MET B 100 ? 0.8869 0.7170 0.8096 -0.0683 -0.0892 0.0090  233  MET B CB  
3945 C CG  . MET B 100 ? 1.0801 0.8941 0.9945 -0.0622 -0.0862 0.0040  233  MET B CG  
3946 S SD  . MET B 100 ? 1.2534 1.0476 1.1470 -0.0681 -0.0871 -0.0012 233  MET B SD  
3947 C CE  . MET B 100 ? 1.1303 0.9212 1.0129 -0.0744 -0.0938 -0.0001 233  MET B CE  
3948 N N   . GLN B 101 ? 0.9022 0.7613 0.8633 -0.0538 -0.0838 0.0142  234  GLN B N   
3949 C CA  . GLN B 101 ? 0.9653 0.8300 0.9402 -0.0443 -0.0808 0.0143  234  GLN B CA  
3950 C C   . GLN B 101 ? 0.9030 0.7778 0.8896 -0.0423 -0.0767 0.0138  234  GLN B C   
3951 O O   . GLN B 101 ? 1.0228 0.8948 1.0142 -0.0351 -0.0725 0.0110  234  GLN B O   
3952 C CB  . GLN B 101 ? 1.0394 0.9155 1.0254 -0.0422 -0.0843 0.0192  234  GLN B CB  
3953 C CG  . GLN B 101 ? 0.9371 0.8037 0.9139 -0.0411 -0.0873 0.0194  234  GLN B CG  
3954 C CD  . GLN B 101 ? 0.9795 0.8358 0.9554 -0.0326 -0.0843 0.0163  234  GLN B CD  
3955 O OE1 . GLN B 101 ? 1.1016 0.9582 1.0847 -0.0269 -0.0800 0.0141  234  GLN B OE1 
3956 N NE2 . GLN B 101 ? 1.0213 0.8687 0.9883 -0.0315 -0.0864 0.0160  234  GLN B NE2 
3957 N N   . TYR B 102 ? 0.7432 0.6299 0.7342 -0.0488 -0.0778 0.0164  235  TYR B N   
3958 C CA  . TYR B 102 ? 0.8000 0.6973 0.8015 -0.0477 -0.0738 0.0158  235  TYR B CA  
3959 C C   . TYR B 102 ? 0.8742 0.7594 0.8658 -0.0474 -0.0696 0.0109  235  TYR B C   
3960 O O   . TYR B 102 ? 0.7889 0.6769 0.7881 -0.0415 -0.0651 0.0086  235  TYR B O   
3961 C CB  . TYR B 102 ? 0.7336 0.6451 0.7398 -0.0557 -0.0761 0.0195  235  TYR B CB  
3962 C CG  . TYR B 102 ? 0.7298 0.6534 0.7464 -0.0552 -0.0720 0.0189  235  TYR B CG  
3963 C CD1 . TYR B 102 ? 0.7698 0.7083 0.8049 -0.0484 -0.0702 0.0200  235  TYR B CD1 
3964 C CD2 . TYR B 102 ? 0.5869 0.5073 0.5951 -0.0612 -0.0702 0.0173  235  TYR B CD2 
3965 C CE1 . TYR B 102 ? 0.7697 0.7200 0.8144 -0.0476 -0.0663 0.0191  235  TYR B CE1 
3966 C CE2 . TYR B 102 ? 0.6817 0.6142 0.6994 -0.0608 -0.0663 0.0168  235  TYR B CE2 
3967 C CZ  . TYR B 102 ? 0.8022 0.7498 0.8380 -0.0538 -0.0642 0.0175  235  TYR B CZ  
3968 O OH  . TYR B 102 ? 0.8471 0.8075 0.8925 -0.0531 -0.0603 0.0166  235  TYR B OH  
3969 N N   . CYS B 103 ? 0.9213 0.7927 0.8957 -0.0538 -0.0712 0.0092  236  CYS B N   
3970 C CA  . CYS B 103 ? 0.8487 0.7074 0.8127 -0.0542 -0.0677 0.0047  236  CYS B CA  
3971 C C   . CYS B 103 ? 0.8651 0.7131 0.8284 -0.0449 -0.0644 0.0009  236  CYS B C   
3972 O O   . CYS B 103 ? 0.9077 0.7521 0.8712 -0.0416 -0.0600 -0.0024 236  CYS B O   
3973 C CB  . CYS B 103 ? 0.7943 0.6394 0.7403 -0.0625 -0.0710 0.0036  236  CYS B CB  
3974 S SG  . CYS B 103 ? 1.1253 0.9806 1.0700 -0.0742 -0.0745 0.0074  236  CYS B SG  
3975 N N   . VAL B 104 ? 0.7613 0.6040 0.7237 -0.0406 -0.0665 0.0013  237  VAL B N   
3976 C CA  . VAL B 104 ? 0.7224 0.5547 0.6841 -0.0319 -0.0637 -0.0020 237  VAL B CA  
3977 C C   . VAL B 104 ? 0.7929 0.6364 0.7715 -0.0240 -0.0599 -0.0020 237  VAL B C   
3978 O O   . VAL B 104 ? 0.9394 0.7767 0.9180 -0.0187 -0.0557 -0.0057 237  VAL B O   
3979 C CB  . VAL B 104 ? 0.7087 0.5346 0.6662 -0.0296 -0.0671 -0.0009 237  VAL B CB  
3980 C CG1 . VAL B 104 ? 0.6919 0.5102 0.6519 -0.0201 -0.0643 -0.0035 237  VAL B CG1 
3981 C CG2 . VAL B 104 ? 0.6085 0.4210 0.5477 -0.0365 -0.0702 -0.0024 237  VAL B CG2 
3982 N N   . ALA B 105 ? 0.7120 0.5722 0.7055 -0.0229 -0.0616 0.0021  238  ALA B N   
3983 C CA  . ALA B 105 ? 0.5352 0.4072 0.5458 -0.0155 -0.0585 0.0020  238  ALA B CA  
3984 C C   . ALA B 105 ? 0.5697 0.4460 0.5817 -0.0170 -0.0542 -0.0005 238  ALA B C   
3985 O O   . ALA B 105 ? 0.3966 0.2747 0.4164 -0.0100 -0.0502 -0.0032 238  ALA B O   
3986 C CB  . ALA B 105 ? 0.4819 0.3718 0.5083 -0.0151 -0.0615 0.0069  238  ALA B CB  
3987 N N   . ALA B 106 ? 0.6247 0.5024 0.6290 -0.0261 -0.0551 0.0003  239  ALA B N   
3988 C CA  . ALA B 106 ? 0.5850 0.4662 0.5890 -0.0286 -0.0513 -0.0018 239  ALA B CA  
3989 C C   . ALA B 106 ? 0.5929 0.4575 0.5859 -0.0256 -0.0477 -0.0068 239  ALA B C   
3990 O O   . ALA B 106 ? 0.6290 0.4967 0.6267 -0.0221 -0.0433 -0.0094 239  ALA B O   
3991 C CB  . ALA B 106 ? 0.5646 0.4495 0.5615 -0.0396 -0.0537 0.0006  239  ALA B CB  
3992 N N   . ASN B 107 ? 0.6670 0.5140 0.6450 -0.0272 -0.0497 -0.0083 240  ASN B N   
3993 C CA  . ASN B 107 ? 0.6620 0.4924 0.6297 -0.0239 -0.0466 -0.0130 240  ASN B CA  
3994 C C   . ASN B 107 ? 0.7672 0.5991 0.7458 -0.0132 -0.0430 -0.0151 240  ASN B C   
3995 O O   . ASN B 107 ? 0.8878 0.7177 0.8671 -0.0100 -0.0387 -0.0184 240  ASN B O   
3996 C CB  . ASN B 107 ? 0.7554 0.5678 0.7075 -0.0258 -0.0496 -0.0143 240  ASN B CB  
3997 C CG  . ASN B 107 ? 0.7491 0.5586 0.6899 -0.0362 -0.0536 -0.0126 240  ASN B CG  
3998 O OD1 . ASN B 107 ? 0.8267 0.6433 0.7677 -0.0426 -0.0534 -0.0114 240  ASN B OD1 
3999 N ND2 . ASN B 107 ? 0.7068 0.5060 0.6376 -0.0380 -0.0574 -0.0125 240  ASN B ND2 
4000 N N   . TYR B 108 ? 0.8526 0.6890 0.8405 -0.0076 -0.0449 -0.0131 241  TYR B N   
4001 C CA  . TYR B 108 ? 0.6941 0.5303 0.6918 0.0028  -0.0420 -0.0152 241  TYR B CA  
4002 C C   . TYR B 108 ? 0.6663 0.5184 0.6794 0.0064  -0.0387 -0.0156 241  TYR B C   
4003 O O   . TYR B 108 ? 0.8491 0.6984 0.8658 0.0130  -0.0348 -0.0192 241  TYR B O   
4004 C CB  . TYR B 108 ? 0.8498 0.6867 0.8539 0.0078  -0.0452 -0.0126 241  TYR B CB  
4005 C CG  . TYR B 108 ? 1.0126 0.8319 1.0016 0.0070  -0.0472 -0.0136 241  TYR B CG  
4006 C CD1 . TYR B 108 ? 0.9878 0.7932 0.9718 0.0134  -0.0449 -0.0173 241  TYR B CD1 
4007 C CD2 . TYR B 108 ? 1.1431 0.9601 1.1229 -0.0002 -0.0515 -0.0112 241  TYR B CD2 
4008 C CE1 . TYR B 108 ? 1.0318 0.8217 1.0022 0.0126  -0.0466 -0.0184 241  TYR B CE1 
4009 C CE2 . TYR B 108 ? 1.1666 0.9682 1.1327 -0.0008 -0.0533 -0.0125 241  TYR B CE2 
4010 C CZ  . TYR B 108 ? 1.0344 0.8227 0.9959 0.0056  -0.0508 -0.0161 241  TYR B CZ  
4011 O OH  . TYR B 108 ? 1.2185 0.9921 1.1666 0.0050  -0.0525 -0.0176 241  TYR B OH  
4012 N N   . TYR B 109 ? 0.5770 0.4459 0.5991 0.0020  -0.0400 -0.0124 242  TYR B N   
4013 C CA  . TYR B 109 ? 0.5319 0.4168 0.5696 0.0062  -0.0368 -0.0131 242  TYR B CA  
4014 C C   . TYR B 109 ? 0.5715 0.4576 0.6041 0.0023  -0.0328 -0.0158 242  TYR B C   
4015 O O   . TYR B 109 ? 0.7725 0.6660 0.8144 0.0077  -0.0288 -0.0185 242  TYR B O   
4016 C CB  . TYR B 109 ? 0.5431 0.4470 0.5951 0.0046  -0.0398 -0.0087 242  TYR B CB  
4017 C CG  . TYR B 109 ? 0.4584 0.3655 0.5226 0.0124  -0.0421 -0.0070 242  TYR B CG  
4018 C CD1 . TYR B 109 ? 0.4295 0.3458 0.5099 0.0214  -0.0400 -0.0086 242  TYR B CD1 
4019 C CD2 . TYR B 109 ? 0.3851 0.2855 0.4442 0.0109  -0.0466 -0.0039 242  TYR B CD2 
4020 C CE1 . TYR B 109 ? 0.4001 0.3188 0.4917 0.0284  -0.0427 -0.0068 242  TYR B CE1 
4021 C CE2 . TYR B 109 ? 0.4373 0.3406 0.5073 0.0176  -0.0490 -0.0019 242  TYR B CE2 
4022 C CZ  . TYR B 109 ? 0.5329 0.4451 0.6192 0.0263  -0.0472 -0.0032 242  TYR B CZ  
4023 O OH  . TYR B 109 ? 0.3716 0.2866 0.4694 0.0329  -0.0500 -0.0011 242  TYR B OH  
4024 N N   . TRP B 110 ? 0.6304 0.5091 0.6484 -0.0068 -0.0338 -0.0153 243  TRP B N   
4025 C CA  . TRP B 110 ? 0.7337 0.6102 0.7449 -0.0102 -0.0300 -0.0181 243  TRP B CA  
4026 C C   . TRP B 110 ? 0.8157 0.6755 0.8188 -0.0046 -0.0269 -0.0228 243  TRP B C   
4027 O O   . TRP B 110 ? 0.7926 0.6536 0.7962 -0.0029 -0.0227 -0.0258 243  TRP B O   
4028 C CB  . TRP B 110 ? 0.7517 0.6245 0.7497 -0.0218 -0.0324 -0.0161 243  TRP B CB  
4029 C CG  . TRP B 110 ? 0.7864 0.6787 0.7933 -0.0279 -0.0335 -0.0123 243  TRP B CG  
4030 C CD1 . TRP B 110 ? 0.7862 0.6855 0.7951 -0.0333 -0.0380 -0.0079 243  TRP B CD1 
4031 C CD2 . TRP B 110 ? 0.8006 0.7080 0.8155 -0.0291 -0.0299 -0.0126 243  TRP B CD2 
4032 N NE1 . TRP B 110 ? 0.7109 0.6286 0.7288 -0.0378 -0.0376 -0.0053 243  TRP B NE1 
4033 C CE2 . TRP B 110 ? 0.7113 0.6346 0.7331 -0.0353 -0.0325 -0.0082 243  TRP B CE2 
4034 C CE3 . TRP B 110 ? 0.7789 0.6884 0.7958 -0.0257 -0.0247 -0.0162 243  TRP B CE3 
4035 C CZ2 . TRP B 110 ? 0.7163 0.6577 0.7471 -0.0381 -0.0300 -0.0073 243  TRP B CZ2 
4036 C CZ3 . TRP B 110 ? 0.6633 0.5909 0.6889 -0.0284 -0.0222 -0.0154 243  TRP B CZ3 
4037 C CH2 . TRP B 110 ? 0.6850 0.6285 0.7175 -0.0346 -0.0248 -0.0110 243  TRP B CH2 
4038 N N   . LEU B 111 ? 0.8639 0.7087 0.8603 -0.0011 -0.0289 -0.0235 244  LEU B N   
4039 C CA  . LEU B 111 ? 0.8438 0.6745 0.8355 0.0058  -0.0259 -0.0279 244  LEU B CA  
4040 C C   . LEU B 111 ? 0.7394 0.5799 0.7473 0.0157  -0.0228 -0.0296 244  LEU B C   
4041 O O   . LEU B 111 ? 0.6737 0.5092 0.6810 0.0204  -0.0189 -0.0335 244  LEU B O   
4042 C CB  . LEU B 111 ? 0.9621 0.7766 0.9445 0.0074  -0.0289 -0.0280 244  LEU B CB  
4043 C CG  . LEU B 111 ? 0.9458 0.7434 0.9217 0.0142  -0.0267 -0.0321 244  LEU B CG  
4044 C CD1 . LEU B 111 ? 0.7919 0.5779 0.7546 0.0104  -0.0240 -0.0355 244  LEU B CD1 
4045 C CD2 . LEU B 111 ? 0.8829 0.6682 0.8512 0.0151  -0.0302 -0.0312 244  LEU B CD2 
4046 N N   . LEU B 112 ? 0.6667 0.5214 0.6895 0.0189  -0.0248 -0.0267 245  LEU B N   
4047 C CA  . LEU B 112 ? 0.5842 0.4494 0.6237 0.0283  -0.0225 -0.0282 245  LEU B CA  
4048 C C   . LEU B 112 ? 0.6692 0.5462 0.7141 0.0277  -0.0182 -0.0305 245  LEU B C   
4049 O O   . LEU B 112 ? 0.7250 0.6014 0.7746 0.0347  -0.0145 -0.0344 245  LEU B O   
4050 C CB  . LEU B 112 ? 0.5414 0.4203 0.5959 0.0309  -0.0260 -0.0243 245  LEU B CB  
4051 C CG  . LEU B 112 ? 0.4989 0.3899 0.5723 0.0406  -0.0243 -0.0259 245  LEU B CG  
4052 C CD1 . LEU B 112 ? 0.5443 0.4221 0.6162 0.0492  -0.0220 -0.0299 245  LEU B CD1 
4053 C CD2 . LEU B 112 ? 0.4795 0.3826 0.5675 0.0431  -0.0284 -0.0218 245  LEU B CD2 
4054 N N   . VAL B 113 ? 0.6006 0.4890 0.6452 0.0195  -0.0187 -0.0281 246  VAL B N   
4055 C CA  . VAL B 113 ? 0.6537 0.5544 0.7034 0.0186  -0.0145 -0.0301 246  VAL B CA  
4056 C C   . VAL B 113 ? 0.6549 0.5419 0.6903 0.0165  -0.0111 -0.0337 246  VAL B C   
4057 O O   . VAL B 113 ? 0.5410 0.4340 0.5803 0.0193  -0.0068 -0.0368 246  VAL B O   
4058 C CB  . VAL B 113 ? 0.6628 0.5800 0.7163 0.0101  -0.0159 -0.0263 246  VAL B CB  
4059 C CG1 . VAL B 113 ? 0.5297 0.4584 0.5956 0.0112  -0.0200 -0.0223 246  VAL B CG1 
4060 C CG2 . VAL B 113 ? 0.6475 0.5550 0.6837 -0.0008 -0.0174 -0.0246 246  VAL B CG2 
4061 N N   . GLU B 114 ? 0.7272 0.5957 0.7458 0.0118  -0.0131 -0.0335 247  GLU B N   
4062 C CA  . GLU B 114 ? 0.7133 0.5669 0.7184 0.0107  -0.0103 -0.0370 247  GLU B CA  
4063 C C   . GLU B 114 ? 0.7140 0.5623 0.7242 0.0213  -0.0069 -0.0414 247  GLU B C   
4064 O O   . GLU B 114 ? 0.7004 0.5499 0.7101 0.0229  -0.0027 -0.0447 247  GLU B O   
4065 C CB  . GLU B 114 ? 0.7789 0.6131 0.7666 0.0050  -0.0136 -0.0362 247  GLU B CB  
4066 C CG  . GLU B 114 ? 0.9549 0.7741 0.9266 0.0006  -0.0119 -0.0389 247  GLU B CG  
4067 C CD  . GLU B 114 ? 1.0506 0.8785 1.0188 -0.0086 -0.0110 -0.0375 247  GLU B CD  
4068 O OE1 . GLU B 114 ? 1.1796 1.0116 1.1446 -0.0169 -0.0145 -0.0338 247  GLU B OE1 
4069 O OE2 . GLU B 114 ? 0.9782 0.8090 0.9467 -0.0078 -0.0069 -0.0399 247  GLU B OE2 
4070 N N   . GLY B 115 ? 0.6526 0.4969 0.6689 0.0287  -0.0087 -0.0413 248  GLY B N   
4071 C CA  . GLY B 115 ? 0.5689 0.4083 0.5911 0.0391  -0.0060 -0.0451 248  GLY B CA  
4072 C C   . GLY B 115 ? 0.5862 0.4435 0.6251 0.0450  -0.0029 -0.0470 248  GLY B C   
4073 O O   . GLY B 115 ? 0.7631 0.6177 0.8032 0.0507  0.0009  -0.0512 248  GLY B O   
4074 N N   . VAL B 116 ? 0.5940 0.4697 0.6456 0.0438  -0.0045 -0.0440 249  VAL B N   
4075 C CA  . VAL B 116 ? 0.5139 0.4082 0.5825 0.0495  -0.0019 -0.0458 249  VAL B CA  
4076 C C   . VAL B 116 ? 0.5438 0.4436 0.6082 0.0459  0.0027  -0.0485 249  VAL B C   
4077 O O   . VAL B 116 ? 0.6006 0.5056 0.6720 0.0524  0.0065  -0.0526 249  VAL B O   
4078 C CB  . VAL B 116 ? 0.5900 0.5027 0.6723 0.0479  -0.0049 -0.0417 249  VAL B CB  
4079 C CG1 . VAL B 116 ? 0.4669 0.4000 0.5667 0.0532  -0.0022 -0.0439 249  VAL B CG1 
4080 C CG2 . VAL B 116 ? 0.7080 0.6159 0.7955 0.0522  -0.0094 -0.0391 249  VAL B CG2 
4081 N N   . TYR B 117 ? 0.5872 0.4868 0.6405 0.0352  0.0022  -0.0461 250  TYR B N   
4082 C CA  . TYR B 117 ? 0.5746 0.4782 0.6219 0.0304  0.0062  -0.0479 250  TYR B CA  
4083 C C   . TYR B 117 ? 0.6356 0.5229 0.6731 0.0342  0.0093  -0.0524 250  TYR B C   
4084 O O   . TYR B 117 ? 0.6638 0.5575 0.7038 0.0365  0.0136  -0.0558 250  TYR B O   
4085 C CB  . TYR B 117 ? 0.5665 0.4689 0.6019 0.0180  0.0040  -0.0440 250  TYR B CB  
4086 C CG  . TYR B 117 ? 0.6480 0.5517 0.6746 0.0116  0.0074  -0.0453 250  TYR B CG  
4087 C CD1 . TYR B 117 ? 0.6595 0.5838 0.6957 0.0103  0.0104  -0.0454 250  TYR B CD1 
4088 C CD2 . TYR B 117 ? 0.6639 0.5485 0.6728 0.0069  0.0074  -0.0461 250  TYR B CD2 
4089 C CE1 . TYR B 117 ? 0.7033 0.6294 0.7314 0.0041  0.0135  -0.0462 250  TYR B CE1 
4090 C CE2 . TYR B 117 ? 0.6646 0.5502 0.6655 0.0008  0.0101  -0.0469 250  TYR B CE2 
4091 C CZ  . TYR B 117 ? 0.7513 0.6579 0.7618 -0.0007 0.0132  -0.0467 250  TYR B CZ  
4092 O OH  . TYR B 117 ? 0.7700 0.6783 0.7724 -0.0071 0.0158  -0.0471 250  TYR B OH  
4093 N N   . LEU B 118 ? 0.7639 0.6305 0.7899 0.0348  0.0073  -0.0526 251  LEU B N   
4094 C CA  . LEU B 118 ? 0.7618 0.6122 0.7789 0.0390  0.0100  -0.0569 251  LEU B CA  
4095 C C   . LEU B 118 ? 0.7746 0.6309 0.8050 0.0504  0.0130  -0.0609 251  LEU B C   
4096 O O   . LEU B 118 ? 0.6555 0.5105 0.6840 0.0530  0.0170  -0.0648 251  LEU B O   
4097 C CB  . LEU B 118 ? 0.6337 0.4623 0.6386 0.0388  0.0069  -0.0564 251  LEU B CB  
4098 C CG  . LEU B 118 ? 0.5801 0.3901 0.5754 0.0433  0.0091  -0.0605 251  LEU B CG  
4099 C CD1 . LEU B 118 ? 0.5608 0.3660 0.5438 0.0367  0.0118  -0.0621 251  LEU B CD1 
4100 C CD2 . LEU B 118 ? 0.5087 0.2996 0.4942 0.0437  0.0056  -0.0597 251  LEU B CD2 
4101 N N   . TYR B 119 ? 0.7190 0.5818 0.7631 0.0573  0.0108  -0.0600 252  TYR B N   
4102 C CA  . TYR B 119 ? 0.6701 0.5379 0.7277 0.0685  0.0129  -0.0638 252  TYR B CA  
4103 C C   . TYR B 119 ? 0.7663 0.6529 0.8335 0.0697  0.0169  -0.0664 252  TYR B C   
4104 O O   . TYR B 119 ? 0.8802 0.7657 0.9489 0.0754  0.0206  -0.0711 252  TYR B O   
4105 C CB  . TYR B 119 ? 0.7699 0.6429 0.8413 0.0746  0.0091  -0.0616 252  TYR B CB  
4106 C CG  . TYR B 119 ? 0.8082 0.6847 0.8923 0.0860  0.0104  -0.0647 252  TYR B CG  
4107 C CD1 . TYR B 119 ? 0.8890 0.7570 0.9547 0.0856  0.0116  -0.0587 252  TYR B CD1 
4108 C CD2 . TYR B 119 ? 0.8801 0.7760 0.9825 0.0913  0.0116  -0.0669 252  TYR B CD2 
4109 C CE1 . TYR B 119 ? 1.1390 1.0148 1.2055 0.0904  0.0136  -0.0558 252  TYR B CE1 
4110 C CE2 . TYR B 119 ? 1.1357 1.0384 1.2389 0.0968  0.0129  -0.0646 252  TYR B CE2 
4111 C CZ  . TYR B 119 ? 1.3091 1.2011 1.3936 0.0958  0.0137  -0.0587 252  TYR B CZ  
4112 O OH  . TYR B 119 ? 1.5808 1.4788 1.6647 0.0997  0.0153  -0.0557 252  TYR B OH  
4113 N N   . THR B 120 ? 0.8294 0.7339 0.9033 0.0642  0.0163  -0.0635 253  THR B N   
4114 C CA  . THR B 120 ? 0.8296 0.7535 0.9129 0.0650  0.0201  -0.0660 253  THR B CA  
4115 C C   . THR B 120 ? 0.7529 0.6722 0.8229 0.0595  0.0242  -0.0681 253  THR B C   
4116 O O   . THR B 120 ? 0.6038 0.5336 0.6794 0.0630  0.0283  -0.0719 253  THR B O   
4117 C CB  . THR B 120 ? 0.8307 0.7747 0.9234 0.0596  0.0184  -0.0621 253  THR B CB  
4118 O OG1 . THR B 120 ? 0.8615 0.8000 0.9406 0.0480  0.0164  -0.0576 253  THR B OG1 
4119 C CG2 . THR B 120 ? 0.9177 0.8676 1.0250 0.0655  0.0145  -0.0601 253  THR B CG2 
4120 N N   . LEU B 121 ? 0.6557 0.5596 0.7083 0.0511  0.0228  -0.0657 254  LEU B N   
4121 C CA  . LEU B 121 ? 0.5681 0.4652 0.6072 0.0458  0.0260  -0.0675 254  LEU B CA  
4122 C C   . LEU B 121 ? 0.5446 0.4300 0.5816 0.0542  0.0290  -0.0728 254  LEU B C   
4123 O O   . LEU B 121 ? 0.5589 0.4475 0.5929 0.0539  0.0331  -0.0758 254  LEU B O   
4124 C CB  . LEU B 121 ? 0.6337 0.5147 0.6550 0.0358  0.0230  -0.0640 254  LEU B CB  
4125 C CG  . LEU B 121 ? 0.7162 0.5930 0.7236 0.0272  0.0252  -0.0641 254  LEU B CG  
4126 C CD1 . LEU B 121 ? 0.7679 0.6671 0.7816 0.0211  0.0270  -0.0622 254  LEU B CD1 
4127 C CD2 . LEU B 121 ? 0.7657 0.6237 0.7561 0.0188  0.0215  -0.0612 254  LEU B CD2 
4128 N N   . LEU B 122 ? 0.6385 0.5108 0.6771 0.0617  0.0270  -0.0738 255  LEU B N   
4129 C CA  . LEU B 122 ? 0.5730 0.4354 0.6118 0.0707  0.0296  -0.0788 255  LEU B CA  
4130 C C   . LEU B 122 ? 0.5858 0.4654 0.6420 0.0798  0.0323  -0.0826 255  LEU B C   
4131 O O   . LEU B 122 ? 0.7119 0.5901 0.7629 0.0838  0.0347  -0.0838 255  LEU B O   
4132 C CB  . LEU B 122 ? 0.4436 0.2910 0.4732 0.0737  0.0258  -0.0745 255  LEU B CB  
4133 C CG  . LEU B 122 ? 0.4516 0.2811 0.4642 0.0663  0.0228  -0.0714 255  LEU B CG  
4134 C CD1 . LEU B 122 ? 0.4417 0.2671 0.4474 0.0676  0.0209  -0.0638 255  LEU B CD1 
4135 C CD2 . LEU B 122 ? 0.3794 0.1985 0.3723 0.0625  0.0220  -0.0711 255  LEU B CD2 
4136 N N   . ALA B 123 ? 0.5500 0.4482 0.6213 0.0812  0.0309  -0.0809 256  ALA B N   
4137 C CA  . ALA B 123 ? 0.6370 0.5517 0.7257 0.0904  0.0331  -0.0848 256  ALA B CA  
4138 C C   . ALA B 123 ? 0.7099 0.6426 0.8013 0.0874  0.0376  -0.0871 256  ALA B C   
4139 O O   . ALA B 123 ? 0.6675 0.6124 0.7713 0.0954  0.0402  -0.0916 256  ALA B O   
4140 C CB  . ALA B 123 ? 0.7578 0.6847 0.8629 0.0942  0.0294  -0.0824 256  ALA B CB  
4141 N N   . PHE B 124 ? 0.9238 0.5852 0.7704 0.0504  0.1270  -0.2247 257  PHE B N   
4142 C CA  . PHE B 124 ? 0.7862 0.4635 0.6548 0.0484  0.1212  -0.2167 257  PHE B CA  
4143 C C   . PHE B 124 ? 0.8390 0.5458 0.7244 0.0555  0.1278  -0.2177 257  PHE B C   
4144 O O   . PHE B 124 ? 1.2434 0.9353 1.1121 0.0646  0.1220  -0.2282 257  PHE B O   
4145 C CB  . PHE B 124 ? 0.8871 0.5091 0.7407 0.0459  0.0841  -0.2200 257  PHE B CB  
4146 C CG  . PHE B 124 ? 0.9893 0.6178 0.8655 0.0383  0.0757  -0.2072 257  PHE B CG  
4147 C CD1 . PHE B 124 ? 0.8551 0.4894 0.7400 0.0277  0.0820  -0.1965 257  PHE B CD1 
4148 C CD2 . PHE B 124 ? 1.0058 0.6312 0.8954 0.0407  0.0602  -0.2045 257  PHE B CD2 
4149 C CE1 . PHE B 124 ? 0.8095 0.4451 0.7183 0.0170  0.0756  -0.1828 257  PHE B CE1 
4150 C CE2 . PHE B 124 ? 0.8991 0.5182 0.8110 0.0257  0.0611  -0.1904 257  PHE B CE2 
4151 C CZ  . PHE B 124 ? 0.8815 0.5026 0.8061 0.0095  0.0763  -0.1805 257  PHE B CZ  
4152 N N   . ASN B 125 ? 0.7830 0.5348 0.7058 0.0500  0.1406  -0.2065 1001 ASN B N   
4153 C CA  . ASN B 125 ? 0.7709 0.5576 0.7169 0.0537  0.1485  -0.2056 1001 ASN B CA  
4154 C C   . ASN B 125 ? 0.8375 0.6610 0.8223 0.0478  0.1526  -0.1937 1001 ASN B C   
4155 O O   . ASN B 125 ? 0.7941 0.6082 0.7829 0.0431  0.1465  -0.1872 1001 ASN B O   
4156 C CB  . ASN B 125 ? 0.7287 0.5535 0.6954 0.0480  0.1698  -0.2058 1001 ASN B CB  
4157 C CG  . ASN B 125 ? 0.8484 0.7060 0.8455 0.0316  0.1861  -0.1970 1001 ASN B CG  
4158 O OD1 . ASN B 125 ? 1.0848 0.9622 1.1060 0.0231  0.1881  -0.1874 1001 ASN B OD1 
4159 N ND2 . ASN B 125 ? 0.8563 0.7170 0.8525 0.0271  0.1961  -0.2007 1001 ASN B ND2 
4160 N N   . ILE B 126 ? 0.8349 0.7000 0.8499 0.0476  0.1614  -0.1907 1002 ILE B N   
4161 C CA  . ILE B 126 ? 0.7059 0.6121 0.7624 0.0427  0.1646  -0.1791 1002 ILE B CA  
4162 C C   . ILE B 126 ? 0.6913 0.6347 0.7817 0.0270  0.1770  -0.1680 1002 ILE B C   
4163 O O   . ILE B 126 ? 0.6638 0.6275 0.7795 0.0238  0.1761  -0.1566 1002 ILE B O   
4164 C CB  . ILE B 126 ? 0.7343 0.6740 0.8126 0.0447  0.1684  -0.1791 1002 ILE B CB  
4165 C CG1 . ILE B 126 ? 0.4887 0.4741 0.6106 0.0398  0.1701  -0.1654 1002 ILE B CG1 
4166 C CG2 . ILE B 126 ? 0.6718 0.6302 0.7572 0.0370  0.1795  -0.1837 1002 ILE B CG2 
4167 C CD1 . ILE B 126 ? 0.4911 0.4613 0.6143 0.0500  0.1584  -0.1599 1002 ILE B CD1 
4168 N N   . PHE B 127 ? 0.6804 0.6302 0.7718 0.0177  0.1866  -0.1709 1003 PHE B N   
4169 C CA  . PHE B 127 ? 0.7187 0.6913 0.8349 0.0035  0.1933  -0.1628 1003 PHE B CA  
4170 C C   . PHE B 127 ? 0.6883 0.6445 0.7977 0.0017  0.1919  -0.1565 1003 PHE B C   
4171 O O   . PHE B 127 ? 0.7192 0.6971 0.8534 -0.0044 0.1923  -0.1452 1003 PHE B O   
4172 C CB  . PHE B 127 ? 0.7557 0.7284 0.8701 -0.0046 0.2011  -0.1694 1003 PHE B CB  
4173 C CG  . PHE B 127 ? 0.6594 0.6482 0.7822 -0.0034 0.2020  -0.1757 1003 PHE B CG  
4174 C CD1 . PHE B 127 ? 0.6790 0.6959 0.8263 -0.0091 0.2010  -0.1727 1003 PHE B CD1 
4175 C CD2 . PHE B 127 ? 0.5804 0.5528 0.6821 0.0053  0.2027  -0.1850 1003 PHE B CD2 
4176 C CE1 . PHE B 127 ? 0.6435 0.6731 0.7961 -0.0078 0.2012  -0.1791 1003 PHE B CE1 
4177 C CE2 . PHE B 127 ? 0.4905 0.4778 0.6005 0.0063  0.2038  -0.1905 1003 PHE B CE2 
4178 C CZ  . PHE B 127 ? 0.5245 0.5409 0.6609 -0.0011 0.2032  -0.1877 1003 PHE B CZ  
4179 N N   . GLU B 128 ? 0.7457 0.6583 0.8165 0.0094  0.1866  -0.1638 1004 GLU B N   
4180 C CA  . GLU B 128 ? 0.8144 0.7007 0.8712 0.0084  0.1811  -0.1599 1004 GLU B CA  
4181 C C   . GLU B 128 ? 0.7801 0.6493 0.8422 0.0140  0.1682  -0.1570 1004 GLU B C   
4182 O O   . GLU B 128 ? 0.9160 0.7842 1.0158 -0.0030 0.1863  -0.1541 1004 GLU B O   
4183 C CB  . GLU B 128 ? 0.9083 0.7388 0.9141 0.0143  0.1717  -0.1710 1004 GLU B CB  
4184 C CG  . GLU B 128 ? 1.1437 0.9871 1.1495 0.0091  0.1869  -0.1749 1004 GLU B CG  
4185 C CD  . GLU B 128 ? 1.3835 1.2641 1.4260 -0.0077 0.2023  -0.1657 1004 GLU B CD  
4186 O OE1 . GLU B 128 ? 1.6747 1.5557 1.7245 -0.0143 0.2029  -0.1577 1004 GLU B OE1 
4187 O OE2 . GLU B 128 ? 1.7951 1.6980 1.8562 -0.0142 0.2103  -0.1678 1004 GLU B OE2 
4188 N N   . MET B 129 ? 0.7968 0.6405 0.8502 0.0210  0.1591  -0.1663 1005 MET B N   
4189 C CA  . MET B 129 ? 0.6733 0.4860 0.7689 0.0081  0.1639  -0.1710 1005 MET B CA  
4190 C C   . MET B 129 ? 0.6693 0.5675 0.8546 0.0011  0.1937  -0.1573 1005 MET B C   
4191 O O   . MET B 129 ? 0.6501 0.5552 0.8741 -0.0193 0.1775  -0.1252 1005 MET B O   
4192 C CB  . MET B 129 ? 0.6339 0.4248 0.7114 0.0191  0.1468  -0.1789 1005 MET B CB  
4193 C CG  . MET B 129 ? 0.6741 0.4174 0.7891 0.0017  0.1246  -0.1701 1005 MET B CG  
4194 S SD  . MET B 129 ? 0.7971 0.5254 0.8975 0.0179  0.1133  -0.1855 1005 MET B SD  
4195 C CE  . MET B 129 ? 0.7574 0.4578 0.8706 -0.0132 0.0443  -0.1289 1005 MET B CE  
4196 N N   . LEU B 130 ? 0.7122 0.6851 0.8964 0.0085  0.1891  -0.1415 1006 LEU B N   
4197 C CA  . LEU B 130 ? 0.6260 0.6686 0.8498 0.0056  0.1860  -0.1139 1006 LEU B CA  
4198 C C   . LEU B 130 ? 0.6363 0.6937 0.8570 -0.0008 0.1839  -0.0984 1006 LEU B C   
4199 O O   . LEU B 130 ? 0.7668 0.8703 1.0197 -0.0057 0.1775  -0.0712 1006 LEU B O   
4200 C CB  . LEU B 130 ? 0.6361 0.7023 0.8420 0.0122  0.1772  -0.1121 1006 LEU B CB  
4201 C CG  . LEU B 130 ? 0.7194 0.7985 0.9333 0.0215  0.1721  -0.1124 1006 LEU B CG  
4202 C CD1 . LEU B 130 ? 0.6965 0.7865 0.9070 0.0194  0.1747  -0.1199 1006 LEU B CD1 
4203 C CD2 . LEU B 130 ? 0.6787 0.8047 0.9446 0.0191  0.1674  -0.0876 1006 LEU B CD2 
4204 N N   . ARG B 131 ? 0.6103 0.6337 0.7946 -0.0030 0.1858  -0.1111 1007 ARG B N   
4205 C CA  . ARG B 131 ? 0.5263 0.5545 0.7166 -0.0115 0.1888  -0.1021 1007 ARG B CA  
4206 C C   . ARG B 131 ? 0.4611 0.4780 0.6899 -0.0244 0.2047  -0.0963 1007 ARG B C   
4207 O O   . ARG B 131 ? 0.4393 0.4854 0.6833 -0.0298 0.1986  -0.0732 1007 ARG B O   
4208 C CB  . ARG B 131 ? 0.5305 0.5250 0.6944 -0.0194 0.1954  -0.1185 1007 ARG B CB  
4209 N N   . ILE B 132 ? 0.6076 0.5752 0.8584 -0.0305 0.2270  -0.1170 1008 ILE B N   
4210 C CA  . ILE B 132 ? 0.6376 0.5681 0.8869 -0.0607 0.1778  -0.0718 1008 ILE B CA  
4211 C C   . ILE B 132 ? 0.6235 0.6282 0.9415 -0.0763 0.1541  -0.0222 1008 ILE B C   
4212 O O   . ILE B 132 ? 0.8059 0.8438 1.1594 -0.0982 0.1364  0.0202  1008 ILE B O   
4213 C CB  . ILE B 132 ? 0.7544 0.5653 0.9274 -0.0675 0.1336  -0.0793 1008 ILE B CB  
4214 C CG1 . ILE B 132 ? 0.8217 0.5572 0.9263 -0.0538 0.1556  -0.1261 1008 ILE B CG1 
4215 C CG2 . ILE B 132 ? 0.7983 0.5731 0.9679 -0.1002 0.0768  -0.0282 1008 ILE B CG2 
4216 C CD1 . ILE B 132 ? 0.9844 0.7220 1.0878 -0.0642 0.1672  -0.1191 1008 ILE B CD1 
4217 N N   . ASP B 133 ? 0.5206 0.5529 0.8588 -0.0653 0.1536  -0.0265 1009 ASP B N   
4218 C CA  . ASP B 133 ? 0.5073 0.5973 0.9036 -0.0813 0.1239  0.0214  1009 ASP B CA  
4219 C C   . ASP B 133 ? 0.4781 0.6567 0.8824 -0.0687 0.1337  0.0343  1009 ASP B C   
4220 O O   . ASP B 133 ? 0.6172 0.8210 1.0290 -0.0838 0.1053  0.0694  1009 ASP B O   
4221 C CB  . ASP B 133 ? 0.5394 0.6189 0.9301 -0.0697 0.1122  0.0104  1009 ASP B CB  
4222 C CG  . ASP B 133 ? 0.7895 0.7559 1.1104 -0.0785 0.0647  0.0087  1009 ASP B CG  
4223 O OD1 . ASP B 133 ? 0.8407 0.7473 1.1303 -0.0999 0.0300  0.0306  1009 ASP B OD1 
4224 O OD2 . ASP B 133 ? 0.7132 0.6507 1.0109 -0.0645 0.0615  -0.0137 1009 ASP B OD2 
4225 N N   . GLU B 134 ? 0.5167 0.7090 0.8624 -0.0396 0.1494  0.0028  1010 GLU B N   
4226 C CA  . GLU B 134 ? 0.4525 0.6860 0.7739 -0.0305 0.1405  0.0098  1010 GLU B CA  
4227 C C   . GLU B 134 ? 0.5415 0.7710 0.8528 -0.0311 0.1454  0.0120  1010 GLU B C   
4228 O O   . GLU B 134 ? 0.6689 0.9245 0.9874 -0.0315 0.1418  0.0227  1010 GLU B O   
4229 C CB  . GLU B 134 ? 0.6304 0.8506 0.9309 -0.0103 0.1535  -0.0141 1010 GLU B CB  
4230 C CG  . GLU B 134 ? 0.8046 1.0346 1.1147 -0.0062 0.1491  -0.0158 1010 GLU B CG  
4231 C CD  . GLU B 134 ? 1.0295 1.3073 1.3662 -0.0141 0.1348  0.0070  1010 GLU B CD  
4232 O OE1 . GLU B 134 ? 1.3072 1.6038 1.6505 -0.0201 0.1312  0.0193  1010 GLU B OE1 
4233 O OE2 . GLU B 134 ? 1.2462 1.5353 1.5964 -0.0144 0.1275  0.0094  1010 GLU B OE2 
4234 N N   . GLY B 135 ? 0.4924 0.6857 0.7860 -0.0309 0.1546  -0.0006 1011 GLY B N   
4235 C CA  . GLY B 135 ? 0.6201 0.8080 0.9047 -0.0314 0.1587  0.0006  1011 GLY B CA  
4236 C C   . GLY B 135 ? 0.6558 0.8287 0.9202 -0.0179 0.1699  -0.0196 1011 GLY B C   
4237 O O   . GLY B 135 ? 0.6230 0.7896 0.8794 -0.0109 0.1736  -0.0340 1011 GLY B O   
4238 N N   . LEU B 136 ? 0.6546 0.8225 0.9126 -0.0190 0.1728  -0.0188 1012 LEU B N   
4239 C CA  . LEU B 136 ? 0.8610 1.0161 1.1046 -0.0138 0.1795  -0.0340 1012 LEU B CA  
4240 C C   . LEU B 136 ? 0.8471 1.0388 1.1027 -0.0136 0.1747  -0.0143 1012 LEU B C   
4241 O O   . LEU B 136 ? 0.8295 1.0326 1.0933 -0.0197 0.1703  0.0010  1012 LEU B O   
4242 C CB  . LEU B 136 ? 0.9674 1.0726 1.1885 -0.0185 0.1882  -0.0579 1012 LEU B CB  
4243 C CG  . LEU B 136 ? 1.1448 1.2399 1.3568 -0.0197 0.1924  -0.0711 1012 LEU B CG  
4244 C CD1 . LEU B 136 ? 1.1479 1.2495 1.3595 -0.0175 0.1923  -0.0807 1012 LEU B CD1 
4245 C CD2 . LEU B 136 ? 1.0170 1.0696 1.2127 -0.0296 0.1985  -0.0898 1012 LEU B CD2 
4246 N N   . ARG B 137 ? 0.7658 0.9749 1.0216 -0.0084 0.1750  -0.0154 1013 ARG B N   
4247 C CA  . ARG B 137 ? 0.7950 1.0358 1.0589 -0.0085 0.1715  -0.0014 1013 ARG B CA  
4248 C C   . ARG B 137 ? 0.8548 1.0773 1.1047 -0.0042 0.1788  -0.0167 1013 ARG B C   
4249 O O   . ARG B 137 ? 0.8354 1.0400 1.0762 -0.0021 0.1830  -0.0335 1013 ARG B O   
4250 C CB  . ARG B 137 ? 0.8497 1.1302 1.1295 -0.0098 0.1642  0.0113  1013 ARG B CB  
4251 C CG  . ARG B 137 ? 0.7293 1.0230 1.0307 -0.0194 0.1549  0.0290  1013 ARG B CG  
4252 C CD  . ARG B 137 ? 0.8016 1.1154 1.1210 -0.0196 0.1496  0.0420  1013 ARG B CD  
4253 N NE  . ARG B 137 ? 0.7096 1.0259 1.0528 -0.0251 0.1370  0.0690  1013 ARG B NE  
4254 C CZ  . ARG B 137 ? 0.7597 1.0771 1.1183 -0.0287 0.1250  0.1004  1013 ARG B CZ  
4255 N NH1 . ARG B 137 ? 0.7347 1.0505 1.0883 -0.0272 0.1279  0.1039  1013 ARG B NH1 
4256 N NH2 . ARG B 137 ? 0.8464 1.1676 1.2245 -0.0337 0.1070  0.1312  1013 ARG B NH2 
4257 N N   . LEU B 138 ? 0.9457 1.1731 1.1955 -0.0055 0.1792  -0.0111 1014 LEU B N   
4258 C CA  . LEU B 138 ? 1.0945 1.3062 1.3340 -0.0038 0.1850  -0.0240 1014 LEU B CA  
4259 C C   . LEU B 138 ? 1.1297 1.3771 1.3759 0.0003  0.1823  -0.0144 1014 LEU B C   
4260 O O   . LEU B 138 ? 0.9876 1.2257 1.2272 0.0025  0.1863  -0.0260 1014 LEU B O   
4261 C CB  . LEU B 138 ? 1.3111 1.5058 1.5458 -0.0073 0.1875  -0.0248 1014 LEU B CB  
4262 C CG  . LEU B 138 ? 1.4977 1.6600 1.7198 -0.0105 0.1941  -0.0450 1014 LEU B CG  
4263 C CD1 . LEU B 138 ? 1.3993 1.5195 1.6099 -0.0184 0.1984  -0.0685 1014 LEU B CD1 
4264 C CD2 . LEU B 138 ? 1.5229 1.6814 1.7442 -0.0121 0.1952  -0.0395 1014 LEU B CD2 
4265 N N   . LYS B 139 ? 1.2288 1.5136 1.4889 -0.0024 0.1755  0.0031  1015 LYS B N   
4266 C CA  . LYS B 139 ? 1.0685 1.3821 1.3360 -0.0027 0.1735  0.0076  1015 LYS B CA  
4267 C C   . LYS B 139 ? 1.1467 1.4773 1.4274 -0.0051 0.1694  0.0122  1015 LYS B C   
4268 O O   . LYS B 139 ? 1.3847 1.7111 1.6719 -0.0075 0.1662  0.0170  1015 LYS B O   
4269 C CB  . LYS B 139 ? 0.9409 1.2602 1.2186 -0.0076 0.1724  0.0190  1015 LYS B CB  
4270 C CG  . LYS B 139 ? 0.9992 1.3026 1.2659 -0.0067 0.1758  0.0151  1015 LYS B CG  
4271 C CD  . LYS B 139 ? 1.2457 1.5543 1.5241 -0.0102 0.1741  0.0299  1015 LYS B CD  
4272 C CE  . LYS B 139 ? 1.4193 1.7156 1.6863 -0.0094 0.1780  0.0236  1015 LYS B CE  
4273 N NZ  . LYS B 139 ? 1.5119 1.8140 1.7899 -0.0106 0.1765  0.0392  1015 LYS B NZ  
4274 N N   . ILE B 140 ? 1.0717 1.4171 1.3579 -0.0042 0.1701  0.0114  1016 ILE B N   
4275 C CA  . ILE B 140 ? 1.1912 1.5443 1.4924 -0.0043 0.1674  0.0195  1016 ILE B CA  
4276 C C   . ILE B 140 ? 1.1965 1.5468 1.5170 -0.0043 0.1596  0.0526  1016 ILE B C   
4277 O O   . ILE B 140 ? 1.3390 1.6886 1.6639 -0.0031 0.1566  0.0710  1016 ILE B O   
4278 C CB  . ILE B 140 ? 1.1970 1.5617 1.5001 -0.0018 0.1701  0.0153  1016 ILE B CB  
4279 C CG1 . ILE B 140 ? 1.2358 1.6060 1.5149 0.0024  0.1710  -0.0052 1016 ILE B CG1 
4280 C CG2 . ILE B 140 ? 1.0467 1.4176 1.3641 0.0007  0.1662  0.0296  1016 ILE B CG2 
4281 C CD1 . ILE B 140 ? 1.5214 1.9005 1.8001 0.0035  0.1717  -0.0112 1016 ILE B CD1 
4282 N N   . TYR B 141 ? 0.9314 1.2840 1.2621 -0.0045 0.1532  0.0647  1017 TYR B N   
4283 C CA  . TYR B 141 ? 0.8018 1.1586 1.1491 -0.0040 0.1396  0.1034  1017 TYR B CA  
4284 C C   . TYR B 141 ? 0.8123 1.1811 1.1701 -0.0014 0.1316  0.1208  1017 TYR B C   
4285 O O   . TYR B 141 ? 0.7439 1.1118 1.0991 -0.0022 0.1365  0.1003  1017 TYR B O   
4286 C CB  . TYR B 141 ? 0.6345 0.9800 0.9848 -0.0100 0.1356  0.1057  1017 TYR B CB  
4287 C CG  . TYR B 141 ? 0.7610 1.1126 1.1291 -0.0118 0.1170  0.1484  1017 TYR B CG  
4288 C CD1 . TYR B 141 ? 0.8528 1.2083 1.2252 -0.0109 0.1085  0.1746  1017 TYR B CD1 
4289 C CD2 . TYR B 141 ? 0.8271 1.1815 1.2073 -0.0152 0.1053  0.1640  1017 TYR B CD2 
4290 C CE1 . TYR B 141 ? 0.9338 1.2966 1.3214 -0.0137 0.0873  0.2162  1017 TYR B CE1 
4291 C CE2 . TYR B 141 ? 0.8673 1.2276 1.2631 -0.0190 0.0836  0.2058  1017 TYR B CE2 
4292 C CZ  . TYR B 141 ? 1.0280 1.3927 1.4270 -0.0184 0.0740  0.2322  1017 TYR B CZ  
4293 O OH  . TYR B 141 ? 1.0890 1.4597 1.5023 -0.0232 0.0490  0.2753  1017 TYR B OH  
4294 N N   . LYS B 142 ? 0.7830 1.1641 1.1513 0.0015  0.1181  0.1598  1018 LYS B N   
4295 C CA  . LYS B 142 ? 0.7613 1.1549 1.1391 0.0033  0.1078  0.1827  1018 LYS B CA  
4296 C C   . LYS B 142 ? 0.7810 1.1724 1.1719 -0.0026 0.0924  0.2068  1018 LYS B C   
4297 O O   . LYS B 142 ? 0.7798 1.1726 1.1783 -0.0052 0.0782  0.2380  1018 LYS B O   
4298 C CB  . LYS B 142 ? 1.0011 1.4097 1.3811 0.0086  0.0998  0.2136  1018 LYS B CB  
4299 N N   . ASP B 143 ? 0.8481 1.2363 1.2423 -0.0053 0.0935  0.1932  1019 ASP B N   
4300 C CA  . ASP B 143 ? 0.9674 1.3509 1.3744 -0.0126 0.0786  0.2116  1019 ASP B CA  
4301 C C   . ASP B 143 ? 0.9412 1.3365 1.3612 -0.0140 0.0578  0.2560  1019 ASP B C   
4302 O O   . ASP B 143 ? 0.8958 1.3035 1.3139 -0.0083 0.0575  0.2694  1019 ASP B O   
4303 C CB  . ASP B 143 ? 1.1870 1.5620 1.5920 -0.0150 0.0880  0.1784  1019 ASP B CB  
4304 C CG  . ASP B 143 ? 1.3693 1.7332 1.7839 -0.0245 0.0765  0.1858  1019 ASP B CG  
4305 O OD1 . ASP B 143 ? 1.5061 1.8690 1.9303 -0.0302 0.0580  0.2199  1019 ASP B OD1 
4306 O OD2 . ASP B 143 ? 1.3237 1.6795 1.7355 -0.0269 0.0841  0.1582  1019 ASP B OD2 
4307 N N   . THR B 144 ? 0.9529 1.3425 1.3854 -0.0228 0.0387  0.2795  1020 THR B N   
4308 C CA  . THR B 144 ? 0.7484 1.1449 1.1925 -0.0270 0.0145  0.3265  1020 THR B CA  
4309 C C   . THR B 144 ? 0.8073 1.2147 1.2521 -0.0228 0.0171  0.3296  1020 THR B C   
4310 O O   . THR B 144 ? 1.0270 1.4439 1.4752 -0.0222 0.0047  0.3649  1020 THR B O   
4311 C CB  . THR B 144 ? 0.4865 0.8701 0.9425 -0.0396 -0.0079 0.3450  1020 THR B CB  
4312 N N   . GLU B 145 ? 0.8563 1.2623 1.2974 -0.0198 0.0328  0.2932  1021 GLU B N   
4313 C CA  . GLU B 145 ? 0.7384 1.1539 1.1816 -0.0168 0.0339  0.2944  1021 GLU B CA  
4314 C C   . GLU B 145 ? 0.7378 1.1658 1.1699 -0.0071 0.0476  0.2857  1021 GLU B C   
4315 O O   . GLU B 145 ? 0.7483 1.1860 1.1817 -0.0045 0.0467  0.2930  1021 GLU B O   
4316 C CB  . GLU B 145 ? 0.8807 1.2901 1.3251 -0.0177 0.0432  0.2594  1021 GLU B CB  
4317 C CG  . GLU B 145 ? 1.0162 1.4115 1.4709 -0.0279 0.0302  0.2627  1021 GLU B CG  
4318 C CD  . GLU B 145 ? 1.0976 1.4812 1.5453 -0.0293 0.0396  0.2392  1021 GLU B CD  
4319 O OE1 . GLU B 145 ? 1.2108 1.5952 1.6444 -0.0219 0.0613  0.2064  1021 GLU B OE1 
4320 O OE2 . GLU B 145 ? 0.8122 1.1842 1.2675 -0.0390 0.0239  0.2543  1021 GLU B OE2 
4321 N N   . GLY B 146 ? 0.7849 1.2120 1.2064 -0.0025 0.0589  0.2709  1022 GLY B N   
4322 C CA  . GLY B 146 ? 0.6464 1.0829 1.0573 0.0053  0.0704  0.2608  1022 GLY B CA  
4323 C C   . GLY B 146 ? 0.7914 1.2216 1.1902 0.0086  0.0909  0.2123  1022 GLY B C   
4324 O O   . GLY B 146 ? 0.9158 1.3515 1.3057 0.0136  0.0996  0.2014  1022 GLY B O   
4325 N N   . TYR B 147 ? 1.0578 1.4762 1.4560 0.0051  0.0976  0.1837  1023 TYR B N   
4326 C CA  . TYR B 147 ? 1.0976 1.5085 1.4834 0.0067  0.1155  0.1380  1023 TYR B CA  
4327 C C   . TYR B 147 ? 0.8881 1.2882 1.2648 0.0052  0.1231  0.1228  1023 TYR B C   
4328 O O   . TYR B 147 ? 0.8034 1.1967 1.1844 0.0014  0.1168  0.1362  1023 TYR B O   
4329 C CB  . TYR B 147 ? 1.1820 1.5863 1.5696 0.0039  0.1189  0.1141  1023 TYR B CB  
4330 C CG  . TYR B 147 ? 1.1664 1.5803 1.5637 0.0051  0.1118  0.1259  1023 TYR B CG  
4331 C CD1 . TYR B 147 ? 1.2824 1.6988 1.6945 0.0010  0.0951  0.1595  1023 TYR B CD1 
4332 C CD2 . TYR B 147 ? 1.1359 1.5556 1.5279 0.0090  0.1204  0.1038  1023 TYR B CD2 
4333 C CE1 . TYR B 147 ? 1.2979 1.7224 1.7188 0.0012  0.0881  0.1705  1023 TYR B CE1 
4334 C CE2 . TYR B 147 ? 0.9116 1.3401 1.3122 0.0102  0.1143  0.1140  1023 TYR B CE2 
4335 C CZ  . TYR B 147 ? 1.1591 1.5901 1.5739 0.0065  0.0986  0.1471  1023 TYR B CZ  
4336 O OH  . TYR B 147 ? 1.2911 1.7304 1.7145 0.0070  0.0921  0.1575  1023 TYR B OH  
4337 N N   . TYR B 148 ? 0.7688 1.1675 1.1334 0.0072  0.1355  0.0959  1024 TYR B N   
4338 C CA  . TYR B 148 ? 0.7839 1.1724 1.1380 0.0050  0.1436  0.0772  1024 TYR B CA  
4339 C C   . TYR B 148 ? 0.8493 1.2282 1.1925 0.0010  0.1513  0.0424  1024 TYR B C   
4340 O O   . TYR B 148 ? 0.8398 1.2235 1.1767 0.0016  0.1554  0.0201  1024 TYR B O   
4341 C CB  . TYR B 148 ? 1.0033 1.3960 1.3494 0.0077  0.1509  0.0661  1024 TYR B CB  
4342 C CG  . TYR B 148 ? 1.3663 1.7689 1.7175 0.0121  0.1434  0.1000  1024 TYR B CG  
4343 C CD1 . TYR B 148 ? 1.6246 2.0415 1.9806 0.0165  0.1376  0.1204  1024 TYR B CD1 
4344 C CD2 . TYR B 148 ? 1.4181 1.8169 1.7678 0.0118  0.1416  0.1119  1024 TYR B CD2 
4345 C CE1 . TYR B 148 ? 1.6369 2.0647 1.9951 0.0206  0.1298  0.1523  1024 TYR B CE1 
4346 C CE2 . TYR B 148 ? 1.4853 1.8949 1.8385 0.0162  0.1338  0.1434  1024 TYR B CE2 
4347 C CZ  . TYR B 148 ? 1.5744 1.9987 1.9313 0.0205  0.1277  0.1638  1024 TYR B CZ  
4348 O OH  . TYR B 148 ? 1.6767 2.1126 2.0357 0.0247  0.1193  0.1958  1024 TYR B OH  
4349 N N   . THR B 149 ? 0.7709 1.1395 1.1092 -0.0024 0.1515  0.0402  1025 THR B N   
4350 C CA  . THR B 149 ? 0.7750 1.1381 1.0976 -0.0038 0.1547  0.0172  1025 THR B CA  
4351 C C   . THR B 149 ? 0.8616 1.2175 1.1661 -0.0029 0.1589  0.0084  1025 THR B C   
4352 O O   . THR B 149 ? 0.9663 1.3196 1.2759 -0.0052 0.1596  0.0170  1025 THR B O   
4353 C CB  . THR B 149 ? 0.8089 1.1640 1.1433 -0.0076 0.1480  0.0302  1025 THR B CB  
4354 O OG1 . THR B 149 ? 0.9423 1.2889 1.2583 -0.0053 0.1511  0.0132  1025 THR B OG1 
4355 C CG2 . THR B 149 ? 0.9391 1.2870 1.2859 -0.0116 0.1414  0.0564  1025 THR B CG2 
4356 N N   . ILE B 150 ? 0.8906 1.2326 1.1756 0.0049  0.1621  -0.0005 1026 ILE B N   
4357 C CA  . ILE B 150 ? 1.0034 1.3170 1.2745 0.0081  0.1682  -0.0059 1026 ILE B CA  
4358 C C   . ILE B 150 ? 1.0368 1.3077 1.2966 0.0100  0.1738  -0.0218 1026 ILE B C   
4359 O O   . ILE B 150 ? 1.1313 1.3985 1.3910 0.0124  0.1736  -0.0273 1026 ILE B O   
4360 C CB  . ILE B 150 ? 1.0595 1.3739 1.3227 0.0125  0.1726  -0.0105 1026 ILE B CB  
4361 C CG1 . ILE B 150 ? 1.0893 1.3786 1.3446 0.0105  0.1771  -0.0158 1026 ILE B CG1 
4362 C CG2 . ILE B 150 ? 0.9867 1.2815 1.2416 0.0176  0.1777  -0.0243 1026 ILE B CG2 
4363 C CD1 . ILE B 150 ? 1.3839 1.6763 1.6347 0.0129  0.1804  -0.0189 1026 ILE B CD1 
4364 N N   . GLY B 151 ? 0.9298 1.1669 1.1797 0.0063  0.1785  -0.0329 1027 GLY B N   
4365 C CA  . GLY B 151 ? 0.9022 1.0966 1.1393 0.0021  0.1833  -0.0556 1027 GLY B CA  
4366 C C   . GLY B 151 ? 0.7307 0.9201 0.9720 0.0010  0.1807  -0.0518 1027 GLY B C   
4367 O O   . GLY B 151 ? 0.8496 1.0538 1.1011 -0.0006 0.1765  -0.0350 1027 GLY B O   
4368 N N   . ILE B 152 ? 0.6785 0.8487 0.9134 0.0004  0.1823  -0.0670 1028 ILE B N   
4369 C CA  . ILE B 152 ? 0.8142 0.9795 1.0531 0.0003  0.1799  -0.0643 1028 ILE B CA  
4370 C C   . ILE B 152 ? 0.9386 1.1349 1.1907 0.0062  0.1747  -0.0532 1028 ILE B C   
4371 O O   . ILE B 152 ? 0.7791 0.9643 1.0246 0.0081  0.1764  -0.0672 1028 ILE B O   
4372 C CB  . ILE B 152 ? 0.9410 1.0626 1.1626 -0.0057 0.1849  -0.0885 1028 ILE B CB  
4373 C CG1 . ILE B 152 ? 1.1005 1.1941 1.3101 -0.0139 0.1898  -0.0984 1028 ILE B CG1 
4374 C CG2 . ILE B 152 ? 1.1042 1.2192 1.3286 -0.0045 0.1829  -0.0855 1028 ILE B CG2 
4375 C CD1 . ILE B 152 ? 1.0816 1.1659 1.2844 -0.0194 0.1933  -0.1131 1028 ILE B CD1 
4376 N N   . GLY B 153 ? 0.9168 1.1550 1.1891 0.0060  0.1667  -0.0278 1029 GLY B N   
4377 C CA  . GLY B 153 ? 0.7861 1.0581 1.0738 0.0075  0.1596  -0.0160 1029 GLY B CA  
4378 C C   . GLY B 153 ? 0.7269 1.0087 1.0086 0.0145  0.1624  -0.0217 1029 GLY B C   
4379 O O   . GLY B 153 ? 0.9672 1.2597 1.2540 0.0179  0.1599  -0.0215 1029 GLY B O   
4380 N N   . HIS B 154 ? 0.7336 1.0125 1.0061 0.0162  0.1669  -0.0260 1030 HIS B N   
4381 C CA  . HIS B 154 ? 0.8798 1.1675 1.1483 0.0215  0.1693  -0.0303 1030 HIS B CA  
4382 C C   . HIS B 154 ? 0.8614 1.1988 1.1430 0.0209  0.1624  -0.0121 1030 HIS B C   
4383 O O   . HIS B 154 ? 0.9456 1.2953 1.2275 0.0177  0.1621  -0.0085 1030 HIS B O   
4384 C CB  . HIS B 154 ? 0.8930 1.1515 1.1467 0.0197  0.1764  -0.0484 1030 HIS B CB  
4385 C CG  . HIS B 154 ? 0.9058 1.1699 1.1567 0.0227  0.1785  -0.0549 1030 HIS B CG  
4386 N ND1 . HIS B 154 ? 0.8484 1.0980 1.0943 0.0220  0.1797  -0.0706 1030 HIS B ND1 
4387 C CD2 . HIS B 154 ? 0.9002 1.1843 1.1531 0.0259  0.1791  -0.0474 1030 HIS B CD2 
4388 C CE1 . HIS B 154 ? 0.8040 1.0639 1.0497 0.0242  0.1810  -0.0728 1030 HIS B CE1 
4389 N NE2 . HIS B 154 ? 0.8466 1.1260 1.0962 0.0269  0.1811  -0.0587 1030 HIS B NE2 
4390 N N   . LEU B 155 ? 0.8130 1.1750 1.1050 0.0195  0.1563  -0.0083 1031 LEU B N   
4391 C CA  . LEU B 155 ? 0.8545 1.2380 1.1621 0.0097  0.1510  -0.0081 1031 LEU B CA  
4392 C C   . LEU B 155 ? 0.7819 1.1727 1.0762 0.0157  0.1521  -0.0134 1031 LEU B C   
4393 O O   . LEU B 155 ? 0.8436 1.2271 1.1255 0.0287  0.1554  -0.0092 1031 LEU B O   
4394 C CB  . LEU B 155 ? 0.7027 1.0932 1.0364 0.0047  0.1474  -0.0024 1031 LEU B CB  
4395 C CG  . LEU B 155 ? 0.7463 1.1257 1.1012 -0.0015 0.1400  0.0213  1031 LEU B CG  
4396 C CD1 . LEU B 155 ? 0.7546 1.1228 1.0984 -0.0027 0.1400  0.0139  1031 LEU B CD1 
4397 C CD2 . LEU B 155 ? 0.7158 1.1007 1.0918 -0.0019 0.1306  0.0413  1031 LEU B CD2 
4398 N N   . LEU B 156 ? 0.8321 1.2256 1.1391 0.0085  0.1552  -0.0159 1032 LEU B N   
4399 C CA  . LEU B 156 ? 1.0675 1.4676 1.3636 0.0116  0.1558  -0.0241 1032 LEU B CA  
4400 C C   . LEU B 156 ? 1.2502 1.6504 1.5747 0.0087  0.1606  -0.0216 1032 LEU B C   
4401 O O   . LEU B 156 ? 1.5365 1.9382 1.8551 0.0105  0.1586  -0.0320 1032 LEU B O   
4402 C CB  . LEU B 156 ? 1.0312 1.4287 1.3251 0.0095  0.1595  -0.0245 1032 LEU B CB  
4403 C CG  . LEU B 156 ? 0.8274 1.2190 1.1003 0.0188  0.1591  -0.0132 1032 LEU B CG  
4404 C CD1 . LEU B 156 ? 0.7200 1.1112 0.9981 0.0113  0.1616  -0.0172 1032 LEU B CD1 
4405 C CD2 . LEU B 156 ? 0.7873 1.1522 1.0517 0.0337  0.1707  -0.0095 1032 LEU B CD2 
4406 N N   . THR B 157 ? 1.4840 1.8926 1.8303 0.0096  0.1615  0.0054  1033 THR B N   
4407 C CA  . THR B 157 ? 1.9356 2.3542 2.2909 0.0142  0.1572  0.0271  1033 THR B CA  
4408 C C   . THR B 157 ? 2.1263 2.5516 2.4892 0.0166  0.1453  0.0695  1033 THR B C   
4409 O O   . THR B 157 ? 2.0600 2.4818 2.4214 0.0158  0.1431  0.0820  1033 THR B O   
4410 C CB  . THR B 157 ? 1.8050 2.2275 2.1567 0.0160  0.1633  0.0193  1033 THR B CB  
4411 O OG1 . THR B 157 ? 1.7391 2.1467 2.0786 0.0122  0.1710  -0.0161 1033 THR B OG1 
4412 C CG2 . THR B 157 ? 1.4641 1.8987 1.8211 0.0204  0.1599  0.0320  1033 THR B CG2 
4413 N N   . LYS B 158 ? 2.0361 2.4720 2.4073 0.0189  0.1366  0.0927  1034 LYS B N   
4414 C CA  . LYS B 158 ? 1.6863 2.1306 2.0652 0.0199  0.1228  0.1364  1034 LYS B CA  
4415 C C   . LYS B 158 ? 1.9293 2.3843 2.3045 0.0239  0.1206  0.1565  1034 LYS B C   
4416 O O   . LYS B 158 ? 2.1940 2.6555 2.5740 0.0244  0.1091  0.1934  1034 LYS B O   
4417 C CB  . LYS B 158 ? 1.2303 1.6825 1.6195 0.0196  0.1133  0.1554  1034 LYS B CB  
4418 C CG  . LYS B 158 ? 0.8281 1.2848 1.2277 0.0171  0.0965  0.2005  1034 LYS B CG  
4419 C CD  . LYS B 158 ? 1.0778 1.5392 1.4883 0.0148  0.0869  0.2159  1034 LYS B CD  
4420 C CE  . LYS B 158 ? 1.2223 1.6849 1.6443 0.0094  0.0678  0.2616  1034 LYS B CE  
4421 N NZ  . LYS B 158 ? 1.4581 1.9329 1.8794 0.0117  0.0595  0.2975  1034 LYS B NZ  
4422 N N   . SER B 159 ? 2.0141 2.4706 2.3812 0.0262  0.1305  0.1341  1035 SER B N   
4423 C CA  . SER B 159 ? 1.7745 2.2413 2.1376 0.0302  0.1291  0.1502  1035 SER B CA  
4424 C C   . SER B 159 ? 1.6936 2.1578 2.0559 0.0301  0.1248  0.1692  1035 SER B C   
4425 O O   . SER B 159 ? 1.4797 1.9318 1.8377 0.0274  0.1320  0.1478  1035 SER B O   
4426 C CB  . SER B 159 ? 1.7130 2.1777 2.0687 0.0307  0.1411  0.1178  1035 SER B CB  
4427 O OG  . SER B 159 ? 1.6772 2.1443 2.0344 0.0309  0.1446  0.1013  1035 SER B OG  
4428 N N   . PRO B 160 ? 1.8942 2.3692 2.2607 0.0325  0.1128  0.2093  1036 PRO B N   
4429 C CA  . PRO B 160 ? 1.9678 2.4409 2.3347 0.0325  0.1074  0.2293  1036 PRO B CA  
4430 C C   . PRO B 160 ? 1.9099 2.3832 2.2683 0.0353  0.1155  0.2164  1036 PRO B C   
4431 O O   . PRO B 160 ? 1.8329 2.3172 2.1906 0.0392  0.1098  0.2412  1036 PRO B O   
4432 C CB  . PRO B 160 ? 2.1181 2.6038 2.4922 0.0339  0.0914  0.2768  1036 PRO B CB  
4433 C CG  . PRO B 160 ? 2.0617 2.5586 2.4348 0.0368  0.0921  0.2783  1036 PRO B CG  
4434 C CD  . PRO B 160 ? 1.9398 2.4291 2.3110 0.0349  0.1031  0.2390  1036 PRO B CD  
4435 N N   . SER B 161 ? 1.9070 2.3680 2.2594 0.0326  0.1282  0.1782  1037 SER B N   
4436 C CA  . SER B 161 ? 1.7721 2.2320 2.1173 0.0339  0.1361  0.1630  1037 SER B CA  
4437 C C   . SER B 161 ? 1.6200 2.0627 1.9608 0.0287  0.1462  0.1302  1037 SER B C   
4438 O O   . SER B 161 ? 1.5674 2.0017 1.9059 0.0249  0.1548  0.0980  1037 SER B O   
4439 C CB  . SER B 161 ? 1.8229 2.2901 2.1648 0.0358  0.1417  0.1485  1037 SER B CB  
4440 O OG  . SER B 161 ? 2.0132 2.4751 2.3560 0.0328  0.1472  0.1232  1037 SER B OG  
4441 N N   . LEU B 162 ? 1.5481 1.9861 1.8878 0.0284  0.1447  0.1394  1038 LEU B N   
4442 C CA  . LEU B 162 ? 1.4060 1.8280 1.7408 0.0232  0.1536  0.1109  1038 LEU B CA  
44